3K9AA

Crystal structure of hiv gp41 with mper
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
82
structure length
82
Chain Sequence
GSGIVQQQSNLLRAIEAQQHLLQLTVWGIKQGGGGSEWEREISNYTDIIYRLIEESQNQQEKNEQELLALDKWASLWNWFDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of HIV gp41 with the membrane-proximal external region
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords HIV glycoprotein gp41
total genus 37
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2009-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k9aA00
2MK3A 1DLBA 1EBOA 4JGSA 1DF4A 2OT5A 2EZPA 1QCEA 1I5YA 2X7RB 1SZTA 3M99B 3P30A 1K34A 1Y4MA 4JPRA 2LP7A 4E2LA 5KA6A 1Y66A 3B8MA 1JQ0A 2P6JA 3H01A 5CMUA 4N23A 5HFMA 3CP1A 1QR8A 1QR9A 3MHHC 2EBOA 3GWOA 3MHSC 4JF3A 1JPXA 4FJCC 4N21A 5H9CA 1I5XA 2M7WA 3B8NA 3K9AA 3B77A 1ENVA 4FK5C 4FIPC 1K33A 5CN0A 5HFLA 1QBZA 1DF5A 1MG1A 1MOFA 5KA5A 4G2KA 2EZOA 3WFVA 3CYOA 1F23A
chains in the Genus database with same CATH superfamily
2AHYA 3E22A 4IHJA 3SPCA 1EFRG 2WSSG 5EC1C 3JD4A 1I08A 4GLXA 5EC2C 1NTMH 3CXHF 4GT1A 4YY3O 3JAKB 3LSUA 2VQEO 1JR9A 2RNBA 1D2DA 2UXDB 5IY5B 2HJDA 1S77D 1TA8A 2ILMA 2MK3A 4DR4O 3OR6C 5DN6G 5GONB 4ICGA 3IAYA 2ZT9B 3FD9A 2X7RB 1SKVA 3BABA 3S3XA 5E1AC 4K3AA 2ZM6O 3FX7A 5KUKA 4LR3A 2QEXV 5GTIZ 1I5XA 4FMTA 4PA6A 4FK5C 1WPBA 3DC5A 4O2AA 5HFLA 1NZ6A 5BZBA 1QQCA 2QWPB 2E75B 1L0NH 5KUMA 4MVUA 4PA3A 2WLHA 3DXRA 5LOVB 4WFGA 2LJ2A 1PKXA 3OW2U 4RAIA 3ZN0A 2D2CB 3B8MA 3ZHSA 4RUEA 4H13B 2FYUH 5KMGA 4PDLA 2F1MA 3FYEB 1AI5A 3LUTB 2HKOA 4UFZA 1AJPA 1R6NA 1NQTA 3G80A 5AG2A 4B7EA 4HYOA 3A2FA 4GUNA 1RP3B 1N34B 4OX9O 3CRRA 3HR0A 3ZJZA 5IE9A 2QKAA 3SPIA 2DWEC 3E8BA 4I50B 5LYJA 5CBHA 1JJOA 3G67A 3FB5C 1HNZO 3E2EA 4GX0A 4LF7O 5J2TB 4KP4A 4B7KA 2Q8VA 1MNGA 4RO2A 2QGNA 2W0XA 3MHHC 2UXBB 3VQWA 3L73H 4GCZA 1WP8A 3QO5A 1NBMG 1Q6HA 3P3NA 5KA5A 2DMXA 1RPRA 1TUEB 2PUSA 2N04A 3EVKA 5JQGA 3JAWB 4DUZO 4DR7O 2ZINA 3CS5A 4P9OA 1IXMA 3P32A 3K79A 1Z5VA 2VQFB 3ZBHA 4HNAA 1Q86W 4LF6O 5LA6A 5LP6B 1RM1B 1K9MW 1TAEA 1CEZA 5D5PA 3Q4HB 4NXMB 5KAIZ 2IJIA 1BMFG 4LFBO 1VQ6V 3AG4B 1W0KG 4RQEA 1PP9H 1KB9F 3CC4V 1RPOA 1RFYA 2EBOA 1Y6XA 3T1HB 4X64B 4X1KB 1XUQA 1XMQO 1N36B 5B1BC 2IU3A 4K35A 1DF5A 5LMUB 1KC8W 1S3JA 2NN4A 1PPJH 5CA1B 2KB1A 1HNWB 2IJKA 4X62O 1MZEA 4PDVA 2Q0OC 1K97A 3BY6A 4FFBB 5CMUA 5D5QA 3CRMA 2Q5ZA 1S5HC 1AI7A 1HP8A 3JSLA 5IYZA 1MOFA 4J11A 1YF2A 3FKSG 3E83A 2Q69A 4DV0B 4B3RO 3CJHB 2XTAA 2HHHO 2Q73A 1HNXO 2GBOA 3N2GA 2B1GA 2ZR2A 1QLEB 4W4LA 2QWQB 1M93A 4LBEC 4FLYA 1N0NA 1EN6A 1GN2A 1SETA 4FM2A 3OE7G 4WFAV 2EX3A 4QPKA 1DTOA 4GX1A 2ZE7A 4JV5O 1XOUA 4IL6Z 3KZIZ 4BAYA 4N21A 3H1KH 5J2UA 1Y76B 1CP9A 5L3EA 2OCHA 3WB1A 4J9YB 1ZL8A 2OT5A 2OYQA 1MZFA 4WBNA 3A0BZ 4X65O 2GDSA 1MABG 3HKDA 4QE9A 4H37A 1GO3F 2Q7EA 4NTXA 3TJTA 4IYIA 1XHXA 3H1JH 4JI2B 4LF7B 3CSXA 4DR3O 4IYHA 5IT9N 3B8NA 4TSFG 2JGDA 1KP2A 1UFIA 1GN4A 1PM9A 4X9QA 4YHHO 1YJNV 2QDOA 2HP8A 3GB7C 3RGBA 5JH7A 3H01A 5B5EZ 4F6RB 1AR1B 2DYSB 2BTQA 4O2BA 3ZIAG 3CCMV 5LXTB 4LWSA 3UT5A 2AGAA 3RYHB 5CA3A 1OCOC 4CH6A 1K5SA 2HLDG 5LA6B 2Q0AA 1ZSPA 5IY5C 1P7BA 1JFFA 3W7UA 5HFMA 4KHPO 3VBBA 1K4DC 2CAZC 3J81N 4GKKO 3T1YB 1WN7A 4Q6GA 1XNQB 3C90A 1NT2B 5CB4A 2IJJA 2DQ0A 3AG2B 1OJHA 3CRCA 4LFCO 3QVNA 5FLXN 1VQKV 3OM3B 4I9WA 4LNUB 4X1KA 1AJNA 1N4CA 4MW3A 4X65B 3RFRA 1PNLA 2L35A 2QSAA 2M7WA 1CPYA 1Q90D 2X6CA 4J7KA 4DV4B 1LR1A 1YCIA 4F4LA 2PF4E 1OHHG 3P3PA 3CD6V 4JI4B 4QNHB 2YIBD 1KD1W 2H8PC 1VF7A 3BRCA 3ABUA 1XNRO 1NS1A 2OIGA 4JYCA 2CGNA 3FB7C 4B3MB 1QLEC 2V7QG 1IZ3A 3L9DA 2PGGA 3LSSA 2ZD9A 2ZCEA 2R9RB 3KCYA 1TGOA 1BHBA 2FMLA 1O9GA 5EBLC 4WF9V 1GM9A 1MSWD 1WB8A 3RYFB 4LNUA 4D7SA 4NXNO 2QWOB 3VQXA 3M99B 1Y4MA 1KECA 1BHAA 4DV1B 2JJ2G 1HR0B 4D6TH 4UUJC 1XMQB 1JQ0A 4FLTA 1JCHA 1GM7A 2UXBO 2QM8A 4LF5O 1R6KA 5LXTA 1HNWO 5LBQA 5JQGB 4HBNA 3APQA 2EIMB 3HKEA 4IT5A 2OTJV 2ZDIC 3K57A 2H94A 4F6EA 4MVZA 4TOIA 4EB6B 3IGAC 1AI6A 1YEWA 2XHBA 1X4TA 1FPOA 1JJ2U 2JS5A 3HKEB 4JI6O 1GN3A 1YXBA 2Z0AA 2C2AA 1LUWA 5LP6C 3JAKA 4DR2O 1J5EB 2BSKB 1M9NA 3ABMC 2Q68A 5B1AC 1SQPH 1FFXA 4UCRA 2JRIA 2JGDB 4MVRA 3CCUV 2BOBC 5LOVA 4B08A 1FXKB 3JYCA 1I94B 2CDYA 2Y48A 1YZBA 4DV7O 2P90A 2XAJA 2UUAB 4Q20A 1NR7A 3J7AU 4O2BB 2AZ2A 4F6RA 4BIZA 1O9HA 5JWPA 2JK5C 2IJHA 3QTCA 4I5SA 1XILA 4MSWC 4LF8B 4X66B 1GTOA 1AVMA 4UCSA 5EYPB 4NVPA 3B77A 4X62B 4DR5B 1VQOV 3SPJA 3AG2C 2YICA 2FL4A 5J9PC 4B3SO 1JX9A 1WJZA 2E5LO 5DEDA 4DV7B 4FFKA 3OMNB 1FXHA 3T4ZA 4JI8B 2CK3G 5EZYB 5KA6A 3CEIA 4K8XA 1OZ0A 4EFEA 3HKDB 2JDIG 4LF8O 4YHHB 2QWRB 4I55A 3OAAG 4IHJB 3TGUH 1TVKB 1SQGA 3F5WC 1V54C 1Q5OA 2O57A 2Y4UA 3ASNC 4HAMA 4R8CA 1NKDA 1FFTB 3FAVA 2MW2B 1TVKA 5GW7A 4TT3G 1V55C 2EILC 3LNMB 4PELA 4B3TO 4JZGA 5ITZB 4CH3A 1RSOB 2YC0A 3JD0A 5H6RA 1YI2V 4I9QA 2CTPA 1URFA 4DYLA 2CH7A 1VQNV 2QTOA 3ETQA 1VF6C 5L3BA 1N0JA 3WB0A 2AXTZ 3IC7A 2EULA 3GWKC 4U7NA 1PNKA 1SERA 3T1YO 2ZKOA 1SF9A 4Z2WA 3K58A 4EKWA 4YJ2A 2HJFC 5FPOA 1QBZA 4OX9B 4DV1O 1WA8A 2UXCB 1MSDA 3MDSA 2RN9A 4L8JA 1IX9A 1H2NA 1YJWV 5IYBO 1L8DA 4MTOA 4BR6A 3ASOB 4R50A 1K3EA 1XL6A 1W2BU 5KMGB 4BWAA 3QG5A 1Y67A 5KX5B 3OEHG 4PD4F 1L1FA 3RW0A 4JASA 2M6YA 5B1NA 3RBZA 2XAQA 5F2VO 4MVSA 5IJ9A 1YJ9V 1EZVH 1B6QA 2QTSA 1KU9A 4UCVA 5B3SB 2WLKA 3EXAA 4Z1VA 4U7OA 4YJ3B 3R66A 1NH2D 2R70A 4DUYB 2YXLA 1K4CC 2ZIMA 1VQ4V 2LW7A 2Q7HA 3CCEV 1BE3H 2VWJA 2EJ7A 3RYIB 1GK9A 1S72V 1XNQO 1VEWA 3CPWU 4JI5O 3PN1A 1HDJA 5H5NA 1QU7A 3CJHA 1VQLV 1IBLB 5JCOA 1FJGB 2ZNJA 1L0LH 4LF4B 2KG7B 4O4JB 5C8YB 1DK1A 3W7SA 4O4IA 3K04A 2RDCA 2ITCC 1VF5B 4WFBV 2ZXWC 2LGWA 3UT5B 3SYCA 2F4VB 1QR9A 3OUSA 1PD3A 1SA0A 4FFBA 1UPGA 3H9VA 3ZCCA 1UJWB 1P7GA 3MD0A 4K0KB 3JCUZ 1JFFB 4MT8A 3WFVA 1COWG 1F23A 2HFEC 1V54B 2LQTA 3BA8A 2DYRC 3H1IH 1R3LC 2W6JG 4LF6B 4J7JA 2A3QA 5A2QN 4DV2B 2EIMC 5GONA 1R1BA 1VQMV 4ZOLA 1ROPA 2HEPA 4E4EA 3ETEA 3DC6A 1E79G 2UUCO 1NJIW 2LFSA 3CRQA 3T4DA 3JARA 5JCOC 3BHPA 4YIOA 2X6BA 1I5YA 2XASA 4X8AA 4I4TB 1ZX3A 1XNRB 2FB5A 2ZNIA 1Q3EA 2QM4A 4FIPC 2LW1A 3IC9A 4JI6B 3K59A 1Z5WA 4JV5B 2N05A 2WLLB 3A0HZ 1OV9A 4JTCB 1JA8A 4WBNB 1Y74B 1QCEA 1I0HA 1A32A 4H44B 1GH6A 4IGGA 1V9PA 5BR8B 2E3CA 4KXRA 2DWDC 2YXYA 4HZ3A 3ZHRA 1AB3A 2EILB 2DE0X 4P30A 3KCXA 3UKMA 4X20B 5IWAB 3SJAC 1J5EO 2AZ0A 3ABMB 3A8TA 3LDDA 1M1KW 2UUAO 1WLEA 4PV1B 1B3QA 1H38A 4WCEV 4B3RB 1K7DA 3L70H 1ZLZA 5B3SC 3BEHA 3CCVV 3K0GA 3STLC 3I5DA 2FTKA 2NNUA 2GTAA 3JALB 3BCCH 5LHHA 4JGSA 5B1AB 2QKSA 2YUAA 3G71V 5EBMC 3U10A 2ZE8A 1I7FA 3LDEA 1KP3A 3GVMA 4O4LB 3L71H 1K5QA 2XOKG 1D5AA 1Q6UA 5K1PA 2WAMA 4J80A 2YS8A 2KG7A 4O4JA 4TV8B 4DR5O 1GAXA 5KHKA 2UUBB 1XMOO 3APOA 2YEVA 1M90W 1KKCA 1VF6A 4P2ZA 2YIBA 1Q82W 3HKCB 1VQ8V 3BPZA 3EHBB 3ZMUA 4KL1A 4X20A 2Z5UA 2B9ZA 2EIJB 3HKCA 3AG1C 4LH7A 1AILA 2YEVB 3ZN1A 3BAAA 3MAQA 3ASNB 4J42A 3K06A 2QA4V 2NR5A 5ITZA 5FL7G 3THOA 1YDXA 2ZE5A 3BFRA 2W6IG 4J7ZA 1Y74A 3RYFA 1PNMA 4LF9B 1R3KC 3N27A 3RWRD 5BMVB 1PL0A 5CB4B 1WP7A 4FLXA 3D36C 4Z1MG 3RVYA 2ARHA 3ML0A 4JI8O 1EM1A 2NLJC 1FXVA 4MVMA 3NR7A 5BXZA 1FYJA 1Q7YW 2ADPA 4I4TA 4UCOA 2GTSA 1K33A 2XAFA 1FS0G 1IXBA 3ZEDA 4JAVA 2E74B 3SDLA 1BGYH 4YJ3A 4X88A 3AK1A 4I0XA 3CWBH 2UXXA 4H0LB 4DR3B 4DV5B 1KQSU 3MHSC 4D7TA 1KUQA 4B3TB 2WLIB 3ZHTA 4PA7A 4DR4B 2QWNB 4QGPA 2GV9A 4G28B 4G2KA 2HVKC 1DF4A 1SRYA 1S76D 4CS4A 3HKBB 1V55B 1SZXA 4JZ2A 2YXHA 4UVBA 5E79Z 3T1CA 2WLLA 4E2LA 1VIBA 1OCRB 5B1OA 2DW4A 1Q81W 5FNVB 4ZI7A 4J9ZB 4DV5O 3DTUB 4TUYA 5CA0A 4ASUG 2IH3C 2ZM6B 3K5OA 1BQZA 4FZ0A 1NVPD 4JTDB 2F66C 4TUYB 5CA0B 2OWOA 2RCVA 3WB2A 3OFNG 1HNZB 4DRXA 2WLJA 3JD1A 4AQYO 2CGOA 3ABKB 4GKKB 4MVOA 4O2AB 2UU9B 2R9AA 1ZTEA 2P4KA 3K9SA 2D3OW 3JD3A 2RMKB 4QPJA 5LMNB 4UV8A 4UB8Z 1U96A 1HW7A 3S3WA 2DOSA 4IIJA 5LGUA 4AQYB 2DJVA 2DYRB 1EN4A 4JI3O 2ZIOA 3K08A 3L72H 3A0RA 2WPDG 5EK0A 5H9CA 1VQPV 5B1BB 2YDEA 4PA9A 5EYPA 3JAMN 5KHGA 1HR0O 1KYOF 4RWUA 3H1HH 3SJBC 1M56C 1ORQC 2EIJC 4LFBB 4LC1A 2LFRA 5EIBC 5JVDB 2KQXA 4LCUC 3UQ8A 3F5TA 3NXSA 1XQ8A 4JI3B 2JGUA 1QHTA 4MVQA 1G8MA 4PDRA 1RM1C 5IJ0A 2LO1A 3ZMZA 3ZX6A 1F51A 1GKFA 1ZUQA 1N36O 3VQYA 3D36A 2Y4TA 2G38A 2R9IA 1H2MA 3KKYA 3LDCA 3JCZA 1IBKB 4DR6B 3CXCU 4DW1A 3JATA 2WWWA 1G6UA 4C7UA 4O4HB 4XDLA 1OCZC 2YI8A 3N2KB 5K1XA 4CC5A 1FXKA 2EINB 2EIKB 2P5OA 3UO3A 1H2SB 4EFBA 1WAZA 5KX5A 2CTWA 3E8FA 2L6LA 3G4SV 4L87A 1P49A 2F43G 1EN5A 1FXKC 4JYBA 1PV0A 2WLMA 4U3JA 4QJFB 1W59A 4W4KA 4GKJO 1IDSA 4X1YA 1SC5B 4UV9A 4NYKA 5IYCO 4B3SB 3JARB 2WLIA 4DV3B 2LGQA 1P4RA 2OTLV 4CZZA 5JJJB 5L3DA 3QO7A 2P7TC 2BCCH 2V1DA 1M57B 3FB8C 5KHIA 4FM0A 1M56B 3L74H 1SQBH 4JI2O 2RJZA 2VQFO 1SZTA 3Q4HA 3TCUA 1F4MA 3CRAA 3ABKC 5JJEB 1K73W 3RN4A 1QR8A 3ZHQA 4TV8A 2E76B 2Y0PA 4ZIBA 3ZMSA 2A7WA 2A06H 1FKAO 1Q8IA 2WA4A 4PDMA 5LHGA 1YIJV 3OUFA 1XEQA 4DRXB 1XREA 1M4UA 4JPRA 4BIOA 1QNMA 2JEXA 2OCCC 1NR1A 1KBHA 1H8HG 1AP6A 3FFQA 4LFAB 4DUYO 2Q7GA 1BCCH 3E8GA 2JS3A 2GHYA 4CH4A 1YITV 3N2KA 2BTOA 4DR1O 2PY5A 2A9HA 4AILC 5IYDO 4P9PA 5J2TA 1EBOA 2Q9LA 4YY3B 3RYCB 3VOUA 4PI2A 4XBFA 3ZRWA 4ZOLB 1M5IA 2F93B 3AEIA 4WFHA 4XDKA 1SESA 2DYSC 3JD2A 4UB6Z 2ZQMA 2XAHA 4DK0A 1HNXB 2Q67A 2WLNA 2UXDO 2PI5A 3ABTA 3WG7C 2QR4A 1FAFA 3DGEA 3K5MA 3I56V 1P84F 1Z2GA 1QLNA 3K5NA 1RSOA 2R72A 3CCQV 1YHQV 5IYZB 1VP7A 1D5NA 1S0VA 2BOCC 2UXCO 1US6A 2KKWA 3OMAB 5GTHZ 2YSUB 2PZSA 4UCTA 3JAWA 4B3MO 4CS3A 1X59A 5KLVH 4FLWA 1ZAUA 4R6ZA 4CC6A 4JI5B 3VQVA 3B4SA 4CH5A 4GX2A 5IWAO 2P06A 4KHPB 4JI4O 3CCLV 4DXWA 4CS2A 3JASB 1ZL8B 2P6JA 4LH6A 4ZBMA 3CP1A 1BT8A 4DUZB 4DR7B 3C3SA 3GWOA 1XHZA 1XBLA 2CTQA 4OGQB 5J2UB 3WG7B 1N34O 3ICXA 4ABMA 3D3QA 1H2LA 3QF7A 3F7YC 1DLBA 2RQ6A 4DO2A 3DSQA 3OEEG 3TK1A 1VQ9V 4GYCB 2F4VO 1IBLO 3BVOA 4J10A 2DN9A 2F23A 5EIBD 3ZRSA 3ZRXA 4NXNB 1E1QG 3OTFA 2GUZB 1N32O 2UXNA 4FLZA 1VMGA 1GM8A 1MG1A 5LMNO 2Q6AA 4NTYA 2CE4A 1CXZB 2B5UA 2AW9A 2EZPA 2LP7A 4K0KO 3H1LH 5H6QA 2ZXWB 3W7XA 4NTWA 4MTXA 1N32B 1JOYA 1J95A 1U97A 4DK1A 2QM7A 3KG2A 3AG4C 4MTGA 1BL8A 2HG5C 4RQFA 3U11A 3CMAV 1NVPB 1G4YB 3SR2C 1HWYA 4AHCA 3SJCC 3OD4A 1AP5A 5KAFZ 4LF4O 4UVCA 3SYOA 3WU2Z 4NB5A 5CN0A 1AR5A 1R3JC 3F7VC 1K8AW 1BZKA 1AROP 1NH2B 5EBWC 4LF5B 3T1HO 1XMOB 1XDCA 4NXMO 4U3JB 1LNQA 4DW0A 1OCCB 2ZR3A 2IH1C 1SA0B 4N23A 1YSCA 4FVMA 3ABLB 5A9GA 2PYJA 1WPXA 5BR8O 1Q43A 4DV2O 3RYIA 3R65A 1TUBA 4ZHQB 3E22B 4TWKA 3ZRVA 5L3FA 1IURA 3B09A 2QE7G 5EZYA 4JI1B 4MTFA 5BY1A 2EINC 2WA3A 4LF9O 4FJCC 4NR1A 3K5LA 3RVZA 2B1IA 4MS2A 2VRZA 4UCUA 3TETA 2VS0A 2JEUA 2CTRA 1S5LZ 1IVSA 3W7WA 3ZMTA 1JMKC 1NTZH 1VQ7V 4HNAB 2XAGA 1AJQA 3N2GB 4I0XB 3ETDA 3FAVB 4WFEA 2Y0IA 3OGCC 4JAUA 1KKDA 4G27B 5CBFA 2DQ3A 1VQ5V 1TUBB 5LGNA 4DV6O 2X6AA 4JI0B 4DV4O 3ZHUA 3OGIB 2ADQB 2A0LA 4TQFA 4PHZA 3AK2A 4YXWG 3LNNA 4JI7B 4JYAB 4BW5A 2K1EA 3O65A 3TXQA 3JSNA 5C93A 4DR2B 1EZJA 3J80N 1XI1A 5CA1A 3U0ZA 2CH7B 1GRJA 1Y66A 5LYJB 4YIPA 4LFCB 4LWSB 2UUBO 1VARA 1OCOB 2X0LA 4ZKIA 1PL4A 3SGIA 4PI0A 5H2FZ 2IU0A 2PTMA 1N33O 3LSQA 2EZOA 1XL4A 3BA9A 4UVAA 1B06A 3ZHVA 4JF3A 4CBCA 3IFXA 4GX5A 4UXNA 1S5JA 5CBGA 1NTKH 2ZDIA 3PJSK 4RUFA 3OTOB 1FFXB 1BS3A 1M57C 2ODMA 1QVGU 3ASOC 1YTFB 2P22C 4BW9A 1B04A 2OCCB 2Y69C 3OR7C 1QVFU 1K92A 1F7YA 1IBMO 2H3OA 3JALA 2PYLA 4EEQA 3CX5F 4I55B 4FPPA 5DECA 4FZ1A 3CCSV 3SYPA 2JIZG 4DV6B 1Y76A 3AK3A 5LGTA 3M8AA 4X1IB 1ZWIC 5LL6Y 2GUZA 3ZMVA 4NKGB 3K9AA 4DV0O 2VWKA 3TXSA 2VQEB 3CYOA 5IJ0B 3CCJV 3E89A 4GZRB 1N8RW 4JI7O 4WFFA 3SYAA 4TV9B 2FKXA 5B66Z 3SJQC 2ITDC 3QNEA 1NI8A 1R6TA 4K8ZA 4OPHA 3CE2A 1SQXH 1OCRC 5C8YA 3CC2V 3E8HA 5FNVA 4ZI7B 1FD9A 3HPLC 2V4DA 1MMMA 5JJNB 2P4VA 2UU9O 4TQDA 1Q6IA 5BMVA 3D3IA 3P30A 1LUVA 4J41A 3STZC 3T2MA 4IIJB 1YTFD 2QJ1A 2YIDA 3B40A 1R73A 1BSMA 1JPXA 2BSKA 1FJGO 3OTOO 4FLVA 2IBZH 3AG7A 3CHXA 3E35A 1ENVA 2XNDG 2XT9A 3AG3B 4TV9A 1AR4A 4KUMA 1IBMB 3CB2A 3RYCA 2JVDA 2HVJC 3HKBA 5TISZ 3EFFK 3M7MX 1DGSA 3OT7A 4R7CA 1T5EA 3AG3C 1NU1H 2IM9A 2A79B 3C3TA 4A5UB 1THZA 1G1XB 4GKJB 2Q4PA 2BE3A 4BIUA 4X64O 4OPAA 3UCSC 1SQVH 4DV3O 4JI1O 2EIKC 3K3WA 4DR1B 3O9OA 3RT3C 2YI9A 1MA1A 2QKCA 1H2KA 5L3CA 4X66O 3OMIB 2ETNA 4AI8A 1GMGA 2CUGA 2IW5A 4OXSA 5LMUO 4X89A 1WNSA 1YVWA 4YJ2B 2ATKC 3K0DA 3X2QC 1SQQH 1GN6A 5KHHA 2OIEA 2BTQB 5KHJA 3G6BA 4MW8A 5IJ9B 5L3GA 3UM7A 1H2GA 2EJRA 4JYYA 3FYIB 1OCCC 4I50A 3CMEV 1OCZB 4JI0O 4EB6A 4ZHQA 3FB6C 3ZRWB 2HR3A 2P67A 1I94O 3AG1B 4O4LA 1SQFA 2HHHB 3CC7V 4JYAO 2K9PA 3K03A 3G6EV 2E5LB 2F95B 2ZE6A 1F4NA 4I7ZB 3IJ4A 3CCRV 4PA4A 2JJ1G 2W0FC 4X1YB 5LP6A 3UO2A 4XDJA 1IBKO 3I55V 4DR6O 4JTAB 3X2QB 4O4IB 1BQ0A 4H33A 2XUMA 3B2EE 3DXRB 2KSDA 3QO8A 3W7TA 2UUCB 4FM1A 4O4HA 1N33B 1W0JG 5DM6V 2AHZA 3E86A 4JAAA 1SS3A 3D8CA 3ZS8C 4U3FH 2GSMB 5JH7B 1AI4A 2YIAA 1R3IC 2Y69B 1WA8B 1H8EG 1WB7A 3SPGA 4LFAO 3RYHA 1K34A 2N74A 5IDJA 2PI4A 3ABLC 2Z3YA 4LP8A 4KFMA 3L75H 5LHIA 3JASA 1KMIZ 4QE7A 4QIWF 3SPHA 3SYQA 1E1RG 4FLUA 3ETGA 3HB3B 3JATB 5FPRA 1JVMA 4X1IA 5JVDA 4PJ0Z
chains in the Genus database with same CATH topology
4MTGA 1BL8A 1PNMA 2AHYA 2OTJV 1R3KC 3SPCA 2ZDIC 2HG5C 2H94A 1PL0A 4RQFA 1EFRG 3CMAV 1NVPB 2WSSG 5EC1C 4MVZA 1G4YB 3JD4A 4Z1MG 3RVYA 1HWYA 3ML0A 3IGAC 5EC2C 2NLJC 1AI6A 4GT1A 1FXVA 4MVMA 1Q7YW 4UVCA 5IY5B 1K33A 3SYOA 5CN0A 1JJ2U 1R3JC 2XAFA 3F7VC 1FS0G 1S77D 1K8AW 2MK3A 3OR6C 4JAVA 1AROP 5DN6G 1NH2B 5EBWC 2C2AA 4X88A 1LNQA 2X7RB 1OCCB 5E1AC 2ZR3A 2UXXA 2IH1C 4N23A 1M9NA 3ABMC 5KUKA 2Q68A 5B1AC 1YSCA 1KQSU 3MHSC 2QEXV 4MVRA 2WLIB 1I5XA 4FMTA 4PA6A 4FK5C 3ABLB 3CCUV 4PA7A 2BOBC 5HFLA 1WPXA 4G28B 4G2KA 1FXKB 5BZBA 3JYCA 2HVKC 5KUMA 2Y48A 3R65A 4MVUA 2P90A 1DF4A 1SRYA 4PA3A 2XAJA 1S76D 1V55B 2WLHA 4Q20A 4TWKA 1NR7A 3ZRVA 4UVBA 4WFGA 5L3FA 1PKXA 3T1CA 2WLLA 4E2LA 3OW2U 2QE7G 4BIZA 1OCRB 5B1OA 2JK5C 2IJHA 3B8MA 4I5SA 4MSWC 4RAIA 4RUEA 3ZN0A 2DW4A 4MTFA 1Q81W 2EINC 1GTOA 4FJCC 4J9ZB 3RVZA 3B77A 3DTUB 2B1IA 4MS2A 3TETA 4PDLA 1VQOV 4ASUG 2IH3C 3FYEB 3SPJA 1AI5A 3AG2C 3LUTB 1NVPD 2JEUA 4JTDB 2HKOA 5J9PC 1AJPA 1JX9A 1R6NA 1NQTA 3OFNG 3W7WA 3OMNB 4HYOA 1FXHA 2WLJA 3JD1A 3ZMTA 3T4ZA 1VQ7V 2CK3G 5KA6A 2XAGA 3ZJZA 3E8BA 3ABKB 2DWEC 3SPIA 4MVOA 1OZ0A 1AJQA 2JDIG 5CBHA 3ETDA 2D3OW 3JD3A 3FB5C 4WFEA 3OGCC 4QPJA 3OAAG 4JAUA 3E2EA 4UV8A 1KKDA 4GX0A 4G27B 5CBFA 3F5WC 1V54C 2DQ3A 4KP4A 1VQ5V 5LGNA 3ASNC 4HAMA 4R8CA 1NKDA 2X6AA 1FFTB 5LGUA 2DYRB 5GW7A 2A0LA 4TT3G 1V55C 2EILC 4RO2A 3LNMB 4PELA 3K08A 3MHHC 4YXWG 3A0RA 2WPDG 5EK0A 5H9CA 4GCZA 1VQPV 5B1BB 2K1EA 3JD0A 4PA9A 3QO5A 5H6RA 4BW5A 1YI2V 1NBMG 5KA5A 5C93A 1EZJA 1VQNV 1RPRA 2QTOA 1TUEB 5L3BA 1M56C 1ORQC 3IC7A 2EIJC 4LC1A 4P9OA 2LFRA 4U7NA 1IXMA 4LCUC 1Y66A 1PNKA 1SERA 3NXSA 3P32A 3K79A 1Q86W 1OCOB 2X0LA 4EKWA 4ZKIA 2IU0A 1RM1B 2HJFC 1K9MW 4MVQA 1G8MA 4PDRA 3LSQA 1CEZA 1RM1C 1QBZA 2EZOA 1XL4A 3ZMZA 1F51A 2IJIA 4UVAA 1GKFA 1BMFG 4JF3A 1VQ6V 4CBCA 3AG4B 3D36A 3IFXA 1W0KG 4RQEA 4GX5A 1YJWV 5IYBO 2R9IA 3LDCA 4UXNA 3JCZA 5CBGA 2ZDIA 4MTOA 3CXCU 3CC4V 1RPOA 3PJSK 4RUFA 3ASOB 4R50A 1K3EA 1M57C 2EBOA 1QVGU 3ASOC 1XL6A 1W2BU 1YTFB 2WWWA 5B1BC 2OCCB 2Y69C 2IU3A 3OR7C 1DF5A 3OEHG 1L1FA 1K92A 1S3JA 4XDLA 3RW0A 1KC8W 1OCZC 1QVFU 4JASA 2KB1A 2IJKA 1FXKA 2EINB 4PDVA 5B1NA 2EIKB 3RBZA 4FPPA 1K97A 3BY6A 3CCSV 2XAQA 4MVSA 3SYPA 2JIZG 5CMUA 1YJ9V 3E8FA 5LGTA 1B6QA 1ZWIC 1S5HC 1AI7A 3G4SV 3ZMVA 4L87A 3K9AA 2WLKA 5B3SB 2F43G 4U7OA 1MOFA 1NH2D 3FKSG 3CYOA 1FXKC 3E83A 4JYBA 3CCJV 3E89A 1N8RW 2Q69A 2WLMA 1K4CC 4WFFA 4QJFB 1VQ4V 3SYAA 3CCEV 3SJQC 2ITDC 3QNEA 1GK9A 1S72V 4UV9A 3CPWU 2B1GA 5IYCO 2ZR2A 2WLIA 1P4RA 1QLEB 4CZZA 2OTLV 1OCRC 5L3DA 3QO7A 1VQLV 3CC2V 4LBEC 2P7TC 2V1DA 3E8HA 1M57B 3FB8C 1SETA 1M56B 3HPLC 3W7SA 3K04A 3OE7G 4WFAV 3D3IA 4QPKA 1SZTA 3P30A 1DTOA 3TCUA 2ITCC 4GX1A 4WFBV 2ZXWC 1F4MA 3SYCA 3ABKC 3STZC 3T2MA 1K73W 1YTFD 1QR8A 1QR9A 4BAYA 3OUSA 1R73A 1JPXA 1PD3A 4N21A 3ZCCA 1UJWB 3ZMSA 3MD0A 1CP9A 3E35A 3WFVA 4MT8A 5L3EA 1COWG 1ENVA 1F23A 2HFEC 2XNDG 3AG3B 4PDMA 1V54B 5LHGA 1YIJV 4J9YB 2DYRC 2OT5A 3OUFA 1R3LC 4KUMA 2W6JG 4JPRA 1MABG 2HVJC 2JEXA 2EIMC 2OCCC 1NR1A 3EFFK 4QE9A 4H37A 1GO3F 1H8HG 4R7CA 1VQMV 3AG3C 1ROPA 3E8GA 2A79B 3ETEA 3B8NA 1E79G 4TSFG 2GHYA 1THZA 1KP2A 1YITV 1NJIW 2LFSA 3T4DA 2A9HA 5IYDO 4BIUA 1YJNV 4P9PA 1EBOA 3GB7C 3VOUA 2X6BA 1I5YA 2EIKC 3K3WA 4XBFA 2XASA 4X8AA 3ZRWA 3H01A 3AEIA 1AR1B 4WFHA 2DYSB 4XDKA 1SESA 5L3CA 3ZIAG 3CCMV 2DYSC 3OMIB 4FIPC 3JD2A 2ZQMA 5CA3A 1GMGA 1OCOC 2IW5A 2XAHA 2WLLB 4OXSA 4JTCB 2Q67A 2WLNA 4X89A 2PI5A 3ABTA 3WG7C 1K5SA 1QCEA 3DGEA 2HLDG 5IY5C 1P7BA 2ATKC 3K0DA 3X2QC 3W7UA 2DWDC 3I56V 5HFMA 3VBBA 1QLNA 1K4DC 4HZ3A 4MW8A 5L3GA 3CCQV 2EILB 3UM7A 1YHQV 1H2GA 2EJRA 1S0VA 2BOCC 4P30A 3FYIB 3UKMA 1OCCC 2IJJA 3OMAB 3CMEV 2YSUB 1OCZB 3ABMB 3LDDA 1M1KW 2DQ0A 3AG2B 3FB6C 3ZRWB 1WLEA 4R6ZA 4GX2A 1VQKV 2HR3A 2P67A 3AG1B 3OM3B 4I9WA 3CCLV 4DXWA 1H38A 1AJNA 3CC7V 4MW3A 2P6JA 4WCEV 4ZBMA 3CP1A 3K03A 1K7DA 3GWOA 3G6EV 1PNLA 5B3SC 3BEHA 2M7WA 1CPYA 3CCVV 3K0GA 1F4NA 3WG7B 3CCRV 2X6CA 4PA4A 2JJ1G 2W0FC 3STLC 2FTKA 2NNUA 4F4LA 4XDJA 3I55V 1OHHG 4JTAB 3X2QB 3CD6V 3F7YC 1DLBA 5LHHA 4JGSA 4H33A 5B1AB 4DO2A 4QNHB 2QKSA 3G71V 3OEEG 5EBMC 3TK1A 1VQ9V 1KD1W 3LDEA 1KP3A 2H8PC 1K5QA 2XOKG 3ABUA 3QO8A 3W7TA 2WAMA 4JYCA 3ZRSA 3FB7C 3ZRXA 1E1QG 1W0JG 2AHZA 5DM6V 3E86A 1QLEC 2V7QG 2UXNA 3LSSA 2ZD9A 2YEVA 2R9RB 1M90W 2GSMB 1BHBA 1GM8A 1MG1A 4P2ZA 2Q6AA 1AI4A 1Q82W 1R3IC 2Y69B 5EBLC 4WF9V 1VQ8V 1GM9A 2B5UA 1MSWD 2EZPA 1H8EG 3EHBB 3SPGA 3ZMUA 3M99B 2Z5UA 1K34A 1KECA 1Y4MA 2EIJB 5IDJA 2LP7A 1BHAA 3AG1C 2PI4A 2JJ2G 3ABLC 5H6QA 2ZXWB 4UUJC 2Z3YA 1JQ0A 4LP8A 1JCHA 4KFMA 5LHIA 3W7XA 1GM7A 4QE7A 2QM8A 2YEVB 4QIWF 3SPHA 1E1RG 3SYQA 3ZN1A 3ETGA 1R6KA 3ASNB 3HB3B 4MTXA 3K06A 5LBQA 1J95A 2QA4V 1JOYA 5FL7G 2QM7A 3KG2A 2W6IG 1JVMA 2EIMB 3AG4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MK3 A;  1DLB A;  1EBO A;  4JGS A;  1DF4 A;  2OT5 A;  2EZP A;  1QCE A;  1I5Y A;  2X7R B;  1SZT A;  3M99 B;  3P30 A;  1K34 A;  1Y4M A;  4JPR A;  2LP7 A;  4E2L A;  5KA6 A;  1Y66 A;  3B8M A;  1JQ0 A;  2P6J A;  3H01 A;  5CMU A;  4N23 A;  5HFM A;  3CP1 A;  1QR8 A;  1QR9 A;  3MHH C;  2EBO A;  3GWO A;  3MHS C;  4JF3 A;  1JPX A;  4FJC C;  4N21 A;  5H9C A;  1I5X A;  2M7W A;  3B8N A;  3K9A A;  3B77 A;  1ENV A;  4FK5 C;  4FIP C;  1K33 A;  5CN0 A;  5HFL A;  1QBZ A;  1DF5 A;  1MG1 A;  1MOF A;  5KA5 A;  4G2K A;  2EZO A;  3WFV A;  3CYO A;  1F23 A; 
#chains in the Genus database with same CATH topology
 2AHY A;  3E22 A;  4IHJ A;  3SPC A;  1EFR G;  2WSS G;  5EC1 C;  3JD4 A;  1I08 A;  4GLX A;  5EC2 C;  1NTM H;  3CXH F;  4GT1 A;  4YY3 O;  3JAK B;  3LSU A;  2VQE O;  1JR9 A;  2RNB A;  1D2D A;  2UXD B;  5IY5 B;  2HJD A;  1S77 D;  1TA8 A;  2ILM A;  2MK3 A;  4DR4 O;  3OR6 C;  5DN6 G;  5GON B;  4ICG A;  3IAY A;  2ZT9 B;  3FD9 A;  2X7R B;  1SKV A;  3BAB A;  3S3X A;  5E1A C;  4K3A A;  2ZM6 O;  3FX7 A;  5KUK A;  4LR3 A;  2QEX V;  5GTI Z;  1I5X A;  4FMT A;  4PA6 A;  4FK5 C;  1WPB A;  3DC5 A;  4O2A A;  5HFL A;  1NZ6 A;  5BZB A;  1QQC A;  2QWP B;  2E75 B;  1L0N H;  5KUM A;  4MVU A;  4PA3 A;  2WLH A;  3DXR A;  5LOV B;  4WFG A;  2LJ2 A;  1PKX A;  3OW2 U;  4RAI A;  3ZN0 A;  2D2C B;  3B8M A;  3ZHS A;  4RUE A;  4H13 B;  2FYU H;  5KMG A;  4PDL A;  2F1M A;  3FYE B;  1AI5 A;  3LUT B;  2HKO A;  4UFZ A;  1AJP A;  1R6N A;  1NQT A;  3G80 A;  5AG2 A;  4B7E A;  4HYO A;  3A2F A;  4GUN A;  1RP3 B;  1N34 B;  4OX9 O;  3CRR A;  3HR0 A;  3ZJZ A;  5IE9 A;  2QKA A;  3SPI A;  2DWE C;  3E8B A;  4I50 B;  5LYJ A;  5CBH A;  1JJO A;  3G67 A;  3FB5 C;  1HNZ O;  3E2E A;  4GX0 A;  4LF7 O;  5J2T B;  4KP4 A;  4B7K A;  2Q8V A;  1MNG A;  4RO2 A;  2QGN A;  2W0X A;  3MHH C;  2UXB B;  3VQW A;  3L73 H;  4GCZ A;  1WP8 A;  3QO5 A;  1NBM G;  1Q6H A;  3P3N A;  5KA5 A;  2DMX A;  1RPR A;  1TUE B;  2PUS A;  2N04 A;  3EVK A;  5JQG A;  3JAW B;  4DUZ O;  4DR7 O;  2ZIN A;  3CS5 A;  4P9O A;  1IXM A;  3P32 A;  3K79 A;  1Z5V A;  2VQF B;  3ZBH A;  4HNA A;  1Q86 W;  4LF6 O;  5LA6 A;  5LP6 B;  1RM1 B;  1K9M W;  1TAE A;  1CEZ A;  5D5P A;  3Q4H B;  4NXM B;  5KAI Z;  2IJI A;  1BMF G;  4LFB O;  1VQ6 V;  3AG4 B;  1W0K G;  4RQE A;  1PP9 H;  1KB9 F;  3CC4 V;  1RPO A;  1RFY A;  2EBO A;  1Y6X A;  3T1H B;  4X64 B;  4X1K B;  1XUQ A;  1XMQ O;  1N36 B;  5B1B C;  2IU3 A;  4K35 A;  1DF5 A;  5LMU B;  1KC8 W;  1S3J A;  2NN4 A;  1PPJ H;  5CA1 B;  2KB1 A;  1HNW B;  2IJK A;  4X62 O;  1MZE A;  4PDV A;  2Q0O C;  1K97 A;  3BY6 A;  4FFB B;  5CMU A;  5D5Q A;  3CRM A;  2Q5Z A;  1S5H C;  1AI7 A;  1HP8 A;  3JSL A;  5IYZ A;  1MOF A;  4J11 A;  1YF2 A;  3FKS G;  3E83 A;  2Q69 A;  4DV0 B;  4B3R O;  3CJH B;  2XTA A;  2HHH O;  2Q73 A;  1HNX O;  2GBO A;  3N2G A;  2B1G A;  2ZR2 A;  1QLE B;  4W4L A;  2QWQ B;  1M93 A;  4LBE C;  4FLY A;  1N0N A;  1EN6 A;  1GN2 A;  1SET A;  4FM2 A;  3OE7 G;  4WFA V;  2EX3 A;  4QPK A;  1DTO A;  4GX1 A;  2ZE7 A;  4JV5 O;  1XOU A;  4IL6 Z;  3KZI Z;  4BAY A;  4N21 A;  3H1K H;  5J2U A;  1Y76 B;  1CP9 A;  5L3E A;  2OCH A;  3WB1 A;  4J9Y B;  1ZL8 A;  2OT5 A;  2OYQ A;  1MZF A;  4WBN A;  3A0B Z;  4X65 O;  2GDS A;  1MAB G;  3HKD A;  4QE9 A;  4H37 A;  1GO3 F;  2Q7E A;  4NTX A;  3TJT A;  4IYI A;  1XHX A;  3H1J H;  4JI2 B;  4LF7 B;  3CSX A;  4DR3 O;  4IYH A;  5IT9 N;  3B8N A;  4TSF G;  2JGD A;  1KP2 A;  1UFI A;  1GN4 A;  1PM9 A;  4X9Q A;  4YHH O;  1YJN V;  2QDO A;  2HP8 A;  3GB7 C;  3RGB A;  5JH7 A;  3H01 A;  5B5E Z;  4F6R B;  1AR1 B;  2DYS B;  2BTQ A;  4O2B A;  3ZIA G;  3CCM V;  5LXT B;  4LWS A;  3UT5 A;  2AGA A;  3RYH B;  5CA3 A;  1OCO C;  4CH6 A;  1K5S A;  2HLD G;  5LA6 B;  2Q0A A;  1ZSP A;  5IY5 C;  1P7B A;  1JFF A;  3W7U A;  5HFM A;  4KHP O;  3VBB A;  1K4D C;  2CAZ C;  3J81 N;  4GKK O;  3T1Y B;  1WN7 A;  4Q6G A;  1XNQ B;  3C90 A;  1NT2 B;  5CB4 A;  2IJJ A;  2DQ0 A;  3AG2 B;  1OJH A;  3CRC A;  4LFC O;  3QVN A;  5FLX N;  1VQK V;  3OM3 B;  4I9W A;  4LNU B;  4X1K A;  1AJN A;  1N4C A;  4MW3 A;  4X65 B;  3RFR A;  1PNL A;  2L35 A;  2QSA A;  2M7W A;  1CPY A;  1Q90 D;  2X6C A;  4J7K A;  4DV4 B;  1LR1 A;  1YCI A;  4F4L A;  2PF4 E;  1OHH G;  3P3P A;  3CD6 V;  4JI4 B;  4QNH B;  2YIB D;  1KD1 W;  2H8P C;  1VF7 A;  3BRC A;  3ABU A;  1XNR O;  1NS1 A;  2OIG A;  4JYC A;  2CGN A;  3FB7 C;  4B3M B;  1QLE C;  2V7Q G;  1IZ3 A;  3L9D A;  2PGG A;  3LSS A;  2ZD9 A;  2ZCE A;  2R9R B;  3KCY A;  1TGO A;  1BHB A;  2FML A;  1O9G A;  5EBL C;  4WF9 V;  1GM9 A;  1MSW D;  1WB8 A;  3RYF B;  4LNU A;  4D7S A;  4NXN O;  2QWO B;  3VQX A;  3M99 B;  1Y4M A;  1KEC A;  1BHA A;  4DV1 B;  2JJ2 G;  1HR0 B;  4D6T H;  4UUJ C;  1XMQ B;  1JQ0 A;  4FLT A;  1JCH A;  1GM7 A;  2UXB O;  2QM8 A;  4LF5 O;  1R6K A;  5LXT A;  1HNW O;  5LBQ A;  5JQG B;  4HBN A;  3APQ A;  2EIM B;  3HKE A;  4IT5 A;  2OTJ V;  2ZDI C;  3K57 A;  2H94 A;  4F6E A;  4MVZ A;  4TOI A;  4EB6 B;  3IGA C;  1AI6 A;  1YEW A;  2XHB A;  1X4T A;  1FPO A;  1JJ2 U;  2JS5 A;  3HKE B;  4JI6 O;  1GN3 A;  1YXB A;  2Z0A A;  2C2A A;  1LUW A;  5LP6 C;  3JAK A;  4DR2 O;  1J5E B;  2BSK B;  1M9N A;  3ABM C;  2Q68 A;  5B1A C;  1SQP H;  1FFX A;  4UCR A;  2JRI A;  2JGD B;  4MVR A;  3CCU V;  2BOB C;  5LOV A;  4B08 A;  1FXK B;  3JYC A;  1I94 B;  2CDY A;  2Y48 A;  1YZB A;  4DV7 O;  2P90 A;  2XAJ A;  2UUA B;  4Q20 A;  1NR7 A;  3J7A U;  4O2B B;  2AZ2 A;  4F6R A;  4BIZ A;  1O9H A;  5JWP A;  2JK5 C;  2IJH A;  3QTC A;  4I5S A;  1XIL A;  4MSW C;  4LF8 B;  4X66 B;  1GTO A;  1AVM A;  4UCS A;  5EYP B;  4NVP A;  3B77 A;  4X62 B;  4DR5 B;  1VQO V;  3SPJ A;  3AG2 C;  2YIC A;  2FL4 A;  5J9P C;  4B3S O;  1JX9 A;  1WJZ A;  2E5L O;  5DED A;  4DV7 B;  4FFK A;  3OMN B;  1FXH A;  3T4Z A;  4JI8 B;  2CK3 G;  5EZY B;  5KA6 A;  3CEI A;  4K8X A;  1OZ0 A;  4EFE A;  3HKD B;  2JDI G;  4LF8 O;  4YHH B;  2QWR B;  4I55 A;  3OAA G;  4IHJ B;  3TGU H;  1TVK B;  1SQG A;  3F5W C;  1V54 C;  1Q5O A;  2O57 A;  2Y4U A;  3ASN C;  4HAM A;  4R8C A;  1NKD A;  1FFT B;  3FAV A;  2MW2 B;  1TVK A;  5GW7 A;  4TT3 G;  1V55 C;  2EIL C;  3LNM B;  4PEL A;  4B3T O;  4JZG A;  5ITZ B;  4CH3 A;  1RSO B;  2YC0 A;  3JD0 A;  5H6R A;  1YI2 V;  4I9Q A;  2CTP A;  1URF A;  4DYL A;  2CH7 A;  1VQN V;  2QTO A;  3ETQ A;  1VF6 C;  5L3B A;  1N0J A;  3WB0 A;  2AXT Z;  3IC7 A;  2EUL A;  3GWK C;  4U7N A;  1PNK A;  1SER A;  3T1Y O;  2ZKO A;  1SF9 A;  4Z2W A;  3K58 A;  4EKW A;  4YJ2 A;  2HJF C;  5FPO A;  1QBZ A;  4OX9 B;  4DV1 O;  1WA8 A;  2UXC B;  1MSD A;  3MDS A;  2RN9 A;  4L8J A;  1IX9 A;  1H2N A;  1YJW V;  5IYB O;  1L8D A;  4MTO A;  4BR6 A;  3ASO B;  4R50 A;  1K3E A;  1XL6 A;  1W2B U;  5KMG B;  4BWA A;  3QG5 A;  1Y67 A;  5KX5 B;  3OEH G;  4PD4 F;  1L1F A;  3RW0 A;  4JAS A;  2M6Y A;  5B1N A;  3RBZ A;  2XAQ A;  5F2V O;  4MVS A;  5IJ9 A;  1YJ9 V;  1EZV H;  1B6Q A;  2QTS A;  1KU9 A;  4UCV A;  5B3S B;  2WLK A;  3EXA A;  4Z1V A;  4U7O A;  4YJ3 B;  3R66 A;  1NH2 D;  2R70 A;  4DUY B;  2YXL A;  1K4C C;  2ZIM A;  1VQ4 V;  2LW7 A;  2Q7H A;  3CCE V;  1BE3 H;  2VWJ A;  2EJ7 A;  3RYI B;  1GK9 A;  1S72 V;  1XNQ O;  1VEW A;  3CPW U;  4JI5 O;  3PN1 A;  1HDJ A;  5H5N A;  1QU7 A;  3CJH A;  1VQL V;  1IBL B;  5JCO A;  1FJG B;  2ZNJ A;  1L0L H;  4LF4 B;  2KG7 B;  4O4J B;  5C8Y B;  1DK1 A;  3W7S A;  4O4I A;  3K04 A;  2RDC A;  2ITC C;  1VF5 B;  4WFB V;  2ZXW C;  2LGW A;  3UT5 B;  3SYC A;  2F4V B;  1QR9 A;  3OUS A;  1PD3 A;  1SA0 A;  4FFB A;  1UPG A;  3H9V A;  3ZCC A;  1UJW B;  1P7G A;  3MD0 A;  4K0K B;  3JCU Z;  1JFF B;  4MT8 A;  3WFV A;  1COW G;  1F23 A;  2HFE C;  1V54 B;  2LQT A;  3BA8 A;  2DYR C;  3H1I H;  1R3L C;  2W6J G;  4LF6 B;  4J7J A;  2A3Q A;  5A2Q N;  4DV2 B;  2EIM C;  5GON A;  1R1B A;  1VQM V;  4ZOL A;  1ROP A;  2HEP A;  4E4E A;  3ETE A;  3DC6 A;  1E79 G;  2UUC O;  1NJI W;  2LFS A;  3CRQ A;  3T4D A;  3JAR A;  5JCO C;  3BHP A;  4YIO A;  2X6B A;  1I5Y A;  2XAS A;  4X8A A;  4I4T B;  1ZX3 A;  1XNR B;  2FB5 A;  2ZNI A;  1Q3E A;  2QM4 A;  4FIP C;  2LW1 A;  3IC9 A;  4JI6 B;  3K59 A;  1Z5W A;  4JV5 B;  2N05 A;  2WLL B;  3A0H Z;  1OV9 A;  4JTC B;  1JA8 A;  4WBN B;  1Y74 B;  1QCE A;  1I0H A;  1A32 A;  4H44 B;  1GH6 A;  4IGG A;  1V9P A;  5BR8 B;  2E3C A;  4KXR A;  2DWD C;  2YXY A;  4HZ3 A;  3ZHR A;  1AB3 A;  2EIL B;  2DE0 X;  4P30 A;  3KCX A;  3UKM A;  4X20 B;  5IWA B;  3SJA C;  1J5E O;  2AZ0 A;  3ABM B;  3A8T A;  3LDD A;  1M1K W;  2UUA O;  1WLE A;  4PV1 B;  1B3Q A;  1H38 A;  4WCE V;  4B3R B;  1K7D A;  3L70 H;  1ZLZ A;  5B3S C;  3BEH A;  3CCV V;  3K0G A;  3STL C;  3I5D A;  2FTK A;  2NNU A;  2GTA A;  3JAL B;  3BCC H;  5LHH A;  4JGS A;  5B1A B;  2QKS A;  2YUA A;  3G71 V;  5EBM C;  3U10 A;  2ZE8 A;  1I7F A;  3LDE A;  1KP3 A;  3GVM A;  4O4L B;  3L71 H;  1K5Q A;  2XOK G;  1D5A A;  1Q6U A;  5K1P A;  2WAM A;  4J80 A;  2YS8 A;  2KG7 A;  4O4J A;  4TV8 B;  4DR5 O;  1GAX A;  5KHK A;  2UUB B;  1XMO O;  3APO A;  2YEV A;  1M90 W;  1KKC A;  1VF6 A;  4P2Z A;  2YIB A;  1Q82 W;  3HKC B;  1VQ8 V;  3BPZ A;  3EHB B;  3ZMU A;  4KL1 A;  4X20 A;  2Z5U A;  2B9Z A;  2EIJ B;  3HKC A;  3AG1 C;  4LH7 A;  1AIL A;  2YEV B;  3ZN1 A;  3BAA A;  3MAQ A;  3ASN B;  4J42 A;  3K06 A;  2QA4 V;  2NR5 A;  5ITZ A;  5FL7 G;  3THO A;  1YDX A;  2ZE5 A;  3BFR A;  2W6I G;  4J7Z A;  1Y74 A;  3RYF A;  1PNM A;  4LF9 B;  1R3K C;  3N27 A;  3RWR D;  5BMV B;  1PL0 A;  5CB4 B;  1WP7 A;  4FLX A;  3D36 C;  4Z1M G;  3RVY A;  2ARH A;  3ML0 A;  4JI8 O;  1EM1 A;  2NLJ C;  1FXV A;  4MVM A;  3NR7 A;  5BXZ A;  1FYJ A;  1Q7Y W;  2ADP A;  4I4T A;  4UCO A;  2GTS A;  1K33 A;  2XAF A;  1FS0 G;  1IXB A;  3ZED A;  4JAV A;  2E74 B;  3SDL A;  1BGY H;  4YJ3 A;  4X88 A;  3AK1 A;  4I0X A;  3CWB H;  2UXX A;  4H0L B;  4DR3 B;  4DV5 B;  1KQS U;  3MHS C;  4D7T A;  1KUQ A;  4B3T B;  2WLI B;  3ZHT A;  4PA7 A;  4DR4 B;  2QWN B;  4QGP A;  2GV9 A;  4G28 B;  4G2K A;  2HVK C;  1DF4 A;  1SRY A;  1S76 D;  4CS4 A;  3HKB B;  1V55 B;  1SZX A;  4JZ2 A;  2YXH A;  4UVB A;  5E79 Z;  3T1C A;  2WLL A;  4E2L A;  1VIB A;  1OCR B;  5B1O A;  2DW4 A;  1Q81 W;  5FNV B;  4ZI7 A;  4J9Z B;  4DV5 O;  3DTU B;  4TUY A;  5CA0 A;  4ASU G;  2IH3 C;  2ZM6 B;  3K5O A;  1BQZ A;  4FZ0 A;  1NVP D;  4JTD B;  2F66 C;  4TUY B;  5CA0 B;  2OWO A;  2RCV A;  3WB2 A;  3OFN G;  1HNZ B;  4DRX A;  2WLJ A;  3JD1 A;  4AQY O;  2CGO A;  3ABK B;  4GKK B;  4MVO A;  4O2A B;  2UU9 B;  2R9A A;  1ZTE A;  2P4K A;  3K9S A;  2D3O W;  3JD3 A;  2RMK B;  4QPJ A;  5LMN B;  4UV8 A;  4UB8 Z;  1U96 A;  1HW7 A;  3S3W A;  2DOS A;  4IIJ A;  5LGU A;  4AQY B;  2DJV A;  2DYR B;  1EN4 A;  4JI3 O;  2ZIO A;  3K08 A;  3L72 H;  3A0R A;  2WPD G;  5EK0 A;  5H9C A;  1VQP V;  5B1B B;  2YDE A;  4PA9 A;  5EYP A;  3JAM N;  5KHG A;  1HR0 O;  1KYO F;  4RWU A;  3H1H H;  3SJB C;  1M56 C;  1ORQ C;  2EIJ C;  4LFB B;  4LC1 A;  2LFR A;  5EIB C;  5JVD B;  2KQX A;  4LCU C;  3UQ8 A;  3F5T A;  3NXS A;  1XQ8 A;  4JI3 B;  2JGU A;  1QHT A;  4MVQ A;  1G8M A;  4PDR A;  1RM1 C;  5IJ0 A;  2LO1 A;  3ZMZ A;  3ZX6 A;  1F51 A;  1GKF A;  1ZUQ A;  1N36 O;  3VQY A;  3D36 A;  2Y4T A;  2G38 A;  2R9I A;  1H2M A;  3KKY A;  3LDC A;  3JCZ A;  1IBK B;  4DR6 B;  3CXC U;  4DW1 A;  3JAT A;  2WWW A;  1G6U A;  4C7U A;  4O4H B;  4XDL A;  1OCZ C;  2YI8 A;  3N2K B;  5K1X A;  4CC5 A;  1FXK A;  2EIN B;  2EIK B;  2P5O A;  3UO3 A;  1H2S B;  4EFB A;  1WAZ A;  5KX5 A;  2CTW A;  3E8F A;  2L6L A;  3G4S V;  4L87 A;  1P49 A;  2F43 G;  1EN5 A;  1FXK C;  4JYB A;  1PV0 A;  2WLM A;  4U3J A;  4QJF B;  1W59 A;  4W4K A;  4GKJ O;  1IDS A;  4X1Y A;  1SC5 B;  4UV9 A;  4NYK A;  5IYC O;  4B3S B;  3JAR B;  2WLI A;  4DV3 B;  2LGQ A;  1P4R A;  2OTL V;  4CZZ A;  5JJJ B;  5L3D A;  3QO7 A;  2P7T C;  2BCC H;  2V1D A;  1M57 B;  3FB8 C;  5KHI A;  4FM0 A;  1M56 B;  3L74 H;  1SQB H;  4JI2 O;  2RJZ A;  2VQF O;  1SZT A;  3Q4H A;  3TCU A;  1F4M A;  3CRA A;  3ABK C;  5JJE B;  1K73 W;  3RN4 A;  1QR8 A;  3ZHQ A;  4TV8 A;  2E76 B;  2Y0P A;  4ZIB A;  3ZMS A;  2A7W A;  2A06 H;  1FKA O;  1Q8I A;  2WA4 A;  4PDM A;  5LHG A;  1YIJ V;  3OUF A;  1XEQ A;  4DRX B;  1XRE A;  1M4U A;  4JPR A;  4BIO A;  1QNM A;  2JEX A;  2OCC C;  1NR1 A;  1KBH A;  1H8H G;  1AP6 A;  3FFQ A;  4LFA B;  4DUY O;  2Q7G A;  1BCC H;  3E8G A;  2JS3 A;  2GHY A;  4CH4 A;  1YIT V;  3N2K A;  2BTO A;  4DR1 O;  2PY5 A;  2A9H A;  4AIL C;  5IYD O;  4P9P A;  5J2T A;  1EBO A;  2Q9L A;  4YY3 B;  3RYC B;  3VOU A;  4PI2 A;  4XBF A;  3ZRW A;  4ZOL B;  1M5I A;  2F93 B;  3AEI A;  4WFH A;  4XDK A;  1SES A;  2DYS C;  3JD2 A;  4UB6 Z;  2ZQM A;  2XAH A;  4DK0 A;  1HNX B;  2Q67 A;  2WLN A;  2UXD O;  2PI5 A;  3ABT A;  3WG7 C;  2QR4 A;  1FAF A;  3DGE A;  3K5M A;  3I56 V;  1P84 F;  1Z2G A;  1QLN A;  3K5N A;  1RSO A;  2R72 A;  3CCQ V;  1YHQ V;  5IYZ B;  1VP7 A;  1D5N A;  1S0V A;  2BOC C;  2UXC O;  1US6 A;  2KKW A;  3OMA B;  5GTH Z;  2YSU B;  2PZS A;  4UCT A;  3JAW A;  4B3M O;  4CS3 A;  1X59 A;  5KLV H;  4FLW A;  1ZAU A;  4R6Z A;  4CC6 A;  4JI5 B;  3VQV A;  3B4S A;  4CH5 A;  4GX2 A;  5IWA O;  2P06 A;  4KHP B;  4JI4 O;  3CCL V;  4DXW A;  4CS2 A;  3JAS B;  1ZL8 B;  2P6J A;  4LH6 A;  4ZBM A;  3CP1 A;  1BT8 A;  4DUZ B;  4DR7 B;  3C3S A;  3GWO A;  1XHZ A;  1XBL A;  2CTQ A;  4OGQ B;  5J2U B;  3WG7 B;  1N34 O;  3ICX A;  4ABM A;  3D3Q A;  1H2L A;  3QF7 A;  3F7Y C;  1DLB A;  2RQ6 A;  4DO2 A;  3DSQ A;  3OEE G;  3TK1 A;  1VQ9 V;  4GYC B;  2F4V O;  1IBL O;  3BVO A;  4J10 A;  2DN9 A;  2F23 A;  5EIB D;  3ZRS A;  3ZRX A;  4NXN B;  1E1Q G;  3OTF A;  2GUZ B;  1N32 O;  2UXN A;  4FLZ A;  1VMG A;  1GM8 A;  1MG1 A;  5LMN O;  2Q6A A;  4NTY A;  2CE4 A;  1CXZ B;  2B5U A;  2AW9 A;  2EZP A;  2LP7 A;  4K0K O;  3H1L H;  5H6Q A;  2ZXW B;  3W7X A;  4NTW A;  4MTX A;  1N32 B;  1JOY A;  1J95 A;  1U97 A;  4DK1 A;  2QM7 A;  3KG2 A;  3AG4 C;  4MTG A;  1BL8 A;  2HG5 C;  4RQF A;  3U11 A;  3CMA V;  1NVP B;  1G4Y B;  3SR2 C;  1HWY A;  4AHC A;  3SJC C;  3OD4 A;  1AP5 A;  5KAF Z;  4LF4 O;  4UVC A;  3SYO A;  3WU2 Z;  4NB5 A;  5CN0 A;  1AR5 A;  1R3J C;  3F7V C;  1K8A W;  1BZK A;  1ARO P;  1NH2 B;  5EBW C;  4LF5 B;  3T1H O;  1XMO B;  1XDC A;  4NXM O;  4U3J B;  1LNQ A;  4DW0 A;  1OCC B;  2ZR3 A;  2IH1 C;  1SA0 B;  4N23 A;  1YSC A;  4FVM A;  3ABL B;  5A9G A;  2PYJ A;  1WPX A;  5BR8 O;  1Q43 A;  4DV2 O;  3RYI A;  3R65 A;  1TUB A;  4ZHQ B;  3E22 B;  4TWK A;  3ZRV A;  5L3F A;  1IUR A;  3B09 A;  2QE7 G;  5EZY A;  4JI1 B;  4MTF A;  5BY1 A;  2EIN C;  2WA3 A;  4LF9 O;  4FJC C;  4NR1 A;  3K5L A;  3RVZ A;  2B1I A;  4MS2 A;  2VRZ A;  4UCU A;  3TET A;  2VS0 A;  2JEU A;  2CTR A;  1S5L Z;  1IVS A;  3W7W A;  3ZMT A;  1JMK C;  1NTZ H;  1VQ7 V;  4HNA B;  2XAG A;  1AJQ A;  3N2G B;  4I0X B;  3ETD A;  3FAV B;  4WFE A;  2Y0I A;  3OGC C;  4JAU A;  1KKD A;  4G27 B;  5CBF A;  2DQ3 A;  1VQ5 V;  1TUB B;  5LGN A;  4DV6 O;  2X6A A;  4JI0 B;  4DV4 O;  3ZHU A;  3OGI B;  2ADQ B;  2A0L A;  4TQF A;  4PHZ A;  3AK2 A;  4YXW G;  3LNN A;  4JI7 B;  4JYA B;  4BW5 A;  2K1E A;  3O65 A;  3TXQ A;  3JSN A;  5C93 A;  4DR2 B;  1EZJ A;  3J80 N;  1XI1 A;  5CA1 A;  3U0Z A;  2CH7 B;  1GRJ A;  1Y66 A;  5LYJ B;  4YIP A;  4LFC B;  4LWS B;  2UUB O;  1VAR A;  1OCO B;  2X0L A;  4ZKI A;  1PL4 A;  3SGI A;  4PI0 A;  5H2F Z;  2IU0 A;  2PTM A;  1N33 O;  3LSQ A;  2EZO A;  1XL4 A;  3BA9 A;  4UVA A;  1B06 A;  3ZHV A;  4JF3 A;  4CBC A;  3IFX A;  4GX5 A;  4UXN A;  1S5J A;  5CBG A;  1NTK H;  2ZDI A;  3PJS K;  4RUF A;  3OTO B;  1FFX B;  1BS3 A;  1M57 C;  2ODM A;  1QVG U;  3ASO C;  1YTF B;  2P22 C;  4BW9 A;  1B04 A;  2OCC B;  2Y69 C;  3OR7 C;  1QVF U;  1K92 A;  1F7Y A;  1IBM O;  2H3O A;  3JAL A;  2PYL A;  4EEQ A;  3CX5 F;  4I55 B;  4FPP A;  5DEC A;  4FZ1 A;  3CCS V;  3SYP A;  2JIZ G;  4DV6 B;  1Y76 A;  3AK3 A;  5LGT A;  3M8A A;  4X1I B;  1ZWI C;  5LL6 Y;  2GUZ A;  3ZMV A;  4NKG B;  3K9A A;  4DV0 O;  2VWK A;  3TXS A;  2VQE B;  3CYO A;  5IJ0 B;  3CCJ V;  3E89 A;  4GZR B;  1N8R W;  4JI7 O;  4WFF A;  3SYA A;  4TV9 B;  2FKX A;  5B66 Z;  3SJQ C;  2ITD C;  3QNE A;  1NI8 A;  1R6T A;  4K8Z A;  4OPH A;  3CE2 A;  1SQX H;  1OCR C;  5C8Y A;  3CC2 V;  3E8H A;  5FNV A;  4ZI7 B;  1FD9 A;  3HPL C;  2V4D A;  1MMM A;  5JJN B;  2P4V A;  2UU9 O;  4TQD A;  1Q6I A;  5BMV A;  3D3I A;  3P30 A;  1LUV A;  4J41 A;  3STZ C;  3T2M A;  4IIJ B;  1YTF D;  2QJ1 A;  2YID A;  3B40 A;  1R73 A;  1BSM A;  1JPX A;  2BSK A;  1FJG O;  3OTO O;  4FLV A;  2IBZ H;  3AG7 A;  3CHX A;  3E35 A;  1ENV A;  2XND G;  2XT9 A;  3AG3 B;  4TV9 A;  1AR4 A;  4KUM A;  1IBM B;  3CB2 A;  3RYC A;  2JVD A;  2HVJ C;  3HKB A;  5TIS Z;  3EFF K;  3M7M X;  1DGS A;  3OT7 A;  4R7C A;  1T5E A;  3AG3 C;  1NU1 H;  2IM9 A;  2A79 B;  3C3T A;  4A5U B;  1THZ A;  1G1X B;  4GKJ B;  2Q4P A;  2BE3 A;  4BIU A;  4X64 O;  4OPA A;  3UCS C;  1SQV H;  4DV3 O;  4JI1 O;  2EIK C;  3K3W A;  4DR1 B;  3O9O A;  3RT3 C;  2YI9 A;  1MA1 A;  2QKC A;  1H2K A;  5L3C A;  4X66 O;  3OMI B;  2ETN A;  4AI8 A;  1GMG A;  2CUG A;  2IW5 A;  4OXS A;  5LMU O;  4X89 A;  1WNS A;  1YVW A;  4YJ2 B;  2ATK C;  3K0D A;  3X2Q C;  1SQQ H;  1GN6 A;  5KHH A;  2OIE A;  2BTQ B;  5KHJ A;  3G6B A;  4MW8 A;  5IJ9 B;  5L3G A;  3UM7 A;  1H2G A;  2EJR A;  4JYY A;  3FYI B;  1OCC C;  4I50 A;  3CME V;  1OCZ B;  4JI0 O;  4EB6 A;  4ZHQ A;  3FB6 C;  3ZRW B;  2HR3 A;  2P67 A;  1I94 O;  3AG1 B;  4O4L A;  1SQF A;  2HHH B;  3CC7 V;  4JYA O;  2K9P A;  3K03 A;  3G6E V;  2E5L B;  2F95 B;  2ZE6 A;  1F4N A;  4I7Z B;  3IJ4 A;  3CCR V;  4PA4 A;  2JJ1 G;  2W0F C;  4X1Y B;  5LP6 A;  3UO2 A;  4XDJ A;  1IBK O;  3I55 V;  4DR6 O;  4JTA B;  3X2Q B;  4O4I B;  1BQ0 A;  4H33 A;  2XUM A;  3B2E E;  3DXR B;  2KSD A;  3QO8 A;  3W7T A;  2UUC B;  4FM1 A;  4O4H A;  1N33 B;  1W0J G;  5DM6 V;  2AHZ A;  3E86 A;  4JAA A;  1SS3 A;  3D8C A;  3ZS8 C;  4U3F H;  2GSM B;  5JH7 B;  1AI4 A;  2YIA A;  1R3I C;  2Y69 B;  1WA8 B;  1H8E G;  1WB7 A;  3SPG A;  4LFA O;  3RYH A;  1K34 A;  2N74 A;  5IDJ A;  2PI4 A;  3ABL C;  2Z3Y A;  4LP8 A;  4KFM A;  3L75 H;  5LHI A;  3JAS A;  1KMI Z;  4QE7 A;  4QIW F;  3SPH A;  3SYQ A;  1E1R G;  4FLU A;  3ETG A;  3HB3 B;  3JAT B;  5FPR A;  1JVM A;  4X1I A;  5JVD A;  4PJ0 Z; 
#chains in the Genus database with same CATH homology
 4MTG A;  1BL8 A;  1PNM A;  2AHY A;  2OTJ V;  1R3K C;  3SPC A;  2ZDI C;  2HG5 C;  2H94 A;  1PL0 A;  4RQF A;  1EFR G;  3CMA V;  1NVP B;  2WSS G;  5EC1 C;  4MVZ A;  1G4Y B;  3JD4 A;  4Z1M G;  3RVY A;  1HWY A;  3ML0 A;  3IGA C;  5EC2 C;  2NLJ C;  1AI6 A;  4GT1 A;  1FXV A;  4MVM A;  1Q7Y W;  4UVC A;  5IY5 B;  1K33 A;  3SYO A;  5CN0 A;  1JJ2 U;  1R3J C;  2XAF A;  3F7V C;  1FS0 G;  1S77 D;  1K8A W;  2MK3 A;  3OR6 C;  4JAV A;  1ARO P;  5DN6 G;  1NH2 B;  5EBW C;  2C2A A;  4X88 A;  1LNQ A;  2X7R B;  1OCC B;  5E1A C;  2ZR3 A;  2UXX A;  2IH1 C;  4N23 A;  1M9N A;  3ABM C;  5KUK A;  2Q68 A;  5B1A C;  1YSC A;  1KQS U;  3MHS C;  2QEX V;  4MVR A;  2WLI B;  1I5X A;  4FMT A;  4PA6 A;  4FK5 C;  3ABL B;  3CCU V;  4PA7 A;  2BOB C;  5HFL A;  1WPX A;  4G28 B;  4G2K A;  1FXK B;  5BZB A;  3JYC A;  2HVK C;  5KUM A;  2Y48 A;  3R65 A;  4MVU A;  2P90 A;  1DF4 A;  1SRY A;  4PA3 A;  2XAJ A;  1S76 D;  1V55 B;  2WLH A;  4Q20 A;  4TWK A;  1NR7 A;  3ZRV A;  4UVB A;  4WFG A;  5L3F A;  1PKX A;  3T1C A;  2WLL A;  4E2L A;  3OW2 U;  2QE7 G;  4BIZ A;  1OCR B;  5B1O A;  2JK5 C;  2IJH A;  3B8M A;  4I5S A;  4MSW C;  4RAI A;  4RUE A;  3ZN0 A;  2DW4 A;  4MTF A;  1Q81 W;  2EIN C;  1GTO A;  4FJC C;  4J9Z B;  3RVZ A;  3B77 A;  3DTU B;  2B1I A;  4MS2 A;  3TET A;  4PDL A;  1VQO V;  4ASU G;  2IH3 C;  3FYE B;  3SPJ A;  1AI5 A;  3AG2 C;  3LUT B;  1NVP D;  2JEU A;  4JTD B;  2HKO A;  5J9P C;  1AJP A;  1JX9 A;  1R6N A;  1NQT A;  3OFN G;  3W7W A;  3OMN B;  4HYO A;  1FXH A;  2WLJ A;  3JD1 A;  3ZMT A;  3T4Z A;  1VQ7 V;  2CK3 G;  5KA6 A;  2XAG A;  3ZJZ A;  3E8B A;  3ABK B;  2DWE C;  3SPI A;  4MVO A;  1OZ0 A;  1AJQ A;  2JDI G;  5CBH A;  3ETD A;  2D3O W;  3JD3 A;  3FB5 C;  4WFE A;  3OGC C;  4QPJ A;  3OAA G;  4JAU A;  3E2E A;  4UV8 A;  1KKD A;  4GX0 A;  4G27 B;  5CBF A;  3F5W C;  1V54 C;  2DQ3 A;  4KP4 A;  1VQ5 V;  5LGN A;  3ASN C;  4HAM A;  4R8C A;  1NKD A;  2X6A A;  1FFT B;  5LGU A;  2DYR B;  5GW7 A;  2A0L A;  4TT3 G;  1V55 C;  2EIL C;  4RO2 A;  3LNM B;  4PEL A;  3K08 A;  3MHH C;  4YXW G;  3A0R A;  2WPD G;  5EK0 A;  5H9C A;  4GCZ A;  1VQP V;  5B1B B;  2K1E A;  3JD0 A;  4PA9 A;  3QO5 A;  5H6R A;  4BW5 A;  1YI2 V;  1NBM G;  5KA5 A;  5C93 A;  1EZJ A;  1VQN V;  1RPR A;  2QTO A;  1TUE B;  5L3B A;  1M56 C;  1ORQ C;  3IC7 A;  2EIJ C;  4LC1 A;  4P9O A;  2LFR A;  4U7N A;  1IXM A;  4LCU C;  1Y66 A;  1PNK A;  1SER A;  3NXS A;  3P32 A;  3K79 A;  1Q86 W;  1OCO B;  2X0L A;  4EKW A;  4ZKI A;  2IU0 A;  1RM1 B;  2HJF C;  1K9M W;  4MVQ A;  1G8M A;  4PDR A;  3LSQ A;  1CEZ A;  1RM1 C;  1QBZ A;  2EZO A;  1XL4 A;  3ZMZ A;  1F51 A;  2IJI A;  4UVA A;  1GKF A;  1BMF G;  4JF3 A;  1VQ6 V;  4CBC A;  3AG4 B;  3D36 A;  3IFX A;  1W0K G;  4RQE A;  4GX5 A;  1YJW V;  5IYB O;  2R9I A;  3LDC A;  4UXN A;  3JCZ A;  5CBG A;  2ZDI A;  4MTO A;  3CXC U;  3CC4 V;  1RPO A;  3PJS K;  4RUF A;  3ASO B;  4R50 A;  1K3E A;  1M57 C;  2EBO A;  1QVG U;  3ASO C;  1XL6 A;  1W2B U;  1YTF B;  2WWW A;  5B1B C;  2OCC B;  2Y69 C;  2IU3 A;  3OR7 C;  1DF5 A;  3OEH G;  1L1F A;  1K92 A;  1S3J A;  4XDL A;  3RW0 A;  1KC8 W;  1OCZ C;  1QVF U;  4JAS A;  2KB1 A;  2IJK A;  1FXK A;  2EIN B;  4PDV A;  5B1N A;  2EIK B;  3RBZ A;  4FPP A;  1K97 A;  3BY6 A;  3CCS V;  2XAQ A;  4MVS A;  3SYP A;  2JIZ G;  5CMU A;  1YJ9 V;  3E8F A;  5LGT A;  1B6Q A;  1ZWI C;  1S5H C;  1AI7 A;  3G4S V;  3ZMV A;  4L87 A;  3K9A A;  2WLK A;  5B3S B;  2F43 G;  4U7O A;  1MOF A;  1NH2 D;  3FKS G;  3CYO A;  1FXK C;  3E83 A;  4JYB A;  3CCJ V;  3E89 A;  1N8R W;  2Q69 A;  2WLM A;  1K4C C;  4WFF A;  4QJF B;  1VQ4 V;  3SYA A;  3CCE V;  3SJQ C;  2ITD C;  3QNE A;  1GK9 A;  1S72 V;  4UV9 A;  3CPW U;  2B1G A;  5IYC O;  2ZR2 A;  2WLI A;  1P4R A;  1QLE B;  4CZZ A;  2OTL V;  1OCR C;  5L3D A;  3QO7 A;  1VQL V;  3CC2 V;  4LBE C;  2P7T C;  2V1D A;  3E8H A;  1M57 B;  3FB8 C;  1SET A;  1M56 B;  3HPL C;  3W7S A;  3K04 A;  3OE7 G;  4WFA V;  3D3I A;  4QPK A;  1SZT A;  3P30 A;  1DTO A;  3TCU A;  2ITC C;  4GX1 A;  4WFB V;  2ZXW C;  1F4M A;  3SYC A;  3ABK C;  3STZ C;  3T2M A;  1K73 W;  1YTF D;  1QR8 A;  1QR9 A;  4BAY A;  3OUS A;  1R73 A;  1JPX A;  1PD3 A;  4N21 A;  3ZCC A;  1UJW B;  3ZMS A;  3MD0 A;  1CP9 A;  3E35 A;  3WFV A;  4MT8 A;  5L3E A;  1COW G;  1ENV A;  1F23 A;  2HFE C;  2XND G;  3AG3 B;  4PDM A;  1V54 B;  5LHG A;  1YIJ V;  4J9Y B;  2DYR C;  2OT5 A;  3OUF A;  1R3L C;  4KUM A;  2W6J G;  4JPR A;  1MAB G;  2HVJ C;  2JEX A;  2EIM C;  2OCC C;  1NR1 A;  3EFF K;  4QE9 A;  4H37 A;  1GO3 F;  1H8H G;  4R7C A;  1VQM V;  3AG3 C;  1ROP A;  3E8G A;  2A79 B;  3ETE A;  3B8N A;  1E79 G;  4TSF G;  2GHY A;  1THZ A;  1KP2 A;  1YIT V;  1NJI W;  2LFS A;  3T4D A;  2A9H A;  5IYD O;  4BIU A;  1YJN V;  4P9P A;  1EBO A;  3GB7 C;  3VOU A;  2X6B A;  1I5Y A;  2EIK C;  3K3W A;  4XBF A;  2XAS A;  4X8A A;  3ZRW A;  3H01 A;  3AEI A;  1AR1 B;  4WFH A;  2DYS B;  4XDK A;  1SES A;  5L3C A;  3ZIA G;  3CCM V;  2DYS C;  3OMI B;  4FIP C;  3JD2 A;  2ZQM A;  5CA3 A;  1GMG A;  1OCO C;  2IW5 A;  2XAH A;  2WLL B;  4OXS A;  4JTC B;  2Q67 A;  2WLN A;  4X89 A;  2PI5 A;  3ABT A;  3WG7 C;  1K5S A;  1QCE A;  3DGE A;  2HLD G;  5IY5 C;  1P7B A;  2ATK C;  3K0D A;  3X2Q C;  3W7U A;  2DWD C;  3I56 V;  5HFM A;  3VBB A;  1QLN A;  1K4D C;  4HZ3 A;  4MW8 A;  5L3G A;  3CCQ V;  2EIL B;  3UM7 A;  1YHQ V;  1H2G A;  2EJR A;  1S0V A;  2BOC C;  4P30 A;  3FYI B;  3UKM A;  1OCC C;  2IJJ A;  3OMA B;  3CME V;  2YSU B;  1OCZ B;  3ABM B;  3LDD A;  1M1K W;  2DQ0 A;  3AG2 B;  3FB6 C;  3ZRW B;  1WLE A;  4R6Z A;  4GX2 A;  1VQK V;  2HR3 A;  2P67 A;  3AG1 B;  3OM3 B;  4I9W A;  3CCL V;  4DXW A;  1H38 A;  1AJN A;  3CC7 V;  4MW3 A;  2P6J A;  4WCE V;  4ZBM A;  3CP1 A;  3K03 A;  1K7D A;  3GWO A;  3G6E V;  1PNL A;  5B3S C;  3BEH A;  2M7W A;  1CPY A;  3CCV V;  3K0G A;  1F4N A;  3WG7 B;  3CCR V;  2X6C A;  4PA4 A;  2JJ1 G;  2W0F C;  3STL C;  2FTK A;  2NNU A;  4F4L A;  4XDJ A;  3I55 V;  1OHH G;  4JTA B;  3X2Q B;  3CD6 V;  3F7Y C;  1DLB A;  5LHH A;  4JGS A;  4H33 A;  5B1A B;  4DO2 A;  4QNH B;  2QKS A;  3G71 V;  3OEE G;  5EBM C;  3TK1 A;  1VQ9 V;  1KD1 W;  3LDE A;  1KP3 A;  2H8P C;  1K5Q A;  2XOK G;  3ABU A;  3QO8 A;  3W7T A;  2WAM A;  4JYC A;  3ZRS A;  3FB7 C;  3ZRX A;  1E1Q G;  1W0J G;  2AHZ A;  5DM6 V;  3E86 A;  1QLE C;  2V7Q G;  2UXN A;  3LSS A;  2ZD9 A;  2YEV A;  2R9R B;  1M90 W;  2GSM B;  1BHB A;  1GM8 A;  1MG1 A;  4P2Z A;  2Q6A A;  1AI4 A;  1Q82 W;  1R3I C;  2Y69 B;  5EBL C;  4WF9 V;  1VQ8 V;  1GM9 A;  2B5U A;  1MSW D;  2EZP A;  1H8E G;  3EHB B;  3SPG A;  3ZMU A;  3M99 B;  2Z5U A;  1K34 A;  1KEC A;  1Y4M A;  2EIJ B;  5IDJ A;  2LP7 A;  1BHA A;  3AG1 C;  2PI4 A;  2JJ2 G;  3ABL C;  5H6Q A;  2ZXW B;  4UUJ C;  2Z3Y A;  1JQ0 A;  4LP8 A;  1JCH A;  4KFM A;  5LHI A;  3W7X A;  1GM7 A;  4QE7 A;  2QM8 A;  2YEV B;  4QIW F;  3SPH A;  1E1R G;  3SYQ A;  3ZN1 A;  3ETG A;  1R6K A;  3ASN B;  3HB3 B;  4MTX A;  3K06 A;  5LBQ A;  1J95 A;  2QA4 V;  1JOY A;  5FL7 G;  2QM7 A;  3KG2 A;  2W6I G;  1JVM A;  2EIM B;  3AG4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...