3K7NA

Structures of two elapid snake venom metalloproteases with distinct activities highlight the disulfide patterns in the d domain of adamalysin family proteins
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
396
structure length
396
Chain Sequence
DRYLQDKKYIEFYVIVDNRMYRYYNNDKPAIKIKVYEMINAVNTKFRPLKIHIALIGLEIWSNKDKFEVKPAASVTLKSFGEWRETVLLPRKRNDNAQLLTGIDFNGNTVGRAYIGSLCKTNESVAIVQDYNRRISLVASTITHELGHNLGIHHDKASCICIPGPCIMLKKRTAPAFQFSSCSIREYREYLLRDRPQCILNKPLSTDIVSPPICGNYFVEVGEECDCGSPQACQSACCNAATCQFKGAETECRVAKDDCDLPELCTGQSAECPTDSLQRNGHPCQNNQSYCYNGTCPTLTNQCITLLGPHFTVSPKGCFNLNMRGDDGSFCRMEDGTKIPCAAKDVKCGRLYCTEKNTMSCLIPPNPDGIMAEPGTKCGDGMVCSKGQCVDVQTAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of two elapid snake venom metalloproteases with distinct activities highlight the disulfide patterns in the D domain of ADAMalysin family proteins
pubmed doi rcsb
molecule keywords K-like
molecule tags Hydrolase
total genus 112
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
A PF08516 ADAM_CR ADAM cysteine-rich
A PF17771 ADAM_CR_2 ADAM cysteine-rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3k7nA01
4WKEA 1XFZA 5B5OA 3HBUP 2AYKA 1O0TA 1BIWA 3B2ZA 2OW0A 1PWUA 1AF0A 4XM8A 3RTTA 1OS9A 1R1HA 1HTDA 1YOUA 2L0RA 2ERQA 1UMTA 3HDAP 4JIJA 5L7FA 2FV5A 2CLTA 2YIGA 4XM7A 2JIHA 3F15A 1QICA 1QIBA 3G42A 5I12A 2FV9A 2A8HA 3CKIA 3EWJA 1GE5A 3LIRA 1HFCA 1PWVA 2X3AA 4GR0A 1G9KA 2WO8A 2K9CA 2W0DA 1GO7P 2W14A 1I1IP 4Q1LA 1CIZA 2OI0A 1YQYA 4ZR5A 3KHIA 1USNA 3V96B 2DW1A 3N2UA 1ZXCA 1SLNA 1R1JA 4HMAA 4I35A 1A86A 3L0VA 1CAQA 5D7WA 1R55A 1JAOA 4DF9A 3DL1A 1D8MA 3LMCA 1J7NA 4GR3A 3OHOA 4GUYA 1IADA 4WK7A 2OZRA 1PWQA 2KRJA 5D1UA 1KAPP 3LE9A 1K7IA 3B92A 3EHYA 4AIGA 1MMQA 1XFUA 4G9LA 3O64A 2USNA 4H49A 4L6TA 1JK3A 3LUNA 3UVCA 3WV1A 3KWVC 3DPEA 3F19A 4IN9A 4H3XA 1BUVM 4PKQA 2RJPA 3TS4A 1BQQM 3KECA 5BPAA 1HV5A 1B8YA 3TSKA 2OXWA 1MMPA 2D1OA 1Y8JA 2E2DA 4AXQA 3SHIA 4WF6A 2OXUA 1KUIA 1R1IA 4A3WA 1L6JA 3LJGA 1KUFA 3EDHA 1KBCA 1KUHA 1FLSA 3P1VA 2Y6DA 2RJQA 3AYKA 1IABA 1XUCA 3Q2GA 1OMJA 4JP4A 4G0DA 4I03A 2POJA 1JAPA 1G12A 3I7IA 4WZVA 5LABA 2V4BA 2DW0A 3KMCA 2I47A 2PJTA 3HBVP 4FXYP 1ATLA 3DSLA 1G4KA 2QPJA 3BA0A 3DPFA 1BKCE 1DMTA 1ZXVA 3RTSA 3ZVSA 2WOAA 1D8FA 1SATA 5CXAA 1YP1A 3TT4A 3EDZA 4HX3A 2MZHA 4H1QA 3F18A 1Z3JA 3USNA 4CTHA 1JIZA 5D2BA 2HU6A 2OY2A 3KRYA 1GE7A 2TCLA 1GE6A 1OO9A 4ON1A 1EAKA 4GF1A 3VTGA 2E3XA 2Y6CA 1PWWA 1WNIA 2OY4A 4H76A 3HY7A 2MLSA 2JT6A 4GWNA 4FXQA 3P24A 4EFSA 1BZSA 1QUAA 2DDYA 1C3IA 2W15A 4XCTA 1FM1A 1GXDA 1DTHA 4GQLA 1BSWA 3B8ZA 5JMYA 3N2VA 1ZTQA 3WV2A 1H71P 1Q3AA 2Z2DA 1GKDA 4WKIA 2OW1A 1RMZA 2OW9A 1QIAA 3LGPA 4ILWD 2X3CA 3U1RA 3Q2HA 3L0TA 5B5PA 4DPEA 2YB9A 1C8TA 1BUDA 1ND1A 3VI1A 4PKSA 4FU4A 3EDGA 1R54A 1XFYA 2OVZA 5BOTA 4QKZA 1IAEA 1SLMA 1QJIA 1Y93A 4L19A 3ELMA 3ZXHA 1IAAA 5H8XA 966CA 4H84A 3F17A 3AYUA 3NX7A 1SMPA 2AIGP 2MLRA 1I73A 1HY7A 1IACA 1MMRA 1BM6A 1B3DA 1D5JA 1JH1A 4JQGA 3LJTA 1HOVA 2D1NA 2W13A 3KMEA 4XM6A 3TVCA 1OM8A 1CGEA 2CKIA 3LIKA 3G5CA 2JT5A 2N8RA 1XUDA 4H82A 3LUMA 1SRPA 1XFVA 1XFWA 2WO9A 1A85A 1ZS0A 3GBOA 1JANA 1YCMA 1CGFA 3WV3A 3KEKA 1MNCA 1KUGA 1RM8A 2X3BA 3LK8A 2MZEA 4FVLA 2DW2A 3DNGA 3LILA 1JJ9A 1SU3A 1MMBA 3LEAA 5CUHA 1Y0VA 4DV8A 2JSDA 3F1AA 4A7BA 1AKLA 3EHXA 1OM6A 1ASTA 1FBLA 5CZMA 5D3CA 2XS4A 2OXZA 1UMSA 2J83A 4R3VA 830CA 1BKCI 5BOYA 2X7MA 456CA 1BQOA 1OM7A 4J4MA 2SRTA 4PKUA 3ZUKA 3KEJA 2XS3A 1K7QA 4JA1A 1CQRA 3HYGA 1QJJA 1ZP5A 3LJZA 1G05A 1JIWP 1ROSA 3EDIA 3HY9A 2O36A 2W12A 1PWPA 1JAQA 5I2ZA 2ERPA 1AYKA 2J0TA 4PKWA 1JKYA 4PKTA 1S4BP 3K7LA 1UEAA 4XBHA 3I7GA 1G49A 3LQBA 4H2EA 5I0LA 3HB2P 4H30A 1EB6A 3F16A 3DWBA 2OW2A 4IUWA 4GR8A 1BKCA 1C7KA 1ZVXA 3OHLA 1CXVA 2JNPA 5I43A 4IJOA 1K7GA 3LQ0A 5L79A 1IAGA 2DDFA 1KUKA 4JPAA 5I3MA 4PKVA 3K7NA 3AIGA 1UTZA 4GWMA 4AUOA 1CK7A 1HFSA 1OS2A 3E8RA 4PKRA 3O2XA 1I76A 2O3EA 1O0QA 1CGLA 1XURA 2MZIA 1GKCA 2EROA 4DD8A 1EUBA 1GO8P 1XFXA 3LKAA 5D1TA 2OVXA 4L63A 3HDBA 1UTTA 5I4OA 4AYKA 1D7XA 5D1SA 2K2GA 3MA2A
chains in the Genus database with same CATH superfamily
4WKEA 1XFZA 5B5OA 3HBUP 2AYKA 1O0TA 1BIWA 3B2ZA 2OW0A 1PWUA 1AF0A 4XM8A 3RTTA 1OS9A 1R1HA 1HTDA 1YOUA 2L0RA 2ERQA 1UMTA 3HDAP 4JIJA 5L7FA 2FV5A 2CLTA 2YIGA 4XM7A 2JIHA 3F15A 1QICA 1QIBA 3G42A 5I12A 2FV9A 2A8HA 3CKIA 3EWJA 1GE5A 3LIRA 1HFCA 1PWVA 2X3AA 4GR0A 1G9KA 2WO8A 1XM5A 2K9CA 2W0DA 1GO7P 2W14A 1I1IP 4Q1LA 1CIZA 2OI0A 1YQYA 4ZR5A 3KHIA 1USNA 3V96B 1XAXA 2DW1A 3N2UA 1ZXCA 1SLNA 1R1JA 4HMAA 4I35A 1A86A 3L0VA 1CAQA 5D7WA 1R55A 1JAOA 4DF9A 3DL1A 1D8MA 3LMCA 1J7NA 4GR3A 3OHOA 4GUYA 1IADA 4WK7A 2OZRA 1PWQA 2KRJA 5D1UA 1KAPP 3LE9A 1K7IA 3B92A 3EHYA 4AIGA 1MMQA 1XFUA 4G9LA 3O64A 2USNA 4H49A 4L6TA 1JK3A 3LUNA 3UVCA 3WV1A 3KWVC 3DPEA 3F19A 3DTKA 4IN9A 4H3XA 1BUVM 4PKQA 2RJPA 3TS4A 1BQQM 3KECA 5BPAA 1HV5A 1B8YA 3TSKA 2OXWA 1MMPA 2D1OA 1Y8JA 2E2DA 4AXQA 3SHIA 4WF6A 2OXUA 1KUIA 1R1IA 4A3WA 1L6JA 3LJGA 1KUFA 3EDHA 1KBCA 1KUHA 1FLSA 3P1VA 2Y6DA 2RJQA 3AYKA 1IABA 1XUCA 3Q2GA 1OMJA 4JP4A 4G0DA 4I03A 2POJA 1JAPA 1G12A 3I7IA 4WZVA 5LABA 2V4BA 2DW0A 3KMCA 2I47A 2PJTA 3HBVP 4FXYP 1ATLA 3DSLA 1G4KA 2QPJA 3BA0A 3DPFA 1BKCE 1DMTA 1ZXVA 3RTSA 3ZVSA 2WOAA 1TVIA 1D8FA 1SATA 5CXAA 1YP1A 3TT4A 3EDZA 4HX3A 2MZHA 4H1QA 3F18A 1Z3JA 3USNA 4CTHA 1JIZA 5D2BA 2HU6A 2OY2A 3KRYA 1GE7A 2TCLA 1GE6A 1OO9A 4ON1A 1EAKA 4GF1A 3VTGA 2E3XA 2Y6CA 1PWWA 1WNIA 2OY4A 4H76A 3DTEA 3HY7A 2MLSA 2JT6A 4GWNA 4FXQA 3P24A 4EFSA 1BZSA 1QUAA 2DDYA 1C3IA 2W15A 4XCTA 1FM1A 1GXDA 2YUFA 1DTHA 4GQLA 1BSWA 3B8ZA 5JMYA 3N2VA 1ZTQA 3WV2A 1H71P 1Q3AA 2Z2DA 1GKDA 4WKIA 2OW1A 1RMZA 2OW9A 1QIAA 3LGPA 4ILWD 2X3CA 3U1RA 3Q2HA 3L0TA 5B5PA 4DPEA 2YB9A 1C8TA 1BUDA 1ND1A 3VI1A 4PKSA 4L7AA 4FU4A 3EDGA 1R54A 1XFYA 2OVZA 5BOTA 4QKZA 1IAEA 1SLMA 1QJIA 1Y93A 4L19A 3ELMA 3ZXHA 1IAAA 5H8XA 966CA 4H84A 3F17A 3AYUA 3NX7A 1SMPA 2AIGP 2MLRA 1I73A 1HY7A 1IACA 1MMRA 1BM6A 1B3DA 1D5JA 1JH1A 4JQGA 3LJTA 1HOVA 2D1NA 2W13A 3KMEA 4XM6A 3TVCA 1OM8A 1CGEA 2CKIA 3LIKA 3G5CA 2JT5A 2N8RA 1XUDA 4H82A 3LUMA 1SRPA 1XFVA 1XFWA 2WO9A 1A85A 1ZS0A 3GBOA 1JANA 1YCMA 1CGFA 3WV3A 3KEKA 1MNCA 1KUGA 1RM8A 2X3BA 3LK8A 2MZEA 4FVLA 2DW2A 3DNGA 3LILA 1JJ9A 1SU3A 1MMBA 3LEAA 5CUHA 1Y0VA 4DV8A 2JSDA 3F1AA 4A7BA 1AKLA 3EHXA 1OM6A 1ASTA 1FBLA 5CZMA 5D3CA 2XS4A 2OXZA 1UMSA 2J83A 4R3VA 830CA 1BKCI 5BOYA 2X7MA 456CA 1BQOA 1OM7A 4J4MA 2SRTA 4PKUA 3ZUKA 3KEJA 2XS3A 1K7QA 4JA1A 1CQRA 3HYGA 1QJJA 1ZP5A 3LJZA 1G05A 1JIWP 1ROSA 3EDIA 3HY9A 2O36A 2W12A 1PWPA 1JAQA 5I2ZA 2ERPA 1OZ9A 1AYKA 2J0TA 4PKWA 1JKYA 4PKTA 1S4BP 3K7LA 1UEAA 4XBHA 3I7GA 1G49A 3LQBA 4H2EA 5I0LA 3HB2P 4H30A 1EB6A 3F16A 3DWBA 2OW2A 4IUWA 4GR8A 1BKCA 1C7KA 1ZVXA 3OHLA 1CXVA 2JNPA 5I43A 4IJOA 1K7GA 3LQ0A 5L79A 1IAGA 2DDFA 1KUKA 4JPAA 5I3MA 4PKVA 3K7NA 3AIGA 1UTZA 4GWMA 4AUOA 1CK7A 1HFSA 1OS2A 3E8RA 4PKRA 3O2XA 1I76A 2O3EA 1O0QA 1CGLA 1XURA 2MZIA 1GKCA 2EROA 4DD8A 1EUBA 1GO8P 1XFXA 3LKAA 5D1TA 2OVXA 4L63A 3HDBA 1UTTA 5I4OA 4AYKA 1D7XA 5D1SA 2K2GA 3DTIA 3MA2A
chains in the Genus database with same CATH topology
4WKEA 1XFZA 5B5OA 3HBUP 2AYKA 1O0TA 1BIWA 3B2ZA 2OW0A 1PWUA 1AF0A 4XM8A 3RTTA 1OS9A 1R1HA 1HTDA 1YOUA 2L0RA 2ERQA 1UMTA 3HDAP 4JIJA 5L7FA 2FV5A 2CLTA 2YIGA 4XM7A 2JIHA 3F15A 1QICA 1QIBA 3G42A 5I12A 2FV9A 2A8HA 3CKIA 3EWJA 1GE5A 3LIRA 1HFCA 1PWVA 2X3AA 4GR0A 1G9KA 2WO8A 2K9CA 2W0DA 1GO7P 2W14A 1I1IP 4Q1LA 1CIZA 2OI0A 1YQYA 4ZR5A 3KHIA 1USNA 3V96B 2DW1A 3N2UA 1ZXCA 1SLNA 1R1JA 4HMAA 4I35A 1A86A 3L0VA 1CAQA 5D7WA 1R55A 1JAOA 4DF9A 3DL1A 1D8MA 3LMCA 1J7NA 4GR3A 3OHOA 4GUYA 1IADA 4WK7A 2OZRA 1PWQA 2KRJA 5D1UA 1KAPP 3LE9A 1K7IA 3B92A 3EHYA 4AIGA 1MMQA 1XFUA 4G9LA 3O64A 2USNA 4H49A 4L6TA 1JK3A 3LUNA 3UVCA 3WV1A 3KWVC 3DPEA 3F19A 3DTKA 4IN9A 4H3XA 1BUVM 4PKQA 2RJPA 3TS4A 1BQQM 3KECA 5BPAA 1HV5A 1B8YA 3TSKA 2OXWA 1MMPA 2D1OA 1Y8JA 2E2DA 4AXQA 3SHIA 4WF6A 2OXUA 1KUIA 1R1IA 4A3WA 1L6JA 3LJGA 1KUFA 3EDHA 1KBCA 1KUHA 1FLSA 3P1VA 2Y6DA 2RJQA 3AYKA 1IABA 1XUCA 3Q2GA 1OMJA 4JP4A 4G0DA 4I03A 2POJA 1JAPA 1G12A 3I7IA 4WZVA 5LABA 2V4BA 2DW0A 3KMCA 2I47A 2PJTA 3HBVP 4FXYP 1ATLA 3DSLA 1G4KA 2QPJA 3BA0A 3DPFA 1BKCE 1DMTA 1ZXVA 3RTSA 3ZVSA 2WOAA 1D8FA 1SATA 5CXAA 1YP1A 3TT4A 3EDZA 4HX3A 2MZHA 4H1QA 3F18A 1Z3JA 3USNA 4CTHA 1JIZA 5D2BA 2HU6A 2OY2A 3KRYA 1GE7A 2TCLA 1GE6A 1OO9A 4ON1A 1EAKA 4GF1A 3VTGA 2E3XA 2Y6CA 1PWWA 1WNIA 2OY4A 4H76A 3DTEA 3HY7A 2MLSA 2JT6A 4GWNA 4FXQA 3P24A 4EFSA 1BZSA 1QUAA 2DDYA 1C3IA 2W15A 4XCTA 1FM1A 1GXDA 2YUFA 1DTHA 4GQLA 1BSWA 3B8ZA 5JMYA 3N2VA 1ZTQA 3WV2A 1H71P 1Q3AA 2Z2DA 1GKDA 4WKIA 2OW1A 1RMZA 2OW9A 1QIAA 3LGPA 4ILWD 2X3CA 3U1RA 3Q2HA 3L0TA 5B5PA 4DPEA 2YB9A 1C8TA 1BUDA 1ND1A 3VI1A 4PKSA 4L7AA 4FU4A 3EDGA 1R54A 1XFYA 2OVZA 5BOTA 4QKZA 1IAEA 1SLMA 1QJIA 1Y93A 4L19A 3ELMA 3ZXHA 1IAAA 5H8XA 966CA 4H84A 3F17A 3AYUA 3NX7A 1SMPA 2AIGP 2MLRA 1I73A 1HY7A 1IACA 1MMRA 1BM6A 1B3DA 1D5JA 1JH1A 4JQGA 3LJTA 1HOVA 2D1NA 2W13A 3KMEA 4XM6A 3TVCA 1OM8A 1CGEA 2CKIA 3LIKA 3G5CA 2JT5A 2N8RA 1XUDA 4H82A 3LUMA 1SRPA 1XFVA 1XFWA 2WO9A 1A85A 1ZS0A 3GBOA 1JANA 1YCMA 1CGFA 3WV3A 3KEKA 1MNCA 1KUGA 1RM8A 2X3BA 3LK8A 2MZEA 4FVLA 2DW2A 3DNGA 3LILA 1JJ9A 1SU3A 1MMBA 3LEAA 5CUHA 1Y0VA 4DV8A 2JSDA 3F1AA 4A7BA 1AKLA 3EHXA 1OM6A 1ASTA 1FBLA 5CZMA 5D3CA 2XS4A 2OXZA 1UMSA 2J83A 4R3VA 830CA 1BKCI 5BOYA 2X7MA 456CA 1BQOA 1OM7A 4J4MA 2SRTA 4PKUA 3ZUKA 3KEJA 2XS3A 1K7QA 4JA1A 1CQRA 3HYGA 1QJJA 1ZP5A 3LJZA 1G05A 1JIWP 1ROSA 3EDIA 3HY9A 2O36A 2W12A 1PWPA 1JAQA 5I2ZA 2ERPA 1AYKA 2J0TA 4PKWA 1JKYA 4PKTA 1S4BP 3K7LA 1UEAA 4XBHA 3I7GA 1G49A 3LQBA 4H2EA 5I0LA 3HB2P 4H30A 1EB6A 3F16A 3DWBA 2OW2A 4IUWA 4GR8A 1BKCA 1C7KA 1ZVXA 3OHLA 1CXVA 2JNPA 5I43A 4IJOA 1K7GA 3LQ0A 5L79A 1IAGA 2DDFA 1KUKA 4JPAA 5I3MA 4PKVA 3K7NA 3AIGA 1UTZA 4GWMA 4AUOA 1CK7A 1HFSA 1OS2A 3E8RA 4PKRA 3O2XA 1I76A 2O3EA 1O0QA 1CGLA 1XURA 2MZIA 1GKCA 2EROA 4DD8A 1EUBA 1GO8P 1XFXA 3LKAA 5D1TA 2OVXA 4L63A 3HDBA 1UTTA 5I4OA 4AYKA 1D7XA 5D1SA 2K2GA 3DTIA 3MA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WKE A;  1XFZ A;  5B5O A;  3HBU P;  2AYK A;  1O0T A;  1BIW A;  3B2Z A;  2OW0 A;  1PWU A;  1AF0 A;  4XM8 A;  3RTT A;  1OS9 A;  1R1H A;  1HTD A;  1YOU A;  2L0R A;  2ERQ A;  1UMT A;  3HDA P;  4JIJ A;  5L7F A;  2FV5 A;  2CLT A;  2YIG A;  4XM7 A;  2JIH A;  3F15 A;  1QIC A;  1QIB A;  3G42 A;  5I12 A;  2FV9 A;  2A8H A;  3CKI A;  3EWJ A;  1GE5 A;  3LIR A;  1HFC A;  1PWV A;  2X3A A;  4GR0 A;  1G9K A;  2WO8 A;  2K9C A;  2W0D A;  1GO7 P;  2W14 A;  1I1I P;  4Q1L A;  1CIZ A;  2OI0 A;  1YQY A;  4ZR5 A;  3KHI A;  1USN A;  3V96 B;  2DW1 A;  3N2U A;  1ZXC A;  1SLN A;  1R1J A;  4HMA A;  4I35 A;  1A86 A;  3L0V A;  1CAQ A;  5D7W A;  1R55 A;  1JAO A;  4DF9 A;  3DL1 A;  1D8M A;  3LMC A;  1J7N A;  4GR3 A;  3OHO A;  4GUY A;  1IAD A;  4WK7 A;  2OZR A;  1PWQ A;  2KRJ A;  5D1U A;  1KAP P;  3LE9 A;  1K7I A;  3B92 A;  3EHY A;  4AIG A;  1MMQ A;  1XFU A;  4G9L A;  3O64 A;  2USN A;  4H49 A;  4L6T A;  1JK3 A;  3LUN A;  3UVC A;  3WV1 A;  3KWV C;  3DPE A;  3F19 A;  4IN9 A;  4H3X A;  1BUV M;  4PKQ A;  2RJP A;  3TS4 A;  1BQQ M;  3KEC A;  5BPA A;  1HV5 A;  1B8Y A;  3TSK A;  2OXW A;  1MMP A;  2D1O A;  1Y8J A;  2E2D A;  4AXQ A;  3SHI A;  4WF6 A;  2OXU A;  1KUI A;  1R1I A;  4A3W A;  1L6J A;  3LJG A;  1KUF A;  3EDH A;  1KBC A;  1KUH A;  1FLS A;  3P1V A;  2Y6D A;  2RJQ A;  3AYK A;  1IAB A;  1XUC A;  3Q2G A;  1OMJ A;  4JP4 A;  4G0D A;  4I03 A;  2POJ A;  1JAP A;  1G12 A;  3I7I A;  4WZV A;  5LAB A;  2V4B A;  2DW0 A;  3KMC A;  2I47 A;  2PJT A;  3HBV P;  4FXY P;  1ATL A;  3DSL A;  1G4K A;  2QPJ A;  3BA0 A;  3DPF A;  1BKC E;  1DMT A;  1ZXV A;  3RTS A;  3ZVS A;  2WOA A;  1D8F A;  1SAT A;  5CXA A;  1YP1 A;  3TT4 A;  3EDZ A;  4HX3 A;  2MZH A;  4H1Q A;  3F18 A;  1Z3J A;  3USN A;  4CTH A;  1JIZ A;  5D2B A;  2HU6 A;  2OY2 A;  3KRY A;  1GE7 A;  2TCL A;  1GE6 A;  1OO9 A;  4ON1 A;  1EAK A;  4GF1 A;  3VTG A;  2E3X A;  2Y6C A;  1PWW A;  1WNI A;  2OY4 A;  4H76 A;  3HY7 A;  2MLS A;  2JT6 A;  4GWN A;  4FXQ A;  3P24 A;  4EFS A;  1BZS A;  1QUA A;  2DDY A;  1C3I A;  2W15 A;  4XCT A;  1FM1 A;  1GXD A;  1DTH A;  4GQL A;  1BSW A;  3B8Z A;  5JMY A;  3N2V A;  1ZTQ A;  3WV2 A;  1H71 P;  1Q3A A;  2Z2D A;  1GKD A;  4WKI A;  2OW1 A;  1RMZ A;  2OW9 A;  1QIA A;  3LGP A;  4ILW D;  2X3C A;  3U1R A;  3Q2H A;  3L0T A;  5B5P A;  4DPE A;  2YB9 A;  1C8T A;  1BUD A;  1ND1 A;  3VI1 A;  4PKS A;  4FU4 A;  3EDG A;  1R54 A;  1XFY A;  2OVZ A;  5BOT A;  4QKZ A;  1IAE A;  1SLM A;  1QJI A;  1Y93 A;  4L19 A;  3ELM A;  3ZXH A;  1IAA A;  5H8X A;  966C A;  4H84 A;  3F17 A;  3AYU A;  3NX7 A;  1SMP A;  2AIG P;  2MLR A;  1I73 A;  1HY7 A;  1IAC A;  1MMR A;  1BM6 A;  1B3D A;  1D5J A;  1JH1 A;  4JQG A;  3LJT A;  1HOV A;  2D1N A;  2W13 A;  3KME A;  4XM6 A;  3TVC A;  1OM8 A;  1CGE A;  2CKI A;  3LIK A;  3G5C A;  2JT5 A;  2N8R A;  1XUD A;  4H82 A;  3LUM A;  1SRP A;  1XFV A;  1XFW A;  2WO9 A;  1A85 A;  1ZS0 A;  3GBO A;  1JAN A;  1YCM A;  1CGF A;  3WV3 A;  3KEK A;  1MNC A;  1KUG A;  1RM8 A;  2X3B A;  3LK8 A;  2MZE A;  4FVL A;  2DW2 A;  3DNG A;  3LIL A;  1JJ9 A;  1SU3 A;  1MMB A;  3LEA A;  5CUH A;  1Y0V A;  4DV8 A;  2JSD A;  3F1A A;  4A7B A;  1AKL A;  3EHX A;  1OM6 A;  1AST A;  1FBL A;  5CZM A;  5D3C A;  2XS4 A;  2OXZ A;  1UMS A;  2J83 A;  4R3V A;  830C A;  1BKC I;  5BOY A;  2X7M A;  456C A;  1BQO A;  1OM7 A;  4J4M A;  2SRT A;  4PKU A;  3ZUK A;  3KEJ A;  2XS3 A;  1K7Q A;  4JA1 A;  1CQR A;  3HYG A;  1QJJ A;  1ZP5 A;  3LJZ A;  1G05 A;  1JIW P;  1ROS A;  3EDI A;  3HY9 A;  2O36 A;  2W12 A;  1PWP A;  1JAQ A;  5I2Z A;  2ERP A;  1AYK A;  2J0T A;  4PKW A;  1JKY A;  4PKT A;  1S4B P;  3K7L A;  1UEA A;  4XBH A;  3I7G A;  1G49 A;  3LQB A;  4H2E A;  5I0L A;  3HB2 P;  4H30 A;  1EB6 A;  3F16 A;  3DWB A;  2OW2 A;  4IUW A;  4GR8 A;  1BKC A;  1C7K A;  1ZVX A;  3OHL A;  1CXV A;  2JNP A;  5I43 A;  4IJO A;  1K7G A;  3LQ0 A;  5L79 A;  1IAG A;  2DDF A;  1KUK A;  4JPA A;  5I3M A;  4PKV A;  3K7N A;  3AIG A;  1UTZ A;  4GWM A;  4AUO A;  1CK7 A;  1HFS A;  1OS2 A;  3E8R A;  4PKR A;  3O2X A;  1I76 A;  2O3E A;  1O0Q A;  1CGL A;  1XUR A;  2MZI A;  1GKC A;  2ERO A;  4DD8 A;  1EUB A;  1GO8 P;  1XFX A;  3LKA A;  5D1T A;  2OVX A;  4L63 A;  3HDB A;  1UTT A;  5I4O A;  4AYK A;  1D7X A;  5D1S A;  2K2G A;  3MA2 A; 
#chains in the Genus database with same CATH topology
 4WKE A;  1XFZ A;  5B5O A;  3HBU P;  2AYK A;  1O0T A;  1BIW A;  3B2Z A;  2OW0 A;  1PWU A;  1AF0 A;  4XM8 A;  3RTT A;  1OS9 A;  1R1H A;  1HTD A;  1YOU A;  2L0R A;  2ERQ A;  1UMT A;  3HDA P;  4JIJ A;  5L7F A;  2FV5 A;  2CLT A;  2YIG A;  4XM7 A;  2JIH A;  3F15 A;  1QIC A;  1QIB A;  3G42 A;  5I12 A;  2FV9 A;  2A8H A;  3CKI A;  3EWJ A;  1GE5 A;  3LIR A;  1HFC A;  1PWV A;  2X3A A;  4GR0 A;  1G9K A;  2WO8 A;  1XM5 A;  2K9C A;  2W0D A;  1GO7 P;  2W14 A;  1I1I P;  4Q1L A;  1CIZ A;  2OI0 A;  1YQY A;  4ZR5 A;  3KHI A;  1USN A;  3V96 B;  1XAX A;  2DW1 A;  3N2U A;  1ZXC A;  1SLN A;  1R1J A;  4HMA A;  4I35 A;  1A86 A;  3L0V A;  1CAQ A;  5D7W A;  1R55 A;  1JAO A;  4DF9 A;  3DL1 A;  1D8M A;  3LMC A;  1J7N A;  4GR3 A;  3OHO A;  4GUY A;  1IAD A;  4WK7 A;  2OZR A;  1PWQ A;  2KRJ A;  5D1U A;  1KAP P;  3LE9 A;  1K7I A;  3B92 A;  3EHY A;  4AIG A;  1MMQ A;  1XFU A;  4G9L A;  3O64 A;  2USN A;  4H49 A;  4L6T A;  1JK3 A;  3LUN A;  3UVC A;  3WV1 A;  3KWV C;  3DPE A;  3F19 A;  3DTK A;  4IN9 A;  4H3X A;  1BUV M;  4PKQ A;  2RJP A;  3TS4 A;  1BQQ M;  3KEC A;  5BPA A;  1HV5 A;  1B8Y A;  3TSK A;  2OXW A;  1MMP A;  2D1O A;  1Y8J A;  2E2D A;  4AXQ A;  3SHI A;  4WF6 A;  2OXU A;  1KUI A;  1R1I A;  4A3W A;  1L6J A;  3LJG A;  1KUF A;  3EDH A;  1KBC A;  1KUH A;  1FLS A;  3P1V A;  2Y6D A;  2RJQ A;  3AYK A;  1IAB A;  1XUC A;  3Q2G A;  1OMJ A;  4JP4 A;  4G0D A;  4I03 A;  2POJ A;  1JAP A;  1G12 A;  3I7I A;  4WZV A;  5LAB A;  2V4B A;  2DW0 A;  3KMC A;  2I47 A;  2PJT A;  3HBV P;  4FXY P;  1ATL A;  3DSL A;  1G4K A;  2QPJ A;  3BA0 A;  3DPF A;  1BKC E;  1DMT A;  1ZXV A;  3RTS A;  3ZVS A;  2WOA A;  1TVI A;  1D8F A;  1SAT A;  5CXA A;  1YP1 A;  3TT4 A;  3EDZ A;  4HX3 A;  2MZH A;  4H1Q A;  3F18 A;  1Z3J A;  3USN A;  4CTH A;  1JIZ A;  5D2B A;  2HU6 A;  2OY2 A;  3KRY A;  1GE7 A;  2TCL A;  1GE6 A;  1OO9 A;  4ON1 A;  1EAK A;  4GF1 A;  3VTG A;  2E3X A;  2Y6C A;  1PWW A;  1WNI A;  2OY4 A;  4H76 A;  3DTE A;  3HY7 A;  2MLS A;  2JT6 A;  4GWN A;  4FXQ A;  3P24 A;  4EFS A;  1BZS A;  1QUA A;  2DDY A;  1C3I A;  2W15 A;  4XCT A;  1FM1 A;  1GXD A;  2YUF A;  1DTH A;  4GQL A;  1BSW A;  3B8Z A;  5JMY A;  3N2V A;  1ZTQ A;  3WV2 A;  1H71 P;  1Q3A A;  2Z2D A;  1GKD A;  4WKI A;  2OW1 A;  1RMZ A;  2OW9 A;  1QIA A;  3LGP A;  4ILW D;  2X3C A;  3U1R A;  3Q2H A;  3L0T A;  5B5P A;  4DPE A;  2YB9 A;  1C8T A;  1BUD A;  1ND1 A;  3VI1 A;  4PKS A;  4L7A A;  4FU4 A;  3EDG A;  1R54 A;  1XFY A;  2OVZ A;  5BOT A;  4QKZ A;  1IAE A;  1SLM A;  1QJI A;  1Y93 A;  4L19 A;  3ELM A;  3ZXH A;  1IAA A;  5H8X A;  966C A;  4H84 A;  3F17 A;  3AYU A;  3NX7 A;  1SMP A;  2AIG P;  2MLR A;  1I73 A;  1HY7 A;  1IAC A;  1MMR A;  1BM6 A;  1B3D A;  1D5J A;  1JH1 A;  4JQG A;  3LJT A;  1HOV A;  2D1N A;  2W13 A;  3KME A;  4XM6 A;  3TVC A;  1OM8 A;  1CGE A;  2CKI A;  3LIK A;  3G5C A;  2JT5 A;  2N8R A;  1XUD A;  4H82 A;  3LUM A;  1SRP A;  1XFV A;  1XFW A;  2WO9 A;  1A85 A;  1ZS0 A;  3GBO A;  1JAN A;  1YCM A;  1CGF A;  3WV3 A;  3KEK A;  1MNC A;  1KUG A;  1RM8 A;  2X3B A;  3LK8 A;  2MZE A;  4FVL A;  2DW2 A;  3DNG A;  3LIL A;  1JJ9 A;  1SU3 A;  1MMB A;  3LEA A;  5CUH A;  1Y0V A;  4DV8 A;  2JSD A;  3F1A A;  4A7B A;  1AKL A;  3EHX A;  1OM6 A;  1AST A;  1FBL A;  5CZM A;  5D3C A;  2XS4 A;  2OXZ A;  1UMS A;  2J83 A;  4R3V A;  830C A;  1BKC I;  5BOY A;  2X7M A;  456C A;  1BQO A;  1OM7 A;  4J4M A;  2SRT A;  4PKU A;  3ZUK A;  3KEJ A;  2XS3 A;  1K7Q A;  4JA1 A;  1CQR A;  3HYG A;  1QJJ A;  1ZP5 A;  3LJZ A;  1G05 A;  1JIW P;  1ROS A;  3EDI A;  3HY9 A;  2O36 A;  2W12 A;  1PWP A;  1JAQ A;  5I2Z A;  2ERP A;  1OZ9 A;  1AYK A;  2J0T A;  4PKW A;  1JKY A;  4PKT A;  1S4B P;  3K7L A;  1UEA A;  4XBH A;  3I7G A;  1G49 A;  3LQB A;  4H2E A;  5I0L A;  3HB2 P;  4H30 A;  1EB6 A;  3F16 A;  3DWB A;  2OW2 A;  4IUW A;  4GR8 A;  1BKC A;  1C7K A;  1ZVX A;  3OHL A;  1CXV A;  2JNP A;  5I43 A;  4IJO A;  1K7G A;  3LQ0 A;  5L79 A;  1IAG A;  2DDF A;  1KUK A;  4JPA A;  5I3M A;  4PKV A;  3K7N A;  3AIG A;  1UTZ A;  4GWM A;  4AUO A;  1CK7 A;  1HFS A;  1OS2 A;  3E8R A;  4PKR A;  3O2X A;  1I76 A;  2O3E A;  1O0Q A;  1CGL A;  1XUR A;  2MZI A;  1GKC A;  2ERO A;  4DD8 A;  1EUB A;  1GO8 P;  1XFX A;  3LKA A;  5D1T A;  2OVX A;  4L63 A;  3HDB A;  1UTT A;  5I4O A;  4AYK A;  1D7X A;  5D1S A;  2K2G A;  3DTI A;  3MA2 A; 
#chains in the Genus database with same CATH homology
 4WKE A;  1XFZ A;  5B5O A;  3HBU P;  2AYK A;  1O0T A;  1BIW A;  3B2Z A;  2OW0 A;  1PWU A;  1AF0 A;  4XM8 A;  3RTT A;  1OS9 A;  1R1H A;  1HTD A;  1YOU A;  2L0R A;  2ERQ A;  1UMT A;  3HDA P;  4JIJ A;  5L7F A;  2FV5 A;  2CLT A;  2YIG A;  4XM7 A;  2JIH A;  3F15 A;  1QIC A;  1QIB A;  3G42 A;  5I12 A;  2FV9 A;  2A8H A;  3CKI A;  3EWJ A;  1GE5 A;  3LIR A;  1HFC A;  1PWV A;  2X3A A;  4GR0 A;  1G9K A;  2WO8 A;  2K9C A;  2W0D A;  1GO7 P;  2W14 A;  1I1I P;  4Q1L A;  1CIZ A;  2OI0 A;  1YQY A;  4ZR5 A;  3KHI A;  1USN A;  3V96 B;  2DW1 A;  3N2U A;  1ZXC A;  1SLN A;  1R1J A;  4HMA A;  4I35 A;  1A86 A;  3L0V A;  1CAQ A;  5D7W A;  1R55 A;  1JAO A;  4DF9 A;  3DL1 A;  1D8M A;  3LMC A;  1J7N A;  4GR3 A;  3OHO A;  4GUY A;  1IAD A;  4WK7 A;  2OZR A;  1PWQ A;  2KRJ A;  5D1U A;  1KAP P;  3LE9 A;  1K7I A;  3B92 A;  3EHY A;  4AIG A;  1MMQ A;  1XFU A;  4G9L A;  3O64 A;  2USN A;  4H49 A;  4L6T A;  1JK3 A;  3LUN A;  3UVC A;  3WV1 A;  3KWV C;  3DPE A;  3F19 A;  3DTK A;  4IN9 A;  4H3X A;  1BUV M;  4PKQ A;  2RJP A;  3TS4 A;  1BQQ M;  3KEC A;  5BPA A;  1HV5 A;  1B8Y A;  3TSK A;  2OXW A;  1MMP A;  2D1O A;  1Y8J A;  2E2D A;  4AXQ A;  3SHI A;  4WF6 A;  2OXU A;  1KUI A;  1R1I A;  4A3W A;  1L6J A;  3LJG A;  1KUF A;  3EDH A;  1KBC A;  1KUH A;  1FLS A;  3P1V A;  2Y6D A;  2RJQ A;  3AYK A;  1IAB A;  1XUC A;  3Q2G A;  1OMJ A;  4JP4 A;  4G0D A;  4I03 A;  2POJ A;  1JAP A;  1G12 A;  3I7I A;  4WZV A;  5LAB A;  2V4B A;  2DW0 A;  3KMC A;  2I47 A;  2PJT A;  3HBV P;  4FXY P;  1ATL A;  3DSL A;  1G4K A;  2QPJ A;  3BA0 A;  3DPF A;  1BKC E;  1DMT A;  1ZXV A;  3RTS A;  3ZVS A;  2WOA A;  1D8F A;  1SAT A;  5CXA A;  1YP1 A;  3TT4 A;  3EDZ A;  4HX3 A;  2MZH A;  4H1Q A;  3F18 A;  1Z3J A;  3USN A;  4CTH A;  1JIZ A;  5D2B A;  2HU6 A;  2OY2 A;  3KRY A;  1GE7 A;  2TCL A;  1GE6 A;  1OO9 A;  4ON1 A;  1EAK A;  4GF1 A;  3VTG A;  2E3X A;  2Y6C A;  1PWW A;  1WNI A;  2OY4 A;  4H76 A;  3DTE A;  3HY7 A;  2MLS A;  2JT6 A;  4GWN A;  4FXQ A;  3P24 A;  4EFS A;  1BZS A;  1QUA A;  2DDY A;  1C3I A;  2W15 A;  4XCT A;  1FM1 A;  1GXD A;  2YUF A;  1DTH A;  4GQL A;  1BSW A;  3B8Z A;  5JMY A;  3N2V A;  1ZTQ A;  3WV2 A;  1H71 P;  1Q3A A;  2Z2D A;  1GKD A;  4WKI A;  2OW1 A;  1RMZ A;  2OW9 A;  1QIA A;  3LGP A;  4ILW D;  2X3C A;  3U1R A;  3Q2H A;  3L0T A;  5B5P A;  4DPE A;  2YB9 A;  1C8T A;  1BUD A;  1ND1 A;  3VI1 A;  4PKS A;  4L7A A;  4FU4 A;  3EDG A;  1R54 A;  1XFY A;  2OVZ A;  5BOT A;  4QKZ A;  1IAE A;  1SLM A;  1QJI A;  1Y93 A;  4L19 A;  3ELM A;  3ZXH A;  1IAA A;  5H8X A;  966C A;  4H84 A;  3F17 A;  3AYU A;  3NX7 A;  1SMP A;  2AIG P;  2MLR A;  1I73 A;  1HY7 A;  1IAC A;  1MMR A;  1BM6 A;  1B3D A;  1D5J A;  1JH1 A;  4JQG A;  3LJT A;  1HOV A;  2D1N A;  2W13 A;  3KME A;  4XM6 A;  3TVC A;  1OM8 A;  1CGE A;  2CKI A;  3LIK A;  3G5C A;  2JT5 A;  2N8R A;  1XUD A;  4H82 A;  3LUM A;  1SRP A;  1XFV A;  1XFW A;  2WO9 A;  1A85 A;  1ZS0 A;  3GBO A;  1JAN A;  1YCM A;  1CGF A;  3WV3 A;  3KEK A;  1MNC A;  1KUG A;  1RM8 A;  2X3B A;  3LK8 A;  2MZE A;  4FVL A;  2DW2 A;  3DNG A;  3LIL A;  1JJ9 A;  1SU3 A;  1MMB A;  3LEA A;  5CUH A;  1Y0V A;  4DV8 A;  2JSD A;  3F1A A;  4A7B A;  1AKL A;  3EHX A;  1OM6 A;  1AST A;  1FBL A;  5CZM A;  5D3C A;  2XS4 A;  2OXZ A;  1UMS A;  2J83 A;  4R3V A;  830C A;  1BKC I;  5BOY A;  2X7M A;  456C A;  1BQO A;  1OM7 A;  4J4M A;  2SRT A;  4PKU A;  3ZUK A;  3KEJ A;  2XS3 A;  1K7Q A;  4JA1 A;  1CQR A;  3HYG A;  1QJJ A;  1ZP5 A;  3LJZ A;  1G05 A;  1JIW P;  1ROS A;  3EDI A;  3HY9 A;  2O36 A;  2W12 A;  1PWP A;  1JAQ A;  5I2Z A;  2ERP A;  1AYK A;  2J0T A;  4PKW A;  1JKY A;  4PKT A;  1S4B P;  3K7L A;  1UEA A;  4XBH A;  3I7G A;  1G49 A;  3LQB A;  4H2E A;  5I0L A;  3HB2 P;  4H30 A;  1EB6 A;  3F16 A;  3DWB A;  2OW2 A;  4IUW A;  4GR8 A;  1BKC A;  1C7K A;  1ZVX A;  3OHL A;  1CXV A;  2JNP A;  5I43 A;  4IJO A;  1K7G A;  3LQ0 A;  5L79 A;  1IAG A;  2DDF A;  1KUK A;  4JPA A;  5I3M A;  4PKV A;  3K7N A;  3AIG A;  1UTZ A;  4GWM A;  4AUO A;  1CK7 A;  1HFS A;  1OS2 A;  3E8R A;  4PKR A;  3O2X A;  1I76 A;  2O3E A;  1O0Q A;  1CGL A;  1XUR A;  2MZI A;  1GKC A;  2ERO A;  4DD8 A;  1EUB A;  1GO8 P;  1XFX A;  3LKA A;  5D1T A;  2OVX A;  4L63 A;  3HDB A;  1UTT A;  5I4O A;  4AYK A;  1D7X A;  5D1S A;  2K2G A;  3DTI A;  3MA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...