3K7UA

Structure of essential protein from trypanosoma brucei
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
QLQESGGGLVQAGGSLTLSCAASGRTFSNNAMGWFRQAPGKEREFVAAISWTGGLLFYADSVNGRFTISRDNAKRTVTLQMNSLKPEDTAVYYCAARPQGDYVTAHYDYWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a key interaction protein from the Trypanosoma brucei editosome in complex with single domain antibodies.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system, rna binding protein
molecule keywords Antibody
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k7uA00
4MQXD 4ERSL 2Q8AL 4P2RB 4G80A 3U7WL 5I19H 4Y2DB 2VLJD 3SQBA 4Y16D 4QOKB 1WV7T 4MHHI 4HXAL 4OF0A 2HTLD 1VFBB 5I1LB 4XCYA 4RMUA 2C4XA 1C08A 4JRYE 3QWOB 4ELMB 1IGMH 3PWNA 1G9EA 3OV6A 4KJYA 4DGIH 1NFDA 1PSKL 1RZJL 4L3CB 2A1WL 1LEGB 1B4JH 5KBNC 1UJTA 3ROLA 1DUZA 4HX1B 4OIBA 4WDIA 4L8DA 1S9XA 1MJUH 3MX0A 1ZHKA 2NXZB 2X4RA 2QQKL 1NGQH 1T2QL 2X4OB 3BPNC 1CFNA 5BXFA 1LE5A 5GS2D 4XI5D 3O4LB 1VFAA 4HJJL 5TE7L 4LHUB 4YDKL 3GMMA 3G6JE 4AYFA 6FABH 2MWCA 1PKQE 4Q0XH 3KXFD 3M8OH 1SJXA 1NLBL 3GSNA 3PP4L 1ES0B 2XKSA 2F53D 2H45A 3U46A 1T5WB 3T3MF 4ZFZA 1V05A 3G6JB 4GAFB 3QUXB 3T3PE 1LEIA 2OJEA 1QBMH 2JB5L 1HHGB 2CRYA 5SWSB 4EUPB 1A1OB 1XF5B 1NSNL 2L7JA 4JFXB 1FJ1A 2GT9B 1KXQE 4UUJA 3KPQB 4RRPG 5L2KA 1OQOA 2MKLC 3NTCH 2ZOLA 3MV7D 4MXQC 4LNRB 2OZ4A 4QRPE 4OZHA 4N1EA 3NCFB 2L7UA 2IGFH 3AREC 4NKQB 4PLOB 2N4IA 4WHYH 3MNWA 1TLKA 4V1DA 1MFNA 2IH1B 4IDJH 4NSKA 5DO2D 4KK6C 3L3KA 1LO4H 5DUBA 2WNGA 2VAAA 8FABB 1CFSA 1T0MB 1FDLH 1RURL 2I60L 2X41A 3HCVA 1FL5A 2ZWLT 3MRFA 3G6DL 2ADIA 3O4OC 4QRRE 4U05A 1CDIA 5I71B 3EYQD 3ZDYE 3X13B 2I9TB 2DI7A 5JZ7D 4Y5XC 2X4NA 4OZGA 5DI8B 4HWEL 2O61B 2OLDA 1NJ9B 1QHPA 3N85H 4GAJH 1JPGB 1K4CB 4NO0D 5IB2B 2X4TB 1KCUH 2CDGA 3T4AB 3F12B 1IBGH 3HC3L 3VFMB 1Z5LB 3TIEB 3AC0A 3QEQD 3DURB 5SX5K 3RUGB 2F53A 1S7SB 1A64A 3FB6B 5DRXB 3VH8B 1ZHLB 1YPZB 1A2YB 4XNQB 3TWCH 1BQHB 5FA3A 5LGJA 1FNFA 1A3LL 5I1CL 2HYMA 3IAQA 1HE7A 3K0WA 3GKWL 4LLMB 3QCTL 1UKSA 4X6FB 5CIPB 5DJXA 4NQDB 1OAZL 1J10A 5CILL 4DZ8A 4WUUB 4NQSB 4U6YB 3RPKA 2X1XR 1AR1C 3VGFA 1ERNA 3PGFH 2OTPA 3L6FB 3WV0A 4DKAA 3UBXB 1QYGH 5IOPB 4XPHL 1IMHC 4PJ8A 1W8OA 1N5YH 4HWBL 4FOMA 3RUGF 5E8DL 5TF0A 4OD1H 4AEEA 1N8ZB 1HWGB 3V95A 2H2SC 3ULVH 4QY8A 4P9HH 1BD2B 3BD4A 3T0AA 1WBYA 1I9RH 3O3EB 43C9A 5DJDB 4XBEH 3LRGA 1JV5A 3O2VL 2E9IA 1BD2E 5ANMA 3FB8A 2BXYA 3BKYH 2DQFB 5TE7H 1Q38A 4N1CA 1R5WA 4YUEL 3EOAB 2X89D 4UIKL 1N2RB 4JFED 3M8OL 1PX4A 2FIKA 2ZSVB 1ZAGA 4JM2D 4U0QB 4PJIA 1UQSB 1MIMH 3TH3T 4NSKB 5BRZB 3L3OB 4JB9H 15C8L 1MWAA 3T8XA 4H20L 3IXTB 1QEWA 3FB5A 4NNXA 1OAQL 3Q1SL 5JPMB 5T1KD 4M62H 4U1SB 3O11B 5GS0C 5DK2B 4GAYA 3WJLA 3KPTA 3C5JB 3LN5A 4FFZL 3IDGB 2L0DA 3LQZA 2VLLA 4PGDA 4DUXA 5JW4N 1A4JA 3BN3B 2KDGA 2YMXH 1RV6X 2GIYA 4S10A 5HI3C 4KRMB 1IC7H 4HPYH 3GSNB 2I26N 5EU4A 2AK1L 1TJGH 1VEOA 4AEIH 4M3KB 5HVHB 2X4TA 3TT3L 3ZE2E 1RUKL 4ZFZB 2AV7A 3UBXI 3INUL 1WZ1H 2R2EB 1GJIA 3BPLB 3MZTA 3UZEA 4OGAD 4ZUWB 2FYYA 1TMCB 3B6SB 5DUBB 4NPYA 4FFVC 1YMMA 2YD8A 1XGYH 1LO0L 4NP4L 4JR9H 4NCC1 1OF2B 4H26B 2IBZX 3QIWD 1DLHA 3S3PA 2IH3A 4MA7H 1OT1A 3P77A 5ELIA 5IB5A 4I18A 4JFEA 4H1LG 4LF3B 4RFOH 5C09B 5JQ6H 5JTWA 1JGUL 3OX8B 1XFPA 1G1YA 1JZ2A 4XI5C 1DQDL 1TVDA 1CZ8L 4HIJB 3FQWB 1OTUD 2QSTA 3U1SH 3RWCA 3TBTA 4LLVA 1HHIB 2MMXA 3A0OA 4XVUC 1MY7A 2ZUXA 3DWTA 4LIQH 3ULUE 4J6RH 1JPGA 1K4CA 1A6WL 5GGRY 3ET9F 1IAMA 5JW4M 2X4NB 3SOBL 4JFOB 2OXHA 4JRWA 4Z77B 5AD0A 2ENSA 1OGAA 2DM4A 4PYHA 4RA0C 5IGXH 1KB9J 3DYMA 3RTQA 5EULV 2DQIL 1V7NL 4OLUH 5ITBH 3B83A 4GO6B 3QWOA 5HHQA 2VLJB 2AERT 1LEGA 1IC4H 1YPZF 4XPBH 4ZS6D 3NOIA 1J0HA 5CIPA 2DLGA 5HY9A 1V7ML 2BERA 5LJYH 2FECL 3CFBA 4G42B 1CD8A 1L0YA 4OZHB 4OFPA 2B4CC 3QQ9D 3KYAA 3OHXA 4FQXB 5DJXB 4K23H 3QWRD 4NQUA 3TZVC 5A3IC 2FL5B 3CFKB 4GMTL 5KSVB 3U4AA 2EE3A 2APFA 1FVDA 5IQ7H 3F12A 4BFBD 2EIZA 2ZUQC 2WBJC 1RZIA 4OCYL 5CGTA 5LWYL 4BSWB 3O2WL 1TIUA 1LILA 3CX2A 4FXKB 3OR7B 4Q6YA 1MJ8L 5B8CA 2GUOB 5ISZA 4POUB 4ALAL 3HAEB 4JPKL 5CCKH 1P1ZB 1FYTE 4Y89A 3U36B 1U3YA 4HIHB 1ZGLA 2ATKA 3UZVB 4QTHB 1OAUL 4PUBH 1CE6A 4PJEB 1E6JH 5J1TC 4PS4H 3PDOB 3U0TA 4QKXB 2IPTL 3HUJE 1WISA 1F4WL 3HMXH 2J8HA 8CGTA 5EIQA 3D6GA 4K94C 5D96B 3WS3B 4TSAL 1YN7A 5JOPE 3AB0B 4M6AA 2EC8A 2J8UA 3LKOB 3SKJL 5C0AB 3HTLX 2DQGL 5HJ3B 3QFJE 2NCMA 5E7FA 5GS1C 4ZFOB 4G43B 4PPTA 4ZODA 1FZMB 2VUOA 3EFFA 3MRHB 2CGRH 5C08E 3NFPB 5SWZA 2SEBA 4RAVA 4LKXA 1P4BH 2J12B 2DD8L 2M8XA 2PTTB 1JUFA 5EBLA 1F2QA 4YXLL 3HNVL 5IB4A 5F6HJ 1FGVH 4K9EC 2B4CH 4P5TB 1HSAA 2A83A 1JTOA 4X7TA 2PXYB 4IRSB 2YXFA 2J8OA 1CR9H 1WIUA 2BVPA 5I8KL 3DVFA 4YXHH 3QI9A 4FQJH 3VRIA 1S5IH 2ZPKL 3LZFH 1QFHA 4RMWA 4DVRL 4ETYA 5IROA 3P4NB 1JMZA 2XXMB 2YUXA 3MLXL 4Z78A 3DRTA 3C5SB 2AEIT 1AC0A 4YDVB 4XNYH 4EI5D 2DWDB 4JDZB 2EDXA 4K3GA 2R0ZH 4OFDA 1FVDB 4FTVA 1TVBB 3CJJA 3DARA 2IPUK 3OJDB 5L2KD 3MRJB 1VGEL 4YPGA 2ZOKB 3O8XA 3MJ9L 4C83B 5C92A 5I76A 5I9QC 1F4XH 4P4KD 1F2XK 4GXUN 5C0JB 1R0AH 3QDJA 2DI8A 2VISA 2IAMC 2YPLD 3MZGB 2VDPL 4I4WA 3GSRB 3KWWA 4PGCB 2CKBL 3TIDA 3BKCL 4AJ0A 4LPXA 4U1JB 1EERB 3QULB 2XY2A 1OTSC 5F97E 3QDJE 4POYA 2F9BT 3BDXA 4QHMA 5CEXA 2FEDD 4QRPA 4PY8J 5T5NF 4LLAA 5INCB 4JDTH 2YC1A 3A6BL 5EH1A 5BZWB 3OB0H 4X6CB 3PWUA 1F4YH 1V8HA 5JLZA 1GOFA 3OR7A 4GRMB 43CAB 1T1YB 5F9OL 4XNMB 3MRNA 2YD7A 1G84A 1A7OL 3IFNL 1AR2A 1U8LA 3BDBA 3MLVH 3GMRA 4PGEB 1H8NA 3WL9A 3RA7L 4B53A 1X5IA 1DANT 1ZLSH 2FX9H 2LV4A 1J0IA 1JF5A 4EI5A 1J0JA 4IHOB 4L4JA 1GPOH 1LHZA 2VXTH 1S7RB 4OT1H 2PO6D 1E0OB 4TN9A 3CFBB 1RSFA 4PLKC 3EGSA 1F97A 5C3TA 1L0QA 2UZXB 2E7LA 1QNZL 4ZOCA 1HIML 2WMPA 1ZVYA 3C09C 4K7PY 3E3QC 2NLJB 4KZDL 5DLML 1JHKL 4NRYA 1I9JL 5L88L 1VSCA 1IL1B 3HRZB 4LPVA 4NZTL 1DQML 1UJ3B 1YY8B 4G9FD 3C5SA 4ETQB 3QEHA 1EEYB 2HLAB 1U8IA 3EKCA 3MTRA 5GJSH 3X12A 5JMRA 1SYVB 2Q87A 3MLYL 4HK0B 4NNYB 5IMMB 5GGVY 4HMEA 4ZPVB 5CD3A 1BHGA 1U41A 3RDTD 1CT8A 3LEVL 3LCYA 2B5IC 2BDNL 4QO1A 1KCKA 5ABDE 1YEGL 4MJ6A 1NC2B 1FRGH 1J9CT 5H35A 2MTPA 5DJZA 3QNXA 3CFEB 3DROB 4RAUA 4POZD 5GRJH 1BGXH 1SY6A 2YPKA 4GW4B 1HDMA 4NN7B 3MGTA 4UTAH 3MXVL 2W0FA 4M6NL 2WBWB 5I8OH 3PV7A 3AS0A 2I07B 4LBEA 2YA2A 3KPOA 2B0SH 3IDIA 1JVKA 3MJ6A 4AEFA 1AO7A 4W6YB 5D1XB 4WV1C 5J4MA 3ARFA 3DUUB 1FL3B 5GRWA 3IDXL 3O9WD 1UC6A 1ZT4A 5HTSA 4MNQD 3WFCH 1OAKL 4U33A 3ZKXC 1XZ0B 4ODTH 1A6VL 2B1HL 4HLZG 5SV4A 1I1YB 2YD4A 3IDYC 3VRIB 1AD9A 3BVNB 1MLCB 2EE2A 4APQD 4EVNA 4WFGD 4AMKL 5C8JB 5KN5A 3TN0A 2IJ0C 4LQ1A 2V5MA 2JELH 2OP4L 2PETA 2VE6A 3BGAA 3L3KB 4NC2B 4QEGA 1E27A 2VL5A 5D1ZB 4L9LB 2P24B 4KTYA 4LVNC 2XYCA 2OMNA 3T0ED 4QRPB 2A9NH 4N8VB 2PTTA 4ZTPL 2D03L 2VXVH 1C08B 2ZG1A 1P7QD 4JANA 3FB7A 1UA6H 1Q72H 4YBHA 2EYRA 4OKDA 4YZFE 1G7IB 4PJFE 5D4QA 3TIDB 2IG2L 4LLMA 3CIQA 2HFFB 4S1SH 5TH2B 3S4SB 1NGYA 1VACB 2LU3A 3KLAA 3VG0L 5IEHB 3QCUL 4CADB 5GIRA 2JJSC 4JQVC 4N0CC 4XNUL 3NIFF 3KXFB 2ED9A 3DPBA 3AAZA 3MBEB 2VOTA 1OT2A 4H0GA 3BYYA 3N06B 1INDH 3QNZA 3H0TA 4KPHL 4C4KT 4D3CL 4U4BA 3JV4A 4PJHF 2YPVL 1N4XH 2C3VA 5H37H 3WEXB 2IPKA 1HHKB 4YBQC 1ULVA 5E56A 4J1UA 4PR5A 5DRNB 4LCWD 2HJKA 3B9AA 5B38G 3MV9D 1Z6JT 1UACL 5LGHH 4K3EL 3VDCA 2NZ9D 1M1SA 5GJTL 1NGWB 3KGRA 4X80L 5D9SA 1JTPA 5ETUA 4OT1L 1EVUA 4O00A 3BJLA 3D69A 5F96L 3P4OA 5DUPL 2ESVB 3ZTJG 1FAIH 3ZL4H 5TPWL 3GSQB 4XCYB 4JZJC 3NBNA 2I9LA 5TFSL 4OZFB 3WE6B 3QHTC 2Z31C 4F7EB 1AKJD 3RWHA 4YFDB 2DM2A 4XCFH 1S9WA 4ODBD 4GG6E 2A0LC 4M8VA 3KPPA 2JKXA 2IANB 1HOCA 4YGVB 2WUCL 4IM8A 5A2JH 2WUBL 5C86A 1X44A 3IDIB 1ZA6A 4X6DF 2MQCA 4WTWA 3HZVB 5H94B 5B22A 3MV11 2DMCA 2NY6D 4M61B 2XA8L 1M05A 5I66B 2I24N 4XPTL 5FV2A 5LGKA 5DDHB 4NZDA 3B2VL 3VXMB 1REIA 2W9EH 4P4RA 1BEYH 5EOCL 4JFFD 4KI5E 1TTFA 3T08A 4DK3A 5ISZD 1D6EB 1A0QH 1D5IL 5I18L 1P84K 3PWLA 1CLCA 2VDKH 1KJVA 5D8JL 2BNRE 1F3DH 3OSKA 2HRLA 3QDAA 4U7SA 3WHE1 4N0FB 4ZPVA 2V17H 5CD3B 4MS8C 1CI5A 1RUAL 2DYPD 4NKMB 2O61A 3H9SB 1YEEH 3PHQB 4GMSH 1FGNH 3KYNB 5EB9A 1DQTA 3IU4H 3MRDA 3TT3H 3I3DA 5DMKB 2OCFD 2Z35B 1UJ3A 4TPRH 3MA9H 4KHXL 5F89B 4ZUUB 1UZ8A 2IH1A 1N64L 1D9KB 1YN6B 1WWWX 4R3SA 3L6FA 5D70H 3UJJH 3QXAB 4XZUB 3FQUA 3D0LA 4EXPX 1EAJA 4X4ME 4FQCH 4XVTH 1IQDA 1UFUA 1WFOA 5H2BA 2MJWA 3KPLB 5ERWA 2D31A 1U8MA 4BYHA 3QT2A 4X5WA 3DECA 5C0GB 4K23L 1QLEH 5EC2B 1W72B 5FHBH 1MJ8H 1FO0B 5E8OA 4P0DA 2V2XB 1HINH 1RZ7L 4JGMA 4F9PA 3W39A 5DTFA 4MJ6B 4PJBB 3LHPL 2F19L 3MCKA 5JORB 4XX1E 1WSST 3WHXA 4DVBB 4R6UA 4CMMA 3LAFA 1MCNA 4BFIB 5HYJE 3VWKC 4N0UB 3EDKA 3BQUC 4PV8B 1I8IB 3QI9D 4PY8I 2BMKA 4KKNA 4Z7VB 3O3EA 2UY7A 2X1PA 1LGVA 4JO3H 4X7SL 5JIPA 1L9NA 1CLOL 2W07A 1CIUA 3DV4A 1R5VB 4OLXH 5TE4H 4Z7NF 1V5JA 4PJGF 4OF7A 1T7YA 2PXYC 3GMQA 4YXHL 4WNQA 5KOVC 1QO3A 3FT3A 5KANG 1T4KB 5BRZE 1RZKH 3KYMA 7CGTA 1CVRA 5IBTH 2WQRA 4YWGH 5HVHC 5EO1A 2OS7A 5EZJA 3MRCA 5KSBF 4P4RB 4PJ7B 2XTJB 3RJQB 2DQGH 1QEWB 3FB5B 4G9FB 2VQ1B 1CDGA 4JAMA 4W81A 2V17L 4R4NC 4JFZH 2YPLA 3CD4A 3T0EB 2HLFD 3FN0L 2DWEB 3FONB 1JGEB 4YHMH 1PX3A 4FTVE 4N90E 5AUMA 1VADA 4K3JH 4WTXA 3ZHLA 1KG0B 4JG0L 5A2LH 5GGUB 1N26A 1DLHB 1R3IL 5TE6H 3F7VA 4IOIA 5HI5C 1X5ZA 4X5LA 3JWNC 5BQ7B 4HT1L 4WWKC 5IV2B 5IEKA 3P4OB 5GRYA 3SE3A 4JDVB 4L9LA 3LQAL 1FVCB 2N1KA 4K71C 1G0YR 1UXWB 4JPKH 5HHQB 1S9YB 4X4YB 4D9LH 1J5OL 1D9KC 3QDMB 4J7RA 1ND0B 1YMME 3U7YH 5EUOB 3DVNA 4M02A 4FABH 4EUPH 3U7WH 3ALPA 3EDDA 4MA3B 4S0SD 4QOKD 1E28A 3EO9L 4JKKA 4OLWL 4ZUSB 3D1MC 5FB8B 4NUJA 5I8EB 3C2AL 4CN4A 1RVFL 2CJUL 3W0WD 5J9PB 1XF2A 3DV6A 4OGXL 5H37G 1RHFA 5ESQA 1FE8L 2OMBA 4BELD 1I1FA 1JRHI 3G5VB 4N1HB 2DBLH 1BOGB 3QIBA 1MF2L 2NX5A 5ERWB 2VLKB 4P2CG 2R4RL 2HT3C 4J3OC 2V2WB 2YD2A 3RVXC 3MOBL 5IJKA 4MNGA 5LBSH 4FQLH 3QUXC 5DMKA 1UT9A 4Z0XA 4QHKJ 4G8GE 1FG2B 5GGTL 3D2UA 2CRZA 4GS7B 4S2SB 3SO5A 1U3JA 5C09D 2I5YH 2Y9RT 3C09B 1MOEA 1XF3B 5ISZB 4W70A 3B5HA 3U4EB 2VSDA 5GXBB 5D1QC 5F44A 3TNNB 5FO8B 5IB4B 4X4XB 5C0CB 2BRRL 4PBWD 1IM3A 1NC4A 1M7XA 3AS3A 4QNPE 1U95A 2P8LA 4Y88A 5DK0A 2DWEA 5C0GA 3WO3B 3RA7H 4HKJB 4I0KA 4LCWB 3EAKA 12E8H 4QOKA 2EC9T 1ONQB 2V2XA 1GHFH 1E4JA 2OM5A 1EHLH 3FOMA 1NUDA 5F7DB 5CFHA 5TDPA 2LABA 3ARFD 3BH9B 2VDRL 4H5SA 4NZJA 5J13C 3PP3K 1MCRA 4EZMA 5HY9B 1QR4A 5KW9L 4RGMB 3NIGE 3ROOB 3OAZK 1JHLL 3SDCD 1HH6A 4Z78B 5SX5H 2BC4B 2ATKB 1I4FA 5IFAH 3GMMB 4GAGH 3HC4H 2EEDA 4M7KH 3VE0B 2IFFL 2G60L 3HZKA 3HUJB 5ECJE 2AABH 3OKKA 1K5NA 4YXKH 5I17B 3HUJF 2B2XL 3BP6B 1MELA 3IDMA 5J0BA 1FFRA 4NN6B 2X4SA 5T3XD 2FDBP 1K3IA 2ICES 3QUXD 3C60C 1DSFL 4PJ5A 1DBML 2AJ3B 3F7RA 1PLGH 5E6YA 2YMXL 4XMPH 1ZEAH 4M7ZB 2ICEB 1DL7H 1BWMA 3PJSA 3KPMA 2B39A 3WFDL 3Q3GA 4AH2B 3K81A 4KRLB 2NY2D 4OCWL 1BAFH 3VWKD 1EDQA 4ELKA 5D1QD 3TPUB 1ZHBB 3D39E 3PWVA 1CXKA 1LEKB 2DQCL 4MA1B 4U1LA 3CMOL 5EBMA 4N68A 2E7LC 4KVNL 4DZ8B 4KUCF 1YEJH 4JM4H 1QVOA 4N0YL 1HXYB 1W0VB 5BW7C 3CVHB 3GM0A 3V9FA 2APWA 4NN5C 4Y1AA 3D0LB 5CBEA 4OM0L 5JDSB 5MEOB 3MRJA 4OFYA 5TDNA 1UVQB 4Y4KA 5HHME 3MRCB 3IDXH 3TYFB 4OF3A 1D5MB 3RWGA 3V0AC 4F9LA 1CTNA 1WEJH 3NACH 3QUYA 1T5WA 4HQQL 1HQ4A 4KRPC 1PD6A 4WO4C 2BNQA 3H3PH 1Z9OA 3PWUB 4LSVH 3KNBB 4S1QL 4KGLA 3SDCC 4NQCE 2DB8A 4LPYA 5EOQL 5E03A 4PJBF 2DRUA 4PRIA 5A2IH 4PRHB 1WFTA 4F33B 1DN0B 3FFDA 4GAGL 4M7KL 4NN6C 2Y72A 3BAEL 3S98A 4ISVB 1RUMH 1YEFL 3HG1D 1EAPA 4PLKD 3MNWB 4V1DB 1A1NA 3WYRA 1EBPA 1KEML 1CXHA 1KB5B 2YK1H 2VUYA 2HJLB 1BJ1H 1ZA3B 4GUPB 4CDHA 5DRWB 4E5XA 2XZAL 3HMWL 1G9MH 4DKEH 1BIIA 3BIKA 4P9MH 5JHLH 1A3RH 1N0XL 1KTDB 3OWEA 4RRPA 2VXSL 3BPLC 5KG9A 4FQHB 5E9DA 4M6NH 1J1XH 3GO1L 3LKSB 3QNXB 1JRHL 3UCRA 3FQNB 2YRLA 4XVJH 4YDVA 2A73B 1JGVH 1DL7L 4CNIA 3S88H 2R1XB 3RDTC 3RRQA 1CLYL 3LKNA 1HDMB 1DFBH 2H26B 3W9DB 4M7LT 5C8JA 2DYPA 3DOSA 1WBYB 2YD6A 3RTQD 2B1AH 2ICEA 4AENA 5AYUH 2VLMD 3MA7A 1NC2A 2WLYA 4KJWC 1VGKB 1Z0MA 1HHJB 1G7PA 5GGTH 4X9HA 1AXTL 5CJXC 2Y06H 4IIQB 3ABZA 1EJOH 4FQ1H 1JHLH 4XP1L 3TH4T 5KW9H 5B4MC 4ONGH 3UZQA 2R2CA 5CUSL 1J8KA 3TBWB 4L29A 3AVEA 4KXZI 4BM7A 8FABA 3U1SL 2EDRA 4NCDA 4KROD 1DUYB 1P7KA 4KGJA 4RBPH 4YNYA 5DJ6B 4FQPA 6FABL 3FO1A 3Q5TA 5GZOC 5E95B 1KEGH 4AG4L 4HJJH 3CH8A 3ZKQD 5FA3B 4NCC2 1FGVL 32C2B 1BOGA 5C0IB 5DK0B 4G5ZH 1KPVA 1Q0XH 4MX7A 4PJ7F 3KHOA 4PLJC 1N0LA 1T22A 2D7TH 4XP5L 4MYWB 2W9DL 1GAFL 4XNXH 5J89A 4NZUL 2AQ1A 4P5MB 1ZVSB 2Y07L 4A2MA 4NZRH 2X2YA 4XNZB 5IHZB 4HS8L 3RX8A 3V6FA 1DN0A 3FFDB 3FB8B 1OW0A 4TPRL 1KLGB 2IQ9L 4FFWD 4I2XE 3QUKB 4HUNB 4UOW1 1QFUL 3KPRA 2ZPKH 3LZFL 3OKLB 1K85A 4LCIH 4PRHE 1ZSDA 1FAKT 1QSFD 3N1MC 5HYSA 5FYJE 1N0XH 3AREB 1SEBA 2VDQL 4M3JA 5K59F 3REWA 5IFHL 3CSYB 4XBGB 4OKVA 3RL2A 1TZHB 4NQSA 2BNQB 4U6YA 1DVFC 4YEFA 1V3KA 5GS0L 1ZT4B 3HRZA 5EU5A 5DJ2B 1GZQA 4KY1H 5MEQB 3BQUB 4U1HB 3P0YH 4R26L 3RWEA 4PRBB 3O2VH 4Y19B 5C0BE 5CGMA 4HFWA 2C3XA 3FFCB 5HGGS 4NQEA 3G9AB 4H88L 2WINB 3NCBB 5HGBB 3RWCB 5J6HB 3CVHA 1B4RA 2MHAB 3H6JA 1N5AA 1IAIH 1NDMA 5BO1L 4O2EA 5HXMA 4EI6A 1EGJA 4I0PA 4DN4L 5L0QB 1IC5L 2NPLX 4GS7C 2D9QB 5DJAA 1UEMA 4YLQT 4GKOA 1CBVL 4HS6A 1P7QB 2BSED 3I6KA 3BZDA 3MLSL 1QLRA 4Z7VE 5IMOB 3FB7B 5D1QB 3ARDA 4G5ZL 4EDXA 4F15B 4ISVA 4L4VD 1F6AA 2IAMA 3QQ3A 2NY1C 3JUZA 2A0LD 1FH5L 4F33A 4ZTOL 1IC7L 4OB5H 2AJ3A 2NW3B 4RGNB 4QHLA 4YK4C 1MCIA 3QCTH 2ZZUT 3CXHJ 2JJTA 5DEGA 1XCTA 5IVXB 3DYPA 4M6MH 5CILH 3U30C 1UWEL 3ARBC 3TWCL 4DTGH 5HSFA 4C57C 4D0CB 2YXMA 2NY5L 4TVPD 4ZQKA 4UTBH 1ZOXA 1KSRA 4K71B 5C0AD 1CK0H 4J8RA 4BQCA 1JTTA 1KJ3L 5K9JL 2FGWH 4Z6AT 4Q9RH 3GB7B 3B43A 3OKNB 5SWQB 3ARRA 4QXGL 5FO9A 5T1MB 4WI6A 4PBXA 1MFEL 3CK0L 4FQ2L 1WK0A 4HUWA 4GFTB 5EZOH 4GKNA 3RIAK 3WNLA 4CNIB 4YHNA 2DJUA 1SYSB 3SDDB 2YRPA 3SKOA 3ARUA 1SY6L 1GIGH 3HI6L 3VXMA 2NY0C 5LQBL 1I75A 1A14L 3O3UN 4NQED 3FN0H 3P73A 2W92A 5GRUH 5IMKA 1WC7B 3GMPB 5F7UA 2EO9A 3AS1A 4ELMF 1Y18A 4OQTL 3V7MA 2YK1L 2DI9A 1OARH 1IKFL 1IAKA 3K3QA 3UX9B 2BY0A 1WICA 2QQNH 5DZLA 2HN7A 3H9HA 4NZTH 5KSBA 4U2YA 3OXSA 2C1OA 4UMGA 2HJLA 3K74B 3LN4B 5H2BB 4GBXC 4NDMA 1D6VH 4QRPD 4IRJD 5GGQL 3DV4B 1T6VN 1G7QA 1YEHH 1HKLL 4JN1L 2IAMD 1FO0L 1YNTB 3U83A 1RJLA 1Y0LB 3VD5A 3QJFA 3MUGB 1VENA 4X7SH 5B8CB 1AE6H 5BW7A 3S7GA 4J6RL 1I3RA 1D6EA 2H41A 3I50L 1XCQA 4YHYB 5IB3A 1JJUA 4U1KA 4OBSA 4DFIA 5D6DC 1UCTA 2FBOJ 2VXQL 3GSNL 1LD9A 3CZJA 2UZIL 1HILA 1T80A 1G9NH 3WIIH 5BJTA 5SWZB 1IARB 2E7MA 4OSUH 4L8CB 4PJEF 3DX8B 3MV9B 1SMOA 3NZHH 3QUZD 1R24B 4MQTB 3CXHK 2BFVH 4X9FA 3OR6A 1WFNA 3P3YA 4KK9C 4LLYB 5DD1H 3D3VB 3IFOA 1HOCB 2EICA 1T7VA 1KJ3H 1YN7B 2PN5A 4MXWL 4P5TD 2Z9TA 3WD5L 5J6HA 1BZ9B 2GTZB 3GNMH 4NFBA 2Q8BH 1I3UA 5DMGC 3WUWA 1BQHG 1MFEH 4FQ2H 4YDIL 3MRKB 3RHWK 1VFAB 5DJ2A 2V7HA 5EUOA 4XTRC 2MOVA 4PD4K 3LPGA 5FKAB 1JGUH 1S9XB 3BHBB 5ADOL 3IGAA 5LXGH 4FZEL 5E1AB 4UIMB 1YY9D 4XRCB 2J8UF 3LPWA 3MRMA 5J8OA 3QRFM 1BECA 3VFSA 3L5HA 2FR4A 2EIDA 3L5XL 3O3DB 1JNLH 4JREC 5FDWB 3PWNB 1DSFH 1GHFL 4K8RL 1H3WM 3VW3L 2VAAB 1QNZH 4D3CH 2EEBA 2HTKD 4L3EA 5DJ0A 1FLRL 3TYGL 1N6VA 3W5NA 2OR7A 2QADC 3PG2A 4P4KB 3V6ZB 1T22B 3H9ZA 1D5IH 4KMQA 5KVGH 5D72L 1VKXB 1BQHA 4I13B 3OB8A 1MCJA 3ARED 4TSCL 4R7DA 1B6DA 4YR6B 3MRGB 2H3NB 3CH1A 3GJFH 4K8RD 2DDQH 3MRIB 5FOBB 2AKRA 3TF7C 4OFYD 4X9GA 3CU1A 4KJPC 4OLVH 1U8QB 5E6ID 2ID5A 2NY7H 4YFLI 1GC1C 4U1MB 1NCNA 5BV7C 1TJIH 4I0PC 2EXYD 5IQ9A 2OYPA 1GSMA 4XP6L 3GJFB 3Q6GH 3QPQD 3GRWL 4FZ8H 1YNLL 2AJXH 4G6AC 1UXWA 4KK8D 5DVMA 3GMQB 3AFLA 1QSEA 3WUWG 4LSVL 1NCDL 1U3HA 3UPAA 4O4YH 2OSLB 5T3ZE 5I75B 4U1GB 2A74A 5EPMA 4HKBB 2YPVH 5BCAA 5EZIL 5EWIL 5IMOA 4BFEA 4EKXA 5FYKD 1J05A 3ZYJA 4CMMB 4AEHL 3TGXA 4CJ1A 2Q6WA 5CEZD 2VR5A 1KN4L 3D3VA 4NT6A 4RGND 5KSBB 3LN9A 4YFEA 4HCRA 3ZYOA 2XN9D 5DVOA 3CLFH 4GG8B 3M17B 4UTBL 1RZFH 1CGSL 4JM4L 1LWRA 3KPQA 4JLRA 3L5WA 4WUKL 5LAXB 5T1KA 3V4VH 4ZD3H 2E3VA 3CMOH 5JO5B 1VGEH 2CIKB 4OD2B 2ZCHL 5IFJB 4OAWB 1MY5A 1ROWA 4NM8H 4NWUL 5GQBA 3V8CA 1KOAA 2YA1A 1QRNB 1XIWA 4U1HA 1A1MA 5DC4B 2GK0B 2LQRA 3JWOC 5I0DA 2PW2A 2UZIH 4HUWB 5E6IA 1F3JA 2BHUA 4LP4A 4XAKE 2ZSVA 4ZNCD 3VJ6A 5GRVK 4DQOH 5HGHB 5J11B 2RFXB 2VE6B 2O93L 3AM8A 4LLUA 5FUOH 3VXTA 3DUSA 4NJ9L 4PBVC 2P44B 3HNTH 4ODSH 3TA3D 2CDFB 1AIFA 3PXJA 4U6VH 4M1DH 3T2PA 3QNYA 3SDAA 4D9QE 4IRSC 4ZFOL 1NGZB 2FZ3A 1P4LB 4MHHG 4MAYC 4KK8C 2DQTL 1NLBH 5E8DH 1I4FB 3ZE1E 4EDWL 1FPTH 3STLB 4WUUA 5I1IL 3P11H 3VFGL 4DGYL 1MCWW 4LIQE 4Q58C 1NAML 3BW9A 5JPNA 2DMKA 5GS0D 3EYFB 1EBAA 2R2BA 2NY1B 4IIQC 3W82A 1G6VK 1L9MA 1ZWIB 3QFDB 3TO2B 4XCNA 3IJSB 5GGSB 4Z76A 2R1YB 4X6FA 2W9LA 1CU4L 5ACZA 1QG3A 1NCCH 4Y4HA 4BKLA 3QH3B 2QSQA 4K3DH 4XXDB 3WXVL 5E2TH 1YQVL 1U8LB 4OGYH 4E41D 3WD5H 4BQBA 2CDGB 4YX2L 3V79C 3EYVA 1R5IB 3KPRD 5HVFB 2DF3A 1A7NL 4FNLH 4Z7UA 4RA3A 5E00B 4HH8A 5MENE 3JVGA 1UM6L 4LEXH 3VFNA 4UIMA 4XRCA 4CW1A 4MXVF 1X9QA 2AW2A 2OJZH 4LLDB 5T1DL 3UPRA 3S34L 4KDWA 3UDWA 2IFGA 3OB0K 2FR4B 1MCOH 1CFQB 3KS0J 3P4MB 5C6WH 1YNKL 5F7YC 5IBTL 1CYGA 4Y5YA 1BMGA 4PJIF 1T1XB 4NWTH 4OZ4B 4ZFFA 5DLMH 3A67H 3TJEH 3RUGE 3PHOA 1RK1B 2V9QA 3UXFA 3MSPA 5DMGD 4U49A 1RZ7H 3GHBL 4M1GH 2HP4A 2E27L 1TQBC 1CICB 1QA9B 3P0YL 1LEKA 3S5LG 4WUUD 3BP5B 4P48A 3S4SA 2FL5A 3CFKA 2PW2B 1B9ZA 1R6VA 3FQWA 4KRPD 1VPOH 2FH6A 1U91A 2BVEA 2HVKA 2P45B 3QSKB 4KQ4H 4GRLB 1GGTA 1OQXA 4DKEL 5ID1B 3NIFE 2Z8SA 4GLRI 4NT6B 3MLVL 3ARBA 1PKQA 5TE6L 3TPUA 4AEIL 3S3SA 5HHMB 3KPSA 2P24A 1G7IA 1GOGA 1U8JB 3HB3D 1H3UA 1ZLSL 1OSPL 3T0DA 4CJ0A 2W60B 5ADPL 1YDPB 3GSUA 2CDFA 4LVOC 3ZDYF 4I77L 5IJVB 1RUQL 4PJCB 3P9LB 3REVB 5I17A 3CDGA 4HZAA 2KPNA 2ESVD 1VFOA 3VFSB 5DR5L 1KPUA 3RGVB 1I9IL 4C56E 5F89A 4ZUUA 4Z7VF 3B3IB 4Y5XB 3RNQB 3PNWB 3O45A 1GGIH 3MYJA 4UB0L 1MCBA 2AJZA 1A3QA 1C7TA 2EH7H 3QUML 5LCVH 1MAML 3L3IA 1ACYL 3QUYC 1YNLH 4V1DE 1MNUH 4RFOL 3K2UL 3LEYL 3NH7H 4N5UA 4K9EH 4AG4H 1D5BA 4LLVB 4RDQF 1MJ7L 2R23B 3GMNA 2VABA 3SBWA 2HKHL 1CZ8H 3BUYB 3QEUA 5L9DL 1HI6A 4X6DE 3NFNB 3VXMD 4QXTA 1QVOB 3Q6FB 1YEKL 4YBQD 4JM2C 3ISWA 5EU6D 4U31A 3C08L 4FS0A 2XQBH 4WRLA 3AMKA 2R39A 3IVKB 4RMVA 1OP5K 1BF2A 3NZ8A 4X6DA 3D9AL 1J05B 3DI2B 2ZUVA 3L3DA 3M17A 5DHVB 5E8NA 4L3EB 1CF8L 5CZKA 4YO0B 3QEGH 5JXEC 2VKXA 1NEUA 5IHUL 4EOWL 2D7TL 4OQ1A 1C12A 3H9SD 4WV1B 2XIDA 3WS3A 1ETZA 3EOTH 2PKDA 3VXUE 4IRSA 1W2KT 5L8KB 2GFBB 2PTVA 3LQMA 3PWJA 5C08A 3EYSL 1HN1A 1PDKA 3WLWC 5GS1B 3QQNA 1J11A 3EJJX 3M1BB 1ZGLB 4JVUA 5FDYA 1KCSL 4RWYH 4TULL 2WLZA 1FHGA 4JO2L 3DX7B 1C5BH 5FCSH 4MJ5B 2Z93A 2UY6A 4CVXB 2CO7B 1IGTB 1CGXA 4OIIL 3ZL4L 4MDJA 3O6FC 3BMVA 5HDBF 2PF6A 2H1PL 4K55A 3MLZL 5F1IB 4I0PB 2APVA 4L8SA 4FXGA 3GMOB 4JG0H 4X80H 2EDJA 5FK9A 1MF2H 3JV0A 3E1F1 4Q9QH 4LQFL 3VXOB 3SDYL 3HRPA 4LAQL 2D03H 2VXVL 4UUJB 4G80B 4P46C 2XTJE 4PREA 1N59B 1GZPB 4XPAL 2FEEI 3U0WL 3CGTA 4MD4B 4ZYKB 2IG2H 4PJEA 2YPLE 2WWMC 1VERA 5F1KC 3WN5A 4JZNB 3D5OF 2VQTA 3E8UH 3BI9X 2C7UB 4XBGA 3EBAA 2V5RA 1MCKA 1V3JA 3OJ2C 4JPVH 2CKBA 2CK2A 5HHOB 1I8KB 1LE5B 4WU5B 3D85B 2YUVA 1NCTA 3FCTB 1MFDL 2PXYA 2X4QA 4TNVK 4L1HA 2B1HH 3CVHH 1WIOA 4I1NB 4JO4L 3FFCD 2HT3D 1NSNH 4GRWE 3RVTD 4G7YL 4PG2A 3C2SA 3ILQD 2R0WH 3F7VB 2FBJH 5J1AB 1KJVB 1MCSA 4YE4H 4X6DB 1Y18B 5JQHC 1S7TB 4FXLA 4M8QA 5FYKL 4M4PA 1JGEA 4JHWL 5EC2A 4BQ8A 2XZCL 3SKMA 1NCBL 1QSFB 4O2EB 1IKFH 4MMXC 2EDEA 5FGBC 1S78D 1DBMH 3NCEB 2G75B 1DVFB 3EO0A 3PQYD 2R23A 1IGYB 2Y23A 4UI2A 3MRPA 4C58B 4UNVA 3NA9L 1I8LA 1IBGL 3GJFK 4CU6A 3D18B 3QXAA 3BFOA 5E08H 3IT8D 4FQCL 1WF5A 2BSSA 3ORJA 3FO1B 1AJ7H 3LDBC 4HWEH 1S3KH 1TCRB 2XNAB 1OWRM 5D6CB 2AJVH 1OGTA 5EOCJ 3NVQA 3QO0A 5FGCE 4MDIB 5INCA 4LPWA 4U6TA 3QQ4A 2D0FA 1LO3L 4M7LL 1P6FA 1UB5B 1NFIA 1BZ7A 2LE9A 3C6LD 3DX9A 1F6AB 4ZPTA 4JPVL 5F9JA 4TTDC 3TM6A 2BVYA 4GW5B 3SDDD 3HI5L 3BKJH 5DGRA 3BOVA 5DEZA 5DMIH 3GSRA 2HAZA 3KWWB 3GHEH 2XWJA 3IS0X 2IADB 3RL1A 3F58L 1WCQA 2WP3O 4O2CB 5I30L 4IRJC 3BWUC 4JO2H 3K2MC 4NRZB 4CKVX 1MWAB 2DQDH 3CDYA 4NHCL 2P5EA 3GMLB 3HPLB 3SY0B 5INDA 2DDQL 5T1MA 5FO9B 4GKSA 1IM9D 1OSZA 1NQBA 3ULVE 1QLFB 1FL6B 3EDEA 4QT5A 3F6IA 4CMHB 2ZUWA 3WL9B 4KKBC 2BNQD 2NXYD 3MUGA 5EU6B 1QP1A 5CD5C 2WW8A 3B4NA 4K07A 5C2UB 4MNQE 2AV7B 4JPWH 1TENA 1NPUA 4Y19D 4XPGL 3LV3B 4AQ1B 1MUJB 1CICC 4NKOB 3QP3A 1LVEA 2FYYB 5JLZB 5KS9E 2CDEB 5IG7B 4NO5A 1AHWB 2VXUL 1P7QA 4HJ0C 3CZFA 2E7BA 4HULB 3MJ9H 4I3SL 4WO4D 2E9JA 1JWUA 2X70A 5EO0A 5EN2A 3IDYB 4E0RB 3WFBL 4P2QD 4LVNB 1G6RB 3Q1SH 2Z0BA 2H2PD 4XPFH 2R0ZL 4Y7MA 4G7VL 3SDDC 5CSBA 5CSZB 4JHBA 1EEZB 4DGVL 5DFTA 1MIEH 5D2LE 1ZE3C 4QCIA 4F7CB 5CBEB 3C9NB 4W4OA 5IKCA 4GQPH 1C5CL 3RGVC 3AAZB 2LU4A 2VR9A 3NGBC 4I48A 3B8SA 1BGXL 4Y0GA 2P5ED 3G6JF 4X98A 1TXKA 4Z7QF 1KELL 5L88H 1J1OL 1GYAA 5TQ0H 4D8PA 4S11A 3G6AB 4WU7A 4XBEL 3CFEA 1INEH 3THMH 1CD9B 2NY4B 3CCHA 4U1NB 1QHOA 5MP6H 1CXLA 1KPRA 5DHXB 5GZNC 1RFDH 3MOQA 4LVEA 5D5MF 3U7AA 3MBXL 5EPMB 4OTXH 3QJFB 4I3GA 2WK2A 4KH2A 1QR1A 4JM2B 2HA1A 3WIFB 5K59E 4MCYA 5SWZE 5MEPA 3VRJB 2W0PA 4HKZA 3QXUA 1MFBH 3ULUC 3GK8H 3QIWB 1RJZB 3IFNH 1A7OH 3GIZH 3HZKB 4M7LH 4J3TA 2V2WA 1EXUB 3DO3A 5CZXC 5DK2A 4GRWH 4WI4A 4XWGL 1GAFH 2BCKB 2PCPA 1CLYH 1OP3H 2AAVA 2QKIA 3VG0H 3E6HA 3FOMB 3I2CL 2J88L 2AJSH 5F3HA 1MCQA 3RVWD 4PJ8D 2B0SL 2VO5A 3KPSD 3LRHA 5IJKC 4LEXL 5KSAA 5CZVL 4OQTA 4Z95H 3TBSB 1XCQB 4JFDE 5IB3B 5E99L 1KTKE 4X4XA 4F37K 2V9RA 3MR9B 2NY3D 4ONGL 3VCLA 1P5UA 1QZ1A 2O5XL 1RUQH 5AEAA 4JFQB 3BVNA 1P4LA 3Q0HA 4MB3A 5DFVC 2BVQB 4PS4L 4BH7B 2X89A 3KNBA 4KROB 4NHCH 4RGNC 1RVFH 2CJUH 2OTWA 3U9PL 3QHFH 1YECL 1NBYB 3S34H 1RZ8A 5JW3H 2R0KL 5MERA 4JJ5A 5JHDA 5L2KE 1JF6A 5E6IB 5SWSE 3QUZB 4C59B 4UT6H 4MLSA 3X14B 3OG6B 2C3VB 2EEAA 1AO7B 5D1XA 3GIVB 4U1SA 4XP9H 4HMCA 1NUNB 1YZZA 3VFUB 1A4JB 5F6IC 4L3AA 4QT5B 5F7HA 3QUYB 4Q6IA 4QYOB 1KPVB 4MX7B 2CUMA 2H9GA 5K93A 4PTUB 1BFOB 5EU7C 4Y2DD 4ALAH 4KK9D 2GTWA 2G2RA 2AK4A 3NN8A 5D7IF 2X6MA 3BD5A 1RI8A 5FA4A 1CFVL 4PGBA 1IGCH 4YQXL 1M71B 4ZAKB 4U0RC 4I2XB 4KVCL 2DJSA 4N8CH 4MJIE 3O3AA 4G7VH 3IF1B 4I3RH 1BFTA 5CGYD 4Z5RA 3RPIA 5C08D 2A6IA 4XGZB 5GISL 1S9WB 3MV01 4UV4L 5HBBA 4X7FC 2DJ4A 1QFWL 4N0RA 3VWJD 2F53E 1MAMH 4I18C 3ALXA 4RNRB 4LCCC 3DHJA 5CJBA 3UTSD 3BO8A 1C5CH 3OKOA 3E2HB 3U36A 3O4OB 4WIQA 4RIRB 2HWZL 1NGQL 1T2QH 2EXWD 3D39B 3W9DA 4NQVA 1OAXL 1MUJA 4NKOA 3FFCE 4R96B 1TPXC 5D7KD 5HGDB 3NACL 4UDTA 4P3CL 1TITA 2W91A 2A73A 3ARQA 3QAZC 4PRAA 3TEUA 4HGWB 3EJZD 5C2BH 4M1CC 5D7LD 3B2VH 2HFTA 3NCYS 1VESA 2VIRB 5K9OB 1MVFA 2VNCA 3MODH 1KJ2H 4U1IB 3V5HA 1T3FB 3F7PC 3NMEA 3DRQA 5IMLB 3MJ8B 4MQXC 1RIHH 4F57H 2GT9A 4XVSL 1G6RA 2VZUA 1PEZA 1F90H 3CUPA 1O0VA 4XPTH 4A6YL 3BWAB 1HKFA 5IHUH 2W65A 4U3XA 1EEZA 4TSAH 5F1NB 2AK4D 2H32B 1FCGA 1J87A 2NW2A 4TRPL 4EOWH 4HIIB 4KC3B 4ZSOA 3WFDH 1QYGL 5DRZA 2CQVA 3QG7H 3FQRA 1T1XA 2DQHL 1XR8B 2CXGA 1HINL 4M03A 3TV3H 4ODUA 1C1EL 2PXYD 2HFGH 2V5YA 1U42A 3E6FB 3S36X 3KPNB 2ADIB 4JY5H 3VGBA 3LEXA 2ADFL 4Z7VA 3UPCA 3BXNA 2JF1A 3VXUB 5T33L 2HKFL 2AEQL 1KPRB 4YXLH 4M5ZL 5FECA 4Z7WB 3FOLB 3L7EB 4M43L 2GSGA 2HRPL 2CKBH 1QPPA 3WHXB 3PDGA 2P48B 3CDGB 2IANE 4H1LH 2FD6H 1O7VA 2IBGA 1BJMA 3C8DA 3FO9B 5IESL 4PGBB 4LHJB 3SGJA 4ZO9A 5E8EB 5L7XL 5FM4A 4TUKL 4MXWH 4BA8A 4HCRL 4X5WB 2FLRT 4ODVL 3ZE0E 5FYKH 5CAYB 4GRLA 3PQYA 2XKUA 3LKOA 4U3CA 2J1KA 2YPLB 3OGOE 2GHWB 3V6BR 5C3LD 4WFEE 2NX5D 4R7NB 4OFKA 4U6HA 2VB5A 5ESVB 1T66D 3T65B 3ULUD 4AM0B 4PJDF 1FLRH 4HAGA 4BH8B 5EZJB 4X7DC 2ICWA 4RMQA 4DK6A 2BP3A 5IWLA 5IB2A 4YHNB 4IMLB 4XNXL 1CF8H 4PRDA 4Z7UE 3L5XH 4WHYG 1OAYL 3NFSH 3PNWA 5E5UB 3WS6A 4PRIE 1VCAA 3VDAA 4QRQB 5FF6A 1R5VA 2WANA 2WSKA 4P5TC 4KTEH 1FL5B 3FTGB 3MRFB 5I9QB 1NGPL 4KTDL 4PJCA 4GOSA 5D7KE 5MHSD 3VXSA 5DF0A 3B9DA 5E5MB 1Y6KR 5EBWA 3H9YA 5C0FA 5D5MB 4YH6A 3RWFB 1QTYT 5C07E 4Z8FH 1FZMA 3EFFB 4HS6B 3VXNB 4OLYL 5FIEA 1G7HB 3DGGA 3QHFL 3P9LA 3REVA 3TCXA 3DV6B 1EJOL 4FQ1L 4OD1L 4YO0A 1JGLL 5GGUA 5C07B 4APQC 1IAKB 4PB0L 2PO6B 5FB8A 5ESQB 2VC2H 3EGSB 4O51A 2VLKE 3LEVH 1DQQA 3GB7A 4IRJB 5IF0B 1ZHLA 1AR1D 2H9GB 1TJHL 1BOYA 5GRZA 3R1GH 4BSJA 4QXTB 3G5YA 2D7PA 1I7ZB 3MLYH 5JR1L 4ODWA 2R0LL 5F7MC 1D5BB 5HYJD 4NQVB 4UBDD 4Y19A 3BEWB 4Y16C 4EDWH 2ARJA 1DANU 4PJCF 2HTLC 4IOSD 3BPOB 3X14A 2N56A 2YOCA 5AAMA 3F65A 5C9KA 4D0CA 4N0CD 5KN5B 5JOFA 2C26A 3CLEL 2Y36H 3MUHL 4CVXA 5BZWA 2Y7QA 4CUCA 5ITBL 3SBWC 5CHNB 3MFFA 5D7IB 4KKAD 2VLRE 4LCCA 5I1IH 4ODUB 1NEZB 1YJDH 4TSBH 1TQCB 4ZDHB 3SOBH 5C08B 4HBCL 1DLFL 5F9AC 4KV5F 5E4EB 1MPAH 5F1SA 5D1QA 3PWPE 3G5VA 3T0XA 2B20A 3VA2C 3S37L 1P53A 1ETZB 2FGWL 1JHKH 5HVWA 3O41B 1DVFA 5KS9A 4YHML 5IW6A 1A7NH 1X6NA 4FNLL 5GS3A 4EN3A 2OTUA 4PJ5E 1SJHB 3BWAA 1D5ZA 3H42H 5F9WC 5AAWA 2XN9E 1JZ4A 1R24A 3N1PC 1XIWD 3STBA 1FN4A 1NMCB 1QBLH 1T3FA 3FT4B 5HHPB 2MCPH 5FK9B 1A7BA 3QG6B 2FRGP 5HI3D 4FG6D 2KBGA 1LD9B 3B9KB 2DAVA 2O26U 3UO1H 2K7PA 1SVZA 1HI6B 3G04A 5CWSA 1NJ9A 2E7HA 5ALBH 2WBJB 3LQAC 2COQA 4PRID 5F7KC 3TESA 2CR3A 4P46B 1NDGA 5DO2C 3WFHA 5F6IB 4DN4H 4MJ5A 1E4WH 4HGKC 5D71L 4F7TA 5D93B 2P5WA 4HWNA 1E27B 3Q5OA 1R3KB 4HZLA 1YMMB 3OF6D 3OKMA 4POZC 3N1QC 3SGJC 2NY2C 4KMLB 1KIPA 2ZKHL 4OUUB 4J4PD 1HYSD 3C8KA 1F3RB 1V3MA 3B5TA 4K2UH 3K8KA 3QUMA 4NC0B 3V4PH 3GJFA 2NZIA 2VZ3A 4ZAKC 1TQCC 4M9PA 4BQ9A 1RY7B 2KZWA 2XICA 4YIQB 1KB5L 2E8YA 1QRND 4YBLC 4R90L 4DWHA 5D8JH 4Y5YC 2NLJA 2IPTH 5CJ5A 3ULUH 1E6JL 3PXHA 1A3LH 1UM5L 3BESR 4R7NA 5F93C 4YDLC 1QBAA 1RIVH 1J0KA 2NTFB 1A1MB 1PSKH 1RZJH 3IYLW 3UTSB 3LS4H 1PBYA 2BVOB 2BSRA 4EN3D 2C1PB 5CKAA 3RJDA 3KLAB 2D4DA 4H88H 4U7KA 1IEAA 4XNYL 2VDLH 3GGWA 3TJEL 4XCFL 5GHWL 2ZUYA 2IQAB 1DBJL 1FP5A 4HHAB 3RDTA 3FO9A 2NR6D 4IRZH 3TNNA 3RWHB 1A4KA 1MJJA 4TUJB 5E5MA 2XPGA 3O6ML 4NO0A 5DJDA 4OCYH 3KPMB 1KTLA 3BPCA 4N8VA 4P99A 4QWWD 1JPST 5E9DE 3CSPA 1JNNL 3RBSA 2IPUG 1QSEB 4Q6IC 2YRZA 3DETD 4JFDA 3T4YA 3BRGC 1N7ML 2GJ6E 3UTZB 2OSLA 3PGDB 2RIKA 3IFPA 1A6ZB 1K9TA 4R0LA 1HEZB 1N3NB 3SQOH 4YAQA 4K8RC 5CBAA 4GBXB 3FQNA 2XKNB 1D5MA 4UOW0 1XR8A 1QSFE 3JV4B 3TVMC 5D71H 5JPMA 4OCXL 5I1GH 2E6JA 5E8PA 3UTQB 1A6AA 5I8KH 3MBEA 3EJYD 3EZJB 3RU8L 5BVJB 4BSWA 5IR1B 5JHDE 4QRTA 3RWGB 4Z76B 1QRNA 1QRKA 1K2DA 4FQHA 2R4SL 3IFLH 3MRRB 5D7JD 1OAZH 4MA8H 1VACA 3QH3A 2GI7A 2CIKA 2WBKA 3DO7A 3QA3B 4OI8A 2Q7YA 4TOYL 3VFWA 4ODHL 1EAPB 2WZPD 1ADQH 1AGBB 1UYWL 5L2JB 5DWUH 3R1GL 5J1AA 4Z7NE 1JGLH 2DLHA 3GSWA 2OTUB 1G7HA 3DGGB 3QHZL 4R3SB 4NNPH 2ESVA 3O4LE 1CWVA 2BFVL 3VD9A 1U3ZA 3V7AG 4F9PC 3P9WB 3FJTA 3QNYB 5AYQA 4JANB 4Z18A 2AJUH 3RIFK 5D1ZD 1XMWA 1RUML 1YEFH 5EIIA 4E42A 4OSUL 1JPTL 3N1FC 5ALBL 3LH2L 4JO1L 3SDAB 3OAYH 2NY6B 3NCMA 3WXWH 5MENA 1W72L 4QXUL 5CMAA 1UCBL 1FIGL 4NQDE 4Y1AB 4WEBL 4OGAC 2JLLA 4P9HC 1ZHNB 5IQ9B 4UBDC 1BFSA 5EU6A 1L7TL 2PYEE 1DQQB 2FO1A 2F54A 1VFBA 5FFLA 5EZLB 1I1AC 3BEVB 3PGFL 1FV1B 4LSUH 4KFZC 1EX0A 3MBED 5JO5A 5E6ZA 3QRGH 4Y4FC 4Y5VC 3F7QA 4KUZH 4XCNB 5GGSA 4I5BA 2AJVL 2X4PA 4G6KH 5EU6E 4DN3H 1U8MB 3NPZB 1GGUA 2EE6A 2J8UB 1WTLA 3I75A 2PW1B 1T7XA 1AQKL 1RK1A 2AK1H 5A1AA 4MAYD 4XZUA 3RL1B 2B1AL 3ZKSD 1ZK9A 4HDIB 1U58B 4HV8B 1AKJA 1JNHB 3T2NH 4MCZB 3WCYA 1ADQL 1DE4B 1MHCB 2C3HA 3PDOA 3U0TB 4UNTA 4PJFB 3WJJC 1AHWA 4XVTL 5GJSL 1KCVL 1P84J 1MCPH 4YHPA 1AIFB 1YUHA 5ACLA 3MNVA 1MJJB 2ZUTA 3W2DL 1BQLL 5DUML 3B9KD 4KJQD 1IC4L 1G1CA 2NXZC 1R5IA 5JDJA 2Q3ZA 2XFXA 5CINH 4M43H 2YBRB 1LK3H 1U8HA 4WI3A 2A77L 3ARDB 2UYLA 3AXLB 3TLRA 3W39B 2IQAA 4AK1A 4GRLD 4TQEH 4YGAB 1FNLA 1FPTL 2W9DH 2YUWA 4WEBH 5IP4A 4OD3H 3EW3B 4A6YH 4IHOA 5I8OL 1U91B 5BO1H 2X44D 5AZEL 1TTGA 3RWIA 1MFAH 4JFXA 3PV6B 2MFNA 5A3ID 3P11L 3MXWH 2WIIA 4YHZL 1GXEA 4ODHH 1TJGL 2VDNL 4GKNB 2GEEA 4J12A 3U46B 3CVIH 5D7SH 3VMNA 3KG5A 2R56L 3VFRA 2N7AA 3D39A 3QHZH 5JW5A 4MCYB 1ZLVH 2Q76B 5GHWH 4KKCD 4QHLB 4MA7L 5DVKA 1NFDB 2AXGB 3FO0L 3VXSD 1J7VR 4LGPB 2DQDL 3ZE1F 1Q9OB 1BBDL 1N8ZA 5GS0H 3AM8C 4OZIF 1I9EA 4Y1AE 1ZT7B 4X0KB 3A6CL 1QLRB 4NKDB 2WBJA 3EYOA 4R4ND 1DQJA 4U1NA 1H9VA 3E3QE 3EOBA 1B4JL 4WCYL 4DJMA 3QIBC 4ACPA 1J1OH 4G6MH 3SE4A 1TZIB 4LKXB 1GOHA 4IS6A 5E7BA 4NZUH 5DHVA 5F7EL 2ZG3A 4PJGA 2OI9B 1RK0A 4LPUA 4M5YH 2GJJA 4ESKA 3LH2H 4X6EA 3VWJC 4GBXD 3ILQC 4JFFE 3U2SA 4U6XA 3EHBC 3IXAB 4PLJD 4H25B 3BUYA 4JKLA 4LIQL 2GITA 1A6AB 2AABL 2Y07H 1T4KA 3P40A 5AZ2L 1MFAL 3PP4H 4O58L 1RJLB 3MRNB 4WI7A 4YAQB 4UDTB 4M9OA 5D7JC 3QXDB 2H6PB 1E4XL 1YY8A 2VDRH 5D2NE 4NQTA 3IETB 5DJCA 2YC1B 4JKPL 3W0WB 2ADJA 1UWGL 3D48R 1XGTA 5EUKA 2A6JA 5LVEA 1H3VA 3UAJD 5CZXD 1XGUA 1DVFD 5DS8A 2K1MA 1P4IH 5IJVA 3ROOA 1JPTH 2A6IB 4XGZA 1E4KA 1MFCL 2OJZL 2F5BH 3HI6H 4NDMB 3IDJA 2H3NA 3L9RB 5EBMB 3T65A 3MNZA 2GQHA 4EI5C 1NGYB 1GRWA 5KVFH 2W38A 3WSQH 4L4VB 4KUCD 3NAAH 1PGRB 3HLAA 4L3EE 1FC1A 3G5ZA 5FO7B 2NNAA 3HFMH 1T1ZA 4QGTA 1JZ8A 2QADB 4P4KC 1IE5A 5GGQH 2CMRH 4N8PA 1F4AA 3QR2A 1I8LC 3DHMA 4WEMB 3ARSA 2BZDA 3GIZL 3ILPA 1CD1B 4X0KA 3SCMD 1FNGB 3HNSL 2XZAH 1UWXK 5K9JH 3BT2H 3BAEH 3PIQB 3TCLA 1NBVL 3UEZA 2AJYL 4PRHA 2BSTB 3M45A 5DHVH 4PUBL 4YJZL 5C0AE 35C8L 4DTGL 4NBXB 4HK0A 1H3XA 2JB6B 1BVLA 5M7QA 5AWNH 4LASL 3KDMA 4PRDB 2NW2B 3KPNA 1NAMB 5B38B 1S9KC 5DURD 2EZ0D 3B9VA 1BQUA 2Z8RA 3V5DB 1PY4A 3BZFA 3TYFA 2D7OA 2NX5B 3PL6B 4R2GD 1M7IA 3BSZL 5DT1H 4KKLC 5DD1L 4WW2B 3HC4L 3PWPB 5KVDL 1KCSH 4RWYL 4ZXBC 2VLJE 3ARGA 3S88L 4MAUL 2G5RA 4PJIB 2FB4H 4X9IA 1GVIA 1KULA 2ZSWB 4JVWA 3TBVB 4F7PA 3ARTA 2I9LB 3WE6A 4YHLH 3LEXB 3RWDB 3NCJL 4WENB 1KLUA 3QDGE 3ZTNH 3C5ZA 3EOBB 2ZKHH 1JWSB 4RZCB 4N0FA 3IDUA 1A3RL 3QO0B 3H8NA 2ATPB 1OGAB 4UQ3A 3RVVC 4WJ5B 5C0CD 1RHHA 1PVHA 2B5IB 3RX7A 5FYLH 1R3LB 3SGDH 4K2UL 1JWMB 3QZWB 5EWIH 5MI0B 4CBPA 3S96B 5K9KA 3IS1X 3MV7A 4IDLA 1A5FL 3UTPE 3E8UL 4DKFL 3LKRB 4OJFH 1J1PH 5B39G 4MAYB 4JKPH 2IC2A 4Z0BH 5C9JB 1SBSL 5D7JA 3ARFB 4F3FB 3FZUC 4LASH 1FZJA 1UB6A 4F80A 4OFVA 4U6XB 4OIIH 4R7DB 4Q7DA 3FO2A 5IM7B 4ONOA 3HPLA 5KSAD 1B3JA 2AJYH 3MBXH 1J8HE 1CDYA 2ICCA 5ICZB 3ARGD 3BZ4B 1X4YA 4JY4B 1FNAA 2HVJB 5CJQH 3W5MA 1OP5H 5GISH 1OLZA 4OLVL 3VGAC 4G8IB 4ELME 1CG9A 4GLRH 2FECI 1F42A 2K7QA 4UILH 2VWEE 3OGCB 4G6JH 2ADJB 1MI5B 1Q9WB 5D1ZA 3TA3C 4IEFB 3RY5A 4NO5B 4P3DA 3KDMB 4F58L 1MRDH 1ZV5A 1DCLA 5HYSG 2QL1A 3P4MA 5FCUH 4DVRH 5MEND 5F8QC 3WSQL 3QFJA 1NANH 4FZEH 3O3BB 3E2HC 3FHAA 5CLWA 1AGEA 3BEWA 2XACC 2Y6SD 1Q9KA 3VXRA 5C71A 1F8TH 2CLVB 1BBJB 3DJ9A 5GGVH 4HIEB 1BLNA 1A6WH 1BWWA 3MLRH 4P49A 3ECBA 3CCHB 1QFOA 2LFGA 4GXVL 3ZE0F 1JZ3A 3MODL 2EIZB 4TNVF 1MCFA 4MD0A 3QAZB 3X3FL 32C2A 4XX1G 4WY7H 1NMBL 5ACZB 2D7NA 4JLRB 5LAXA 1X7QB 3VD3A 1B2WL 1TJIL 7FABL 3L3GB 5C0BD 4XWOC 3BRFA 4XBPB 5T3XL 5IFHH 4EUPA 3I6LD 3QIUA 3GRWH 4LRIA 1XR9A 3KPLA 5EOTA 1MEXH 1M7DA 4F9LC 2QQLL 5IW6B 3VXNA 1KIUA 4OM1H 4Y4HC 3GSVB 4OZHF 4QF1A 5ICYB 4KY1L 4HJ0D 3KYOB 1CN4A 2QLVB 5EO0B 2IALB 1GL4B 1A47A 1NCBH 2MSPA 5I71C 4AMKH 4DEPC 1A1NB 1D9KA 1YN6A 4LU5L 4AENB 3CFIC 1T1WB 4QOKE 3ZKMD 2OZ4L 4HWZA 1XF1A 1ZANH 2AV1A 1KCVH 1MCPL 1HHJA 3MJ7B 3C87A 4JQXA 5TGBB 3UTPD 5C0DB 3TCLB 1K4DA 1EMTL 3OTTA 4HPYL 2QHRL 2YN3A 2D0HA 4C56A 3MV8D 1F3JB 2A6DB 3ZZ1A 2HFEB 5ICZA 3ZKXB 3EYUH 4PRPD 1S5HA 5A2FA 3FRPA 4HPOL 4JM2F 3QXVA 4RWHA 1LO3H 5I1KH 1CG9B 2ITDB 2EH8L 1F00I 2C1PA 5HGAA 4LKCA 1FNSL 5C0RH 2EDOA 1RJZA 5I1HH 1KCRH 1RMFL 4PGZA 3Q5YA 4WW2A 1MREH 1HXMB 4XCCH 1SJEB 3V0WL 3EJZC 1EPFA 3IDNB 1WBXB 3UTTA 4AIOA 1JWUB 1UB6B 4D9RE 2LTQC 3BP7A 3ES6B 1KB9K 4O5LH 2Q20A 4N9GB 5KS9B 4XNMA 2C4FT 1GGYA 4HCRH 1BF8A 1Z3GL 2UWEA 2BX5A 3UTTE 1FG9C 4LHUA 2X9YA 4KAQL 1ZT1B 2J6EL 3MA9L 1VEPA 1CFQA 4KV5E 4ONHB 1HEZA 3D2UB 4NOBA 5BQ7A 3VD7A 1SEQH 4JQIL 3V4UH 3HG1E 3L3HB 1A7QL 1DBAL 4O02H 4XNZC 1JK8B 5DSCA 2RCSH 1AI1H 3I3BA 3ZYIA 3QCUH 2W60A 1ITBB 1FH5H 4ZTOH 4BZ2L 4LVHC 4WFFD 2FHBA 3KR3L 5DQJB 1GC1H 1KLUB 3RKPA 3MRLB 4PJ9D 3LN4A 5DEFB 1MFBL 5ENWB 4LSSL 4HWBA 1F8TL 3QO1A 2JJSA 3CX5J 3HR5A 2ZCLL 3LMJL 4ZAKA 3SDXE 3HS0A 3FB6A 3S5LB 1ONQA 2G2RB 5E2JA 4PGEA 1BFVL 3FRPG 3OJDA 4LLYA 4AT6B 4KI5F 1OD9A 1YEKH 4Q74A 5CEYB 1A9EB 1F4HA 3ZDXF 4WFED 5EFIB 4DOHE 1HQRB 1TZHA 3BP4B 3JWDH 3PGCA 1QO3B 1LDSA 1AFVL 4X6CA 4HQQH 1MH5B 1Z9SA 4RIRA 5CEZL 3RZCD 1LP9F 2LVCA 3V0WH 2JCCE 2P8MB 1T1YA 1AC6A 3IFPB 7FABH 5FECB 3O2DA 2WUBH 4HUUA 4GG6F 2CIIB 4LHUD 4EVNB 3BQUD 4N9OB 4GMSL 4OV5B 4JHAL 3RHWF 1UH4A 1UM4L 3UJTL 2FATL 3JV6A 1AO7E 2JCCA 1Q1JH 4PJAE 2NY4C 3MV8E 3RWDA 4H5SB 4WGVB 5JIKA 3HAEG 4L5FH 1INEL 4RFNC 5K33A 1JL8A 1YC8A 3NIDF 3QA3A 4QRRB 3BKCH 1MQKH 2JE8A 5CGYC 4LAQH 1U93B 2C1OB 3U30B 2GSIB 5F7EH 3PV6A 3OR6B 1M4KA 2EO1A 3GMPA 2EDTA 3C6SB 4TNWF 2KL6A 2B7DT 4GW4A 5EZLA 2X7LB 2FX7H 4NYLA 5F7NC 5I18H 3KS0H 3PQYE 2EXWC 3MLXH 2BNUB 1NCUA 1WLHA 4J8RB 5E8EA 1T2XA 2ESVE 4YUEH 1SVCP 2VL5B 5F21B 1OVZA 5DJ0B 4OZGB 2EDHA 2P4AB 4PRHD 1NLDL 1QKZL 3RVTC 3K2UH 4NOFA 2VN7A 1C5DB 5D7SL 5DQDL 1ZMYA 3VE0A 4MNHB 4LSTH 1XGRB 5D9SB 1WGOA 3IFLL 5L9DH 4HDIA 3QEHB 4Z77A 5AD0B 4V1DD 3IGAB 3T04D 4C4KO 1PQZB 3S8WA 1PY9A 1QPXA 3WN5B 1N5YL 2O5XH 1KIQA 2FWOB 2E6QA 2Y06L 2BSSB 5E94B 5JW3L 4P23C 1EHXA 3K80A 1TNMA 2YHGA 3HE7A 4AT6A 5JZ7C 2MCPL 3FQRB 1RU9H 3U2SB 3MACL 3H0TB 1EO8H 3HC0A 3ZT6A 4LBEB 4OCMC 5HI4C 5KJRH 3TBTB 3HE7C 3RVUC 4HWUA 1S7TA 1F6LL 2VH5L 3CFCL 1IM9A 4H25A 1BIIB 4FQJL 5B3JF 1S8DB 3F8UB 4B50A 4CADA 1IFHL 1ZXQA 2MPAL 2FIKB 5DEFA 5ENWA 1P2CB 3PHSA 5JIHA 2G5BB 4OCSH 4JRYD 3WJJA 3ULVD 2A6DA 5A43C 1IILE 2UYLB 3O6KL 3C5ZD 4FQLL 1JK8A 3BIAX 4BSVA 1YJDL 1JGDA 1A6UL 1FYTB 3DTXA 2JCCB 1YEGH 5DQJA 1KJ2A 3LKQA 1OPGL 1DQJB 4QHUB 4HEME 4ZFGL 1T83A 4TVSa 3T3PF 4NPYB 1KENH 4TUOB 3EO1A 4TVPE 1WZKA 3JWDC 5M94B 1G6RH 4JHZA 5FKAA 4J4PA 4Y19E 5F9WB 1CGYA 5C0BB 4J1UB 4I3RL 4HIHA 5BS0E 5DJYA 1KNOB 2I25N 3CC5B 4QHNA 5KVDH 1YECH 4H8WC 4JFOA 5DRZB 4AIZA 5DT1L 4JZJB 1NBQA 4EIGB 4LSRH 3IRZA 5ACMA 5AYUL 2XN9B 3OAYK 2ED8A 3AB0C 4KZDH 3V8OA 3WMSA 3AROA 2F58L 1UZ6F 3UC0L 3C9NA 4WI9A 2NY5H 1HIMH 2RCSL 3H2WA 2FB4L 5ILTL 4XB8A 4MAUH 1LMKA 1IEHA 1J12A 1E4WL 1CL7I 2FATH 4OIAA 4HG4J 3PABB 2GCYA 2GYSA 3HZVA 4IS6B 5H94A 3EFDL 1IGJB 4L4TD 5I0ZA 2R8SL 4CDGC 4D0DA 1IAII 4LSQL 1I1CA 1J8HA 5B3JE 1C16A 3K4DA 3U6RB 3S37X 1L7IH 4OCSL 1PW3A 4NKMA 1OTTC 2R2HB 3IAGC 3VXRD 2AS5M 1ZSDB 2NXZD 4IIQA 3ULSB 1NAMH 3JVGC 1KBGH 5EIVA 4JPWL 4HXBH 3CPLA 5DD0H 3ILPB 1HHHA 3GHEL 5I1AB 3MO1A 4JEGB 3T0EE 3MQIA 4A2LA 3BYTA 3C60D 3DLQR 2GK2A 3DETC 4YE4L 1WQVT 3WS6C 5TDNB 3JTTB 2SEBB 2Z92A 2QR0B 5I2IA 3VI3F 3KHQA 2VR4A 2VDQH 4ZFGH 4K94L 2ZNWA 3LD8C 5LQBH 4G9FA 3QISA 4OM0H 2DBJA 2R2BB 4JFYA 4PY7A 1NDMB 4B7IA 2QEJA 1LDPL 1YEDB 1E4XI 1OLLA 5F70A 1UGNA 3VFOA 5IESH 3G5XB 3QIWA 1RU9L 1H15B 3STLA 4G9FE 5D1XC 5HPMB 3F7YB 3MRQA 1WZLA 1T03H 2JB6A 1H0DB 3W0WE 3O0RH 1GZQB 1KPUB 2EKJA 3MJ9A 5I1GL 2APTA 3A6OA 1UZ8B 1A6ZA 3C8KB 5MERB 4NGHH 1P9MA 4I3SH 4XVUD 5DQDH 5IVXA 4RISL 4QTIH 4KXZH 1KJMA 1P9MC 2J5LC 1EZVY 3G04B 4C56D 1JMXA 1P1ZA 2JTDA 1SQ2N 4RFEA 5I74B 1MH5A 1D5XB 1OTTD 3HKFA 2XPGB 1A6TB 4NO0B 4PJEE 3GUTB 4TUOA 4PFEA 4QLRA 1ZEAL 5DDHA 4FG6C 1I7UA 1T5XA 1A21A 2G5BA 1CD0A 4Y2DA 1C8PA 3G08A 1P7HL 5AUMB 4Y4KD 1B2WH 3MREB 2OQJB 2B4CL 2FD6L 4KRPB 1RIUH 4WY7L 5GGRB 2PYFB 3EYSH 1UXSA 5ITFA 1GGIL 2GY5A 4BUGA 1B0GA 2BVOA 2BSRB 2XOTA 3SKNA 3S3JA 3SE8L 1LQSR 2R1YA 1LO5B 4MAYA 4X8JB 5T1LA 2H8PB 4YHIB 1KGCD 5J57B 1OCWH 1TVBA 3NABL 3WIHL 4CVZA 4X4ZA 3SDAD 3UYPA 2BY3A 3KLHC 3V5DA 2HT4C 3IKCA 5D2LF 3GBML 5E24E 3PL6D 4Y4FD 3KYMB 4LU5H 3TZVD 1F58L 5IROC 3QWRA 3TBWA 4XHJD 1U2HA 2XQBL 1AQDB 5DEGB 2DQJH 5BVPH 3O4LA 4JM2A 2AXFA 4N8VG 4PB9H 5H8DA 1SHMA 3SE3C 1G7JA 5KSUB 4ETQA 1EEYA 1C16B 3MROB 1P69B 4K8RH 2DKMA 2QHRH 1C12B 2ZNXA 3GKWH 3B5GA 4OCLC 4MB4A 4KRNA 1CR9L 4P3WA 4NC1E 4P5MA 2HVJA 5E2UL 5FKPA 4MZ3A 5FYLE 4LSPH 5A16B 3VI4E 2IMMA 4NQDA 1NH6A 3RKDC 3A6BH 1NL0L 5FYJU 4LCWA 5I1CH 3FQTB 1KACB 4Y5VA 1RQ5A 3QDGB 4BQ6A 3H3PL 4HWBH 4PJHE 1AXSB 4NUJB 4WHTA 5I2IB 3U4BH 2WUCH 1FLTX 1B0RA 4A6YA 4FFYH 1M7IB 4EIZC 3OKNA 4UV4H 2VDPH 2GAZB 1RULH 3U82B 2ORBH 4P59L 1UH2A 2YZ8A 3ARDC 1SMAA 1AI1L 4M00A 5DJYB 3T0VA 5FEBA 4JN2B 3R8QA 2R0KH 4L8SC 5CMAB 3BN9D 2Z91B 2BJMH 4QNPF 4D9QD 2WV3A 3OBAA 5E1HB 3BHBA 5EBGA 1K5NB 2Q86A 5KTEL 1MLCA 1LDPH 3NPSB 2X4UA 4X6CE 2Y1VA 1MSPA 4D0DB 1FYTA 4JB9L 4H1LB 3MV7E 4PRNB 1MI5D 2X5PA 3O2DH 4TUJA 3FT2B 5FUZL 1J8HB 2DICA 5HYFA 3ZDZF 1BJ1J 1XH3B 2VSCA 1OTUC 2BDNH 5IBUG 4CVZB 2VISB 3O11A 4JFYB 4G8GB 3SKMB 1RMFH 4JRXE 5SX4H 4K94H 5GSRB 5KOMC 4J3VA 4JG1L 1R3JB 2AP2A 5L6YH 1OGAD 5FOBA 2EH8H 1IRAY 5ISZE 2Z92B 1N6UA 3STZB 4JZJA 4WW2F 1T0PB 1FNHA 2FX9L 5FDWA 4WI8A 1KN2H 5DQ9B 3CVHL 5BVJA 5IR1A 2DTML 3AY4A 2VKWA 4M7JH 4HF5H 4NP4H 2X4QB 1M6OB 1EGJL 1XF3A 2PYEB 2MCG1 1AGEB 3TO4A 5F3BB 4PJXB 5IVNA 2EKSB 4TYUA 5SV3A 3M1BA 2KZ1B 4Y16A 4PYGA 3VXUA 2CRIA 4LCIL 3HR6A 1WTGT 4Z0XB 5J7CC 1EEQA 1T04B 1U8OB 2YKLH 3HA0A 3GBMH 4ZO7A 1JBJA 5KZCD 1KYOK 2VWEC 4U6VL 3P2TA 1MLBA 3Q2CA 4HIIA 4AEHH 1I1FB 2D3VA 1VKXA 5F9OH 4PJCE 5F8RC 4IOFC 3FQXB 1ZGLM 2G75A 4N9GA 3O2WH 3MJGX 3MRIA 5BJTB 1DQDH 3PQYB 1CGSH 1UENA 2XT1B 2OQJA 4JFHE 5E2VL 4YHLL 1PZ5A 3TNMB 3OHXB 4FQXA 1AY1L 1ZLWK 5HGAB 1U8HB 4LOUD 2AEPH 5AWNL 1AGCB 4M6ML 5IT2H 2VXUH 1NAKH 4QY8B 3VD4A 1A6UH 4IRZL 3VXQB 5TGBA 2FX8H 2HFGL 2V5SA 3FMGH 1H8SA 3H3KA 3BXNB 4ZPTB 3V6OE 1L4IA 4ODXA 3PF2A 3QQ4B 1J1PL 1WUNT 5C09E 1XF4B 1UM6H 1I7RA 2UWEB 3BJ91 4XPBL 4LLQB 3KPSE 2BHZA 3PL6C 1X5HA 3HFML 4ZYKA 1NMAL 3KLDA 2C4FU 2X1WL 3TJHC 2VDOL 3MACH 4HG4K 3IXAA 1MHEA 1OM3L 5BS0A 4IRJA 4NYLB 4FFWC 4JGJA 4TRPH 4M1DL 3EYFA 1HXMA 4X6EB 4OD2A 4MGXA 5IGXL 3RZCC 3LSOB 1J18A 3BT2L 4NRZA 3RNKA 1B88A 5A16A 3SO3C 3QO1B 4C56B 3CFDB 3H9SE 4F8QA 2YEZB 4XPGH 4QRRA 1EFXB 1S5HB 1FFNA 4YEEA 9CGTA 3RWFA 2FJGB 4YHYC 1HH9B 1CE1L 4F7EA 1KIRB 3HE6B 1TJHH 4PRNA 4HKBA 4YHOH 2N7BA 4LSTL 4PJDA 1Q9OA 5CP3A 3QDGD 4Z7OF 5I30H 3SHSA 2DTMH 4OV5A 1DQLH 1YYLH 4LOUC 4MDIA 5EBLB 3O9WC 3UYRH 3IETA 5DJCB 4I77H 3L5JA 2ARJQ 2EDNA 2IAND 3DGCR 3MFGB 3MRDB 1DZBA 3SJVE 1F11A 4FXKA 2BNRB 1B0RB 2ZP0T 4UAOB 4WFGE 1AQKH 1S7UB 1E4KC 4WTZA 5KS9F 3X3FH 4F8TA 4HXBL 2ZUSA 2CLRA 2NY2B 4K3EH 1FNEA 1RZGA 4Z8FL 4NBYB 2DMBA 4U1MA 5FGBA 5D93C 3WKNA 3MRHA 3BN9C 3TN0D 5EA0L 1NANI 3BGMB 3RGHA 3T0EC 3OAUL 3IJSA 2V6HA 3GI9L 1II4E 2XRAH 4WW1B 5EC1B 1JHTB 3KYKH 4YC2B 3I02A 2UV3A 2D31B 5FUZH 4FTVB 1ZA6B 5CD5D 2A77H 1N5AB 2Q7NA 4GQ9H 3D2UD 4FN0A 2BY2A 2ITCA 4KQ4L 4PP2B 5CINL 4KUZL 3QUMB 1CLZH 3FZUD 3Q6GL 4HKZB 3C6LA 5EN2B 1S7XA 5IIEB 3V5KB 4MD5B 1HKLH 4LK4A 4WVRA 4QRRD 5HHOE 4XXCC 3GNML 3S4SG 1IC1A 5IW3A 3GM8A 3DBXA 1PLGL 4P2QB 2Z35A 3QQ3B 4HFUH 1OP3K 4Y5XA 3ZLQC 1MRCH 2XA3A 2Y5TB 1VHPA 1IGFH 1DEEB 3BE1L 5J3HD 4LLUB 5F88B 4RGMC 5C0RL 3MA7B 4J3UA 1JUFB 3UPRB 2VDNH 1T2JA 3HCVB 1PG7X 3DTXB 6CGTA 3G6AA 1MREL 4Y8AA 3PGCB 5IB1A 1IKNC 4R97C 4EI6B 4MWFB 1HCFX 3ZSSA 4HK3J 5BV7B 1DLFH 5M95B 1U8JA 2NMSA 4G43A 4H0IA 5IVXE 1I9RL 1P4IL 4NRXA 3LKSA 4UT7H 4WU7B 1WEJL 1BBDH 4MZ2A 5HJ3A 4JY4A 5I1DA 5IW1A 2HVKB 3QZWG 5DYOB 2NTFA 1I7TB 1XGQA 5TDOB 3WN5C 5F3HB 3MUY1 1TETH 3O6FB 3QFDA 3TO2A 3HC0B 1JNJA 2Z31B 3HN3A 3PL6A 1FFOB 3VFPB 5BS0B 3P4LA 2AJSL 2CO6B 1DEDA 3QUXA 1EXUA 4YWGL 1LEIB 3ALWA 3U0WH 1NGZA 2FZ3B 3GDBA 3T2OA 2EZ0C 5MEPB 3VRJA 4FP8H 1FIEA 2ERJB 4ZFFB 2W9EL 1JNNH 5I15H 4KHTH 5CBAB 2KKQA 3T09A 4XVSH 1UH3A 3MMEB 2DQTH 2E5EA 5JQ6L 4DCQA 4BSVB 3EJYC 4MMZC 1KT2A 5E0QA 4NO3A 1KIRA 2XWTA 3V6OC 1RIUL 4LDEB 5JXAH 3X3GH 1BD2D 2F8VA 1UADC 2XTJD 1GGCL 3C5ZB 1CLZL 3RVWC 1MHPH 3UROR 1KTLB 3BPCB 2NX5E 5EZIH 3IF1A 3RU8H 1CGTA 3FONA 3VCLB 4D8PB 1RUPL 1WIPA 2HN7B 1FNGA 3H9HB 1A4KB 4P5KB 1UWGH 4EJ1C 3BZ4A 3HI1B 2R4SH 1WJ3A 2BVUA 3VFOB 4ZFOA 5E4IA 1M7DB 4ENEC 3TBYB 1DQLL 1YYLL 5HYEA 4KZEL 2YEZA 1FFPB 4APQA 2AEQH 3LS5H 4LNRA 4XMKL 3UP1A 2DWDA 1QFWI 4JDZA 1V7NH 1Y6NR 3VH8A 2OL3H 3G6JA 4WWID 4RMRA 5C9JA 3TA3A 2W0FB 1NAMA 5FGCB 5B38A 5D1ZC 5BZDA 4L9LC 1F3DJ 4U7MA 3ZKNC 1IGTA 3N50A 1YMHA 4KDTA 4XH2B 4NUGH 1MHEB 3FAXA 4MNQB 2YWZA 4KI1A 3DMMA 2AJUL 5DVNA 1IGCL 3DIFA 4TNWK 4OBRA 1X5KA 4ZQKB 5KVEL 2X4RB 5BXFB 4X4YA 5T3ZH 1CVSC 4NNPL 3S36H 1NUGA 1FVEB 1Z0NA 1G7QB 1U6AL 1U8KA 1JPFB 1MI5A 1Q9WA 2ADGA 4M48L 1EFXA 4PJ9A 4X99A 1UM5H 3I3EA 1QQDB 3UBXA 3GHBH 2IALA 4U0RB 1AFVH 3FHQA 5E6IC 3U0PB 1HH9A 4MA8L 1G9NC 4ZAKD 3WO4B 4PJ8B 3DXAD 3GRWA 2YD3A 4W4OC 4OJFL 4OZFH 5TQ2H 4XAWL 2O5ZL 4MA1C 4XP5H 4G9DB 5EOTB 5JXAL 4NJAH 1MQ8A 3CFDA 1OAXH 5FYJH 1SBSH 3PABA 3DUHA 4CRPA 5T33H 3MV9A 5CEZH 2Q7YB 4Z7QE 2AK4B 3NN8B 3GEWB 3VXOA 1PG7W 1JZ5A 2IH3B 4M6OL 3CH1B 4CU7A 2DOCA 4ERSH 4HKJA 4MD0B 2NZ9C 4OGXH 5CP7A 4ENED 3DROA 4P2OA 4RAUB 3OXRA 1G7LA 1LE9A 5DRXA 1QFPA 3D39D 4NHUB 3TO4D 2B8OT 4DN3L 5E8PB 3UTQA 3SQOL 1SM3H 4ZUWA 3K8LA 4Y8DC 1YNKH 3JXAA 5JMOC 3TN0C 3ZKND 3DVNB 2F8XC 1SBBA 3HUJA 2AEWA 3BO8B 4FQQB 5F7WC 4M1CD 1WAAA 4ZMAT 3O2DL 2FJGA 5EU7E 4WWKD 3ELAT 1U8NA 3GSXA 3OZ9H 4MD4A 1I1AA 5ALCL 1JN6B 4S1SL 1EFXD 2ICWB 2IBBA 3D18A 3VFPA 3WXVH 1LK2A 2H8PA 4YHIA 4NNXB 3ZYZA 2C3GA 1FL3A 2BVTA 1KFAH 4HIJA 3SKNB 5BRZA 3DRQB 4OLZH 3VFVA 3WNOA 5FXCH 1XR9B 4YR6A 2BOCA 3MLSH 3X3GL 1A5FH 1TPXB 4LCYA 4LDOB 4KKAC 4FFYL 1FNEB 1RZGB 4HF5L 1NFDF 3P77B 5IB5B 3RWIB 3DX8A 5I75C 1IGIH 3VWJB 3X11A 4OZFG 3AXLA 2GJ6B 1MHPL 2J2ZA 2VLKD 4PJGE 4UDUB 2X4SB 1I85A 1G9NL 5DD0L 1FZKA 1ZVHA 1PJ9A 1TQBB 2VAJA 1MVUA 2ADGB 1W72H 4QRQA 5FF6B 1YY9C 2EECA 4ODSL 3MJ7A 1SY6H 1WVZA 3TN0B 4LCUB 5I15L 5JOFB 2W0KA 2P8PB 2FO4A 4XXCA 5EZOL 4LHUG 3CFCH 5EDXA 5F1OB 4R8WL 2UWEF 1RURH 4LMQI 4JFPB 3VMOA 3KYOA 4Z7OE 4JY6A 4U6HB 4HSQA 5JOPD 4GT7A 2VDMH 4WHTB 5D2NA 3S36L 3C8HA 3IFOB 1AKJB 1JNHA 5IEHA 2VDOH 5C09A 4L1DA 4X8JA 4TTGA 5HHXH 3G5ZB 3N85L 4HAFA 5HYQA 4ZUVB 3B2UD 1MAKA 1YYML 1M05B 2J4WH 3HI1A 4NJAL 4D2NA 4JG1H 4OCWH 3KAAA 3RZCB 4M5YL 4NRXB 2X05A 3VFTA 5AZ2H 4WUUE 1K8DB 3DYOA 5TE4L 4WFHE 5FKPB 4F2MA 2DKUA 1TVHB 1JRHH 4J3WA 5F9JB 1T04A 1LP9E 3VG9B 4IDJL 4MJ2A 2ZUUA 4JFEE 4EN3C 2Q86B 5CHNA 5J11C 4GKZA