3K8MA

Crystal structure of susg with acarbose
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
650
structure length
650
Chain Sequence
QWTALTASPDTWDETKRADISYQLLLYSFADSDGDGYGDLNGVTQKLDYLNQLGVKALWLSPIHPCMSYHGYDVTDYTKVNPQLGTESDFDRLVTEAHNRGIKIYLDYVMNHTGTAHPWFTEASSSSESPYRNYYSFSEDPKTDIAAGKIAMITQEGAAGYNAAEWFQVSDETAAVKGLLKFTLDWSNAPSPILVVSTGTKADEDNPDTGTDNAKYLYYGEDICKKFYDKGNNIYELTVDFESTWGLLIRTSNASFWPSGTKYGASSSSEKLALNKDFKLTNAGNPANIMFDSQQITYFHSHFCTDWFADLNYGPVDQAGESPAYQAIADAAKGWIARGVDGLRLDAVKHIYHSETSEENPRFLKMFYEDMNAYYKQKGHTDDFYMIGEVLSEYDKVAPYYKGLPALFEFSFWYRLEWGINNSTGCYFAKDILSYQQKYANYRSDYIEATKLSNHDEDRTSSKLGKSADKCKLAAAVLLTSAGHPYIYYGEELGLYGTKDNGDEYVRSPMLWGDSYTTNYTDKTDATVSKNVKTVADQQADTHSLLNIYFSLTRLRNTYPALAEGNMTKHSVYNESQEKDYKPIAAWYMTKDNEKLLVIHNFGGTAMQLPLTDKIEKVLFVNGETQQNTDSDSYTLKLGGYASVVFKLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Alpha-amylase, susG
publication title SusG: A Unique Cell-Membrane-Associated alpha-Amylase from a Prominent Human Gut Symbiont Targets Complex Starch Molecules.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 187
structure length 650
sequence length 650
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k8mA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3k8mA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k8mA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3k8mA03
1Y0LB 2AJYL 3SPVA 4MCYB 1NGYA 4Y4HD 4IBLT 4F2MA 2NX5E 5LA0A 2D3VA 1ZGLM 3UBXB 4UIMB 1N5AA 4NZRH 4OZGF 4L8SA 4RZCB 4UQ9A 1XH2A 4GRLC 5EU5A 5CZXC 3R4DA 1R85A 1I9IL 1G7HA 3BAWA 2OTWB 4Z78A 1TJGH 5F8QC 3MXVH 4JRWA 1GIGL 2EABA 1T04A 1P9MA 3OG4B 5HGHB 1UM4L 5E99L 2DYPB 4UFIA 1VHPA 4AZCB 4Y7MA 2FATH 1PPIA 4AD1A 1WITA 4AMKL 1AGEA 3TN0A 3IDIA 4FOMA 3AM8C 5HHVH 3GO1H 3OXRB 5A6KA 4MWFA 2FJHB 2PO6A 1PJ9A 3HE7D 1I1YB 1KTDA 3DO3A 3H6JA 2BHYA 3MFFB 3QFJB 1VJZA 3V8CA 2CRZA 3FFDA 1T4KB 1OP3K 3EYUL 4W84A 1A6TB 3C8KA 2WM0A 4AEIH 3DVNA 4R5EA 1AXSA 4BUHA 2GJ6E 1CICC 1M01A 2CJUL 2NXYB 3WDPP 1UWEL 3APGA 1Y6MR 2GAZA 2XZZA 4JPVL 3GXMA 2OS7A 5K9OA 1P84J 2CIIB 2HYMA 2O93L 3QO0B 4P59H 1ZHNA 4HS3B 3ZR6A 3QUYD 1KUMA 1YPZE 3EDDA 3KXFD 2BY2A 3GXPA 4AENB 4RGMC 2UWEA 2BVQB 2VLLA 4K9EC 1UT9A 4OI9A 4OT1H 5HYJA 4XWGL 3S9DB 5BJTB 3EO1B 3FRPA 2G9HA 4APQD 5D72H 3U0TB 3UTTB 2J5LC 3ZTJH 4XNZC 4XNUH 3PXHA 2UY7A 4ZPTB 2Y9RT 4L3EA 2P45B 5JR1H 1M6OB 4PJ5E 5CP3H 4S1RH 3QI9D 3MBEB 4G80A 4X6FB 1JNLH 4NFCA 3ZIZA 4AZ6A 5I77A 4PJDE 3WO4C 3J8F7 2ADFH 3I6LE 4Y2DA 4M7LH 3KPMA 1QNZL 4LDLB 1MW3A 3VXUE 3IVKB 3O2VH 5KSBE 1HL9A 3IDJA 4I0PD 4CN6A 2J8HA 3IJ9A 4NKIH 1FOBA 3S96B 2F74B 4MNGA 4EN3B 3SUUA 1K8DA 1Y0LA 4J3WA 4H8WH 1R5IA 3G08A 1N6QL 2X5PA 1X6LA 4JKKA 3RY6C 3TT1H 2IPTL 2V2WB 2CGRL 1ZBKA 5ITFB 4UIMA 5CEZE 3CC1A 4RZCA 4W5UA 1HXYB 4UQBA 2E6PA 4G7YL 4NO3A 1LO5B 1D3CA 3MGAA 3OKMB 5D1QB 4PJ8B 1UKSA 3G9AB 1PKQA 3VGBA 1V05A 2H1PL 1BVNP 4JN1L 4RRPA 3FO2B 1QI3A 1ZT7B 1NBVH 2BXYA 3HMCA 1I9EA 1UUQA 4U7MA 3TYFB 4HHAA 1T83C 3ULVD 1O7VA 2ZCHH 3OXRA 2ICES 5IFHL 3F7VB 2ADJB 3L3OA 4C59B 4P3WA 4U1IA 1XCWA 1M7IB 4NO5B 1UH3A 3U57A 3BAEH 5CZKA 3MFFA 4GG8A 4NP4L 3ZM8A 1E3XA 4P5TC 3LPWA 3OAZH 1Q9WB 1GOFA 1NH6A 2NXZD 4YX2L 2AXHA 3LX9A 2ZX5A 2YEZB 4Z76B 4JLRB 4WVRA 1MVYA 3CZSA 5F7EL 2I27N 1SVZA 4X7SH 4ZSOE 1LK3L 4GUPB 1TENA 4D0BB 3PZGA 3RUGE 2Y07L 4M48L 3BZEB 1AHWC 4LPVA 3UJIL 5DTFB 2BZDA 2XZQH 4V28A 5IW1A 3ET9F 2CIIA 4GBXC 4PJAE 3QO0A 4C7FA 2VZ1A 1CU4H 2B31A 4HS3A 5E2UH 1LLOA 4NSBA 1HXKA 4TVPH 4HWBH 1Q0YH 1K9DA 1HZHH 2HWZL 3B5HA 1LDPH 1GQLA 4JHWL 4Y4KD 1K4CB 4JGJA 3BH9A 5FYLL 1A8JH 1CD1B 5A2KH 1HYSD 4PMQA 2ATPB 5BJTA 3EO1A 3U7WL 2AXJA 2XN2A 2EC8A 5C07D 1ZGLA 5KJRL 4MA7H 2WBJC 1KLUB 3U0TA 4AZ8A 3UTTA 5CCKL 3V7AE 4YIQA 1QLEH 4FQLH 2PETA 4LVNB 4MB5A 3LKNB 1M6OA 4QRPB 5HGBA 9CGTA 3GSQA 3MBEA 1HIML 3AGVA 2VLKD 2DTMH 1KWGA 4H88H 4M62L 3V6OE 1DVFB 4XPFH 4ZFGH 4DK6A 2NLJA 4YZFF 2J8UF 4PY8I 3LS5L 3IVKA 3WLBA 3BSGA 2KUTA 2JIEA 2PTTA 3KPSB 5AY7A 4ELMF 2YKLH 3S96A 3GSWA 3HNTH 4EN3A 1W9VA 2Z35B 1URLA 1ZHKA 2PYEB 4JDZA 1NMAL 4H2CA 3AISA 3O4OC 1ORQA 1OAKL 2V2WA 4OZHF 3ZE0F 3VPLA 1HKFA 4HJ0C 3FO1A 3O3BA 3AB0B 5DD0L 1HXYA 4ZXBB 3RNKB 5I6SA 3MJ9A 3VFNB 1MHPL 2C1PB 5CEZH 3RWFB 1X3DA 1XGUB 1G01A 2XWBB 5T5NF 1GOQA 3V6FB 1KLFA 4PJ8A 1OW0C 1ZLUK 1HTYA 2EPMX 3FO2A 3U1SH 5D2NE 4L9LA 5LKNA 4Q2ZB 2GK0A 2Q7YA 5EC2B 4FMFA 1KCUH 2BNQE 3NVQA 4PJBF 5CD5C 3GM0A 1KJ3H 4AL8H 3IU3B 1DL7L 5ERWA 1LEGA 2DQIL 2F58L 2F19H 3F7VA 1NC4A 2PWEA 4JO1L 2ITDA 1AFVL 3B9EA 4LRNH 2JCCB 1FO0H 2ZUQB 1XCTA 2FIKA 1FQ9C 3LKSB 4JJ5B 4HMEA 3ETBF 2X4OB 1A3RH 1NCDL 1TVNA 3ES6B 4E41D 1BQLL 1Q9WA 4OCYH 4Y88A 1B4RA 1SYVB 1FYHB 5IBLD 5EFFA 2YEZA 4Z76A 4JLRA 2QR0A 4RFNB 5F7DB 1AJ7H 1A1MB 2AAVA 3D85A 4PG9A 4GUPA 1YEKL 1J9CT 4HFWB 5IT2H 2Q3ZA 3BPNC 3QEGH 4OFYA 4R97B 3BUQA 1U95B 4HJJL 2LU7A 1E55A 2A6JB 2ZX6A 3A67L 3O41B 5L2KB 2BXZA 4MNGE 4LQFL 5F70A 1CE1H 1QHOA 1K4CA 5ADPH 2VDNL 2OW7A 1CD1A 2XYCA 1V7ML 1OAQL 3BZDA 5HHMD 2JF1A 1T7WA 1KLUA 4OZOA 3WNNA 1ZS8B 1YNKH 1ZXQA 4F57H 1FC1A 5DD6A 2XN9D 4AH2A 5T1DL 5LA2A 5I18L 3V4PL 5A6SA 5HDOA 4X6DF 3SDYL 3SKNB 1D7FA 4W6XB 3AQUA 4ZMAT 3P0YH 5DJ6A 1S8DA 3QEQE 4LHUA 4F7TA 3CVHB 1PYWB 1A22B 1JPGB 1SYSA 2I25N 2NY4C 2IBZX 1UVQB 2YBRB 4LAJH 4HDIB 5E6IA 3KPSA 4XCFH 3MCKA 1V03A 2DQCL 2OJZH 1WP6A 1NCCH 2OYPA 5L9DL 3FONB 3GI9L 3OKLA 4JN2A 4MMZC 2PYEA 5F9WC 3U83A 4X4YB 3U2SB 1KJMA 4OFPA 3KLKA 4CCEA 1I85C 4ORZC 3WD0A 4G8EA 4X4ZA 1FYTE 5DLML 3RNKA 3E6HB 4PMDA 3DYPA 2C1PA 1B31A 2XWBA 5C6PB 4XNXL 2OLHA 4X9BA 1NLDH 4Y8AA 3O3DA 5BXFB 4KK5C 4Q2ZA 4Z7VB 5GIRA 5EC2A 2AEWA 3BGMB 2AJSH 4Z9KB 5ICXB 5ACLA 3EMCA 4NFDA 3D4ZA 1XSKA 2GT9A 1EEQA 5C2BH 3LZFH 3RVVC 3Q6GL 2GK1A 1WSST 3LKOA 2O9OA 3U5UA 4PJ9A 2P5WA 3VXTB 4Z7NE 2JCCA 3MUHL 3NDYA 1OLLA 1BWWA 1AP2B 4JFFD 3T4YB 3BISA 2DQEH 2ORBH 1TJHH 1R87A 3LKSA 4JJ5A 8FABB 1J8HD 1F90L 3ES6A 3TZVD 4D6HA 5HPMB 5F7DA 3QB7C 3ARRA 4NBXB 1UKPA 1RZFL 4WEUD 2DTSA 3QDME 3BKCH 5F9DC 2FH8A 3KJ4C 4S3JA 1V02E 3SDAA 5GJSL 3MUIA 2C3VB 1PX3A 4RWYH 4KJWD 4EK7A 2YC1A 2A6JA 1GC1L 2X2YA 1KXTB 5FXCH 1G6RA 3QHZL 4R9HA 5EU4B 5L2KA 1RK0B 1E4WL 3OHXB 3DWTA 1JYXA 1CGTA 4BSVB 4DFIA 2V5CA 3V9FA 2VN4A 1Q6DA 2JF6A 1HKJA 3BDYL 1YEEL 3S4SG 1J9YA 4QO1A 3ZE1F 3QNZA 5JW3H 4RMUA 1EHLH 4JL2A 5BS0D 4OQTL 1EQPA 1R8LA 4FQIL 3WFDL 5ISZA 3TGXA 3RJYA 4JHBA 2APWA 3RWJB 1JZ3A 4R7NB 3HG5A 1DQQB 2ZIDA 4PJIB 3P4LA 3HC3H 4MJ5B 2XG9A 2VMFA 1ZT1B 3PWJB 2UY5A 3CVHA 3DX2A 2CK0L 3BSZL 2CDEB 1S7RB 1UVQA 3UYRH 1D6EB 3H7BB 3WL9B 4HDIA 1QYGL 5I1KL 4IJ3B 4YNYB 4MD4A 1M7XA 1W8NA 1QD0A 1J1OL 5FHAL 3WFBL 5D1ZA 2ZXDA 4YN5A 3U2SA 4X4YA 1OCWH 1J05B 1CLVA 3ARFD 3QIUC 3EKCA 4XH2A 1INEH 3SJVA 1RMFH 2YLAA 1S9VB 4J3UA 5EU7E 4KQ3H 3DJ9A 2XZCL 2FEDD 1LG2A 1GC1C 4Z7WF 4JO2H 3TO2B 4KK9D 3CLFL 3EBVA 5C8JB 2EYSB 3CIQA 1XZ0A 3B9KB 4PJHB 3D39E 3QFDB 3N04A 3UBXI 4QXTA 1MREL 2BSRB 4JZJC 1E1EA 3DTXA 3INUL 2V5YA 5FUZL 4A6YA 3BGMA 2DLIA 3K4ZA 5ICXA 2F53B 4UV7L 2NYYC 3UTSE 2CEQA 4EBQH 5C70A 2Z31B 1C7SA 2DWEB 5CKAA 3L1OL 2VL5B 4U2ZA 1X4XA 4KJPC 5DWUL 2ZUXA 1E5NA 3MV8D 3GMPB 2AI0H 2V9RA 1JPTL 3GHBL 3QUXD 4W89A 4JZ5A 4M03A 3MRBB 4JFEA 3EO0B 1FORH 4YHML 1NCWH 3QG7H 4P7RA 1KXHA 2FWOB 3L2LA 5L8LB 3ZSSA 4QLKA 4UR9A 1KIRB 5TDNB 2EDEA 1P53A 1MCEA 3LY6A 4NNPL 2B39A 5GRVL 2VB5A 4HKXB 2IF7A 3T0EA 5FEBA 5CSYA 3VD3A 4OCMC 3W11D 2BY3A 2YD6A 4K23H 3RZCC 4J6RH 5GS0L 1U8PB 4LSPL 4JFVA 4XP6L 4EI5A 5EU4A 1MVUB 2HKHH 3K3QA 3LAFA 5IUSA 1X4YA 3OHXA 4BSVA 4QRRE 5KG9B 1O6IA 2GTZB 1WUNT 2FD6H 1PIGA 1P1ZB 5DFVC 2MQ0A 2X09A 3A23A 3MRRB 3VA2C 1I8LA 1Q6EA 1V6WA 1UWIA 4M6OH 2CKBA 3U48A 2F54B 2IG2H 1HKKA 3WD5H 1B0WA 1KJVB 1BAGA 1HX0A 2I26N 4LLAA 2FJFB 3K8MA 3UG4A 1EO5A 4HU0A 4B3LA 1A3LH 2AW2A 3C9NA 4OF6A 4PJIA 2Y5TB 1BQHB 4JVPA 4P2OA 3VCLA 1KELL 4YR6B 4MJ5A 4NM8H 1MLBA 3PWJA 1P4IH 1CD8A 2CDEA 2EKSA 1NAMH 4Y89A 3NIYA 3O9NA 3H7BA 4LSTH 1QZ1A 3QJFB 4WFGE 5IHZA 3T2QA 3UTPE 4XAKD 3QH3B 1WZMA 2X2IA 3MV7A 1EMTL 3FTGB 1J05A 2Y1VA 4RISL 3R8BB 3SKMB 1KNOB 1S9VA 5HJ3B 5IHLB 3EDKA 4RQQB 2GJPA 2FL5A 5DEFB 5IF0A 1OAUL 1S5HB 3G6JF 4ONGL 2IADB 4MJIA 2DICA 3QUML 2EYSA 3HC4H 1UFUA 4BA8A 2OP4H 4JO4L 2WANA 3B9KA 3QFDA 4AD2A 2BSRA 3LMJH 4D8PA 1TDQA 4XHQA 1RHHA 2ZJSL 4DFHA 2WVVA 1A7QH 3KDMB 2EADA 5IJKC 4KDTA 5A6AA 2HTLD 2F53A 1HH9A 5EZOL 2YD2A 2J7HA 2Z31A 1A7RL 4H1LA 4CUCA 1G9NC 5HVFB 1PW3A 4G5ZL 2GDUA 2F7QA 4V2BA 2R4SL 4LKCA 2VL5A 1T1WB 1RIUH 4RGOH 3QEHB 4NJ9L 2OL3B 3WNKA 3L3HA 1ZEAH 3GMPA 1YJDC 4W4NA 4LLYA 1U36A 1QSFA 4F3FB 4P0DA 1ZANH 5GQBA 3I6GB 3QHMA 4R4FH 3U36B 3HG3A 3DUHA 2ALWA 4MS8D 3N1AA 1KIRA 5TDNA 5C0CB 1QSEE 5MI0C 4Q0XH 2C8NA 4K8RL 5ESQA 1C8XA 3R0NA 4X6BB 4LIQH 5T3XD 5J6GA 4HFUL 5DD5H 1Y18A 2R69H 1KOAA 4DKFH 1MW1A 3PL6D 3M8OH 3SCQA 2APBA 5IB5A 4TNVF 4TNVK 2OSYA 3STLB 3EBAA 3HZVA 2DMKA 4HV8A 5FF6A 1HKIA 5DDHA 1MVUA 4KKAC 5DQDH 3IDNB 4DO6A 1W2VA 5FB8B 4IRZH 4EUPA 2JKXA 4PP1C 2F54A 3TV3H 5DO8A 3GNMH 2A3HA 4UQCA 5HGAB 5I8KL 3CTTA 2YPLB 2XICA 1NGPH 3EOBB 3UJJL 5FHBH 1I9RL 5IIEB 4DKEH 1WT5C 3M46A 4PGDB 4S0SD 3P73A 1FP5A 4L4TD 1QVBA 1P7KA 5T5NG 1PFCA 4C7GA 3GI8L 4Y4FC 1RK1A 2D7TH 1MQKH 4MAYD 4XUYA 1MJ8H 4NF7A 3B5GA 3QWRA 3QJFA 4C54A 2XSAA 1A6VH 3O8XC 1XFPA 3AC0A 3QH3A 2X4RB 3N1GC 1MCQA 4P2YA 5L88L 3A6OA 2BNRB 1KV3A 3FTGA 3K81A 5E4EC 3TO4B 6FABH 1AQKL 4JPIB 2XWTA 3SKMA 4M5YH 4B7LA 1MFDH 3BAXA 4LU5H 3A21A 1NCBL 3DX6B 5DSCA 1N3NB 4AT6B 2BSED 3GMRB 5LGHH 5TH2B 2R1WA 3BKYL 4PLJD 5CD3B 5EU3B 4L4VE 3LQZB 3X3GL 2IFFH 1S5HA 2VC2L 4FXGB 1CGSH 2XPGB 1E4JA 1EFXA 4XVUC 1A47A 4P2RB 4CW1A 3GKZA 3DNKA 4DQOH 4J23A 2QQKH 3I84A 4F9JA 3C5SB 3G6DL 3PHQB 4M1CD 3SDCB 5CBAB 5T1KD 1CEOA 3MR9A 2D7MA 3KJ6L 3RPMA 1CDBA 3KDMA 3I85A 3BH4A 2D7QA 3JWDL 4DWSD 1BQUA 1MFVA 2P48B 1KPRA 4KUZH 3STZA 5J13C 1BGXH 1K2DB 2WUCH 5DYOA 5CPSA 5D9OA 1XIWB 2BX5A 1T1WA 2R39A 2VH5H 4NC0B 4X4XB 3QEHA 3GSNH 2J4WH 4O5LL 2EKJA 5CUSL 4PY7B 5J0BA 5IEHB 3HFMH 4NKDA 2DAVA 4I77H 4TUKL 5FCZA 1AQHA 2BVPB 4V2CB 3JUZA 1IQDB 2AABL 1T2QL 3U36A 3DURB 3QDJB 2V3DA 2IH1B 3GM8A 1JWMB 4B15A 1U3HA 4Y16A 2D22A 4ATLA 1KTRL 4IEFB 3VXSD 4RNRA 1TQVA 4M8QB 1B6UA 2JELH 2XA8H 4R8WH 1F8TH 4XP5L 4JM2B 1XF5A 3S36X 4F33B 2IXUA 2NX5B 4W81A 3W6LA 5F9OH 1ZS2A 2ITCB 1L7TL 4WI8A 4YBLC 4IRJB 3HI6H 1NSNH 2UZYB 5HHXL 3TYGL 3MLYL 4PRNB 4GG6F 3IDNA 4Q22A 2LAAA 4XRCB 5KSAB 3RJXA 4JHZA 2UVFA 3OGOE 1XGYL 1CL7I 1HHIB 1EXUA 5E2WH 4W7VA 1QFWH 3TT3H 4MNJA 5BRZB 3WDIA 2HFFB 3C5ZC 2YPLA 1MRFH 5CHNB 5GS2H 1IC1A 2B4CH 1IGTB 3EOBA 4KZEH 4AYGA 3OLEA 4I18B 2WVUA 1FGVL 3ZYZA 4P46B 5E1HB 4X98B 1R3LB 2RB8A 3UPCA 4YUEH 3QYCA 5F6HI 3MRLA 3O2DL 4MQTB 1INQB 4CVXB 4RFEA 5D1XD 4JRYE 2BDNL 5A2LH 5I1GL 4C83A 5F9JA 1OL0A 3V79C 2IAMD 4IM4A 4LCUB 4M7ZB 4YFLF 4LRIA 4D3CH 4UZSA 4OIAA 2BNRA 3FN0L 4UT7H 3D6GA 3QPXL 5FCUH 2GJ6B 4PRIE 5TJWK 4JPIA 1P7QB 5DD3H 5I1LB 3EOTL 1N3NA 4FMVA 3B2UC 4ZUWB 3S3PA 2E7LA 4S10A 3ISWA 3S34L 1HVQA 1QNOA 1FE8L 5EU3A 1JF5A 5EWIL 3LQZA 3VXRA 2GJZB 4TUFA 2Y6SD 3THML 4P2RA 4QHLB 2VRKA 2VDPH 2W9DL 4MTVA 1IM3B 1XMWA 4NGHL 1H5BB 2VDRL 1OQXA 1KPUA 1BVLB 1UM5L 3C5SA 3RWEB 2DYPD 3PHQA 4EXPX 4LEXH 1SM3L 1UA3A 3EJRA 1QVOA 3U46B 4N5ED 3DBXA 1EBAA 4JFQB 3TA3B 1YJDH 5A2FA 4FQXC 2YD3A 4MPKA 2OLDA 4JFZH 1IFHH 3HG1B 3SDDB 1H15B 5CP3A 3PNWB 4F7MB 3MLPA 1K2DA 3GMMB 2VWEC 3RX7A 1PZ2A 1EJOH 1C12B 1XIWA 5HVWA 1UYWL 3KEHA 1GOWA 4EDXA 3QFJD 4X6CE 5C0FB 4OV5A 5K9QG 4XHJD 1BSIA 1E6QM 2BVPA 2BFVL 3MSGA 4BS0A 5JUEH 4GRLB 3QDJA 3VXUB 2IH1A 2YD8A 5KSBB 5ESVB 3VXNB 3V0VB 2D31B 4GQ9L 2OYKA 1TVPA 2CLVA 4TSAL 2QF8A 4JPWL 4CBPA 1CFQA 2FEEI 3VGFA 1NDGB 4JM2A 1CFNA 5T1LD 3VH8G 4QRTB 5C09B 2D23A 1OQOA 4Q6IC 3I6KA 3JWOL 4IRJA 2VXSH 2NMSA 3IGUA 4WHDA 5GNZA 2XGIA 4YHPA 2MQ3A 4HS8H 4XRCA 5CGYC 4NCC2 4H0IA 1E6RA 4KI5D 2ILLA 3FO9A 4OF7A 3NCYP 5MP6L 2EPKX 1TQCC 2PW1A 5IMMB 4Q9CA 5I66A 5BRZA 3IJHB 2C5DC 2EH8L 3QAZC 5CHNA 1HWHB 1HKMA 4MDPA 4BUGA 3QHTC 4FQQA 2H6PA 3NGBC 3SKJL 2GKIA 4FQJL 1R3LA 1FO0B 1G7QA 1NUDA 4P23A 4NUJA 3A6BL 3I02A 1A0QH 4DGVH 5F96H 1INQA 2PR4L 1WEJH 5BVPL 1CPUA 2ZG3A 2O5XL 4UOW0 4WTZG 5IFAH 3O45A 2DMBA 4DKDC 43C9B 5JA9A 4BFBD 3FZUC 2MKWA 1QKZL 1WWWX 1AVAA 2YBUA 2EJ1A 4LF3A 1PY4A 3EYSL 2EIEA 1NBZA 5C0GB 4LSQH 1Q0XL 1T7ZA 2JJVA 3RUGB 3SGEH 4KDWA 1VGKB 3NACH 2GJZA 3O3EB 4RMRA 2Z1SA 1AI1L 3GBDA 4A3HA 4QHLA 4HWZB 5AYIA 1IM3A 4ZS6C 5GHWL 1OSEA 1H5BA 1BVLA 3X17A 4FNRA 3BEVB 5DJCA 3WO4B 2HFGL 2OXGA 4NO0A 2CKNA 1MCKA 3TA3A 5DA4A 1VGEL 4TVUA 1AGDB 1LWJA 4HU8A 1MWAH 3HG1A 3RWHB 4J3TA 3GMMA 4HG4K 4L8CB 5C7XH 3P0VL 4JY4B 3F58L 4ODTH 2X4UA 2M1KA 4PGEA 4OZIB 4GKZB 2E6QA 3L3DB 5C0FA 1T66D 5GPRA 2V3EA 2EPOA 5GSVB 4GRLA 2GIYA 1UB6A 1N5YL 1EAJA 3VXNA 4M4RA 8CGTA 3V0VA 4IDJH 2APFA 2YA2A 5KOMC 1V6YA 1XR9A 5DJAB 3POCA 4L8DB 1JD7A 4NIKB 1Y6KR 5J56B 2KQMA 5C09A 1UYQA 1AMYA 3MV9B 2BV9A 2UY3A 3CGTA 4CVZA 1HL8A 2FLBT 4HA1A 4UINL 3AM8A 4N0UE 5E5UB 2PW2B 3LDBB 5JOPD 4OLUH 3T4AB 4UV4L 4PLOB 2R2CA 1FSKB 1IBGH 2QKIB 2YZ8A 4KK8D 4ZXOA 1LL6A 1QLRB 4HBQA 5IMMA 3UTQA 5D2NB 3IJHA 2XZAH 4WFHD 5L6YH 3DX8A 4PJXB 2IGFH 3ZKXC 3RAJH 4P2QE 3RVXC 1JNHA 3O9WB 4QRPD 1OWQA 3PWUB 4AMCA 1KB3A 1CICA 1FO0A 1MCOL 1D5MB 1NLBH 2O9PA 1DVFD 3MZTA 4LGXA 5KVEH 3W4RA 3S88H 1IAIM 5IEKA 3S7GA 4DVRH 2VRAA 4WUKL 4U6VH 5I1DA 2IGTA 3RDTB 2ENSA 4GBXB 4AIOA 1OWWA 43C9A 2EYTB 2HLFD 3ILPB 2Z92A 2H8PB 1XCXA 4LCCC 1I1XA 4NT6B 5ALCH 5A6MA 2Q8XA 4WWKD 3QULB 2AXGB 5CJOL 1OP3H 2EEDA 4Y4HC 1BGAA 1MRCL 1K3IA 2VDMH 1C08A 3HE6B 2EDKA 5F93C 2FBOJ 4WUUE 1BVZA 2EEAA 1IMHC 1FVCA 1AD9A 4QEGA 3O3EA 1W72A 4FQCL 2WVSA 3S2CA 5DD1L 3BEWB 2XVNA 1IC5L 2HT4D 5FL1A 3BP6A 3FAWA 1S7SB 1BBJB 5FUOL 1B1YA 1D5IL 4O4YL 4AG4H 1OGGA 5AZ2L 5GGUA 1P4LB 1A6UH 3RWHA 1B4JH 1H1NA 1I8MB 3QDGB 2ED7A 4FZ8L 2X42A 4HD9A 1U8MB 4TOQA 1U3YA 2XPKA 4PREB 5I71C 3LEXA 4X5WA 2PXYB 1FBIL 2H3NB 4HWEL 3RY6A 4OZIA 4OAWB 3O4OB 3PGFL 5C92A 1KN2L 5GSVA 2JJUA 3C8DA 4WIQA 3QZWG 2WZHA 4YZFE 2J8UE 1TZHA 1YN7B 5MENB 1KB5A 3ZJ8A 2A2QT 3BESR 2MSPA 1J10A 1BJ8A 4I9WE 2C3GA 1CQKA 3D18B 4ELME 5I8CB 3V5DB 3VGAC 1Q38A 1GZPB 2IWGA 4UQ3B 3F62A 4L1DA 5DURD 2VQ1B 1XGRB 3CFIC 4YHZL 3TPUB 2BY1A 3MV9A 4OZHE 3ZE0E 1AO7E 2ZKHL 1ETZA 4O2FA 1SJHB 3VWKB 4AWEA 3WXWL 4XBEH 3KLDA 4KRPB 3PZTA 1RUAL 3QUYC 1S7QB 4FFWD 3BN9C 4M6NH 1JFQH 1T83A 1RURL 1OAYH 4QHUB 5EMYA 3FQNA 1XH3A 4IS6B 3JWNC 4OLWH 35C8L 4TOYH 2FB4L 2X10A 3I50H 1T20B 1LO0L 5JW5A 1HXMB 3WFEH 3TNMB 2ZUVA 1A7PL 1U8NA 3E2HC 4P5TA 1G7LA 2BHUA 5BXTA 4JDVB 4PJXA 5DFAA 5T5FH 4AD3A 4U6HA 5EU6A 3CO4A 2DQHH 3GB7B 4PJBE 4Y1AD 2AV7A 1OP5K 3QI9C 3HZYB 5EFIB 5HYQB 5AYUH 1PAMA 3WEXB 4HIIA 2MHAB 3U7AA 4LLDB 4X9GA 5I1EL 1HQRB 4ONHA 3LKQB 1I1AB 4PD4J 2D73A 3N17A 4WNQB 3GZKA 4GBXA 4YJZL 5I3DA 2EYTA 2H8PA 3KPPB 2DLFH 2OR8A 4KI5F 3QULA 2AXGA 4U0QB 4J2XA 3G5ZB 3AFBA 2B8OT 1T89C 4MD5A 3ELAT 3EJQA 1INDL 4WHCA 4AIZB 5GRJL 1DR9A 2WBJA 3CFCL 3MLWL 4GOSA 5FA4A 3QDMB 4WTZA 1FNSH 3EFDL 3ZKQD 2W62A 3DXAB 3BLPX 4WKFA 1DP0A 5JLZB 1JIBA 1HVXA 1R0AH 1ADQL 3G04B 2J6EL 1S7SA 1BBJA 4NQDD 4PBVC 4OM1L 5BWFA 1VCAA 1JWSB 3L3JB 4KTDH 3IKCB 2FGLA 2OWXA 2WZEA 3W0WE 5GRYA 2NY4B 3L4XA 1MJUH 2E7BA 3WS3B 3P4MB 4W8BA 3ULVC 1I8MA 2E0PA 3KPLB 1C16B 2J12B 3ARBD 3S35L 1U8MA 7TAAA 2RIKA 4GW1A 4HXBH 4JFDB 3U0WL 4X6DE 2PXYA 4KPHL 5B39A 2H3NA 4OAWA 1GONA 1ND0B 1NAMB 3KLLA 3GMNA 1H2JA 1JCKA 2NXZC 3HUJF 4JO3L 3S37L 2G75A 2R0KH 1FG2A 1YN7A 5MENA 1WAWA 1PVHA 5E6ZA 4WSJA 3FQTA 4P9HL 1BAFL 5I8CA 3V5DA 1OW0A 2P8MA 5I1JL 2VQ1A 5HTSA 2Z8VC 3IJSB 2R2BA 1XGRA 5KN5B 3TPUA 2I5YH 1E27B 1Q9OA 3DOSA 1SJHA 1AQDB 2FLRT 2D0FA 5JPNB 4AZHA 1CBGA 1QBMH 4UTBL 1UG6A 5IVZA 3WN6A 4QHUA 3GUTB 2WP3T 4Y4KC 3RQ3A 4PV8B 1E28A 4P9ML 2X7LB 1F6AB 2NTSP 3OKYA 5CIPH 5ELIA 5HGDA 3W9DA 1VEOA 2ESVB 3KAAA 4ZUSB 1HYSC 3D39B 5EC1A 1SY6H 5DJYA 3TNMA 3RVWD 4M56A 5IW6B 1MIEH 4JDVA 1GGCL 5D7JD 2CR6A 2J8OA 1WDQA 2X9YA 3BUDA 4ZXLA 3OXSA 3GB7A 2BSTB 4D0CB 2C1OB 3VX0A 4D9LH 3UTSB 3HZYA 5HYQA 3EIFA 4JM4L 4NKQB 1KTLA 2X44D 1V6UA 3W39B 5ITBL 2MHAA 4U1MA 1CE6B 1KGCD 3LKQA 1OLZA 5SWSE 1HWWA 2X4PA 3K46A 4WNQA 1L6ZA 1VIWA 2YUZA 1K4DB 2IANE 3N9GL 4PSRA 3MJ8B 3VFOB 1XRVA 5D4QA 1QWUA 2JK5B 1JGEA 3T0AA 3G5ZA 2NY2D 2YL8A 4OUOA 2R29L 3ECBA 3OTTA 4S1QL 4AIZA 3RHWF 5IOPB 4JPKH 5LBSL 3RHWK 3UAJD 4P3CL 1NJ9B 3UPRA 3LSOA 2DB8A 4JREB 3DXAA 2VITB 5D6CB 5JMOC 2XFYA 1RU9H 1JPST 5F44A 3M6DA 2DH2A 3HTLX 4GKNB 5EUOA 5IBTH 3WQ5A 3G04A 5HD8D 3NFSH 1O7DC 3LRGA 3OLDA 1DLFH 4QRRB 5KS9A 1A3QA 2KDGA 1JFHA 3L3JA 1G5AA 3CJJA 2DWDA 1OCQA 2AV1B 3CUPB 1B0GB 4R27A 3WS3A 3ZE1E 4U4BA 3T2OA 5EZIL 2G41A 1KXQE 1BFSA 3WE6A 3EJPA 5ABFB 4JFDA 3GJEB 1FNEA 5FGCE 1ZTXL 3MLUH 1CFVL 3CNKA 4PIRF 5JOFA 1ND0A 3QIUB 5IV2B 5EZJA 3GBNL 2E3ZA 3QCTL 3A5VA 1I85A 1WZ1L 5FCSH 1ZHBB 2AJZB 1TFVA 3KWXA 5D2LF 5IBLC 3MSDA 1MCJA 1A7OL 1EGJH 3OB0K 1IQWL 2DD8H 5F7LB 3QPQC 2WIIB 4ZOCA 3QXDB 2CBJA 5KN5A 5JNYA 5KW9H 3PQYE 3H9HA 1LEKB 2X40A 2OTUB 1T2JA 1CDHA 4LMQE 1XT5A 4WI7A 4R6UA 5JPNA 4Z7WE 1I9IH 3B2VL 4PUEA 4PJ7A 3QQ4B 3PWNB 1F6AA 3TJEL 3II1A 2EAEA 2ESVA 4ZUSA 1RULL 1DDHA 3P11L 1UM4H 5E99H 3EGSB 1S7TB 1K5NB 4GO9A 3MYZA 4N8VA 2V7HA 3BIBX 5EBMA 2JIXB 5IB3B 1UWUA 1FFOA 2OK0H 1F4HA 3IFNL 5HI4D 2H41A 4G6KL 3GSNB 4I5BB 3X3FL 1CE6A 1H8SA 4NOFA 4ZQKB 2AEPL 4ORGB 4PCSA 2DJUA 4JR9L 3BPLB 3RZCB 5JHDD 5I24A 1K4DA 2XHYA 2CSPA 1UKTA 2VDKH 2W59A 4BQCA 5LQBL 3I75A 3DRTB 3TLRA 3VKKA 5D7KD 1HHJB 4U3HA 2YDSA 3NSMA 1A5FL 4XXDB 4FTVD 1UWEH 3MRNB 1BZQK 2R2HB 4FABH 1JJUA 1LEIB 1NJ9A 3FB5B 1HI6B 1YNTB 1FP8A 2VITA 15C8L 1P6FA 1XHGA 1D2KA 1JWUA 4C56D 5FYLE 4JANA 4AD5A 2JB5L 3ULVH 3OJ2C 4YAQA 3Q0HA 4Y19E 2A3EA 3NCFB 4CD7A 3QRGH 5JOEA 2ZXAA 3AMGA 1K3ZA 1XAUA 1AE6H 4XWGH 4A2MA 3HZ3A 4GRWF 1AXTH 4NM4L 3CUPA 1B0GA 4UOW1 3ARYA 2QSCL 3VXPB 3GJFA 5I2UA 3WD2A 1JDAA 3Q1SL 3B3IB 5D7LE 4XMLL 3TJHD 4ZUUB 3QIUA 5IV2A 4NQTA 4N9GB 4Z5RB 4PJCB 3SCRA 5EA0H 1ZHBA 2AJZA 4QRUB 1QNZH 3GSVB 4PJEF 3ARTA 3TZVC 2XXMB 3JTSA 3K4DA 5CZVH 5C0CD 2BNUB 2X70B 5KEZA 1X1NA 3CUHA 5E9DE 3VD4A 1BYCA 1VF8A 4GPNA 3LN5B 2WIIA 4ZNEE 3AJ7A 4JZJA 5FAAA 5I9QC 1TVHB 2F8VA 4K2UL 3KPNB 2IPTH 1NBYA 3DDFA 3VFMA 2CGRH 5FYJD 2PYFB 5E8PB 2DI7A 5JBEA 1U91A 4UT9L 2OTUA 4KJWC 4KZDL 2J79A 3KPRD 4MSWB 4G7YH 3NABH 4PLNC 5IR1B 4HF5L 4L4VB 1IZKA 1XSIA 1Z9SA 2GFTA 1BD2B 5DK0A 2G3JA 2H1PH 2R9HD 1KSRA 2EBNA 1J0JA 1C5BL 1L7IL 3G5YA 1PS3A 3OKEB 4HUVB 5FGBC 4HK0B 1UR1A 5IM7A 2JIXA 5A3ID 5IB3A 4MNQD 2FGWL 2LQRA 3VXME 3S3SA 2JEQA 2NT0A 4WI6A 4OF5A 3SE8L 3GSNA 4I5BA 2VLRB 2A6DB 3LOWA 4ZQKA 1OGAD 3D50A 3ZOAA 2V38A 3FXYA 1U58A 2Z93A 5C0IB 5ADOL 4NP4H 3RZCA 4BQ8A 3D2UD 2CO6B 3MODL 1JHLL 2YD4A 4X80L 1NP0A 3HB3D 3PWPA 4JIEA 4EQ2A 3M17A 2NW0A 1ZA6B 3C6SB 5GGSY 1CLXA 1VADB 2F7PA 2XN0A 3RM9A 5IVXF 1HHJA 1WIUA 4CU7A 1IARB 3P3YA 3TO4D 3HN3A 5B22A 5FUCC 3CHCA 3CUGA 2XGBA 2Y07H 2W91A 4OFKA 2YKKA 4NHUB 4KK9C 5HYSG 3VE0B 4PMVA 4JL1A 2DT2A 2HWZH 1KCRH 2QTEA 3MI6A 3O6KL 4D6JA 4JHWH 4W93A 3O4LE 1MAKA 2VERN 4XCCH 4NXKA 1J8HE 2Y06L 1JTOA 5HHNA 3U30C 5KJRH 5CCKH 2YS4A 1H0DB 4Y5YB 3VJ6B 5IK3A 3O8XB 3FQUB 4JFXB 3MUZ1 3B3IA 3MJ7B 1OHQA 2WINB 3ARGB 4LSSL 4Y5XC 2R8SL 3AXLB 3B43A 5D9MA 2R1XB 1HIMH 4KVCL 3SCMD 3MJ6A 4ZUUA 3O0RH 3QUXC 4PJCA 1PBGA 4P7OA 2A9NL 4QRUA 3FFCE 4AQOA 2V3GA 1LDSA 2KBGA 4PG2C 1Y7VA 2BNUA 4TNWF 4CKQA 4TNWK 1G1CA 3DC0A 2XIDA 3KPOA 2WB5A 1XYFA 2Z4QA 5TQ2L 4XNQB 3OKKB 1NMAH 4KROB 4ETYA 2WUBL 3W11C 1BX2B 4U0RB 4PRIB 2NX5D 5DZNA 5E8PA 2I07A 5IJKA 1OT1A 3I9GL 3WENA 4LVEA 4PN2A 3UZEA 2DDQH 3FW6A 2XFRA 5INCB 1U3ZA 4GAYB 1PIFA 5IR1A 1MHPH 3HZMB 2F1AA 3BGFB 1MEXL 3AAZB 4E5XB 4F8QA 5J13B 1IAII 4JB9H 4X9FA 5KSAD 4RDQF 4LLWA 4I2XB 4UIKL 1BD2A 3T0DA 3WL0A 4B3KA 4QTIL 4FLQA 1U8KB 2G60H 1X5IA 1QRNA 4PGJA 5C0EB 4KHTH 3OKEA 4HUVA 2FX9L 1MWAB 4WW2C 7FABH 3BUYA 4WO4B 4H25A 4AK1A 1JI2A 5DUBB 3E0GA 1BOYA 2R1YB 1DL7H 2DQIH 3QJHA 2F58H 2GI7A 3NN8B 4JO1H 4PRDB 5D93C 1GGBL 1AFVH 5GGRA 2VLRA 4PV9B 3OKOB 5BCAA 3QXUA 2DBLL 1EEUA 1WFTA 4GFTB 5C0IA 3GNOA 5TE6H 4X6CB 1E56A 1GOHA 4Z7QF 3VIJA 4J27A 1WCQA 1BQLH 2D03L 1GGIH 2VX7A 3C6SA 3SGDH 1WFUA 1W32A 4M7JH 4OCWH 4G8GA 5HBFA 4GRMA 2GJ6D 5DRWB 2VABA 1MELA 4J3SA 4ZAKB 1P7QD 1R3JB 2UYLA 3UERA 3BYYA 3I2CL 3N1PC 3VIIA 5DMYA 2P8LA 1YEKH 3MGOB 4HCRL 4FFZH 3FOLA 4MA3A 1X5GA 3CHFA 3S4SB 3C5ZB 3UJTH 3CHDA 3BKMH 3C09C 3VE0A 4OZGB 3A67H 5HVGB 1WT5A 4QP0A 1YYMH 3HC0A 1JXKA 2VDNH 4CNIB 4LOUD 3HRZA 1AKJD 4W7WA 1RZ8B 2HTLC 5A3HA 5MERB 1OF2B 4I3SL 1JHKH 4UQ2B 3VJ6A 1H0DA 4UB0L 4XBPA 3NCOA 3SDDD 4QHNB 3O8XA 5T1DH 1W3KA 3FQUA 1H3GA 3H3KA 1DFBL 3LVEA 4MCZA 1TNMA 4JFXA 1AC6A 4X5XA 3H3PH 3MJ7A 4GMSH 2WINA 4LASH 3SDYH 2YD7A 4PJ5D 3E3QC 1O5DT 2E8ZA 1W0WB 1V6XA 3JTTA 2W66A 2FO4B 2DQDH 3P9WB 3SUVA 2AXFB 1MYRA 3I6LD 1JF1B 2VUOA 4QHMB 3VXUD 5JHLH 4MA1C 4MS8C 4QF1B 4P8WA 4XCYA 2DQCH 4FXKB 4KRUA 4FNUA 1RJYB 4XNQA 5C0AD 2CLRB 2YN3A 3PL6C 1HSBA 1BX2A 4M3JA 5CEZD 3IETB 2HVKA 3L7EA 4FQXB 1IGIL 3MGTA 1MRDL 3G5VA 5EPMB 1ISWA 2MQCA 1PG7W 4I2XA 4XNXH 2K7PA 1RI8A 4QOKB 1HJXA 4PUDA 3C87A 1T1XA 4M3KB 4ODVL 3CX5J 3C2AL 4Q7NA 1I1CA 4WO4A 4ALAL 4UDUA 1FH9A 3X11B 1MH5B 1IL1B 2YD1A 3MREA 3NN8A 1VACB 2E9MA 4ZS7L 1FFPB 2AQ1A 2JJWA 1DBKH 2HLAB 3BP7B 5LXGH 5M17A 3RL2A 1IT0A 2CIPA 1RZGA 7A3HA 1NQ6A 3X13B 4ZFFB 5J1TC 1FN4A 3BAIA 5ID1B 1QPPA 5D4YA 1DSFL 5C6TL 2R0WH 4LLVB 1GHFL 2IH3A 3VNYA 3T3MF 3LS4L 1S7UB 5T3ZL 3WKNA 1CBVH 1TIUA 2BNJA 4PLJC 1KEGL 5A6BD 3C5ZA 1EV2E 5GJSH 1UZ4A 4K3GA 4OD3L 2A77H 1GCYA 1R86A 4HIXH 1UJTA 3AXHA 3GXDA 4P7QA 4Z2JA 5EBLA 4OZGA 5EOCJ 1M7DA 1IGCL 3QHZH 2NZ9C 3NGBB 4PRHE 3IU4L 4K71C 1E4WH 4N90E 1RZIB 1CENA 4CNIA 1NBQA 1GOMA 5E8DL 4M1CC 3NA9H 4C4KO 4YXKL 2HJLA 4Z6AT 4XPAH 1RZ8A 1T21B 5GRUL 1W0YT 4UQ2A 4X6EA 5D96C 3IDGB 4GS7C 1FLRH 5HYSA 5DT5A 2O9TA 2FCBA 1S5IL 5DJ0B 5DJDB 2EDHA 4F58L 1Z0NA 4XP4L 1CFSA 4KTEL 4P2QB 3PDDA 1HKLL 2VQTA 1W0WA 3SKUD 4Y0GA 1W3JA 4J7RA 4K7PL 4XPGL 2D2OA 3ZDZE 1NOUA 2CK0H 3BSZH 1JF1A 1MCSA 2Q8AH 1QYGH 1Z5LA 2G5BA 4QF1A 4O51A 3JV4B 2XYLA 3WFBH 1RJYA 2CLRA 1H11A 4WGWB 1M71A 1MJ7L 3MLRL 5EO9B 3NCBB 3TONA 2XQBL 1IAMA 3TBTB 3IETA 1MCRA 4FQXA 4R0LB 1KIPA 4D1JA 3HPLB 1E0WA 1YEIL 2VZOA 1CIDA 3EFFA 2CPCA 5EPMA 1LD9A 5I1IH 2OTPA 4RE3A 4WEMB 2Z8SA 4QOKA 4BSWB 5HHOE 2R23B 5I6XB 4X7DC 4U31A 4PGBB 2VRQA 2BNQD 5HI3D 2DQJH 3GFUA 3HPJB 5F9AC 5FV1L 1MH5A 5ABHA 1CFBA 3L1OH 1N8ZA 2Y23A 1U0QA 1JGUL 1WK0A 2EIBA 4S1SL 3WH8A 1FVDB 2VSDA 4UUJB 1R3HB 3BP7A 4IISA 3GXTA 3CFJB 4NQCB 3WIFB 1C91A 4Q6IA 4HP5A 2IAMC 5LA1A 5D8JH 4BQ6A 4Q74A 5KTEL 4ZFFA 1IZJA 1U8IA 3RWIB 4EI6A 3L4YA 3OGCB 2ICWJ 3BCDA 1JBJA 3HE6D 4NNPH 4PR5A 4LLVA 1EBPA 12E8L 1TZIB 4G9FB 1IGFL 1UCBL 4MXWL 1S7UA 4JFYB 4WENB 2VXUH 5BRPA 2Y6SC 4NKMB 4LSPH 3L3KA 2D4DA 1MCWM 4XP6H 5F7MC 1V3LA 1BF2A 3GHEL 3N1MC 1HF6A 5TQ0H 1FHDA 1I3GL 5CIPB 1ED3B 5ID0A 1A4KB 1RZIA 5JW4N 3WH6A 1N0XL 5BO1L 1PZ3A 3KHQA 5GGVL 2NY3B 1T21A 4I0CC 3EO9L 4LYPA 4HZ6A 2KH2B 2K7QA 3SDXF 1DBJL 3IDGA 1VEMA 2XFXB 2PUQT 5DJ0A 5DJDA 5BV7L 4LCCB 5TE4L 5DZOA 3GRWH 1XEDA 5K9JH 4U1SB 4NXSA 4U1GB 1T03L 4LARL 1QFWI 1BZ7B 4GLRH 4JZNB 4PJBB 3CUFA 3LXCA 2VLME 3K2UH 4KKCD 4Y4HB 5T3XH 1NAKL 4XHJC 5I73B 1OSZB 3QEQD 4XP9L 3U4EA 1YPZF 2OR9L 1I1RA 3OKDA 3TNNA 1T1ZA 3JV4A 3A6CH 1VESA 4X8JB 1VB9A 1BYAA 1VFAB 3MO1B 4GQQA 3MBXL 4LP4A 4FFYH 1TA3A 1AGFB 4FRWA 5DO2D 1X5XA 3JV6B 4B50A 2QQNL 5H35B 4LX4A 1FYTD 1SVCP 1F02I 1K8IB 3MJ9L 5SX4H 3IAGC 1OAUH 1E6JL 1KCSL 4ONGH 3QUMH 3HE7B 5I71B 4E0RA 2GTWB 5HDQL 1T1YB 2ZJSH 4Z0XA 3CSPA 5EIIB 2G3NA 2DL2A 4PGBA 5DR5L 1QBLL 5F7UA 2A3BA 5JIWA 1T0MA 3MRFB 2MCPL 3IGAA 4BH7B 4G5ZH 2A9ML 2XI9A 1I4FA 3M1BB 3MXWL 3VGAB 3HMWH 1SQ2N 2LFGA 3OR6B 5DQJB 3UYPA 3UEQA 3IDYB 1DUZA 1I1AD 4UUJA 4X6DB 2Y4SA 3CFJA 4MQ7A 1IEHA 4LVOB 4BFGA 3CVIL 5ACMA 5E4IA 1RUPH 3KXFB 1RZ7L 1RHFA 3SKOB 1UWSA 1OAXL 1FNHA 2R4RH 2A0LD 4K8RH 3RY5A 4HQQL 4CMMB 4X5LA 4G9FA 3BRDA 4HFUH 5C08A 4APQB 2XTJE 5D71H 3E2HB 3IXTB 4HGWA 3DUUB 1V6VA 1UR9A 5D1QC 5CJQL 3TCLB 3CUJA 3BD4A 4KGJA 1A4KA 4Q58C 1NUFA 5LCVL 3WFCH 1ZL1A 3V5KB 3PWVB 2XOTA 4PJGA 1IGJA 1JV5B 1CD0A 1ZWIB 2XFXA 5I8KH 5ANMA 3CDCA 3NFNB 4JG0H 4LCCA 5F72S 4I0PB 3UJJH 3CZKA 3WUGA 3CZGA 1NMBL 1LP9B 1BZ7A 3LN9A 4JZNA 1CWVA 4Y4HA 3MOBL 2J7LA 5F7KC 1W1YA 1KTKE 1C8PA 3GI8H 3VDCA 1OSZA 1LO3L 3D69A 4JDTH 4QHKJ 2X4TA 1ZVHA 2OX5A 4M1DH 5I15H 5SWSB 3SE3C 2J7BA 1XYZA 4PRBA 3MYJB 3R0MA 1R3KA 3OX8B 4MZ2A 1P69B 1MNUH 3C08H 4KJQC 1NC4D 3U7VA 3GMOA 4X8JA 5INDB 3MO1A 2CRYA 5IGXL 1I3VA 4NQSB 5ICZB 3LRKA 1AQKH 3QO1A 1NCBH 1WC7B 1XF4B 3KLAB 3EUUA 5H35A 3BKYH 2D4FA 1T7YA 5I76B 3LRMA 5DK3A 2OMBA 5BOZG 3VIKA 1D9KB 2YD5A 1VJSA 2YFOA 3TWCL 1S9WB 3DLQR 1K9FA 4ODUA 2GTWA 3D85D 3D39D 3WUBA 4KK8C 3PG2A 5DMIL 4EKXA 3KJ6H 3MRMB 3SCVA 2BSSB 2MWCA 4M1GL 1Z2KA 1J1XL 4NWUL 2NXZB 2Y25A 2R0ZL 2ZWLT 3PIQA 1BPLB 3JWDH 3MRFA 2ZX8A 2DF3A 1B2WL 3UTSD 4BH7A 1Q6CA 3ME0A 4QAWA 3M1BA 2QHRH 1DVFC 2YK1H 3OR6A 4O9HH 5DQJA 2GVYA 3OGVA 3MOAH 4GH7B 2QADD 4YDJA 5IVOA 2ZCLH 3MNVB 3BRGC 1MCNA 5AD0A 1FAIL 1EK3A 2BC4A 3QUYA 4CJ1A 5F1SA 1T2QH 1LO4H 3HUJE 4RE2A 3PP4L 4Y4KB 1GW1A 3EW3B 2E6JA 2FX7L 4K3DL 2HJFB 1JI1A 2PI6A 1HJVA 1FIGL 4OZ4B 4U1LB 4UOZA 3LHPL 3AB0C 4CN1A 4ZXBC 4FNTA 4JY6B 3DUUA 3QWOB 1CL7L 2W60A 4HUXB 5E6ID 3H9SE 5HHXH 1KEML 4WY7L 3TYGH 1WAAE 2HT4C 3HCVB 3QI9A 3EYFB 3ARDD 2P5EE 4Z7WB 2WSPA 2VLKB 4N0CD 4ZO8A 1ZSDB 2MPAL 3O6FD 4QRRD 2DQTH 1OAZL 1A6PA 5CILL 1EDTA 5LYRA 3MMEB 1OTTD 1JN6A 3MRKA 1XGYH 3T08A 5JPMA 1IEBA 3T77B 3ALXA 3O3UN 1UQSB 3MOQA 1GORA 1EEYA 2CBVA 4LCYB 4I0PA 1LP9A 2ARWA 1MJJB 2OSXA 2ZUQC 2CUHA 4D6IA 1T89A 3GH4A 1II4E 3O2DH 3OPZL 5GGTH 1OP5H 1U92B 2NY5L 3CVHL 3FMGL 2EDXA 3KGRA 1TITA 3U0PA 1F45A 2Y5EA 1L0PA 3MYJA 3MMDA 3MACL 3CMOH 4RFNC 5BYWA 3OX8A 1HK6A 3O6LL 1NCNA 4WFGD 5I1AA 3FB8B 4DKAA 2P24B 4XCNB 3CZJA 4OD2A 2P5WD 1NEZG 3FN0H 3ULUL 2EYRA 4IOIB 5ICZA 4M5ZL 1YNLH 4G43B 1G84A 2C26A 5JZ7D 1WC7A 3CPLA 2RGMA 1QHZA 1D6VL 4HW6A 3S34H 5A2JH 1FE8H 4DGIL 4KKNA 2EXOA 5C6WH 1FJ1B 3O6ML 1E4XI 3THMH 3R8QA 2W9DH 2VDRH 4RAUA 1UM5H 4Y19B 4LSUL 1Q9LA 2FHBA 1U8LB 1SM3H 3MRMA 1G9ML 4KVNL 3EJZD 1PEZA 3F6LA 4P3DB 4E41B 1CZ8H 5D9SB 3DSNA 4GMTL 1FZKB 4OCRH 3PV6B 5KSVB 3QIBB 1HH6B 4F8TA 2X0HA 5D7LB 2VE6B 2BJMH 5EN2B 2EXWD 1A14L 2BFVH 2FEEL 4KGLA 5ANME 4BA0A 5D2LE 5ISZD 1J5OH 4Y4KA 4GQ9H 1GHSA 1QSED 1SBSH 4TSAH 2YA0A 5E9DB 2PWHA 5HYEA 4JPWH 1ZBWA 4U1LA 5C07A 5HHMB 2BFGA 5F3HB 3FT2B 2O9RA 1EQCA 4EOWL 2W63A 5DK2A 1DE4B 2XN9B 4HUXA 3JWOH 4XXCC 3AHTA 1CXLA 1UKQA 1MI5A 2FGZA 3EYFA 1U42A 5KVFH 4QYOB 4X0NA 4NNYB 3L4TA 2VLKA 5KZ6A 2KPNA 3G6JB 4AY1A 2I9TB 2DSWA 3MMEA 3SOBL 3FQXB 3UCQA 5JUVA 1TTUA 2ZOKB 1ISZA 5D9NA 1OTUC 5GS2D 4OD1H 2YPKA 2CKBL 4MXQD 4GAJL 3MCLL 3VIFA 2A6KA 1UQSA 2JLLA 4C55A 4ODHH 2EH8H 4KY1L 4HPHA 4LCYA 1KPVB 3ARBC 4J28A 4D2NA 5MHSE 3TV8A 1MW0A 4HPGA 1YY8B 2CXKA 3SKJH 1T5WB 2CHOA 1MQRA 5I0ZA 3F8UB 3VXMB 4X9IA 2QLVB 1H8NA 3F7YA 2PR4H 1W9BM 2O5XH 2Z8RA 2XNAB 2BRRH 5EG6C 2RFXA 4H26B 3N18A 4M9OA 4DEPC 2WC4A 1JTPA 2VXTH 3SEPA 1QKZH 4YHKL 3UTZB 3FB8A 5AZEL 2VCAA 4OSUL 1N6UA 2P24A 4LNRB 4N9OB 4IOIA 3AS1A 2CQVA 4BSJA 5DMGD 3F5LA 2HT2D 2EZ0C 1M05B 3WF0A 3QIWB 2C7UB 1H49A 1I1FB 2DT1A 4L4VD 3AHVA 1NCTA 2Q20A 1JD9A 3VD5A 4QWWD 2OBGA 3QDAA 4YGVA 4JFFB 1W0VA 1U8LA 2HFGH 3RVWC 3O4LB 3NCJL 1J8HB 4TUOB 1C7TA 2P46B 4P3DA 4BF7A 4E41A 4HGMA 3MQIA 4WI5A 3S5LA 4GXVL 3DX4A 2W0FA 1OB0A 3WNLA 4EI5D 3QZWB 4PMZA 1ZHLB 3RWDA 5E5MB 1SMDA 3PV6A 1FNGB 3LIZL 4UU9B 1HH6A 4NCC1 5B38G 4B7IA 2VE6A 1DBAL 5IB1B 5E6YA 5EN2A 1I3UA 2OI9B 5EBWB 3WNOA 3H2WA 1TE1A 4IJ3C 3LQAC 4JHAL 2D3NA 3L4WA 2H45A 3FT3B 1N5YH 3PABB 1KCVH 2Q86A 4NQDE 4WCYL 3T04D 2NY2C 1TJIH 3VFGL 1WCBB 4GAGH 3OB0H 5J12B 3UAJC 3FRUB 2HRPH 1FA2A 3FT2A 4YDKL 4Y5VC 2XN9A 3OKNB 3H42H 4LGSB 3EYVB 5D70H 4G6FD 1QEWB 4N0YL 3AOFA 5DEGB 3MUY1 4QYOA 5FYJU 4NNYA 5HD8C 5EBGA 3G6JA 4UV4H 2I9TA 1IC7L 3FQXA 5JW4M 4OF3A 4ZFZA 5I17B 2IALB 3MRHB 4YHIB 4OZFA 2Z91A 3SY0B 2HJKB 2AAAA 2NY6D 1N6VA 3ARGD 5F89B 4CMHC 3NTCH 5E1AB 5DI8B 3KHOA 1GGYA 4K94L 4AEEA 3ARFB 5HDLA 2PF0A 1HN1A 1A6ZB 2CBUA 4JRYD 2ATKA 4WUKH 2XNAA 2WWKO 3NAAL 4H26A 3X14A 2GCYB 4K68A 3TBYA 1UD5A 3UTZA 4EVNA 1CXIA 3K2MC 4LNRA 1UWGL 4JKPL 4E42B 5IVXE 4DCQB 4PRID 3OF6D 3U7YH 4ZDHA 3DX9A 1RUML 1BBDH 3LPPA 2WLZA 4YE4H 5F88A 4FQCH 5DD1H 3T65B 4Y5XB 5IMLA 4JFFA 4HULB 5GRXG 2AJXL 4U1HB 4GG6B 5FUOH 3MV8B 1D5IH 4HPOL 5DGRA 2RGLA 4TUOA 1R5WB 5A43C 4IRSB 1M53A 2JCCF 3TZVA 4QNPF 4KXZH 3WEOA 1MI5E 5IJVB 3BUIA 3MROA 2UZXB 5E5MA 5BXSA 4G6ML 4Q7DA 3O3AA 2YXMA 4POZD 4ZPVA 4GRWH 1KENL 1RUQL 4Z0BH 2YOCA 1FBIH 5IB1A 1FPTL 1JZ6A 2EDLA 3DV6A 1MY5A 4NCDA 2FX8H 3GXIA 1MW2A 1KN2H 1IKNC 2OZ4A 1SEQL 2AK1L 3ARXA 4MA8L 1QI5A 5E2TH 1ZLWK 2H2SC 4HKBB 3D52A 5GGSB 4NKOA 1FAKT 3WKML 4P5MB 3BVTA 4ZOBA 4TRPH 4ZAKD 4YPJA 3O2LA 5M95B 4WF7A 5SWZE 1FHLA 1MQ8A 3FRUA 4NZRL 4YHZH 4R90L 2ZKHH 5BS0A 5JTWA 3U4BL 3OKNA 3VFUB 2V2TA 5FGBA 4Q9RH 3H55A 3WXWH 1RUAH 2HN7B 1QEWA 2Z9TA 4LLQB 2VKWA 3D0LB 1CZ1A 3W26A 2VR9A 1DN0B 2FB4H 1WJ3A 5KVDH 1L6XA 3ROLB 5I17A 2IALA 4FN0A 4YHIA 1MFAH 4QLRA 1JHTA 4YQXL 1FVEA 1KF9B 5E95B 4EKJA 5LG1A 5FOBB 1AR2A 1TQUA 4GXUM 4MAVA 4Z2HA 5F89A 2WWCA 3K4AA 4RIRA 1ZKAA 3TJHC 3U79A 1MFEH 2R0LH 1A6ZA 5KVMC 1AQMA 4V1DE 1H3WM 1AXIB 4NQEA 4XBGB 2V2XB 3V4UH 3ULUF 3MRGB 1NGQL 4Z7QE 2O92A 4F66A 3PBGA 4U5KA 5TF1L 2A74B 4LCWE 4MXVE 3GNPA 4E42A 4H0HB 1EXPA 4IPNB 5TPWL 1TCRB 4GQPH 2X1IA 3LRLA 4YH6A 3WY1A 3R06B 2F8QA 1JUFB 1INDH 2VKXA 5E8OB 5HY9B 1YEJH 3U9PH 1HCFX 3MLWH 3CFCH 1CWYA 4PP2B 2ZUSA 3L9RB 4EIZC 1BWMA 2ZE0A 1KLGB 3T65A 2EO7A 1U3HD 4Y5XA 1ADQH 1B0IA 2XWJB 4OT1L 1IC4H 4DN4H 4ZNCD 2WCGA 4GG6A 2R9HC 3BO8B 3P4OB 1MHHA 3MV8A 5JHDE 3SHSA 3QUXA 5D72L 1W91A 2YLLA 1DWAM 4M43L 4MNHA 1OB1A 2P49B 3GMLA 1F58L 3FNDA 4PG2A 4IHOB 1DEEB 4S1RL 4P8UA 4FTVE 3S35H 3SO3B 1JNLL 3U0WH 1F4YH 2ICWA 2HVJB 1YMHB 2FZ3B 2ZNWA 3FRPG 1CD9B 4NC1C 2VR4A 2ADFL 3NZ8B 1X5KA 3PL6B 5D5MA 3LD8B 3BN3B 4OF0A 1DQML 2ED9A 3RM8A 3W2DH 2IC2A 2J8GA 4LFHG 1GOGA 32C2A 3S37H 5DUPL 4HKBA 4NKIL 4XWOC 3MRDB 4YEEA 3R1GH 4H8WL 4R4ND 2EICA 3CFEB 4P9HH 5DS8A 3TO4C 2H32H 4OCXH 3QEUB 3TT1L 4OBSA 1T0OA 3NA4A 3D3VE 5FK9B 3ALFA 5C0BE 5C0RL 5CWSB 1A7BA 3WH5A 1L0QA 4WW2A 1XF2B 4HXAH 3IRZA 1UD2A 3VUPA 3JZ7A 3A0OA 3QUMB 4UTBH 2V17H 5FGRA 3ZKND 1T0NB 2ESCA 2EPLX 4L4TB 1ZGLP 3G6AA 1S9YB 4P9MH 3SDCC 3C5JB 1UZ1A 2VX5A 1DN0A 4JRXE 2FBJL 3CUIA 4F7CB 3TBWA 2GQHA 3OAYK 4MAYB 2D20A 1GZQB 3NZHL 5J89A 1BF8A 2UY6A 4LMQI 4XB7A 5BOPA 5HHOB 4YHGA 1J12A 4PJIF 2GJXB 3QR3A 1S46A 4MQXD 1TCMA 3VXRD 2OR7A 1GJUA 2ZCHL 4D71A 1FZMB 4P2QD 3VRIB 4I48B 4P57A 1I7UB 3DETC 3QUKA 4OLXL 1F00I 4RRPG 4D94A 3SCMC 3WY2A 4Q9BA 1DN2A 1TG7A 4KUCD 4S1DD 3ZT5A 1C3FA 4IMKC 3IDMB 2O5YL 4ACZB 1CGYA 4XBGA 2V2XA 1WZKA 2X1OA 4H8WC 2XIBA 2WBGA 2A74A 4JCMA 4X7SL 4G7VL 5CLTA 1HQ4B 2X4SB 3P0GB 4ZFOB 4DTGH 3MU7A 4JM2C 1CLYH 5T1KB 1NFDA 4TSCH 5E8OA 4HX1A 3BUPA 5LBSH 4MNQE 4WUUD 4P3CH 3K0WA 4PP2A 3VI4F 1CU4L 3BKJL 5D96B 5E2UL 2ZUNA 4GS7B 4TVPL 4DWSB 1OVZA 1FRGH 4DOHE 1LDPL 4L4PA 1WV7T 5KSAC 3AHYA 4WRLA 1Z3GL 3FO0H 4MA7L 2FSEB 1QBBA 1PQZA 2CERA 2WMKA 1QLEL 2D7NA 4H5SB 1MAML 3FOMA 4I18C 3GRWA 4P46C 1ZAGA 1DEEA 2EH7L 2VDQL 2HMID 5EZIH 3BWAB 5D7SH 2HVJA 2D0GA 5DVLA 3VXSB 2FZ3A 1TQWA 1GGUA 1ZTXH 3NZ8A 3GGWB 4XPFL 4FMKA 4ZD3H 3PL6A 1CFVH 3H9ZA 3GBNH 4X4ME 4O2CB 5I8OL 4MB4A 1CT8A 1C8QA 4JQXC 5ALBL 4M7ZC 3KS0H 1A7OH 1DLHA 3KYAA 2V5SA 3D1MC 3HNTL 4FQ2H 3WIHA 4RBPK 3WLWD 5IFTA 3A47A 4I9WD 5D7IA 3FHQA 5T1MB 3RTQB 2B0SL 2NY1B 1AGCA 2B1HL 4LSVL 4HIEB 1UXSB 2WMIA 4NQEE 3OZ9L 2PTUA 1AO7D 1XF2A 3MRPA 2WMHA 1UWRA 4LLUA 1UZ8B 1T0NA 3DECA 3B2VH 4L4TA 1G0DA 4BFIA 1S9YA 2VLJE 4L5FH 4U1KB 3C5JA 2Y7QA 3U1SL 2NY3D 2J88H 4LOUC 5D1XB 4BKLA 1KT2B 3V52H 3BVWA 4ONOA 5AC4A 1GZQA 3MRIA 2VDLH 3SDDC 1KJ3L 1UD3A 4AL8L 5DHVH 2IAMB 3B9AA 1N82A 3VRIA 4I48A 4XVSH 2CXGA 1I7UA 5K59F 1N2RA 1ESWA 1FO0L 4G6KH 4YGAB 4WTXA 1V0MA 3CFKA 3X3FH 1KFAH 5DJZB 3MC0A 3IDMA 3WSQH 1A3RL 5HI5D 1NARA 5FYJH 4WKAA 4OCYL 2R2EA 4JR9H 2ZP0T 2C0HA 5E0CA 4ACZA 3K1KC 1E0XA 4W86A 4UAOB 1AJ7L 1SJEA 5LQBH 1N59B 1EO8H 1LQSR 4LPYA 1CK0H 1Q94B 2X4SA 2QBWA 1WWBX 4R4BA 4ZFOA 1A5FH 2RCSL 4K9EL 4KRLB 5IT2L 2WK2A 3CFBA 3PWLB 3SGDI 3QEGL 4PRPE 3KS0J 2AVGA 2XTJB 1G7PB 1I3RA 1W72L 15C8H 4JKLA 3WD4A 1LE5A 1CE1L 3T8XB 1MF2H 2JB5H 1BMGA 3BQUB 4EAMA 3NCYS 4Z7OE 2E9JA 5CJXC 2HH0L 3L7FB 3WUZA 3PZ9A 2E3VA 3AIWA 5J06A 2A38A 4NZJA 4H5SA 2VDOL 3DARA 3VFTB 1KIQA 5KANG 1JGVL 3W0WD 3S35X 3SDXE 4XZWA 4PUBL 1VFUA 3Q1SH 4DO4A 3VXSA 1FFNA 2KL6A 4N0FB 2P7TA 3P0YL 4R3SA 4EANA 1I8KB 4HH9A 1P84K 4OJFH 5CSUA 5T1LB 1F3JB 1J0HA 4JKWA 4HZLB 4O2CA 5KZCD 3VINA 1I7TB 5DXWA 4NSKB 5DFWH 4WJ5B 5F1NB 3S37X 3SE4C 5DJ8B 2F5AH 3VFSA 4BZ1L 1KB5L 1NCCL 5BMFH 1KCLA 3BPCB 1GH7A 2L4OA 4XCEA 3UX9B 3FB6A 4LHUG 1I8IB 1ISXA 1JK8A 5HPCA 2PCPA 4K2UH 1QG3A 4NRYB 1LO2H 3TTYA 1H09A 4ZTOL 1MUJA 1UXSA 3HZKB 2D24A 1Q4NX 3L5IA 5D8ZA 3SCSA 4UT9H 2WW8A 4KZDH 1DQDH 1UB5B 4MADA 1VPOH 4GIAA 1UZ8A 4HF5H 4ZODA 3SQOH 1MCBA 5J1SC 2VAAB 4U1KA 4WEBH 1J18A 3EJYD 1I75A 1NFDE 1NLDL 4PYGA 5EO0A 4PJFA 1KT2A 3F5JA 1D5ZA 2AK4E 2AJSL 2VISA 3HAEA 4LPTA 5CJ5A 1JGDA 2Y2WA 5JW4R 1RZJC 1NKOA 1T22A 2IAMA 1IGML 3PGCA 4ZYKB 1AR1D 3HI1B 3DVGA 4GQRA 3ARUA 4GJTB 4Z8FH 5C0AE 2UWFA 3E3QE 1KJ2H 3WN5B 4MCYA 2ORBL 5JIPA 3CU7A 3PUCA 3UBXA 4K7PY 2OQJB 3V6OC 4W8LA 1TZGH 1OD0A 4YXLH 5SWSD 1OSPL 4H0GA 1HOCB 1SBBA 1FDLH 2HKFL 2IAND 2OTWA 3QG6B 5HXMA 5BXPA 3HUJB 1H3PH 1C5DB 5BZDB 5HGHA 5GRWA 1YMME 3CV5A 2DYPA 3BKCL 4AZCA 1IEAB 3OZOA 4YHNB 4YPGB 3NMEA 4FNLL 1R47A 2OJEB 3UEZA 1KBGH 1V7NH 3GSOB 1D9KD 1A6WL 4N8CH 4X83A 3DPBA 2XKUA 2FJHA 1JF6A 3LDBC 4KUCF 5MEOB 5DT7A 3T8XA 3F5KA 1N64L 3RIAF 3ZTNH 3RIAK 5D7IE 3VXQB 1VERA 1I1YA 3H9SB 1PZUB 2GSGB 1BLNB 3QOKA 1FSKC 1KXVC 3O6KH 2JB6B 3U7BA 4DWHA 4O2EB 1VSCA 3L7FA 3QFJA 3OZPA 4ZUTB 1O7SA 2QSTA 5D2NC 5DRXB 2Y06H 1T4KA 5JW3L 1MXGA 1A6TA 3WUWB 4MQSB 5LWYH 3O9WC 5HI3C 3BDBA 1E4LA 2CESA 3KVQA 1U6AL 4NO2B 4HZ8A 3DMMD 2W9EL 3UESA 2X89D 2XVKA 4N0FA 4MLIA 1OARH 4KVCH 3WQVA 5GGTA 3WS6C 1B3XA 1YC8A 4YHEA 5T1LA 3RDTC 4HZLA 1GYAA 1C5CL 1I7TA 3UYRL 2A9NH 1UM6L 4NSKA 4P5TD 4WJ5A 4J1UB 4ZTPL 2E9BA 2ICWI 4Z7UB 3VWJB 4AENA 4XGZB 2EDBA 2BVQA 1EHNA 4DGYH 1DQTA 2C3WA 4DK3A 3HE6C 1KTCA 1KACB 4ODWB 5TQ2H 3KYKL 4TVSa 4W85A 3RX8A 4QRQB 1INEL 4NRYA 1IAIL 2DKSA 2WUBH 4H04A 4NN5C 4EDWH 1QFUL 4JO2L 3PQYD 3I9GH 4QXGL 5C0JB 4ZPTA 1WF5A 5C3TA 4U7SA 2SEBB 3MUGB 1PZ5B 1T0PB 3D9AL 4FFVD 1UKOA 5JORB 1MEXH 4X6FA 3H7LA 3NPZB 4O58L 4PBWD 2VAAA 1LE9B 3GSUB 5GGVY 4WFFE 1RJZB 4QTIH 2D7OA 2K9UA 2BVDA 4XZBA 1BVKB 2EO9A 3UC0H 2ZUMA 1VFBB 1ZV5A 4F37F 4EBQL 2FX9H 3ARED 2MJWA 4ZYKA 4D9QE 2X2JA 1WE5A 1FL6B 2F74A 3RKDD 5J6HB 3RGVD 5AWNL 2DM2A 4WWKB 2PXYC 3S6TA 4FLOA 4KKCC 1GGBH 1PEWA 1LILA 5ITFA 2AI0L 5CSBA 4HZAA 4IUGA 2YFNA 3IANA 3BZ4B 4ATWA 2D03H 3OAUH 1MFBL 1LO5A 3DSFH 4HSQA 3OKMA 4CD5A 5D1QA 3QG6A 1HNFA 2W07A 4CN4A 5D2LB 1C5DA 5T3ZE 5MEQB 5BZDA 4JAMB 1BIHA 1IEAA 1NCUA 1ZT7A 2HFEB 4YHNA 3IS1X 4YPGA 5DO2C 3GMQB 4HJ0D 3VWKC 4J6RL 1E4IA 3TYFA 4LKXB 3WUFA 4JE4B 4KRPC 3S6CA 2V5RA 4ENED 3GIZL 2ADJA 2CRIA 2UWEE 4IMLB 1G1YA 5FYLD 2A1WL 2GSGA 1M7IA 4NO5A 1UH2A 5HYJE 3WL1A 4EIGB 2WWMD 4Y19D 4HC1A 2NY7L 3N1QC 1MFCL 4RA3A 5BZWB 3H0TB 3S97C 4M00A 3WUWA 2DN7A 4L3EE 1G7JB 1CG9B 1MCFA 3SE3A 4I3SH 3WD5L 4UB0H 5CD5D 1UACL 1ZLSL 2VXVL 2XWDA 4LGPB 5ECJE 1DFBH 1A3LL 3QIBD 3KLSA 4NM8L 3AYRA 5CEYB 5D7LD 5DURB 4D0BA 2E27H 1I1AC 3BZEA 4RWHA 5DTFA 3WJJC 3NBNA 1CIUA 4MB1A 3WY3A 4GLRI 3UR7A 4AY0A 4H8VA 4Z7UA 1JE6A 5FD0A 2DM7A 3W9EB 1DJSA 4XGZA 4AM0B 2A0LC 2A6IB 4ODWA 5E9DD 2ATPA 2B5IB 2X1PA 2DLGA 5L0QB 1MY7A 3AFLA 5DUML 1LMKA 2LU3A 5D6DC 1A2YB 1JPFB 5I16B 3LKNA 1XGZA 4QRPA 1RZJH 3HC4L 4Y1AB 3TH4T 1PKQE 4BQBA 1WCGA 3CMJA 5DVOA 1LE9A 3GSUA 3LMJL 1X5LA 1DVFA 3HG4A 1N0LA 3HMXH 1OGBA 5SX4I 1H8OA 3NPSC 3VRLF 2J78A 3NCCB 3T2NH 4G8FB 4ODVH 5FO8B 4GKLA 2EE3A 4PB0L 1YYLH 1DQJB 3F5WB 3T0BA 4U6XB 2Z35A 4GRWB 2GUOB 3WHXB 3VXMD 5T33L 3ZKSD 3QQNA 1CTOA 5HHPB 1U2YA 3WDJA 5LGJB 1KQYA 1ZEAL 3HNVL 3BIKB 4QHKI 1JZ4A 1ZANL 4ZXBA 4PMNA 3HR6A 4H1LG 3VFNA 4PB9L 4LYQA 3RWFA 3BZ4A 1XGUA 2VQUA 1UQZA 4Q0XL 5LAXB 1NC2D 3V6FA 3VG0H 1U2CA 1HINL 4YFDB 4LIQL 4NBZB 4JQIH 3QUZB 4PJEB 5M7QA 5MEQA 2R69L 3BW9B 4NQDB 3LEYL 3O11B 2HFEA 4OCSH 4WV1B 1X7QB 3LS4H 3GMQA 3QA3B 3QIWD 1DWGM 1DEDA 5EU7C 4DUVA 3IU3A 3CLEL 3ARBB 2W38A 5DT1L 5DQDL 5C2UB 2Y8VA 3ESVF 4F80A 5A2AA 1YDPB 1BP3B 5BZWA 3UTTE 3O4LD 2X4OA 3BVXA 3H0TA 5L8KB 3Q3GB 1EO7A 2APXA 3TV3L 1GQKA 1F6LL 1SYVA 3BI9X 3E6FB 4K7FB 5E5RB 4DEPB 1UJ3C 1A1MA 4KRTA 1X5JA 4OZIF 4L3CB 3BPOC 1JRHI 4N0RA 2XRAH 4CGTA 4MD0B 4EUPG 1XF3B 3WNMA 4HFWA 1DUYB 4R96B 4P99A 1RFDL 1MQKL 4XNYH 4B53A 2DDXA 1MJ8L 4XPGH 4M7LT 2QADC 3IAPA 1U95A 1O7AA 3TVMB 1SZNA 3FFCD 3O41A 2YJQA 4NHCL 1OD9A 1OD7A 4AM0A 2ICCA 2A6IA 1ZBCA 6FABL 1A1OB 1MFDL 4KHXH 1ZS8A 5IVXB 3P9MB 4OGAD 1KC5H 2XQBH 4JREC 4OJYA 5D7JB 2IFFL 5I16A 1CGSL 5A8PA 3SKNA 4Y1AA 7CGTA 1YEIH 4QGYA 6CGTA 1JZ5A 4UBDC 3RVUD 4N0CC 3O6FC 1MIML 3MNWB 1FIEA 1NDMB 1PYWA 4TQEH 1JPGA 4OCLC 3MUJA 2YBRA 3CMGA 4G8FA 5FO8A 1U8QB 2WW5A 2DIJA 5DMKB 1DQJA 3F5WA 4KUZL 3BZFB 1AGBB 1N7ML 3FONA 2GUOA 3WHXA 1I7RB 4X0KB 4I0KA 2NY2B 3GSNL 5HHPA 4JFHE 3WNPA 2CDGB 4NPYB 2GITB 5E00B 4S1SH 1OPGL 3E8UL 3E6HA 4Y5VB 2J8FA 2NY0B 4XXCA 2BHZA 3BWUC 4UFLA 2O61B 4LYRA 1AIFB 2H32B 5HNNA 1UEYA 3MZGB 2DLHA 3L95B 1HNYA 2XA8L 5BXFA 4Z7VA 3O11A 4TPRH 5ACZB 5JZ7C 12E8H 1IGFH 3QA3A 4YHLH 2OSLB 4TSBH 5F9OL 1BHGA 1JAKA 3DHMA 3A4AA 3ARBA 2JTDA 2DPEA 3VXTA 2IQ9L 4N1HB 5SX5K 4CMHB 1AP2A 3ZYJA 3T4YA 2Q7NA 1XF1A 1Q8MA 4RGNE 3UR8A 1XGTB 1TFHA 5GGVH 8FABA 4F7PB 3DROB 3TT3L 3SURA 5DJ2B 3EJZC 3Q3GA 5IB2B 3E6FA 1UGNA 2P44B 4IRSD 1DANU 1MRFL 5H2BB 4PS4L 1A7NL 1DBJH 1G6VK 3EOAB 5HPMA 4KZEL 2QL1A 4UOJA 1UG9A 4L3CA 5BV7H 4U1JB 3MUAA 3T1WA 4YUEL 1ZT4B 2BOBB 1MHCB 3WSUA 3UETA 1I7ZB 4KJPD 1DUYA 3SCOA 3F65A 4R96A 3EZJB 4IM8A 2EXWC 3BPLC 1NAKH 3S36H 3LMYA 2C3VA 3KPSE 4KI1A 2OR9H 4YHYC 1KXTA 1RK0A 3NUKA 2PYEE 2W67A 3PDGA 4UT7L 3WDHA 1DWHM 1R5VB 4BK4A 2BRQA 5DD3L 3PHAA 4LCWB 4HOXA 2K3TA 4OIIL 3G5XB 5TE7H 4J4PD 1S7XB 1UZ6F 5D7JA 3AMLA 3IFOB 1FNFA 3MJ9H 3DGGB 3RWJA 4R7NA 1G9NL 1E6JH 1DQQA 1KCSH 1VA9A 4OCNC 3VM5A 1R3IH 3VIHA 3MNWA 1FFRA 3O2WH 1ZT1A 4LEXL 5HDBF 4G42B 1S7RA 3RI5F 1X5AA 3KYOB 3RI5K 4FQHB 1YJDL 3LKRB 1D6EA 2B4CC 3WL9A 4MXQC 1U8QA 5JHDB 5DMKA 4JFZL 5FM8A 3AICA 1IFHL 5DR5H 1QBLH 4YNYA 1RIHH 3K74B 1PY9A 3D25B 1E4NA 3BZFA 2P5WE 1AGBA 2MCPH 2JCCE 3VFWB 4QNPE 2CDFB 1I7RA 2A9MH 1JG9A 1P6AB 4RMVA 2YSSB 4FTVB 4BFEA 2CDGA 3ZTJG 4DN3H 5TDOB 4M02A 4Y5VA 3TO2A 3L4UA 3ZHDA 2APTA 3CVIH 3SE9H 5C8JA 4C56B 5FDYA 4PJHA 2DQFB 2H32A 5GRZA 1WBXB 1OAXH 5DMGC 3QXVA 1KB9J 2HT2C 4QRSB 4AMWA 2LV4A 5AYQA 4JFPB 5GISH 4I13B 5GS0D 1SEBB 2CHNA 2VXSL 5EUOF 5L2KE 1MCCA 2DWEA 1CDCA 1IT9L 5KS9F 3QQ9D 5CJQH 4QWWC 4PRAB 4M61B 4PRHD 1V08A 4MHHI 4N90D 1B9ZA 1KGXA 4ZOEA 1XGTA 5LCVH 3PZUA 1D5BB 3MRBA 4W6WB 3EO0A 4MVBD 2FWOA 5ISZE 4MGXA 5DHVB 1Q72H 3EOAA 3IFLL 3IF1B 5IXEA 1WBZB 4U1JA 2AKRB 6A3HA 3GDBA 1C1EH 4POUB 4HKXA 1A0QL 1I7ZA 4DGVL 1WEJL 4Z2LA 3MOBH 4K7PX 1A4JB 5F3BB 3BMVA 4OFVA 1RSFA 5I8EB 4M1RA 1NGXB 4OLZL 1U8PA 4Q9QL 4UDTB 1FZJB 3MRJB 1F4AA 2EE6A 3KPRB 2DSKA 4AYSA 1J88A 4LNVA 2COQA 4OKVB 5A8OA 5KG9A 3ULUE 2J7DA 4URIA 2GTZA 5IHBA 2N7BA 1XGQB 3IDXH 1P1ZA 4S2SB 4BQ4A 3SGJC 1VKXB 4AIUA 2C3HA 3TH2T 3SJVE 3MRRA 2DIEA 3CZNA 2EDJA 1CLZL 1S7XA 5DA0B 4JGMA 4PJ7F 3TH3T 2YBTA 3NACL 1KJVA 1MQPA 3QNYB 1QNQA 4MNQB 2FJFA 3VFPB 4OGZA 3VVGA 2YR3A 1CI5A 4KKAD 2Y5TA 1BQHA 5F21B 5FO9B 3WH7A 4YR6A 4JFSA 4DVBB 2PNDA 1MCLA 1OGAB 1QPKA 4YO0B 4G42A 1BPVA 3KYOA 4FQHA 5FO7B 1G0CA 5DMIH 3KPQB 4Y5YC 5HHOD 1IKNA 3D2UB 1J1XH 2ZCKL 4HEME 4AJ0A 3EHBD 4UI2A 3VFWA 5C7XL 3ARGC 1B2WH 3L5WB 2CDFA 2AQ2A 5CSZB 5C0ND 4ESKA 3GBML 3L3GB 4ODTL 2XN1A 2YSSA 2WNWA 1GUVA 2MFNA 3MO4A 5E7FA 1KNOA 2J7CA 4KMTH 1V3MA 4JFEE 5HJ3A 4Y4FD 5TDOA 4JKMA 4QDMA 1U93B 4RQQA 3VTRA 5DEFA 3TEUA 4M8UA 1JPSL 2IADA 5ILTL 1FAIH 4C56A 4NZTL 2V7NB 4K8RD 5CAYB 4IDJL 4UILL 5EO1B 2W4XA 1WBXA 2RGSA 3PP4H 4JEGB 2DJSA 3T0EE 4NYLB 4MMXC 1DQLL 4KROC 1ZLWH 2FX7H 4U0RC 5B8CB 4DW2L 3F12B 5GSRB 1EVUA 2DRUA 2WYSA 3MSPA 2XJ7A 3W38A 2ED8A 4HBCH 5CP7B 3ZZ1A 1E6OH 5TFSL 2G4FA 3BGFC 4I3RH 4XVUD 3EJUA 1GPOL 1G6RH 1KEMH 4PRAA 1YEDB 5J1AB 4M61A 2WHJA 4HUWB 1E6PA 2OL3A 3SCMB 2FJGB 4D9RE 4XC1L 1JMXA 1I9JH 2EDYA 1OAZH 2VLJB 4OM0L 5CILH 1JNNH 5MEPB 4F3FA 2ZG1A 3EYQD 3I6GA 3GJFK 2Y24A 1T5XB 4WO4C 3IF1A 1WBZA 5C0CA 1KG0B 4D1IA 3EAKA 2K1MA 4PJIE 1KJ2B 3WY4A 2Z0BA 2AKRA 4K3JL 25C8L 1ONQB 2ZOLB 4POZC 2W1NA 4X6BA 3IKKA 3DX7B 4M9PA 2VXQH 3S88L 1UXWB 1BEYL 2VLMD 1A4JA 4LGRB 4MX7B 4DVRL 4U6VL 5I8EA 2I60L 2NY5H 3FMGH 3BVNB 4UDTA 3STLA 4XC3H 3GIVB 3KPRA 5ALCL 3TFKC 3MV7E 4G3YL 4WHTB 3O6LH 1HJSA 1XGQA 4NRZB 4ZAKC 4RAVB 5FB8A 1MWOA 2VDML 4NDMB 1Q6FA 1VKXA 3RTQD 2DQGL 2NY1D 1E4XL 4FK9A 3ULUH 4FLRA 4M5ZH 3WQ6A 4R7DB 4Z2IA 4XTRD 5HGAA 4GZJA 4MJIE 2CMRL 1D6VH 2ZSWB 3KYMB 5A2BA 3VI4E 4PRPB 5IIEA 4PGDA 1XR8B 4AEHL 5KAQF 5IDIA 1F2XK 3ZQ9A 1IKFH 3UPAA 4PMYA 2I9LB 3CDGB 3HS0B 5I2IB 1FNLA 2F53E 5B38B 2OSWA 2Q3AA 5KOVC 3GNRA 1MFUA 4A6YH 4KVNH 4E4PA 3D2UA 4IIQB 5FV2A 2X4RA 3VDBA 1TPXB 1ACYL 1RUKL 5CSZA 1A9EB 3Q5TA 3RO8A 3SDXB 1M4KA 4U5IA 3TO4A 2DLTA 5DVNA 1BFTA 3DX6A 1QSFE 4AT6A 1JYVA 3GMRA 3VFVB 5TH2A 3WD1A 2QPUA 3LH2H 1P2CB 5CD3A 4HUNB 1S7VB 4ONFH 4U1NB 1CR9H 4FXGA 2XPGA 1GVIA 1ROWA 2V7NA 1YPZB 4DZBB 5GXBB 2IPKB 1KCKA 5HOSA 2CO7B 3ZYIA 3SDCA 5CBAA 2XM1A 5GSRA 3AS0A 5EB8A 1AKJB 3B6SB 3CXDH 2Q1EA 4FNPA 4XBEL 3A22A 2XTJD 4EOWH 1JFQL 1IM9D 4F9LC 1CXFA 3BQUD 1Q1JH 3WQWA 4X4XA 4NBYB 4BCEA 4HUWA 4PJ5B 4TOYL 2QLYA 2MMXA 1UQYA 3SCMA 4PY7A 3I50L 5TGBB 1RZKC 3VDAA 4YDLB 4YFEA 5LJYH 5IEHA 3WFEL 3FB7B 3IT8D 5E2JA 3EDFA 4PJDB 2F54E 3SOBH 4IMKA 4M24A 4Z2GA 3D51A 1IQDA 4JFOB 2CKBH 3DURA 4GAJH 3MCLH 5GRVK 3RX5A 1CTNA 1JWMA 1XC6A 1KJ2A 3OAYH 1HE7A 2EDFA 5AYUL 3IYLW 1ONQA 2ZOLA 4YDIL 4PJCF 4P8VA 1BGGA 4M8QA 2RAMA 5C0AB 5K59E 3GKWH 4MX7A 4F33A 2E4TA 2NX5A 2HRLA 4WDIB 4WTWA 5DC0A 4LHQB 2ITCA 3CDYA 2F18A 3GIVA 2CLZB 2QSQA 3M7SA 4PRNA 3L4ZA 4WHTA 1RIVH 4R4NC 4NRZA 5KSAA 5AZEH 1D5XB 4OSUH 3JSSA 1HXJA 5FM4A 4PEEA 1HHIA 1W2KT