3K8MA

Crystal structure of susg with acarbose
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
650
structure length
650
Chain Sequence
QWTALTASPDTWDETKRADISYQLLLYSFADSDGDGYGDLNGVTQKLDYLNQLGVKALWLSPIHPCMSYHGYDVTDYTKVNPQLGTESDFDRLVTEAHNRGIKIYLDYVMNHTGTAHPWFTEASSSSESPYRNYYSFSEDPKTDIAAGKIAMITQEGAAGYNAAEWFQVSDETAAVKGLLKFTLDWSNAPSPILVVSTGTKADEDNPDTGTDNAKYLYYGEDICKKFYDKGNNIYELTVDFESTWGLLIRTSNASFWPSGTKYGASSSSEKLALNKDFKLTNAGNPANIMFDSQQITYFHSHFCTDWFADLNYGPVDQAGESPAYQAIADAAKGWIARGVDGLRLDAVKHIYHSETSEENPRFLKMFYEDMNAYYKQKGHTDDFYMIGEVLSEYDKVAPYYKGLPALFEFSFWYRLEWGINNSTGCYFAKDILSYQQKYANYRSDYIEATKLSNHDEDRTSSKLGKSADKCKLAAAVLLTSAGHPYIYYGEELGLYGTKDNGDEYVRSPMLWGDSYTTNYTDKTDATVSKNVKTVADQQADTHSLLNIYFSLTRLRNTYPALAEGNMTKHSVYNESQEKDYKPIAAWYMTKDNEKLLVIHNFGGTAMQLPLTDKIEKVLFVNGETQQNTDSDSYTLKLGGYASVVFKLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title SusG: A Unique Cell-Membrane-Associated alpha-Amylase from a Prominent Human Gut Symbiont Targets Complex Starch Molecules.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Membrane protein
molecule keywords Alpha-amylase, susG
total genus 187
structure length 650
sequence length 650
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k8mA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3k8mA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k8mA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3k8mA03
3EYFA 1I9JH 1S7VB 3UAJC 2FHFA 4NCC1 3B9KC 1BIHA 3TWCL 4GQQA 2AK4E 3HI1B 4DGIL 1YNTA 3DLQR 1IT0A 1JF6A 5IVZB 2A3HA 1OD0A 4KK8C 1WZ1L 3UZQA 2CPUA 1OBAA 4N9OB 1AGCA 1TMCB 4OZGB 4J23A 3CV5A 1OSZA 3C87A 5F89A 5C2BL 5BXTA 1U6AL 1U8OB 4QP0A 4I48A 1KQYA 3FRUB 4OZFH 3HE7B 1Q4NX 2GK1B 4M4PA 3EMQA 4FTVB 1KNOB 2ZUUA 3MLSL 3WIFB 3CUFA 3AZTA 1KTDB 4POZC 2A3BA 3MXVL 3PL6D 2VLRE 1P4LA 4MNQD 2VUYA 3MROB 4OZFG 3MROA 1CYGA 1OCWL 2R1WA 2V17L 4JN1H 2D4FA 1T3FA 5FB8B 5H37H 1WK0A 1WCQA 3F8UB 1CZ8H 1PIFA 1NUFA 2OQJB 1F90H 3QG7L 4KI5E 1U95A 3NCBB 3BLBA 4F7CA 1H5BC 4KKAD 4PRHB 2E8YA 3ROOB 1R5VA 3EO1A 4AEIH 3NDZA 4E8CA 3MRFA 5B8CC 1X3DA 2NYYD 2GJRA 2ZCLL 3BUDA 2GK0B 4FFWC 4P9ML 3QUYD 5INCA 1W0VA 2JIXB 2X4PB 1CQYA 2ESVB 5L9DL 3REWB 3WNPA 1QO3A 1SMAA 1G0DA 3MUAA 1F3RB 2ZXBA 2Y1VA 4YPJA 1B31A 2DQDL 5HI5C 3EBVA 2YD7A 2XIBA 1K4DA 2D7NA 1NJ9A 1OAQL 3MUGA 3WKZA 2R4RH 2XM1A 2UZXB 3OJDB 3PGDA 4HUUB 3BKMH 3VWJD 4N0UA 5I71B 1KF9B 5MEPB 4LLYB 1OGTB 4H5SA 1HQRA 1IM9A 4D3CH 1YEEH 2JJTC 4RGMB 3IU4L 2HISA 1SEQH 4XPTL 4JLRA 4D9LL 3S5LA 5DJCA 4AZ8A 3ZO0A 4AD3A 5DTFB 1G7PB 5LAXB 1YC8A 5KVEH 1MFEH 2HT2C 3S5YA 1H0GA 4KMTL 1KB5A 4LP4A 2QBWA 3ARXA 1NLDL 4MJIE 2HP4A 5TD4A 4DZBB 2WWKT 4M62H 3VFNB 1XCTA 5GS2D 4QRRE 1CZ1A 4ZTOH 4U1MA 3X3FH 2J79A 1T03L 5K9OA 1LK3H 4V1DD 2YBRA 1CGXA 4KRUA 1JGDB 3V0AC 1Z2KA 3SKJL 2DQXA 3FT4B 3QUXC 2EAEA 2R4SH 3UC0H 3BIBX 5EZJA 2VJXA 1C93A 4UFJA 2VL5A 5HVWA 3T2PA 5CGMA 1QA9A 3HE7A 4CD8A 5GRUL 5MEQA 4W70A 3GXNA 3N0PB 1AXTH 4NZDA 2PKDA 1WAAE 3I3EA 3NIGF 43C9A 4M43H 4NQCD 2WPGA 4NO2A 5GSVA 3FFDA 4LMQE 4EDXB 1FAIH 4UQEA 1ZAGA 4L8BA 2VR5A 1EBPA 5BVJA 1CFSB 3AIEA 4UT9L 2XHYA 3HE6D 1IBGL 5FECA 4BZ2H 1NBZA 1J05B 3MOAL 3TO2B 2VDLH 3V6BR 5LXGL 4WO4A 4QXGL 1SYVA 2D23A 2PXYD 2XZAH 1NC2A 4DQOH 4PLJC 1XSJA 2GJ6E 3ULSA 4NYLA 3WDHA 4BH7A 4D0CA 3SGEH 1BBDH 2G2RB 4UOQA 2CUIA 5J6GB 4G8FA 1E4XH 5D2NE 1DE4B 3UTSB 1FA2A 4X80L 4PJGA 5C0JB 1V3LA 3ECBB 4HJJH 3MODL 3T8XA 1N82A 4AYSA 3QEUA 3WL1A 2WC7A 5HI3D 3MFGB 3M46A 4H20L 5F8QC 2O9RA 2OWWA 3TESA 2YSSA 2MNUA 4Z7WF 2WIMA 2JF1A 4ZO9A 3O3DA 1FH8A 4P7OA 1FFPB 5TDNA 1AHWB 3MOBL 2OR9H 2HRPL 4Z7WE 5EOCH 5HGBA 4E41A 2FRGP 1R85A 4CCEA 1FORL 5TQ0H 4Z7WB 5L0QC 1U92B 4JFWA 4HIIB 4KK5D 5D1ZB 1BAFL 1S9XB 3KYOA 5I73B 4IRJA 1YPZB 5E5MB 4O02L 5DHVH 3SN6N 5JA9A 4JB9H 5F7NC 2J7DA 2YBTA 1C91A 1LL7A 3LV3A 4I18A 4AIZB 3VIOA 3L9RA 2AV1A 4MA1C 4ZOBA 1E5NA 2NZ9D 5GS0C 2VIRA 3GI8H 3VXMA 4HS8L 4JG0L 2W0KA 2XNAB 4OFIA 4DM1A 1UB6A 3QPQC 4MA8L 4D0BA 2V2XB 5LGHH 5EZJB 1KCUL 2D03H 4JDVA 1N2RA 5HGAA 3WIHL 1HL9A 3IF1B 4KDWA 3VXUB 4JRYE 3KJ6L 3P9WB 1EDGA 1AO7A 4O02H 4FK9A 1OAYH 1MAKA 2HMID 1JD7A 3BDXA 1FPTH 3SCSA 4WEBL 5CEYB 6TAAA 3TA3D 4UFLA 4J3VA 5D5MF 1UT9A 3LSOA 1IL1B 3H9SE 4L3ED 4HC1L 2O9PA 3IU3B 5FKAB 2IH3B 2ATPA 4HIIA 4R3SB 1EFXA 2E9LA 1MFAL 3OKMA 1ISYA 1W8OA 1PLGH 5AEAA 1E4XI 3Q6FB 4BYHA 2AJ3A 4GI9A 1LDPH 4ZS6D 2VXQL 3MA7A 2IALB 4JJHA 2AJXH 3FCTA 1UR4A 4NQSB 1TFHA 5CPSA 2VZSA 3LKOA 1EQPA 1XCTB 1XH2A 1T04B 3M17A 1FSKC 4JHBA 4TX6A 3KPLB 4C4KO 2Q8XA 4YZFF 4P99A 5KG9A 3B3IB 4NNXA 4C56E 3ARVA 4UZSA 5FD0A 1BBDL 1Q9OA 3O4OC 4R97C 5HGHA 2E7BA 2DQCH 3L3GB 3OTTA 4ZFOL 3OF6A 3OKOA 4BZ2L 2XN9E 3KYMB 5K9KA 3IFLL 3O11A 4ODHH 2VUOA 5DJ2A 2R0ZH 1H5BA 2K1MA 5GRZA 5KOMC 5IF0A 2JEQA 3NZ8B 2DIJA 1J01A 1KENL 3LKPB 3FB6B 3M07A 1DHKA 2H3NA 2HKHL 1MIEH 3S2CA 1JFXA 3WUGA 2I26N 2DQUH 2VXUL 5D1ZC 3TNMA 4P5TA 1FL6A 1ZANH 4QHNB 1YEJH 4P46B 2QR0B 1AP2A 4A6YA 3BOVA 1T22B 4QT5A 1PKQA 3VA6A 4MA8H 4Y16D 5EO9A 2ZX5A 4YHOL 3KPSD 1TNNA 3ARFD 5F3BB 1BGGA 2BVQB 5IFAH 3JUZA 2XNAA 3WFDL 3RWHB 1X5KA 1QG3A 2CXGA 5FYLD 1C16A 2FJHA 3RI5F 1ZK9A 1QFWL 3I6GB 3CZJA 1E70M 1E28A 4QRPD 1E28B 4WUUE 2OK0L 3IJ7A 5TFSL 2CKSA 3VFGL 1J8HB 1BZ9A 3UX9B 1XR9A 2VE6A 3MYJA 4N0YL 3ZO9A 2AQ2A 5I1CL 3PTMA 1ZLWK 2VRJA 2ITDA 1F11B 1MWAL 4P3CL 5E6IA 4GAYB 5SX5H 2B5IC 3E6FA 4PGBA 3LEVL 3SDDC 4FXKA 4NNYB 4GRLD 5GISH 1DQTA 4D6JA 4KY1L 4U6XB 3RUGF 2UWFA 1RUQL 1WICA 1KCRH 4XCEB 3ZSTA 5CZKA 3WNKA 4TRPL 4S1DC 3G08B 5D2LF 3U36A 4JFQB 5FCZA 1UR9A 4IDJL 3S8WA 1OT1A 4B53A 2XG9A 2VLMD 4HWNA 2V5YA 1YY9D 3L7EB 1JZ6A 1VB9A 4LCIL 2R4RL 3LXCA 4KI1A 3GXIA 3ULUD 4YHZH 2X2JA 4OOZA 3GSVB 3LN4B 5BROA 1KCLA 5F1NA 3ZMRA 1TG7A 4PTUB 2I9LB 4H0HB 2H2PC 3F7RA 4E0RA 1B1YA 2P8PB 1EO8H 2YDRA 4AZIA 4YIQA 3MLZL 4JKPH 4TNWF 4YDKL 2ZKHH 4GRWF 1NP0A 3QPXL 3FQRA 4RBPK 5SWZD 3DXAD 1UWEL 5SV4A 1ODUA 1E0XA 3QXWA 3KLAB 4KDVA 4J3TA 1G1YA 1F58L 1UXWB 3IDNA 1R7OA 5GGRY 4AEIL 3NCMA 4MXWL 4PJBF 3VD4A 3K46A 4RFOL 1OPGL 5I75C 3GMNB 2WBJC 2YEZA 3LY6A 4I3RH 1YY9C 4R2GB 3KLLA 1KTLB 4AXNA 3CZSA 3WDRA 2XVGA 2ZUXA 1ZTXL 2G3MA 3QI9D 1YUHB 3GSUB 5T33L 3GUTB 2NT0A 2YL6A 1FO0L 2Q76B 1BD2E 4BJLA 1FH5H 5IP4A 2DLFL 4PUBL 5C6PB 4OZHF 1L0YA 3MLYL 1DLHA 3C2SA 1KEMH 4J6RH 4KMQA 3PN8A 1NUGA 4DGVH 4U0RB 4OZHE 4HT1L 1JHKH 5DD0L 1QNPA 2BVQA 3B2UD 2UY7A 3QFJE 2QV4A 5ESVA 4IHOA 3RL2B 1OP5H 4NI3A 4FTVA 5HYQA 2YPVL 2EC9T 4FS0A 2DH2A 2YPLD 1GZQB 2J8UE 5EUOB 2I5YL 4Y4HC 5JZ7D 4JZNA 2Y36H 2XWJB 1WWWX 3IJSA 3NAAL 5E4EB 5I1LB 4WDIB 2W1NA 3ESVF 5KSBF 1I9IH 2PCPA 3ARDB 5SWSB 2BFVL 1R86A 1Z9OA 5TDOB 4WHYH 2X89D 2WUCL 2BOCB 5EG6C 5EA0L 3M7SA 3AIWA 3F6IA 1IGCH 3PP4L 1T4KA 4MSWB 4HZLB 4I5BB 3AZSA 1I3UA 4MJIA 1B6UA 1PG7W 2AABH 2BVOB 2VITB 1IGFH 3MV8B 3OZ9L 1UWXH 5DVOA 4W84A 4N8CL 2YL9A 4QFUA 4OZ4B 5TQ2L 5I5RA 3ETBF 3G5VB 4FFYL 1OM3L 3RVWD 1T03H 2OWXA 2P49B 3AIBA 3O45B 4OCYL 1SJEB 1OAQH 1UC6A 3MRMB 3ZE2E 5KSBA 3PWLB 4U1SA 3LPFA 1MRCL 4Y5VB 4WUUB 4KI5C 3U36B 1NFIA 3ARPA 1OB1A 4OLXL 2DQJH 3HG4A 3MCG1 2VCBA 2WZHA 1MJJB 5IUSA 1INDL 1KCVH 1E0WA 4TNWK 3T0EC 5KVEL 3RO8A 3TOPA 1MI5A 4Q2ZA 4Y88A 5ERWB 3RZCC 4D2NA 3B9KD 4TSCH 3Q5YA 4UAOC 1XMWA 4RMUA 5J3HD 4NRYB 1YYMH 4X7SL 3OAZK 5F6HI 1BF2A 1IMHC 1P4IH 4JFOB 1NL0L 3DHPA 1LQSR 3PHQA 4PD4K 4R7DA 5F9AC 1T2JA 3V4UH 1RZGA 1FFQA 3MLRH 1R34A 5CSBA 5FUCE 3U46B 4K8RC 4Z8FL 3WD5H 3PV6A 3VVGA 4L8DA 4JN1L 4GKZB 2XZCL 3IFPB 2F1BA 3ARWA 4P2OB 2DQGH 3BT2L 4GO8A 1QR1A 3L3KA 2Z31B 4XI5D 3DGCR 1S7RA 1T1ZB 3FZUC 2VXQH 4F15B 4B50A 4WF7A 4LRNH 3PWUA 1BIIB 1F4XH 1U6AH 4PSPA 1TVHB 5IB5A 2J77A 1WWCA 1I7ZA 4U1NB 1MI5E 1FVEA 4BELD 4H25A 4HV8A 4KKAC 3DC0A 1WAWA 5IFHH 3MRCB 4PTWA 3KPOA 5C0DB 3TWCH 4CN6A 3QG7H 1HVQA 1F90L 1CDGA 3ARSA 3LQZA 3ILPB 1DL7L 1R46A 3EOTL 4P4RB 4P5TD 4PBGA 2C3XA 2DD8H 4PMRA 1NKRA 5HHMD 4MS8C 3OZOA 1F3DH 2HLAA 4JY4B 4JQVC 3EYFB 1R5IB 1KC5L 2YWYA 4HSQA 4AYGA 4WI4A 1LEGA 4JO2L 3FO0H 4PJFF 3GMNA 2DI9A 3Q3GB 2XFXB 4FXGB 3E6HB 5J13C 1GOGA 2BSRA 1RJZA 4U1KB 1F6AB 2F53D 3D5HA 1G9ML 4N5EC 4P2QD 1T5XB 1JIBA 5J57B 4M48L 5E94B 1SJXA 2PUQT 3W0WA 2TAAA 4K23H 5AG9A 4F7MA 4IJ3C 4WCYH 1TNMA 4ACZB 5D7SL 3LXAA 1E0VA 2UWEE 4TSAH 4KKCD 4UQDA 1UA7A 3GK8H 2HRPH 4KJPC 1NEZB 4ODVH 2OSXA 2NY6B 4TQEL 1IQWH 4HKZB 1SR0A 4EVNB 5ICXB 3E2HC 4ODBD 1RZ8B 1QFUH 2QSCL 5L88H 4PG9A 1CQKA 3W82A 1AO7E 1JZ5A 5I15H 1N3NA 1LO2L 4APQD 2B1AL 3AVEA 3HG1E 1FRGH 1CGTA 1MSPA 5DD1L 5EULV 3POHA 4LVOC 4EQ3A 3KWWB 3LHPL 4P5MA 5CJQL 5EU7E 3N15A 3DX7B 1YECL 5BS0D 2NTFA 5BMFH 4OGYL 5FECB 4EUPB 1PKOA 4PRHA 3CUIA 1DQLL 3T3PE 2DF3A 3ARBB 1UWGL 1WEJH 3C8DA 1A1MB 1XIWC 1PX4A 2XVPA 5JW5A 5D9PA 1ERNA 3G5ZB 3QJHA 5F7EH 1S3KL 1JGVL 5CKAA 2XFFA 1D5ZB 4PB9L 3RPKA 5BRZE 2EDDA 5FCSH 2GVYA 3QNXB 1AFVH 3QUMH 1OW0A 4AYFA 3D0LB 3NPSB 3L95B 5T1MA 1XF5B 2X4RB 4M1RA 4HC1A 3QHNA 2AXGB 1UZ6E 4PJBB 4XVUC 5FCUL 5EO1A 5CAYB 4AZ5A 3TCLB 4CCCA 4F2MB 1KFAL 1ONQB 2IQ9L 1BVLA 3EJJX 4L8SC 3MRIB 5CZXC 4WCYL 1TIUA 3DVNA 3OG6B 1X5AA 4MQTB 4PRID 3PQYD 3ZHLA 5EBWA 1DBKH 3KWWA 4UV7L 3V79C 3BZ4B 4OM0H 4GINA 4NQCE 4BQCA 5C07A 4H1LG 1LK3L 1KJ2A 3NSNA 3QEHA 2BSTB 1TDQA 1OAKL 4JM2D 3VFNA 4KK9D 4G6KH 5CEXB 4FQXC 1UB5A 4LSDA 3L4YA 3U1SH 2DTML 5JDSB 4KY1H 5JTWA 3UBXB 5JQ6L 3VWKC 1EHNA 2FSEB 4JM2B 4Z7VE 4UTFA 4RGOL 2BSSB 4I4WB 1MCOL 2FSEA 1MFEL 4DO5A 1XGTA 1CDYA 4FQCL 1VEOA 3RU8L 4H0IA 5IWLA 3RDTC 4LIQL 1T89C 4DM2A 3BXWA 3N85L 1NC2D 1DL7H 4FXKB 4ZDHA 3OGVA 2NCMA 2YPKA 5I1GL 4KZEL 1TZHA 4FQJL 4JRYB 2FO1A 3K1KC 5IXEA 2C3GA 3HE6C 2BX5A 3VXNB 3G04A 3U48A 4JJ5A 3A24A 1JMXA 1CLVA 2QKIA 3MYZA 5TE7L 5GSVB 3PZIA 2YRPA 4GKNA 3U7AA 2IFFH 3NCJL 1C08A 3RIAF 4IMKC 4PJAF 2VXTH 2GITA 4MJ5B 4WTZA 1L9NA 5GSRA 2H32H 2J7BA 5IROC 1AHWC 4XMPL 5CBEB 2ZCLH 4IPLA 4C7GA 4GFTB 3EYSH 3DX7A 3MJ9L 2CD0A 2G3JA 3PGCB 4K8RD 2DJSA 1GW1A 1L6XA 1WIPA 2XPKA 5K9OB 3LZFH 1I1AB 2JCCB 1AQDB 4U1HB 1P2CB 3GO1L 4X0NA 5T3XE 4PB9H 1NL0H 4MNKA 5BYWA 4X6CE 2J4GA 1G6RA 3CD4A 4JFPA 4XCNA 1Q6GA 2E8ZA 3SE8H 4OFYA 2UYLA 5E8EA 3CMGA 4OGYH 2WZEA 4Z6AT 1MFNA 2VCAA 5IB3B 4ZO8A 3CMJA 2ZOKA 1FNSH 5ALBL 4P4KB 5EZIH 1J1PH 3TIDB 3GM0A 1J0KA 1UR1A 3THDA 1HINH 2NY3B 2WM0A 3VXME 2OSLB 4PRBA 1QOXA 4Y4FD 1DDHA 2FLRT 2WMPA 1MCDA 1S7UB 4O9HL 3RIFF 4HP5A 3VMPA 2NNAB 3LAFA 1XGYL 1A0QH 4XMKH 3WQ6A 3QUKB 1CDHA 3RWIB 5C0EB 4OZHA 2JALA 2X4TA 3WF4A 4UT6H 5C0EA 1RZJH 1VPOH 1P9MA 4HKBB 3BUYA 3QXDB 4X4YA 4LAQL 1GGBH 2YD1A 2R29L 1J10A 1E6NA 3MX0A 5CQ1A 1ISZA 2L4OA 1L6ZA 4PGJA 5J4MA 2CKNA 3GSWA 4KQ4H 3D39E 1QACA 3WKNA 4RDQG 2EIBA 3B3IA 4NNXB 1O7VA 4OZGE 3FB5B 3SCMA 4HGWB 1NANH 3F4VA 4AD0A 1FGNH 2RAMA 4PGBB 4N1CA 3D51A 4JVPA 3T65A 1LO3L 3L95A 5AYUL 5T1MB 5C3TA 3Q0HA 4S10A 5JHDB 3AS0A 1PG7H 3I75B 2F5AL 2M2DA 3DRQB 4ZFGH 2J7HA 3GMRB 4HZLA 4DN4L 3VDBA 1KTCA 3MNZB 2B4CL 1R3HA 5DK2A 1UD2A 3FFCE 5IG7B 1TLKA 4DVRL 1V03A 1W1PA 4UNVA 1E6XM 3HNVH 4NQEA 1CL7I 5DRZB 4X6BA 4CD6A 1JI2A 4M7ZC 3LEXB 2ZSWA 4MVBC 4RE3A 1AIFB 2DL9A 4L4VA 4FLOA 4C7FA 1U3ZA 1U8OA 2FD6L 1JK8A 1RHHA 1RUAH 1S5IL 3QCTH 4G8GD 2IXUA 1FZKA 3S36X 1A7QL 3HUJE 3QB7C 3QDME 5IFHL 1PKQB 5E9DE 2VWEE 1AMYA 2JEPA 1OW0C 1CLOL 3DVGA 4LPCA 1P7QA 4QLJA 4LCWE 1CLXA 4Q0XL 3CBWA 1G0XA 1RJYA 1NFDF 1QEWB 5L2JA 4NQTA 2QHLA 4QCIB 4Y2OA 1R5WB 1FYTD 3U57A 4B9ZA 2B4CC 5D1ZD 5MERB 1J8KA 3FO1A 2YSSB 2G41A 3AROA 4XT1C 4JO1L 4KRLB 4RE4A 5DZNA 2HRLA 5F44A 2BOBB 1XYZA 2H2PD 3M8OL 5IVNA 1MHEB 3SKUD 2AS5M 2CJUH 3S9DB 4NWTH 1LO5B 5I17B 5I17A 4LKCA 1BFOB 4HG4K 1J9YA 1G7MB 1HQ4B 3L4VA 1BEYH 3LIZL 1Z9LA 4OZHB 2R1XA 3A21A 1SJHB 3KL3A 2APFA 4NQSA 4FQ1L 1NANI 3TFKC 4N68A 2X1XR 3MV8D 1UJ3A 5E0CA 1J7VR 3OGCB 3RX7A 1EGJA 3JWOL 1N59B 4YWGH 1AC6A 1V6YA 2AV7B 3LPGA 1VEMA 5MI0C 3OPZH 1AXTL 1R5WA 4BS0A 3HI6H 1JP5A 2COQA 4HF5L 1U3HA 1FZMA 1QFWH 2X4SB 5J89A 1R24B 1E0OB 4EKJA 3K8LA 1BX2A 3ZQ9A 5D1XA 1KJMA 3DIFA 3L6FB 3KYAA 1P84J 4OSUH 4NRZA 1AD9B 2EH8H 4CL7A 4GKSA 3QQ3B 4EDWL 4LEXH 3RWCA 4HCRL 2GW5A 2WBJA 4ZOCA 4OCWL 2CITA 3ILQC 4D72A 2WUCH 1TZGH 3TCXA 3BRGC 5KVDL 5IHBA 4XX6A 1DN2A 1AQKH 4KPHL 4I0CC 5DVNA 4ZTOL 4PJFA 3RVUC 4ZG1A 2W65A 1ZHBA 3ZL4H 2EYRB 5IGXL 4POYA 4O2FA 1Q0XL 5I78A 2EE2A 3GSOA 2EYTB 5HHXL 2YD5A 1DBML 2V9TA 5EZOL 5B4MC 3AICA 4ZUVB 3VRJB 2XTLA 4OF0A 1U91B 5F71A 2H6PA 3AIQA 2BDNH 1NOUA 4NNPH 4OCXH 5I8KL 4G8IB 2ADJA 2CMRL 5FO9B 4PTXA 3WH5A 3MV11 4OD1L 3EYQD 4XXDB 3CUGA 2OI9C 2P8MB 3P0VL 1JNEA 5T3XL 4ERSH 5D93C 4ELMF 1HT6A 3SCPA 2YUZA 4OV5B 1R0AL 2FX7L 2YKLH 3BGFC 1YYLL 3TBSA 1JWUB 4RWHA 2E5EA 5ID0A 3DXAB 4MQXC 4UINL 4MB4A 3J7HA 1SJVA 1RQ5A 3BAKA 3WV0A 3U0PB 3GB7B 5EBGA 4M5ZH 4IISA 5LWYH 2VABB 3NABH 3BE1H 1SJEA 1KFWA 3VWJB 4OCMC 1GOHA 1IKFH 5FGCB 3VFPA 4UT7L 1QPKA 5M7QA 1GAFL 1BEYL 3UJJH 2YHGA 1KPRA 4UAOB 4LLYA 3WENA 4JGMA 2V2WB 1P7KB 4EJ1C 1F4YL 1RZ7L 2BHZA 1MRFL 3N13A 1IEAA 3VFOA 4FMFA 4HWZB 2AQ1A 2C1OA 5CSYA 3CDYA 3NSXA 1J5OH 5CSUA 3BZ4A 4LSQH 3WIHH 5AG8A 1CVRA 1QQDB 3FT2A 1BGXL 1FCGA 4LKXB 3RBGA 1OTUD 1SQ2N 5J8OA 1G5AA 4PRHD 4G9FE 3EFFA 1IGYB 2HLAB 2BP3A 4DTGH 4UQ2B 3S96B 4S11A 5LYRA 2PWGA 1HKJA 4PJ9D 5BOZG 2R2HB 3QWOA 2HJLB 3IFOA 3BZEB 1KIRB 4NQDD 2EO7A 5F7FA 4WU5A 4X9GA 3BZEA 2NTFB 3IDYB 3C5SB 4KHTH 5D1XB 1E4WL 1LK2B 1LVEA 3WD2A 3Q1SL 1CLOH 1KXQA 4MD0A 4G5ZH 4LVHB 3KS0H 2Y5EA 4WHYG 1KLGA 5D1QC 2AJVL 3WE6B 4PJFB 1H4PA 5CPTA 3S4SG 3OB0H 2B31A 4WW2F 4K7PX 3HI1A 2JK5A 1IAOA 1A6VL 1T20A 3QO1B 4MB1A 5DLML 1E4JA 1TITA 1N8ZA 2FDBP 4NZTL 1YPZF 3SBWA 1FNGA 2FL5B 3IS0X 3MLPA 1LE5B 1ZKAA 1KN4L 4PR5A 4PV9B 1H49A 1HKLL 2RCSL 3K8MA 5F96H 4Z0XA 3INUL 5CKGA 2DB8A 3O6ML 3FW6A 2OBGA 2VDQL 2F18A 1SY6L 5JUEH 2CRZA 3MV9D 4C55A 1DVFD 4ZYKB 1OCQA 4ELME 3WNOA 2WIIB 1YNKH 3RAJL 5IV2B 1JHLL 5CSZA 4TOQA 3OIHA 3QEHB 3TV3L 4UUJA 4KKBC 3OZPA 5DJZA 3CPUA 5IEHB 2YN5A 1NCWH 3HA0A 4K3DH 2QPSA 3LRGA 3NPZB 1E4MM 1HN1A 4F15C 3U9UA 1V0KA 1UCBH 3V4PL 5MP6H 2AJYH 1V8HA 1OIMA 5HGHB 5EPMB 5I30H 32C2B 3GSRB 4CU7A 1EEQA 1JTOA 5E8EB 4GG8A 1QNOA 4Q22A 4PJBA 1P5UA 2X4RA 3HMCA 5F1IA 5EZIL 2EYTA 3ARGA 5JXEC 2GSIB 4D6CA 1ONQA 1HIMH 4I18C 4XBEH 1V0LA 1PX3A 5BS0A 5FHAL 4LNRB 1J0HA 3NFPB 4GRLC 1DBBH 5FB8A 4LNRA 2WHMA 3IS1X 4HULB 4IMLB 1U8KB 2IQAB 4M6AA 3F12A 4JY5L 5ECJE 1CR9L 4HC1H 4L8DB 4Z7UB 4BQ9A 4DKFL 4YXKL 4NM8H 3UESA 1JF5A 2R69L 1MHCA 4PRAB 4G42B 4MQXD 3CLWA 4KRNA 3ROLB 4BSVA 3VXPA 3NPSC 1N7ML 2R1YA 3QDJA 4WIQA 1EGJL 1Z6JT 3QNZA 1R3JA 1VACA 3CSYA 3BH9B 3O8XB 5MHSE 3OLDA 3WHE0 5DEZA 4Z77B 3DO7B 2VR9A 5FYLH 3QEGL 4JPKH 1LE9B 3G6LA 2GTZB 1SBSH 3H9SD 3BGMB 4FFZH 1RZ8A 4L3EE 3SGKC 3RJYA 5EIVA 5C09B 5HHOB 5KSAC 1RVFH 4OCRH 4XP1H 1YJDL 1PZ5B 4NOBA 3ZJ6A 1KBKA 1BM3L 3QEUB 1QRNA 3VRLE 2CK2A 4HWEL 4RFNC 1DN0B 1PQZB 5D7JB 1YJDH 1VF8A 1EEUA 5I8OH 1WBXA 4UTAH 4UV7H 3O6KL 4KZEH 2DQTL 4FHBD 1BQCA 4HPYL 1XZ0A 5A3IC 3UYOD 5TGBA 3DX6A 4IOIB 5ITBH 5IEHA 5E6ID 1X5IA 1QRKA 4FQCH 1KEGH 3C6LB 2VDMH 4XWOC 1HJXA 1S7UA 5ICZB 4HFUL 3L3IB 3B4NA 2C9AA 1RD6A 1XD0A 3M1BA 3T8XB 3D3VA 2G75B 3FONA 3PDOA 3VXOA 5KW9L 4LGSB 3FN0L 4TVUA 4Z77A 1HHIA 3MODH 3NCOA 2EE6A 5J6GA 4EN3A 1F6LL 2HVJA 4QRRB 3BUQA 5E9DA 3HE6B 1M71A 3T09A 2GHWB 3CDFA 1IAOB 3HC3H 4M7JL 1GCYA 3OR6B 2DSVA 2XKUA 4ELMB 3MRCA 2VL5B 4HLZH 3DVNB 5D96B 1NUNB 5IT2H 2H9GA 5C8JB 4A3HA 2FIRT 1GORA 2D4DA 1G7LA 4HUVA 1QBLH 1CD9B 5EO1B 1QNQA 2BRRL 1I1YA 3UJIH 2X4QA 1Y18B 5EU7C 3TH3T 4FQXD 3T0EE 1XSIA 4QOKB 3BZFA 3K4DA 3VXNA 1H3GA 1TPXB 3PABB 3SQBA 4MMZC 5C0AE 1I8IA 4HXBH 1JGEB 5F3BA 2R2EA 1T7VA 1OSPH 4DO6A 3MRKA 2P24A 4UDTB 2RJMA 1VGKB 4X7CC 4QRRA 4K23L 1TETL 3FB5A 3ZHKA 2L0DA 4OUOA 5EPMA 3QHTC 3VXMD 4Y89A 1I1CA 3VIIA 1YNLL 4XWGL 4P57B 4XC3H 3MOQA 5JXEA 1EDQA 2J6EH 5I1HL 1DSFH 3UEZA 4U5IA 2YEZB 2EXOA 4NFBA 1U58B 2BRQA 1OF2A 5ILTL 4WSKA 4AT6B 2OW6A 3VGAC 4I77H 4OB5H 5F7WC 4HH9A 4W93A 4XCEA 3SUUA 1RULH 3UPCA 1Q94B 1V7ML 4BQ4A 1CFVL 3QUMB 3ARBC 1HSBA 5IVXE 3TZVD 4QNPE 3G6JE 4WFHE 4X4XA 3RVXD 1P5VA 3BPNB 3QDGB 5DLMH 1LO5A 5JNYB 1V7NH 1A7PH 2E9IA 5JHDE 4IOSD 1UEYA 5F1NB 1EHLH 2D3LA 3VGGA 3FAWA 5FO9A 1YNKL 3NA9H 4GSDH 1F42A 3FCTB 2Z31D 3QR2A 2AJVH 4X6CA 5EZLA 4TVCA 3F7VA 1OWRM 1FYTA 5F9JB 1XGPB 1T04A 3UPAA 1WT5C 5BQ7A 3OLIA 4H8VA 1BM3H 3GMQA 3QJHB 1D9KB 4CRPA 4WHCA 4UOW0 3WUFA 4JFUA 4LCWB 2MCPL 1KC5H 1NGQH 3U82B 3BQUB 1V02E 3MJ7B 4NKMA 1QHZA 1I1FA 2G3NA 3VXSD 5I16B 1PKQE 1FYHB 1KJ3H 3GIVB 4XAKD 4LVNB 4HCRA 4EXPX 4YDJA 1J0YA 3UDWC 4XPGL 3TBVA 1C7TA 1X5YA 2BY1A 3MLRL 3VXSA 4A4AA 4P4KC 4WK9A 4KGJA 1GOKA 3GHBH 4TNVK 2VZOA 3Q6GL 1S7RB 3HC0B 3Q2CA 4PJIE 4WUUD 4WV1A 4PYSA 2GSGA 4H1LB 1ZA3B 3GSNA 5DUPL 1QWNA 1B4JL 1UKPA 3RVTD 4G3YL 2X10A 1XGPA 5EO9B 1DEEA 1MCNA 4OOUA 4AL8H 3MLSH 4UQAA 4G9DB 3RI5K 1YN6B 3UTZA 2CRIA 3VH8A 2ED8A 2Z35A 2GJPA 2ZXAA 5DJCB 3WHE1 2BNUB 3BISA 2FX7H 2YKLL 4CAGA 4Z78B 2W63A 1GZPA 2NR6D 4AM0B 3BKJL 3CC5A 5DMKB 4RGNB 1JPGB 3WN5C 3SDAD 3SCNA 5ETUA 4C59B 3SDAB 4PGZA 3WF2A 3LD8B 4NQVA 3DETC 3BCDA 2CNCA 4NQVB 1JWUA 2HJFB 2BV9A 3VCLA 1M04A 1VDGA 4JQXA 3BH4A 4OFKA 1A6PA 1MH5A 1IFHH 1E4KC 4DEPC 1G94A 3L7EA 2BFVH 2GTWB 4EUPG 5D7KE 3UO1H 5H8DA 2FNBA 4U1SB 4NUJB 4HIJB 1XIWD 2FATH 3SJVE 4AD1A 3H9SA 4NDMA 4JFZH 4XRCB 1WWBX 4KKLC 2CPCA 3GXTA 2G60L 2OTPA 1WZAA 1OAZL 3ARDC 1U42A 3HAEH 4H25B 1JGEA 4WI6A 4G8IA 3H3PH 1RY7B 4XVTH 2J7FA 3SGDI 3MRKB 2FH8A 4UNTA 2AABL 2VISA 4QWWD 3K80A 2EDKA 3IGAB 4R2GD 3N12A 3HMXA 3TYFB 4X6DE 5KTEH 4OSUL 4P2CG 3H2WA 4EDXA 3PP4H 1CLYH 3C60C 1FH5L 5K9JH 1HXYA 3O2DL 4H8WH 5DJ0B 3GBLA 2NY7L 1MCLA 4PJIA 5SWZB 3MUZ1 2MANA 3PE9A 3U7WH 2EO1A 3AUVA 2CO6B 1LK2A 2I5YH 3CVHL 3CDGB 1JHTB 1U36A 3MQIA 3U30B 1KXVA 3BVVA 3D9AH 4HUMB 1Z9MA 2DLTA 4YEEA 4OGXL 3HNTL 4ZAKB 1T22A 1UD6A 4UNIA 2ADIB 5E99L 1G7HA 2VZUA 4I1NB 2UY6A 1AQMA 4N90D 4P2QA 4FABL 1CICA 1OGAE 1YEIH 3MBXH 5D72L 4GAFB 1PY9A 4JO3H 2ICWA 2CJUL 4TUOB 3P11L 2VXSH 4NN5B 1N59A 1C8XA 4K3EH 4QAWA 2R2CA 1GGIH 1LDSA 4YK4B 4Y5VA 2VN4A 1QNZH 4M4RA 3H9ZA 1UG6A 4ONGL 1Z0NA 3B43A 3KNBA 5FO8A 1NLBL 2JJSC 5DRNB 5DTFA 3MRJB 2BVPA 2OSYA 3S37X 3X17A 1WFUA 5DMKA 3HN3A 4Z7WA 1AH1A 2XPGA 2CESA 4YHPB 3K4ZA 1B3XA 4AZCA 1UXWA 4XNUH 5ERWA 4AZCB 3G5XA 4NO5B 3TNNA 2VMFA 4DKDC 5ISZD 5H94B 4JO4H 1LO4L 3MJGX 1HZHL 4G7YH 1VCAA 4QRPB 1INQB 3MXWH 4K3JH 5EIQA 5T1LD 3ULVF 4JKPL 2VCCA 3BMVA 5KS9E 1W3LA 3HZVA 4L4OA 1V3HA 1IVLA 4LBEA 3NABL 2UY3A 4NWTL 2CQVA 1FDLL 4XH2A 5ID0B 1LMKA 3OJDA 1A14L 4OLVL 8FABB 4NKOA 4PJDF 3QDJB 1JPTL 3BPLB 4WV1B 4ZPTB 4P46D 3KYNA 1KJ3L 3TV8A 1CNVA 4EEEA 4XP6H 5C0RH 4WUKH 4POUB 1LE5A 1EMTL 3MSGA 4Y4FB 1NMCC 3QDHA 4DWHA 1T0MA 2I9TB 3R06B 4JREB 4RFEB 4RFEA 1TVNA 4P23A 2D7QA 3OJMB 3DRTA 4HV8B 4LU5H 3EKCA 3ROOA 1I3RA 4TSBL 1WCGA 4NQDA 1BFNA 4NQDB 3RKDC 4MCYA 1OAZH 3TYFA 2I24N 2GY5A 1FNLA 1AGFB 5IR1A 3RZCD 4P2OA 1IC7H 5FYJL 4HOWA 4S3KA 3WEOA 5M5DA 1IC5H 3DBXA 2DYPD 4G43B 4ZENA 1FNFA 1IAKB 25C8L 3W37A 4BFIB 1TZGL 1T0NA 4FZ8H 4HUWA 3RWJB 1KYOJ 2B7DT 4M5YL 3JV4A 4X8XA 5IFPA 4KRPD 1CLYL 5EFFA 1S9WA 2WMFA 4RFNB 4CCDA 4JM2A 4U7SA 4CMHB 3HRZB 3BVWA 1XAUA 3DO3A 1TA3B 3KHQA 2EDWA 2OTUA 1LO3H 5AYUH 1EJ6A 3C5ZD 1YY8A 3VXSE 1C12B 4RAVB 3QUXA 4XWGH 4N0RA 1TVDA 4Y2DD 5EU6D 2DRUA 1E6SM 1XCWA 3JWOH 3S6CA 1KN2H 2VERN 1YHTA 2E9MA 4M1DL 4JPWH 1F4WL 2DBJA 4O58L 2PWHA 4PLOB 4UIKL 4HUXB 3VFWA 2ERJC 3IJYB 4TTUA 4GUPB 1YEDA 2R29H 3DSNA 4N5UA 4MAUH 2ZOKB 3S5LB 3HZYA 5DRNA 1J11A 3RIKA 4XAWH 4WTZG 5E2WH 2WSPA 5AAWA 4Z0XB 1A9EA 1NC4D 3L4ZA 3VO0A 3LQAH 5BXFB 12E8H 3TGXA 4AMCA 3MRFB 4D0CB 4YUEL 3LKOB 4YQXL 1NGXA 2Y9RT 3WXWH 4QYOA 3KPLA 4PRAA 3WSQL 4N8VA 3SCUA 1T0PB 4C4KT 4UOJA 4UOW1 4WEUD 2EPKX 1BG9A 3BH9A 3STBA 3VMNA 3PHAA 5C0GB 4N5ED 4TXEA 1VENA 2JB5L 1A4KB 4PBXA 5FKPB 3TVMA 4EAMA 4G3YH 3T2QA 4R90L 3VXRD 2E7LC 2B0SL 2G9HB 4RBPH 1N6UA 5DFVD 3VG9B 2O5YH 4F8XA 3SO3C 2G5BB 2PETA 2WBJD 3B9EA 3LQZB 3UROR 1XF2B 1WISA 1ZBVA 4HIHA 4PJDB 2C7FA 4HAFA 2X4OA 5KEZA 4M7LT 5B4MD 2LU3A 1FG2A 1QFHA 2H8PA 1L4IA 1WFOA 2F5BL 2QV2A 5I66B 3A6BH 4CVZB 3F7VB 1I7RA 3NFPA 1DLFL 2F7RA 3VXRE 1C5BH 1N26A 3MRBB 4L5FH 1ZBCA 4R8WL 5SWZE 3WQ8A 5LGJB 3LS5H 1A1OB 3C09B 3QAZB 5GGTA 3T0ED 5LQBH 4X5XA 3QEQB 4LASH 2W9LA 2AERT 4M93B 1CE6A 1M4KA 5JXED 5DJYB 3TM6A 1OAKH 1T6WA 5E94A 4ENEC 2JELH 4F7MB 4QHKI 2YFNA 1ADQH 4GMTH 2E7HA 5ABHA 3TN0B 4UQBA 4HD9A 3FQWB 2BSSA 5D7JC 3PGFH 1I3VA 4LSPL 5F9WB 5EMYA 1IGTB 1IRAY 1EHLL 1EHXA 4LPUA 4ZXLA 3OKLA 3W6LA 1YY8B 5I18L 4AMWA 5GS1B 4I0PD 5D9OA 1OF2B 3KLKA 1AQHA 2LU4A 5EUKB 4PRDB 3KPRE 4MLSA 3AYRA 5DVMA 4TTDC 3KL0A 4GXVH 1VADB 2CLVB 3AFLA 4BZYA 1KXVC 1PFCA 3ARGD 5SV3A 4P2OC 3QUYC 1XCXA 2BZDA 3WNLA 2IPTH 1GPOH 4HWUA 3BQUD 3QDJE 2VZVA 2X5PA 2XSBA 2XWTB 1DEEB 1GHSA 2QQKH 2VWEC 2MQCA 3Q3GA 1J05A 2G8ZA 2R1YB 1D9KD 5GRUH 3VIGA 4G9DA 1W32A 1YNLH 4V1DB 2OJZL 3GJFK 1S9KC 5ABFB 2LU7A 4OM0L 3S3SA 3OX8A 4XPHL 1BFVH 1QP1A 5A2LH 5FYLE 4M61B 4ELKB 3MGTB 3O4LE 1OTSD 2H1PL 2Z93B 3RRQA 3G5ZA 4JVWA 1JRHI 1YECH 3KPSE 1J8HA 2DIBA 3W81A 2YWZA 5I2UA 2A9ML 2XRAH 4DCQA 1VFOA 4JFHD 3PXHA 2KUTA 3A4WA 2FEEI 5MEQB 4S2SA 3MBEA 1EFXD 3L3DB 2K3TA 3HU7A 4F80A 1U8QA 2BHYA 3WY4A 1CXLA 2ZNXA 3GMRA 2NY3C 5KW9H 4HUKB 4OIBA 1S7XA 4OUUB 1W1TA 1RFDH 3B9DA 4YE4L 3ULUC 5FYKH 3S97C 5IOPA 1AP2B 4A6YB 1ZLVH 5FIPA 5D70H 5KN5A 2Z8WC 1WPCA 4NQEB 5JHDD 1MEXH 2FGLA 1KEGL 3RZCA 3UJIL 1JZ7A 4JQIL 3ZKXB 1P9MC 4PYGA 3WD3A 5D6DA 3UBXI 5I18H 2ZXQA 3UXFA 3TNMB 3M1BB 3WBEA 1UR8A 4EE9A 2ZNWA 1YA5A 1NH6A 4PJ5D 2G4FA 3H0TA 3PGFL 4XPHH 1L0QA 1NFIB 1J1XH 4DUWA 3IANA 4X7DC 1Z3GH 1J8HE 3GJEB 5FL0A 3KYMA 4QYOB 4OZIE 2WAHA 4JFYA 3WUEA 2DI8A 2NNAA 3O4LD 1CPUA 1KOAA 4P8XA 3RTQC 4AIEA 2ZOLB 3WHXB 4I4WA 3FQWA 1BYAA 2Z35B 4LGXA 1RPKA 1CE6B 1DBJH 4AD2A 2X1QA 2ICEA 4KC3B 2NY3D 4GXVL 3VW3H 4Y1AA 3WXVH 5MEOA 4QOKD 3SKNB 1S5HA 4RGNC 4AEHH 3P40A 4BQ8A 3TBSB 5JQ6H 3C5JA 2NY2B 2WUBL 3WH8A 1QRNB 1NCDH 3WH6A 4UBDC 3QDGE 2ZUQB 2DQTH 4CDGC 4Y19B 4W87A 1A2YB 4PMDA 3HC0A 1QSEE 1I8IB 3MV01 3PHSA 4FTVD 1T2XA 1DWIM 4P4KA 1EXUB 1QLRA 5HHNA 4LLDA 4HK3J 4X6FB 5B38A 1C5DA 4N0UE 2DN7A 4JFDE 4X9IA 4RRPA 5GXBB 5ABEA 5DRXB 3KPNB 5TE6H 4QRTA 5DRXA 1IZJA 1KXTB 2EEBA 4FNRA 3GDBA 3MNWA 2EEXA 4X7EC 3ARDA 5C2BH 1QI4A 1I1FB 3I6GA 5A6BA 3KR3H 4AEFA 3HE6A 5IW6B 2DOCA 4MDJB 5F70A 3RVWC 1IGYA 5HVHC 2R69H 1RZ7H 4R26L 1RUPH 3QXAB 4Q9QL 1B2YA 3ZR6A 1NC4A 1S3KH 4TX8A 3UCQA 1UQZA 1CLZL 5T1DH 5E2TL 4M6OL 1F4XL 1X44A 3A5VA 1ZHKA 3DOSA 2X4UB 1UWGH 1INDH 4F8QA 4YDLB 1ZBWA 4M7KH 4QOKE 3D0VA 5DD5L 1QBML 3AISA 1B3JA 1FL6B 5CJXC 5FIEA 1VADA 1BVZA 3H9SB 4NDMB 3VGEA 2YPLB 3TPKA 2ICWJ 1HSBB 1I75A 3KHOA 4AH2B 3BP4B 1ZT1A 4S1DD 3UJTH 1H2JA 3IXTB 2ZIDA 1FRGL 2C1PA 4AWEA 3AIVA 3MRDB 1RZFL 3MRDA 1WIOA 1HWWA 1KG0A 4HK0A 1QFUL 4BA8A 1UWTA 4OCSH 1C1EL 4K7FB 1ZEAH 1U0QA 3RGVD 3FQRB 3PZQA 1DQML 3CC5B 3GNML 3WJLA 5A1AA 3VE0B 4X4ME 4PGEB 5CD5C 4NO0D 1V5JA 2H32B 5D7SH 4ZYKA 3ZZ1A 4R4FH 1DBMH 2ORBL 4TYUA 4B0MM 4P7NA 2ADFH 1S9WB 4PRIB 4QRUA 1KIPB 3IDIA 3RFZC 1KBGH 3VMOA 5CGYD 2WXDM 5IQ9A 4ODUB 1ZA3A 3BKYL 5HHQA 1OM3H 1P4BL 2KZWA 3HZMB 3VRIA 1HIZA 3V7AE 4LU5L 4N8CH 5B22A 3MJ6A 3INUH 4MD4B 5C0IA 1HYSC 4LYRA 1GZQA 5EUOA 1FFNA 4RMWA 4UIMA 5I74B 5I1JH 2HLFD 3KPNA 1Q0YH 4XP4L 1CEOA 3QUZB 5AC5A 4P5KB 1FZKB 4B7LA 3WD1A 2WSKA 2VISB 5HHOE 5LCVH 3EOTH 4MNGA 3ZKSD 2FX8H 3R06A 2X89A 3EYUH 4F7PA 3V7AG 2F58H 5D2LA 4FQHB 3ZKNC 3VKKA 3PG2A 3O8XC 4L1DA 3EUUA 1DR9A 4JZJC 5T1LA 3TH4T 2Y36L 2J25A 5IHUL 4HU8A 1MY5A 1JNNL 4JEGB 2E27L 3RHWK 4LCYA 3S96A 4MJID 3HJEA 1GAFH 1B3WA 1UVQB 3CX5J 1G6RL 2GCYA 4CW1A 2EPMX 4I3GA 3W9EA 4EQ2A 1WZLA 3RL1A 3ZJ8A 3PNWB 3FXYA 4DUXA 4LLQB 5DJZB 5E6YA 3C5JB 3O9WB 1D5XA 3PZVA 3ZTNL 3AHVA 2HFGH 1KPRB 1UKTA 2UZIH 5E08H 3QA3A 3GXPA 1D6EA 1QNZL 5H2BB 1Z5LA 1AD0B 2J88L 2HT3C 5DO2C 1AD0A 4MNMA 3QHMA 2FYVA 5HDRA 1BVKA 3KPPA 4R0LA 1AY1H 3AB0B 5AUMB 4PREA 3WY2A 3FOLB 3N11A 3OKKA 4FABH 4L8CB 5K93A 4PJXE 4XVJL 5FAAA 3QUXB 2D22A 4NQXA 1MJJA 3LB6D 2VB5A 4P2QB 3EFDL 4RDQF 4U3AA 5GNYA 5DFAA 2HN7B 4FFVD 2M1KA 4PB0H 4Y4HD 4Z7UF 2QADD 4HA1A 1L7IH 1QEWA 4NBXB 2VLKB 1CF8H 4YHIA 1VFFA 5HHXH 4XXDA 3IB4A 2HG5A 3VXUE 3QOMA 1J18A 1HHKA 2JIXA 1WB0A 4UILL 4D6GA 2OZ4L 5EU5B 4C83B 1HEZB 2E7LA 3ZYIA 4E4PA 1RUAL 3QCTL 5HHMB 2ITCA 3EYUL 5JMRA 4AD5A 2Y23A 4I5BA 2UWEA 4KVNL 3WS6C 1NCBH 4H8WL 5I6XC 3APGA 4MJIB 5EN2A 1WO2A 1MHCB 3S4SB 3U2SB 3LN5A 3GXDA 3KXFE 4NRSA 1T20B 5A6AA 1KCRL 1QW9A 5D72H 4D0BB 2QSTA 3FTGB 2DDXA 3MMWA 2V5DA 1T1ZA 2HTLC 5DJ8B 1WWAX 3BYTA 3NFSL 5D9NA 1QLEH 2ALWA 5I71C 4W68A 4ZQKA 1YPZE 3MJ8B 4PJHF 4WTWA 2WMJA 3H6JA 4PLKC 5L0QB 1DQDH 5HNNA 1C7SA 2GSIA 3ZKMD 2DBLH 3RMEA 5GRWA 1BQUA 4OTXH 1NWSA 3DRTB 2F54D 4RE2A 1KR0A 1ED3B 3S88L 2VYRE 1JUFB 2FATL 3JBG7 1OD8A 3KYNB 3VWJC 4HPGA 1QA9B 4KPHH 2DBLL 2ORBH 3C09C 3QAZC 3PP3K 2HG5B 2HJLA 5L8JB 3IDJA 5BVPH 1RZJL 1ZJBA 1DQMH 4LKXA 2D24A 2C4FT 3LIZH 1C08B 4L3EB 5EOTA 3EJPA 2YC1B 1XH3B 4HDIB 4PGEA 5IFJB 5BRZA 5I1DB 4LXFA 4HT1H 2VRKA 1MJ8L 3T3MF 4DK6A 4GKZA 5SX4I 1Y0LB 1CDBA 3C6LA 1CK0L 3MMEA 1UZ1A 5DUML 3EYPA 5T33H 1G6VK 5IBTH 2CLRA 4RGMC 1CL7H 1NWUA 4ZO7A 2HFEB 4PGDB 1NEZA 4P9HH 2CKBL 2WVVA 1ZLSL 3FO9A 3WQ5A 4MA1B 4Y5XA 3WMSA 1X5JA 3CCHA 2AK4A 2PO6A 5A40E 5C08D 3ILQD 4FQQB 2FLBT 3QISA 1UCTA 2X8RA 1IGJA 3MU7A 2F53A 4X9YA 5CEZH 2OP4L 1JWSB 4YR6A 2Y2WA 1K9EA 1DN0A 1PQZA 1CLZH 3ZJ7A 2X70A 4JKLA 4QRPE 1QSFE 3BRDA 3MBEC 3QIBB 2DM4A 2P8LB 2O9TA 3O6FC 2LQRA 4F3FA 5DC4B 2PF6A 4JY4A 5JIKA 1V3MA 3SCMD 1CLCA 3ULSB 4LSTH 4OIFA 2YL8A 4W86A 3H7LA 4U05A 5EBWB 3TF7C 4JO1H 4XMPH 1ZA6A 4P8VA 2FEEL 3BD4A 2P46B 5JW5B 3P0YL 2LFGA 2CBUA 4WU5B 3HC4H 5ANMB 5AZ2H 2XVLA 5CP7B 1ZOXA 2BNRB 3AU1B 1YEGL 4IMKA 4LGRB 4PJ8B 3QNXA 4HJGB 4BFIA 1ZGLA 4Z7UA 3JWDC 1NWRA 2BC4A 3S3JA 1PX8A 2A74A 3O3EB 1E71M 4K9EC 1WCBB 4WGVB 3GMQB 1FGNL 1CE1H 4OGZA 3DTXA 3CH9A 4LCWA 2V2XA 1EUTA 4NPYB 4HZ6A 4KJPD 3ZYZA 4ACPA 1OGAA 1UM4H 4XC1H 4ZDHB 4NHUA 3BDYH 5T3XD 2K7QA 1WITA 1KB9K 4UT6L 1CENA 3TN0C 3L3JB 5T3ZE 4HX1B 2CIIB 2RHEA 3I02B 1RUKH 3N1QC 3P4NB 1U92A 4JG0H 5HI5D 5C6WH 2Z1SA 4DN4H 5DD6B 1QRND 4GRMA 3EJQA 3CAFA 3QDGA 3SGJC 1V08A 4X6DB 4QXUL 1NFDA 3ECQA 3HZYB 3MLVL 3B6SB 4ZUTB 2ZCHH 3MC0A 1DSFL 2DQEL 5E00A 5FK9A 4MQ7B 1H3PH 1XGRB 2B2XL 3P77B 4YDLC 2A6KB 2XM2A 4K68A 3REVB 3PXJA 3QR3A 4PJ7E 4TVDA 3DYOA 3MMEB 1HKFA 4JCLA 2B5IB 2Z9TA 1ULVA 1DE4A 3JTSA 4EANA 1H41A 3IDXL 2R0ZL 4BQBA 2F53B 1QO3B 3HZ3A 4HWBH 3MSDA 3AY4A 2JCCF 3GNMH 5KZ6A 3B2UC 3L3HA 2NY1C 3C08H 2ZUSA 1P6WA 2A73A 5ABGA 2AXGA 3KS0J 1G7IA 3CNKA 4HPOH 4DKAA 2J1KA 1HJUA 7FABH 4NP4H 1NBYA 1QFWM 4U1JA 5FDWB 1JFHA 3CXHK 1H9VA 3FRPG 3O3AA 3WF0A 4PFEA 2PTTB 1I7RB 1XIWA 1UQYA 4JHAL 2K9UA 2R4SL 1NGZA 4KMLB 4MAVA 1I1YB 1CT8A 4MB3A 4D9RE 1IAIM 1NCNA 5T1KB 5JIHA 2BXZA 1IBGH 1P2CA 4ORGB 1MFBL 4DKEH 5EU3A 3W39A 4M7LL 5CHNB 4KK5C 5I19L 1XGZA 2FEDC 2FYYA 1UD4A 4WJ5B 3HZKA 5GPRA 4WI9A 4PRIE 4LCCC 4BFBD 4BQ5A 1HJVA 2NTSP 4LSSL 1T83A 1MLCA 3DJ9A 4Q9QH 1LWHA 2ZICA 5I1GH 3LZFL 1HHIB 4S1QH 2W59A 3E3QE 1FZMB 1NLDH 4L29B 3VFUB 3VD9A 5E9DB 3KPRA 3OKYA 2HVJB 4ZXOA 5C0BE 3DUSA 3R1GL 1QLEL 5C0AD 3KXFA 3FAXA 1RUML 1Q38A 4NZFA 4PIRF 5HHVL 2VR4A 5J6HB 1Y6KR 4Q9RH 2Q8BL 2QHRH 3NGBC 5JMOC 2D7OA 1ZE3C 4LSPH 3OKLB 4M7ZB 1GVYA 3O2VL 1TCMA 5INDA 5D6CA 4DK3A 1YPZA 1SYSA 2DWDB 2ZJSH 3MV9A 1MCSA 1DQJA 1OP9A 2IH1B 3FFCB 5JZ7C 1G9MH 2LAAA 3ZYJA 4D9RD 1ISVA 4AQOA 4AW7A 4K8RL 1KIUA 1T1XA 3DPBA 2ZJSL 4DOHB 3UP1A 3BH8A 1Q94A 4KXZH 3RY6A 1Q9WA 2HAZA 5GRXG 3HE7D 4NIKB 3K7UA 15C8H 3O41A 3EJYD 3QEGH 3KDMB 4QHKJ 5F7DB 5LGJA 4LRIA 3DVIA 3KDMA 4NGHL 1SM3H 4RMRA 1U8NB 3ZE0F 2XYLA 3EFDH 3V5DB 3QGVA 3HCVA 5ADOL 3DVGB 1AFVL 4LEOA 4XZBA 4FMVA 1A6AA 4JZOA 4G8EA 3RKPA 5HBFA 2DLHA 4X80H 1HH6A 4FQ2L 3E6FB 4A6YL 5KN5B 4RAHA 5FKAA 2DT3A 5E6IB 3L3DA 4MAYD 2X4UA 2GY7B 4XAKE 3PL6C 1ISXA 1CFTA 4NN6B 2AGJL 4P3DA 4LNVA 3GHEH 2F53E 1BP3B 1X9QA 3OAYK 3MCLH 2MKLC 4XBEL 1EA9C 1GRWA 2DQIH 4MJ5A 6FABH 1M7DA 1W9BM 1M01A 1AI1H 1DLHB 3RVVC 3QNYB 4EN3C 1DP0A 3L5WB 4DW2L 1WZ1H 4OKVB 4KUCD 3MJ9A 1KTKE 3B2VH 4RWYL 3AY4C 3IDMB 4Q74A 3VI4F 4CVXB 2RQ8A 1C16B 5C0BA 2XICA 5HD8C 3GJFH 2RIKA 1CGSH 4X6CB 2C4XA 3SDCD 4ETYA 1UWSA 4JG1L 4LHUD 4MNHA 3RZWA 1WBYB 4R4BA 5IDIA 4NCC2 1CDIA 5LCVL 3QXTA 2DICA 4XBGB 4U1IA 4XPFL 4U6YB 3MLUL 1QFPA 4PCSA 5CWSB 4L4TA 3V4VL 1WBZA 2AJZB 2IAMD 1V0NA 2X2IA 5B39B 5C8BB 2Z92B 4RZCB 2OJZH 5IQ9B 1CWVA 1HQ4A 2IEPA 3QRGH 5HI4D 3QHFH 5DEGA 3W0WB 2IANB 4PJDE 5KVFH 4P0DA 3BH8B 4L9DA 2IPTL 3SDCB 1MFCL 2EIZA 2Y7QB 3OKNA 1I9JL 2AJYL 3F5JA 2OS7A 4Z2GA 3JUYA 3CC1A 3BAWA 2RGSA 1HCFX 1HQRB 4XPFH 4Y2DA 3UTSD 2NT1A 5E4EC 1BWWA 4S0SD 2QL1A 2XA8H 3ZT7A 2WINA 2BNQA 3ARBD 4ZNCD 1UUQA 2J8GA 2GJXA 3GIZH 2I07B 4GBXC 2OJEB 3WJJA 4J3XA 1RZFH 3RVTC 4F57L 1ITXA 5HPMB 4PJXB 1W3KA 3GMOB 3RA7L 2V6HA 2VT0A 4RWYH 1CS6A 1DANT 1XH0A 4WKAA 5SWSA 5KSVA 1SY6H 4U3CA 5F1KC 2EO9A 2B39A 1VFAA 6FABL 4GBXB 5KVGL 1JHTA 4Q9BA 4TULL 4YPGA 2O5XL 2KBGA 4NUGH 5JBDA 4NQCA 4D6HA 4GKSB 4JY6B 4NO0A 4HUWB 4NQCB 3RWJA 4NN7C 5L9DH 2ZX6A 1NGWA 1C5BL 4XNMB 1DVFB 2CK0H 2XG4A 1OGSA 1MHHB 3UAJD 3CFDB 1SVCP 2WHKA 2FECI 1BFTA 3WN5B 4RX4A 4CVXA 3PDDA 3U4BH 5KANI 4HLJA 1OAXH 1IC1A 4X7TB 1QVOA 3TPUA 3F6LA 4PMOA 1QQDA 2R56L 1MQRA 3H53A 1ZLUK 2I07A 1MY7A 4AQ1B 1IGML 4YHYC 2GAZB 3WFEL 5I24A 5CEZL 3V9FA 3SURA 4NGHH 5E7FA 1H0IA 1GUVA 2VQ1A 4Z2JA 3FFCD 4R90H 2FB4H 4JFOA 4KAQL 2YD3A 1RI8A 1EK3A 1ZA6B 3RDTB 3KPRD 4MVBD 3LMJL 4M5ZL 2X4SA 5FDYA 4ZFZB 4X98A 1AKJD 2AMGA 3O9WC 4YN5A 4R4NC 3ULVC 1UR0A 3MUIA 1J5OL 1T5WA 3HFMH 4FN0A 3GMLB 1F3JB 2XIDA 4ZPVB 3TBTB 4ZSOB 3HR6A 5JIWA 2NZIA 4NWUL 4P46C 4Z2KA 3HAEB 4X7SH 4TUOA 4UDUB 1IGCL 4Z7QE 5GISL 5E2WL 5GRVK 4UT7H 1BQLH 3STZA 1XGQB 2A83B 3WKML 1TQBC 3ZKND 4NZCA 1F2QA 2EKJA 3BXNA 3PZGA 4UIKH 2Y72A 4B7IA 4ZUSB 3VRJA 2C26A 2KZ1B 4I13B 5E4IA 5JOEA 5EB8A 2VLJA 3GMMB 3RKDD 1D5MB 2R0KH 2R39A 4LDLB 5GNZA 5DJAA 3ZJKA 4NHCH 3FNDA 5KVDH 1YMMA 1HE7A 1LEGB 2J8UF 2EC8A 4QHMA 5DQ9B 1D3CA 3FMGL 2GCYB 3ULVE 1KWGA 2IQAA 3FJTA 5BRZB 4MDJA 2EDYA 3VWKD 1GGCH 4L8BB 5IESH 4U1IB 3SKOA 3GSXA 1VSCA 1EZVY 1AD9A 1WDQA 3HPJA 1TQSA 5BV7B 5JBEA 1KELL 5ITFA 4ONOA 1U33A 1FAKT 3TO4D 2ATKB 1OQOA 4O4YL 3BWUC 2BNRA 1YEHL 2DSKA 1XEDA 4PS4L 2DQUL 1O5DT 2VXUH 1IC5L 5F89B 4HZ8A 3VOCA 4YE4H 1NMBH 4TUJA 3MNVB 4N9GA 3HS0A 4YWGL 2V2TA 4UILH 2GK1A 5DA0B 5A2IH 1E6JL 1JZ2A 4Q6IC 3UO1L 1KB5H 4YDVB 3HG1B 3HB3D 3MR9B 4PB0L 5CP3A 3FTGA 3S98A 2DQFB 1NSNL 4M7LH 1GPFA 1OGGA 3QH3B 1MI5B 5IW1A 5I2IB 3QIBA 2YUWA 3LRHA 2H1PH 1T66D 4N8PA 5I1AB 3ARGB 2YBUA 5IQ7H 4GW4A 3C60A 4CD5A 3T0DA 3DX6B 3QP3A 5BXRA 1EXPA 5D8JL 4IDJH 1QKZH 4WNQB 4OQTA 4JM4L 1FIGH 3BI9X 4HTYA 3FRPA 2AXFB 4XZWA 3E1F1 2VX4A 4DVBB 1CFQA 1F6AA 1KJ2B 2OL3H 3ET9F 3QDMA 2PTUA 4LSUL 3QXUA 2MPAL 4MA7L 1QRNE 5EC1B 4LPVA 2GTZA 3PWVA 4XC1L 1VIWA 4WWKB 1U2CA 2ZKHL 4YDKH 1C12A 1MWAH 4P3CH 4NJAH 4UTBL 4OZ4A 5AY7A 1UH2A 2BNRD 1KTRL 3HRZA 4ATDA 5KZCB 1NLBH 4OZIA 2DMBA 3LPOA 3RQ3A 3IT8D 4U3HA 4FG6C 1OAUH 1AO7B 1SYSB 4Z7VF 2GT9B 1KCUH 2H26B 1RZKL 3GEWB 1CGVA 5J11C 1ED3A 4MDPA 2FZ3B 2EXWD 4WW2C 3T4YA 4RQQB 1RUKL 1T3FB 3EDFA 2MCPH 4I9WE 3C6LC 3QIBD 5E99H 5AZEH 1AIFA 1W72B 4GMSH 2F5AH 3VDHA 5I75B 3BJLA 3RVUD 1QSVA 4IUGA 4NZUL 4P2RD 4OF7A 1TXKA 3QWQB 4ZEPA 3LV3B 4I18B 4AIZA 2PB1A 3VILA 2QJDA 4LOUD 3ARBA 2XWBB 4UQ3B 5C08B 1HTYA 1RK0A 3OX8B 1MJ7H 1FYTB 3QIUC 4YXLL 3QSKB 3D87B 4LCWD 1OP5K 5IVOA 3KZSA 3OWEA 5DMIH 2P5EE 4G8EB 1ORQA 1C3FA 3QDMD 3AU1A 2DKMA 2V5RA 4OM1L 4OIAA 3X13A 2B0SH 3T0EA 4CD4A 4J4PD 4NM4L 1A0QL 4XMKL 2V3GA 4EN3B 1HI6B 4O9HH 3O3DB 4WSJA 1C90A 1FOBA 2FWOB 3KPTA 5GGSA 2A6JB 3W29A 1FIGL 5BZDA 2P8LA 3SCOA 1SY6A 4MLIA 1WTLA 4IRSB 5HPOA 1HYRC 3SUTA 5C08E 5IF0B 2APWA 5DC9B 1HJWA 4G7VH 2A38A 4ZTPL 2Y6SC 1JL8A 3B6SA 3B83A 1MJ8H 5E0FA 3FOMA 1HJQA 1CDCA 1A9EB 1XZ0B 4DVBA 3HG2A 3TIDA 4IRSC 1NAMA 4JPVH 1U8PA 1REIA 4GZIA 2FGWL 4BH7B 4HHAB 4JFYB 5A43C 1EO5A 4QCFA 1I4FB 3E0GA 2XFXA 4FRWA 3WELA 1F45A 3WHXA 4DEPB 2Q7NA 2AEQH 3KAAA 3IAQA 2OXHA 3H9HB 4Y1AD 5IBUB 3OSKA 1OAYL 3FQNB 5FYKU 1TQVA 4PBVC 1HINL 2UZYB 4EI6A 1TA3A 1X5HA 3MV7D 4R0LC 2A0LD 1W8NA 5CD3B 3QBTB 4QXTA 1NEZG 5KSAD 4YDJB 1UZ8B 4FQIL 2J8UB 3LN9A 3QG6B 4ZS7H 1RJLA 4WI3A 3G6AA 1U8LA 2ARJB 1XF2A 2XZZA 2W92A 3RZCB 2ARJA 4XB3A 5C8JA 1N6VA 4KU1A 4FQXB 3SE8L 4GOSA 5JOFB 3EO0B 2VLKD 3WSUA 3MBED 4XPBL 1UM4L 2W60B 2XN0A 2F7QA 3EJYC 5DMIL 3X3FL 3PTKA 3F12B 1E56A 1GNXA 3HUJF 3JV6A 1P6AB 3CPLA 3BGFB 4HA4A 4AJ0A 3ZE1E 4TTDD 1UXSA 5CS7A 2PTTA 3QNYA 4R5EA 2WUBH 3HUJB 3G6JF 4IRZH 1CXIA 4HMEA 5EFDA 1RIHL 3GMPA 3LD8C 4YAQA 3ES6B 1G9NL 4UBDD 5LJYH 4OI9A 4V1DA 4JFVA 1OWQA 1EEZB 4F7TB 2JB6B 4LQFL 4Y1AB 4AISA 2W5FA 5GGQH 3RX8A 4H20H 4FLRA 2VNCA 3HHRB 4D3CL 4FQQA 4EBQH 4XP6L 5C0RL 2H32A 1MAJA 4B41A 3FZUD 3HNSL 3I2CL 2LTQC 3ME0A 5AAMA 4LCCB 3UTPE 5DMJB 5CCKL 4XGZA 2ESCA 4PV8A 5I1EL 1V6WA 1EFQA 1U8IB 4MNLA 1BAFH 1HDMB 3KPQB 3UBXG 4LVOB 1MUJB 5C6TH 1UQSB 4NJAL 5DJ2B 1MUJA 1FIEA 4OI8A 5DMGC 5D7JD 2GJZA 3WIJA 1BTCA 1AXIB 4M93C 2OSLA 1EAJA 1G6RH 2NY5H 2DPEA 4MJ4A 1G7HB 3G08A 4UT9H 3FQUB 2X7LB 4E8DA 3FB7B 3OKNB 3N1GC 1FG9C 1RIVH 4FXLA 5GZNC 1KCSH 4AMXA 1NBZB 3TO2A 3VH8B 3VIPA 3MRNB 5ILTH 5HDQH 1W72L 3BD3A 3U4BL 3QEQA 4KK6C 1D5IL 1NC2B 5FUOH 1NMBL 5F6HJ 3CFCH 4Q97A 4G8GE 1RK0B 3GKWL 2JB6A 3GBML 3T2NL 2WANA 1FO0A 3TIEA 4H88H 1I7UA 1GGIL 2J7CA 4M81A 1A4JA 4Z7UE 2NQCA 3MLTB 4QCIA 3KYKH 4DCQB 5BRPA 2JJSA 1X5XA 2FJHB 5I1JL 7CGTA 4KKCC 4QTHA 1GGCL 3U4EA 4KJYB 3EZ8A 1PZ3A 1BFVL 3HR5B 1UR2A 3CU1A 1FZJA 4XNXL 5BV7H 2GDUA 4EI5C 5IM7B 3V6OC 5JO5B 3DX8B 2PYFB 2ARJQ 3TBVB 4EUPH 3BAIA 4NRZB 2GUYA 3RPIA 1CTOA 1EAPB 1JNNH 3N06B 3VFVB 3AI0A 3C2AH 1NCUA 2NXZB 1QSFB 3EYOA 4X6FA 2YOCA 2OX5A 4DGYL 5C0BD 5J1AA 5C86A 1A64A 3N1AA 3IFNL 1CT8B 1MFVA 1IC4L 1ZT7B 1EXUA 4H26B 2BMKA 2HWZH 3O6LL 4Y4KA 4DN3H 4L4VE 5K9JL 4PJ9C 4Z9KB 4HIEB 1BQSA 1UKOA 5MENA 1PSKH 5F9JA 1UJ3B 1W0WB 3RY5A 1UKQA 1YEEL 2AK1L 4G9FD 1PDKA 4PJXA 3GMMA 3SHSA 4CU8A 3MMDA 2C8NA 3O2WL 5FOJA 2CDFB 4FA8A 4UB0L 4NO3B 4Z0BH 3AS1A 3TNNB 4NHCL 1PIGA 1QTYT 5BJTA 3BP5A 4PP1D 2P8PA 1HHKB 4NC2B 5BJTB 5I0DA 3A6CH 2X4NB 3GSNH 5E2VH 3BAEL 3CVIH 1CN4A 4KDTC 1Q1JH 5A16A 5BXFA 2GIYA 5HI4C 4P2RA 3WYRA 4C56B 1K6QH 3TO4A 3CLFH 5HDBE 3UR7A 1CBVL 5DD5H 1SYTA 5J0BA 3ZDYE 3BVUA 2VDKL 2UYLB 4UZGA 2HJFA 3TBTA 4XI5C 1BQLL 3QUZC 4JFQA 4PV8B 4F9LA 4S3JA 5KS9B 5DD3H 2J3SA 3PWJA 4Y0GA 2F5BH 2ICWB 1U8IA 2R8SL 4K7PL 5KJRL 3PIQB 4OCSL 1AJ7H 5KSBB 1MCPL 4WI2A 1X4XA 5EWIH 3DX1A 1HF6A 1HCVA 3GNRA 4X5LA 1RHFA 1JYVA 5TPWH 5I9QC 1TMQA 5HGGS 1AI1L 3U0WL 1MREL 2EDBA 1UZ4A 2GAZA 5FV2A 4HBQA 3ZTNH 2G5BA 3C6SB 2WQ8A 1KPVA 3MXVH 1XC6A 2EXYD 2FB4L 2ZSVA 3MUY1 4KK9C 4L4PA 5FF6A 1UFUA 4AY0A 5IJVB 1T66C 2NY2D 5IW6A 3IVKB 2H8PB 5M94B 4W88A 3EFFB 4M80A 4ZFOA 1V02A 4OIIL 5DJ6B 1T89A 3GSXB 4RA3A 3WD5L 1UJ3C 5DVLA 1TQUA 3NYDA 1UD3A 3RM8A 4HMCA 4G9FB 4BH8A 1DVFA 3NCFB 3VXSB 1A6TB 3IFPA 5LA1A 5TH2A 3VWKA 1NCAH 2CSPA 3C5SA 1KIPA 2HKFH 3IDIB 5IM7A 3WF1A 3UJJL 32C2A 3QCVH 3L1OL 4WHDA 4HOXA 3OHXA 3LMYA 4P5TB 3QUZA 3WLWD 3O6FB 3QZWG 2UY2A 1T0MB 3VW3L 3X11A 4RL3A 5C0IB 2DL2A 1NGYB 2HJKA 3NCCB 3QULB 3V52H 4CUCA 3FQTB 4HJ0C 5B38B 4NKOB 4F58L 2IBZY 5IVZA 3AXIA 1L7TH 3MRGA 3U5YA 3W2DL 3BAEH 1MRCH 2M26A 4AZBA 4RRPG 1TJIH 3A4AA 3MPCA 4P2RE 5ICXA 2D7PA 3DI2B 4FFYH 1K5NA 3P4OA 3HCVB 5IMMA 4WRLA 4PRPB 5IMMB 4QRPA 4LPTA 4LLWB 1NP2A 2DTSA 3QPQD 4X0VA 6CGTA 4OGAD 4H1LH 2YS4A 2ILLA 5DD6A 5C0AA 2CMRH 5H94A 3GJFB 1RUMH 2MQ3A 5I1KH 4QGYA 3WXVL 2R2BA 3OGSA 4U1KA 1D6EB 4Y5YB 5H2BA 5F1OB 3N04A 4E5XA 3LEYL 4LL9A 3PNWA 1ETZA 1MFCH 1B2WL 1MRDL 2R23A 3LKNB 3ABZA 4X7TA 3BUBA 1JGLH 5CGTA 5EO0B 3FQTA 4RGNE 3REWA 5L8KB 1HYSD 4N0CD 3V6FB 3KPSA 2YXMA 4LEXL 1U3HC 5I9QB 1I3GL 1BQHG 3VXQB 5D9SA 1CD1B 2F15A 4HIHB 3F7QA 2Z8VC 2O92A 1ZHLA 4JANA 1PSKL 3B9AA 4YGAB 1S7XB 4F2MA 2PYEA 4O51A 3HPLA 3K4AA 4NZTH 1OHQA 4J3UA 1RZKC 3W27A 1R3LB 5IB4B 3SUSA 3DBXB 3NN8B 1XT5A 3T2NH 1MCCA 3IFNH 1OGAD 4ETQA 2QQKL 1A22B 4FOMA 3PZMA 4OD3H 1N0XH 5FA3A 4V28A 4U1MB 4P2YA 5DSCA 5GHWH 5EBMA 4GBXD 5JIIA 3V6ZA 1MPAL 4HGMA 4ODUA 4LBEB 4HJGA 3GRWA 2IC2A 4JY6A 5BV7L 1LO4H 2YXFA 2VLLA 4M8VA 1O7SA 3ARDD 3PWNA 2EDLA 5HHPA 5IEKA 1ACYH 3RUGB 3THMH 3VA2C 3MCLL 2AKRA 3DDFA 4DGVL 3TP4A 5CD3A 3AAZA 1AR2A 1GC1L 3OBAA 4Y4KD 2IADB 3H9YA 4U6HA 1GGYA 3GSQB 4MX7B 1O6IA 3D3AA 2IG2L 4IDLA 4GUPA 4JLRB 3HG5A 5L2KE 1U8HA 4RAUA 3GKWH 4PCTA 3NZHH 3NACH 4HGKC 2OW7A 4V27A 1GC1C 2NYYC 1YEIL 1OPGH 4LVHC 4LQFH 4RMSA 3QQ4A 2A77L 2ED9A 1M6OB 2CKBB 2JFEX 1NQBA 1AGBB 3R1GH 3TA3A 1NFDB 3LEVH 4X98B 1FBIH 4L3EA 5EOTB 1XGRA 3SJVD 2OCFD 2ZX9A 4LK4A 4JL2A 1CXKA 3MLXL 4WW2B 4HPYH 4WFED 4PJAA 1A3LL 1RP9A 3UG3A 1RH9A 1BJ1J 1NQ6A 1S5IH 2P5ED 4YHLL 4K8RH 1CE1L 4KJWC 4DWSA 3PZUA 5A2AA 4TUFA 2VSDA 4LCIH 4YJZL 3GMPB 1K8IA 3EMZA 2JELL 3O8XD 3VI3F 5F9WC 4XMLH 3HNVL 5CUSL 1MFBH 4DKEL 1W91A 4JDVB 5ALCH 3CXDL 3JTTB 5IW1B 5DFWH 2NX5A 5GGRA 5KBNC 4X0KB 3U9PL 3TPUB 5IKCB 5HY9B 1R3IH 5DHVB 1FLRH 2VC2H 5IMKB 3CMOH 4F79A 3PQYA 4OLWL 1ODZA 2WWDA 1UM6L 1IL1A 4XBPA 3A6BL 1JD9A 2ZX8A 1JWMB 5D70L 1IGIH 1NPUA 1U8LB 1UYQA 4P8UA 5D9SB 1E4KA 3TVMD 4JRXD 3RWDA 1GJIA 4NP4L 7FABL 3RWDB 1UWQA 5ID1B 2HKHH 5IK3A 1OD9A 2AEWA 2XN9A 3MRQA 4YQXH 4YUEH 2FBOJ 2H26A 5M17A 1HEZA 5E56A 1DWJM 5CP7A 1DANU 4FFVC 4M6NL 2DT2A 2J8OA 2JIWA 1QNRA 2EEAA 5CIPA 3W11D 3W39B 2YUXA 3VFMA 1M7DB 4I3SH 4ZD3H 5L8LB 3SCWA 3C5ZB 3FB7A 4WHTA 3L5HA 1P1ZB 4FNPA 5F7DA 5BCAA 4YBQD 3W5NA 3FQNA 4O2CA 3LX9A 3L3GA 3P73B 3OGRA 3TBYB 3SJVB 1FCCA 4KRPB 5DEFB 3WUWB 1W3HA 3BP6B 1GZPB 5BOPA 3DSFL 3ZR5A 4LEOB 3MLVH 3ALPA 2ZXDA 2N4IA 1CU4L 2Y4SA 4S1SL 5DK0B 1JV5B 1GYAA 5MEPA 1RIUH 2AEQL 3TBWB 1ACZA 5D5ME 3RWFB 4C7DA 5ADPH 1NARA 3TLRA 4HU0A 1W9PA 5GS1A 1HKMA 5HOSA 3MV9B 4JFSA 2CIPA 1TPXC 1U8JB 5E8NB 4M8QB 2ZE0A 2VX5A 3IDXH 3VD5A 4AT6A 3GBDA 5KZCD 5M03A 2BMKB 4Y4KB 1I85C 4IRSA 4N0FB 2HT2D 5I1DA 3REVA 3ALGA 4S1RH 1KN2L 1MJ7L 5IROA 4MS8D 1AQ0A 3GRWL 1ZL1A 4S1SH 1NAKL 3AOFA 4Y5XC 4GAJH 4YHKL 1T83C 3BP4A 4KKNA 4JQXC 4ZUTA 3NCYP 1ZT7A 1KGCE 1E3XA 3VXPB 4WJXA 4TSBH 1B0RB 1WUNT 2EICA 2P24B 1N2RB 3CMOL 5HGAB 1EEZA 2KPNA 4F7TA 3CZLA 5A94A 5CHNA 4K07A 3V0WH 1QD0A 2O26U 3DUSB 3CXDH 1D6VH 3ZOAA 1UEMA 5DJ0A 5DRWA 3HG1A 4XNYH 3LRKA 1ZU8A 2O61A 1AR1C 3DROB 3PV7A 5C92A 4LCYB 3AXXA 5A8PA 2N7AA 2ZWYA 2XGIA 5A6SA 1CGYA 3X12A 1A6ZA 1TE1A 1N4XL 4HK3N 4JJ5B 2NX5B 4M6NH 3T65B 5TF0A 4MJ6A 1NAML 1UACL 4P3DB 3ZKQD 2P7TB 4D6FA 3DRQA 1RK1A 1FHDA 3MZTA 3VGHA 1UOKA 3CHFA 1CIUA 4HKXB 1N4XH 5TQ0L 1A7PL 5H37G 2J8UA 2ED7A 1DQQA 2IUZA 4ML4A 4J3WA 3MLWH 4OFYD 4XNYL 4MNQE 2H3NB 3G6DL 5DZOA 3TA3B 8CGTA 1ZLUH 4HQQL 4JRYD 3PJSB 3RWIA 2R0WH 3VPLA 1SEBA 1GGUA 2BK8A 3H9HA 1IQDA 3K8KA 3V5DA 1JF1B 2Z1KA 3PL6A 4L9LC 4MHHG 4Z7VB 5A2CA 4EI6B 3ULUE 2GYSA 5M95B 3UTSA 4NJ9H 4K3EL 4JO3L 5DHYA 4JE4B 2AI0H 5BRZD 4KQ4L 2FHCA 3BUIA 3TJEH 2BNUA 5E7BA 4KTEL 1HHGA 1UM5H 5MEOB 2W9EL 1MCIA 3GKZA 3O0RL 1WIUA 1NSNH 2ZCKH 5TF1H 1L0XA 3BIKA 4NN5C 1T4KB 5JLZA 2YD8A 3D18B 3V0VB 1MPAH 1A9BB 4J1UA 1TVPA 4CU6A 5J1SC 3P4NA 4ZPVA 1F4WH 2YK1L 3BX7C 1E6PA 5INDB 2VZ3A 4LHUG 3AREB 1ZLSH 4JHOA 2DLIA 4OD3L 3SE3C 1EEYB 4HJJL 1A7RL 4PJ8C 1TVBA 1YEHH 3MA7B 5DQDH 2NY7H 3WN5A 1ZWIB 3JV6B 1KGUA 5ALBH 4JFEB 4LDOB 1QBLL 4PRPE 5J9PA 3CZEA 1I8MB 2SEBB 4MZ2A 2CBJA 3P11H 4PP1C 2D73A 2CGRH 1OD7A 4P23B 4GKLA 1YQVL 1NFDE 3MO1B 4ZOAA 4PJCB 1W9DM 5EIIB 4M5YH 1RHHB 1RV6X 3HNTH 4WWKD 3R8BB 1GOMA 43CAA 3DUUB 4NKMB 4XCYA 3LH2H 1U3HB 5KAQG 4MJ6B 2P47B 4HXAH 5I15L 5FYJH 1VFAB 1PY4A 1VFUA 1N0XL 1BMGA 1MAML 5I6SA 3CDCA 3RILA 4RGND 3B5GA 1I9RL 1XF3A 1IZKA 2J2ZA 5HI3C 3AB0C 4O4YH 3TT1H 1V6XA 3EYSL 3S4SA 3U2SA 4D1JA 2VO5A 5B21A 1FL3B 1GQKA 3UC0L 1TR1A 2R2BB 3NFNB 4D9LH 4APQA 3MANA 3NCJH 3BHBA 5HHME 5ALCL 2PO6B 4TUKL 4E0RB 1QVBA 4QHUA 2BNRE 1H3TA 1ISWA 3SE9H 2UZIL 3HI6L 3BD5A 5ACZA 1TZIB 3PZTA 2CRYA 5FL1A 2EDQA 4L1HA 5KG9B 1PW3A 1A14H 1VKXB 3UTTA 2E0PA 2X4TB 2X70B 3LN4A 2XXCB 4N0CC 5LGKA 4NXSA 1OGBA 4ACYA 3MGAA 3EYQC 1RZJC 1Y6MR 1XH3A 1DBAH 4HDIA 2KKQA 1X1NA 3TO4B 4XBGA 2VDNH 1FE8L 4Y4HA 4YO0B 1ZVSB 4NKIL 2CDFA 4LQ1A 4XNUL 4HEPG 5FV1L 1MVYA 3IRPX 5CWSA 1G0YR 4K2UL 5IFTA 5HHPB 3BWAB 5HDBF 5IEKB 3BP5B 1OARL 3VWKB 2A3EA 2PXYC 5C09E 3V5HA 4RZCA 3JZ7A 4MSWA 1N0LA 2EKSB 4XXCA 1JGUH 2YFOA 4HKXA 3RPIB 1P6FA 3T3PF 1VEPA 1OTSC 5D5MA 4GS7B 2WBKA 4UU9B 4XVUD 5DS8A 1CXFA 2EC9U 1QSFD 4M9OA 2QF8A 5C0NC 5F93C 2F54B 5A6JA 4XHQA 1QBBA 4JL1A 4OLYH 5EIIA 2I60H 3C6SA 1MREH 1UADC 4MQSB 1TENA 1JZ4A 3LKQA 2HTKC 4JANB 1JFQH 2IAMB 1KULA 1OARH 4FQHA 1FO0B 3NUKA 5DT7A 3SIMA 5E8DH 4GBXA 4TTGA 2DJUA 4NZRL 2YPLE 5MP6L 4GAGH 1XD1A 4K9EL 1HH6B 4QTIL 2Q86B 2PWFA 1YNTB 7TAAA 5AWNL 2QSVA 4PJCF 2CUHA 2XI9A 1CFTB 2D3NA 4PJCE 2B4CH 3HZVB 1A9BA 2FEDD 4J1UB 1F97A 2DH3A 1H3XA 4XH2B 2FX9L 4YDIL 1LP9F 4ZUWA 4JN2A 5D7IA 4PREB 4B16A 4HEME 2MOVA 2EEDA 4MD5A 4DWSB 1AE6L 2QMKA 3P9LB 4ACZA 2PTVA 4OCNC 5TPWL 3UJTL 3UPRB 3H42L 4PJFE 1L0PA 4JAWA 3ECBA 1FH9A 2YZ1A 4Q7DA 1Z5LB 3O3UN 3IRZA 4JDTH 1IGFL 3OZ9H 3GSQA 2Z8SA 4XP9L 4IIQB 4YHIB 2AK1H 5EFIA 5FM8A 3VFTA 4WWID 4PJHB 1Q9KA 4LLWA 4ZMAT 2BVPB 4N0UB 2IFGA 3B9VA 2PNDA 2HWZL 3O6LH 3NTCL 3WD4A 1XF1A 3PQYE 4I9WD 3STLB 3PWPB 1QBAA 1NKOA 1CFSA 1AVAA 3GMLA 4X6DA 1PAMA 1LHZA 4ZS6C 2DWEA 4ZFZA 4BK5A 2IGFL 2AJZA 2YA1A 1JFQL 3DX9A 2N56A 1OL0A 4C58B 5TE4H 5I74C 4BSJA 3WE6A 1R5VB 3EO1B 4JKWA 3U0TB 1FVDA 3B5TA 3JV4B 2MMXA 1T0NB 3P30L 1QSFA 3CFDA 5ENWB 1KIRA 1L7TL 4PMYA 1FGVL 3L4XA 4MWFB 3QQ9C 3LCYA 2F54A 3VGDA 1K9FA 4UIMB 2DM2A 3CFBA 1JUFA 2WNGA 4QWWC 3CIVA 1LEKB 3LOWA 2DM7A 1JTPA 5ESAB 4DN3L 4P5KA 4JGJA 4WFEE 5E2TH 3MBEB 4Z7NF 1JZ3A 1W0YT 3ZE2F 1QVOB 4O2FB 5DUBA 1FC1A 3MJ8A 2XTJB 3QUZD 1KTDA 3MA9H 4D6DA 2FZ3A 4EIGB 3V95A 1MLBA 2OMNA 1HJSA 5KSAB 4AZHA 1FE8H 3BGAA 2IAND 2MHAB 5KANG 1ZBKA 1ZHNA 4UMGA 4FQXA 1DUYB 4D9QD 4AY1A 5I76B 3QI9B 2OTWA 3MV7A 3NDYA 5CILL 5EU5A 4C83A 4YXHH 2W9EH 5A8NA 3MI6A 4LGPB 2EDXA 3WH7A 4PJAB 1KJMB 4K94C 4N0FA 2VXTL 3IKKA 3ZLQC 4JFFA 5C09D 1FHGA 1QHPA 3VDAA 2H41A 3CLEH 3D2UA 4OFVA 5SWSE 1ZVYA 5BW7C 3AHTA 4U0QB 3U0WH 3GB7A 4H88L 1F6FB 4NKQB 3TTQA 3UG4A 1GOIA 4FQ2H 3PWJB 3HAEA 3O45A 1JWSA 5FOOA 1ETZB 5FUOL 2MFNA 5HVHB 3FT3A 4MX7A 3PWLA 5HDQL 1K4DB 5T3XH 2ICEB 4LHQB 4U1GC 2V9RA 4RAUB 3OKKB 4NKIH 5ECUA 1SBSL 2AK4B 4JHZA 5A8MA 1NDMB 3T0AA 2IWGA 2AKRB 1DLFH 3TN0A 1G9NH 1Q8MA 3F62A 4O5LH 2BDNL 5IBUG 4IRSD