3K7WC

Protein phosphatase 2a core complex bound to dinophysistoxin-2
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
288
structure length
288
Chain Sequence
FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
publication title A structural basis for the reduced toxicity of dinophysistoxin-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
total genus 108
structure length 288
sequence length 288
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3k7wC00
1XZWA 5EQVA 3AUZA 5GTUA 4I5NC 1QFCA 3C9FA 5JJTA 3QFOA 2YVTA 2O8AA 2HY1A 4ORAA 5DNYA 1AUIA 3IB8A 5INBA 4MP0A 4DHLA 1W24A 4O5GA 3ZTVA 3T1IA 4TUGA 1Z2WA 3H61A 4KBPA 4O24A 4ZVZA 3RL3A 3H60A 4G9JA 3ZU0A 4ORBA 1TCOA 2QFPA 1UF3A 3H66A 1SU1A 4O43A 4LTYA 1S95A 4YKEA 3QG5C 3THNA 2WDEA 3EGHA 2BCDA 2CV9A 2P6BA 1IT6A 4IYPC 4MOYA 1FJMA 4O4KA 5F3WA 2Z72A 2IE4C 5C1VA 2USHA 1QHWA 1HPUA 4J6OA 3EGGA 4KKZA 3QFKA 1V73A 3KBPA 5B8IA 1HO5A 2NPPC 4LACC 4LU9A 3E7AA 3DW8C 3DSCA 3DSDA 1S8EA 4ZX2A 4I5LC 1II7A 3GVEA 1S3LA 5JPFA 4MOVA 2O8GA 4FBWA 4UT3A 3IVDA 2BDXA 4OR9A 4TUIA 4XPNA 2WDFA 2ZBMA 4DT2A 4FBQA 3AV0A 4H2FA 1XM7A 3H67A 1WAO1 3H62B 4HD0A 1UTEA 2AHDA 1MF8A 4V0XA 5IOHA 3TGHA 3C5WC 3HVQA 1NNWA 2HYPA 3H63A 3K7WC 3QFNA 1S3MA 4H2BA 4ORCA 5JPEA 1S70A 1S3NA 4M0VA 2NXFA 1OIEA 3PSNA 1M63A 2BQ8X 2JOGA 4JA7A 1OIDA 2DFJA 2Z1AA 2Z06A 3QFMA 1T70A 3N5UA 4JA9A 4UT3B 3P71C 3RL4A 3V4YA 2A22A 4IL1A 4H1SA 4UT2A 3CK2A 3LL8A 1KBPA 2Q8UA 4V0WA 4H2IA 3RQZA 3PSOA 4WWLA 3FGAC 1JK7A 2XMOA 2IE3C 4H1YP 3H69A 3JYFA 5J28A 1Z2XA 2KKNA 2NYMC 4F0ZA 3E7BA 2GJUA 4DSYA 1G5BA 3THOB 3H68A 2NYLC 4H2GA 2R17A 2WDDA 4V0VA 3RL5A 4UWQA 4B2OA 1U32A 4NZVA 1T71A 3ICFA 3IVEA 2HYOA 2QJCA 2IAEC 2QFRA 3IB7A 5HPEA 1USHA 2WDCA 4FBKA 1OI8A 3K7VC 1WARA 4FCXA 4Q7FA 1HP1A 3H64A
chains in the Genus database with same CATH superfamily
1XZWA 5EQVA 3AUZA 5GTUA 4I5NC 1QFCA 3C9FA 5JJTA 3QFOA 2YVTA 2O8AA 2HY1A 4ORAA 5DNYA 1AUIA 3IB8A 5INBA 4MP0A 4DHLA 1W24A 4O5GA 3ZTVA 3T1IA 4TUGA 1Z2WA 3H61A 4KBPA 4O24A 4ZVZA 3RL3A 3H60A 4G9JA 3ZU0A 4ORBA 1TCOA 2QFPA 1UF3A 3H66A 1SU1A 4O43A 4LTYA 1S95A 4YKEA 3QG5C 3THNA 2WDEA 3EGHA 2BCDA 2CV9A 2P6BA 1IT6A 4IYPC 4MOYA 1FJMA 4O4KA 5F3WA 2Z72A 2IE4C 5C1VA 2USHA 1QHWA 1HPUA 4J6OA 3EGGA 4KKZA 3QFKA 1V73A 2ZOAA 3KBPA 1HO5A 5B8IA 2NPPC 4LACC 4LU9A 3E7AA 3DW8C 3DSCA 3DSDA 1S8EA 4ZX2A 4I5LC 1II7A 3GVEA 1S3LA 5JPFA 4MOVA 2O8GA 4FBWA 4UT3A 3IVDA 2BDXA 4OR9A 4TUIA 4XPNA 2WDFA 2ZBMA 4DT2A 4FBQA 3AV0A 3D03A 4H2FA 3FLOA 1XM7A 2ZO9B 3H67A 1WAO1 3H62B 4HD0A 1UTEA 2AHDA 1MF8A 4V0XA 5IOHA 3TGHA 2DXNA 3C5WC 3HVQA 1NNWA 2HYPA 3H63A 3K7WC 3QFNA 1S3MA 4H2BA 4ORCA 2YEQA 5JPEA 1S70A 1S3NA 4M0VA 2NXFA 1OIEA 3PSNA 1M63A 2BQ8X 3E0JA 2JOGA 4JA7A 1OIDA 2DFJA 2Z1AA 2Z06A 3QFMA 1T70A 3N5UA 4JA9A 4UT3B 3P71C 3RL4A 3V4YA 2A22A 4IL1A 4H1SA 4UT2A 3CK2A 3LL8A 1KBPA 2Q8UA 4V0WA 4H2IA 3RQZA 3PSOA 4WWLA 3FGAC 1JK7A 2XMOA 2IE3C 4H1YP 3H69A 3JYFA 5J28A 1Z2XA 2KKNA 2NYMC 4F0ZA 3E7BA 2GJUA 4DSYA 1G5BA 3THOB 3H68A 2NYLC 4H2GA 2R17A 2WDDA 4V0VA 2DXLA 3RL5A 4UWQA 4B2OA 1U32A 4NZVA 1T71A 3ICFA 3IVEA 2HYOA 2QJCA 2IAEC 2QFRA 3IB7A 5HPEA 1USHA 2WDCA 4FBKA 1OI8A 3K7VC 1WARA 4FCXA 4Q7FA 1HP1A 3H64A
chains in the Genus database with same CATH topology
1XZWA 5EQVA 3AUZA 5GTUA 4I5NC 1QFCA 3C9FA 5JJTA 3QFOA 2YVTA 2O8AA 2HY1A 4ORAA 5DNYA 1AUIA 3IB8A 5INBA 4MP0A 4DHLA 1W24A 4O5GA 3ZTVA 3T1IA 4TUGA 1Z2WA 3H61A 4KBPA 4O24A 4ZVZA 3RL3A 3H60A 4G9JA 3ZU0A 4ORBA 1TCOA 2QFPA 1UF3A 3H66A 1SU1A 4O43A 4LTYA 1S95A 4YKEA 3QG5C 3THNA 2WDEA 3EGHA 2BCDA 2CV9A 2P6BA 1IT6A 4IYPC 4MOYA 1FJMA 4O4KA 5F3WA 2Z72A 2IE4C 5C1VA 2USHA 1QHWA 1HPUA 4J6OA 3EGGA 4KKZA 3QFKA 1V73A 2ZOAA 3KBPA 1HO5A 5B8IA 2NPPC 4LACC 4LU9A 3E7AA 3DW8C 3DSCA 3DSDA 1S8EA 4ZX2A 4I5LC 1II7A 3GVEA 1S3LA 5JPFA 4MOVA 2O8GA 4FBWA 4UT3A 3IVDA 2BDXA 4OR9A 4TUIA 4XPNA 2WDFA 2ZBMA 4DT2A 4FBQA 3AV0A 3D03A 4H2FA 3FLOA 1XM7A 2ZO9B 3H67A 1WAO1 3H62B 4HD0A 1UTEA 2AHDA 1MF8A 4V0XA 5IOHA 3TGHA 2DXNA 3C5WC 3HVQA 1NNWA 2HYPA 3H63A 3K7WC 3QFNA 1S3MA 4H2BA 4ORCA 2YEQA 5JPEA 1S70A 1S3NA 4M0VA 2NXFA 1OIEA 3PSNA 1M63A 2BQ8X 3E0JA 2JOGA 4JA7A 1OIDA 2DFJA 2Z1AA 2Z06A 3QFMA 1T70A 3N5UA 4JA9A 4UT3B 3P71C 3RL4A 3V4YA 2A22A 4IL1A 4H1SA 4UT2A 3CK2A 3LL8A 1KBPA 2Q8UA 4V0WA 4H2IA 3RQZA 3PSOA 4WWLA 3FGAC 1JK7A 2XMOA 2IE3C 4H1YP 3H69A 3JYFA 5J28A 1Z2XA 2KKNA 2NYMC 4F0ZA 3E7BA 2GJUA 4DSYA 1G5BA 3THOB 3H68A 2NYLC 4H2GA 2R17A 2WDDA 4V0VA 2DXLA 3RL5A 4UWQA 4B2OA 1U32A 4NZVA 1T71A 3ICFA 3IVEA 2HYOA 2QJCA 2IAEC 2QFRA 3IB7A 5HPEA 1USHA 2WDCA 4FBKA 1OI8A 3K7VC 1WARA 4FCXA 4Q7FA 1HP1A 3H64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XZW A;  5EQV A;  3AUZ A;  5GTU A;  4I5N C;  1QFC A;  3C9F A;  5JJT A;  3QFO A;  2YVT A;  2O8A A;  2HY1 A;  4ORA A;  5DNY A;  1AUI A;  3IB8 A;  5INB A;  4MP0 A;  4DHL A;  1W24 A;  4O5G A;  3ZTV A;  3T1I A;  4TUG A;  1Z2W A;  3H61 A;  4KBP A;  4O24 A;  4ZVZ A;  3RL3 A;  3H60 A;  4G9J A;  3ZU0 A;  4ORB A;  1TCO A;  2QFP A;  1UF3 A;  3H66 A;  1SU1 A;  4O43 A;  4LTY A;  1S95 A;  4YKE A;  3QG5 C;  3THN A;  2WDE A;  3EGH A;  2BCD A;  2CV9 A;  2P6B A;  1IT6 A;  4IYP C;  4MOY A;  1FJM A;  4O4K A;  5F3W A;  2Z72 A;  2IE4 C;  5C1V A;  2USH A;  1QHW A;  1HPU A;  4J6O A;  3EGG A;  4KKZ A;  3QFK A;  1V73 A;  3KBP A;  5B8I A;  1HO5 A;  2NPP C;  4LAC C;  4LU9 A;  3E7A A;  3DW8 C;  3DSC A;  3DSD A;  1S8E A;  4ZX2 A;  4I5L C;  1II7 A;  3GVE A;  1S3L A;  5JPF A;  4MOV A;  2O8G A;  4FBW A;  4UT3 A;  3IVD A;  2BDX A;  4OR9 A;  4TUI A;  4XPN A;  2WDF A;  2ZBM A;  4DT2 A;  4FBQ A;  3AV0 A;  4H2F A;  1XM7 A;  3H67 A;  1WAO 1;  3H62 B;  4HD0 A;  1UTE A;  2AHD A;  1MF8 A;  4V0X A;  5IOH A;  3TGH A;  3C5W C;  3HVQ A;  1NNW A;  2HYP A;  3H63 A;  3K7W C;  3QFN A;  1S3M A;  4H2B A;  4ORC A;  5JPE A;  1S70 A;  1S3N A;  4M0V A;  2NXF A;  1OIE A;  3PSN A;  1M63 A;  2BQ8 X;  2JOG A;  4JA7 A;  1OID A;  2DFJ A;  2Z1A A;  2Z06 A;  3QFM A;  1T70 A;  3N5U A;  4JA9 A;  4UT3 B;  3P71 C;  3RL4 A;  3V4Y A;  2A22 A;  4IL1 A;  4H1S A;  4UT2 A;  3CK2 A;  3LL8 A;  1KBP A;  2Q8U A;  4V0W A;  4H2I A;  3RQZ A;  3PSO A;  4WWL A;  3FGA C;  1JK7 A;  2XMO A;  2IE3 C;  4H1Y P;  3H69 A;  3JYF A;  5J28 A;  1Z2X A;  2KKN A;  2NYM C;  4F0Z A;  3E7B A;  2GJU A;  4DSY A;  1G5B A;  3THO B;  3H68 A;  2NYL C;  4H2G A;  2R17 A;  2WDD A;  4V0V A;  3RL5 A;  4UWQ A;  4B2O A;  1U32 A;  4NZV A;  1T71 A;  3ICF A;  3IVE A;  2HYO A;  2QJC A;  2IAE C;  2QFR A;  3IB7 A;  5HPE A;  1USH A;  2WDC A;  4FBK A;  1OI8 A;  3K7V C;  1WAR A;  4FCX A;  4Q7F A;  1HP1 A;  3H64 A; 
#chains in the Genus database with same CATH topology
 1XZW A;  5EQV A;  3AUZ A;  5GTU A;  4I5N C;  1QFC A;  3C9F A;  5JJT A;  3QFO A;  2YVT A;  2O8A A;  2HY1 A;  4ORA A;  5DNY A;  1AUI A;  3IB8 A;  5INB A;  4MP0 A;  4DHL A;  1W24 A;  4O5G A;  3ZTV A;  3T1I A;  4TUG A;  1Z2W A;  3H61 A;  4KBP A;  4O24 A;  4ZVZ A;  3RL3 A;  3H60 A;  4G9J A;  3ZU0 A;  4ORB A;  1TCO A;  2QFP A;  1UF3 A;  3H66 A;  1SU1 A;  4O43 A;  4LTY A;  1S95 A;  4YKE A;  3QG5 C;  3THN A;  2WDE A;  3EGH A;  2BCD A;  2CV9 A;  2P6B A;  1IT6 A;  4IYP C;  4MOY A;  1FJM A;  4O4K A;  5F3W A;  2Z72 A;  2IE4 C;  5C1V A;  2USH A;  1QHW A;  1HPU A;  4J6O A;  3EGG A;  4KKZ A;  3QFK A;  1V73 A;  2ZOA A;  3KBP A;  1HO5 A;  5B8I A;  2NPP C;  4LAC C;  4LU9 A;  3E7A A;  3DW8 C;  3DSC A;  3DSD A;  1S8E A;  4ZX2 A;  4I5L C;  1II7 A;  3GVE A;  1S3L A;  5JPF A;  4MOV A;  2O8G A;  4FBW A;  4UT3 A;  3IVD A;  2BDX A;  4OR9 A;  4TUI A;  4XPN A;  2WDF A;  2ZBM A;  4DT2 A;  4FBQ A;  3AV0 A;  3D03 A;  4H2F A;  3FLO A;  1XM7 A;  2ZO9 B;  3H67 A;  1WAO 1;  3H62 B;  4HD0 A;  1UTE A;  2AHD A;  1MF8 A;  4V0X A;  5IOH A;  3TGH A;  2DXN A;  3C5W C;  3HVQ A;  1NNW A;  2HYP A;  3H63 A;  3K7W C;  3QFN A;  1S3M A;  4H2B A;  4ORC A;  2YEQ A;  5JPE A;  1S70 A;  1S3N A;  4M0V A;  2NXF A;  1OIE A;  3PSN A;  1M63 A;  2BQ8 X;  3E0J A;  2JOG A;  4JA7 A;  1OID A;  2DFJ A;  2Z1A A;  2Z06 A;  3QFM A;  1T70 A;  3N5U A;  4JA9 A;  4UT3 B;  3P71 C;  3RL4 A;  3V4Y A;  2A22 A;  4IL1 A;  4H1S A;  4UT2 A;  3CK2 A;  3LL8 A;  1KBP A;  2Q8U A;  4V0W A;  4H2I A;  3RQZ A;  3PSO A;  4WWL A;  3FGA C;  1JK7 A;  2XMO A;  2IE3 C;  4H1Y P;  3H69 A;  3JYF A;  5J28 A;  1Z2X A;  2KKN A;  2NYM C;  4F0Z A;  3E7B A;  2GJU A;  4DSY A;  1G5B A;  3THO B;  3H68 A;  2NYL C;  4H2G A;  2R17 A;  2WDD A;  4V0V A;  2DXL A;  3RL5 A;  4UWQ A;  4B2O A;  1U32 A;  4NZV A;  1T71 A;  3ICF A;  3IVE A;  2HYO A;  2QJC A;  2IAE C;  2QFR A;  3IB7 A;  5HPE A;  1USH A;  2WDC A;  4FBK A;  1OI8 A;  3K7V C;  1WAR A;  4FCX A;  4Q7F A;  1HP1 A;  3H64 A; 
#chains in the Genus database with same CATH homology
 1XZW A;  5EQV A;  3AUZ A;  5GTU A;  4I5N C;  1QFC A;  3C9F A;  5JJT A;  3QFO A;  2YVT A;  2O8A A;  2HY1 A;  4ORA A;  5DNY A;  1AUI A;  3IB8 A;  5INB A;  4MP0 A;  4DHL A;  1W24 A;  4O5G A;  3ZTV A;  3T1I A;  4TUG A;  1Z2W A;  3H61 A;  4KBP A;  4O24 A;  4ZVZ A;  3RL3 A;  3H60 A;  4G9J A;  3ZU0 A;  4ORB A;  1TCO A;  2QFP A;  1UF3 A;  3H66 A;  1SU1 A;  4O43 A;  4LTY A;  1S95 A;  4YKE A;  3QG5 C;  3THN A;  2WDE A;  3EGH A;  2BCD A;  2CV9 A;  2P6B A;  1IT6 A;  4IYP C;  4MOY A;  1FJM A;  4O4K A;  5F3W A;  2Z72 A;  2IE4 C;  5C1V A;  2USH A;  1QHW A;  1HPU A;  4J6O A;  3EGG A;  4KKZ A;  3QFK A;  1V73 A;  2ZOA A;  3KBP A;  1HO5 A;  5B8I A;  2NPP C;  4LAC C;  4LU9 A;  3E7A A;  3DW8 C;  3DSC A;  3DSD A;  1S8E A;  4ZX2 A;  4I5L C;  1II7 A;  3GVE A;  1S3L A;  5JPF A;  4MOV A;  2O8G A;  4FBW A;  4UT3 A;  3IVD A;  2BDX A;  4OR9 A;  4TUI A;  4XPN A;  2WDF A;  2ZBM A;  4DT2 A;  4FBQ A;  3AV0 A;  3D03 A;  4H2F A;  3FLO A;  1XM7 A;  2ZO9 B;  3H67 A;  1WAO 1;  3H62 B;  4HD0 A;  1UTE A;  2AHD A;  1MF8 A;  4V0X A;  5IOH A;  3TGH A;  2DXN A;  3C5W C;  3HVQ A;  1NNW A;  2HYP A;  3H63 A;  3K7W C;  3QFN A;  1S3M A;  4H2B A;  4ORC A;  2YEQ A;  5JPE A;  1S70 A;  1S3N A;  4M0V A;  2NXF A;  1OIE A;  3PSN A;  1M63 A;  2BQ8 X;  3E0J A;  2JOG A;  4JA7 A;  1OID A;  2DFJ A;  2Z1A A;  2Z06 A;  3QFM A;  1T70 A;  3N5U A;  4JA9 A;  4UT3 B;  3P71 C;  3RL4 A;  3V4Y A;  2A22 A;  4IL1 A;  4H1S A;  4UT2 A;  3CK2 A;  3LL8 A;  1KBP A;  2Q8U A;  4V0W A;  4H2I A;  3RQZ A;  3PSO A;  4WWL A;  3FGA C;  1JK7 A;  2XMO A;  2IE3 C;  4H1Y P;  3H69 A;  3JYF A;  5J28 A;  1Z2X A;  2KKN A;  2NYM C;  4F0Z A;  3E7B A;  2GJU A;  4DSY A;  1G5B A;  3THO B;  3H68 A;  2NYL C;  4H2G A;  2R17 A;  2WDD A;  4V0V A;  2DXL A;  3RL5 A;  4UWQ A;  4B2O A;  1U32 A;  4NZV A;  1T71 A;  3ICF A;  3IVE A;  2HYO A;  2QJC A;  2IAE C;  2QFR A;  3IB7 A;  5HPE A;  1USH A;  2WDC A;  4FBK A;  1OI8 A;  3K7V C;  1WAR A;  4FCX A;  4Q7F A;  1HP1 A;  3H64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...