3K8MA

Crystal structure of susg with acarbose
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
650
structure length
650
Chain Sequence
QWTALTASPDTWDETKRADISYQLLLYSFADSDGDGYGDLNGVTQKLDYLNQLGVKALWLSPIHPCMSYHGYDVTDYTKVNPQLGTESDFDRLVTEAHNRGIKIYLDYVMNHTGTAHPWFTEASSSSESPYRNYYSFSEDPKTDIAAGKIAMITQEGAAGYNAAEWFQVSDETAAVKGLLKFTLDWSNAPSPILVVSTGTKADEDNPDTGTDNAKYLYYGEDICKKFYDKGNNIYELTVDFESTWGLLIRTSNASFWPSGTKYGASSSSEKLALNKDFKLTNAGNPANIMFDSQQITYFHSHFCTDWFADLNYGPVDQAGESPAYQAIADAAKGWIARGVDGLRLDAVKHIYHSETSEENPRFLKMFYEDMNAYYKQKGHTDDFYMIGEVLSEYDKVAPYYKGLPALFEFSFWYRLEWGINNSTGCYFAKDILSYQQKYANYRSDYIEATKLSNHDEDRTSSKLGKSADKCKLAAAVLLTSAGHPYIYYGEELGLYGTKDNGDEYVRSPMLWGDSYTTNYTDKTDATVSKNVKTVADQQADTHSLLNIYFSLTRLRNTYPALAEGNMTKHSVYNESQEKDYKPIAAWYMTKDNEKLLVIHNFGGTAMQLPLTDKIEKVLFVNGETQQNTDSDSYTLKLGGYASVVFKLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, susG
publication title SusG: A Unique Cell-Membrane-Associated alpha-Amylase from a Prominent Human Gut Symbiont Targets Complex Starch Molecules.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Membrane protein
total genus 187
structure length 650
sequence length 650
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k8mA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3k8mA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k8mA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3k8mA03
1IM9A 1W3KA 1JZ7A 2IGFL 1MCWM 2V17L 5CBEA 1JPSL 5IVXA 1HVQA 5FUCE 2DJ4A 5KEZA 4JFFB 3GEWB 3H2WA 2IH3A 4OFYD 5EBMA 4YJZL 4PS4H 2VDRH 1S7WB 4DFHA 4B7IA 1MREH 4XBPB 4OTXL 3VGGA 5KN5A 1R3KA 4KJYB 4TOYL 1XF5A 3C2AH 4IRSD 5GS2H 5JQ6L 3SDCC 1U3HB 2Q8BL 4UTAH 5E95B 1AE6L 5IUSA 1QSEE 2NTFB 1DEEA 2YMXH 5JUEL 1MI5B 5ICZB 1NSNH 1FFPB 2F5AL 1U8JA 3PL6D 2HRPH 2DMBA 1U33A 1Q6DA 2CLZB 3S97C 4WVRA 2W9DL 2EXYC 2V38A 2FO1A 5I76A 1KF9B 5CIPA 1E3ZA 1C5DA 5JUVA 1A8JH 1E6OH 3VFUB 2PWGA 1KFAL 3V0VB 4PJCB 2NY6C 4ZS7L 4HWZB 4XCYB 1I1YA 3AIBA 1EMTH 1CE1L 4LCCA 3T65B 3V52L 4NZTL 3A6OA 3SDAA 4PRHD 3MR9B 1V3IA 3B5HA 2ZOLA 5IJVA 1XH0A 3MRDA 3ESUF 4NPYB 4AEEA 4NT6B 4LPTA 2V7NB 3HG5A 1B4JL 1OAQL 2UZIH 1NAKL 4PJ8A 2VRJA 4DVBB 2HFFB 4L3AA 1Q9WA 1TVHA 3PV6B 3IAQA 1K4DA 1DBBL 4E41A 1LEGB 4X9GA 3UYRL 2AV1A 1P53A 1HWHB 3T2NH 5IT2H 1R0AL 4ZE4A 1NGWA 3RVUD 4D94A 4LIQL 1HHKB 2ENYA 1TMCB 1OAZL 1YEGH 2DWDA 1E6PA 3AB0B 4TOQA 2Y24A 1NPUA 3P73A 5DJ0A 3TJHC 5D9PA 5D7IB 4UNUA 2ADFL 2X89D 4OLWL 5HGHA 5C07D 1BWWA 3I9GH 3VFWA 3D39A 3GI9L 4LSSL 1OF2B 1BYBA 4PRWA 1OAKH 5JNYB 5KS9F 4KKAD 1CNVA 3QEHB 4WENB 4GFTB 5F1KC 1HIML 3OKMB 2V5RA 1FO0L 1JGDB 5I19L 3RUGB 1MQKL 4HZ8A 1SMDA 3UG5A 1OGAA 5E1AA 1UD6A 5C0ND 4JFQB 3ARDC 3P0VH 4YXLH 4I48A 3HLAB 1KEMH 2LAAA 4K3DL 5CLTA 1IAOB 1RUQH 1B0RB 4MJIA 1M6OB 1WC7A 3HZMB 5C0BA 1OSZA 1WAAF 3HHRB 1U6AL 1I1AD 3VW3L 4D6HA 4HWBH 2R2CA 4LP5A 3PZNA 1JGEA 2IADA 4RFNB 4LARH 2I24N 3HB3C 3LEYH 2IF7A 2WCGA 1AO7E 1CK0H 2VC2H 4XP9L 3SGDH 1TJIH 4TTDC 4LF3A 3F7YA 1A0QH 4KVCH 2VQTA 3L5XH 4HSQA 4F66A 4U1KA 1B3VA 5D1ZD 3PHQB 3HJEA 5ABFB 2YEZA 1EAJA 3F7PC 3UDWA 5HI5D 4O58H 2YL9A 3N17A 4F15C 2FJGA 3QXAA 4P46D 3MLZL 1ZHKB 3J7HA 1N6QH 1J8KA 4U6VL 1T1WA 4D8PA 1UH3A 1YC7A 2LABA 5DO2C 5DRNA 3CZGA 2GUOA 4G7YL 1U8IB 4LLQA 1DVFD 3FT4A 2HT2D 4KMTL 3QI9B 4WDIA 4Y5VC 1QLEH 5D6DA 3KPOA 3L4UA 3DETD 2X4NA 1I8LC 4K94H 1UB5A 1EEYA 1MELA 3F58H 5FF6A 4JN1H 2Y07L 1ZSDB 3P11H 1T83A 2WWMC 3ROOB 3T0EA 4RX4A 3DX8A 1EEUA 4N42A 3AMCA 2GJ6B 5I1DA 1LEKB 3EJTA 2WWKT 1NFDF 4LQFH 4HUMB 3X3FH 4LVOB 4XRCB 3TCXA 5ADOH 2F2HA 3LY6A 1EGJA 1SJHA 4W4OA 4EI5A 1DQQA 4LSTL 1SMOA 4XX1E 3IK2A 1MW3A 3MJ7A 4J3VA 4Z7VB 1NMCB 4LPWA 4UDUB 1N2RB 4C59B 4HU8A 2VXVH 3LKNA 4QTHA 2X7LB 1YJDL 1CENA 1OY3B 3C8KA 2UY6A 3EJJX 4FFYH 3UBXG 1NMAH 1ORQA 3WNNA 4NC1E 1JYXA 2HJFA 3BD4A 3QNZB 3RIKA 1W2KT 3VXPA 5LXGL 1NJ9B 4AEHH 5IESH 3B6SB 4NQDE 4O02L 5D1XA 4N9OB 1GPFA 2R0KH 2JIXA 1G7PA 3MACL 4M93C 1MQQA 3QEUB 3KPRE 4MAYC 2IAMB 1HSBB 4OFVA 2F54D 5HI3C 3CAFA 5TGBB 5LGJB 1XIWC 1FBIL 3HZVA 4R96A 3BUIA 1IM3B 1JPGA 1QYGL 5CJBA 5CCKH 5CUSL 2PR4H 1JN6B 3P0YH 1OTSD 3ULUL 1YEHL 1AC0A 5ECJE 5I6SA 4QF1A 3LRSB 5BS0D 2VVNA 4DKEH 1H3PH 4ENEC 2C4FT 3VDAA 3O9WC 4Y4FD 2BSTB 1EZVX 1XD0A 1GH7A 4AMCA 4JFHE 4JFPA 5EBGA 1DFBH 3LQAH 1NBZB 4XAKE 5I5RA 3LS5H 3VFMA 4OFIA 4P4KD 2CRZA 5C08E 5D2NA 5T3XE 5IR1A 1LQSR 1ES0B 1NOUA 2Z35B 1Z9OA 5EPMA 5LA2A 4ZDHB 3TA3A 1TXKA 5FDWA 1UWIA 3QCVH 3V5HA 3JTTA 4F9PC 3SQOH 1AY1L 1JZ8A 4OCRH 2WVVA 1NCCL 5C92A 2VLKD 3A6CL 4HP5A 3HZKB 3QWRA 1LL7A 3PWPA 1UJ3C 3WFZA 3G6AB 4ELKB 3CMOL 1YEJL 3RWDB 1KCUH 1AXIB 3CFKB 2DM7A 4I77H 5IQ9A 3FO0H 4LSPL 3RNKA 4HXAH 4TNWF 1ZHLB 4V28A 1IE5A 2A6IB 3QHOA 1A3HA 2L0DA 2D0GA 2C0HA 2C3HA 2CBVA 1LO4L 1OP5K 1YUHB 2GEEA 3HC0A 4KK6C 1U8LA 3QHZH 1BAGA 1MCWW 1Q6EA 1GPOL 5FHAL 5EO9B 3VWJD 4HH9A 4QXTA 2XVGA 2FNBA 5CJQH 1I4FB 2OR9H 3LQAC 3U7WL 1JF1B 2O26U 5TQ0L 1KTRL 4E42B 2V5CA 3LKPA 3CSGA 4D6IA 2EDHA 3B9VA 1KJ2H 4O9HH 3E6HA 1WVZA 3DRTA 4XPFL 1DBAL 2Q3ZA 3D85B 3JWOH 3QH3A 3RZCA 2IPUK 1E4JA 1Q6CA 5ESVA 4BELD 5HHOB 2GTWB 4PB0L 5EZJB 4YDKH 1K6AA 3CUGA 4UMGA 3JSSA 5F6IB 1UYWH 5LGKA 5FYJL 4IS6B 4D0CA 4WU7B 5TE4H 3S88H 1G7HB 4HA1A 3ALGA 3T4YB 4CGTA 5ALCL 4MZ3A 2I9TA 4JRYA 3PP4L 3HAEA 2N4IA 1TTFA 4HLZH 4A6YH 1F58L 1CBGA 5EZOH 1TETL 5EU6A 5DD1L 2X70B 2A6DB 3OZ9L 2DLFH 1MJJB 4FQXA 1H8SA 2NMSA 2WC4A 2HA1A 1A7QL 1VDGA 5D96B 1UD4A 1QSEB 4JREB 4O2FB 4TUKH 4G9FA 4NSKB 1P9MA 2NY0C 1DUZB 5CPSA 1Q0YL 4U1IB 5IMOB 5L9DL 4J4PC 2WHMA 4W7UA 1G9EA 3O6LH 5KZ6A 3HG1D 1AR1C 1KBGH 4M6NL 3NOIA 3V6ZA 5H94B 3BEWB 4L8CB 1S3KH 3L4VA 5F89A 1WIUA 5K33A 1MWAA 4Y4HB 3WF4A 4M1DL 3LEVL 1BZQK 2V5MA 3BIAX 4B0MM 1SJEB 3MRIA 4PGEB 3JWOC 4WFEE 2W38A 3RTQC 5FGSA 2OK0H 4PUDA 3RDTA 2BCKA 4WHCA 1JTTA 5I73B 1FZMA 4MNHA 5IF0B 3OJDA 25C8L 3C6LC 4HC1H 3TT3L 4Q9QH 1U95B 3C8DA 2Z92B 2NX5A 4JJ5A 5T1MB 4JIEA 3BVNB 4X9HA 3ULVH 3IXAA 1O7DC 1TQUA 1XR9B 4HHAB 3HC3H 5F9OH 3HUJA 2I9LA 3PQYA 4OKDA 1R3LA 5M3WA 2QSCL 2RJMA 1EO7A 2ZKHH 4KTEH 5I74B 4UU9B 3ZT7A 3NACL 5FK9B 2C3XA 3BAEH 2VAAA 1K8DA 1SY6L 2OMNA 1IT9H 4KKLC 3GNRA 3PWUA 4YEFA 3PDOB 5E5MA 4X6FA 2V6HA 4KDWA 1C1EL 4GRLA 3RBGA 4R9HA 4DEPB 5F71A 3WFDH 2O5YH 4F7CA 1S7TB 4UBDC 5E6IA 3RP1A 2OTWB 3RAJH 3WCYA 4LLYA 5IB4B 1YY8A 4N9GB 1Q6FA 4G42A 4WFFD 1O5DT 2DQFA 4R97B 3E1F1 1XF2B 2QTEA 1FN4A 1AHWC 1NGYB 2X42A 4X5LA 1PZ2A 2CERA 4IOFC 4PY7B 1FORH 5D7JA 4GAYA 2WBJA 2C7UB 4LSQH 1I7ZB 4PRHE 5MI0C 4KQ3L 3ULVC 5MEQB 2WMFA 2VDOH 3RKDC 2BDNH 5FD0A 1ND0B 3QUMH 3UBXA 2CJUL 1UCTA 5I17B 2EPMX 1I85C 3RPMA 1PD6A 2MTPA 4CJ0A 3RVXC 2NW2A 1J0HA 1AO7B 1UA6H 3MNWA 1H09A 2Z8RA 4XZUB 4BQ8A 2D0HA 5FCUL 2JELL 1FAKT 2P24B 3BDYH 2XRAL 1MFNA 2Q87A 3WLBB 3NAAH 3KPNA 2GITA 2V9TA 5FYLD 4NZDA 2APVA 2OL3B 5BXFB 3QDGA 4GT7A 1MPAH 3CU1A 3LHPH 2WINB 4P0DA 2A6KA 5CBAA 1FJ1A 2YWYA 5C07E 3S5LB 1HNYA 2G9HA 2F74A 1FHGA 5JR1H 1FNGA 3MA7A 3MCKB 5JXAH 4PJ9A 2FIKA 2OZ4A 2ZE0A 4P23A 1CQYA 2ZIDA 5DHYB 1U8MA 4WSJA 1IBGH 1TE1A 1TUXA 1CLZH 3QEQD 4XNUL 4L4OA 2W65B 2EH7L 4Y16A 3GTNA 5I1LA 4N0YH 5A94A 1WWWX 4R4BA 1E72M 2HKFL 3BPNC 3MODL 2PTTA 3MRGB 4EUPG 1GC1H 3ZDZF 4C56B 1RUPH 1C93A 1KC5H 2N7BA 1S9WA 3HE7C 3CPLB 4OBRA 4U05A 4YBLC 1EK3A 3IGUA 3KDMB 4YDLC 4PR5B 4HUKB 2ITDB 4RFEA 4NQTA 3MXWH 3WL9B 1A4KA 4WEUD 3IDGB 3RWEB 3SJVA 1ZGLP 4WHYG 1E4KC 3DGGA 1KENH 2ENSA 3TFKD 3PJSB 3C09B 5IB5B 1AGCA 4JG0L 5CGYD 3GHBH 3G5XA 3GSNL 3TTOA 3KLLA 3ZDXF 5EZIL 4JFZL 3MJ8B 3H0TA 1LE9B 2BSRB 2OW7A 4PRAA 2J25A 1FL3B 2DTML 2CKBB 5GZND 3RWIB 2JALA 2PYEA 3MSGA 2WWDA 1FNSH 3QIWD 4U0RB 1ODZA 3A67L 4K3EH 4QTIL 1FAIL 4DGYH 3OGRA 1T2JA 2CD0A 1T1XA 3QB7C 1KYOJ 3PG2A 4NQDB 1V05A 2WMIA 1QSFB 2FX7L 1N3NA 2NY3B 3GMLA 2EKSA 4X7FC 1S7UB 3KPRB 4PY8J 2GCYB 4PMVA 4LSVH 4CU6A 3WD3A 4PJFA 2APFA 2O9RA 1IGML 1KLFA 4P2OB 1IARB 1KB3A 1YNKL 1GC1C 4PGCA 2RCSL 2YPLD 1FCCA 5CD3B 2Z93A 2JJTA 5C0JB 3VXMB 4WWKA 5JTWA 1A6ZA 4D9QD 4PEEA 1DANU 1Y18B 3NGBC 4Z7UA 5FOBA 3SDYL 1W2PA 5K9JL 1TVBA 4AIOA 1YDPB 3KL0A 1BM3H 4YDVB 1WFOA 3GMPA 1U42A 1IL1A 1NBVL 4W81A 2PW2B 3ZKMC 5I1GL 5C08B 4EXKA 1MCQA 2FBOJ 4JPKH 4M43H 3DVIA 4Z7QE 3MROB 4AY0A 3L5WB 1AIFA 2DQHH 4NRYB 5TE7H 4KHXH 5J89A 5SWZA 3D52A 4S1RH 3ZE2F 1OWQA 1VFBB 1NLBL 4RIRB 3MBED 4D1IA 1FVCA 3QIUB 1K5NB 1DUYB 3GO1H 2GY7B 3TBWA 2FB4L 3AOFA 3DJ9A 4JY4A 4XCNA 4GKOA 1AP2B 1N64L 2EDQA 4AENA 2W91A 2XA8H 1ODAA 4JM2B 3REWA 4L4PA 3W9DA 3UG3A 3F5JA 2J8UA 2F54E 4JFYB 1BWMA 4KUZL 4NUJA 4K2UH 5D70L 3N85H 5CMAB 3GXTA 2EACA 4B9YA 3S36H 1LG1A 3AICA 3POHA 2P5WA 5A16B 2GK0B 5BV7H 1BJ1H 6A3HA 3MOAH 5B38A 5KOVC 2J7FA 2Z91B 4OQTL 1H15B 1A4JA 4YHLH 1I9IH 5BS0E 1G94A 1H5BC 4MJ2A 1OIFA 1G9MH 4FF5A 5HYJB 3FZUD 4NQED 3MC0A 3AXHA 2EABA 2IFFL 4JFXB 3T4AB 1BZ9A 3FCTB 2P49B 2FSEB 4DGIH 3CUPA 1U8QB 2VLJD 5CLWA 3I75A 4KZEH 3MNVA 1X3DA 3QHNA 4DWHA 3IFNH 3U0WH 3SPVB 4RDQG 4BM7A 5JPNA 4UV7H 2B0SL 5FA4B 4GBXA 4X7DC 4KAQL 2ADJA 4WI3A 2P5EB 3G6DL 2VLKE 3UTTD 1MFDL 1RU9L 3TF7C 1XSKA 4DVRH 3A24A 6CGTA 3I6KA 2J75A 5D8ZA 4D0BA 3BFOA 4JQIH 3DROB 5H35B 5DJ6B 1CGVA 2XYLA 2V9RA 2DQXA 1TTGA 3G6JA 1KPUA 3ZKNC 4ATLA 1JJUA 4NBZB 2UV3A 5BV7C 3BP4B 4PP2B 3MRNA 3D0LB 5AAMA 4F37K 5GRJL 4FQHB 4F7EB 4FFWD 4Z7OE 4XTRD 1G9MC 3ARBD 3KYOB 5FO9A 4AYGA 1GZQA 1GIGL 3CC5A 1G7QA 3KPPA 4H5SA 2CLVA 3ARVA 4BZ2L 1HXKA 3WF1A 3HRPA 2EDEA 4YK4C 5DJYA 1XCWA 2OYLA 4OZIA 4MNGA 3MLVH 1T0OA 3FHAA 5A2KH 3GMQA 3TZVD 4ORZC 4QLJA 2X05A 1OLZA 5J13C 4R0LB 3HI5L 3U2SA 1NGQL 4HF5H 5MEOB 4GXVH 5HHXH 4L8SA 4N0UA 5HHQA 3IDYC 1AXTL 3MGTA 1KEGL 1MAML 4KV5E 2QF8A 1G6RB 4OI9A 1Q9KB 3SQBA 4AQ1B 3AGVA 4AZ5A 3MUJA 1PS3A 1INQB 2CSPA 4HBCL 4PJEE 2A1WH 3PXHA 3EDKA 4Z76B 3MRBB 1G7JA 1BPLB 1S7WA 4H8WH 3L3DA 3AIQA 2VQ1B 3QUZA 1H2JA 5KVEL 1IQDB 2BY2A 4MQ7A 1EA9C 1U3HA 2RQ8A 4IRSB 3BXNA 2P8MA 2CDEB 4L8BA 4TVPD 3NPSB 3IJYA 1MI5A 2CGRL 4HZAA 1IKNA 3HFML 2ZUWA 5DD5H 1EDGA 3PL6B 3VXNB 2CLZA 1T6VN 5FGRA 2QR0B 4P2RA 3GSRB 3HG1E 4HGKC 5F7DB 3PP3H 1D9KC 1SBSL 4N1EA 2PF6A 1T0NB 3FFDB 4POZD 1A5FH 4CW1B 5FL0A 5LWYL 1KN2L 4Y19D 3VFUA 3TPUA 4HBQA 1IEBB 3GIZL 2D1ZA 4YHYC 3V0VA 4PJCA 5IBTL 2QQNL 4A2MA 2HN7B 4BK4A 3T65A 3JVGA 4L4VB 4XZWA 3O2WH 4NOBA 2UUDK 5BRZB 1FYTD 2J8FA 5C8JB 4I2XA 1SVCP 3VG0L 4XBEL 1KB5H 1EUUA 1JWMA 1XGQB 2XTJC 4OLXL 3T2QA 3WH8A 5TDPB 3M46A 4FQIH 3D2UD 4RMTA 3QZWB 1T21A 1IVLA 1X5HA 4DVBA 1YPZF 4H8WC 4MHHG 4X5WA 1A9EB 3NA9H 3PV6A 1KIUA 1MFBL 1AKJB 2CKRA 1LEGA 1H3WM 5DVKA 5D7SL 1YC8A 3GBNH 5CWSB 2CDGB 3B8YA 1HHKA 3BLBA 2EDXA 1FDLH 1MY7A 3RIFK 3GBMH 3SDDD 4A2LA 3MLXL 4MNQB 3CUHA 1RZGB 2DWEB 4P3CL 5C07B 3D5OF 4Y8AA 2YK1H 3WFHB 4W7WA 1VACA 3LKSB 2ZUTA 4LGPB 4FZ8L 3U7VA 5EUKB 3MKKA 4WFFE 3QEHA 2WZHA 4K3HA 4CN1A 5BW7A 3VSTA 1QFOA 2V2WB 2XACC 1NCNA 3RUGA 1QHZA 2QPUA 4JFQA 3HLAA 4WI9A 1IAOA 5GRYA 3G9AB 4PP1D 1KGXA 4PJDE 3GNOA 5JORA 3HZMA 3RVWC 2AQ1A 3BGAA 4YNYB 2UVFA 4JZNA 2E7BA 3BZFB 4OQTA 4APQA 5GSVA 3BIBX 1RV6X 4NIKB 2WSPA 4I13B 5IW6B 3WDRA 5FO8A 2XN0A 1CD8A 2EDNA 2NY1B 5FKYA 2NW3B 2VDPH 2WSKA 1AJ7L 5IBUG 3VE0B 5LQBH 2YRLA 3BPCB 4U1HA 1VKXB 2OJZH 5C0IB 1HYSC 5C0EA 1ZB5A 3PHQA 5ABFA 5FYLE 1H11A 2XZAL 1DQJB 1K2DB 2KDGA 4XNQB 3AMGA 1AFVL 2G5BA 1ETZB 4PBVC 3BCDA 4Q9CA 5CKAA 1N59B 1MCEA 3DHMA 1ZHKA 2J4GA 1WKYA 3P9LB 1ZEAL 4HIEA 1CFSB 3MOBH 3PE9A 4MD0B 4WTZA 4Y0GA 4DGVL 3AHXA 2JKXA 1CF8H 3VIGA 3JTSB 3A22A 3QI9A 1OPGL 3BISA 4OCXH 5ERWB 3SDCD 1H49A 1E56A 3BPOB 3P4MA 4GKSA 3ZTNL 3BVVA 5FOOA 3QXDA 3QEQE 3CFCH 3WUZA 4Q6IC 2IH1B 3B43A 3L7FB 2NXYB 1ZSDA 1IGYA 3MBXH 2EXYD 1G7LA 2AJSH 1U91A 4NJAL 2IALB 2R23B 2GJ6A 5JXEC 4H0IA 2AXJA 1M05B 3SN6N 5CD5C 4M8QB 5L88H 4YHIB 2FLRT 2NY6D 1YN6A 5B3JE 4J12A 4IJ3C 4DO4A 4UILH 4WI2A 2Y36L 4WF7A 4GZJA 4PN2A 3FO2B 4UDUA 1N2RA 5CJXA 4OCSL 5AYUH 2X7LA 1CFNB 2YD3A 3D9AL 1B6UA 4PJBF 3WN5A 1FHDA 1MCPH 1XMWA 1LP9E 3DBXA 1Z5LA 4OD2B 3OR6B 1C16B 2V3FA 3A6BH 2E27H 5DC4B 5E8OA 3QNZA 1IV8A 4ZPVB 3OGVA 5GS2D 2W0FA 3THML 3NCEB 5D7KD 1CQKA 3OXRB 5DVLA 5IG7B 2J77A 2IAMA 3FO1A 1PG7H 1QLFA 3TJHD 1E71M 2F54B 2ZNWA 5TGBA 5LGJA 3HMWH 3V5DA 5FXCH 3S5LG 2YPLE 1JN6A 2J47A 2UY3A 2KBGA 2MHAA 5DUPH 4D9QE 3LRSA 4XI5C 2VRAA 5GGSY 5BS0B 1T3FA 4X8JB 4YUEH 5CZKA 2NR6C 4GXUN 4PJGA 4Y4FB 1BAFH 4P57B 1F45A 1U3YA 5I8KL 2XXMB 3GUTB 1SM3H 5FGBA 2AP2A 4P4KB 3S37H 3UR7A 2PCPB 5IFHH 1X5XA 2CITA 1OAXH 5L7XL 4ZDHA 4UFIA 3MFGB 2AEWA 1TQVA 4LRNL 2OL3L 1US3A 1P5VA 2ZSWA 3LN4B 3UJTH 5IJKC 2R4SH 3HB3D 1S9XA 3OX8B 5CILL 1E4NA 1UENA 4C7GA 2FD6H 1OAYH 5DK2A 2VLKB 1RUAH 4TTDD 4XZBA 4NNPH 3HZKA 2IG2H 2EYTB 4GG6E 4QCFA 1JAKA 4G5ZL 3RWFA 1ZOXA 2PXYC 1OP3H 3ELAT 5I9QC 4NFDA 2XQBL 4NN7C 3PHSA 5IVOA 4RMSA 4NJ9L 3Q2CA 4D6FA 1ZHLA 3RNQB 3GKWL 4JO2H 2ZP0T 2VR9A 4ODVL 1NC4D 1E6XM 2D23A 1DQDL 4OF5A 1YUHA 2QV4A 1OVZA 5DO2D 1TTUA 3NZHL 1OT2A 4JPVL 5B8CB 2DBLL 4PYHA 1QKZH 1YY9C 4M5ZH 4UNVA 5EO9A 2I07A 2LAGB 3WBDA 3PWVA 1PVHA 3ZT5A 1W9BM 5I23A 4UDTB 1CLXA 4LHUG 4NQEE 3CZNA 2QQLL 4J6RH 2AK4D 3W29A 3BPLB 4YFLF 2QSVA 4M29A 4N90D 4D3CL 3QIBC 4Q0XH 2XM1A 1TFVA 1FL6B 2WWMD 1NMBL 4XGZB 4PRDB 3MZGB 2VLJE 4S2SA 3APGA 2OWWA 5E5UB 3D85A 5BZWA 1JIBA 1Q72L 2I5YL 5HHOA 1PQZA 2GTWA 1RVFL 5EZJA 3X14A 2ARJQ 1XRVA 2W0PA 1S5HB 3MRFB 2CKBL 4IS6A 4PLNC 5HHPA 32C2B 4QRQA 4XH2B 2HFEA 3KPQB 2G75B 4GQRA 3UTTE 1L7TL 1ZE3C 4I0PA 1G7HA 3WNOA 2COQA 4ZAKD 4RRPG 2EXOA 4YXKL 2O5XH 4J3XA 5GS3A 1WBYA 2HTKD 1HI6B 3B3IA 3SO3B 3CVHA 1CDCA 3GMOB 2X70A 2A6DA 1MJJA 4NKQB 3SE4A 4XC1L 4NCC1 4EI6B 4DTGL 3KJ4C 3UCRA 5A6BD 1D5IH 4Z0BH 2NXZB 4GG8B 3NZ8B 5C0AD 3KL3A 1QSEA 4WEMB 1QBAA 1PZ5B 4HJGB 3MO1B 4IRZL 1V6WA 4NSKA 1FGNL 1FGVH 4U1IA 5AWNH 5F9DC 4NSBA 1VEMA 3GH7A 4PG2C 4HK0A 3HG1B 2EO9A 4NO3A 3AJ7A 4I3SL 5H94A 1XIWD 5GSRB 4NKMB 5HOSA 1VPOL 2HG5B 3HMXL 4LCIL 4Y4HA 1A6WH 1JPFB 1MRCH 3DYOA 4K71B 1SJEA 3D87B 4PGEA 2XM2A 2XFXB 2YRZA 5T3XL 3W24A 2X09A 5E4EB 3DUSB 2B1HH 2BVPB 2AMGA 1RSFA 1LO5A 4Q9BA 3HI6H 4ENED 5J11B 1IMHC 2X4OA 4F58L 3BH8A 4DWSA 1U95A 3O9WD 4DO6A 3ILPB 1ONQB 2VZTA 5T1MA 3SEPA 1QHOA 4MB1A 3BVNA 2W61A 1MW1A 3MA9L 4M4PA 4G7VL 3BO8B 1NKRA 4HHAA 5D1QC 5F93C 2MQ3A 5B21A 2VXUL 4DK3A 4ZXLA 1C5CH 4ZYKB 1JHKL 2F8QA 1GXEA 4IDJH 5HGAB 4UU9A 5DJ8A 5KSBE 1L7IL 4RMWA 3BRGC 5E7BA 5FK9A 3N1PC 4CU8A 1HH9A 3MU7A 4XP6L 1W72A 5IBLC 3PDOA 2HFGL 3O6ML 1YHTA 3KS0H 5INDB 4JGUA 4TQEH 4YPGB 3PHAA 4TVPE 4NX0A 4LKCA 2CIKA 4TRPH 4Z5RB 1S7TA 1XGYH 3UBXI 3UG4A 3FT3A 3OG6B 1AD9A 4IDLA 2H32B 4IRJA 2OTWA 3IFPA 1RAMA 2R69H 5HYIA 4HW6A 5IB4A 3WF2A 3W6LA 4PJXA 5MENA 5HGBB 5A43C 4OZGF 5F1IB 3AIUA 1CDYA 4BKLB 4Y19E 2Y7QB 1CLOL 3UZVB 1AD0B 4KK6D 2YD4A 2VWEC 4Z2HA 5C0GA 5KVMC 2VR4A 5FM4A 1NOFA 4JL1A 2C7UA 2ERJB 2F19L 1D5ZB 1I7ZA 5I1CH 2RFXB 3WUWG 3QNYA 2OLHA 2OSYA 4PJDB 2A83B 3L1OH 1FYTE 2E40A 4L1DA 4PY8I 2R0ZH 4UB0L 5MEQA 4R2GB 3DHPA 4OUEA 4IOIB 1FVEB 2DQUL 3WO4C 1KJMA 5I17A 2XZQH 3S35X 4PRNB 1WO2A 1UWXH 2BJML 5E00B 4OGXL 2ZWYA 1WV7T 1AO7A 2QLYA 4QKXB 1RPQA 2CR3A 2VCCA 2BS9A 1VFOA 1ECEA 2X4PB 5EIQA 2P24A 3L9RA 3TVMA 3RY5A 3V5KB 5BXSA 2V2TB 2J8GA 5DEFB 4W7VA 4U3HA 2ZJSL 4TULL 2WXDM 4KGLA 1FG9C 5EUOA 3S5LA 5T3ZH 5LBSL 1EO8L 4N0FA 2FHBA 2K7QA 1US2A 3TT1H 1RIVH 3GNML 4OSUH 4JRWA 4G8GB 3D4YA 1U8NB 5DHYA 5HI4D 1RD6A 2EYRB 5EH1A 3QBTB 3I02B 2GDVA 4HUWA 1D6VL 2W65A 3BKJH 3QEQB 4JDTL 4P59L 2NY0D 3TONA 3GB7B 4JG1L 3WXWL 3CMGA 3WUEA 5E4IA 3QNXB 4OQ1A 1JFQL 2APWA 1OCQA 1KTCA 4C56A 1JGUH 4LMQI 2EH8H 2IWGA 4LLUB 3DVNB 4NHUB 3MMDA 4G43A 1KG0B 4X4ME 4FFZL 2FATL 1G6RL 4JHZA 3SCPA 2V3EA 5IHZB 1MFEH 3FL7A 4WFGD 4LVEA 5CJ8A 3K8KA 2ITDA 5FKAB 1I1CA 4XVTL 3WL9A 3N1AA 4PGBB 4NC2B 4POYA 3IDGA 3EHBC 3RWEA 4YIQA 3U6RB 3CO4A 1QVOA 3PJSA 4M8UA 2ZUUA 1QR1B 4ELMF 4Q22A 4PJHF 1UXSB 1OQXA 3MJ8A 3W39A 5I75B 3AREA 4OKVB 4Y4KC 4WI7A 5KJRH 2OSLA 3MTRA 1FL3A 2CKBA 3K8LA 5ILTH 3RWIA 1FPTH 5DSCA 1UQZA 3P40A 3N9GH 2AS5M 3QIWB 3LPPA 3UJIL 4OZ4B 3RZWA 4XNZB 4RAUB 2NY7H 3V6OE 5EU4B 4LGSB 5FECB 1QFUH 1QSFA 4JZOB 3V8CA 4DN3H 3MSDA 2NY5H 1NGXB 4LHUA 3NIGE 1CWYA 4EDWH 1N4XH 1IGTA 1JNJA 2YWZA 1S7UA 3KPRA 1Q6GA 2G60H 1GL4B 1BJ8A 1AR2A 4UBDD 5C1MB 4AIUA 2J4WL 4P2OA 4GUPB 4Z7WA 5IFAH 4GRWE 1GHFH 1S7RB 1DZBA 5CD3A 1JRHL 2VUOA 4JM4H 1QRND 2CXGA 5ETUA 5C0JA 3OG2A 5FUZL 5C7XH 1GVYA 2W9LA 3VXMA 1OB1B 4PBXA 1X4YA 4RGMB 3MGAA 4G6JH 5ITBL 4YAQB 1II4E 3OQ3B 1NM9A 3R06B 3VXRA 4Q2ZA 4CMHC 5JMRA 4AY1A 1AQDA 3I84A 1YDPA 1HCFX 3CSBA 4KKCD 5E9DD 3KWWB 1T1YA 4RRPA 2EPLX 2QKIB 5GISL 1HJXA 1ERNA 2IJ0C 4M6MH 2XGIA 1I7UB 5EOCH 2YN3A 43CAB 1MUJB 3ULVD 5C08A 5MP6H 3RKDD 3ZE1E 3INUL 4NRXB 4FNPA 3RM4A 1IGIH 4E8DA 4U1JB 4NRYA 1YMMA 4JANB 2YDQA 2WB5A 3E8UH 1S7VB 1FCGA 5FA3B 3WXVH 1VFBA 4XC3H 4RIRA 3RVXD 1EO5A 5HDBF 1K5NA 1DUYA 3BGFB 1UZ8B 4GG6B 5DFTA 2NY5C 1L6XA 1E4XL 5D7KE 2PYFB 4XPTH 3KNBA 3UTSB 4JM2A 3VIOA 1CL7L 2F7RA 1GHSA 2UYLA 3I50H 4P5KA 4G8IB 1AGFA 3LSOB 1RY7B 4HJ0D 4ZD3L 4N8VG 1E0OB 3N12A 2A3AA 3ARDA 5I77A 4ZXBB 3IU4L 2WBWB 2ZCLH 3ZE0F 4GQPH 3SKNB 1C12B 1H15A 1X7QA 3D3VA 5F7MC 5IVXF 3RHWK 1QBBA 4QRPD 5ID0A 1HJUA 2VXTH 1UM4L 3EIFA 3O6FA 5HYJA 4NQEB 5L8JB 2WP3T 1SYVB 1T1ZA 1BQUA 4YBHA 3STBA 4JFXA 1FP8A 4LLMB 3BKYH 2DDQH 3JV0A 3WE6B 3FCTA 3VM7A 3ALFA 1U8QA 4X5XB 3F5WB 3V0WL 1MCHA 4D6GA 2VLJB 1XV8A 1U36A 1P1ZA 3MJ9L 4QRRD 5F44A 3PZUA 4JFED 1WDPA 2VKWA 4HPOL 4RGOH 1DWGM 4J28A 3HE7D 1NL0L 1CGUA 5FA4A 3VI3F 1J9CT 2Y2WA 5I1HH 3RJYA 1KCLA 2CKNA 2EIZA 3ARZA 5EB9A 2P5EA 3QO1B 5TPWL 1W8OA 5ABDE 3UTTB 1B3WA 5JPMB 3DX1A 5SX4I 4NN6B 4ZOBA 3KXFD 5E8EA 4F57L 3FAXA 2WNGA 3O0RH 2EDTA 3DROA 3AXXA 3O4OB 5H35A 1E6RA 4DN4H 4I18C 5D71L 3OL2A 3BQUC 1HKKA 3MLWL 2CCRA 1HVXA 2YSSB 4FTVD 4M4RA 4ZS6C 1ITCA 1EHNA 2Q6WB 4PMOA 1LD9B 3MREB 4YEEA 1JTOA 1RP8A 4FQHA 4PJAF 4F7EA 3WUWA 5TFSH 2Q86B 3KYOA 4J8RA 1W9VA 2V5YA 2X4TA 2EO1A 3JUGA 2WW8A 4AD3A 2OWXA 1HJVA 4FHBD 2AK4E 4JRXD 2Y9RT 4U1SB 4DK6A 4MQSB 3EJUA 4N90E 1QLRA 3OHXB 4Y5YC 3U1SH 3QULB 1B2YA 1HN1A 3QFJB 2HMID 3RA7L 3VFSB 2O9OA 3D0VB 4JDZB 2IEPA 3IJSB 4JFDD 12E8L 5MEOA 1I7TA 1T89A 2LV4A 4M7JH 1LF1A 1HSAB 1Y6MR 4X6BA 4U49A 3CUIA 1W0WB 1Q9KA 1UZ6F 5CIPH 1F4AA 5EIIA 5KS9A 4BQ2A 4M48L 1INQA 2KKQA 1NCWL 5EU3B 4BFEA 1MNUH 5E7FA 4DKAA 4X0VA 4Z76A 2OTUB 5KSBB 3MRBA 5GNZA 5ABGA 5TQ2H 4QT5B 5HVGB 4IOSD 4CVXB 2J78A 3SCSA 3LPWA 3FB5B 4Q58C 5T1KD 2VOTA 2Y23A 2DKUA 5C0AE 2CDEA 1DTUA 4L3EB 1KXQE 2X4QA 3DXAA 5GJSH 1ROWA 1MCNA 3VXNA 5GNXA 4Z77A 1BEYH 4KK8D 3AVEA 3QRGH 3GSRA 1LE5B 3BUQA 4ATDA 2GTZB 1QNZL 4QRSA 5F7DA 1WAAE 2Z8SA 2DIEA 3FFDA 4GAFB 1UD3A 3ZOAA 1B2WH 4JZJB 3ROLB 4BZYA 5DVMA 4Y19B 3P4LA 1IEBA 4FQ2L 2DBJA 5KOMC 1C5BL 3DURB 1H8NA 5D5ME 2HJLB 2HKHH 2HN7A 1IGFL 3IU3B 2EXWD 1U0QA 4X99B 4L4VA 2XKSA 1U8OB 1RJCA 2E9JA 5BRZA 1GOGA 4KKBC 4OF7A 4OLZH 3VOCA 2VZ1A 5C8JA 1FYTB 3RFZC 3GSUB 1UYQA 3MJ6A 3H42H 2D9QB 1LHZA 2BC4B 2ZICA 3GZAA 4TYUA 1XGQA 3V4UH 4ODTL 4F9PA 4AYSA 5ALBH 4W6XB 5EOQL 3D2UB 2CK0L 3P30H 1D5BB 3FOMB 1A9EA 4OGZA 2ZNXA 4LCCC 5HVFB 4PPTA 1AKJA 2YL5A 3SDAC 1JHLL 2VITB 1B0GA 5F7EL 3QJFB 3RJXA 2CDGA 4OB5H 5GJTL 1MIEH 5DMYA 4XVSH 3FO9A 4EKXA 1JUFB 2NZ9C 4OLUL 1VSCA 4OJFL 4LFHG 4NUGH 3SDDB 1HX0A 3WEMA 4MNQA 4HDIA 1NFDA 4O5LH 4M7KL 4PJ8C 2DWEA 5C07A 3S7GA 3VIJA 4N8PA 2XG9A 1A47A 3O3BB 3WFHA 1KUMA 4X7SH 5EUKA 3ZKND 5B3NA 3FMGH 4F7PB 4WY7L 4JY6B 3P4OA 2GFBB 3VH8B 1A7PL 4OM0L 3IF1A 4XPGH 1QNOA 4XNMB 3KGRA 1F13A 3Q6FB 4ZUWB 5C09D 2QHRH 4ZE5A 2VH5L 3H7BB 4JL2A 4YC2B 4MSWB 2C1PA 1T6WA 2VL4A 2PB1A 5A6MA 1W1YA 2ICCA 1Y6KR 2XIDA 4JZ5A 2FBJL 3BZFA 1NANI 5D4QA 5IHBA 3N1QC 2B2XL 1U8KB 3TP4A 2EE6A 3ARFD 1ZLUH 1T2QL 1C3FA 2VZOA 5IW6A 1DJSA 1W91A 3VGEA 1BGXH 2F1BA 1BD2A 1HQRB 1P7QD 2AJYH 4XNXL 4AD2A 2C3WA 4YDJB 3VE0A 1VKXA 3BPCA 4KRPC 1JBJA 4M6OL 4BZ1H 1NARA 3R1GH 3MJ9A 4Z2JA 2JE8A 1RZIA 1JDCA 1GVIA 1BQLL 1DQJA 2CIPA 5E2TL 1K2DA 1MHEB 3NN8A 1N59A 3UZQA 4MAZA 4N8VA 1EGJH 3MV9A 3P9LA 1CFSA 3LXCA 3ZT6A 5IFPA 4MD0A 1RHFA 2MNUA 1P4IH 1OTUC 4QRTB 1PIGA 4Z8FL 3FQUB 2E7MA 4X6CE 2XNAB 3LD8B 3AZTA 2BZDA 1BBJB 4CN6A 1HKIA 3O11B 4A3YA 3WJLA 5FOJA 3UDWC 1MF2H 1UWEL 1SYSB 2IH1A 4XP5L 4I3RL 4F9DA 3CFJB 1BF8A 2Y8KA 2V17H 5F8RC 3RTQA 3HNVH 4GRWB 5FAAA 1D9KD 4J1UA 2IALA 2R23A 1GJUA 3KLAA 3C6LA 1U8HA 4M8QA 3F5LA 3N13A 4WFGE 2W9EH 4FNLL 4YHIA 4ZNEA 2BFGA 4NXSA 4PV8A 2NY6B 4X4YB 1CD9B 5D6DC 5FUOL 1UD8A 3X3GH 4BFIA 3CLWA 5C2BH 1JFHA 1O7VA 1CICC 3X17A 1GAFH 1H3VA 4TOYH 3DO7A 3BVWA 4NO5A 2F18A 4EDXB 4GI6A 2Y1VA 4ZFGL 1DCLA 3GSXB 4WW1B 2YD9A 3ZDYF 2XTJD 1OTTC 2YPVL 5T5FL 3U36A 3W11C 5HYSG 2BNQD 4KRMB 1TCRA 4OD2A 1D7FA 2Z31D 3OR6A 4PG9B 4RWHA 1EX0A 3VXTA 4W4OC 4EI5C 2X41A 5KVGL 4NN5B 2O9TA 1A14L 5A3HA 1BFOB 1UWQA 1H41A 2XGBA 5JBFA 5EB8A 1P5UA 1JFXA 4ZPVA 1MHCB 3BN9D 3TN0A 15C8H 4I4WB 5K93A 1PDKA 2CBUA 5F1SA 1GGYA 4ZUTB 4KROC 3K0WA 5DRXA 5IG7A 1DL7L 3CFDB 5I3DA 1NCBL 2DKSA 1AHWA 4MX7A 5IKCB 4Y7EA 1NGPH 1O7SA 4JPIB 3GI8H 2FGLA 2QMKA 3UP1A 1INEL 1X4XA 1KIQB 1QRNE 1PKQE 5DD3L 3EJZC 4PMXA 4FNSA 4LPXA 1G1YA 5EA0L 5A1AA 5FCSH 5GGTA 4X8JA 3GXIA 4PMQA 1TA3B 1JNNH 4JHAH 1F4XL 1GSMA 4P57A 2F58L 3W0WD 5E9DE 3QXWA 2YKKA 3CLEH 2MANA 2UWEE 1PGRB 5CGTA 2VX5A 1RZKL 3GUTA 3RVWD 1X1NA 3ULVE 2PCPA 1F4WH 3HE6B 2F8XC 2VDQL 2XG4A 4ZEPA 1AQKH 3TV8A 3LN4A 3AU1A 5FYLL 2HH0H 4MB5A 1X5IA 1YEIH 3V6FB 4Z6AT 3OX8A 3U4EA 3GI9H 2WKLA 3BAYA 1HINH 3O45B 3IXTB 1DQLL 1EJOH 2BXYA 4EK7A 3O3AB 4K7PH 3WS3B 1CLYH 1VADB 3JWDH 2ADGB 2Q76B 4ZFOL 3NYDA 4U5IA 1GGCL 4MHHI 4QXUH 3TA3C 2F53D 1PLGL 1BVLA 3RNQA 4F15B 5FHBH 2YUWA 1VHPA 4FG6D 5DWUH 2HVKB 1LL6A 1NC4B 2JF1A 1U92A 1A6VH 1WWAX 1FP5A 3F12B 2WZIA 1GGUA 1FFNA 3BMVA 3VPLA 2Q20A 3T0BA 1RUML 1BJMA 4D6JA 1FZOB 4JO4H 3WF3A 5B8CA 5C0CB 3OF6A 1MCCA 4MVBC 2B31A 4LASL 5ICXA 4XPBL 5GHWL 3SY0B 4QRPE 4UDTA 4Y5VB 1BLIA 1LK3H 4UQEA 1WWBX 5F7KC 1LMKA 1XF1A 1FLTX 1FL6A 5IEKA 1CG9A 2EEBA 4PJIE 4NKIL 3JV4A 4QRRE 1CD1A 4JFEE 5CD5D 1I1RA 2A6JB 2NW0A 3MLZH 5T33L 3AM8A 1UEMA 3MRFA 1UD2A 2FGWL 3E2HC 3NVQA 2VABB 4U6VH 4XH2A 1JNLH 4ZSOE 3KPQA 1R46A 2G75A 1V6UA 2C5DC 2HLAB 3MGOB 4LEXL 3OB8A 3KXFE 4FQLL 4ZAKB 5JHDD 4NO0A 3L4WA 4XNYH 1MWAH 3JWDC 4NQCD 1HI6A 3GMRB 3ZL4H 1FZKA 1HHJB 1X5AA 1NAML 5LGHL 4TTUA 1KCRH 3GMOA 1SR0A 1P6FA 5DJAB 3TIEB 2EICA 3NABL 2X4SB 1FFOA 4YHNB 5L2KD 1E5NA 1H9VA 4ZTOL 5EU5B 3IDUA 1UKOA 2CO6B 1PZ5A 1J1PH 3MO1A 4P8UA 5IB2A 3ULUF 1MJUH 5DS8B 4M93B 2MCPL 4P5MA 5IP4A 1TFHA 3BWAB 5DO8A 4FZEH 4WEBH 4LSTH 1V0KA 4JRXE 1QACA 3CFBA 3GM8A 3SKMB 1WZAA 4UQBA 5GSRA 4NKMA 4FQXC 2HG5A 4FK9A 4QRUA 1AGEA 1Z3GH 3T3ME 3QG7L 2XFXA 3W37A 4JO3L 2Q8AH 5D5MB 1V3KA 3AC0A 5I15H 1P9MC 3FQWA 3V7AG 1J1XH 3OPZL 4JFDE 4QHMB 1UQSB 2NR6D 5C0DB 1TQSA 3O9WB 4LU5L 2K9UA 1ONQA 3ILPA 3B2UC 3PGCB 2BSSB 1WSST 1G0XA 5GRUL 1A6UH 1WZ1H 5BVPL 2BK8A 3SUWA 1ZA6A 4ZYKA 2GSIB 4HXBH 4WRLA 4IIQC 2VX4A 5HGAA 3VCLB 3RDTC 1KGWA 3IJHA 1FH7A 4X7EC 4Q6YA 1UGNA 1FBIH 4RCAA 3EO0A 1QYGH 1OWRM 3CSPA 1BVZA 1FLRH 1E28B 3O6KL 4YHZL 4JR9H 2PO6B 4IBLT 4Z5RA 2X2JA 4MWFB 5EN2B 5DT1H 2H32A 4KTDH 5ACZB 1NDMB 5IXEA 2XWDA 1MXGA 2X0YA 2R1WB 4K7PY 5CXPA 2BNUB 4QXGH 1QQDA 1TQTA 1BBDH 2R29L 1WDQA 2E9IA 1YJDC 4GRLC 4GQ9H 3MV8D 1F90L 2DYPD 5TE6L 3MLRH 5J1AB 2P42B 3QEGL 1UWUA 3VX0A 5IHRA 4DKFL 1YY9D 4JHBA 3J8F7 1EHXA 1EOKA 1OT1A 5E6IC 5BVJB 1CYGA 4Z7NF 1MVUA 5F96L 2A83A 2H3NB 4CVUA 4NGHL 2ARJB 3WH6A 4BA8A 1QFWM 1UWRA 1R3JB 1FVEA 4MD4A 4E5XB 5HYSA 1I8MA 4U1LB 1YEJH 1EBAA 2OZ4H 1UADC 4KFZC 1A6AB 5MEPB 5FYJU 2D0FA 7CGTA 3RVTC 5D7JC 5KG9B 2WBJC 1Q1JL 3SCWA 2R8SH 2IPTL 2X4PA 4TTGA 3D4ZA 3ZHDA 1KJVB 3PBGA 3V5KA 4PJFF 3ULUC 1YNLL 5DEFA 4I8DA 4UFKA 5A2IH 3U0TA 5IGXL 4JFSA 4XWGH 2F15A 3DGCR 5DUBB 1Q8MA 5K9QG 2Y06L 2DI8A 3HC4L 2B1AL 3NIFF 3LXBA 3LDBC 1UWGL 5DDHB 5E99H 5EO0B 4HFWA 4Z7UF 4KZDL 1Y0LA 1NC2D 4X6CB 2WLYA 5I1JH 4G8GA 1HZHL 1U8NA 1J8HA 4UT9L 5LCVL 4MAVA 2MMXA 2B5IC 4H20H 5EORH 4XPFH 3I02A 2FEDD 5C09E 1WPCA 5DD0L 4MCYA 1G9NH 3QEQA 4IMLB 4QHKJ 4ISVA 4FNTA 2NY0B 2DH3A 3VWKD 3DO3A 1MJ8L 4YHEA 1NEZB 3RBSA 3QNXA 4QXWA 4PSPA 5I66B 1CXLA 4LLUA 4PJ9C 1XH3B 1KG0A 4M03A 2FZ3B 4DCQB 4KK5C 4P23C 3VXOB 5IHZA 1QW9A 1KJ2B 3ZE2E 2ZSVB 1XCQB 4U2ZA 1WCGA 1S5IL 3ARGB 4Y16C 3S35L 3U6RA 4YQXL 4X80L 3FOLB 1K9FA 4L8DB 3WNPA 5I8EB 1V08A 3C6SB 3CU7A 1E70M 2OP4L 2X44D 4DAGL 1QR1A 4ODWB 5D7LD 4BJLA 3MUGB 5BRPA 5E8DL 1I9RH 3CIQA 1YEDB 4OKVA 5DRWB 5D1QD 4TVPL 3WBAA 4LAJH 1ED3A 2IQ9H 2WIMA 4RMQA 1L0PA 3W9EA 4Z18A 5I1EL 1BOGB 1N82A 4Y89A 4IMKA 3S36X 1YYML 4CDHA 4KHTL 5FECA 4OZFB 3V8OA 5BQ7B 3QHTC 3ZYOA 1YEKL 1ZLWH 4HIXH 5ADPL 2VXSH 1G9NC 4WFHD 3MRHB 5IHUH 1MXDA 4HKXB 1A1NB 4PD4J 5C9KA 4GUPA 4ODSL 3C60D 1UH2A 4S1SH 3PABA 2J8HA 1PEWA 4P9MH 5L6YL 1S7RA 4NFBA 5AAWA 1VBRA 4AL8H 3TBVA 1B90A 2E7LA 1QRNB 1PKQB 2YBRB 2FWOB 1S78D 4PRPA 4KI5F 1OB1A 5EWIL 3SKJH 3GGWA 2HJKA 2ORBH 1OARL 2ZZUT 4UZGA 1YECH 4UINL 4H88H 2MCG1 5EZLB 1CZ1A 2DQEL 4U6HB 5E9DB 3V4PL 2Q8XA 1JZ4A 1I7UA 1SEQH 2UWEB 4JN2A 2J5LB 5FM8A 1N0XL 43CAA 5J4MA 1R3IH 5K59F 1HIZA 3N1MC 5JW3H 3HMCA 4NRXA 2XWEA 4LSUL 4WWKC 3B8SA 2WMPA 3SUSA 4JFWA 3GRWA 3I85A 4PJAB 2BNQE 3VFNB 3CX5J 2YD2A 2A3CA 5FA3A 4P8XA 4BK5A 1VFFA 2EE9A 2X9WA 2XA3A 4W93A 2YD8A 4GRMB 4I5BA 2EDDA 2P4AB 3O41B 1S7SB 1EVTC 4CKVX 5ESAB 1J1OL 1FRGL 2ZCKH 3DARA 4V2BA 3W4RA 2PYFA 3UTSA 1V7NL 3LEXB 5IDIA 3L3JB 2BERA 5A2BA 4QHUA 2RAMA 4XVUC 3WHE1 1MJ7H 3KLKA 4G8IA 1MLBB 3DI2B 4K3GA 2LTQC 3M07A 4YGVA 1NLDL 1OSPL 3WFBL 2HVMA 3MZTA 1F8TL 4HUVB 4ZXBA 3ZKXB 4HGMA 3SKNA 3S34L 3DOSA 3T0VA 2DLGA 3U48A 4CJ1A 5C0FA 2JF6A 4QRPB 4XXCA 3VFTB 5E2VL 4MXQC 4RSVA 3HCVB 4L29A 3VSUA 3W0WE 5JLZB 3U9PH 1F3JA 3QUYA 4LLMA 3WE6A 3BPNB 5JDSB 2AQ2A 4X5XA 1ZJBA 1ZLSL 3T77B 4PJIB 5T1DL 4M7ZC 1CGSH 1WITA 1K6QL 3QUMB 3SE9H 3LXAA 4MJ5B 1B31A 3HNTH 2R56L 3HE7B 4YBLB 4KQ4L 4JGMA 1K4CB 1ZVSB 3QO1A 3WIHL 3B9DA 4FQ1H 2ZWZA 2ZOKB 5SX4H 1P4BL 1RUKH 3DECA 1JMZA 1TIUA 1E4IA 4P7QA 4R8WL 3VIPA 1AMYA 4YPJA 5D9NA 2DEPA 4Y4KD 2F53E 2P8PB 3WNLA 3ESVF 3CLFL 3MLUL 3AS3A 4YHKL 5T3ZD 4PJCF 4GBXC 4M8VA 3UC0H 4OF8A 5C9JB 1C8XA 1J0IA 5E0QA 3L5HA 1XGRA 2Q6WA 1DR9A 3VI4F 4Q6IA 2CETA 1HXYA 4EQ3A 5AUMB 2MPAH 1E6SM 4M5YL 4E9LA 2PWEA 2XG5A 4BCEA 1T4KA 4AW7A 1FH5H 5DT7A 1VRXA 3OGOE 1IC4H 5JXEA 3P77B 4U1SA 5A2FA 4JRXB 2R2EB 3TWCL 3OHXA 1EEQA 4L5FL 4XAWL 3U7YH 1J88A 3QULA 2NSXA 3R8BB 5BXTA 4HZLA 3L95B 3IETB 3QFJA 3VFSA 3M1BA 3D0VA 3SKOB 5GNYA 5DJDA 3WKMH 4JFDB 1OW0A 3VFGH 3VFRA 1H4PA 5ICYB 1IEAA 3VD9A 3IYLW 1HSAA 1E3XA 1ZBWA 4PS4L 3WL0A 5D7IF 2AERT 3L7EA 3LMYA 2VDRL 1TZ7A 5TH2B 3SGKA 1MREL 2VKXA 4L4TA 5JHDE 1KXTB 4NQCE 3HPJB 5EU3A 1CXHA 1B0WA 1A1OB 4UTAL 5KSBA 3MRMB 2GUYA 2YMXL 5JOFB 2XIBA 1NSNL 3RUGF 4WHYH 2HRPL 4PMDA 1DE4A 1YNKH 1CFTB 3RPIB 4J23A 1MQRA 4MA1B 1OWWA 1RZ8B 2N56A 1JRHI 1UKTA 5L2KE 5JIPA 3TEUA 2QMJA 5MERA 3LRMA 4L3EA 5C3LD 3VRLF 3GBEA 1JNDA 1OIMA 1B88A 1T5WB 3S3SA 3O8XD 3QDJD 1E40A 2C3VB 4X7TA 1UVQB 2VX6A 2GTZA 3E3QC 3BIKB 3KVQA 1EMTL 4NO2B 1X9QA 4I3GA 4JZJA 4EE9A 5F7FA 1U3HC 2HISA 1DSFH 2HRLA 2L4OA 2HJLA 3X13A 4ZFFA 2YFNA 3RL1A 4PTXA 3IU3A 1ISZA 4X99A 1CE6B 1QA9B 5KSUA 2ATPB 2CEQA 3QWOB 1U8OA 5J8OA 1QI3A 1IAMA 2UZIL 3DX7B 4UIMB 4W4NA 3GSUA 5E2JA 2BC4A 3EDJA 1RZJH 3IT8D 5HDQH 1UZ1A 3EO1B 4P99A 2CMRH 5J6GB 3T2NL 5IT2L 1XF3B 1NWSA 3D2UA 1RK1B 4AD5A 4QOKA 4ETYA 3SCRA 1LWJA 1YEGL 4WNQB 3F65A 4PSRA 5D9OA 3X11A 1QI4A 2EDJA 4JPWH 3JVGC 2CIIA 2VITA 2PXYA 4KUZH 4M61B 3QJFA 1IAII 2WVSA 1HT6A 3VDBA 3I9GL 3RWCA 4R90H 1OAKL 4P7OA 4V1DD 1RHHA 3RGVD 2YBUA 3OKOA 4OQTH 1BQSA 3UPRA 2VLMD 3MRLB 1HHIA 5I6XB 4XWOC 1X44A 3T3PF 3O3BA 3H3PH 3GSQB 1SJVA 3BQUD 3P0VL 3QUXB 4YXLL 4F7PA 1KEML 4MCZB 1RUQL 5DC9B 4Y2DD 4ZS6D 4HZ6A 3MV8E 1AVAA 4WHDA 5BV7B 3AB0C 3Q6FA 3PP3K 2YA1A 4CN4A 4Z7VF 5C09B 3QIBA 4HWBL 4U1NB 4HS8H 4LCWB 1XCXA 3LMJH 4LDLB 3EJQA 3EYUH 1VB9A 3LEYL 1C8QA 1Y7VA 4TUFA 1CK0L 2VC2L 2GK1B 3STZB 1NANH 2B8OT 1JGIA 4OJYA 5BW7C 1A0QL 1U8PB 2OI9B 4KVCL 3OA5A 3BD5A 4Z78A 1D6EB 2VDLH 4Q9RH 3NCYP 3L5XL 1OLLA 3ARFB 3L3IA 5DJZB 2W1NA 5E08H 1V6YA 3LN9A 3SCMD 2JIWA 3CBWA 1HQRA 4O58L 2GJRA 1ITXA 4YDJA 3BYYA 4ERSH 1F02I 4MYWB 1I8KB 4HKJA 1H0DA 3IDYB 4LDOB 3DX2A 1R8LA 4WW2B 3G5YA 5I24A 3TO2A 1YZZA 4OCNC 2WZPD 4APQC 2XHYA 4OFPA 5JBDA 3LKOB 1MHEA 1QI0A 4RFNC 3WIHA 3W25A 1PG7X 1I7RB 1R5IB 1QLEL 1M7IB 3TGXA 1FE8H 2OXGA 3BKMH 5C2UB 2WCAA 4JHWH 4K94L 3FQUA 3F58L 4JN1L 1IM9D 2AK1L 3P11L 4HAFA 5HYQA 4UOQA 5DI8B 1BBJA 4WI4A 3O11A 3L3GB 4HG4K 2FL5B 2APXA 4X98B 4ACPA 4LQFL 1SYSA 1NGQH 3X3FL 4NRZA 4LNRA 4WKHA 3T0AA 4GLRI 3S37X 3QI9C 4HBCH 4UNTA 1T04A 4P3DB 5IM7B 3C08H 3D18A 2AJXH 3AXIA 3QCUH 2VUYA 1NDGB 4BSVA 5L8LB 4FFYL 5DC0A 5KVEH 1NMAL 4KKBD 2V2XB 4U3XA 4H25A 5D7LE 3FQXB 4EDXA 1AQHA 2ED8A 3QPXH 5FO7B 4TNVK 1KTDA 1MRFL 4WW1A 4Z2KA 3SUTA 1RJLA 4AEHL 4NQVB 5IESL 3TH2T 4LXFA 2R0KL 3GSWB 3JV6B 1EOMA 4PG9A 2BNQB 4NQXB 3SDXF 2Z31B 1KULA 1HNGA 4OUUB 2FECL 3BCFA 2IQAB 3SOBH 3GIVB 3SDAD 4WV1B 1KN2H 1MHCA 2NYYD 4CCDA 2BVUA 1NMCC 4GQQA 3V95A 5CJXC 4ODXA 5CCKL 3DTXA 4FMVA 5JIIA 2PR4L 1CVSC 4ZUUB 3WN5C 3P0YL 4WFHE 3W53A 1OOAA 4XPAL 3OZPA 1WUNT 5GGRA 3S96A 5IKCA 4U6XA 4PJ8D 1NBQA 1H3PL 4C4KT 4EVNB 4R7NB 1A7NH 4O2CB 4E41D 2WV3A 3O3DB 3OKKA 1G7IA 3IDMB 4M3JA 1DFBL 1AGBB 1F6AB 2XN9A 3LS5L 3GMNA 2VWEE 4RGNC 4NM4H 1E27B 1JV5A 1TA3A 4QEGA 2IAMC 5LAXB 1QSVA 3OAUH 1CTNA 2YZ1A 1CFQA 3AXLB 2AJUH 5D7SH 3O2DA 3D39D 3SQOL 3CXDH 4BQ6A 4OCRL 3N18A 3F5KA 4AC1X 1NEZG 4IM8A 2IANA 3HE6A 1KELH 3I6LD 4GI9A 4CNIA 3WL1A 1DLFH 3V6FA 1MQ8A 1KCUL 3SCUA 1OGAD 4I77L 4MLIA 1VA9A 3FO0L 3LPOA 3AIRA 1SVZA 3BZEB 1XCTB 3O45A 8FABA 4HXAL 2RIKA 2O92A 1IQWH 4K8RH 3SCQA 4MJID 2BY1A 5C86A 3WS3A 5JMOC 1AI1H 5C0BD 4HQQH 2VQUA 3LN5A 3QHZL 3U30B 4XCEB 1EDTA 2PC8A 3MPCA 1U2HA 3QUKB 2NY4B 5CJQL 1EFXA 5FYKH 2OR9L 4O51B 5C6TH 2AEQH 1FZOA 2VSDA 3D25B 3ULSA 4W86A 5C0CA 1HHGB 5GGVH 4QHLB 5HPMB 2DQJH 3SY0A 2CLRB 3K80A 3NDYA 4OZFG 5GS0H 2VRKA 1WE5A 1KJ2L 3JWOL 5IMKB 3CVHH 1SYTA 3BC9A 3VJ6B 4YDKL 4ZUSB 1GORA 4GAJH 3B9KD 3GJEB 1UYWL 4WO4B 1G0YR 3WDIA 3O3EB 2C26A 2X8RA 4GSDH 5TE4L 3VFPB 3S88L 3AQUA 1ADQL 1ZWIA 3IFLH 1INDH 1NCAH 2PWDA 4A4AA 5KW9H 1OGGA 1MYRA 4PRIA 2AW2A 3V0AC 4G6MH 3BHBA 5EZOL 2JCCE 1PYWA 4K8RC 5JHLH 5A8MA 3EO9L 2HLAA 2DLFL 4ZAKA 3ZSTA 4OZGA 3B5GA 3T0ED 4LL9A 5JHDB 4OD1H 4NQCB 5E8NA 4O2EB 1SEBA 2Q7YA 3DVGA 5IOPA 4TUKL 1OBAA 2G8ZA 1OTTD 1MCOH 3W11D 3TIEA 4F8QA 5T3ZE 2IBBA 2EIEA 3ZQ9A 3TNNB 4RE2A 1OP3K 3U0PB 3N9KA 4H1LB 4EI5D 3O6LL 4YHNA 4ZOAA 2IGTA 2R1YA 3K1KC 1KGUA 5EU5A 5L2KB 1LQ0A 1KBGL 4RNRB 5JW4R 2MKLC 5I16B 1E43A 1FVDB 3ECQA 4JAMA 1S3KL 1WEJH 1MFAH 2LVCA 2FE0A 1BQHG 3DUUB 1C08A 2OK0L 1W0VB 4TSBH 1I9EA 4QAWA 3SKMA 4U3AA 3BJ91 4LVNB 1W72H 3SE4C 2Z1KA 1E6JH 1T03H 3UAJC 4JREC 2D73A 3EJZD 3ULVL 1KIPA 5D1XD 4ZO8A 2DGAA 2JIXD 3HC3L 3NCOA 2APTA 4ACZB 1L9MA 1RK0B 1OGTB 3G5ZA 4XMLH 2ZKHL 4KTEL 3NFPA 4L9DA 5C0DA 2JJVA 1ORSB 3PGCA 3DV4B 4H26A 2BSSA 4QHKI 1IT9L 1ZBVA 3QJHB 4P2QB 3HKFA 3MLYH 4Y4HC 3THMH 3WD1A 3C8HA 2V5SA 4KMLB 3UYPA 1Q94B 4X7CC 2IMMA 4HCRA 3WFDL 5I73C 2O5YL 1JHTA 3H9HB 4IISA 3SCOA 1ZANH 5E8PB 4DWSC 1CXKA 1F4HA 3RAJL 1GZJA 2MOVA 3QO0A 2MWCA 4OI7A 2PO6A 1VEPA 4BQ9A 2BY3A 3VGAB 2VZ3A 1E6ZA 1TNMA 2LU4A 5JZ7D 3P9MB 5EN2A 5I74C 3U79A 5ACZA 4M1CD 2QQKH 4NN7B 2LU7A 3TA3D 1FORL 2R1WA 4JFTA 1REIA 4LSQL 1FNEB 1I3RB 3WUFA 1UQYA 1M71A 2XIIA 1PBGA 3EOYG 3MV8B 2DYPB 3K2UH 3QWRD 3PWPD 4DEPC 3E6FB 4ODUB 4ELMA 5J1AA 5L7XH 4PJHA 2BDNL 3QUML 4GAGH 5BVJA 4KDTA 4B16A 5J1SC 4IRJC 4LBEB 2DQIH 5GGVY 5JW5B 1UA6L 2XVPA 1R3JA 5DGQA 3BAIA 4U1LA 3BDYL 4AZCB 5MEPA 1A6AA 1JXKA 2X1XR 3KPSA 2XFYA 1HEZB 5KG9A 3UYOD 1VJSA 1MPAL 4ZNCD 3LHPL 3QQ3B 3DX3A 4AMXA 4PJ7E 5JR1L 3NZHH 4I18A 3REVA 4V1DE 4ODBD 2ZXAA 4OZHE 3WIIH 1CR9H 2FX8H 3IDIB 3HI1A 4NRSA 5D8WA 3MRJA 2VLME 3IGAB 3VGBA 4MDIB 4U1GB 1A3LH 3RZCD 2OR7A 3PWLB 1IBGL 4UQAA 1BVNP 2ZUQC 1CLZL 5I8CB 5DDHA 2BOCB 5EO0A 4D3CH 1KQYA 5I79A 4N0YL 4RWYH 2ZXDA 4X6CA 1NP0A 1W32A 2ADIB 3VXUE 3WS6C 3CZFA 1GC1L 2ED9A 1RUPL 4RFOH 1ZL1A 1KC5L 1W2VA 2ZUSA 1MHHB 4Y5YA 1BVKB 1N6VA 4JRYD 4CD4A 1E1EA 3VWKB 4YHOH 4LVHB 5CEYB 1KPRA 1NEZA 2X5PA 5IK3B 3MXWL 5I66A 1BGGA 2QADB 4HS3B 3TBYB 4FQXD 2FZ3A 2XI9A 2WVUA 3TH3T 4XB3A 1H8OA 3VRIB 3VXOA 1KXVA 4MB3A 4DZ8B 1R33A 3OXSB 1XCQA 1JZ2A 1GCFA 4MXWH 3I2CH 4G9FD 4U1MB 3ARGA 4ATWA 1A2YB 4L8DA 3QG6B 2XWTB 5DJCB 1HCVA 5GRWA 4XC1H 3L3HB 3K1DA 5D2LE 1UWXK 3EUUA 3KPLB 4QCIB 2B7DT 2DLIA 3AZRA 5D7LB 3B2UD 4K3EL 5CSBA 3MUGA 1ADQA 1ZTXH 3GJFB 4DGYL 3VXSA 3AHTA 1CBVH 5DRWA 1IC5L 5DD6A 4YE4H 1FSKC 4LLDB 1VIWA 4M1GH 2DLEA 1R5VB 3DX4A 1WCQA 2E9WA 1KACB 4PJ5B 4LSVL 4G6AC 4ZTPH 2WK2A 3PF2A 3NPZB 4PV9A 4BH8B 4LYQA 3C09C 4MMZC 5AC5A 1KTLA 2NX5D 4OZFA 3RX7A 2E0PA 4XXDA 4KJPD 2VE6A 5I18H 3KR3L 4NHCH 5KVDH 4UUJB 5GGQH 3AREC 3AAZB 3PQYD 4HIJB 1A1NA 1LO0H 1N5AB 3GSNB 4HKXA 4F2MB 1T0PB 3NFNB 3T8XB 4MA7H 3C60B 2WC7A 2AEPH 4NC1C 4U0RC 3TV3H 3TCLB 1RJYB 1U30A 2WC3A 1BM3L 1QRNA 2FWOA 4G7VH 4QYOB 2VXUH 2VISA 4GRLD 5IIEB 2NY3C 4PREB 4UIKH 2MQ0A 4RQQB 1IGCH 3STLB 3TNMA 1W9XA 5DJXB 3K4AA 3ZJ7A 1F5WA 4U6HA 4X6EA 2DQHL 1X5YA 5B22A 5E70A 4P2OC 5E6ID 1T66D 5TE7L 5IEHB 1QW8A 1QOKA 4S1RL 3DMMA 3BP7B 1NUNB 2BHZA 4OV5B 4K07A 4AG4H 1F11A 3GO1L 3VIIA 3AIWA 3VIMA 3BUYA 3T0XA 4DUWA 3IAGC 4KJQC 3PZIA 4PJAA 3F8UB 4HX1A 2XA8L 3RVTD 5EC1B 5D7JD 1XFPA 2X9YA 2P8LB 1TZGH 2GYSA 2WBJD 5JOEA 4GRMA 4S0SD 4LCYB 2HTLC 1EAPA 3O41A 3RPKA 3FN9A 4D9LH 4QO1A 4TUJA 3K4DA 1BQHA 5M5DA 4K2UL 3N85L 2A74B 5B39B 3S36L 5ABHA 3LEXA 5M7QA 3L3JA 1NGZB 3A3HA 5BV7L 3MOAL 1IFHH 3GBDA 1TPXB 4FFVC 4YHLL 1I9IL 3QAZC 1G9ML 1WBXB 2CR6A 1ZHBB 4M3KB 3C5ZB 3B9EA 4L4JA 3BKCH 2TAAA 4OCWH 4E41E 4UQ2B 5J3HC 4DGIL 4KZEL 3HAEG 1ODUA 4JM2C 4OGXH 1BG4A 3IFNL 3VFTA 4X6DB 3QDGD 3U0WL 3VFOB 4UV7L 3FRPA 5I2IB 1E5JA 3CVIH 1UZ6E 1ZBCA 3ECBA 3D39E 1VCAA 1CECA 2DPEA 3OGCA 4PJ9D 1YEFH 2E6JA 3QUMA 1DQMH 4KK5D 4GI8A 3VNZA 3OR7B 3I6LE 4P23D 4XP4H 2G2RB 3IB4A 4DVRL 3S3JA 1CLCA 1HOCA 4XVJH 2ZX8A 1KN4H 1A3RH 2P47B 1DHKA 1OGAE 3T1FA 3VSVA 1K4CA 3JWNC 5LBSH 3O6FC 1K9DA 1R7OA 4YBQC 3FAWA 2C1OA 1DWHM 4Y16D 1RIHH 3VO0A 2ZOKA 5D6CA 3X12A 4MJIE 1E4WH 3EDDA 5C0BE 1LL4A 5TJWK 1UR2A 3TYGH 1CLVA 4NWTH 4U7MA 1O7AA 2EPKX 2AQ3A 3HS0B 2K3TA 1RIUH 4IPNB 3GSVB 2QSTA 2OYMA 2PI6A 1UR1A 3KLSA 2P44B 3QP3A 5AEAA 3SJVD 3BXWA 2FATH 3GKZA 2BVTA 3H9ZA 5HJ3B 3IFOB 5AUMA 3N11A 3U4BH 4JLRB 2WUCH 4HWEH 5K9QI 3MLVL 3WY3A 2OS7A 3P77A 3ZZ1A 3JUZA 1WP6A 2R4RH 3CXHJ 3MYJA 2PYED 1ZGLA 3C5SB 1J18A 4HF5L 4N0RA 4GXVL 5HHXL 3MANA 2AXGB 4WUKH 1GRWA 4LEOA 2AOSA 3VD5A 1X5LA 5SWSB 5HD8D 3SKOA 4OOUA 1CICA 1HHHB 4JFDA 3PHOB 1CPUA 4AMKH 4EQ2A 5ICYA 4WUUB 1V7MH 4GIAA 2AJZB 4HU0A 3ES6A 4NI3A 1V03A 2VDKH 4H8WL 4EANA 1UG6A 5I1IH 5ISZA 4PLJC 3T0EE 4KTYA 4F37F 3MV7A 7TAAA 1E4MM 3NH7H 3MRMA 1UKQA 1VENA 5JOFA 4WWKD 3PV7A 5DD5L 4R0LC 4BQCA 3EYVB 3C2SA 2AKRB 2J4WH 3WHXB 4NDMB 1JD7A 1JWUB 1T89C 4DQOH 3L2MA 1RZ8A 1JRHH 3I6GA 1A6TA 3QDMA 1I8IB 5J6HB 5F88B 3PTKA 1UEYA 2FYYB 2Y6SC 3CH8A 1KSRA 2J7HA 1BZ7A 1GOFA 1IAKA 3BE1H 3O8XB 4KDVA 3CZ8A 3N15A 4XVUD 5HHNA 5SWZD 4B41A 4NO2A 1F4YH 3O2WL 1U58B 2BNRA 1IZJA 3QXTA 4U6YB 4KC3B 4IRSC 2G41A 2AI0H 2IFGA 3NPSC 4F7MB 5I1AA 1XYFA 3TPKA 2YD1A 2X4UB 2YD6A 1KR1A 1LEIB 3KJ6H 3PL6C 3Q5OA 4PMZA 4FQIL 5CHNB 2YDSA 1BIIB 1GZPB 3DX7A 2XQYG 4UIMA 5F6HJ 3RU8H 3EFFB 3RILA 3NA9L 2X6MA 3ZIZA 1D5XB 4DJMA 4ONHB 3GBNL 5J6GA 1XF3A 1VGKA 1RK1A 2P5WD 3KHOA 1E9LA 3F6IA 2EDWA 1FDLL 1P2CB 3GH5A 4UR9A 5FIPA 1QPXA 4NCC2 4M61A 1IAIH 2Y5EA 4GH7B 1WT5A 1Z9SA 3BSZH 3CFEB 2YK1L 3S4SB 2HAZA 4PJ7B 4S0TD 4OCYH 2O61B 4HIHB 4KY1H 3RGVB 1JD9A 4OZHB 2FDMA 5DTFB 1S7QB 1ZT4B 4KGJA 3H54A 5D2NE 3TIDA 2D7QA 3AIEA 2DMKA 1DLHA 5L2JB 1F97A 2IXVA 3QUXA 4GBXD 1I3VA 2AGJH 3BUBA 4X0KB 5ID1B 5IMMB 4Y2DB 1KT2B 4H1LG 3VXUB 1P4LA 3L3KB 3PWPE 4GMTH 5C09A 1T5XA 5I30H 4U1NA 4LCWA 4TN9A 4X4XA 3BSGA 2QEJA 1VFAA 3HPLB 1UXWA 4Z7QF 4HMEA 3MUZ1 3BAXA 2VIRB 4JDVB 3SDXB 1EHLH 2GK1A 2VDPL 5IFTA 1G1CA 5EBLA 2E8ZA 5LQBL 2YR3A 2IBGA 1D6EA 2OJZL 5DLMH 3RIFF 2ZCHL 5AZ2L 4JKPL 1CFVH 2BY0A 1A7RH 1FO0A 1XR8A 2ICES 5D71H 5ACMA 3SCMB 5C0NC 5H2BA 2PKDA 2RR3A 4BUHA 1GQJA 1UKSA 1CCZA 2VRQA 4L3CB 5IB1B 1NUDA 3H55A 4Y1AA 3MOBL 4TVSa 3QHFH 2D22A 4WTXA 4GW4A 5A8OA 4ONFH 2GJXA 3WD2A 1CF8L 3KYKH 1XF4B 4OCXL 2DJSA 3GXPA 1I7RA 3MRPB 1MSPA 1R5IA 2E9MA 2V7HB 4FXKB 1M7IA 3RY6A 2NY1C 4TPRH 2NY2B 1W8NA 3CFCL 1QEWB 5DK0B 3KYAA 3MBXL 1IM9B 1LNUB 1H3TA 5AYQA 5AZEH 5CBEB 2D4DA 1BPVA 1B4RA 2AJSL 3BT2H 3L3GA 4YN5A 1YA5A 4X98A 4XHJC 3H8NA 3A4XA 4PMUA 4AZ8A 4JRYE 5L88L 4IUGA 1PG7W 5DQ9A 5EBMB 1LWRA 2IBZY 3TO4B 4OM1H 4UILL 4GLRH 4M48H 3IRZA 3I3EA 3QUZD 3EGSA 5EFIB 4YFLI 3I3DA 2ZUNA 2HT2C 4OCMC 4MJ6A 1QSZA 1U3HD 2ITCA 4NNYB 3WSQH 5BYWA 1HJSA 4P3DA 5AYUL 3WQ8A 3WJLC 1DEEB 1LK2A 4G9FE 3DETC 2FH8A 3SCTA 1MCPL 3KPMA 3RL2B 2NXYC 4P7LA 1ZLUK 4IIQA 4P2RD 3FQXA 3A6BL 2E27L 5CIPB 1C5DB 4K7PX 5DK3A 3MLTB 5B38G 4D0DA 3LKRB 4G6FD 5D72H 5F7LB 2EAEA 2Z9TA 4S1QH 5GGTH 1ZT7B 1UR8A 4L9LA 2ICEB 4OUUA 4EOWH 2IQAA 4Z7OF 1KCSH 1PG7L 4TSCH 4WV1A 4F7TA 3HMWL 4LOUC 7A3HA 2Y8VA 1JG9A 1MCFA 2ZOLB 4ZUUA 4YHPA 1GJWA 3HUJE 2A0LC 3PQYE 3RJQB 1NWRA 5DUPL 1DWFM 1TR1A 2ATKA 4YUEL 4Y7MA 5DHVB 1Q9WB 1TVHB 4AZ6A 4QNPE 4O2CA 1BAFL 1UKPA 2FHFA 1K4DB 3O3DA 4E41B 3TN0C 3KYNB 1D3CA 2AV1B 3RX5A 1HWWA 4YHML 1NH6A 4HWNA 4KV5F 1SM3L 2CK0H 3S37L 1QFWI 2VMFA 2DWDB 5A69A 3VGFA 1E27A 5IFHL 1CD0A 5LAXA 4ZG1A 5DJ0B 1RQ5A 1TQBB 3AXLA 1JE6A 1TZHB 3UJTL 4PJEF 2R4SL 3I3BA 4A3HA 2DQDH 5TDNB 2P46B 3BP6B 3IS0X 3D39B 2FD6L 1OAYL 4NZRH 4EBQH 1RUAL 2M1KA 3VILA 4NNPL 1XGUA 2IG2L 1CZ8H 3VFVA 4HEPG 1XGTA 3ZO9A 1J86A 1I1XA 4ZXOA 3BZDA 4AZIA 2C9AA 4Z95H 2MKWA 5E1AB 1MWOA 4D72A 4JVUA 2DJUA 4LNVA 2UZXB 3BZEA 2DM4A 1XHGA 4JO2L 4BUGA 2YL6A 3SCVA 1JGVH 1WC7B 1T20B 3OWEA 1R5WA 4APQD 2D03H 4XCEA 3L3OB 4CL7A 4OIFA 1QKZL 3MMEA 1JGEB 2WUBH 1E6NA 1A7OH 4J6RL 2R1XB 3SGDI 3EOBA 4FQQB 3D25A 3F7YB 4JVPA 3RMEA 1HHGA 4Q0XL 2GHWB 4QHLA 5I0DA 5HPMA 1WBZA 1DDHA 4UNIA 5DYOA 2AABH 2CLRA 4U1KB 2ESVA 1ZA3B 2NNAB 1L9NA 5CKGA 1PJ9A 4AEIL 3QDGE 2YS4A 2Q3AA 1BFTA 2VERN 4R7DB 3ZLQC 2FJGB 3MCLH 3PNWB 3QXAB 5J9PA 5E09A 2KL6A 4S10A 5AC4A 3GJEA 1SFSA 3B9KB 3UESA 4WO4A 4JFOA 3CK0H 3O3EA 5F7HA 1T1WB 1FOBA 1QWNA 3F62A 3ILQC 4B5EA 5B8CC 4UCFA 4YZFE 4EN3A 5SWQB 4PTWA 4NWUH 3EMZA 43C9B 2X1OA 4LLQB 3QI9D 2O5XL 1AXSA 2LVEA 1PKOA 1E0WA 4NCDA 5DFWH 3KPOB 3BPLC 3NCCB 3VMNA 2X4NB 3L4ZA 1EEYB 2XN2A 3BH4A 3T0EB 3HG3A 3DX8B 4O2EA 1UJTA 1D5IL 4GMSH 2GJ6D 4Z0BL 3TESA 3QDAA 3P3YA 5I1DB 5GIRB 2WMJA 3WY2A 3WQ4A 1BYDA 3TTSA 4FABH 2A77H 1FGVL 3AM8C 5AWNL 3TNNA 1C7TA 1SJHB 4H1LA 4LSRH 3QRFM 1DQQB 3B83A 2QHLA 4PUBH 3SJVE 4OT1H 4FLOA 4PJDF 5C0RH 3MJ7B 4I0KA 3SUVA 3R0MA 3MRQB 3LKNB 1U3JA 3WYRA 4QTHB 1MRCL 2D3VA 1XGPB 3SO3C 1SJXA 1W0VA 1TVDA 5FUOH 2B1HL 4OGYL 2PYEE 2J12B 1UM5H 4R4FL 3HI6L 4AQOA 4UQ3A 2HJFB 3SURA 4LMQE 1PY9A 2NXZC 4WU5A 5E2UH 4AD0A 1IILE 4J3WA 5D1XB 4ACZA 2YN5A 1C5CL 1OGTA 1Z9MA 4RGND 3AI0A 2EZ0C 1ORSA 2IAMD 4QDMA 4ZFMA 4PJFE 5J0BA 5T1LA 3BGMB 5KSVB 4P2QA 3AY4A 4R96B 3S5ZA 1R6VA 4NZCA 4JFUA 1G5AA 1TENA 2EEDA 4TQEL 3EKCA 1Q94A 1QP1A 4CVZA 5E4EC 4TRPL 1TVPA 2DD8H 2FJHB 1XGYL 3H9HA 4QF1B 3O3UN 1BOYA 4Z7UE 5J11C 2WQRA 5E8PA 5IHLB 3WELA 5BXRA 2R69L 5BO1H 1TZIA 3UEZA 2X2YA 2DQGL 2AJ3B 4LCUB 1CGTA 2AJVH 5D2NB 5IR1B 3OKEA 4HJJH 1F4XH 3TA3B 4OV6F 5C8BB 5F7NC 4K3JH 5SWZE 5ACLA 4FP8H 3V5HB 5CEZH 3GMMB 4JE4B 5I1CL 5H37H 5B3JF 1SY6A 3L1OL 2DRUA 1O6IA 3LAFA 4R26L 5IW1B 2R0ZL 4ODUA 3PWPB 3Q3GB 2W62A 2G5RA 2GI7A 1GGBL 3RI5K 3WNKA 2XZQL 4LBEA 1QBMH 5IQ9B 3RNKB 2J8UE 4WTZG 1LP9F 2W4XA 3RKPA 3P4NB 1FZJA 3DX6A 4KMQA 5IQ7L 1HEZA 3HR6A 3K7UA 2X1IA 3QQ4B 4K23H 4HH9B 4RA0C 5DJ2B 5DUMH 2ICWB 3ISWA 5T3ZL 4DZBA 1F6LL 3D51A 1U2YA 4R2GC 4YH6A 4H8HA 1RUMH 4K8RD 1U9KA 3TT1L 3ALWA 4WWID 1RIVL 5ESQB 3IDIA 4OSUL 4KRTA 3IS1X 3LKPB 3IGAA 4MDIA 5BOZG 3C9NB 3D85D 3DRTB 3PWLA 3RZCB 3QH3B 5HHOD 4F33A 1PSKH 5KSAA 2BOCA 1RZKC 1AQ0A 1WFUA 6FABH 1QG3A 2ADIA 5FYKD 4D0CB 3TJEH 2WWKO 1CDJA 4I0PD 2CUMA 1JGUL 3O2VH 2EH8L 1JWSA 2OQJB 4HPYH 4UFMA 3RM8A 5IB3B 1BVKA 4IEFB 5HVHB 5GS0D 1MFEL 2I9TB 1XAUA 4JRYB 3H6JA 4NZUH 1CDBA 4QY8A 5J12B 1QTYT 5DZNA 3TBYA 3G6JE 4P5TA 1GYAA 1KYOK 1OQOA 3AMKA 5A3ID 4GKNA 4FQXB 3VRIA 4MGXA 3OXSA 3UAJD 1OM3H 4W6YB 2BHUA 4GG6F 4G6KH 4EIGB 2XQYK 4U1MA 1DANT 4G9FB 1A2YA 1HXJA 5KJRL 1NOWA 3EJPA 1ZHNA 1R24B 5ILTL 1FPTL 4QCIA 1BYAA 5F3HA 5GS1A 4LX4A 3N9GL 2F7OA 2J6EL 1LILA 3GJFA 1HH6A 5H8DA 4ALAL 1LWHA 5KAQF 2NY7L 1MWAB 4OZIE 1QFUL 4PIRF 4DN3L 1UR0A 2A9NH 2NY5L 4EDWL 1N4XL 2R2BB 3QSKB 5D8JL 4PJ5A 4MNHB 4JFFA 2BVEA 1MHPH 1DWAM 1G6VK 1CS6A 1W9PA 3WDPP 2CQVA 4N0UE 4DWSD 4DM1A 5IFAL 3Q6GH 1GHFL 4ONGH 5I75C 3G08B 4JM4L 3B2VH 3IXAB 4XBPA 5DURD 4M56A 3WMCA 3AAZA 5C7XL 3BUDA 3HUJB 2I9LB 4HIJA 1TLKA 3GSNA 3PQYB 4G6JL 4KJYA 1R3LB 1MW2A 3GRWH 3C60A 4H0GA 1QI5A 4LU5H 2NTFA 1S9YB 1RJYA 3IDNB 2VAAB 1K8DB 3E3QE 5ICZA 1FFPA 2H9GB 4IMKC 3PWUB 5CPTA 1JTPA 5F9AC 1TVNA 4JCMA 4M6ML 5EOCL 2X2IA 4X6FB 1CU4H 5IIEA 1KLUB 4GRLB 3H53A 5MP6L 3VMPA 1W9UA 4URIA 1IKFH 1IGIL 3FTGB 1A7BA 4AD4A 5IEHA 5E6IB 4IRJD 3E8UL 3ZKQD 3BP7A 4JJHA 3WXVL 3BW9B 4XC3L 3EMQA 4P2RE 4LLYB 3MRRB 4HWZA 4XCYA 4OV5A 5MEND 3HG4A 1KTBA 4G42B 2E7LC 1IC7H 1FN4B 4PRHB 2YC1B 3V79C 3MR9A 4PJCE 1HE7A 1R86A 5EC1A 2P8LA 2VURA 4GAYB 1MEXH 4UZUA 2WBJB 4LCYA 4NPYA 2CRIA 4NT6A 3I50L 2V7NA 5EU7E 3TTYA 4I2XE 2HFFA 5B39A 2RGSA 1NGZA 2FIRT 4N8CH 4XUYA 4G8EB 3UBXB 1H3UA 2ZCLL 3AMLA 1LVEA 2H2PD 3BRDA 4RE4A 3AZSA 4YXHH 2YKLL 2VXTL 2RBLA 1ZLWK 1AO7D 3C5ZA 2NW2B 3LDBB 1QNQA 3MNWB 3BGFC 5D7IA 3JBG7 2DSWA 3HR5B 3QYCA 3BKYL 2DDQL 3TVMD 1QR4A 1OF2A 3G04B 2WHKA 2GITB 3DI3B 5JNYA 5E1HB 4X6DA 1J11A 1GCYA 3OKMA 1RURL 1JGDA 3VFOA 3GK8H 4MD5B 2P45B 5CG0A 2A6KB 5CBAB 1FJ1B 4LGRB 5KSBF 5I1HL 1JGLH 2JB5H 4M7LH 1YNLH 2F74B 1V0LA 1LG2A 5SV3A 1FNGB 3GHEH 4JY5H 4PJ9B 1X5ZA 2FIKB 4ZXBC 3OR7A 2EDBA 4MDJB 1B0RA 3M17B 1M6OA 3RUGE 2ZXQA 3MLSH 3O0RL 4XXCC 3FT2B 2CRYA 3QQ9C 3DSFH 4MXVE 1I1AB 4Y16B 5ECUA 4DN4L 1HYRC 4LRIA 4R4BB 3QUYC 1HZHH 1XYZA 2PTTB 3VRLE 3D5HA 3WENA 4C56D 5F6HI 2Y5TB 4B9ZA 3RHWF 2I60H 1AQMA 4RZCB 4UQ9A 1TITA 1OINA 3ZHLA 5TFSL 3HU7A 1HKFA 1MJ8H 2B4CH 2YLLA 5D1ZB 1A4KB 1F00I 1KOAA 2XWBB 4G6AD 3SJVB 3DGGB 4YWGH 4PCTA 3U1SL 4P46B 3V4VL 3IFOA 1AGCB 1KLGB 3G5XB 5HDOA 3H0TB 3ARED 1Q0XH 4OGAC 1X6LA 1U8IA 2BFVH 1YYLH 1DVFB 2PYEB 3WQVA