3K8MA

Crystal structure of susg with acarbose
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
650
structure length
650
Chain Sequence
b'QWTALTASPDTWDETKRADISYQLLLYSFADSDGDGYGDLNGVTQKLDYLNQLGVKALWLSPIHPCMSYHGYDVTDYTKVNPQLGTESDFDRLVTEAHNRGIKIYLDYVMNHTGTAHPWFTEASSSSESPYRNYYSFSEDPKTDIAAGKIAMITQEGAAGYNAAEWFQVSDETAAVKGLLKFTLDWSNAPSPILVVSTGTKADEDNPDTGTDNAKYLYYGEDICKKFYDKGNNIYELTVDFESTWGLLIRTSNASFWPSGTKYGASSSSEKLALNKDFKLTNAGNPANIMFDSQQITYFHSHFCTDWFADLNYGPVDQAGESPAYQAIADAAKGWIARGVDGLRLDAVKHIYHSETSEENPRFLKMFYEDMNAYYKQKGHTDDFYMIGEVLSEYDKVAPYYKGLPALFEFSFWYRLEWGINNSTGCYFAKDILSYQQKYANYRSDYIEATKLSNHDEDRTSSKLGKSADKCKLAAAVLLTSAGHPYIYYGEELGLYGTKDNGDEYVRSPMLWGDSYTTNYTDKTDATVSKNVKTVADQQADTHSLLNIYFSLTRLRNTYPALAEGNMTKHSVYNESQEKDYKPIAAWYMTKDNEKLLVIHNFGGTAMQLPLTDKIEKVLFVNGETQQNTDSDSYTLKLGGYASVVFKLGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, susG
publication title SusG: A Unique Cell-Membrane-Associated alpha-Amylase from a Prominent Human Gut Symbiont Targets Complex Starch Molecules.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Membrane protein
total genus 187
structure length 650
sequence length 650
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k8mA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3k8mA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k8mA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3k8mA03
1H15A 1YNTA 2EYRB 4P2CG 3ZKQD 1A0QH 4F9DA 3MJ9H 3HNVL 1EGJL 4I3RL 1E4XL 1BIIB 4JRXD 4NIKB 1HTYA 2AKRA 1JZ7A 3V4UH 4G8FB 3K2MC 2EDXA 3WXWH 4XCCH 2HG5A 4LKXA 5IROC 4Z2JA 3QT2A 5HI3D 2IXUA 1T20B 1NEUA 1DE4B 5D1XB 4M8QA 4HIXL 1AE6L 1YC7A 4JQIH 5IP4A 5F9OL 1CZ1A 1IVLA 3FRUB 1X5IA 2VZTA 1HJWA 1P2CB 3PWPE 1IGFH 1OGSA 2ZSWA 2Y6SD 3VXUE 2VIRB 2DDQH 4I2XA 4X98A 2CMRH 2UWEB 3C2SA 3VWKA 4DUWA 4P59H 1HILB 3NA9H 3PQYA 3SIMA 1RAMA 1RP8A 3VFTB 1L9MA 5D96C 1FH8A 4PV9A 1ETZA 5AZ2H 4DN3H 1ZT4B 5ALBH 4R27A 3PWUA 5L2KA 3CSYA 5IHBA 1QI2A 1DQQB 3L4TA 1BJMA 1FFOA 5BXFB 3B4NA 2J7GA 4QY8B 3U7VA 2W66A 4FQPA 1O7DC 1BZ7B 4ODHH 2D03H 4PMQA 3DRTA 4XNZC 3AOFA 3B8SA 1XCWA 4M00A 4RMTA 2DQFA 4ZPTB 1RH9A 1YDPB 5IR1A 4CL7A 1S78C 3T2NH 4W85A 3QUKB 3VIPA 1NBYA 5IFPA 3F58L 1YQ2A 3REVA 2J8OA 4P8VA 3CH9A 1QRNB 4B7LA 4MA1C 4D0BA 3QIWA 3RX5A 2DQEL 1N5YH 1I75A 4FZEH 5D1ZC 2JB6A 5K33A 4FMVA 3UESA 1QSFB 4NP4H 5GGUB 1XH3A 1CICB 1XF1A 2GT9A 4L4VE 5F89A 3BZEB 2NY6C 4YHEA 3SO3C 2DQJL 3GMNB 1DJSA 2NYYD 5AAMA 3IKCA 1G9ML 3MLYH 5C6TL 3IJYA 2XIBA 2OTWA 3VGHA 1NUFA 1QLRB 1S9XA 3VX0A 4G8GA 3QEHA 5TDOB 2ZUSA 3FW6A 4P23B 3MUAA 2BERA 3QIBB 5B39A 3EJZC 2W38A 2WWMD 4OB5L 1VKXB 1ZJAA 3HLAB 3LKSA 3HI5H 4GRLC 3VFSA 3MJ9A 3VRJA 1GOOA 1YJDH 3PL6A 2X2YA 4HH9A 3L3GB 4Z76A 5I77A 1KTLB 5E09A 3QIUC 4XPHL 4P7NA 3QUZA 4PGCB 1G7LA 3Q48A 3W0WA 2V38A 5KN5A 3PHOA 5L7XH 4JR9H 5AD0A 3ZO0A 2A73B 1IT9L 2QSCL 3TH3T 4IRSC 3TWCL 5GS0C 3WUWG 3PZVA 4P7RA 3CUPB 4POUB 3TC9A 3KPRB 3DBXA 1EHLL 1HNYA 4HA4A 2J4WH 1RURH 5JHDE 1ZT7B 3EJRA 3L3DA 3LRSA 1GAFH 1R3KB 3TESA 3V7AE 1TJIL 2CDGB 2UV3A 3GGWB 3R0NA 4MJIB 43C9B 5IW1A 3LRKA 2MKWA 2FZ3B 1Y6MR 1KTDA 4A2MA 1WNOA 2F54B 4HK0A 5FAAA 4DZ8A 3CFIC 3HI1A 3THML 4UMGA 1U3HC 1BFOA 4LBEB 1XF5A 3Q0HA 5E24E 3B9EA 2BRRH 4E0RA 2MHAA 1DN0B 1LO2L 3TT1L 2G75B 3HTLX 4ZFOB 2HFEA 4PRIB 3ROLA 4XP6L 2EDRA 2EXWC 3FB8B 3QUYA 5JHLH 3B43A 3WSQL 2EDDA 5T1DL 3VXOB 4PLJD 4RAUB 1HKFA 1MCLA 3QHOA 1U8LB 3EZJB 1FLRL 2Y36L 1BG9A 3T3MF 4J27A 5I18H 4X7SL 3AGVA 4YEFA 4WNQB 5GS1C 3KDMB 3KEHA 3WH5A 1FGVL 4KRPB 3HG5A 3S35X 5GZND 4HKBB 1BLNA 3ZLQC 2ZJSL 1OTTC 1TETH 4QXGL 3W53A 4A6YH 1GUVA 1KBBA 4PJHA 4K9EC 1ZHNB 1B3ZA 3TCXA 4JFFD 4LKCB 1KELH 4WU7B 3STBA 3D87B 3IXAA 4X6FA 3W82A 4YPGB 1B1YA 1HXJA 2VXSH 3MV11 1HCFX 3EO9L 3OPZL 5BQ7B 4GMSL 3DGCR 4I18A 3DETC 5DHVB 5I1AB 5T5FL 5E99L 4EIGB 4RFNC 4P4KC 3UZQA 4MD0A 1UGNA 1DWJM 5FHAH 1YUHA 1AO7E 2XPGB 4YHLL 4F37K 3RZCB 1R5VB 1JF1A 4PJXE 3VH8B 1XZ0B 2HMID 3LQAC 1G7QB 1MRFL 2ZX6A 1JDAA 4Y88A 1BYDA 1CF8L 3BJ91 5CJ5A 3X14B 1T4KA 5DHXB 1MJ7L 4PY8J 1KOAA 1JF6A 3HCVA 3VDCA 1HT6A 5E2UL 1WFNA 2J2ZA 5IV2A 3O0RL 3IJ8A 4N9GB 4J3UA 4N1EA 2DQTL 4HGKC 4JFYA 5CGMA 1C08B 2DWDB 3FAWA 4PJCE 1GHFH 5HYJD 4GI8A 3GNOA 3PN8A 3WF2A 5E8OB 5BXTA 5ETUA 3WNOA 2ED7A 4FQLL 5K9KB 3TM6A 1A7QH 1N4XH 1F3DJ 2FIKA 4LSPH 5HGAB 2ADJA 4GMTL 5TD4A 3F5JA 3KJ6H 5TPWH 4G9DA 1CFTA 2CERA 2PUQT 1FZJA 1MCWW 4ZE4A 1QNOA 4HIIB 5I9QB 1T7XA 3BVWA 1WZ1L 4CADA 1DSFL 1FYHB 1Q9OA 1TG7A 4ZSOE 3BN9D 3VW3H 1UVQA 3VVGA 1TMQA 4LHUA 4Q74A 1LP9F 4OFIA 3AJ7A 1GGBH 1AY1H 4LLUB 1REIA 4FABH 3IJHA 1MLCA 4TQEL 4FOMA 4UTAH 1LE5B 2PO6B 2NY0B 4K8RD 3HE6A 1GGCL 3ZKMC 2XFFA 4ZO9A 5GSRB 2BV9A 2VCAA 3AMLA 4QO1A 4XB7A 3ZHLA 4PJAE 2Z4QB 4PJBB 1EDTA 4QTHB 4MS8C 1JVKA 3F7YB 1DUZA 4GKOA 5F97E 4F3FB 5DQDL 1C5BL 4FLOA 5DQJA 3CZGA 3UTTB 2DSVA 5KG9B 3QUXC 4XMKL 5DT7A 5T3XD 1CS6A 3KXFD 1QQDA 1SJEB 3W0KA 5EORH 3QHNA 5I1IH 2F5AH 4A6YA 3N1QC 4GI9A 1L4IA 4PJ9C 5T5NG 4CU6A 2IH3B 1GGIL 2VLKA 4WI6A 1J8HE 1FV1B 1UCBL 1WAAF 1AQKL 3WO4C 1CVRA 3FTGB 5J89A 3AM8C 5EU4B 3LH2H 3ZKXB 3TJEL 3IJSA 4NFDA 3UTZA 3BXNB 1DN2A 1LK3L 32C2B 3T0DA 5J9PB 4QHUB 1S46A 3NBNA 5E5MA 1HF6A 2NT1A 3DYMA 3B2UD 4JQXC 2R23B 3MV7B 2JJVA 4M1GH 1KGCE 4M3JA 4NO5A 1UKSA 1OGAA 4HBQA 4U6HA 3DV4B 3BDYH 4K2UL 3OKKB 3FRPA 5D7LE 1E6OH 5IB3B 2WHJA 1V6UA 3BGMA 4Y4HD 5KSVA 1D2KA 5C0BD 3I02A 2HN7B 5F7KC 2VLJD 3J8F7 3SHSA 3LHPL 3WFZA 3DARA 1B2YA 3W11D 1U33A 1QX1A 4PJEB 2GY7B 3ALXA 4IIQC 2GK1A 4QRUB 1YN7A 3ZE2E 1WZMA 2GFTA 4HJ0C 2F74B 5K93A 5GS0H 2LE9A 3GI8L 3SQBA 4GXUN 5SX4H 4PMXA 3KHQA 3RM4A 4FQXD 5CINL 1FNGA 1MH5A 1KEMH 1YYLH 3O4OB 1OB0A 2WBJB 4ODSH 3RPIB 1GOQA 4TX6A 4I1NB 2OJEB 4OLXH 4G6FB 4PD4J 3NFPB 3OWEA 3S4SA 5IBTL 2FEDC 1NAKL 3PV6B 3S96B 3MRBA 3IFLL 4PJFF 5I1EH 4OLZH 1BVKA 4ZUUA 3FO0L 2DDXA 4TUOB 3S2CA 1LWHA 1RK1A 3GSOB 2ZKHH 3KPNB 4YH6A 1HHIA 1TJGL 4TUKH 3RJXA 3O8XC 3V0VA 3S9DB 3U2SB 3MBXL 1WO2A 4PGBB 3QCTL 5D7SL 2B4CL 2DYPD 2WIIA 1U8HB 1WCBB 3L3JB 3BUDA 1KQYA 2W63A 1NMAH 2WYSA 1A4JA 5FYLH 1JGLH 4F33A 4XTRD 4NQUA 5T1MB 3CZKA 3HR5A 3LEYH 2NXYD 3FO9A 2IAMA 3STZA 4GBXA 2R2BB 2K7PA 1CTOA 3DIFA 4NKDA 3DTXB 4PR5A 3MPCA 4JFWA 1F4XL 1JGEA 5SWZD 3HG1D 4YIQB 5DD6A 3OG4B 1LQ0A 2NR6C 3VI3F 3K4DA 3NN8B 3DX6A 4IMKC 4FNRA 5IB1A 3BWUC 2BXZA 2HJLB 3SN6N 4CU8A 4DEPC 4N1CA 4W93A 3S88H 2JF6A 5AYUL 1I7UA 3Q2CA 3QO1A 1WWCA 9CGTA 4TRPL 4DM1A 3QDMA 2ERJC 5FIPA 1A7PH 1XCXA 3A4XA 35C8L 4L8SC 1KGUA 3B5TA 5EFFA 2VAAB 4UQDA 2WHKA 1IFHL 4MXVE 4MDOA 1MJJB 1V3JA 2EDLA 2VZOA 2OP4L 1Q9LA 4N0FA 2VDNL 4ISVB 5D6CB 2O5XL 4WGWB 3PWPB 4Z0BH 4X6DE 2EKJA 3QIUA 3ZT5A 2ARWA 4ZXBD 3RWGA 3VXUB 3LQAH 1XIWB 1AD9B 3LB6C 2ICEA 4PP2A 1CD8A 3WE6B 2PETA 2DWEA 2OJZL 4ODVL 4G6MH 2ILLA 1CE6A 3MRQB 4S2SA 5IESH 3HNSH 4IRSA 4I8DA 1WICA 4OQTH 5KANI 3VWJB 2ZUXA 4TNVF 5I16A 4HWEH 2VRKA 1EZVY 2VITA 4RNRA 3AIRA 5CSGA 3CSGA 1QZ1A 3JTTA 5LAXA 1PBYA 1AQDB 2Z35A 4NM4L 1LNUB 3FZUC 5DT1L 4ZFGH 4DWSB 1X44A 5ALCH 4LRNH 5FM4A 4XAWH 1XGUB 4RMUA 5FO8B 3QAZC 5EZOH 4N0UE 3ARSA 5F9JB 1XEDA 3DSFH 4NZUH 1R5IB 3SCNA 1HKLH 2BSTB 2WSKA 2MTPA 3T0EC 5M03A 3QO0A 3OXRA 1KNOB 4UI2A 1K4CA 3B5GA 3GSQA 2F1BA 3TCLB 2E9LA 5D7IE 3RMEA 4YFLF 3C6LC 3OSKA 4HEME 2GSJA 5IHSA 4NF7A 4HUWA 4BQ2A 3V6ZB 5KAQF 2E7HA 1G9NL 2XKUA 4XUYA 1XGZA 3FQRA 1OCWL 3PABA 3OGVA 2ZXBA 4BFBD 5HHQB 4JRYA 4RFOL 1GQLA 5DK2B 1EEYA 4Z7VA 3LRMA 3ZJ6A 2JCCE 5SWSA 4F2MB 5TGBB 4U1JA 5LA1A 1FH7A 3BESR 4NQCA 2DQGL 1ZGLB 2X1XR 1RIUH 4LSUH 1IQDB 5LJYH 1U8PB 5CJ8A 5L9DH 2CO6B 5DJ0B 5C0RL 3INUH 3WFBL 3RO8A 5LKNA 4P7LA 1PJ9A 3U0WH 1HHHA 1OTUD 4YDVA 2PXYA 5DD3L 4F79A 4GQPH 3RDTD 1F4WH 4NKOA 3CIVA 1OLLA 2EDNA 3BEWB 1AHWC 3RA7H 2GCYA 4BZ2H 1ISVA 2DQHL 2JKXA 4I4WA 4FG6D 5KAQG 1DVFB 3FT4A 3ULUE 5E4IA 5BV7L 2XQYG 4XPBH 2E6PA 2LU7A 4D6DA 3LMJH 2QBWA 3I2CH 1QNZL 3JWOC 2AJZB 1NL0L 4YAQB 3UR7A 4QHKI 3GM0A 1D9KB 4QCEA 4LSQH 4MXWH 4B53A 4QFUA 2ZPKL 1NBQA 2WHMA 2VUOA 3IDIA 2CKSA 1P9MC 2PTVA 3IETA 3L4XA 1D5IH 2HKHL 4JDVA 2G9HA 1JMZA 1LO3H 2W59A 4LLAA 5DMJB 1GC1H 4OD1L 3AIQA 4HMEA 4UILH 5IVZA 4C55A 4EI5B 2Z8RA 3PHQA 1FDLH 1A14L 4I13B 1RUQH 4TSAH 1UC6A 3VE0A 5DK0B 4QF1B 5FCUH 1FFNB 2XVPA 3MKKA 2ZWZA 2H41A 3U4BH 3RWEB 3C87A 5KVFH 3BKCH 3BAIA 1O7AA 2E8ZA 4AC1X 1AR1D 3IFNL 4OSUL 4GXVL 2YXMA 2WUCL 3TYFA 3QZWB 4IOSD 5I15L 3DC0A 1A2YB 3VGAB 3NAAL 4F57L 2CLRA 3QNXA 4H25A 5HJ3B 2LVEA 4PREA 5EOCJ 4UDUB 6TAAA 3TBTB 1MCPL 2Q20A 2OZ4L 4N0CD 4HXBL 3WLBA 4GH7B 1RZIA 3HZVA 4GPNA 4HPYH 1XYZA 1YMMA 4R4NC 3UTSE 3QOKA 3CSPA 2VR4A 3L9RB 5ICYB 1A8JH 2I9LA 1T1WB 3WEOA 2YD8A 4WDIB 4U05A 1JUFB 3WEZA 4LLYA 2GSGA 2WVVA 4HLZH 1T22A 2JF7A 3GEWB 4Q6IC 1KYOJ 3ISWA 1T2XA 1OAUH 3LKPA 2CITA 3N1FC 1S8DA 1LILA 3TPUA 1YN6A 3L5WA 1AO7B 4U1MA 1P4LB 4JCMA 4PUDA 1MXDA 3L3KA 4HCRL 4PJXB 4UIKH 3EJYD 3GTNA 3CDYA 1KLGA 2OSLA 4R4FH 5MERA 3EDEA 3S37H 1QFWI 2AEQL 1BZQK 4XI5D 3WXVH 4LEOB 2DI8A 2ZE0A 1HZHH 4ORZC 3QDJA 1BZ9B 1KIQA 2GJZB 5IGXL 4FZ8L 3OKDA 3MNWB 3MJGX 4QWWD 4FNPA 5FA4A 3PWJB 5CEYA 4KK5C 5I8KH 3G5YA 4PJCB 4OFPA 1ZANL 1ZBKA 3MFFB 2A0LD 3CFKB 2FGWH 1E56A 2ZCHL 3PF2A 4OKDA 3RQ3A 1T1ZB 3D85D 4NN6B 2BY2A 2DQUH 5IT2L 5C07B 5KVEL 3QI9B 2VDRL 1CPUA 3GBDA 1J0YA 3PWLB 2YUWA 5IHZA 3CLWA 1E6RA 1W8OA 3R1GH 2F61A 3OG6B 3KR3L 4ZE5A 4ZSOB 3BD4A 4M4PA 5I79A 4XZBA 4YXLL 2GSIA 2G8ZA 1PVHA 4WO4C 5IIEA 4D94A 3SDXF 3GSXB 3W9DA 4HKJA 2YL9A 3VFUB 5GJSH 1T83A 3EOAA 5SWQA 3ULUL 3DI3B 4AEIH 3H55A 2D23A 4L3AA 5D71H 4DM2A 4IEFB 4HWUA 2J8FA 3BO8B 3BLBA 3QH3B 2X41A 1E6JL 3UPCA 4EOWH 4O2FA 1OY3B 4PUEA 3U9UB 1RFDH 2Y06H 4XXCA 3ZDYE 3VFVA 4M62H 4GAJH 5EUOA 5ADPH 2ADGB 4WJXA 4GSDL 3M46A 3BKML 5KW9H 1MRDH 3T3PF 2PYED 4ZUWA 3CVHH 4NDMB 3BRFA 3RDKA 4FQ2H 1RZGB 2FHFA 3O8XA 4XNMB 1WISA 3NH7H 1AQHA 1CECA 4ZG1A 1K3ZA 4U0QB 1E4XI 2ESCA 1TVNA 5ITFB 2DD8H 3ZDXF 3IFPB 3RNKB 1NGQL 4NGHH 4P23D 3QIBD 1J8HB 2ZWYA 3K81A 4MB5A 5MHSD 5DURD 3CZSA 4X6EA 2Y5TA 1CE1H 3VIKA 4YC2B 3LRHA 4AMXA 4TNVK 3U7WH 3MRFA 3TJHC 4FQCH 3CFBB 5LGKA 5DYOA 4UU9B 5A6BD 3SKUD 4JFEA 1K9FA 3CLFL 3I3BA 4R7NA 1B3VA 3SGEH 5FYJH 1T2JA 4OQ1A 2M8XA 1MFAL 3C8DA 4HV8B 5EU5A 3OGSA 2RHEA 1YY9D 1UXWB 5ERWB 3MR9B 2CD0A 5A43C 3HR6A 1DLFH 3J7HA 3BAJA 3EJUA 3F65A 1RZKH 4Z7WA 3AHZA 3C5ZC 5CZVL 3WEMA 5D8WA 4ORGA 1DHKA 2YRZA 1V7NH 3U57A 3RKPA 3DO3A 4QRTA 3MV9A 5ITBH 1JHKL 3EDJA 1DBJH 4PGEB 5C1MB 1X6LA 3HMWL 4EIZC 4KPHH 2XN9A 4BQCA 3BUPA 3JWOH 3QULB 4F58H 2BNQA 3GRWL 1E27B 5D7JD 2MCG1 4UQ2B 2YBRB 4AZCA 5GRJL 4FQIL 5HVGB 2F8XC 1JBJA 2GJ6E 4PRHE 4FLQA 2M2DA 1JP5A 4HUXA 1KXVA 4JFVA 3FAXA 3MROB 1QW8A 1WFTA 3HI1B 3MA9L 2AMGA 1B2WH 3KLDA 1V6XA 2XXMB 1PX3A 5HD8C 4HGWA 3V8CA 4MAUL 1UKTA 4CU7A 3GH4A 1GSMA 4LRIA 1GZQB 2B1HH 2VE6B 4AIOA 1EUUA 1TJHH 4YHIB 4R97C 2I07A 3ZYZA 3QUMB 1WWBX 3MLVL 3TTYA 4KRPD 2X89D 4RMVA 5IB2B 4URIA 2GDUA 1INQA 3ZE0F 1ZHBB 5E8DL 4U2YA 4WWKC 2P5EA 2NW2B 3W81A 5A6JA 2ESVE 5KSBF 3KPSA 3IJ7A 2QR0A 3CVHA 3EHBD 4B3LA 5DJCB 2A9MH 4JHWH 1SYVA 1NC4D 4LVNB 4Y5YC 1LK2B 1BAGA 4Z5RA 1T04B 3DHJA 5BJTA 1MVFA 3QA3B 5CKGA 1J1OH 3TYGL 3D3VA 1RZJH 3X12B 1ZU8A 1MHEA 5IFHL 2XVNA 3CFJA 4XMLL 2IXVA 5J06A 1KJVA 1UB5A 3FQNB 2EC9U 4WHTA 2VDPL 3RZCD 43CAA 1BHGA 3C60A 2OSYA 2A83A 4QLRA 4UZGA 5C0NC 2ICWB 3OF6D 4X6CF 3O3DA 3AZTA 1I7ZA 2ZCLH 3BD5A 5CZKA 3G9AB 1LQSR 2ORBL 4OCWH 3D2UD 3KNBB 4NUJB 1QBMH 4IJ3C 1P5VA 1GONA 1F02I 2J8UA 1BYAA 1A3HA 3F5LA 2KZWA 2F15A 5JXED 4KKLD 4NWUL 5TF1L 3RVUC 4PGDA 3CVIH 1Q0XL 2D24A 1W0YT 4G7YL 1MFDH 1XAUA 1NAMB 3SE4A 1VBRA 1AHWA 1CGSH 2Q76B 6FABH 1OSPH 4BH7B 1JL8A 2LV4A 5M94B 3IDYC 4Q2ZA 4Y7EA 2GTWA 4HZLB 2YN5A 4YX2L 4R8WH 5J0BA 1MOEA 1X5AA 4PY8I 1Z9MA 3MZTA 1B4JL 4BYHA 1WBXA 4WRLA 4P3DA 4LP5A 4F7EB 1R87A 1KIPB 1OQXA 2P8MA 2YMXH 3WQ5A 1NOWA 3WJLC 4YXKL 3RL2B 1EXPA 3NZHL 1UM5L 2DF3A 3FQWB 3PP3H 4L4OA 2YEZB 4JG1L 3GSNH 4JPKH 4LLMA 4LU5H 1B0GA 1C12A 4EDXB 4FQHA 4U0RC 1HDMA 1AIFB 3TPKA 3P0GB 1M6OA 4N0UB 5D8JL 2NXZB 4UQ9A 1VADA 1OAZH 1ORSB 3B9KB 3TNMB 3BUIA 5CHNB 3OGCA 1FVCB 4QT5B 4IS6B 1DWGM 4HT1L 1YNKH 1CR9L 3D4ZA 4HKXA 1A3RL 1NJ9A 2XA3A 5FIEA 1XH2A 3NFNA 4JANB 3MUGB 4DK6A 1MRCL 3BIAX 1JMXA 1XR8A 4JGJA 5EU3A 2A3BA 2RGLA 1NKRA 4PJ7E 3MLPA 3UYRH 1HSAA 3BCDA 4UDTB 2R4RH 4CMHC 3EO0A 4QHMA 4YR6B 1I8KA 1MIMH 3NPSB 4ZAKB 2WC4A 2EYTA 2VAJA 5E6IB 2HFGH 4ZOEA 3VDHA 3H9SD 2JCCB 4KZDL 3PTMA 5JUEL 3BIKA 4JM2A 1A6VL 1QWNA 5D70L 1NGZB 2BDNH 5JR1L 5CS7A 5JZ7D 3CMOL 2VLKB 3SE8H 3KL0A 3L6FA 4ESKA 4G8EA 4XX6A 5C0CA 2NQCA 2XZCL 4Y5XC 3RY4A 3V5KA 5KTEH 4ELMF 5HPMB 1UR2A 1QFUH 1PBGA 2YPKB 4FMFA 3S5YA 2EE6A 4GQ9H 3GBNH 3M6DA 4DO6A 4JN1L 4YDKH 4JY6A 3ECQA 2FJFB 3PZQA 1OB1A 2NY7L 4YFLI 5CD5D 4GQQA 2VT0A 1BF8A 4MAYB 5JBFA 3PGCA 1SY6H 3PUCA 3WO3B 2BCKA 5C7XH 2J47A 1C8QA 4MWFA 3DRQB 1I8IB 4OTXH 5AYQA 2C1PB 4H1LG 4MA7H 4ZFFA 4ETQA 2MPAL 5DXWA 3GXPA 2UVFA 2H2SC 1FL3B 1FZMB 1R3IL 3QWOA 2VCBA 4OOUA 1ED3B 2R1WA 4KKNA 3QEUA 3HC3H 4S1DD 4RE3A 4U1LB 3WL9B 3ULVE 3OR6A 1BGXL 2X1IA 4I3SH 4G7VH 3SOBL 4J4PD 4XPAL 3PJSB 5K59F 1M71B 4F80A 1I1AC 4CW1B 5GNYA 4N90E 3H9HB 4NKIL 1QO3B 3WBDA 1J0IA 4XPFH 1C1EH 3VM5A 1HP5A 4NQEE 4UV7L 4XNUL 2GYSA 3ROOB 4KMLB 1QLEH 3AY4A 1X5FA 4PJIE 4YE4H 3PZMA 3GSNA 2ZOLA 2W9EH 5H2BB 1MI5A 4XH2B 1HJUA 5D96B 4K71C 5FCZA 1V02E 2EE9A 3DX4A 3ZHKA 5DJXA 2NNAB 4I77H 4JY4B 2VC2H 4NQDA 3LIZH 3H7BB 3EIFA 1V0MA 1IKFH 2O5ZL 1O7VA 4I9WD 4WO4A 1S7VA 4MX7B 3WF1A 5K9OA 5IJKC 1YQVL 1YEDB 1ES0A 1I3RA 1ZS8B 4XNZB 3ALFA 1H11A 2XGBA 4L9LA 4NQVA 3SGKA 1A9BA 1NDGA 4CNIA 1BAFH 1MLBA 2WAHA 3S3SA 5FB8B 3UTSB 5EBWB 5JOEA 1YECH 4L5FH 1QSEE 3QPXL 3LN5A 4YQXL 3T0EE 1IAKB 2P8PA 2YSSA 3RTQD 2ID5A 5CQ1A 3LZFH 3VMNA 1EJOL 5I73C 5CAYB 3CUHA 3PZNA 4XNXH 1VPOL 4MA1B 3ARFD 3RI5F 4N0RA 5FF6B 2MCPH 4TVUA 4LASH 1TPXB 5D1ZB 4LYRA 4DN4L 2UWEF 3UCQA 3MLSL 2NY6B 3QFDB 4UFLA 4RAHA 3SO3B 3HC0A 4AMKL 4P46D 4D0CA 4UAOC 1KB5B 3VXTB 4GZIA 1MHHA 4HUVB 4NSKB 2NW0A 4ZTPL 2GQHA 4M1DL 1KB9J 1NMBL 4FQQB 4FQ1H 1SY6A 1I8MA 1EAJA 1LO4L 1XIWD 4GINA 1TZHA 3WKML 1QNQA 4BK5A 4Z95H 1QPKA 3FXYA 3RGHA 1C5CH 4GRLB 1C8YA 1UKPA 3LVEA 1UT9A 4PRNB 1OD0A 3WUWA 5INCA 3RHWF 1S5HA 1YEKL 1G7IB 2Y2WA 4YXHL 3KYMA 3VWJD 5DFTA 2F9BT 4W68A 3WUEA 1W0WA 4HAFA 2W9DL 2X9XA 1JRHL 3ESUF 3WN5A 1BQLL 1XF3A 2OI9C 4YO0A 3PV7A 3MLZH 2XA8L 2VABA 1XCQB 1JDCA 1HH6B 1SBSH 1WDRA 2J62A 4DWSD 2XG5A 4MJ5A 5DMIL 4QXUL 2D3VA 4WFED 1D6VL 1T0MA 1PY9A 2UWFA 1U6AL 4UOW1 3FFCE 3MRNB 5E8PB 3NMEA 3P73B 4Y5VA 1NMCC 4KV5F 4ODBD 1KG0B 1MCKA 1DWIM 2WUBL 1XGPB 3I9GL 1E70M 3CLEH 4UV4L 2V3DA 2Y24A 4S1RH 4BFIB 1LEIB 1BYBA 1L6ZA 1BECA 1W0VA 4W6WB 1CT8A 2XQBH 2Z31C 3P9WB 4Z8FL 3RIKA 1UG9A 3T8XA 1HE7A 1U3HB 4R90H 1YNLL 2CKBH 4OLYL 3IXTB 3ULVL 3QRGL 3RNQB 3HE7D 3PTQA 3U46A 4HZ7A 3TIDA 2VZ1A 5CKAA 3EBAA 1MFCH 3HI6L 3POCA 3UC0H 4F66A 2HVJB 3UJIH 3NCEB 1NGWA 3L3HA 2FD6H 3RFZC 3RVVD 1A64A 5HVWA 3PABB 4M61A 1ZLWH 3LV3B 1GPFA 2E5EA 1EEZB 3MRCB 3LRGA 2W92A 4PG9B 1IEBA 5TE7L 4F7MA 5GS1B 4M7LL 2FSEB 2FX7L 2DI9A 4J3XA 3BP6A 5DD1H 1X1NA 2G60L 1MJUH 1HEZA 3CNKA 3LN4B 3QWRD 4U1JB 5F96L 1JZ8A 1JPFA 1LEKB 3S35L 1AKJB 5MEOB 2YDSA 1QYGH 2P48B 2BNRA 4H5SA 4NO0B 4OCSH 2FDBP 4OF3A 1AXSB 2DJ4A 4LCIH 4R5EA 1K2DB 4JKPL 3FB7B 3B6SA 1ERNA 1H3TA 3I6KA 1N82A 3AIVA 1PZ2A 2CIKB 3QXDB 4GW1B 3WV0A 3VNZA 3CDFA 1AI1H 3I6GA 3GKWH 1GQJA 3MV8E 5MEQA 1UM4H 3WY1A 3I50H 3OBAA 3TP4A 4E41D 5GRXG 4NHCH 4HPOL 4GKNB 3SDCC 2DT1A 4XC3H 4RFNB 4P4KB 4GRMA 2VKWA 3TO4D 1CZ8H 1E1FA 5IW6B 3WUBA 3H6JA 1JHTA 2P5WA 3O45A 5CSBA 4AD0A 2VCCA 5IB4A 4QRSB 5ABFA 1HYRC 2WQRA 4KI5D 2ZWLT 3DUHA 1KN2H 5DEGB 3S37X 3D0LB 2HT2D 2OYLA 3WF0A 2R8SL 5F1IB 5JQ6L 5DJYA 4BSWA 2GJ6B 4PRHB 1NH6A 4O5LL 1IAIH 1UKOA 1VACA 3CX5J 4JVUA 2O26U 4M1CC 3P11H 2R2CA 3TBWA 5HHOA 1B6UA 2AK4A 3WJLA 4HFUH 2ATKA 1A1NB 3WIJA 1U36A 2GITA 2EDJA 5DGQA 1WGOA 3CFCL 3BVNB 4W4OC 3DVGA 4P2RE 2EIZA 1D6EB 3D9AL 3V5HA 4JFXB 5DJZA 1UR9A 4F7CB 1QR1B 2CKBA 3EOTH 2M1KA 1V7ML 4HXAH 1NWTA 4HX1B 1FO0L 1BVLA 4P4RA 4Q9BA 2XTKA 3O6FC 4G5ZH 3UERA 4FTVA 3U7YL 1RI8A 4OV5A 4HQQH 4QOKE 4POZD 2W61A 5FUOL 1CBVH 3DX1A 2CGRL 3DMMC 4WY7L 5IVXE 2DMKA 3GHEL 1F13A 1CIUA 1U2HA 4MCZA 4HKZB 5DS8A 5F7WC 3TIEA 4EQ2A 3VD3A 5EN2A 1JZ3A 2AJYH 4K3EH 5DJ8B 4QCIB 5BOZG 4EE9A 3OR7B 3ZOAA 1XGRA 2F7QA 1FN4B 1DBMH 1PIFA 1LP9A 4PJ8C 3UBXB 5F6HI 3QUXB 4K7PH 4HJJH 1ODAA 2V6HA 4LX4A 4W87A 3TNNB 1XF4A 2C26A 1U8MB 5JXAL 3FT2B 4RMSA 3ZIZA 4JFPA 4PJ9B 5HHME 4KAQH 1DBBH 1SYTA 1A6AA 3HMCA 5FGBC 1AD0B 4LMQI 4BQ4A 2JIWA 3WO4B 5ID0A 3O3UN 2OTUB 3AU1B 4G3YH 3D1MC 4W6XB 4JO3H 1CLYL 4UNTA 1LDPH 5ESAB 2XWJB 4BZ1L 4TVPD 4J12A 3HZ3A 5D93C 4NWTL 3BUYB 3BAYA 3MRKA 2HRPL 4G9FB 1EO7A 2R4SL 1W72L 1KJ3L 1FORL 2XZQL 5F1SA 3VWKD 4MJ2A 1KT2A 5C07D 2APVA 4C7FA 3AMKA 3PQYE 2CBJA 3CMGA 2APXA 3Q6FB 1N0XH 1WAAA 5I8OH 3IAGC 2FYYB 1KENH 5DR5H 3SCMC 1I4FA 1L7IH 2DKMA 4F7TA 3MUHL 3P4NA 5L2KD 4M6OL 4DVRL 4PJBF 5AWNH 1TQVA 1J1XL 1INDH 1IKNC 2DAVA 3ARGA 4UNVA 1F3DH 3PGFL 1K6QH 4X0KB 3U7AA 1DZBA 5IB5B 4LIQH 3AAZA 1AGFB 5L8KB 2FB4L 3HB3C 4IIQB 4GT7A 2UUDH 4M8VA 4APQC 2OW7A 3S97C 4U3CA 1XC6A 1P6FA 3K2UH 3G6MA 2D7TL 2ADFL 4NNYB 1NANH 2CH8A 3MC0A 2VKXA 8FABA 1S7SB 4JHBA 3WDIA 2Z8VC 1HSBB 2H9GB 2G4FA 3KPLA 1FAIH 2ZG2A 3ARPA 5HHNB 3N04A 1S5IL 2F19H 4U1GC 1JAEA 5H35B 4PYHA 1CK0H 4LSVL 2XG4A 1KFAL 7FABL 1ZWIA 3WJJC 4PJ7B 4N9OB 1JNNH 4KK8D 3KPQB 2RGSA 2PNDA 5F7MC 2WWCA 2DOCA 2CO7B 3CXHK 4U6XB 2W5FA 2YL6A 2R0WH 2HVMA 1WIPA 2RCSL 2CLVA 4PPTA 3RHWK 3U4EA 4FP8H 4U1IB 5GJTH 3F4VA 1OSZB 1TVBA 2N1KA 3MACH 2AV7A 3SE3C 1A7OL 1FFRA 4J28A 1IBGL 4G8GD 3VDBA 5JW3H 1P7HL 1RULL 2X70B 3DUUA 4KQ4H 5B3JF 1G9EA 4ZFZA 4Y4FB 3CD4A 4HBCL 1A3LH 1FYTA 4OFKA 1ZHKB 3QP3A 1S7QA 3FQUA 3MGOA 4PJEF 2XSBA 1X5HA 3PL6D 5EU6E 3V6FB 4RISH 3WBEA 4PJGA 3SKMA 5DRWA 1HYSC 3KL5A 3BUBA 2CK0L 3QUZD 1OD8A 1R5WA 2KZ1B 4OZIA 2NY1C 2Y8VA 3W0WD 4W8AA 3I75A 3WQ4A 1F5WA 5HDQL 4DEPB 2H8PA 1JYWA 4IM8A 2ERJB 3E1F1 4L8SB 3NDZA 5FO7A 2MJWA 1FL6B 4P9HC 4ALAL 4HFWB 4ODTH 5D7KE 2CDEB 3NABH 1IGCL 4RMWA 4JQVC 3T0WA 4DKDC 3RWJB 4MDPA 1DQDH 2PW2A 5MP6L 3SE9L 1FC2D 5DQ9A 3LXBA 5DWUH 3BPNC 1S3KL 2X44D 2K3TA 3MODH 1YC8A 2V5DA 2QADB 4XP1H 1ADQL 4PJIB 2YPVL 2LU3A 1CDCA 2MQCA 2W1NA 4HMCA 1AGEA 5EH1A 2J7FA 4NPYB 3RWFA 5DTFA 2V5SA 5E94A 3QUYD 2YL8A 5A16B 3TFKD 3L3OB 3ZTNH 4XPTH 5IWLC 3W24A 1CXLA 5FOBA 4Q6YA 5I1LB 4HIJB 4NOBA 1WT5A 2B8OT 5DFAA 5IVNA 1R24A 1VESA 1F4AA 5A40E 3RBGA 4CRPA 1KCUL 2R69L 4NT6A 2I5YL 2Q8AL 5E9DE 1MPAL 5ID1B 4JZ5A 2C4XA 2X7LB 4I0KA 1UR8A 3N18A 3HUJA 3BSHA 4NC2B 1E1EA 2Z31A 1NP2A 4MQSB 1FE8H 2OLDA 4FFWD 2RB8A 1QSEB 3LKNA 5DMYA 4C83A 3T0EB 4MSWA 5CWSA 3S36L 1HVXA 1F58H 1YYML 2IQAA 1FGNL 5D4QA 1HH9A 1OF2A 1BBDL 1HINL 1Y0LB 4M7JL 1SYSA 5TDPB 1H3UA 3MLRH 3C6LB 4P5TA 1I1WA 1ZT1A 3FT3B 1OM3H 1DDHA 1WSST 3DXAA 4Z7UA 3VO0A 5IM7B 1EV2E 1G7JB 2NW3A 3NZ8B 4KVCL 3TA3A 1BM3L 4NQSB 1EK3A 5BRZA 4FNTA 1ZVYA 4F9PA 5ACZB 1CG9A 3ES6A 1TVHB 1KJ2H 4ATWA 1N59A 3HZMB 1C16A 2YRLA 5FKPA 5C0AB 5J3HC 1XD0A 4XGZB 1U8KB 5I19H 3CTTA 2H1PL 1SBBA 2IFFH 4WFHE 2VN4A 3BDBA 4N5UA 4UT9H 5JTWA 2G3IA 2VDLH 1U95A 1PYWA 2JB5H 3MRHB 3AIWA 3FCTB 1HKKA 3JWDL 4HU8A 3B3IB 2X4PB 3BC9A 4GW4B 1C90A 4D6HA 4Z7NE 4PMUA 1I9RH 4KJYB 4OT1L 1V3KA 4LL9A 12E8H 5KVDL 2B2XH 1WVZA 3NIYA 5FL0A 1XT5A 1MQKH 4WUKL 1IC4H 2QSVA 3EO1A 1A0QL 4M43L 3DGGA 1H1NA 5D72L 2H26A 3SDYH 4AENB 4GOSA 3LPPA 3V5DB 2CPCA 3GSUA 1K3IA 2NXZD 1QHZA 3ILQC 3WXWL 4XCCL 2QLYA 1D7FA 3FFCB 3BQUA 2A6JA 1PQZA 4J8RA 2CBVA 2WNGA 4LHUD 3ZTJG 3S8WA 4KJQC 3WIHH 2Z91A 2I27N 2XKNB 2YC1B 3O2VH 5TQ0H 4D9QE 3HS0B 4JQIL 3OQ3B 1OIMA 3RKDD 3ZDZF 3T04D 4RL3A 1WEJL 4W8BA 3HE6D 3SKJH 3NIFE 2WWKT 5I1CH 5A94A 1AGBA 1E4LA 5KJRH 2DDQL 1D5BA 3KPMA 1GJUA 3STLB 3CZFB 3DO7A 3LRLA 2AV1B 2FGZA 3QDGE 3DX9B 1F6AB 2ZICA 1FRGH 3OLIA 4XB3A 5IQ9B 4H8WH 3LSOA 2H3NB 1DQLL 1S9WA 4OD2B 5L0QC 4KHXL 4L3CB 5FXCH 5CD3A 2DQCH 3LPWA 4DW2H 4K8RH 1FSKC 1KXTA 2B1AL 5FD0A 4HA1A 2PTTA 5HDLA 2VLKD 3G6DH 4JM4L 3SQOH 5AEAA 3WNPA 3GMLB 4ODHL 4Z7OE 3O6FA 2QSTA 5H37G 3VSVA 3GUTA 3DOSA 5TE4H 4M7KH 4D6CA 1TFHA 4EN3A 1QNRA 1EVTC 4HIEA 4EUPB 5IFAH 1IM3B 4WWID 1A4KA 5C9JB 4YZFE 1KC5H 3GMOB 4TTDC 3T4YA 4B41A 2VXUH 2VO5A 4M29A 4EJ1C 4KK6C 1OGAD 4U7SA 1KJ2A 4R96B 2QKIB 2Z93B 4PJ8A 1OD7A 2XKSA 3MV8B 4AEHL 1RPQA 3CXDH 4J3VA 2FJHA 1R3LB 3OKEB 4FZEL 4BUGA 4Q6IB 5ABGA 3M8OH 4HJGA 4LCWE 3SKOA 1E71M 1YEHH 5IMOA 3WS6C 2V9RA 3TZVA 3DUSA 2YIHA 1BQUA 3VFWA 5FGBA 4Z6AT 5B38B 3EOYG 4G43B 1J0HA 3GJFH 3KLAB 1E4IA 3MLYL 2VISA 3PXJA 2XTLA 3MBEC 4QNPF 4ZPVA 4DKEH 1GCYA 4GIAA 1FNFA 3OAUH 1MUJA 1FL5A 2VSCA 4JB9H 3V6OA 4C56A 1W32A 1HKIA 2BVQA 3HI5L 2J88H 1QEWA 1Z9LA 3C8KA 5H94A 5J6HB 2QL1A 4P9HH 1FP5A 4XMPH 2BC4B 3Q6GL 4NCC2 1U8QA 3S5LA 1H09A 3V7AG 3G08A 1QBAA 2V5CA 3SO5A 1PY4A 5HDBE 4CMMA 1KULA 1NSNL 3MCKB 3NIGE 5E2WH 1LE9A 5IOPB 3WIHA 1UWXK 4PB0L 4QRRB 3GIZH 3HNTL 3P4OA 3BH4A 5FECB 5L7XL 3TT3L 3QEQE 1UYWH 7CGTA 3IU3B 4D8PA 2GJXB 8A3HA 4L4TB 2YBTA 4QRPE 2J7DA 4P2RB 1TNMA 1RU9H 1YEEL 1OGBA 4NNXB 2YPLE 2QQKH 4NQXA 4FNLH 5DRXA 2XHYA 1S78D 3OKOA 4NXKA 5LGJA 4I5BB 4OCXH 4DGIH 1RD6A 1P7QB 4I0PA 2HWZH 5HYIA 1RJLB 3GSRA 4X7CC 4LYQA 3P0VH 4QOKB 4XVUC 3RWDA 4LGSB 2IAMD 2QLVB 1FVDA 3KYNA 2D0GA 5IVXB 3S5ZA 1J9YA 4GBXD 1JNLL 4YDJB 5KS9E 3WJJA 3QHZH 3HAEB 4OV6F 1CXIA 3MRPB 5D1ZD 5HVHC 3NSNA 3C2AH 3FMGH 2BRRL 3V0WL 3ZT6A 3GZKA 3FN9A 3PHSA 4PJDA 3IDNB 2ZUTA 4RWHA 3MRMB 1H3GA 1NFDE 3SDXA 4BS0A 1EFXA 1U93A 5DO2C 2R1XB 4DQOL 2ENSA 4KDVA 4TUJA 5JOFA 2HP4A 4OZGE 1Q4NX 3ZQ9A 3KXFA 1VBUA 3SE3A 4U3AA 3QDMD 4BQ5A 5GZOC 2ICWJ 4OFVA 5HHMB 3BPCA 1WIUA 4B7IA 2ZP0T 5DMGC 5ENWB 4JL2A 3QQ3A 4NRSA 3QJFA 4MA3A 1EO8L 2AQ1A 3LOWA 3DYPA 1TQBC 1D5MA 2ZOKB 1JZ2A 5EC2B 4UR9A 1JXKA 2ICCA 1F4YH 3NGBB 1U92A 4X5WB 3BWAB 1YA5A 1GHSA 3QIUD 4P5KB 3CFEB 1TETL 4NRZA 4NRXA 2VLRE 1VHPA 4A6YL 3THDA 5M5DA 3RVTC 1XH0A 3GJFA 5EOTB 2YD1A 1RMFH 2KPNA 1OQOA 2OW6A 1T2QL 2J5LB 4IRSD 3WDPP 3F5KA 5GS0D 4X8JA 4P3CH 1TUXA 3EFFB 3C5ZB 1MWAB 4ZS7L 2QQLH 5FHAL 3F12B 5HGDB 1VGEH 3HZYA 4Y1AE 1NBZA 1M01A 3CU1A 1XYFA 1NLDH 3QG6A 4C4KT 1JFQH 3EYSL 4S1SH 4PUBH 5F44A 4AIZA 1NFKA 2IH1A 4M3KB 1LD9B 2AJXH 3MOQA 4GKZB 2DLHA 3P2TA 4XBPA 3TVMA 3KPOA 3WY2A 2HJKA 4KVNL 2GTZA 2QHLA 3BP4B 4JZJC 5C0FA 4H8VA 3CZLA 2MANA 3IFOA 1CFNB 2J77A 1EO5A 1KBKA 5EA0H 1HWGB 4O9HH 4ATLA 2EXWD 4L29A 2D31A 1S7WB 4FHBD 5T3ZH 1GHFL 1NGXB 5A2CA 1M7DA 1E28B 3I3EA 3SPVA 5FYLD 3KLHC 4KDWA 1A7QL 4JDZA 4NCC1 1N4XL 3UETA 5GGTH 4CVZA 1E0XA 3WCYA 4OIIH 2XOTA 3LKRA 5TPWL 1HXYA 2JEQA 4JRYD 4R97B 2FDMA 2YWYA 3MLUH 4HUUA 1JWMB 5SWSD 5F1NB 1HKJA 3P9LA 3CUFA 3V7MA 2P47B 4NQCD 3VIMA 3VW3L 4WWKB 1UASA 4H7VA 1VDGA 4UQBA 4OZHE 4NO0D 1JNHB 1GGBL 1AY1L 1HQ4A 1IAIM 3PGDA 3RX7A 1JPGA 4RIRB 2VRQA 5BZDB 3JV4A 1OWWA 1RUKH 4CVUA 1J5OH 4Y5YB 3ECBB 3DURA 3MRGB 1IL1B 2PXYD 5EU6B 2YXFA 2V2XB 1Y18B 3BIBX 3DVNA 3OGOE 3OKLA 4E5XA 5ISZE 2EH8L 3HG1A 5FK9B 4DGVL 1OP3K 1XD1A 4L8CB 1MEXH 3FFDB 4K3JH 5E08H 4ZYKA 5KSBA 1FFQA 2IBGA 1EAPB 3OIHA 4H1LH 3VRLF 2I60H 5EORL 4YPJA 1MCQA 5I1IL 2IMNA 2DT3A 3MO1B 3OZPA 4JKKA 2IFGA 5LGHL 5EZIH 3G5VB 3HPLB 1HHGA 3D39E 1A6WL 4IJ3B 2MKLC 3O45B 4FXKA 4MQ7A 5IKCB 3BGFC 3LH2L 4V1DA 5JPMA 2O9TA 5FL1A 4YGVA 2RAMA 2D9QB 4H88H 3V4PH 3ALGA 1UZ6E 3MLWL 2BSSB 1BD2E 3ZO9A 1FPTH 3IDYB 2XRAH 3KYKH 4RGNE 1IGYA 1U91B 2XFXA 3RM9A 4XBGB 3KL3A 4NSBA 4H20H 1E6OL 3L5IA 5HHOB 2QEJA 1HHJA 2VQTA 5A6MA 4N0YH 5JW5A 1R46A 4LNRB 4PY7B 2OQJA 4NYLA 2X4RA 1FH9A 1IGTA 1DTUA 2AW2A 5ELIA 1ZTXH 2YN3A 4ZDHA 3OB8A 2LU4A 3VXSA 5DJDA 4UQAA 2IJ0C 4Q0XH 1OTSC 5E9DB 3TO2A 1FG2A 4U0RB 2WAGA 1PAMA 4ODXB 4PTTB 1NUGA 2VSDA 4QRQA 1F97A 1YMMD 2DM4A 3NCJL 3WMSA 5GGTA 2F18A 2QHAA 1KLFA 2VXVH 3CPUA 3N9GH 1WPCA 4AISA 3N1MC 2I25N 2D7PA 2PF6A 3DX0A 1KEML 1MCNA 3KHOA 4ODSL 1P69B 2Y07H 1S7UA 1F6LL 3BYYA 3GB7A 5C0GA 3W39B 3HPJA 5DRZB 3QCUH 4U31A 1CD1A 1UQZA 4CMHB 2NX5E 1KCRH 1WLHA 2WMPA 3QQ9C 5LBSH 5F7DA 2OL3B 4TUKL 5C09A 3RAJH 3HHRB 2GAZB 3N17A 4QHNB 3C8HA 3HJEA 1GRWA 3VXRB 1F2XK 3RWCA 5JOPE 4MNGE 4X5XB 1NMAL 3AS2A 5FYLL 1JGLL 3RVXC 4CD4A 4G9FD 2V17H 1RSFA 2EEDA 3QDJD 2VX6A 2FHBA 4JKWA 5F7YC 5ID0B 3EJQA 2UZYB 3BP7B 4Y5XB 2D9CA 4H1LA 3RUGE 4PBXA 3FOLA 1FVEA 1NCCH 4CUCA 2XN2A 4HZ6A 4XV0A 3VGGA 2EICA 2X40A 3MYZA 4H8UA 4J3OC 1OOAA 4P9ML 4PMOA 2DM2A 1VENA 3G6JE 1BOYA 4OM0L 2YKLH 3GK8L 1JTPA 3IU4H 4HC1H 5CUSH 2J78A 4XWOC 4K23H 3N0PB 3K1DA 2FO4B 3TV3H 3S88L 1X7QA 4CD7A 1DQML 4ELMA 5CCKH 3L7EB 1A7PL 3I6LD 3ILPB 4P2OB 3RL1B 3K8MA 4OUUA 1OGTB 1YEFH 5C0JA 3BAWA 1I1AB 1N5AB 4E8DA 1G7PB 5CMAB 4Z0BL 2YA2A 2ZXDA 1ZEAH 3FO1A 5IG7B 4B9YA 2Q3AA 2NTFB 3MSDA 3B9DA 1RZ8A 3QDGB 5EUOE 1AGDB 1WITA 1FP9A 3MRJB 1K8IA 4MVBC 4P48A 1I1YA 5IESL 4TTUA 2EEAA 1JYVA 4HLJA 3O8XD 2FBOJ 3A24A 5B4MD 1MCJA 2EDHA 4Y16C 3IVKA 4B0MM 4O2EA 5I1HH 5EMYA 4FXGB 4ENED 1BJ8A 3DX7A 1VFOA 3MLTA 5I78A 5ALCL 3P77A 1NPUA 5TDNA 1ZA3B 4WK9A 4UIMB 3WMCA 5EZOL 1EBPA 2ZNWA 4K7PY 4XCFL 4EBQH 3DSFL 4NZUL 1IEHA 1HI6B 3PWNB 4M6MH 4AL8H 7TAAA 1SFSA 1T89C 4JFED 3T0AA 5HI5D 1KJMB 3VFNB 5HYQB 2NR6D 4GKSB 2PBGA 1YEIH 2FX9H 5AZEL 4OD3H 5DJ2B 5I73B 4JLRA 2O61A 4OM1H 4Y4KA 3VXME 5JIIA 1N3NA 3SDDB 4O2CA 5BW7A 5I1DB 2EYRA 1P4BH 4PRAB 2VR5A 1BIIA 3VFGH 4LCWB 5F7HA 5L6YL 5CXPA 1RJZB 4B3KA 4G8FA 4YHGA 5E9AA 1SVCP 4XHJC 4EVNB 4AZHA 4R0LC 3Q3GB 4LK4A 1T20A 3MV9D 1DE4A 4JPVH 5D1XA 4UAOB 3O3AB 5F21B 1BQHB 4N8VB 5JA9A 4TOQA 1OD9A 5GGVL 3D4YA 3FRUA 4CVXB 2XN9D 4R7DB 2E0PA 1P2CA 5BO1H 1J1PH 4JFSA 4U7MA 2BNQD 3OX8B 1V08A 4HC1A 2VIRA 2X9WA 5BVJB 5L9DL 3INUL 1G01A 2UWEA 2V2TB 5HPCA 4LDOB 3U0WL 2DQDH 1L0QA 1DFBL 5I30L 2V7NB 1G9MC 1HILA 3O4OC 3FOMB 2R0LH 2F58L 1F4WL 2C4FU 3VFTA 3SDAC 3T1FB 4P49A 2FRGP 1ZT4A 5HXMA 4BZ2L 3ZE1F 4GO9A 5TE6L 1DQQA 4V2CB 5BXFA 1BF2A 2IANB 3UTQB 2HT3C 2OI9B 3QEQB 4QY8A 3O81A 1GQIA 5AUMB 1CGTA 3LMJL 1BZ7A 6CGTA 4P8WA 4QRPB 1X4YA 2D4DA 3BZFB 4N1HB 2YPLB 3DNKA 3OKMB 2BVEA 3P4MB 4LSQL 3HA0A 4MNQE 4ZPTA 1YDPA 4MXWL 4MB3A 2F1AA 4W7VA 3Q1SH 1GVIA 2OCFD 2P5ED 4GRWE 5I24A 3QG7L 1NMCB 1D5IL 3KPSD 4X7TB 2N7AA 3QUKA 3MS8A 1GC1L 1TZIB 3CSBA 1CFQB 4UILL 5D1QC 3GDBA 1U41A 4JO4H 5ECJE 1QRNA 1FDLL 2JK5B 4ACPA 1RUQL 5GIRB 1W1YA 3EDDA 3O41B 5KS9B 5FCUL 3QJHB 3SCVA 1BFNA 3U4BL 2R9HC 5KVFL 3D3VD 3EAKA 1T21B 5GHWH 1QSFA 5GGUA 3CMJA 1CICA 2C1OB 3BZEA 1UWGL 1NFDB 2B20A 3O4LE 4LSTL 1UD8A 3GMNA 3H9ZA 3C5SA 1NCTA 3C60D 4HS8L 1VA9A 1E3ZA 1CDIA 4OZGB 5C0AD 4LAJH 4R26H 5FYJD 1HK6A 2E3ZA 1QLRA 1LL4A 2SEBB 3CC5B 2JIXB 4TNWF 1ZL1A 5TDOA 4P23A 1L9NA 3QIBA 4U1NB 1M7IB 1VB9A 5DHVH 5HI3C 2P7TB 1VKXA 2XYCA 3HLAA 2NY4D 3WN6A 1BQCA 3BUQA 3VFRB 3H3BC 1XRVA 5ABDE 1J0KA 3AIUA 3PNWB 3SUUA 4GG6E 2P46B 3L3GA 3EJTA 4KZEL 1KTLA 5A6BA 2Y6SC 1WDPA 4JFHE 2VLRB 4PGCA 4QGTA 4K3DH 3FQXA 3MTRA 4R3SB 2GUOB 3CH8A 2A73A 1H3XA 4YBQD 4CJ1A 4S1QL 4UB0L 3PHAA 1OAUL 3SDCB 3CUPA 3NTCL 3OJVC 2UZXB 2WP3O 3KPRA 5JLZB 5CFHA 4Y1AB 1MXGA 2VH5H 3D3AA 3SUSA 1XGYH 1SMDA 3JTSB 1ZT7A 1ZLUH 1R3KA 4UIKL 4P7QA 1SMAA 4FQJH 2CDGA 43C9A 3GGWA 1JPSH 4MJIA 4R4FL 1NGYB 2FZ3A 3QEGL 3EYFB 2F54A 5I74C 5K9QI 1EMTH 1CENA 3SJVE 2NT0A 4LBEA 4MCYB 4KU1A 2VDKH 1DN0A 1MJ8H 5I8KL 2G75A 2HJFB 4ZFOA 3AXIA 3GNRA 4PTMA 3TTQA 3QNZB 4PRIA 3FB8A 3AHYA 3QNYB 2FGWL 3D0VB 1IEAB 4O58L 5EBMB 5HPOA 2Y25A 1EGJH 3HNVH 3VXOA 4RAUA 2DH2A 5D8ZA 1A5FH 1F00I 1U8LA 4G80B 2X8RA 1IGML 5HGHA 3GMPB 2CHOA 3VIOA 1CI5A 1R85A 1UH3A 3VM7A 1MCSA 4M93C 1KXQE 4WNQA 3MUZ1 3KDMA 2D1ZA 4HIXH 2NYYC 2QTEA 5F3BB 4JM2D 1Z5LB 4HKBA 3WDRA 2BSED 2V3FA 1AGCB 5C71A 4OZHB 1JHLL 5EWIH 3U1SH 1A1OB 5BS0B 4H04A 1H9VA 2WWMC 4B9ZA 1NFIB 5C0CD 1MHCB 1WZLA 1ZHNA 2OMNA 4ERSH 4LKCA 1KCKA 4WU7A 3DMMB 4ACZA 3N13A 1U8IB 5CILH 4YPGA 2UZIH 4KWUA 5ISZB 2JJTA 4M62L 3W37A 5BQ7A 3N15A 5ADPL 5DHVA 5I1AA 3M7SA 1K8DB 5F88B 4HF5L 3CVHL 3X13B 3N06B 2XPGA 3LAFA 3RZCA 3NH7L 1R5VA 3VH8A 4IUGA 1XZ0A 1CN4A 1XSJA 3QFJE 5HYFA 4Z0XB 4NGHL 4L3EE 2IGFL 3D39B 3X14A 3VJ6B 1P5UA 1TQUA 3KG5A 1CD0A 4JE4B 4D6GA 4NRYB 4M80A 3F58H 4KK5D 1TVPA 4E42A 4FQCL 4N9GA 1G7HB 1C08A 2DWDA 1MHPH 5D93B 3BH8B 3GNML 2R56H 5FYJL 1JIBA 3VA6A 3DHPA 5E8OA 1BD2B 4Z2LA 2DQEH 5I1GL 5K9KA 4HDIB 3VXNB 4QRRD 5FYKH 5HGAA 1PLGH 1MFNA 3SCUA 1MI5D 4JO2H 4L4TD 2DQJH 3SCMB 1GNXA 3LPOA 1IM9B 4HIIA 4DKFL 4NQDD 3RVWC 2CBIA 1HJQA 3MX0A 4PLJC 1E4MM 2A1WL 1MW1A 3ZJ7A 5D6DC 1MWOA 4WO4D 3QDHA 2UVEA 2VLLB 4LLUA 4OB5H 5M7QA 3MA7B 3G9VA 3U82B 1MCBA 1LE5A 2HAZA 2PO6A 2VXQH 3FONB 3LD8C 4X4ME 4APQB 1EGJA 2ARJB 1TXKA 3PWVB 5E6ZA 5GSRA 5GZNC 5FKAB 3LX9A 1BP3B 1A02N 3GKZA 5GGVY 4HG4K 2DIAA 1KR0A 1CL7I 3U9PH 4A4AA 4XPHH 1JZ6A 2Z4QA 4PJBA 4QTHA 1BSIA 3EMCA 1BYCA 3F7YA 3MRDB 4F3FA 3RIAF 2CCRA 4U1GB 1EXUB 3UTTA 3KYNB 4LCCC 5C92A 5KG9A 5C6PB 4Y2DB 1IT9H 2X1OA 2AXGB 2XZZA 3TWCH 1J7VR 1SJEA 2V5YA 3MQIA 3RBSA 5CEZE 2NX5B 2B1HL 3DWTA 5GS2H 1TJHL 2IH3A 2VI0A 1FV1A 4OCMC 1EHLH 4PRPE 4XVSL 5FDWB 3FTGA 2F53B 3VFMB 3MJ7A 5EU4A 4JO1L 4WI9A 2EDQA 3TJHD 3BXNA 4MNGB 32C2A 5J9PA 1GIGL 4QHUA 2NY5L 1DLHB 3SGDH 3E6HB 2G2RB 2ICWI 2R23A 3MV7A 4U49A 4PBVC 3RUGB 2BRQA 3TT1H 3DV4A 5T1KB 5JW4M 3OKKA 4OZFB 3RY6A 3EJSA 3G6JB 1MCCA 2B4CC 4H41A 4AM0B 5IB3A 1JI2A 2NY1B 2GIYA 1JPTH 1M1SA 2HN7A 2O5YL 2VN7A 2Y36H 5MENE 5F71A 4YUEL 3RWIB 4WUUE 4JFOB 2AXFB 3SUTA 3QI9C 5MI0C 4KJWD 2VERN 5E1AB 5A6LA 5EFDA 4PJEA 4PJ7F 5I2IB 1U9KA 1UEMA 1ISXA 4QRUA 2ZCLL 4OF5A 3OV6A 4KTDL 3IF1B 2F74A 2QHRL 2H32B 4OCWL 4ONGL 1QBML 1NUNB 3O9WC 4YEEA 4CN6A 5FO9B 5T33H 3ZTJH 4HHAB 4JFDE 3BSZH 1FNSH 5C08E 5FFLA 5CP3A 2WBJA 3RPIA 4M7ZC 1MFDL 2FLRT 2OJEA 4TNWK 3NFPA 4MMXC 1CGSL 4Y2OA 4P0DA 4Y8AA 1OSPL 5A2FA 2N4IA 4LGPB 3EO9H 3OPZH 3PV6A 4GMSH 4NBYB 3S96A 5GRYA 5T5FH 1P4IL 1OW0A 5E99H 4TUOA 1DANU 4OUOA 3GSOA 3KPNA 2XWBB 1I1FA 1MW3A 3A6BH 1WQVT 4P2QA 4YHLH 3CGTA 2BVPB 3G6AB 3U2SA 2OBGA 2C3VB 4PGBA 1Z32X 4XP9H 4X4YB 2F8QA 1U8HA 1KACB 1WCBA 3L3JA 3SGJA 1C91A 1I7TB 2HRLA 3GSNL 4OCYL 4JGMA 1WDSA 5T1MA 3TBYA 1GPOH 5H37H 5E2UH 1P7KB 2AQ3A 4UFHA 1SEBB 3O0RH 1OAZL 3MMEB 2R2BA 2DQTH 3U0TB 2BNRD 3DTXA 3GH5A 1B0IA 4YIQA 3B2UC 1YNKL 3NN8A 1QR4A 3HMXH 4XNYH 2WVTA 1R34A 3T3ME 3CPLB 3BOVA 3VXMB 2HJLA 3O6ML 5J13C 2AVGA 4IHOB 2D7MA 4NBXB 2AK1H 1G6RL 1W3LA 2CETA 2UY5A 2R4RL 3K74B 3KYOB 5E95B 1U58B 2VAAA 2HFGL 4LEXH 4NZRH 3AHVA 3KPPB 3EMQA 1MJJA 2P5WD 2ZUVA 3T77B 1OP9A 3L3IB 4ZNCD 3W11C 2KDGA 5D6CA 1NDMB 1U42A 1H8OA 5EZLB 4OJFH 3RVUD 1GOGA 1YEJH 1G9NC 1GGCH 2BDNL 3PWPA 1ZKAA 3GBML 3P9MB 3VXUA 1XIWA 2IEPA 1C93A 1A9EB 1AD9A 4MHHG 3K3QA 2WKLA 5KTEL 3WE6A 1QFUL 2XVLA 4MXQC 4ZUSB 2G5BB 4TOYL 4KY1L 4GQ9L 4WU5B 3MRQA 1WFUA 4YDKL 5HHOD 1UQYA 5IBLC 1CGYA 3FQTB 3VWJA 3A6OA 1UZ4A 2AK4D 5I2UA 4KMTL 5E5RB 3U30C 1TA3B 1BEYL 3D25B 3DLQR 3D18B 4P2YA 1GGIH 2HVKB 1AQDA 1LNUA 3EDKA 2WZPD 4DWSA 2IPUK 4Z18A 1XGUA 5FO8A 2WB5A 3H3PH 4MNQB 3HC3L 3TJEH 4YHNB 1LK3H 4GRWB 1R5IA 4I3SL 4Y0GA 2KQNA 4JN2B 2BSTA 3JBG7 4XTRC 1ORQB 4FTVD 5BV7C 2WCAA 4TXEA 1KNOA 2YLAA 5EFIB 2NXYC 3TCLA 1H3PL 2BSRB 3WFHB 4CD6A 3C6SB 4CJ0A 1ZLVH 3MMUA 2H2PD 1T5WB 4K2UH 4XPFL 1C1EL 2H6PB 1ITXA 2WWDA 4MQXD 4PTXA 1KLUB 4BH8B 5T1LB 3V6ZA 1N2RA 1QLEL 4BK4A 5DHYB 3WFEL 4YE4L 1R3JB 2W9EL 1KB3A 1Q9WB 5L0QB 1QFPA 3O4LB 5HHQA 2WXDM 1LP9E 5DK2A 3T0BA 1UJTA 1E40A 4F2MA 2ENYA 5TGBA 1KXHA 1FSKB 4PGJA 2VC2L 3VXRD 3LIZL 1AQ0A 1ZGLA 3A6CL 5A8QA 2WMIB 1TQCB 3HMXA 4BQ6A 4OCRL 1IQDA 1U8PA 5F7DB 1SJVA 2Y9RT 1DL7L 3VFPB 5DJ0A 4D3CH 3SCSA 3P30H 2CJUH 1QBLL 5CINH 1BAFL 5JDSB 4GG6B 1YECL 5KZ6A 3IRPX 3BEWA 1BPLB 3ZKSD 1MCDA 1NAKH 3LZFL 1DVFA 3IFLH 2WINB 2C8NA 4GW5B 4XNXL 4MB1A 1X5LA 3O3BB 5HHVH 3LPFA 5CSZB 3WLWD 3QHMA 3WNNA 2GKIA 1TJGH 1LF1A 3MREB 2AJZA 1CDYA 4RDQF 4WEBH 4YAQA 3U6RB 1JZ4A 3IDGB 1D9KA 2IG2L 3MBXH 1PG7H 1HL9A 5D7SH 1KGWA 2IALB 3RIAK 3ARGD 1B90A 3QR2A 1W91A 3MBEB 4DTGH 4IRJB 1S7XB 4U3HA 4AD3A 1F8TH 2HT4D 4U7KA 1L0PA 2XTJE 4FFVD 4EI5A 4GAFB 1QFWL 4FQ1L 1NOUA 1F4HA 4YHOH 3POHA 5JORB 4M7LT 1ZBWA 3GO1L 2O93L 1ZLSH 5DK0A 4QF1A 5SX4I 1FFNA 4BJLA 1F4XH 3SJVB 3RWEA 4Y19E 4UOW0 1P1ZB 5BVPL 4HS3B 2RR3A 4WSKA 4K94L 4XPGL 4KQ3H 1A2YA 3EW3B 1GL4B 5HJ3A 5D6DA 2D22A 3DPBA 1ZA6B 4RDQG 4UDUA 4ZAKC 2IADB 3MLZL 35C8H 3TBTA 2AGJL 4ELKB 2F8OA 1IFHH 5D9SB 2D73A 4BQBA 2LVCA 3PIQB 2O5XH 5FGCE 2J7LA 4HGMA 4TULH 3BHBB 2DL9A 4OI7A 5AYBA 2EDFA 2J7CA 1AVAA 2CR6A 1ISYA 2OK0H 3L9RA 5ICYA 3CLEL 2X9YA 4XNQB 1FYTD 1T1WA 4PJFE 3UDWC 4WDIA 1OTUC 1ONQB 1JUFA 5D9NA 3MRIB 4J23A 5DUML 2OJZH 2X6MA 4ODVH 3U83A 3O6LH 4R90L 4EUPG 1WCGA 5D9OA 2CKBL 5HVHB 3W29A 2YDQA 3QPQD 1FCCA 1K5NB 4FG6C 1MFCL 4YFEA 3ULUC 5FCSH 2DIBA 1AO7A 1P4LA 4NM4H 5DT1H 1WBZB 5M17A 4QHLB 4PJXA 1ZK9A 3QFJB 3ZYJA 2FD6L 4NC1C 4JRXE 2X4UB 4L3EB 4JAMA 2NTSP 4LEOA 3BFOA 1BZ9A 2GJZA 4OIBA 2E9BA 1TQBB 3MNWA 1KN4H 2C9AA 4M24A 5B38G 1X5JA 3PWJA 4D9RD 1WV7T 5DRNB 5FOJA 1DQJB 1T1XB 4X9FA 1A1MB 4PJCA 3MFFA 2K9UA 3CFKA 1UWTA 1L7TH 4OCSL 4LCIL 1MSPA 4LQFL 1N8ZB 4WI4A 1QSZA 2DICA 2IAND 1T1ZA 4PRBB 1OCWH 1MQ8A 5C07A 1KTRL 1AR1C 1UWUA 3AS3A 3I50L 3QI9A 2CHNA 3PWLA 5HBFA 4XX1E 4NHCL 5FUCE 2LABA 1H5BC 4NNPH 3BAXA 4ZSOA 2C3GA 2Q6WB 4QXTB 2DQGH 4JRWA 3O9WA 4QTIL 2GJPA 1CZ8L 4PMVA 3GSXA 5E6YA 1GH7A 2FL5B 4N0CC 3MNZB 3VFUA 3OLDA 2O9RA 1KIUA 2APFA 3JV6B 5C0RH 1KWKA 3BO8A 1W9PA 5E8EB 1BMGA 4LPVA 3QUMH 3QH3A 4RWYH 2Z31D 3BT2L 2BP3A 5ESVB 1OAXL 4D0DB 3U9UA 2CUMA 1CL7H 3OZ9L 1KTCA 3W27A 4JZJB 2ADGA 3CV5A 1IAIL 1Q0YL 2RGMA 4MADA 2WKGA 3P11L 4NDMA 4OI9A 4P5TD 3BPLC 1RZGA 4XNMA 3DXAD 1NL0H 1TPXC 4EQ3A 5ITFA 4HFUL 2JIXD 1MAML 3IFPA 5TH2B 3RNKA 4PG2C 3HAEG 3TA3D 2ZPKH 1J8HA 5BRZD 4OGXL 5JUVA 1MREL 4PRPB 3C5SB 3MMWA 1F42A 3EJYC 5J7CC 4TSBH 2XFYA 2NY3D 3UBXI 1NCWL 4EDWL 4OD1H 5CJOH 1FH5L 3CFBA 4KROC 4HXAL 4UU9A 4LLQB 1WC7B 3F7PC 1A14H 4NO3B 1VF8A 4G5ZL 4NUGL 2E27H 3L7FA 4HV8A 5F1KC 5C8BB 5I1JH 1CBVL 1UXWA 4QWWC 5ERWA 3MR9A 4N5ED 4BQ8A 1HNGA 2AJYL 4K3EL 1DEEB 5JNYB 3W2DL 3MGTB 3FQXB 4RSVA 1NAMH 5MENB 5FV2A 5CBEB 2DEPA 3BLPX 1T6WA 4WUUB 4UFMA 5I66B 3W6MA 4PGEA 5EDXA 4X0NA 1WB0A 1JNJA 5F9AC 3WD5H 3WY4A 3QULA 2CIIB 3BQUD 4X80L 3GIVB 1RY7B 1E27A 5KSAB 4UQ2A 1R7AA 4JFDB 2YBRA 3RWHB 1UQSB 4JO3L 3BGFB 4UCFA 5C08B 5GXBB 2J74A 4RBPH 5LWYH 3MROA 1E0OB 3ARWA 1AXTL 4K7FB 3WQWA 3RGVC 1TTGA 1UH4A 4RGMC 2J6EH 4M8UA 3GBLA 2IGTA 1N0LA 1GZQA 2KL6A 2VE6A 4LP4A 4OCNC 4YHIA 1MY7A 1N0XL 5I8OL 1LO0L 3MZGB 5CJXC 5DR5L 1ODZA 3QUMA 1L7IL 4TPRH 5EIIB 8CGTA 4HCRH 5DDHB 1RUPL 5IB2A 2WWKO 1ZHBA 5EULV 3V52L 2NW2A 1INDL 5HGHB 3VDAA 5BS0D 2JELH 4PV8B 3WKZA 5C3LD 4JPWH 3O6FD 2BHYA 2YL5A 4M1RA 4YHZL 4LIQL 4FZ8H 5DJCA 4EN3D 1VEMA 4JDTH 5KOMC 1LK2A 1T04A 4AT6B 5D4YA 3QA3A 5JW4R 3DX2A 1ZANH 1U0QA 4UQ3B 3QOMA 3X12A 1R3HB 4BELD 4JFFE 1YY9C 3W5MA 5BXSA 1J10A 4GI6A 4AD4A 4PJ8D 3W4RA 4BZYA 3B9VA 4ACZB 3FQNA 4LHJB 3UP1A 5DEZA 5JMOC 1JNNL 4HEPG 4H8HA 3WNKA 3L4VA 2XM1A 2ICWA 3KR3H 2C4FT 4PJ5B 3TZVD 1SM3H 3KNBA 2Y7QB 4NUJA 4D1IA 2P24B 4WIQA 4HU0A 3MACL 4FA8A 3ULUH 1E4NA 3BKJL 1KFWA 5IF0B 3CUIA 1N26A 4HD9A 5A6SA 5JW3L 2V2WB 1MCWM 4KQ4L 4C56D 1E6JH 1NAMA 1QI5A 5FYJU 4BA8A 2Q76A 4BH7A 1A3LL 1ISZA 3IYLW 1XSKA 4YDLC 3LS4H 4MHHI 1U8JB 1AQMA 4HZLA 3RX8A 3UYPA 4E42B 3BKMH 1FIEA 1MVUB 1A6UH 3ZM8A 3SCMD 4R2GD 4LNVA 4F7EA 5HYJE 1IM9D 1KIPA 3CFDB 4WW2C 5ABHA 4JKLA 3LMYA 2E7LC 2NMSA 3RL2A 1NGQH 4WFGD 3UTPD 1IZJA 1E4KC 2NCMA 3FQWA 4LCYB 2YEZA 2VLMD 4X83A 3V95A 3WHE1 4JHZA 4EDXA 3HB3D 1CFVH 2BOBB 5T5NF 1AIFA 1QSVA 5CIPB 4N0UA 4APQD 4ONHB 1J87A 1KCSL 2J6EA 1ORSA 3B9KA 3TNMA 3T2PA 3VINA 2ZG3A 4P7OA 5CHNA 3CLFH 1FVCA 4QT5A 2GY5A 4I0PD 1G0YR 3P0YL 4RMQA 4IS6A 2QPSA 1MFAH 3ETBF 1NCUA 4IM4A 2GK0B 4JANA 3MUGA 1EZVX 2CLZB 5C2BH 3PP3K 3M17B 1TCMA 1DBAL 1K85A 3IT8D 3UXFA 3AREB 1M7XA 4QYOB 4UDTA 4X99B 4YR6A 4ZAKA 3CK0H 3E6FB 4KXZH 1LLOA 5E6IA 1EFXD 2R1YB 4Z7NF 3D69B 1JHKH 2OYMA 2GFBB 2F53D 2JCCA 3ZTNL 5T3XE 3HMWH 3MUJA 4Y16B 1ZHLB 3CCHB 3KXFE 1Z9SA 2X4QB 1NGZA 1PSKH 1CLCA 4TSCH 1BVNP 3H8NA 5IEHB 4QCFA 3GRWH 4DUXA 5E2VH 3MJ7B 5HPMA 1INEL 1JN6B 3T3PE 5JXEC 4KKLC 2YPKA 2CYGA 3MNVB 1KB5H 1KTKE 2FJFA 3SGEI 4IRZL 5JPNB 1SJHB 4W8LA 2NY1D 1Q94B 1F58L 4MAYA 3ZDXE 4MAUH 4DKAA 2A3EA 3DRQA 1I8IA 4JZOB 3WF3A 5EC1B 3BX7C 3MLRL 1UWEL 2C1PA 3NIFF 5GQBA 1XGQB 1PKQE 3QXUA 1I1XA 1FL3A 1V3MA 1FZMA 4D71A 3ARBC 4KRLB 4WV1C 1ED3A 5TQ2H 5HGBB 5C0BE 3AROA 5IROA 4U1LA 4R0LB 5F3HB 2VLJE 3WL9A 4WI2A 2WMHA 2EPMX 6A3HA 4XCEB 3GH7A 1KJ2L 3PJSA 1M71A 5HOSA 4CW1A 3L4UA 3MXWL 5I19L 2FBJL 3AS0A 3H9HA 4IDJH 3TVMD 1QO3A 2IFFL 1ZGLM 4PLKD 3N1PC 2VDLL 2JB5L 3ROOA 2PCPB 3TYGH 4Y19B 3VNYA 1ZE3C 2C3XA 4AZ8A 3MOAL 2DLTA 5H2BA 3KPTA 1ISWA 4XH2A 2HA1A 3SDAB 4C4KO 1FNEB 1X9QA 4GAGL 2VDPH 4KHTL 4S0SD 2XI9A 2NNAA 4JY4A 1JK8B 3H7BA 4XRCB 1QTYT 2B2XL 5D5ME 4MX7A 3LXCA 2D3LA 2EZ0C 3VX1A 1I1FB 2R2EB 4M5ZL 4YK4C 1YEDA 4E9LA 1Z3GL 3BYTA 1LEGB 1ZS8A 3K80A 4P2QB 4FFZH 4PJGF 3GXIA 3VIHA 1TENA 3WKNA 4FMKA 3TN0B 1A7NH 4OZIF 3WF4A 5FGCB 5LXGH 2DJUA 4PFEA 5KEZA 3RJQB 5ICXB 4U6TA 4NWUH 5FB8A 3UTSA 1Q0XH 5EBWA 1IC7L 1FZOB 1RUMH 5JZ7C 1V5JA 3WIHL 4Y4FC 3O2VL 5TQ0L 4I48B 1IAKA 4PJFB 3BZDA 3TBYB 3H42H 5J6GB 3SBWC 5D1QB 5F7NC 1UR0A 1Z0NA 4IPNB 1I9IH 5I1CL 1CDBA 4NN7C 3U0PB 3PG2A 4ZO7A 5KJRL 5DT5A 3NDYA 5FF6A 3T4AB 5SWZE 5KZCB 3HG1E 5D1ZA 4LMQE 2AERT 3ZE0E 3QFDA 2O92A 3NZHH 4K9EH 3LY6A 1KB5A 3I84A 4K8RL 2L7UA 1NLBH 1GOWA 2JJSC 3VXTA 2EPLX 4FN0A 4NSKA 4HUVA 2EACA 4G42B 1BFVH 4JRXB 4BA0A 5D8JH 1YY8B 3G6DL 4FQQA 4MJ6B 1MCOL 3ULVC 2EDKA 2RBLA 1Y6KR 1Z0MA 2XPKA 1QVBA 4GRLA 4V1DD 1UACL 1CR9H 4PRNA 1BQHG 4N8VG 1MRCH 4HUNB 1G7IA 5T3XL 3BCFA 4MNHB 1KC5L 4MLSA 4AD5A 2KKQA 4NZJA 3NCMA 2EDYA 2QADC 4X6CE 4W5ZA 2E9IA 4JVPA 5DD0H 3SCTA 2OSWA 4CD8A 4W84A 3RIFF 3SEPA 3HUJF 1XCQA 1HH6A 2OR8A 5IMLB 3UROR 3ZJKA 3M8OL 3HRZB 1PG7X 1YEHL 3DDGA 3ILQD 3FO2B 3X3FH 5D70H 3MRNA 5E8PA 1X5ZA 3P73A 1NFDF 3VXSD 1KG0A 2OYKA 2I9TB 4Q7DA 1J8KA 1XGPA 2X05A 5T3ZD 4Z7QF 4BFIA 2XZCH 1EEQA 3OAUL 1LEIA 2Q7YB 4Z7UF 3GJEB 2N7BA 4RGOH 5KSUB 4PP1C 5I74B 2OR7A 3TEUA 4JN1H 1U3HA 4CDGC 1AXIB 3IXTA 1D5XB 4U6YB 3RNQA 4XMPL 2WMKA 3RTQC 3T65B 3UCRA 3VG9C 1L6XA 3ORJA 3C5JB 5MEPB 2XFRA 5DD5L 2CKRA 4G6AC 4D9LL 2HVJA 3LQZB 1UJ3B 3ARFC 2C7UB 2OWCA 5E2WL 1N2RB 3GIZL 4L8DB 5F7LB 4L4VB 2W91A 4OFDA 1UUQA 3SCPA 3LV3A 4PG9A 1EEZA 3MRCA 4F15B 5C09D 4M93B 5GS1A 2IBZY 4P46C 1RU9L 2FSEA 1CDHA 4XPAH 1WWAX 3LN4A 2Y8KA 4FNLL 3L4ZA 1IQWL 3LEVH 5CJBA 2ZCKH 1LEKA 2WK2A 1I9JH 1AKJA 5MEOA 5LG1A 4NKIH 1BTCA 3MFGB 4MMZC 2YA0A 2VZSA 5EOCL 4AJ0A 3AHTA 2QMJA 3S6TA 4NO0A 4UV7H 4WFFD 4XNUH 1AXSA 2HWZL 1K2DA 4KK6D 2GUYA 3FB7A 3P0VL 1NCDH 3PZIA 1PG7W 4V27A 2CIKA 3QXDA 4GW1A 1ZLWK 4PRDB 2HLFD 3TLRA 3BSGA 2NY2D 1F90L 2AJSH 4UZSA 4FNSA 1QVOB 4GKNA 1E43A 4PMNA 2IPTH 1WZAA 2O5ZH 4P4KA 3CHCA 2A6KB 5HDRA 2BVOB 5IW6A 4QRSA 4HK3N 5DEGA 1JGDB 4NC1E 3D0LA 3CX2A 4O51B 2A2QT 1N64H 5EOQL 4JZNB 3KE0A 1N6QH 1VFAB 5F1IA 4GO8A 5K9JH 4P57B 5JHDB 3ZYIA 3IK2A 5C2UB 2GJ6A 4PRHA 1F11B 2LAAA 3D6GA 1UYQA 3NUKA 4OQTA 1EJOH 1F4YL 3O2DH 1OAYH 2PWEA 3HFMH 4Y89A 2DSKA 3VGFA 3WS3B 1GOKA 5GRUL 4EI6B 4GZEA 5DMKB 2DLFL 4DN4H 4AZIA 1A1NA 3HE7C 4Q9QH 2ITDB 1RMFL 1GOFA 5SX5H 3MLSH 1X4ZA 2W0FB 4R4BB 4MTVA 4WW1B 3BVNA 5K59E 3ARTA 4DO5A 1QP1A 3IANA 5BWFA 1D6EA 4DZBB 1KSRA 5A2BA 4JFXA 2XWTB 4M9OA 4F7CA 1QR1A 3VMPA 4ZTPH 1HP4A 3RVVC 1QG3A 2VRAA 4HX1A 1NMBH 4M5YL 1ZVSB 5B8CB 2D7NA 1NLDL 5ADOH 1LO4H 2F2HA 5JDJA 4PUBL 3BP5B 4XVUD 3WSUA 5LA2A 3OHXB 3LD8B 3QQ4B 4JJ5B 1X5KA 5HHXL 3TTSA 1URLA 4HKZA 4PTUB 3LKQB 1VFMA 1QFOA 1WK0A 5DJ8A 4QCIA 4K3GA 3OR7A 5EA0L 3U36B 4LPTA 1FN4A 4JFFB 4O9HL 1JRHH 5I8CB 2E9JA 1JWSB 2EBNA 4Y4KD 4IOFD 2G3NA 2B0SH 5T3ZL 3UBXA 1JAKA 4LCCB 3VFOB 3MUIA 5DO2D 3QUXA 1H8SA 1EA9C 5ESQB 4U4BA 3TNNA 5GGTL 1U8MA 3FT2A 5IHUL 4FXLA 4PJ9A 3A5VA 3VXPB 1LJYA 5DJ6B 3N50A 1AD0A 5D1XD 3O2LA 3TO4C 2EPOA 2BNUB 2OTUA 3T1WA 3AU1A 3AM8A 4KI5C 3F6LA 5ESAA 1OCQA 2XIIA 2XWJA 3MYJB 1QACA 4JAMB 2W0LA 3GMQB 1X3DA 2VNCA 4Z8FH 3BUYA 4G9FA 1KPUB 2XWDA 3RVTD 4JQXA 3VG0L 4M9PA 2J75A 1YNLH 2UWEE 5A2JH 2HLAB 1K4DB 2IPUG 4OLYH 4YDIL 1J5OL 1D5ZB 1JGVH 2HFTA 3ULVH 3CDGB 4HWZB 3BLKA 3Q6FA 5EO1B 2YD4A 2FYYA 4GJTB 1OARH 1MELA 3CU7A 5HYJB 4X9HA 1KPRB 4PS4H 4XP4L 3RJYA 4UOZA 4PB9H 2B7DT 2VDML 1GHRA 1Q1JH 5E08L 1CEOA 1BOGB 5J57B 3O2DA 4S3JA 4X0KA 5MI0B 4P3WA 1AJ7H 2I60L 4M7LH 5IB5A 2FX7H 1AGFA 4WSJA 4LAQL 1Q6FA 4IIQA 1WWWX 5D2NC 2FCBA 1JWUB 4Q97A 4X9IA 1RJYB 1UOKA 5D9PA 5EZIL 3O9WB 4PJDF 2PKDA 3OAYH 1WFOA 4NNYA 4X6BB 1L8NA 5EB8A 1S7SA 1VRXA 2VXTH 1HSBA 2H9GA 4POZC 5HHNA 4H88L 1QRND 5H35A 4M7ZB 3ZSTA 4NZFA 4UT7L 4OKVB 3AI0A 2FJGB 4PJ7A 3KLHD 4PJAB 3KPQA 4J2XA 3V9FA 3KYKL 1QSFD 1CICD 4U6XA 5EIQA 1J18A 2UY7A 1PZ3A 1QI3A 1FHLA 1CQYA 4KV5E 4H20L 2PYEE 4IOIB 3UJJL 4U1IA 4RFEB 1VERA 1OSZA 3CZEA 3G6JF 2Y72A 5JA8B 4N0YL 2EIDA 2DSUA 2A6DB 4XXDB 2N56A 3IDXL 4WENB 4LOUD 5ANME 2IUZA 2Y5EA 2X70A 3RIFK 4Y4FA 1BWMA 3ARYA 2R8SH 4Q0XL 5MHSE 1PEWA 1ZHKA 4BUHA 4W7UA 2WBGA 4GG8B 3V6FA 3B2VL 3NGBC 2BK8A 1GOHA 1UKQA 5I23A 2QQNL 4PYSA 5CPSA 2OLHA 3N9GL 3CBWA 2DQIL 3RU8L 3F7QA 4IMKA 3L7FB 1C7TA 4J3SA 4KJPD 5L2JB 4PEEA 3VWKC 2BNJA 4LPYA 1NCAL 1C5DB 5J13B 2J5LC 3WD2A 1PKQB 5D7LB 2ZG1A 2ATPB 3CFCH 3QCUL 4P8XA 4MPKA 3O11B 4OF8A 1XGTB 4OZFG 5EU7C 1KCRL 1QUNA 4Y4HB 5C0BB 4L8SA 2BHUA 3KPRD 1FL6A 2VLJB 1EOMA 4HFWA 1T1YB 3RAJL 3F5WB 3VCLB 2CDEA 3PDOB 2X4NA 4RZCA 3U7YH 3RWJA 2A77H 4GXUM 4MJID 3HG2A 3W26A 3Q5YA 2CGRH 2F54D 4WY7H 1JZ5A 1UWRA 4OFYA 3ARUA 1HHKB 1N6UA 5A3IC 2UY3A 2OWWA 4ZNEE 3KJ4B 4GZJA 2D7OA 4PJIA 4FQXB 1NC2B 2RFXB 1ZBCA 1IAII 3GSVB 4NPYA 4PRID 4WF7A 3VA2C 2QPUA 1N7ML 1V02A 5A16A 2DTSA 3QIWC 3L3OA 3P3YA 4KRNA 4HS6B 4KK8C 3IS1X 3U30B 1PX8A 5I1LA 5JXAH 4HIJA 5D5MB 4HC1L 3JWDC 4K23L 3UPAA 3VSTA 2X1WL 3TV3L 1UD2A 5D9MA 3UJTL 5HI4D 5CCKL 2YD6A 5ID1A 2PWFA 2X7LA 1A7RH 2PWDA 2DYPB 2Q8BH 3O3EB 4NWTH 1QSEA 4QGYA 1OHQA 3CUGA 1YEFL 3T0EA 2ZSVB 4PD4K 2HRPH 5I8EB 5INDB 5BV7B 3WHXB 1U30A 2Z8SA 2VUYA 4DVBB 3KLLA 3TBSB 2NXYB 2XZQH 1Y0LA 1YPZE 3U5UA 4LARH 5TDPA 1UB6B 3C6LA 4XCYB 1ZEAL 5C8JB 4M6NL 3FT3A 3A22A 4YHPA 5SWZB 3QUZC 4EUPH 4GLRH 5KVGL 1YEGL 4DVRH 5IM7A 4PJ5D 1G7JA 1P6AB 1J1XH 3NZ8A 3WELA 4NQSA 4HTYA 2AJ3B 4F8QA 2Z0BA 2UYLB 2YD9A 2BHZA 2XNAB 5ACZA 1CGUA 1HQRB 3PGFH 1TVHA 4KTEL 3PZGA 3HZMA 1Y7VA 5C0AA 3HKFA 2VVNA 4XGZA 1KCVH 1U8KA 2WV3A 2VQ1B 3ZZ1A 1EHXA 3DROB 2D7TH 3LCYA 4EKJA 2ADFH 3MRHA 4L8BB 3FCTA 1CIDA 5C86A 2A3CA