3K7UA

Structure of essential protein from trypanosoma brucei
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
b'QLQESGGGLVQAGGSLTLSCAASGRTFSNNAMGWFRQAPGKEREFVAAISWTGGLLFYADSVNGRFTISRDNAKRTVTLQMNSLKPEDTAVYYCAARPQGDYVTAHYDYWGQGTQVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody
publication title Structures of a key interaction protein from the Trypanosoma brucei editosome in complex with single domain antibodies.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system, rna binding protein
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k7uA00
1ZGLP 4BQ8A 1DN0A 1I85A 5ICXB 3O2WL 4X6DB 4JFPB 3ZHDA 5FA3B 1OM3H 1RIHL 1HWGB 4JN2B 3O2VL 5EOQH 4LASH 5ICYB 4X6FA 4OFKA 5DT1L 4PGDA 4PTTB 1R5IA 2V2XB 1AHWB 3FO2B 4EI6B 2MCPH 3MRHB 3MPCA 5HGAB 3Q2CA 4WTXA 3UTTA 3OKEA 4TSCH 1PFCA 3QEHA 5DQJB 3U7YH 4FFVC 3H7BA 5C0AB 5FKPB 1YEJH 2DQHL 3O9WA 4IOIB 1S7UB 1NDGA 2AS5M 4U1HB 5L6YL 1WIOA 2EDHA 4JHWH 1HH9A 3AB0C 4LARH 2RJMA 3O6ML 4Z7WE 1KELH 2O26U 2G60L 2PW2B 4YR6B 2VO5A 2WWKO 4PRBB 4FZEH 4XTRD 3OZ9L 3F58H 4G7YL 5GGRB 3EGSB 4C4KT 1MREL 5HGBB 4MSWA 2Q1EA 3AS1A 2PTVA 3QUYD 2VDLL 5HDOA 2OL3B 4HS6B 2QV2A 3KS0J 4DZBA 3D3VE 5DJZA 5KS9F 2NXYC 1KB9J 1RZFL 3KR3L 3O8XD 4OB5L 1ZMYA 2ZUSA 2P5WE 3BUYA 5CJQH 4PY8I 1H8NA 1PSKL 2LVEA 3GZKA 1CQKA 5E8EA 5TE7L 5IB2A 3FJTA 1ACYL 2A9NL 1TIUA 2BOCB 4LBEA 5I1EL 2VC2L 4M02A 3VG9C 2BHZA 4JZOB 1DLFH 1IMHC 5JNYA 2OP4L 2C26A 1EVUA 4WU7A 1WBZA 4LHJB 4OBSA 1AO7B 4S2SB 3V6FB 4WUKL 2ZUQC 4OD1H 3RZCC 2IPKB 3GSOA 3TA3C 2MPAL 3C08L 1B3JA 3QSKB 3LIZL 3DX6A 4ZDHA 4P2RE 1MCHA 5GPRA 1XR8A 5D8JL 2IH1B 4HSQA 2XYCA 4OGXL 1IM9A 5D7JD 1AR1D 2D0GA 1FG2A 5C6WH 4NSKB 4I0KA 4NQDB 1ZHNA 3MV7D 2ATPB 1EIBA 4LOUD 3OKDA 4X6CA 4H1LG 5EOQL 3QXDB 3E6FB 2VZSA 3IGAA 3MRNA 2BRRH 3L3GB 4NCDA 4U6XA 1ZLVH 2NLJB 4NFDA 4YDVB 1H5BC 1F3DH 1C16B 2E8YA 4JZJA 3FCTB 4RAVB 2NX5A 5DQDL 2BMKB 1KB5H 3EKCA 4NQEA 4WI2A 3CH1A 4NZUL 4WHTA 3HS0A 4G8IA 3QWRD 2DN7A 3ZKMC 4NFBA 3UYPA 2X4UB 3PQYD 3OXRA 4OT1L 3GM0A 2NY5C 3GMRA 3HNTL 1E6OH 4U0RB 4YE4L 5T1LA 1NL0H 4EI5A 2NY5L 3CCHB 4GW1A 3IAPA 4HMCA 3THMH 3F58L 4N0UB 4X99A 2Y6SD 1A0QL 2KQMA 4JM4L 1T80A 5ESQB 1P9MA 1I1AA 3F7YB 4JRYA 3IDNB 2O5XL 3L5IA 3S37H 1UKSA 1QA9A 3ARGD 4HBQA 1EXUA 2X1XR 1T89A 4XB8A 1MCLA 4WFFE 3JTSB 1YA5A 1MH5A 4MCZB 1G7PA 2BVTA 3C9NA 3SE8L 4JB9H 4X7TB 3QO1A 4G43B 4RNRA 5DEFA 4ZS6C 3BIBX 1FZOA 3QH3B 3WIIH 3EO9L 5CP7A 4A6YB 1ZGLM 1A6VL 2H1PH 3PNWB 1W0YT 5CS7A 4L3CA 3RDTC 5T33H 3KGRA 5SV3A 1FFNB 3IJSA 2R9HC 5HBBA 5KS9E 1FC1A 2J88H 4PGZA 1MAJA 1AXIB 2GJ6B 4V1DE 2VR4A 3RL2A 3GSRA 3GSNA 4MJ6A 2IMNA 5EZIL 1U3JA 1U3HA 3MLPA 2X4TA 4DFHA 2Q86A 1IFHL 1Z9LA 3SKOA 4PJDF 1GGIH 3SCMC 1FL5A 5EZOH 5KJRL 4M7JL 3QFDA 5GHWL 4YHKL 2WUCH 4MHHI 5HYJD 4LAQH 1CWVA 3O41B 4LLVA 4HWNA 2C3WA 4XCCL 3N1FC 4NQCA 1QFWL 2FJGA 1U3YA 4J6RL 2AV1B 5JHDA 1JF5A 3FTGA 1U8PA 5D2NA 5D93C 5DS8B 4WCYL 3PE9A 1T1WA 3GEWB 1ZLWH 3X3GL 4XMLH 2X7LA 4LU5H 5DK0B 1S7WB 4L5FL 5B3JF 1CLYH 4Y4FA 4IRZH 1ZE3C 4LVHC 5D2LB 4ZO9A 2O5ZH 3L3DB 3SE4A 1GZQA 4HKJB 4X7DC 1FH5L 4Z7WB 1E6OL 3QCTL 2EE2A 3S5LA 4W70A 3H3PH 5JW4Q 3LV3A 2GSIA 1BD2B 4OFYD 4PRIE 1QP1A 5BCAA 3IDJA 1NL0L 3AAZB 3OMZA 3QEQA 4MA1B 5JPMB 4I18B 4MD4B 3P0VH 4DW2L 3BRGC 1I75A 3ARTA 3RGVC 4RWYL 3LHPL 2VXUH 3D3VB 4ZOAA 3HNVH 1HOCB 4NCC2 4KU1A 2HT4C 1M6OB 3TC9A 2P8PB 1EGJA 1NCWH 3FT3A 2P5WB 4TNVK 5FDWA 4X83A 4JB9L 4YDKL 3CPLA 4P99A 1QG3A 4B7IA 1WTGT 3BI9X 2V7NA 2H1PL 5DVLA 1CE6B 4N8VG 4M7LL 4UOW1 4J8RA 5I71B 2JJUA 4GFTB 1VEOA 3CU7A 1NC4B 4NO5A 2AV7B 2CRIA 4EUPA 1FL6B 2F53A 3K8LA 1WFUA 3IFOB 4XXDB 4MWFA 2DLTA 4KMTL 5IFHH 4BFGA 2WUCL 2D7TL 2VLRD 3KPSD 4GSDL 1SJHB 2CLVA 3MBEC 4ODSH 1MCNA 4BZ2H 4N90D 5C08D 4RQQA 2KBGA 4KUZH 4P5TA 1K8DA 1OW0A 1CLZL 5GGRY 1X9QA 4PJDE 4XMLL 3WFEH 3KNBA 4WO4D 4DKFL 4ZOEA 1PVHA 5C2BH 3B9EA 4CU7A 5DJ8A 2QADC 5JPNA 2IG2L 1PKQA 1MNUH 4YBQD 5EN2B 4I0PD 1OQOA 4XNQA 1RFDL 1NGPL 2AJXL 2P24B 4Y16D 4DUWA 5J13C 3QULB 4MQ7B 2XTJE 3CFJA 1JWSA 3BPNC 4GAYA 5GJSH 2J3SA 2EDLA 5IBTH 3KLHD 5GQBA 2WP3T 3N1MC 1XF5B 1N0LA 4BKLB 2C9AA 2AK4A 1RZGA 5B3JE 4OZHF 5J1AB 2YXMA 4NN7C 1JWMA 4JPWH 3L6FB 1NCWL 3SJVD 3TZVD 4UMGA 4RFEA 1MHCB 1ZA6B 4ZO7A 4JJHA 4TUKL 2AJZA 2VXQL 3MGOB 4OBRA 2UUDK 2XN9E 2A6KB 4D9QE 3IJHA 1ZHKA 4ZOBA 4YAQA 2QSQA 4QOKD 3I6KB 4R7NA 3OAYH 3R1GH 1T6VN 1CLOL 4ZUSB 3HAEH 2EYSB 3NTCH 5IEKB 3E0GA 1FL3B 5KS9B 3CVHL 4V1DB 3KYOB 2VIRB 3W11D 2Z93B 5IQ9B 3UDWC 1P1ZB 4JFDA 1EHNA 3VXRD 4RGNE 5A2JH 2H26B 1JUFA 4XNMA 5HDQL 2NY4C 3P9LA 4CBPA 3L1OL 3DVFA 3SKJL 2IALB 1U95A 2Y36H 4I9WE 1ZLSL 4APQA 2YZ1A 4LMQI 3RWJA 2XA8H 5TF1H 3T8XB 2KZWA 5LQBH 4LHUA 4X6FB 5L2KD 1W2KT 3NCJL 3SE3C 1H3PL 1OAYH 3FB5A 4K7PH 1CYGA 3GJFK 4NQCE 1S78C 4S1RL 3OKEB 3ETBF 2VWEE 2HLAA 2APFA 1LO3L 2XZAH 4KTDL 3FOMA 4OCLC 2COQA 3CD4A 5FUZL 3IYLW 5EH1A 1KIQB 3FL7A 4NYLA 4N8CH 5E2TL 3PDOA 1J0YA 5D9SA 3PHOA 3S96B 4AMKH 1NGZA 2Q7YA 5J3HC 2CXKA 1NSNL 3VXME 4ZQKA 1TJGL 4PJ9D 5HPMB 2FJFA 1LDPL 3IFLL 4H25A 1ZTXL 4K2UH 5C0RH 1F4YH 4FQHA 4H1LA 4PRIB 3QIWB 4UZGA 4Q97A 2PW1B 1A1OB 5JTWA 3QZWG 5DFTA 3QEQE 4MSWB 3NZ8B 1SVCP 5JMRA 4XBEL 4JFED 3KPSE 2W9EH 3HFMH 4D3CH 5GS1A 1MCCA 2FHBA 4X6EB 3OR7A 2VE6B 4WHDA 1BM3H 4YHLH 3UJJL 4AZ8A 3RKDD 4J3VA 1XF4B 3QRGL 3QI9A 4NN5B 5FDYA 4JPWL 4OF7A 1N5YL 2B0SH 1KCLA 3GSUA 1DUZA 2CKBA 5JDJA 4PY7B 4X4XA 4R0LA 3CFIC 4G42A 3GBNH 1QTYT 2IANE 3UAJD 3TPKA 1HKFA 1JTTA 4J3SA 3WNMA 4XPBL 1JGLH 1BQHG 5CJOL 4JRXA 1IKNA 1ZANH 4LBEB 5GRUL 3GSWB 2EDWA 1X7QB 5I8OH 1LO4L 2VR5A 4R7DB 2RBLA 3NIGF 1QLEL 5HVGB 3NFSL 4OZHE 3MXVH 4JO4H 3MRDB 1LVEA 4M48H 1I7ZB 1VFMA 2X4NA 3CSGA 2XTLA 1JNJA 3OAZK 3CMGA 4XVTH 1EFQA 1CFTA 3DX6B 3LS5L 2J4WL 4DAGL 1XR8B 3BGFC 3H2WA 3WUWA 1IM9B 5C0IA 1UH4A 1FG2B 3RPIA 3FHAA 1ZHNB 4M00A 4LEXH 5IJKC 1KLUA 1S9WA 3K46A 3IGAB 3TIEA 4JM2C 1FGVH 5AUMA 4JZJB 4NC1C 4YO0B 4ZXBC 4GKNA 1AKJD 1GGTA 3OB0H 3EJYD 3HZKB 1FO0L 4MNHA 4F7CA 4U2ZA 8FABA 4AG4L 1A6PA 4PJDB 4N8CL 1E6JH 4OQ1A 2P8MA 4F9PC 4QXUL 3RTQC 2OXHA 4PYGA 4ZYKA 3I3BA 2AJ3B 4QT5A 1OAQL 3C6LD 4POZC 2XTJB 2AQ2A 3QO0A 4WI3A 4X99B 2A1WL 3MCLL 4BFBD 1IQWH 2ORBH 1ND0A 1WZKA 2ZJSL 3Q5TA 3BHBB 1F2XK 1I1AB 1CICC 3TH4T 3EUUA 3A6BH 3BKCH 3SGJC 2WLYA 5IMLB 1EXUB 3TESA 3VXSA 2W0PA 4OZ4B 1F90H 5F1NA 4CN1A 4WI9A 3C9NB 1ADQL 3QO1B 43CAA 4RNRB 3TH2T 4ELME 2R39A 2B0SL 5DEFB 1WTLA 2R2BA 2BC4A 3LSOA 5F9WB 3CJJA 3F62A 5J11B 5TQ2L 4L1HA 3P73B 3HRZB 2K9UA 1UKQA 5D6DC 4GRLD 3OF6D 4HKZA 4L3CB 3TFKD 3M8OL 2EXWC 4XCNA 1QEWB 2YKLH 4QRPA 5CHNA 5CZVH 2VLMD 4QRQA 3CGTA 3I02A 3T0BA 5IFAH 4LPCA 4MJ6B 4JO4L 1U8HA 5D96B 3KYKH 1ZHLB 3EYQC 4CKVX 3ULUD 4MAYC 4JKWA 3LKRB 4RGNB 1JYWA 4P23B 1FL5B 4R2GD 2Z31D 3BDBA 5DJ6A 4LKCA 5KVMC 2DQCL 1R24A 3QDHA 1MRDL 2PYFB 1NAMH 2XQYG 4LLVB 3RZCA 3I84A 1TNNA 3GMNB 3TA3A 5JW3L 5IJVB 4M43H 3BD5A 4WTZG 4NQCB 1AGBA 5E94A 3NIGE 4N8VA 3RWEA 5GISL 2JJVA 2D9QB 4PRPD 5D2NB 2BK8A 2QHLA 2V7HB 1S7RA 3QR2A 4G8EA 2JIXB 1V3LA 1JCKA 1EAPA 1NJ9B 4OQTL 4NRYA 1FN4A 3H42L 1JPFA 5FO7A 4W81A 3B5GA 2IGFH 4Y4FB 2AXJA 1E6JL 3VFOB 3ILQD 2Q76A 1H5BA 3VXMB 2JB6B 2V9TA 1XT5A 3S5LB 1J5OH 3LV3B 2OJZH 2LTQB 2LE9A 2PTTA 3DWTA 3F7VA 3IDJB 1WFNA 4GBXD 1KN4H 4W6YB 1Z6JT 4EDWL 3QEQB 4PJ7F 4TSAH 1BP3B 2O93L 2X09A 1B0WA 4PP2A 4AH2A 2GT9A 4UINH 4XVJH 2ORBL 3C60B 1P6AB 2Q3AA 4FQIH 3UCRA 1UVQB 1MY7A 3A6BL 5CILL 3WXWH 4WJ5B 3NPSB 5F7LB 4Z0XA 1LD9B 3BW9B 4TVPE 4QRTA 3D2UA 2ZUVA 5DGQA 3GJEB 1A7RH 5FDWB 1L7IL 4ONHA 1BVZA 4F2MB 4YH6A 1N3NA 1ACZA 3X3FH 2IANB 4Y5XB 1BEYH 3H0TA 3HC3H 3QG7H 1KJ3L 2OCFD 1BZQK 2MMXA 1SVZA 2Q6WA 1NCCL 3SDAC 4J8RB 1RUKL 5I1GL 3V95A 1YMHA 4PB9H 2V2TA 1IE5A 3MX0A 3X13B 4OZHB 2IAMC 1O7SA 2DLFL 2H2PC 4JFZL 4JDZB 2Q7NA 4WRLA 5JQ6L 4P5MB 5ID0A 2DYPA 1FJ1B 5DUPL 4EUPB 4PGEB 2OZ4L 3WXVH 3QQ9C 1KPUA 4QF1A 4Q0XH 3V0VA 4MWFB 1B6UA 4XAKE 5KTEL 3STZB 4DUXA 1G6RH 2CLVB 2CO6B 1CDCA 3EOAA 5JOFB 3WN5C 4P4KC 4G6FB 1DN2A 2FB4H 4ZMAT 4P5TB 3QPQD 4AT6A 3SCMA 1S5IL 4RFOL 1OQXA 4X80L 2P5ED 3RUGF 2WM0A 4MA7H 4P3DA 4C83A 2WANA 2ZUYA 1YY9C 3IDIA 1KEGL 4JN1H 1NC2D 2H45A 2DKSA 1MQKH 5IB4A 5FA4A 5KN5A 1CFQB 1F11A 2IGFL 2NXZB 3GGWB 1TTGA 4UT7H 3UTQA 4KROD 4OZFG 1P7HL 5HD8D 1P4BL 5E70A 4LLWA 4X5XA 4LHQB 1FE8H 4LSTH 3L5XH 5C9JA 4FQCL 3T77A 4HFUL 2DL2A 4H88H 3CFJB 4QCIA 3SN6N 4QYOA 5TQ0L 4HJ0D 4GAYB 5DJCA 3IS1X 1MFAH 4LRIC 4G9DB 2HFGH 5I1IH 5A1AA 3RVXD 3GMPA 4I2XE 1UA6H 4YGVB 1URLA 5DJ0A 4PRPE 2AXGA 2CIKA 1MIEL 1SY6H 2ZOLB 5GGQH 4ZFGL 2P46B 4ZAKC 4RFEB 5GGTL 3ULVC 3MYJA 2X4QA 4PJCA 5K9JH 3LB6D 1FORL 1CE1H 3IJHB 4PJ7E 1ZHKB 2R69H 4MA3B 4CMMB 1NUDA 3QZWA 4HDIA 3ULVL 3BKJL 1V7MH 3D9AL 4K23H 2CK2A 1WBYA 4J4PD 3FO0L 5EFIB 5TE6H 2A73B 4OGAD 1AIFA 5T3XE 4HJJH 4Y0GA 1RAMA 1KGCD 5DC0A 4XGZA 1XGYL 4XNMB 2WZPD 3P9LB 4BK5A 3FZUC 2Y9RT 3WXVL 1U95B 4IHOA 4X9IA 1TCRB 1DQQB 1DQJA 3IFNH 1XZ0A 2X4OA 3HCVB 4LKXA 5I17A 5T5NG 1UZ6F 1MFCH 3EDKA 1OL0A 6FABL 1BQHA 1C5CL 2NNAB 1RUML 4HGWA 4OKVB 5JIPA 4TRPH 3UZVB 4JFFA 1HYSD 5CJ5A 1SHMA 2HLAB 1IZJA 3B5TA 3V5HA 1DEEB 5DSCB 5J06A 5KSUA 1EJOL 4I1NB 3RA7L 5B22A 4NPYA 3PDOB 2Z8WC 5D9SB 3PHOB 1NGZB 1D5BB 7CGTA 3IDGA 3PGCA 2Q7YB 3MBEA 5KG9A 3T0EC 4H8WH 5ACZA 4QTIH 4LVOB 5DC9B 5F3HB 4H25B 5F96H 4U1LA 3VWKC 4HLZH 2QHRL 3L5XL 3MV9A 1U8LB 4FQHB 3V7MA 4H1LB 2AKRA 4RBPH 2JLLA 1BJ8A 1DBML 1QFWM 1FPTH 2EDKA 5T5FH 3NABH 4MQXD 4FTVA 3RUGE 2GK0B 4I0CC 4L4TD 4QTHB 1ZWIB 2NY3B 4XNUH 3L3HA 2HFGL 2UY7A 1HXYA 5B38G 5EUKA 4XPGH 4L9LC 4U0QB 1MRFL 4DGVL 4ALAL 1CD1A 2P5EE 5DR5H 4RMRA 5HHMD 1A7PH 5IW1A 5J56B 3BH8A 1B0GB 2CKBB 1GAFH 5C92A 2MWCA 4X4XB 1K4CB 2VLKA 2J5LB 1QO3B 4R0LB 4NJAL 4P4RA 3MGAA 1DBKH 4G42B 1Q9KA 2L7JA 4LLUB 3SDCD 5BV7H 4JRXB 3REVB 2R69L 4MJ4A 3N85L 1S8DB 1YYLH 3L3JA 4KY1H 1MHEB 2IEPA 3W39A 3OHXB 4XZUA 1N6QL 1OAXH 2EECA 3QNXA 1QRNE 3NIFF 3TJHD 4RDQG 4IRSC 3CVHA 2LAGB 5C3TA 4HJJL 1ZOXA 3T09A 1XR9B 3P11H 2VH5L 5B8CC 2B5IC 4GMTH 3TH3T 3OJDA 2AEIT 1YEFH 3IFNL 3HE6B 1KLUB 4D9LH 2ITDA 3QHFH 2X4PB 5D7LA 4K3JH 2XPGA 4IJ3C 4GKNB 5EORL 4NC2B 4J2XA 4MNHB 3W0WA 3ZKND 5I8KH 8FABB 3AM8A 3WFCH 1EMTH 4OFDA 4WEMB 3SE3A 3ARYA 1BIIA 3MR9B 5EBWB 5I66A 2XFXB 4Y5YB 5FHBL 2P8MB 1FFPA 2LAAA 5HGHA 4NNYB 4ZYKB 4LLDB 4NQUA 1J88A 2F58L 1CF8L 1VFAB 4OJFH 4QT5B 5MP6H 3R06A 2EZ0D 3QAZC 2CDFA 2Y4SA 5EZJB 2XACC 2UVFA 3FOLA 4WTZA 5E9DA 5CEZL 1ND0B 2OSLA 3BQUC 4OCXH 4KHXL 1G9NH 2ZPKH 4X98A 3RZWA 3AB0B 4I2XB 2CMRL 3G08A 2NY6B 4HC1L 4IS6B 3VXSB 4HK0B 3EJZC 1E4XI 5F1NB 1WV7T 3RVVD 4LAJH 5ENWA 3T0DA 2FLRT 2XKUA 2P48B 4ZPVA 2R2BB 2BC4B 3GNMH 3LKOA 2YBRA 2PO6C 5JMOC 3BP4A 3OX8A 3HLAA 4PJ7B 3LH2H 3G5XA 4HKZB 1P84K 1QSVA 1F45A 4XCNB 1EEZB 1EPFA 3HI6L 1Q94A 3QUZD 4QRPB 4TYUA 4W68A 5IHUH 2VDPH 4KY1L 5HTSA 3H9HA 3I02B 4MX7B 4QNPF 4LSRL 1U8HB 4RWHA 43C9A 3JUYA 2N7AA 4PG9A 5CEXA 2W60A 1KTLA 1YPZA 3MJ7A 4LNRA 5FYKE 1BJ1J 3BAEH 5FYLD 3ALXA 3TP4A 1DBJL 4HUKB 3VG9B 2VXSH 1HIML 1MWAB 2VLJA 3B9KB 4UDTB 5DJ6B 1PKOA 3CK0H 1R24B 3U4BH 4F3FB 1DR9A 5A2KH 3B8YA 5D5MA 1KNOA 3L3IA 2ZUQB 3RZCB 2FBJL 3FQWB 2G75A 1NCDL 3TA3B 4KKBC 1A6AA 5E94B 3BX7C 3ARDC 1IT9H 2BSTA 3IU3A 2FEDD 4L8SA 3WFDL 1NMCC 3IF1B 1S7RB 3NIFE 3MCKA 5FFLA 3MRJB 4OCMC 3ZSTA 5A16A 3M1BA 4NRYB 1FN4B 1T0MA 5I8KL 5IJKA 4PB0H 1FO0A 3QEGL 3TV3H 3UYRH 3ZDYF 3O6FD 4RAUA 2GIYA 4JDVA 1H5BB 5GZNC 5ERWA 1A4JA 1WEJL 4PJXA 4ZXBA 5CGMA 4MJ2A 1IKFH 3C09B 2PTTB 5MP6L 1L0XA 1P84J 3BVNA 4G6AD 1J1XH 1GZPA 1LGVA 4AH2B 1GGCH 1TQCC 1A6TA 3WLBA 4NGHH 4RIRB 3RUGB 4F9PA 5CBEA 4QHUA 3N06B 4OCXL 5DJDB 3RTQA 3VFUA 1NUGA 4FG6D 4DVRL 4XPFH 3S35X 4NOBA 3UTTD 1EUUA 4MCYB 1KJMA 3B3IB 1YY8A 4Z0XB 5I1CL 4QRTB 1YPZF 3MTRA 3T2OA 3O9WD 4JKPL 4OZFA 3GIZH 4M6OH 3O2DL 4HQQL 4U3HA 3O0RL 5ID1A 1CICA 1N3NB 1UB5A 4K55A 3GNML 3SGJA 4D0BA 5I18L 4FFYL 4ODBD 1MHPH 1ADQA 3H0TB 1LO0L 5D5MF 1D5XA 4KPHH 4LRNH 4O4YH 4KK9D 5E95B 3VFSA 4X4YA 2HJFB 5GSVA 3HI1A 2YA2A 3BDYL 2OQJA 5IVXA 1JPGA 3JXAA 4NWUL 1OWWA 2F19L 4N5UA 5IHUL 1JYVA 2VDPL 3NCCB 1FFOA 3LPGA 3NGBB 1QRNB 4GKSA 4JPKL 1X5AA 1C1EH 4E41E 1J12A 1C7SA 2C7UA 2MKLC 5D6DA 5DRNA 3RDTB 1YNLH 4QF1B 4MJIE 2OTUB 4JM2F 4KKLC 4KRMB 3S4SG 4G5ZL 4V2BA 3CFEA 1C08A 5I1AB 3EOAB 1A6WL 3T0WA 3UPRB 3QCVL 4P9HH 2OXGA 3IVKB 4QNPE 3SCMB 4L8DA 3T2QA 4LSDA 4EEEA 2D0HA 3V4VL 3F5WB 2J7LA 4P3DB 4C83B 1QPXA 3EFFA 2GEEA 3ZYZA 3BZDA 2FEEL 2X4RB 5J7CC 2HN7B 1ERNA 5KN5B 2Q20A 1OTSD 3C5SB 2CDGB 4OQTA 3UO1L 2F8VA 3UYRL 4ZNEA 1N0XH 1UWXH 3HHRB 4LLWB 4X5XB 4NHCL 4XHQA 5C9JB 4YUEL 5I8EA 3UROR 3NFPA 5KOMC 4QCIB 1IM9D 4ACPA 1T22A 4FABL 4EDXA 4RMVA 3QUKB 5E7FA 5LVEA 3TO4C 1J1XL 3HR5A 1P4LA 2K7PA 3GMPB 3OKNB 4LLQA 2E6PA 1W72H 1YMME 2YA0A 3ZDYE 2RGSA 5E1HB 2NX5D 4M3JA 5FHAL 2QJDA 3SQOH 2QSCL 4NQED 5ANMA 1JGEA 4PTUA 2UZIH 5IHZB 4FFWC 3E3QC 4FA8A 4UIKH 3GIZL 4WWKB 3RGVB 5FGBC 3SOBL 3LZFH 4BZYA 5HHQA 2CR6A 3QDGA 4R90H 3UJIL 2C3VB 4XWOC 1Z2KA 5INDA 2ICES 2YS4A 4HDIB 3BZ4A 3DRQA 2MNUA 1YN7A 2ICWA 5GRZA 5T1LD 1X4XA 4EI5D 3C2SA 4LF3A 3WE6B 1B4JL 5C09A 2I9TA 4Q9QH 4EOWL 5C0CD 1E27A 2YD5A 3ROOA 1CN4A 3PG2A 4MJ5A 2Y7QA 5B38A 1HWHB 2HTLC 1QNZL 4F37F 1I1CA 4OD3L 1Z5LB 2YOCA 3GUTA 1YPZE 3IAGC 5IK3A 4YHMH 4JRYD 5BVJA 4RZCA 1I3RA 4HXAH 1M7DA 1BREA 1WC7B 1WCQA 3SDAA 4IHOB 4ETQB 1DQJB 5D5ME 3I9GH 2CUMA 4L8BA 1FYTA 2OZ4A 2CK0H 1I1RA 2IAMA 3TF7C 2ZG3A 5ACLA 2XRAL 1RHHA 2R2EB 3UJTH 1XIWC 5D7IE 5T5NF 4O02L 3BO8A 15C8L 5A43C 5LWYL 2NW3A 4EN3C 3O3UN 3LD8C 3U2SB 2OTWB 2A0LD 1MFBL 3MMEA 3BFOA 2DBLH 4E5XB 5KSUB 4CDGC 3P0GB 4HXBH 5K9KA 1FIGL 4I3SL 5L8KB 4EQ2A 4WW1A 5C07E 2AI0L 4RA0C 2W1NA 1K8IB 1T5XA 4XNXH 4DQOL 5KG9B 5SWSA 1QSFE 1AP2A 1U3HD 3WN5A 5DZNA 4P4KA 1G0DA 5AWNH 4NC1E 4M1CC 1D5MA 1WFTA 5E8DH 4UUJB 5F9OL 1HILA 3O3EA 4K71B 3DO3A 3C6SA 2EYRA 4NT6A 2HVKA 1WSST 4UBDC 3RNKA 4GJTB 1ZLUK 1FGNL 2FX7L 2AK1L 5I2IB 5ESAA 3L3HB 1T0NA 1HXYB 5L2JA 1QUNA 1JGDA 5JHDD 2Y06H 1CD1B 3MRIB 4TQEH 2NY7H 2A6DB 4UB0L 1HN1A 3V0AC 4WFHD 2UUDH 4LRIA 3RIFF 5MEOA 1J8HE 3T3PF 2J8UA 5D7KD 3KPRA 4P4RB 3P4OB 3VGBA 2JJTC 4PJGE 1U58A 3RQ3A 5FGCE 3BPLC 5FXCH 3KPOA 3GMMB 5GGTA 2OYPA 2HA1A 4NN7B 5F3BA 4Q9RH 1HHGA 4ZAKA 3E8UL 2F15A 1EBPA 1GC1C 2EE9A 3W39B 1TZHA 1NFKA 3QXVA 4MD5B 4YHPA 3L5WA 3QIBD 5SX5H 4XZUB 1WZMA 5MENE 3QNXB 2ZCKL 4KTEH 4Y8DC 2ENYA 3CVHB 1MF2L 4E41B 2VDRH 4JRWA 1GC1L 4RDQF 1OTTD 1OTUD 2VZ3A 5D71L 5H94A 1KCRH 2R0LH 3DPBA 4GKOA 3OJDB 3FB6A 4MJIB 3MNVA 5T1DH 3I3DA 5DMKA 4CJ1A 1QPPA 1LK3H 3CFBA 1ES0B 5JUEH 2PNDA 4HUWB 3T3ME 4GMSH 3LS4L 1A22B 4HUVA 4OFIA 2XPGB 4O2CA 5CZKA 1C7TA 5BZWA 4ESKA 5GRVL 3MA9L 1QZ1A 2QQKL 3KAAA 1G7QA 2CDEB 1W0VA 4YPGB 2B4CH 3GRWL 2DAVA 4KRPD 3VGEA 3ALPA 5SWZA 1AXSB 1V7NL 3C2AL 5HGHB 2XKSA 2I24N 1J1OL 5HDLA 2KZ1B 2J8UF 1S7XA 4B41A 3R06B 1YN6A 1CDYA 2I07A 4S1QL 5T1MA 2F53D 4LSPH 5T3ZL 1YECH 4KRNA 4AEFA 3NACL 1U8NA 5CGYD 1EHAA 2H32B 3MRKA 1K3IA 2YN5A 4PJAA 4BSVA 2LABA 5E5MA 4NKIH 3MLWH 3G08B 1Z3GH 3VWKA 1YMMB 1YNTA 2YSSB 4F58H 5F7EL 5D4QA 4NM8H 4TQEL 4MDIA 4OTXH 4LVNC 2B2XH 1FLTX 1HNFA 1JV5A 4G8GA 5F9DC 2AEQH 4FHBD 3QWOA 3WFZA 3HLAB 2RCSH 1JBJA 2QR0A 4Z95H 5I16A 4L9LA 2PXYB 3G9AB 4IDLA 1Q94B 1U2HA 2QQQA 3AS0A 3FRPG 1LO2L 3H9HB 1EO8H 1GPOL 2DL9A 1QFOA 3WDHA 1I8LC 3FAWA 3NH7H 1EZVX 5E0QA 5JOEA 2YD9A 3MLUL 4LQFH 2NR6C 3V6ZA 1YPZB 3MJ7B 4KTEL 3HR6A 4UV4L 3T3PE 4XPAL 2AK4D 5HYQB 3VW3H 2VDQL 5GGSB 2R0LL 5JXAL 2GTWA 4PJFA 4XP4L 3FFCD 4U6TA 3OGOE 3ZO0A 5D5MB 1FFQA 1FYTE 1JF1A 3PWPD 1U8QB 3AREA 2O5YL 3MODL 4ZTOL 2G75B 3DHJA 4NP4H 4XMPH 4IRSA 4M1DH 4YDLC 4S11A 1C12B 5F7FA 1SEBB 2BSTB 2AABL 4NUGL 3BGFB 1HSBB 3CIQA 3MCKB 2D0FA 3M1BB 4OM0L 4OCYH 4PJAF 1HZHL 1IAIL 5C07B 1A7OH 1LWRA 3SPVA 2DWDA 4LSQL 4JM2B 3MFFB 3CLFH 1QSFB 3ULUH 4JDVB 1MLCA 1F8TL 2DQEL 4JFDD 1EO5A 5CMAA 5ERWB 5DMGC 1HHKA 3GI9H 2WWKT 3QPXL 4ZXBB 4M4PA 1A14L 4M7ZB 1I3GH 3MO1A 4X9FA 3S4SA 2DICA 1X5ZA 2JB5L 12E8L 2FDBP 2YD2A 3DO7A 4WVRA 25C8H 4Y5VA 4APQD 1UB6A 4PRNB 4LHUD 1GZPB 3WLBB 3RU8L 2FX9H 1CFSA 3IB4A 4AEHL 4QHUB 3RTQB 2XWJB 1MI5E 1N64L 1K3ZA 4IRJD 3V2AR 3WV0A 3MUZ1 3BOVA 3SQBA 3CMOH 4KK5C 2VDMH 2Z8VC 1BQUA 3V4PH 3MLYH 3OKKA 1T20B 4NO2A 2VDKL 4F58L 4OZFB 2CKNA 1DE4B 3EFDL 2J8UE 4HC1A 3KPRE 1J8HB 2IPUG 3CX2A 1UB5B 2AEQL 5KSBF 5IM7A 4U3XA 5FGCB 3P9WB 4PJFF 4QXTA 5LJYH 2IQ9H 1JGUH 2AQ1A 1ZT4B 4Z95L 3KYAA 2BNRA 4XI5C 1G9MH 4HIHA 3HI1B 1ORQA 3BP5B 4HJGA 1ONQA 1JPGB 1GCFA 5ADOH 1U8JB 4OZGA 4GQPH 4PJHA 4X4ZA 5MENB 4RAHA 2PO6A 3GK8H 1RUAH 2C7UB 4C56E 1U0QA 3K1KC 1IGCH 1VFBB 3MREA 5DRNB 5IP4A 4JG0H 5FYJD 4KDTC 3MOAH 3QI9D 3MV8E 1I7UB 1OF2B 1NMAL 2B1HH 1MJ7H 4HS8L 1E4WH 1S7VB 4DN3H 5IW6A 5I1DB 4CW1B 3QDJE 4MAYB 4XHJC 1T03L 3DVGA 4XMPL 2MOVA 1OLZA 4M1DL 1YEIH 3VXNA 1F6LL 1S7QA 2R1WA 4L8DB 2R23B 1NCBL 5DUMH 5DXWA 4Z7OF 5TE4H 32C2A 4H0GA 5IMKA 3T4AA 1YJDH 3FN9A 1BWWA 4GKZB 4UIMA 4YPJA 1RI8A 1A5FL 4KI5F 3ARDA 4G9FD 2WQRA 5B4MD 1NBQA 3TBSA 5I8EB 4MB4A 3NFPB 3GSVA 3FFCE 1FVCA 3T0EE 2Q8AH 5CD3B 4AIXA 1P4LB 2CQVA 4NZDA 1BAFL 3RL1B 2GW5A 4OUUA 4LLQB 1H3UA 3VD3A 2DBJA 3IDMB 4PJAE 2HKHL 3VGDA 3IXTB 4OZGF 4X7SH 1UZ8A 1HSAB 3CFCL 2ADJA 2R0WL 4PGCA 5IF0A 2UV3A 1FVDA 3MLYL 4DGIL 1JGEB 1A3LH 2VUYA 4PTUB 4RCAA 4HIIA 2VQUA 2R56H 3STLB 3OAUL 4LLAA 3IJYA 4JVWA 3ESVF 3T1WA 3AU1A 2QLVB 2BNQA 3O2DA 3ESUF 3ZL4L 2VUOA 3DRQB 1YN7B 2ICWB 1MEXL 35C8H 4LF3B 1G9ML 1OSZA 5C86A 1HHJB 1AHWC 5C9KA 2I9TB 4XP1L 3ROOB 1OAUH 4MJ5B 5B38B 2JJSC 5I30L 2R15A 2ADIA 3VXQA 1RUAL 5I74B 4DEPB 5IK3B 3B83A 2NW2B 2XKNB 5F7DA 5BVJB 1GRWA 1I3RB 3NIDF 3P3YA 2GUOA 1R3KB 1RVFL 2ID5A 3RVTC 3SDAB 2VQTA 5KSBE 3MOAL 3KXFE 3GSQB 5FM5O 4PJFE 5CFHA 1RMFL 4ZO6A 4XP6H 5TPWH 1K9TA 5JOPE 1FYTB 3RWGA 2IAMB 2V9RA 3ARFD 4JFQA 1RHHB 3IKKA 1UH3A 5F1OB 3BO8B 4G6JH 2D9CA 2EXYC 2NW3B 2NXYD 1I9IH 1BX2A 4MS8C 3MMEB 4KJWC 1JYXA 2PN5A 1KPRA 1H3TA 2VTFA 3ARUA 3W5NA 3WBDA 5K9KB 1F3JA 5GJTH 4QRPD 5M95B 5TE4L 4WW1B 4IIQA 3DRTB 1RZIA 5IVZA 2OR7A 2BOBA 5SWSB 4UOJA 1KBGH 4H5SA 3FT4A 3WN5B 2OL3L 4Z77A 1MIMH 4OV6F 5EPMA 1D5MB 2JK5B 3P4MA 4QHLA 4HCRH 2EYRB 4NT6B 1QBLH 2HVKB 4BH8A 5BO1L 3RNKB 2WWMD 2DQDL 2W38A 4UT9H 2W0FA 4Z7OE 4HX1B 5IB3B 5ESAB 5CEZE 4A6YH 4I5BA 3SKNA 3SDYH 1HHIB 5L2JB 5EC2A 4KI5E 1BFOA 4DKAA 3PHSA 3WL9A 1MCOH 2CUHA 4PJEF 1P7KA 3SDXA 3DXAA 2DQUH 3O4LE 2J8UB 4YNYB 1FZJB 3KPRB 1A3LL 4R4NC 2MQCA 4TTDC 1AFVH 3WJJC 3GBMH 2BSRA 3KPOB 1DANU 2RFXA 3QJFB 4UQ3B 4NUJB 4Z6AT 4P2OB 2BSED 1J8KA 3OXSA 2AJYL 4ZAKB 4ZFZA 4JFXA 4XNYH 3WEXB 4M7KL 5GGSY 3P0YL 3D85D 3ZKMD 1JL8A 1TZHB 3X14A 4BSWB 2V5MA 3R8BB 3L5WB 1JHLH 1MCJA 1RZ8B 4S1SH 5ALBH 3DYOA 3MRMB 1VGKA 5CUSH 4F7PB 3VXOA 5E5UB 5GS0C 1A1MA 1D6VH 4YXKH 4KJYB 4UT6H 5E56A 2FZ3A 2FRGP 1IGYB 3DMMC 3FB6B 3MV8B 3D2UD 5GS0L 5J57B 2ZUUA 5DRZB 1YZZA 4XP6L 3BN9C 3G04B 1XGUA 2MHAA 3F8UB 1YEHL 4WUUE 1RIVL 2HJLA 3BIKA 3CFBB 3WSQL 3QDJB 3DYPA 2R8SH 5EU5B 2BJMH 5IG7A 1KN2H 4JAMB 4BZ1H 4HGKC 2AGJH 2AJSL 5C6TH 2D2OA 5TH2B 1W0VB 1FVEA 4EXKA 3NIDE 4NZRH 4RA3A 5CKGA 4HKXB 1BOYA 5HHVH 3WFBL 1J1PH 4KI1A 1F97A 3W82A 1XIWA 4OF8A 1QFUL 4NFCA 2Q87A 5JORA 4U6YB 4I4WA 5GZOC 2DYPD 3SDXF 3KYNB 3QNZA 2W9DH 3SE9H 5ALCH 5E6ID 4HPYL 5T1MB 2ESVA 4U05A 1FSKC 1HEZB 2HTKC 5EBGA 3L9RB 3MUHL 1G0XA 3T0EB 4ZS7H 4PLNC 1XCQA 2HFTA 4PJAB 4BSVB 4YQXL 4HUXB 3VWKB 3RPKA 2ARJQ 1YNTB 5I76A 1TENA 2OR9H 2YPVH 2Z91A 3BT2L 2WW8A 3JTTB 3HZVB 1GGBH 4G8GB 1Q1JH 2QKIB 3QWOB 4JGUA 3QB7C 1WAAF 3VRJB 5LKNA 4LIQL 2QR0B 3A0OA 2HH0L 5CP3H 4PJ5A 5FUOH 1X5LA 3VWJC 3UMTA 3L3KB 1BQLH 1MCRA 1DANT 4QHKJ 4FQLL 2JJTA 3FQUA 3MLSH 3V6ZB 1CXLA 1UC6A 3LY6A 4PJEE 5E24E 1AD9A 3DROB 5IWLC 1WF5A 5KSBB 1A7QH 4PJFB 4FQXC 1HXMB 1PAMA 2CLRB 5I9QB 1FYHB 5HYFA 3OGCA 3OKMA 4BQ6A 2AXHA 4IRSB 1QFWI 5CINH 3V6BR 5EO1A 3QUXC 5LCVH 1FHGA 4ISVB 5ILTH 1UM6L 5B8CB 2BJML 4I18C 3RWCB 4BZ1L 1T21A 1BJ1H 4NN6B 5C6TL 2PCPA 2YRPA 1WZ1H 2E9IA 4Y89A 1BLNA 1I7TA 2VDNL 3SPVB 3O81A 1TETL 3Q6FB 1HQRB 2WIIB 3JWOC 4NBXB 4M6ML 2HRPL 4ZUTA 5CMAB 5D1XD 5FYKU 1D5IH 1HHKB 2DQJL 3GRWA 3MLXL 2R0ZL 1KT2A 2FGWH 4XPHH 3SE9L 3JWOL 2VL5B 3RY4A 4E42B 3G5YA 4GRMA 3LPWA 4PUBL 1UFUA 3PWNA 2IC2A 1CFSB 2I5YL 1FIEA 4AEIH 5D72H 1T2QL 3BDXA 1P5UA 4JFFD 5DZOA 3UTPE 1UWGH 5TDPB 1BOGA 4NDMA 3LQAC 3QAZB 3T2PA 1OCWH 3OKKB 4NO2B 1CGUA 3FO9A 2C1PB 5BZDA 2R1XA 3P9MB 1KFAL 3DXAE 4HBCL 4M5ZH 3SDXE 5DHVA 1I9JH 3BQUB 3O4LB 4G3YL 1FAKT 3LQAL 2DJUA 1IC7L 3MBED 1MCEA 1PLGH 1SM3H 3UXFA 2Q8BH 1DSFH 3DOSA 1BVLA 4O2FA 2V5TA 3IKCA 5EOTB 5EO9B 2BNRB 1KYOJ 2ED7A 4MYWB 3MV9D 4IDJH 3HB3C 4XCEA 4HJGB 4KVNL 2VKXA 3E3QE 4OZGB 1IAOB 5GS3A 4YXLH 2EIZB 3UEZA 5LGJA 4Z5RA 2IPTL 2R29H 4FTVD 1M7IA 3A67L 3V52H 4MZ2A 1RK1A 3MREB 1RSFA 2QADD 4CDHA 3DURA 1OAZH 3FN3A 3VFRB 1U92A 2E9BA 1WAAE 4GQ9H 4TPRL 4BK4A 3B2VH 3S88H 4CL7A 3FN0L 3K81A 3IDYC 5KVFL 2BDNH 2EICA 3DARA 4XC1L 1F4AA 1RPQA 4Y1AE 1JZ2A 3X12B 1I8LA 1YEKH 1LE5A 5IW6B 3PWJB 2VLKD 4KMLB 4KV5F 1YEEL 3DVGB 4QGTA 3NZHH 4OIIH 2XA3A 3EO0B 5IKCA 3GJFA 5ELIA 3TGXA 4L9DA 5ILTL 3VXUA 3FQXB 2X70B 2XQYK 5E4IA 2XICA 4RMSA 4UIMB 1F6AA 5DRXA 1CFVL 5BRZA 1BWMA 2ZKHH 1JPTL 5LBSH 5BMFH 4NO0D 1EEYA 2VITA 2NQCA 4KMQA 1ZSDB 1F4XL 1MCDA 2APXA 3VMOA 2I9LA 1LEIA 3U0PA 2J1KA 4JFHE 1A6UL 4R4FL 5F6HJ 1LK2B 4HT1L 5J1TC 5D7LD 4FFZH 1UWGL 2NY4D 2ADJB 1KCSH 1INQA 1GH7A 4PGCB 1LEGB 1OCWL 1OHQA 4XX1E 3W0WD 1O7VA 3J8F7 3B8SA 2EKSA 3CUPA 1TQCB 2G2RA 3UTSA 3IJYB 5KVEL 2NY2B 1NCAH 1KTKE 4MAUH 2Y72A 3CLEL 2FL5B 3VH8G 5F88B 3F6IA 1TJHL 4U6VL 1NAKL 1PLGL 2QL1A 1KCVH 4Q9BA 4M9OA 4OM1H 1OSPH 4YWGL 3EDDA 5E9DD 3WCYA 3V5DA 2ADIB 4HZLA 3JVGA 4PJEB 3U0TA 2F74A 4YHIB 4O5LL 1M7XA 2GUOB 3Q6GH 4DWHA 3CXDH 1OAZL 1NBYA 2EDOA 2PR4H 3IFPA 3S7GA 2IWGA 4XVUC 3SGDH 3VFTA 4ZTPH 4JFQB 5E6YA 2D7PA 2ADGA 3T4YA 1BX2B 4EVNA 3B6SB 2VLLA 2YC1B 5D7JC 4OZIF 1P2CA 1MUJA 3HRPA 3WNLA 4M5YH 4LOUC 1R3IH 1F3JB 4X4ME 4GAJH 2YUWA 4XCFH 1RZIB 3LRSA 3U36B 5IVZB 1O0VA 3IDXH 3TNMA 2YPLA 4H5SB 2FO1A 1INEH 1CT8B 4NN5C 1LHZA 4X7FC 1RJYA 2IH3B 1WICA 4L1DA 5C0EB 2E27L 5LBSL 1J10A 2VLJD 1EHLL 4XNZB 4BH8B 3O3DA 4R8WL 5C0BA 5GSRB 4ZPTA 3AXLB 4GH7B 4M62L 4FOMA 5T1KA 5F7KC 4PLKD 4TNWK 4JHAL 4G6MH 4ETYA 2Y6SC 4P3CH 3VCLA 1IAIM 5CCKL 1P7KB 3SDXB 3DXAB 5IW3A 2GTZA 4ODHL 5DF0A 4B7LA 4HKBB 2LV4A 4KQ4H 4HIXH 5D1QB 4FS0A 3TO4B 5ITBL 3GSNH 3QA3A 5MERB 1YEGH 4OF6A 2QBWA 2RFXB 3GB7A 1TJIL 3IRZA 3O6KL 4ZXBD 4M6NL 4JFXB 5BVPH 4NWTL 4EBQL 3X14B 4XT1C 1J9CT 5AAWA 1AXTH 5ICXA 3GI8L 4OCNC 1OGTA 4X6DA 3VXOB 5ITFA 3KG5A 3FT2B 1A1MB 3R0NA 3ARBC 5FA3A 3TN0B 2EE6A 2Y5TA 3L5HA 2DOCA 1NUFA 1OP3K 2FZ3B 1L4IA 5ICYA 1KACB 3Q6GL 3AROA 5IMOB 3VGHA 1NGQH 2V2XA 3ZTNH 3BIAX 1AHWA 3FO2A 4POZD 4W6WB 4EI6A 4GLRH 3V0WH 2DD8H 2FHCA 2YWYA 1MELA 4Y1AB 1JN6B 2JJSA 5J0BA 1Z0MA 2AXFB 3GSXB 1B0RB 3BIKB 1FLRH 2C3GA 5DQJA 1CICD 3DYMA 3B9VA 2CJUH 1KB5B 1DQTA 5DFVD 1H3GA 5FKPA 5C0AA 1IGJB 2XTJC 1S7UA 5IG7B 4OGYL 1KEMH 4U1HA 2FWOA 1FVEB 4HUUB 4M5YL 1TZGL 3BWAB 3L95B 4QXWA 5HHOE 4MQSB 5CGTA 4FXLA 2XY2A 2Z8SA 3MRLB 1XIWB 3MLVH 3INUH 1AE6L 5BRZE 3JWDH 4EN3B 4PRBA 4I4WB 2D7NA 5GGRA 5H2BB 4KFZC 5HGBA 2NCMA 4PJ8B 3U7WH 2CXGA 2OL3A 4HS6A 1MFDL 5DVMA 1ZLUH 1B2WH 4OZIE 4TUOB 1QBMH 2A77H 3GKWH 5AD0B 4FQQB 4HAGA 4OLUH 1CD9B 1XCQB 5I1JL 2EH7L 5I1LA 3U6RA 2WBKA 3G6AB 4UILL 4WFGD 3WNNA 2D03L 3V7AG 1H3XA 2EEDA 1AC0A 4AY0A 7FABL 3NBNA 2BOCA 5KSAD 2AJUH 3MACH 1LP9A 4RGNC 1WITA 4P23C 1EAJA 5EU6E 3O3BA 4LQ1A 3S6CA 1MFEL 1AO7A 4EUPH 3QFJE 4WFED 1ZEAH 3RIFK 2IPKA 5L8LB 5F1KC 1VACB 2BY2A 4Y2DB 3KDMA 4N8PA 2VWEC 3B2UD 3BPLB 3WJJA 1QLRA 1AD9B 4ONFH 4R9HA 3QWQB 4HW6A 4L3EA 2YHGA 4AENB 4NQDA 1UEMA 3QEUB 3QXDA 3E6FA 1X4ZA 4UV7H 3VE0B 4YHYB 4Y4HB 4MXVF 5HSFA 3FMGL 3V0WL 3S34H 3NVQA 1MCPH 3WNOA 3VD5A 3FCTA 1U8KA 1KXVC 3TYGL 3QDGD 1AGEA 2BMKA 2HVJA 2LTQC 3W81A 3ZT7A 1RUPH 5A2LH 2APWA 3EYOA 3H9SE 2HP4A 3FAXA 3DMMA 4QRSB 1RURL 2X4UA 2H6PA 4JZNB 2PCPB 3BD4A 4Y4KB 2XWTB 3C60C 5C09D 3SGEI 1FNSH 4K3EH 4LSUH 3HG1D 1KJVB 3NPSC 4ZUTB 2ICWJ 4OAWB 4MNQD 4DZ8B 4N0UA 5IHBA 2WNGA 2HYMA 1KT2B 1LP9F 2ZCLL 4FNLL 3G5YB 4GRMB 5DHXB 1AI1L 1CDJA 1YC8A 5E8OB 5C0BE 3SGKC 4EQ3A 3IDNA 4Y5XC 1JNLL 1FAIH 4X9BA 2H2PD 1QBML 4YBQC 4I0PC 4BSJA 3GKWL 1N2RB 3ET9F 4OLUL 4Y16C 3S35H 4MHHG 5CEYB 4LP5A 1BOGB 4X7TA 4XP5L 4G43A 4E0RB 1DBAH 3G6JE 1IAKA 2YD6A 5MHSD 2ZUXA 1RZJH 3QHTC 4PV9A 3HMWH 3K3QA 3KLHC 4OCWL 2EDTA 3HE7C 3SY0A 1TLKA 2V17H 2HLFC 5H8DA 1FFNA 3LEVL 5SWSD 3AUVA 4BFEA 1JTPA 4P4KD 4HMDA 1S3KH 5BXFB 3IU4L 1BVLB 1F4WL 1CZ8H 5GIRB 2GJ6A 4LK4A 1NBVH 4XC3H 3X17A 2P47B 3QIUC 1KENH 1ZVSA 4LVNB 4XCEB 1YY9D 5JDSA 3VI4F 5AYUL 2DQFB 3G5VA 4Z5RB 1DQLH 3EOTH 4L29B 5JLZB 3E6HB 1RK1B 4NBYB 5TGBA 1FDLL 1U92B 2ZOKA 5KAQG 2CRYA 5B21A 2VN4A 3W11C 5KW9H 1Y0LA 4UAOC 5ISZE 3VWJA 1LE5B 3PABB 1H3VA 2AV1A 3L7EA 2FO4B 5HI5D 5DS8A 3WKMH 1P4IH 4LCWE 4HD9A 5D70L 5IKCB 5IWLA 5F8RC 5C0NC 5C7XH 1G7IB 5EOCH 1OGAE 4H1LH 3KJ6H 3U4EB 1EVTC 4XP9L 5HHOB 3WO3B 1S5HA 4ZSOA 4HKJA 1F6AB 5K59F 3ULVD 4Z7WA 4YDLB 4K3EL 1CU4L 3VFGL 5BRZB 5DA0B 1EDQA 3PIQA 4N0CD 1JNNL 4OCSH 3AAZA 3ARSA 2DLGA 2XZCL 3D39E 2VITB 5JPMA 4I18A 3ARVA 1NLBH 4TVPH 1T6WA 3TBWB 5I15L 2IFFH 2MFNA 4OZIB 3D3VA 2CKBH 2ARJA 3OKOA 4PJ9C 4I3RL 4TOYL 3NAAL 2P8PA 5CWSA 3W5MA 2W65A 2Z35A 4JDTH 2P44B 4P46D 3FZUD 1CXHA 3CC5B 3LMJL 4Y2OA 4MGXA 2LU4A 5D6CB 4JQIH 3MXWL 2EKSB 3HMWL 1MLBB 2X89D 1LP9E 2G2RB 4WIQA 1FRGH 5KVDL 3HAEB 1CDIA 5SWZD 1CE6A 4R96B 5EU6B 1I9RL 2F54E 4HWBL 1NANI 2K1MA 1AQKH 1TPXC 3QFJB 1NC4A 4YFEA 4X6BB 3S8WA 2JCCA 3VXPB 2EDQA 1X5YA 1A3QA 2EDEA 1KENL 3HUJA 3O2WH 4WTWA 2AV7A 4NKDA 3CDFA 4P2RA 5L9DH 3VMNA 1RIHH 1FL6A 3ARWA 3U0TB 3O2VH 3MRQA 4XXDA 5LGHL 5DT1H 1WBXA 1D9KD 4MXQC 3IFPB 1SJHA 3LN4A 4EXPX 3WD5L 5KW9L 4PJBF 1TVBA 3VFTB 2NYYC 4G8GD 5E2UL 1X5GA 3RBGA 4LVOC 3C87A 5HJ3B 3PWUA 3FONA 2DQHH 3D1MC 3P4NA 4EVNB 1OD9A 1P2CB 3H9SB 4Y19A 5L6YH 3ZT6A 5EBMB 1FCCA 2ATKB 2GY5A 4L4VE 4LDEB 3W2DL 5DTFA 2PYEE 4YFLI 1I7RB 3HC4L 4YBLB 1LMKA 4HHAB 2WP3O 4M8QA 4OF5A 3OZ9H 4G7YH 2P24A 5LGKA 1MREH 4MB5A 5GRXG 4BQ9A 4GG6F 2VDLH 1JYNA 3D0VB 2DWEA 1JGVL 3EYUH 1RZFH 2B1AH 5C0BB 3KR3H 4BKLA 3ARED 4OB5H 4YDJA 3R4DA 5EWIL 5DMIL 1FNGB 4IRSD 3L7FB 2JCCF 4I48A 1PSKH 1MFNA 4PRHE 4YFDB 1MCKA 3HUJF 3L6FA 5K59E 2HWZL 4NRZA 5C0GA 1MHCA 1ZA6A 5TE7H 4OI9A 1CBVH 3MGOA 4QGYA 2F9BT 2YZ8A 1ACYH 2A9NH 2YR3A 2GTZB 5I1EH 1ZHBB 2VC2H 5FB8B 3MRFB 2OP4H 1ODAA 2EYSA 4LLMB 2EH8L 5BS0E 1SEQL 1VENA 3DECA 5KS9A 4F57L 5FYJU 1IGMH 5E1AA 4V1DA 5J8OA 5KVGL 2VIRA 2MPAH 3C08H 5IQ9A 1NMBL 3EIFA 5SX4H 1P1ZA 3LIZH 2VXVL 4ZO8A 3MBXL 2H26A 2H8PB 3D0LB 5D8JH 4GRLC 1OGTB 1SBSL 3PV6A 4OGXH 4Y8AA 5ITFB 5L9DL 2IALA 4Q7DA 4BFIA 1EK3A 2Y5TB 2C4FU 5FK9A 2R4RL 4PIRF 3T8XA 4QRUA 4Y5YC 5ISZB 4K8RC 4LCIL 4U1JB 1HINL 3HMXH 1KIUA 1LE9B 5DQDH 3PGDA 4R3SA 4NZUH 4R2GC 4P0DA 5FO8A 4LCWB 3UYOD 2HMIC 2F5AL 4K8RL 1KIQA 1E0OB 4OT1H 4QRRE 4RMQA 3WNKA 3S96A 2BNRD 4PLJD 3HNTH 5L88L 2FWOB 4XBGB 4JO2L 4YE4H 3PJSB 4LDOB 4ZSOE 5HPMA 1G7LB 1AQDB 2IMMA 2NY6C 2NY5H 2PO6D 3DX9B 4PJBE 2Y07L 1UACL 3SDDB 4PRIA 3QIWA 2PW1A 1A1OA 3BPCA 1A0QH 3NZ8A 5E8PB 3D39B 4JM4H 1VDGA 2J6EL 4X6EA 3UP1A 2O5XH 2VE6A 3ILQC 3EYUL 2ZWLT 5J9PB 2B1AL 1XF4A 5I1LB 1CK0L 4U1NB 1QSEE 5ICZB 4Z8FL 3U6RB 3SE8H 4GBXC 4OLXH 4GAGH 3O3AA 3PQYA 4TULL 1TVHB 3OL2A 1IJ9A 4PY7A 5EA0L 4O58L 3EO9H 2ZSWA 4MMXC 1CBVL 4GG6E 4I77L 1A6VH 2E3VA 4YK4B 5HDBF 3Q3GA 2P49B 1LP9B 3PP3K 3GSWA 1X7QA 3ARDD 3O3BB 5T3XL 2CSPA 2F54B 3B9KC 2XT1B 4R7DA 4M8VA 3MLTB 1HHHB 1S7SA 1IGML 5EZIH 3MRDA 2JCCE 1SJVA 1I7ZA 1MWAL 3P30L 1IFHH 3HUJE 3CDGB 1KPVB 2ZUWA 8CGTA 3KDMB 1JTOA 5KJRH 4M7JH 1QLRB 5GHWH 3WIHL 1KTDB 2NTFA 4ERSL 4HWZB 5DQ9B 4R97C 3KVQA 4YHKH 4L3EB 4W4OC 5GZND 1NAMB 2IBGA 3MA7B 1JFQL 4XCCH 4XPTH 1QFWH 3LKQB 2AJVL 1BJMA 4NJ9L 4P2QD 4J6RH 3K2UL 3BE1L 2DQIH 4UTBH 5IVOA 3L5JA 4YO0A 3CFKB 4WCYH 1A9EA 3HMXL 1U8KB 4P59L 3ARBA 4D94A 1TXKA 1AGEB 3HZKA 3X3GH 2HVJB 3C09C 4RX4A 3EYOB 1UEYA 2BNQD 4Y19E 4L5FH 4IMLB 3DMMB 3MQIA 2NY1C 4PJDA 4J23A 2H6PB 5HGDB 3WUZA 4L4VB 4MMZC 5IT2L 1FH5H 2E7BA 3V6OC 3QCTH 1M71A 3OWEA 2PYEB 3BEWB 4JPVL 3QPQC 1RY7B 4A2LA 3QHZL 2AJ3A 4TN9A 1T1XB 3MROA 2WV3A 1H9VA 5CSGA 4DW2H 2DI7A 2EDYA 3DI3B 3FQTA 5C0JB 4D2NA 3BHBA 3LHPH 4RWYH 4U4BA 5E6ZA 2XQBH 5F72S 5HD8C 5IMLA 4CMHB 5CJBA 4AIZA 5H35A 4OZ4A 4KUCD 4PRHB 3S98A 5DJAB 1JPSL 1JRHL 2X1PA 4H20L 4HJ0C 4YDKH 4OLXL 4GAGL 1IAKB 1FSKB 4PV9B 1A47A 2XN9A 1J11A 4KKLD 5A40E 1CTNA 3NGBC 2CPCA 3P73A 3HRZA 1QKZL 3SY0B 2N7BA 2VZVA 4M7LH 6CGTA 5IQ7H 2KDGA 2X5PA 2VAJA 4X0KB 5I0ZA 2EDXA 4KKCD 4OFYA 1QEWA 5BS0B 4Q6IC 1C5BL 1XFPA 3BKML 4CVXA 1BBJB 1P7QB 2BERA 4JY6A 1ZVSB 2AW2A 1ZHLA 5JDSB 3ZZ1A 5JQHC 2FECI 2E9JA 3G5VB 3LKRA 4P23A 1JMXA 3ZE0F 1ZLVK 5HHXL 1FFRA 2CH8A 1RZ7L 3V7AE 2QSTA 5HDBE 4KMTH 2X9XA 5TGBB 2D7TH 2PYFA 4J4PC 2ZOKB 4GSDH 4K94C 3D25A 1Y0LB 3GMNA 5IJVA 5KAQF 1PZ5B 1H0DA 2BVUA 4XPTL 3VWJB 3NCEB 3TPUB 3VH8B 4JG1H 3L7EB 4FMFA 1IGIL 2V7HA 2DQIL 4UTBL 2JIXA 1CLZH 1G7HA 3TVMB 4HS3A 2VMFA 2Z4QA 5TDOA 1NJ9A 4DKFH 4WHCA 4QRRB 2QQLL 4NNXA 4FQXB 4LSSL 3VFOA 3FFDA 2IG2H 3D6GA 1S5HB 3VXMA 1II4E 4ZSOB 1RFDH 1NGPH 1NLDH 2AJXH 2JB6A 3GHEL 1L6XA 1N6UA 4JLRB 2DQTL 3QUXB 3PIQB 4PJBB 4KRLB 3MV7E 5I19L 3KPSA 4DN4L 4KZDL 2DQGH 2PKDA 5DURB 1MJJA 4U7SA 3TBYB 3WHE0 4FQ2L 3C60A 4WWKC 2HKFH 1YEDB 4GW5B 3OKOB 1UVQA 2ARJB 1EBAA 2BY3A 2XQBL 3V5KA 4M61B 2HTLD 4WJ5A 3TO2B 1QYGL 1LD9A 3BW9A 4JE4B 1EO7A 5CWSB 1Z9SA 1QSEB 1UXSA 4POUB 3GJEA 3ZTJG 4TUKH 2W65B 2VXQH 2Z35B 1K6QL 4MNGE 3MGTB 3PQYE 2APTA 1S9YB 4F2MA 3OG4B 5KSVA 4Z9KB 3SGKA 4GG6B 2C5DC 2IANA 2NY0D 4Y5XA 1CLOH 5E03A 3SBWC 1ETZB 5CLTA 1T7ZA 1XIWD 4HIJB 2FSEB 3MRBA 5I1KL 1OVZA 3RAJL 1GIGL 5IQ7L 3CVHH 4DKDC 2DM3A 5D1ZB 4U33A 2E7LC 1FBIH 3ES6A 4ODVL 3X13A 4OZHA 5FYKL 4D8PA 1KV3A 2JCCB 4JDZA 2KQNA 4JCMA 3LAFA 2ESVD 3OPZL 4P5MA 1ZKAA 3HUJB 2IPUK 5HDQH 3HE7A 4NKDB 1PX4A 1ZAGA 4P2RB 1FJ1A 3L1OH 1CIUA 4PGEA 3SKJH 4FQ1L 1ZLSH 5EIIB 1U9KA 3MRQB 3LKNB 2N1KA 4M1CD 3NCJH 1WBXB 3AGVA 1H3PH 3MUGB 3STZA 1T04B 1ZLWK 3QIUA 5I1HL 3LN4B 5F7NC 2VQ1A 3T0AA 3WS3A 5DWUL 3LVEA 1AGFB 1TVBB 2OM5A 2FH6A 2QEJA 4S1RH 5JOFA 1WWBX 1LO3H 2A9ML 2DMCA 4Z7VF 3RIAF 4KTDH 4JG1L 3PWUB 4N5EC 3FONB 5FUZH 1BPVA 4NZTL 2BNUA 1C5DA 5GRVK 1Q8MA 3P4NB 5E2TH 4K71C 5C0FB 2A6JB 4Y19B 3ZE0E 2P4AB 3IDYB 4XMKL 4PJ5D 2CRZA 3TT1L 1CFQA 1NSNH 3GGWA 3LN5A 1TJGH 5E4EC 1DFBL 3N9GL 5KZCB 5DTFB 1LDPH 3IFLH 1ZTXH 4JPIB 1Q9LB 2QQNL 4M8QB 4Z76A 1NLDL 2AEPL 2A2QT 5C2UB 4LEOA 3TBVA 1E4XL 3JV0A 3ZKNC 4XBEH 1Y6MR 5HYJE 3C5ZC 4XBPB 2DWEB 1UT9A 5TF0A 4DJMA 5DD1L 4G9DA 2HJKA 2DQGL 3UJJH 1A1NB 2GKIA 4YGVA 2RIKA 4YDJB 2HKFL 4M9PA 3QRGH 3QXAB 1P5VA 2ZOLA 4Z7NF 4B0MM 4I48B 4L8CB 1N5YH 3DX7B 5C0GB 1T7WA 4NRZB 1RUQL 3QDMD 5F7UA 4ELMA 2H3NB 5A2IH 4XPBH 3CNKA 5CJOH 5K9OB 5GRUH 4MA3A 4PJ9A 4CMMA 1OAKL 1I4FB 1X4YA 1U6AH 1CFNB 3KLSA 1LO4H 3A6CL 3DUUB 2C1OB 1QR1A 1QLEH 3RI5F 3NFSH 1YQVH 5E1AB 4JFEA 4KHTL 4BUHA 5EFIA 1OP5K 1T1YA 2A73A 1ORSB 4JGJA 1FBIL 1L6ZA 2AP2A 1K5NB 4HWBA 3LS5H 2J4WH 4DAGH 4NRXB 2VZTA 1CLCA 3O8XB 3PV6B 4NHUB 9CGTA 5T3ZD 4BFIB 2JTDA 3DV6B 1TCRA 1DQQA 2XXMB 3QUZC 4NQSB 5FK9B 3JZ7A 4AM0A 3HCVA 5E08L 5TFSH 3WDJA 1IC4L 2ZNXA 3OR6B 1X5IA 2HRLA 4QRUB 2NNAA 1XF2B 4OKVA 2ENSA 5CAYB 2AAVA 5EC1A 1FO0H 3Q5OA 1DEEA 1CL7H 2UWEF 1VB9A 1VPOL 3PGDB 4R3SB 5DSCA 4WI5A 5FO8B 3D18A 4AG4H 1FZKA 3PUCA 1AR2A 1PEZA 1X5XA 3JBG7 5FYLL 1D5BA 1PQZA 2AVGA 2KH2B 4QXUH 1QBBA 4JQXC 2BFVL 4JY4A 2VSDA 4RISL 4QHMB 2FEDC 5FUCE 2DDQL 5F3HA 5DLML 1OAQH 4ELMF 5CSZB 1U8LA 4G6KL 2R2HB 5D7JB 3BPCB 2A1WH 3MCLH 4Z7VE 2ZNWA 2ZJSH 2VLRE 3MV7B 5DD3H 4AL8L 4RGOL 3ZE1E 2E6QA 2GK0A 4N90E 4DTGL 4QTHA 1ZWIA 4OZFH 5C08E 5J12B 4OFVA 1AKJA 1QR4A 2PXYC 3PP4H 1JNHB 3OAYK 1ADQH 5JO5B 2YD8A 1B0GA 2YD7A 1VKXB 4MNGB 3O3AB 3PQYB 1QHPA 1K4CA 4G6AC 2ZSWB 1QO3A 3S36L 3VXUD 1ZA3A 2FATL 5TQ2H 4C55A 3F12A 4LLUA 3AMKA 1XF3A 2P43B 4F80A 1I1YA 3Q3GB 5EZLA 4FG6C 3N50A 3VDAA 3M8OH 3REVA 1CDUA 1S8DA 1U6AL 5J6HB 2GITB 1MHEA 1JIBA 5F7HA 1YQVL 3H6JA 1S7SB 2X6MA 4H26B 3OHXA 5JXED 4Z7NE 3QT2A 3ARQA 4JO3L 1HDMB 1M05A 3TIDB 5JZ7C 4LMQE 1D5ZA 1XR9A 1QLFB 3ARGB 3V9FA 2NTFB 1QFPA 2DQCH 1OP3H 5M94B 4KK9C 3WHE1 1LNUA 1MRDH 1PZUB 5DMGD 3SJVE 1CGTA 3RJQB 1N7ML 3FQNA 5JW3H 3HE6A 2NZIA 5F1IB 3U30B 4CJ0A 5TFSL 1CFBA 4AQ1B 1ZT1A 3G6DH 1UCBL 5GISH 4QOKE 2X4PA 3VDBA 4ONGL 1JHTB 2OK0L 3KPLB 5FGRA 3UTSD 1A9EB 4M7ZC 3ARBB 4OQTH 3TYFB 2B7DT 1CL7L 3Q1SL 3H42H 1ED3B 2PUQT 3SGEH 2R1YA 3MR9A 3EHBD 4Q2ZB 5EBWA 3S3SA 4KK5D 5I73C 2XFXA 1AJ7L 4Y5YA 3VXRE 1IAII 3H3BC 4NNYA 1M71B 4LLDA 1VFAA 4YLQT 1UH2A 4EDWH 5EZJA 3MROB 4Q6YA 5L2KE 1C8PA 3FQTB 2UWEE 4OFPA 4XI5D 1KG0A 1OTSC 2DTML 3NCBB 5DD3L 2LU3A 3EYVB 5CILH 5I8CB 1BFVL 4I2XA 3EO1B 4PRPA 2J6EA 4IS6A 5LXGL 3ULSA 4HK0A 5FECB 4AIZB 5L0QC 5H35B 1BBDL 1RIUH 3PP4L 1L7IH 1DBBL 1CGSH 1PY9A 1U93B 1T2XA 4BUGA 3QJHB 4OD2B 2XN9B 1S9XB 4NKQB 4PJ7A 4QY8B 5TJWK 1KJ3H 5DJXB 1NCCH 4FMKA 3R8QA 1RUKH 2YPLD 5I1GH 1EEZA 4GBXA 1XGQA 4JFEE 4LL9A 2DLFH 4CVXB 4JFZH 4MX7A 4JY6B 4WV1C 5JQ6H 4CVZB 3JV4B 2O61B 3PDGA 5DUPH 2OZ4H 2XZQL 4KK6D 3UBXI 4I3GA 1IEAB 1MWAA 2JELL 3JV5A 5T1KD 3B9KA 4UDTA 3WS6C 5KTEH 2Z0BA 4EI5C 4F3FA 4O51B 3OB0K 2DKUA 3FQWA 3D25B 3WIHA 1QOKA 5INCA 1H0DB 3T2NL 1J0KA 3MJGX 3G6DL 1S5IH 4RFOH 4X80H 3IF1A 5BOZG 2I60L 3DX8B 1G7HB 3MRJA 4HS3B 2Z4QB 5TDOB 2IFGA 4W4OA 1KEGH 1T89C 4NKMB 1EX0A 3WO4C 3HMXA 3BWUC 1N4XH 4NNXB 1GJIA 3FFDB 1P4BH 5TDNA 1MHHA 3NOIA 4WY7H 4FQCH 2ZUTA 5AZ2L 4OI8A 4HFUH 2A0LC 4JGMA 5TQ0H 4D9RD 4Z7VB 1V3JA 3KPSB 2VLRB 1MPAL 1X6NA 4OGZA 1MJJB 1T66C 3BSZH 1DL7L 2YMXL 2GAZB 2KPNA 4RIRA 3RUGA 5DJDA 3BRFA 4WEBL 1DQML 1F13A 4JQVC 5C08B 3V5KB 4R26L 1MIEH 4MCYA 4HFWA 4ZFGH 2FGZA 3B3IA 2VJXA 2P5EA 4LSVL 5K9QI 1UXSB 2EYTA 2NTSP 4ODUA 1RZKC 1OARL 4KZEL 5C0AD 1T5WB 5GGTH 1NC2A 1RIUL 1RU9L 3ZMRA 3RVTD 1CGSL 4WO4B 4NOFA 1FORH 4LFHG 5KSVB 2D4FA 4OLWL 1B90A 1RZKL 4DEPC 5I74C 3LDBC 1NANH 4OLYL 4I0PB 3ULVH 3MRBB 4LCCC 3BKJH 4Y16B 2EXYD 3D9AH 5DRWA 2HJFA 4TSBL 3FO0H 4MS8D 1Y18A 3ES6B 4D8PB 3UC0H 1W0WA 5CIPA 1QRNA 4MVBD 1CQYA 1XGYH 3HE7B 1Q0YH 4U1SB 3RDTA 2BVQB 3QUMB 1DP0A 1VHPA 4U1GC 2OTUA 4XAWL 4Q6IA 3SJVB 3TZVB 1HH6B 6FABH 1C5CH 5EO0B 3W9DB 3E2HB 4P2CG 1RUMH 2G5RA 3QIUB 3QIBC 1OB1A 2FX8L 2VQ1B 3WS3B 5I1AA 3UPRA 4QOKB 3IVKA 1OTTC 1EJOH 2VABA 3RA7H 2BNUB 1C5DB 3F5WA 1FNEA 1OPGH 5F7YC 2VLME 2X4RA 3GHBL 1KIRA 1AO7D 1G84A 4KKNA 2HN7A 3HA0A 3KHOA 4UAOB 3C5SA 2CDGA 3ULUE 1N4XL 3LN5B 5JHLL 3VXRB 3REWB 5BJTA 1YQ2A 4NNPL 2QHRH 4Z76B 4WW2F 3BXNA 2XWBB 4WY7L 4LEOB 3TBVB 4LDLB 1I8KA 1DBMH 3MRRA 5L2KB 3QUKA 2UWEB 4NQDD 4KRPC 2HJKB 3BSZL 3WLWC 3OKNA 3MSPA 1MJUL 4DGVH 1MRFH 4ALAH 4DCQA 4P2OC 1QQDB 4NCC1 1RJCA 4ODTL 2R4SL 4W6XB 4I13B 3U7AA 1MCFA 4Z0BL 4HEPG 3I2CH 4NJAH 5IHZA 3DMMD 4ELMB 3QCUL 4WWKA 3RGVA 2RR3A 3J7HA 2C3VA 5DD0L 4S1DC 3N85H 4PJ9B 5D7SL 4GAFB 3S97C 1QR1B 1YNKL 1L7TL 3H8NA 5F9JB 1J87A 5GGVY 3WE6A 5EBLB 4JFEB 1N6QH 1T1YB 5C0DB 3TEUA 1UGNA 1VERA 3UC0L 1Z5LA 1Z9MA 3SBWA 5E2VL 2GHWB 2VH5H 1Q0YL 2VR9A 1JMZA 4UTAL 1WC7A 4ETQA 4NKOB 4B5EA 5EG6C 1G1YA 4AM0B 2E7LA 1TPXB 1VGEL 5E5RB 2W07A 2MSPA 3RVWC 2R2EA 2BY0A 1WCBA 1EHXA 5EORH 5EC1B 3MRPB 3U2SA 2OTWA 1NFIB 1KCKA 3D18B 4UQ2B 4XRCB 4E5XA 5IMMA 3KPPA 1FZKB 1OPGL 2YPKB 4B50A 2GJ6D 5FHBH 3NPZB 4IOFC 1K8IA 1PQZB 2V9QA 3MOBL 4JY4B 2F58H 1CF8H 4UNVA 4P5KB 3OJVC 1AY1L 4YDIL 1RULL 2M1KA 4GW4B 3P77B 1MAKA 2WINA 4UUJA 1H15A 5CEZH 4E9LA 4TUJA 1T7VA 1YYML 4NO3B 4KHXH 1P69B 4RMWA 3PL6C 5I2IA 1A4KA 4Q74A 5A2FA 2CMRH 3V6OE 1UYWL 4HC1H 5FCSH 5I75C 4KDVA 1AKJB 3MRIA 5GGUA 3MOQA 1G7MA 4JFYA 2A6DA 1U36A 5IHLB 3C5ZA 1UM4L 3WFHB 3DLQR 3I2CL 4Z7UA 1ZA3B 3P4OA 3F12B 3ECBB 1XF3B 1I1YB 2P7TB 1UKTA 3NFNB 5EZLB 4IRJC 3GMMA 4XXCC 1PG7L 3KS0H 4JR9L 3HI6H 4HF5L 1WUNT 3O4OB 3C6LB 1BD2D 1I8MA 4Z18A 4YHNB 1FNLA 3DV4A 5L7XL 2IQAA 5C70A 2OMBA 4LSRH 2UZXB 5J4MA 4MD5A 4HWEL 5I9QC 3DUSB 2W59A 1F42A 1I1FA 2IF7A 5DJ2A 5DURD 1G7JA 1CD8A 3S3JA 1CVRA 1M05B 1T3FB 4E41A 5E2WL 3N0PB 1DBJH 5SWQA 3D3VD 1D5ZB 1HIMH 4HPOL 4HK3J 3LKSA 4GG8A 1MJ8L 1LNUB 4MJIA 2N4IA 2P5WD 2FBJH 4NN6C 1OY3B 4ODXA 1NCDH 3FQNB 5FEBA 3UDWA 1ZT1B 2ERJC 2P8LB 1ES0A 1LQSR 4HUWA 3WFDH 1XGTA 4GRLB 5DDHB 3I6GA 4NQXB 3QI9C 3QUZA 2CDEA 4YPGA 3DJ9A 2R1YB 3QEGH 4QKXB 5E99L 4FZ8L 5FYJL 4HMEA 1NC4D 3LEXA 3RX5A 1NQBA 1AXSA 1WEJH 1I3UA 1KGCE 3ZHKA 5DD5L 5HVHC 5AG9A 4P2RD 4R2GB 4Z7UF 2Z31B 3D5OF 4KI5C 3V8CA 5IV2B 1A7NL 1KG0B 2H32A 1CXEA 1IGFL 2DM4A 2G9HB 1WWWX 4JQXA 3HB3D 4KVCL 5B39B 4DVRH 3V4UL 1WIPA 3EOYG 4CADB 5JW4M 4PRPB 5I1CH 1YMMA 2YSSA 1R5WB 1FZMB 3ULSB 3SEPA 4DGYL 3QQ4B 4JKPH 5DEGB 3O2DH 4HQQH 3ROLB 4NQVA 1L9MA 2L0DA 3FB8B 3O0RH 1Q0XL 2VXTL 5I18H 4FFYH 4OIAA 1LO0H 2A74B 3BISA 3PP3H 2GCYA 5IGXL 4HZAA 4FXKA 2PXYA 3H7LA 4GBXB 3BDYH 1KJ2L 3LRHA 1XGQB 4NWUH 1CXKA 2A83B 2F19H 3HPJB 5JW4N 4JPKH 1PD6A 1RK0A 2OX5A 4L4TE 1MRCL 3MJ8B 1RD6A 3OQ3B 1KLGB 1IBGL 5HYQA 4MXWL 5HHME 1AGDB 5GGSA 1VFOA 5H37G 2WSKA 2YK1L 3RGHA 4WFFD 4JO1L 4G5ZH 1TFHA 1U8QA 3OKLA 3U9UA 4PY8J 1A6WH 5INCB 4M3KB 3QCVH 5D7IA 4UOW0 4J1UB 1JWUB 1C12A 5D2LE 1SEBA 3MJ9H 3UPCA 2ADFH 1F6FB 3RP1A 4KAQL 1HSBA 1F02I 3V4VH 4R97B 4QHNA 1UJTA 1BD2E 1Q72L 3CVIL 2H9GA 4PBVC 1KCUH 1NGYA 2XNAB 3P40A 3DVNA 4X7EC 1MAML 4GO6B 2HT2C 5C07A 4V1DD 3ARFC 5HHPB 3UO1H 4Q9CA 4UDUB 4JM2A 3MFFA 1QSFA 3VFPB 5TDNB 4F7MB 4F8TA 2K7QA 1G1CA 4NHCH 3EYSH 4YUEH 1MHHB 3C8HA 4YXHL 4WI6A 4FABH 3PDDA 4GXVL 3TT3L 2NY1B 4PRNA 3PWLA 5ETUB 2XWJA 2FD6L 1KOAA 2NY2C 3O45B 4DVBB 1K85A 4LHUG 5LAXB 3SKMA 3WMSA 4HFWB 3GMLA 5FHAH 4HAFA 2QSCH 1MCIA 2P5EB 4OCRL 2EYTB 4K9EC 4ODUB 1T20A 4OSUH 1NC2B 3GMQB 1TQBB 1DE4A 1WIUA 4WW2B 1J8HA 4Z7UE 3SOBH 2WWMC 1YUHB 1R3JA 1T4KA 3UJIH 3U1SH 4KROB 2BVYA 4K9EL 4PJGA 4XVUD 4CU6A 1CI5A 4ODWA 3CFDB 2LFGA 4K3DL 4D0DA 1F58L 1GVIA 3I50L 1ZT4A 5DK2A 5D7IF 5DRWB 1B4JH 2GK2A 2DMKA 2GJJA 3BP5A 3QIWD 4PRID 1Y18B 4EOWH 1OM3L 3EDFA 1U8JA 4PRAA 1W0WB 1QNZH 1J86A 5CIPB 4OD3H 4LASL 4F7TA 3TCLA 5MENA 4D0CB 1VFBA 2MCPL 4ZD3H 1A2YB 4O00A 3BP7B 4AYFA 1IM3B 4TSCL 2GI7A 3QBTB 1I7UA 4Q6IB 1R0AH 1OF2A 3U7YL 2ZSVB 2VZUA 2XRAH 1S7VA 4PBWD 1YEJL 3HC0B 3KPMA 4O02H 4WV1A 5HI3C 1OB1B 5IOPA 15C8H 5LWYH 5I1DA 4CW1A 3UTZA 2J8HA 4MAYA 1IZKA 4PREA 4JHWL 3MJ9L 1MFBH 4LARL 2ADFL 2VABB 1ZV5A 2R23A 4ELKA 1FIGH 1KELL 4I3SH 1B9ZA 3WS6A 1FNEB 1QVOB 2GQHA 4UU9B 2AI0H 4PGBB 1KIRB 4FZEL 1KCUL 4XNZC 4DQOH 2YD4A 4GKZA 5C0CA 4F33B 3IRPX 2QTEA 3QG6A 5BJTB 5FYLE 3H9YA 3EYSL 5F9OH 3OBAA 2AQ3A 1MCSA 3BXNB 1VEPA 2IBBA 3ARPA 3BH9A 4JREC 4TNWF 4ZUUB 3NA4A 4PJGF 1I8KB 3MRRB 1FGNH 5CJQL 2FX7H 2AK1H 5D1QC 5E2JA 3WUWG 5CD3A 1UXWA 3VD9A 2BVPB 3RL1A 3D69B 3IDMA 4DCQB 3IXTA 4X6CF 1IILE 5E6IC 3I85A 1HSAA 4UB0H 3ARBD 1U91A 4RX4D 1DLFL 4URTB 3LKPA 3BZEB 4OSUL 1JZ4A 5CKAA 3STLA 4N68A 4OD1L 3U1SL 4JQVA 3TN0C 1LEKA 3UZEA 4A2MA 3E8UH 3I3EA 4HIEA 3U79A 1U8MA 3MZGB 3VFNB 4V2CB 3T3MF 1HHJA 1J05B 2XTJD 2DLHA 4JANA 5DA4A 3MNZA 1T2JA 2ZCKH 1MF2H 1GC1H 4L4TB 1I1AD 5BQ7B 1J18A 1J0ZA 5D71H 2NW2A 2XKNA 4U1IB 2BRRL 3RWIA 3UTTE 5KANG 1PYWA 2HG5B 4LCCA 1BMGA 1R3KA 1SJEA 4ZD3L 1XMWA 5HHMB 1TZIB 2VB5A 3GSQA 3IS0X 1R0AL 1KB5L 4KC3B 5F89A 5HI4D 3SDCB 3LS4H 1IGTB 2XN9D 1WCBB 2IADA 4CU8A 4D9QD 3SGDI 1RV6X 5FKAB 3MA9H 2MJWA 2QQKH 4M1GH 1UWXK 4U7KA 5HGGS 3QRFM 4PJ8C 4X5WB 4XWGH 5IMMB 3KPPB 3ZKQD 3BP6A 3F6LA 3GRWH 1XAUA 1RHFA 3C5JB 3QIBA 3DRTA 5FO9B 1W8OA 1XH3B 3THML 3JWNC 2X1WL 1L0QA 3TBTA 1V7NH 3RIAK 3C2AH 1B88A 1J1OH 4FRWA 4X9HA 4RGND 1NPUA 4P23D 4S1QH 3S37L 2VAAB 5T3ZH 2JK5A 1NGWB 2WINB 3VG0H 1H15B 5DD6B 5F44A 1N59B 4TUJB 3NACH 1I8IB 4I9WD 2YWZA 1MCWM 1ZGLB 3N1PC 5E4EB 4ZFFB 1A4KB 3VJ6A 4HX1A 5IB3A 1MI5A 4NQCD 3T65A 5DHVH 3WIIL 5D1XC 1HHIA 4MLIA 1GHFH 2GFBA 1NKOA 5F7EH 5GGUB 4BQCA 5J1SC 1G7MB 2JIXD 4ZFOL 3WJLC 5T33L 4JFYB 1DDHA 2CLZB 1GOHA 3C5ZB 2J88L 3K4AA 1OT1A 4YNYA 1FZJA 4Y2DC 4Z7UB 2VKWA 3DGCR 4Y4FD 2EC9U 3ORJA 1ZT7B 3VXMD 4UQ3A 3QJFA 4NUJA 4P2OA 3CDCA 2W9LA 4U1MA 1GGIL 1I8MB 1LO2H 3WEXA 1OP5H 1GPOH 4HUMB 5EZOL 3DV4B 5CSBA 3VU2A 4BSWA 2IBZX 2IBZY 2IQAB 3MRCB 3CSYA 3QEQD 4YHYC 1RZ8A 3MLUH 4X6CE 4Y4HC 3MRMA 1I1FB 2X10A 4LAQL 5DJ2B 5DUBA 4F7PA 1NH6A 1G7JB 5IR1A 4UV4H 3C60D 3BPOC 4XPAH 4J3OC 4C56A 5SWQB 3PXHA 4KJYA 3RI5K 2VDQH 3LKSB 4GG8B 4K7FB 2GSGA 2NX5E 5JR1H 1IGYA 3CSBA 5JXAH 4XP4H 4NQEE 3MV8A 4ZTOH 2O5YH 3EBAA 3MODH 4ODXB 2VDOH 4ONOA 3GJFH 4Y4KC 5DRZA 3G04A 1GOFA 4LU5L 4LCUB 4EJ1C 1LO5B 2AABH 3QDJA 4NUGH 1CLYL 1XGTB 1ZXQA 4GLRI 3CZFB 2IAND 4IRZL 4QWWC 2O5ZL 5EU5A 3I6GB 4OM0H 2X4SA 5AG8A 4JAMA 4YZFF 1FV1B 2FIRT 3QUZB 4M1GL 3PWVB 4QLRA 5TH2A 3H3PL 4XWGL 1HZHH 1IAIH 3MNWA 4HKXA 5C0CE 1NEUA 1WFOA 4LSQH 5IEHB 2RHEA 3LEXB 1F8TH 2DQEH 4BYHA 5EU4A 4JHBA 3QPXH 4JRYE 4U6YA 3P0VL 3KWWA 1A14H 3KYNA 3HE7D 2VXUL 4DK3A 2HLFD 2JB5H 3HNVL 12E8H 3B9AA 3WIFB 1JZ7A 2BVOA 3FFCA 4KKAC 4R4BB 3VG0L 1HEZA 3PWPA 1WWAX 3L9RA 3KPNA 3RU8H 4AEHH 1S9KC 1N64H 4ORGB 3QIUD 1CG9B 3T0EA 4F15C 3DBXA 3Q48A 5ESVA 2WBJC 4G6FD 4HUXA 1OWRM 4U1KA 2YD1A 4P5TD 1GHFL 2BHUA 3K2MC 2VDKH 2X1OA 3EFDH 3JTTA 5ACMA 4NQVB 3HZVA 3CDYA 1IEBB 2QKIA 3PL6A 4PP1C 3VRJA 4CN6A 3O6FB 5FOJA 2NXZD 1Q38A 5SX5K 2GCYB 1DN0B 1NFDA 2OR8A 4FXKB 1IEHA 1DQDH 3OSKA 3KHQA 2J12B 3ZKSD 1TTUA 2DI8A 4JEGB 3IXAA 2EC9T 5C0ND 1KUMA 3AM8C 3OAZH 4XH2A 3L3KA 4GS7B 4PGDB 5IFHL 1R5IB 1RK0B 3GDBA 4IRJA 1X5JA 3VMPA 4ODSL 4XXCA 3UTTB 4BZ2L 5JHDE 3DROA 1RJZA 5D2NE 5A3ID 3QEHB 1NMAH 4KUZL 5F70A 5KSBA 3KXFA 3OKYA 4HS8H 3H7BB 5JR1L 4WFHE 1DVFC 3O9WB 1HXMA 2CLRA 1NDGB 3OKLB 5D7KE 3U9UB 2VDOL 1T03H 5D7IB 3WFEL 1HH9B 2OBGA 5C2BL 4ISVA 1I3VA 1NCBH 3STBA 5CD5D 2NZ9D 5B8CA 1MNUL 1ROWA 4QHNB