3K7WC

Protein phosphatase 2a core complex bound to dinophysistoxin-2
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
288
structure length
288
Chain Sequence
FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for the reduced toxicity of dinophysistoxin-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
total genus 108
structure length 288
sequence length 288
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3k7wC00
2WDFA 1TCOA 3TGHA 3H66A 5J28A 2IE4C 3H60A 1NNWA 3T1IA 3RL4A 1M63A 4O5GA 4F0ZA 2HYPA 3C5WC 2JOGA 4ORBA 5B8IA 3H68A 5EQVA 3C9FA 1Z2XA 1IT6A 2O8GA 3QFMA 1XZWA 4H1YP 4H2GA 3P71C 4I5LC 5JPFA 4TUIA 3LL8A 5GTUA 2NXFA 4UT3A 3H62B 2NPPC 2NYMC 3DSCA 3H63A 5IOHA 3IVEA 4FBKA 2WDDA 2XMOA 2ZBMA 3EGGA 3AV0A 3ZTVA 4ZX2A 1T71A 1OIEA 3EGHA 1OI8A 2QFPA 3QFKA 2BDXA 2Z72A 3IVDA 3K7WC 2QJCA 1USHA 1UF3A 2CV9A 1OIDA 2USHA 2R17A 3FGAC 1S70A 2BQ8X 2HYOA 4FCXA 4ORAA 4B2OA 3K7VC 2O8AA 4JA9A 1AUIA 4ZVZA 3IB7A 4V0XA 3RL3A 4H1SA 3THOB 3H64A 1WAO1 2IAEC 2A22A 1W24A 1S8EA 1S3MA 4UWQA 1MF8A 5JJTA 3DSDA 1HP1A 1S3LA 4UT3B 1HPUA 1Z2WA 2KKNA 4FBQA 4JA7A 2Z1AA 3QFOA 4M0VA 4O4KA 4LU9A 3AUZA 1QHWA 4J6OA 3KBPA 4HD0A 2IE3C 3H67A 4IYPC 3CK2A 1WARA 3THNA 4DSYA 1FJMA 2DFJA 3PSNA 3ICFA 3GVEA 4DHLA 4V0WA 4MOVA 1QFCA 2P6BA 4LACC 4IL1A 3HVQA 2BCDA 2AHDA 4H2BA 3E7BA 3PSOA 4O43A 2QFRA 3RQZA 1XM7A 3QG5C 1G5BA 1S3NA 2NYLC 5F3WA 1U32A 3H69A 4Q7FA 3V4YA 4UT2A 4LTYA 1T70A 5JPEA 4V0VA 4I5NC 5INBA 4DT2A 4WWLA 2Z06A 4MOYA 4KBPA 1HO5A 4XPNA 3RL5A 4KKZA 4MP0A 4YKEA 2WDCA 2HY1A 3N5UA 5C1VA 1II7A 5DNYA 2YVTA 3DW8C 1SU1A 1UTEA 4FBWA 4H2IA 1JK7A 2GJUA 3E7AA 3QFNA 3JYFA 4OR9A 2Q8UA 1V73A 3IB8A 3ZU0A 4O24A 5HPEA 1S95A 4G9JA 2WDEA 3H61A 4H2FA 4TUGA 1KBPA 4NZVA 4ORCA
chains in the Genus database with same CATH superfamily
2WDFA 1TCOA 3TGHA 3H66A 5J28A 2IE4C 3H60A 1NNWA 3T1IA 3RL4A 1M63A 4O5GA 4F0ZA 2HYPA 3C5WC 2JOGA 4ORBA 5B8IA 3H68A 5EQVA 3C9FA 1Z2XA 1IT6A 2O8GA 3QFMA 1XZWA 4H1YP 4H2GA 3P71C 4I5LC 5JPFA 4TUIA 3LL8A 5GTUA 2ZOAA 2NXFA 4UT3A 3H62B 2NPPC 2NYMC 3DSCA 3H63A 5IOHA 3FLOA 3IVEA 4FBKA 2WDDA 2XMOA 2ZBMA 4NZVA 3EGGA 3AV0A 3ZTVA 4ZX2A 2YEQA 1T71A 1OIEA 3EGHA 1OI8A 2QFPA 3QFKA 2BDXA 2DXNA 2Z72A 3IVDA 3K7WC 2QJCA 1USHA 1UF3A 2CV9A 1OIDA 2USHA 2R17A 3FGAC 1S70A 2BQ8X 2HYOA 4FCXA 4ORAA 4B2OA 3K7VC 2O8AA 4JA9A 1AUIA 4ZVZA 3IB7A 4V0XA 3RL3A 4H1SA 3THOB 3H64A 1WAO1 2IAEC 2A22A 1W24A 1S8EA 1S3MA 4UWQA 1MF8A 5JJTA 3DSDA 1HP1A 1S3LA 4UT3B 1HPUA 1Z2WA 2KKNA 3E0JA 4FBQA 2Z1AA 3QFOA 4JA7A 4M0VA 4O4KA 4LU9A 3AUZA 1QHWA 4J6OA 3KBPA 4HD0A 2IE3C 3H67A 4IYPC 3CK2A 1WARA 3THNA 2ZO9B 4DSYA 1FJMA 2DFJA 3PSNA 3ICFA 3GVEA 4DHLA 4V0WA 4MOVA 1QFCA 2P6BA 4LACC 4IL1A 2DXLA 3HVQA 2BCDA 2AHDA 4H2BA 3E7BA 3PSOA 4O43A 2QFRA 3RQZA 1XM7A 3QG5C 1G5BA 1S3NA 2NYLC 5F3WA 1U32A 3H69A 4Q7FA 3V4YA 4UT2A 4LTYA 1T70A 5JPEA 4V0VA 4I5NC 5INBA 4DT2A 4WWLA 2Z06A 4MOYA 4KBPA 1HO5A 4XPNA 3RL5A 4KKZA 4MP0A 4YKEA 2WDCA 2HY1A 3N5UA 5C1VA 1II7A 5DNYA 2YVTA 3DW8C 1SU1A 1UTEA 4FBWA 4H2IA 1JK7A 2GJUA 3E7AA 3QFNA 3JYFA 4OR9A 2Q8UA 1V73A 3IB8A 3ZU0A 4O24A 5HPEA 1S95A 4G9JA 2WDEA 3H61A 4H2FA 4TUGA 1KBPA 3D03A 4ORCA
chains in the Genus database with same CATH topology
2WDFA 1TCOA 3TGHA 3H66A 5J28A 2IE4C 3H60A 1NNWA 3T1IA 3RL4A 1M63A 4O5GA 4F0ZA 2HYPA 3C5WC 2JOGA 4ORBA 5B8IA 3H68A 5EQVA 3C9FA 1Z2XA 1IT6A 2O8GA 3QFMA 1XZWA 4H1YP 4H2GA 3P71C 4I5LC 5JPFA 4TUIA 3LL8A 5GTUA 2ZOAA 2NXFA 4UT3A 3H62B 2NPPC 2NYMC 3DSCA 3H63A 5IOHA 3FLOA 3IVEA 4FBKA 2WDDA 2XMOA 2ZBMA 4NZVA 3EGGA 3AV0A 3ZTVA 4ZX2A 2YEQA 1T71A 1OIEA 3EGHA 1OI8A 2QFPA 3QFKA 2BDXA 2DXNA 2Z72A 3IVDA 3K7WC 2QJCA 1USHA 1UF3A 2CV9A 1OIDA 2USHA 2R17A 3FGAC 1S70A 2BQ8X 2HYOA 4FCXA 4ORAA 4B2OA 3K7VC 2O8AA 4JA9A 1AUIA 4ZVZA 3IB7A 4V0XA 3RL3A 4H1SA 3THOB 3H64A 1WAO1 2IAEC 2A22A 1W24A 1S8EA 1S3MA 4UWQA 1MF8A 5JJTA 3DSDA 1HP1A 1S3LA 4UT3B 1HPUA 1Z2WA 2KKNA 3E0JA 4FBQA 2Z1AA 3QFOA 4JA7A 4M0VA 4O4KA 4LU9A 3AUZA 1QHWA 4J6OA 3KBPA 4HD0A 2IE3C 3H67A 4IYPC 3CK2A 1WARA 3THNA 2ZO9B 4DSYA 1FJMA 2DFJA 3PSNA 3ICFA 3GVEA 4DHLA 4V0WA 4MOVA 1QFCA 2P6BA 4LACC 4IL1A 2DXLA 3HVQA 2BCDA 2AHDA 4H2BA 3E7BA 3PSOA 4O43A 2QFRA 3RQZA 1XM7A 3QG5C 1G5BA 1S3NA 2NYLC 5F3WA 1U32A 3H69A 4Q7FA 3V4YA 4UT2A 4LTYA 1T70A 5JPEA 4V0VA 4I5NC 5INBA 4DT2A 4WWLA 2Z06A 4MOYA 4KBPA 1HO5A 4XPNA 3RL5A 4KKZA 4MP0A 4YKEA 2WDCA 2HY1A 3N5UA 5C1VA 1II7A 5DNYA 2YVTA 3DW8C 1SU1A 1UTEA 4FBWA 4H2IA 1JK7A 2GJUA 3E7AA 3QFNA 3JYFA 4OR9A 2Q8UA 1V73A 3IB8A 3ZU0A 4O24A 5HPEA 1S95A 4G9JA 2WDEA 3H61A 4H2FA 4TUGA 1KBPA 3D03A 4ORCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDF A;  1TCO A;  3TGH A;  3H66 A;  5J28 A;  2IE4 C;  3H60 A;  1NNW A;  3T1I A;  3RL4 A;  1M63 A;  4O5G A;  4F0Z A;  2HYP A;  3C5W C;  2JOG A;  4ORB A;  5B8I A;  3H68 A;  5EQV A;  3C9F A;  1Z2X A;  1IT6 A;  2O8G A;  3QFM A;  1XZW A;  4H1Y P;  4H2G A;  3P71 C;  4I5L C;  5JPF A;  4TUI A;  3LL8 A;  5GTU A;  2NXF A;  4UT3 A;  3H62 B;  2NPP C;  2NYM C;  3DSC A;  3H63 A;  5IOH A;  3IVE A;  4FBK A;  2WDD A;  2XMO A;  2ZBM A;  3EGG A;  3AV0 A;  3ZTV A;  4ZX2 A;  1T71 A;  1OIE A;  3EGH A;  1OI8 A;  2QFP A;  3QFK A;  2BDX A;  2Z72 A;  3IVD A;  3K7W C;  2QJC A;  1USH A;  1UF3 A;  2CV9 A;  1OID A;  2USH A;  2R17 A;  3FGA C;  1S70 A;  2BQ8 X;  2HYO A;  4FCX A;  4ORA A;  4B2O A;  3K7V C;  2O8A A;  4JA9 A;  1AUI A;  4ZVZ A;  3IB7 A;  4V0X A;  3RL3 A;  4H1S A;  3THO B;  3H64 A;  1WAO 1;  2IAE C;  2A22 A;  1W24 A;  1S8E A;  1S3M A;  4UWQ A;  1MF8 A;  5JJT A;  3DSD A;  1HP1 A;  1S3L A;  4UT3 B;  1HPU A;  1Z2W A;  2KKN A;  4FBQ A;  4JA7 A;  2Z1A A;  3QFO A;  4M0V A;  4O4K A;  4LU9 A;  3AUZ A;  1QHW A;  4J6O A;  3KBP A;  4HD0 A;  2IE3 C;  3H67 A;  4IYP C;  3CK2 A;  1WAR A;  3THN A;  4DSY A;  1FJM A;  2DFJ A;  3PSN A;  3ICF A;  3GVE A;  4DHL A;  4V0W A;  4MOV A;  1QFC A;  2P6B A;  4LAC C;  4IL1 A;  3HVQ A;  2BCD A;  2AHD A;  4H2B A;  3E7B A;  3PSO A;  4O43 A;  2QFR A;  3RQZ A;  1XM7 A;  3QG5 C;  1G5B A;  1S3N A;  2NYL C;  5F3W A;  1U32 A;  3H69 A;  4Q7F A;  3V4Y A;  4UT2 A;  4LTY A;  1T70 A;  5JPE A;  4V0V A;  4I5N C;  5INB A;  4DT2 A;  4WWL A;  2Z06 A;  4MOY A;  4KBP A;  1HO5 A;  4XPN A;  3RL5 A;  4KKZ A;  4MP0 A;  4YKE A;  2WDC A;  2HY1 A;  3N5U A;  5C1V A;  1II7 A;  5DNY A;  2YVT A;  3DW8 C;  1SU1 A;  1UTE A;  4FBW A;  4H2I A;  1JK7 A;  2GJU A;  3E7A A;  3QFN A;  3JYF A;  4OR9 A;  2Q8U A;  1V73 A;  3IB8 A;  3ZU0 A;  4O24 A;  5HPE A;  1S95 A;  4G9J A;  2WDE A;  3H61 A;  4H2F A;  4TUG A;  1KBP A;  4NZV A;  4ORC A; 
#chains in the Genus database with same CATH topology
 2WDF A;  1TCO A;  3TGH A;  3H66 A;  5J28 A;  2IE4 C;  3H60 A;  1NNW A;  3T1I A;  3RL4 A;  1M63 A;  4O5G A;  4F0Z A;  2HYP A;  3C5W C;  2JOG A;  4ORB A;  5B8I A;  3H68 A;  5EQV A;  3C9F A;  1Z2X A;  1IT6 A;  2O8G A;  3QFM A;  1XZW A;  4H1Y P;  4H2G A;  3P71 C;  4I5L C;  5JPF A;  4TUI A;  3LL8 A;  5GTU A;  2ZOA A;  2NXF A;  4UT3 A;  3H62 B;  2NPP C;  2NYM C;  3DSC A;  3H63 A;  5IOH A;  3FLO A;  3IVE A;  4FBK A;  2WDD A;  2XMO A;  2ZBM A;  4NZV A;  3EGG A;  3AV0 A;  3ZTV A;  4ZX2 A;  2YEQ A;  1T71 A;  1OIE A;  3EGH A;  1OI8 A;  2QFP A;  3QFK A;  2BDX A;  2DXN A;  2Z72 A;  3IVD A;  3K7W C;  2QJC A;  1USH A;  1UF3 A;  2CV9 A;  1OID A;  2USH A;  2R17 A;  3FGA C;  1S70 A;  2BQ8 X;  2HYO A;  4FCX A;  4ORA A;  4B2O A;  3K7V C;  2O8A A;  4JA9 A;  1AUI A;  4ZVZ A;  3IB7 A;  4V0X A;  3RL3 A;  4H1S A;  3THO B;  3H64 A;  1WAO 1;  2IAE C;  2A22 A;  1W24 A;  1S8E A;  1S3M A;  4UWQ A;  1MF8 A;  5JJT A;  3DSD A;  1HP1 A;  1S3L A;  4UT3 B;  1HPU A;  1Z2W A;  2KKN A;  3E0J A;  4FBQ A;  2Z1A A;  3QFO A;  4JA7 A;  4M0V A;  4O4K A;  4LU9 A;  3AUZ A;  1QHW A;  4J6O A;  3KBP A;  4HD0 A;  2IE3 C;  3H67 A;  4IYP C;  3CK2 A;  1WAR A;  3THN A;  2ZO9 B;  4DSY A;  1FJM A;  2DFJ A;  3PSN A;  3ICF A;  3GVE A;  4DHL A;  4V0W A;  4MOV A;  1QFC A;  2P6B A;  4LAC C;  4IL1 A;  2DXL A;  3HVQ A;  2BCD A;  2AHD A;  4H2B A;  3E7B A;  3PSO A;  4O43 A;  2QFR A;  3RQZ A;  1XM7 A;  3QG5 C;  1G5B A;  1S3N A;  2NYL C;  5F3W A;  1U32 A;  3H69 A;  4Q7F A;  3V4Y A;  4UT2 A;  4LTY A;  1T70 A;  5JPE A;  4V0V A;  4I5N C;  5INB A;  4DT2 A;  4WWL A;  2Z06 A;  4MOY A;  4KBP A;  1HO5 A;  4XPN A;  3RL5 A;  4KKZ A;  4MP0 A;  4YKE A;  2WDC A;  2HY1 A;  3N5U A;  5C1V A;  1II7 A;  5DNY A;  2YVT A;  3DW8 C;  1SU1 A;  1UTE A;  4FBW A;  4H2I A;  1JK7 A;  2GJU A;  3E7A A;  3QFN A;  3JYF A;  4OR9 A;  2Q8U A;  1V73 A;  3IB8 A;  3ZU0 A;  4O24 A;  5HPE A;  1S95 A;  4G9J A;  2WDE A;  3H61 A;  4H2F A;  4TUG A;  1KBP A;  3D03 A;  4ORC A; 
#chains in the Genus database with same CATH homology
 2WDF A;  1TCO A;  3TGH A;  3H66 A;  5J28 A;  2IE4 C;  3H60 A;  1NNW A;  3T1I A;  3RL4 A;  1M63 A;  4O5G A;  4F0Z A;  2HYP A;  3C5W C;  2JOG A;  4ORB A;  5B8I A;  3H68 A;  5EQV A;  3C9F A;  1Z2X A;  1IT6 A;  2O8G A;  3QFM A;  1XZW A;  4H1Y P;  4H2G A;  3P71 C;  4I5L C;  5JPF A;  4TUI A;  3LL8 A;  5GTU A;  2ZOA A;  2NXF A;  4UT3 A;  3H62 B;  2NPP C;  2NYM C;  3DSC A;  3H63 A;  5IOH A;  3FLO A;  3IVE A;  4FBK A;  2WDD A;  2XMO A;  2ZBM A;  4NZV A;  3EGG A;  3AV0 A;  3ZTV A;  4ZX2 A;  2YEQ A;  1T71 A;  1OIE A;  3EGH A;  1OI8 A;  2QFP A;  3QFK A;  2BDX A;  2DXN A;  2Z72 A;  3IVD A;  3K7W C;  2QJC A;  1USH A;  1UF3 A;  2CV9 A;  1OID A;  2USH A;  2R17 A;  3FGA C;  1S70 A;  2BQ8 X;  2HYO A;  4FCX A;  4ORA A;  4B2O A;  3K7V C;  2O8A A;  4JA9 A;  1AUI A;  4ZVZ A;  3IB7 A;  4V0X A;  3RL3 A;  4H1S A;  3THO B;  3H64 A;  1WAO 1;  2IAE C;  2A22 A;  1W24 A;  1S8E A;  1S3M A;  4UWQ A;  1MF8 A;  5JJT A;  3DSD A;  1HP1 A;  1S3L A;  4UT3 B;  1HPU A;  1Z2W A;  2KKN A;  3E0J A;  4FBQ A;  2Z1A A;  3QFO A;  4JA7 A;  4M0V A;  4O4K A;  4LU9 A;  3AUZ A;  1QHW A;  4J6O A;  3KBP A;  4HD0 A;  2IE3 C;  3H67 A;  4IYP C;  3CK2 A;  1WAR A;  3THN A;  2ZO9 B;  4DSY A;  1FJM A;  2DFJ A;  3PSN A;  3ICF A;  3GVE A;  4DHL A;  4V0W A;  4MOV A;  1QFC A;  2P6B A;  4LAC C;  4IL1 A;  2DXL A;  3HVQ A;  2BCD A;  2AHD A;  4H2B A;  3E7B A;  3PSO A;  4O43 A;  2QFR A;  3RQZ A;  1XM7 A;  3QG5 C;  1G5B A;  1S3N A;  2NYL C;  5F3W A;  1U32 A;  3H69 A;  4Q7F A;  3V4Y A;  4UT2 A;  4LTY A;  1T70 A;  5JPE A;  4V0V A;  4I5N C;  5INB A;  4DT2 A;  4WWL A;  2Z06 A;  4MOY A;  4KBP A;  1HO5 A;  4XPN A;  3RL5 A;  4KKZ A;  4MP0 A;  4YKE A;  2WDC A;  2HY1 A;  3N5U A;  5C1V A;  1II7 A;  5DNY A;  2YVT A;  3DW8 C;  1SU1 A;  1UTE A;  4FBW A;  4H2I A;  1JK7 A;  2GJU A;  3E7A A;  3QFN A;  3JYF A;  4OR9 A;  2Q8U A;  1V73 A;  3IB8 A;  3ZU0 A;  4O24 A;  5HPE A;  1S95 A;  4G9J A;  2WDE A;  3H61 A;  4H2F A;  4TUG A;  1KBP A;  3D03 A;  4ORC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...