3K9AA

Crystal structure of hiv gp41 with mper
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
82
structure length
82
Chain Sequence
GSGIVQQQSNLLRAIEAQQHLLQLTVWGIKQGGGGSEWEREISNYTDIIYRLIEESQNQQEKNEQELLALDKWASLWNWFDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV glycoprotein gp41
publication title Structural characterization of HIV gp41 with the membrane-proximal external region
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 37
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2009-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k9aA00
5HFLA 1QCEA 4G2KA 3B77A 5KA5A 4JPRA 5H9CA 3B8MA 1DF4A 1JPXA 2EZOA 4JF3A 3MHSC 1F23A 1DF5A 3M99B 4JGSA 4FK5C 4N23A 2EZPA 1I5YA 1MG1A 2OT5A 4E2LA 1JQ0A 1DLBA 1MOFA 3GWOA 3MHHC 5CN0A 1Y4MA 4FIPC 3CP1A 3P30A 3K9AA 1K34A 3CYOA 1EBOA 4N21A 2EBOA 5HFMA 2X7RB 2M7WA 1QR9A 5CMUA 3B8NA 5KA6A 2LP7A 2P6JA 1I5XA 1Y66A 1ENVA 1QBZA 3H01A 3WFVA 4FJCC 1QR8A 1K33A 1SZTA 2MK3A
chains in the Genus database with same CATH superfamily
2QR4A 2KKWA 1EZVH 2E3CA 2KG7B 3RN4A 1D5AA 4DV3B 2CH7B 3AG4C 1W2BU 1LNQA 4DR4O 4I0XB 1VQLV 3SYQA 2UU9B 3G67A 2GHYA 4UCVA 1K8AW 4CH3A 1WPXA 4AHCA 3CHXA 5IJ9B 2QTOA 5F2VO 3K06A 3VBBA 3UM7A 2Q67A 1BHBA 1F23A 4NR1A 4B3TB 3CD6V 4HAMA 3X2QC 3A2FA 2EILB 4LBEC 1I94O 1KBHA 3ABMB 4X66O 3DXRA 2N74A 3ZMSA 1AP6A 1S3JA 4LF9O 2WLMA 3D3QA 3AG1B 3KG2A 4EFEA 3SYPA 1XMOB 3HKDA 1MABG 4LF7O 2YXHA 4O2BA 4X20B 5LP6C 5CA0B 4PDMA 4FFBB 1VQPV 5IWAO 2QTSA 3CX5F 4D7TA 4H44B 2DJVA 1HR0O 1BT8A 5LOVA 1D2DA 1N34B 2YSUB 4MVRA 2CAZC 3ZHUA 4J9ZB 2DE0X 1XNRB 2DWEC 3FB7C 4G28B 2H3OA 3SJQC 3TCUA 5DECA 4FLZA 4UFZA 2LGQA 3UCSC 3E35A 2WA3A 1S0VA 3GWOA 1Z5WA 1ZSPA 4DV1O 4B3RB 3A0BZ 3RBZA 3LSQA 2UXCB 5JJEB 4RWUA 2YIAA 2P67A 4IL6Z 1JA8A 4AQYO 2UUBB 1K4CC 1NVPD 1CEZA 2RCVA 1M57B 3OR6C 3W7TA 1MNGA 3O65A 4I9WA 2PTMA 1M56B 1OCOB 4JI7O 1SA0B 2XASA 3L71H 5EK0A 5IJ0B 5C8YB 5EIBC 2HJFC 5LHHA 2YEVA 3AEIA 4DUYB 2E74B 2EIJC 3G71V 1BS3A 4LFCB 2YS8A 3G80A 2ADQB 1J95A 3MD0A 4LCUC 1YJNV 5FLXN 2JGDB 1DF4A 2W0FC 4AILC 5D5PA 4ZI7A 1N0JA 1IDSA 4JZGA 5J2TA 2XAQA 2WLHA 4TV9A 1PL4A 2ZDIA 3BA8A 1M9NA 3QO8A 4LFBO 4QPJA 2XT9A 3SDLA 5IY5B 4NXMO 4P9OA 1PNMA 1WAZA 1X59A 4H37A 1H2NA 1Q5OA 1FFXB 3JSLA 2W6JG 5LMNO 1EZJA 3ABTA 4RQEA 3LSUA 4DV0O 1Q6IA 3E8GA 1OV9A 3E83A 4F6RA 1K5QA 2VS0A 3J80N 1L8DA 3K5MA 2F66C 1RM1C 2XAJA 4KUMA 3U10A 3ZHQA 1R3JC 4Z1MG 3VQXA 4A5UB 1R6NA 2G38A 4MS2A 2EX3A 1B6QA 2ZCEA 4JPRA 3K57A 2CH7A 2RMKB 1WPBA 2YICA 3TK1A 4I0XA 1S72V 2EZPA 4LF5B 1GK9A 3FB5C 2GSMB 4PA3A 4MTGA 2VWJA 5LA6B 2Q6AA 4UCRA 1R73A 2XAFA 5EC2C 4LF8B 4DR5B 3OFNG 3OM3B 3U0ZA 2NN4A 3AG2C 2GUZA 2IH3C 2LW7A 4K3AA 2YXLA 4X1IA 1AJNA 1FXHA 2MW2B 1EN6A 2DQ0A 3UT5B 2ARHA 2VQFB 4B7EA 5CN0A 5EBMC 4DV3O 4O2AB 4BWAA 3RYFA 3RYIB 4J9YB 2A9HA 3QO7A 1NU1H 2R70A 2Z5UA 4FFBA 1XOUA 4DRXB 4NXNB 4ASUG 1IBMB 1T5EA 1GRJA 1R3KC 1M4UA 3JD4A 4JAAA 4JGSA 2EULA 1IZ3A 1WB7A 4JI4B 3ZRWB 4B3TO 2F43G 4TUYA 1MZEA 1OCZC 5KAIZ 1S76D 2WPDG 5B1BC 2DYSC 4GX2A 3TXSA 1AROP 3P32A 2HHHB 1WN7A 4KFMA 4ZKIA 1YEWA 3ZHSA 4IHJA 1YJWV 4JI6B 1XNQO 2QEXV 1YF2A 2HP8A 3BCCH 4D6TH 4ZIBA 1URFA 1MSDA 1F7YA 1EM1A 3OD4A 1NR1A 1AR4A 3CJHA 5KA6A 5JH7A 3N2GB 4W4KA 4PDLA 1QBZA 2P4KA 2IU0A 1KP3A 2DN9A 3HKEA 1MSWD 4DR1O 1XNRO 1EN5A 3FAVB 4PV1B 5EYPB 4PA6A 4TQDA 4J42A 5ITZA 3ZMVA 4EB6B 3CCUV 2IW5A 1LR1A 2JJ2G 1K73W 1BQZA 2Q7GA 4L87A 2V7QG 4GKKO 2UUBO 2XAGA 4DV6B 1BL8A 3DSQA 3G6EV 2RQ6A 1FFXA 4WF9V 4E4EA 2YI8A 4DUYO 3G4SV 4ZHQB 4DUZB 2P22C 3LSSA 4PHZA 2BTOA 3W7WA 1Q7YW 4UCTA 1RSOB 4UCUA 4LP8A 4LWSB 1OCCC 3NR7A 1FXKA 1XILA 2Z3YA 4LNUA 4LR3A 1G1XB 4FIPC 1BZKA 3WB1A 4HYOA 2HKOA 3CB2A 4NB5A 2ITDC 3ABKC 3A8TA 1XUQA 3BVOA 3ETDA 1SESA 4TV8A 3CRQA 5BY1A 4CZZA 5LYJB 1YTFB 4J7ZA 2QM8A 2VQEO 3T1HO 1ZL8B 1R3LC 2YC0A 4E2LA 3WG7C 5LGNA 4BIUA 3CYOA 3PN1A 4JI0B 4JV5B 2EIKB 3UQ8A 1QNMA 2Q7HA 3E2EA 5EBWC 2KSDA 5LXTA 4F4LA 2F4VB 2ZXWC 1AI7A 3GB7C 3ZJZA 3UT5A 3CCLV 1R1BA 1IXBA 4JI5B 4LH7A 1BQ0A 1XMQO 4JI2B 5LMUB 1MOFA 2EIMC 3F7YC 3N2KA 3HKBA 4LF5O 4WFEA 4HBNA 5L3DA 3DXRB 1COWG 3HKCB 5GW7A 1N32O 2GTSA 4GCZA 1IURA 3JAWA 1TVKA 1Q81W 4YY3O 3HR0A 3HKDB 3ZN0A 1GTOA 1YCIA 4O2BB 3CSXA 1WNSA 4GKJB 2ZQMA 2Y0PA 4JTCB 2CE4A 2VQFO 3J81N 2DWDC 2X7RB 2ZR3A 2ZINA 4PA7A 3TXQA 3K59A 3JARB 4DW0A 5KHIA 3CRAA 3AG7A 5KUKA 4CH6A 3MAQA 1K5SA 4KXRA 3ZRVA 3CMAV 3H1JH 3ABLB 4MVUA 1IBMO 4I50A 4IYHA 4PI0A 1PNKA 1P7GA 3AK2A 4X62O 2DYRB 2QWOB 4LF4B 4JI8B 1I5XA 1S5JA 1YTFD 2HG5C 3OMIB 2Q69A 3B77A 4FLUA 2E5LB 3OGCC 4WFHA 2HHHO 4UVBA 2N04A 4N23A 5EYPA 4P30A 2V4DA 4ZBMA 2EINB 3P3NA 3OAAG 2IH1C 4EEQA 4JI6O 4CS3A 3JALA 2FMLA 3GWKC 4H33A 4PDVA 4UCSA 4U3JA 4EB6A 4PELA 4J41A 2DW4A 4X64B 2YEVB 4R6ZA 1N8RW 3WFVA 1DLBA 4DV7B 2R9AA 2CTWA 1N36O 4NVPA 1R3IC 3PJSK 1H2GA 3ZS8C 5IYDO 4ZI7B 3OT7A 4I5SA 5J2TB 1VQ5V 4OX9O 3C3SA 4TV9B 1SQGA 1H8EG 1TA8A 1VF5B 4U7NA 3BY6A 2ZE7A 1YI2V 3B2EE 5LL6Y 2P4VA 3CEIA 1HNWO 1P4RA 1K7DA 1N33O 4KHPB 3JCUZ 2IJKA 3I55V 5B1OA 4FZ0A 1N4CA 3SYAA 4IT5A 1XREA 1P49A 4F6RB 3L73H 4DV6O 4DV2O 2ZKOA 2ZNIA 3ASOB 5IYCO 3LDDA 1RPOA 4PJ0Z 4I4TA 1BE3H 3IFXA 4ZOLA 4QIWF 2HLDG 1ZL8A 2EILC 1FJGB 2WWWA 4YJ3A 3TETA 1NJIW 3ABMC 1L0NH 3K03A 2ZE6A 4O4JA 3JASA 1NVPB 1YITV 1SERA 1XL4A 4JYBA 2AXTZ 4JYYA 2RN9A 4QE9A 4K8ZA 2AZ0A 3AG1C 3ASNB 1AR1B 2GV9A 1GN4A 5J9PC 4Q6GA 1TUEB 2D2CB 3LUTB 1JFFA 2P6JA 3RYCB 5KA5A 1FS0G 3LNNA 2X6BA 2W6IG 3B8MA 2GUZB 3OMNB 3ZCCA 4QPKA 4X1IB 4DV5B 4JASA 4RQFA 1P7BA 1YVWA 2HVKC 3OTOB 2NR5A 2KB1A 3JAMN 1R6KA 2JGUA 1GAXA 1SKVA 3HKCA 1TGOA 4F6EA 2QKSA 1FXVA 5CA1A 3CPWU 2A0LA 1WP7A 2ZIOA 2JRIA 2Y69B 2P06A 4LFAO 3RYFB 2PYLA 3CS5A 1H8HG 3DC5A 1E1QG 3SGIA 4JTDB 3K79A 3JATA 2QKCA 1QLEB 3ZMZA 1H2MA 5L3FA 3L74H 3W7SA 1SRYA 3H9VA 4UCOA 4N21A 3JARA 5LMUO 2Q5ZA 4TUYB 1TUBA 1M57C 2CGOA 3CRCA 2IJHA 1M56C 1OCOC 1Y76A 5L3CA 4J11A 1S5LZ 3ZMUA 4CH4A 2PF4E 3AG3B 1VF7A 4CS2A 2L6LA 2BCCH 2HVJC 4B3MB 1ZAUA 3L72H 4K0KO 2YIBA 4IHJB 4GKJO 4NTYA 1F51A 4PA4A 1BHAA 1KC8W 2ODMA 3CJHB 5JH7B 2ZM6B 3SYCA 3VQYA 3KKYA 1AR5A 1VP7A 3HKEB 2PI5A 1N0NA 3STLC 1NTKH 5IY5C 4LF6B 2F93B 1V9PA 2RJZA 1KYOF 5KUMA 1W0JG 2D3OW 3APOA 1UPGA 1VF6A 4FM1A 4FJCC 3IC9A 3K08A 5ITZB 4JI3O 5JCOA 1IBLB 1V54B 4TWKA 2ZR2A 4PI2A 4HZ3A 4BW5A 1HNXO 3AK1A 4DR3O 3ZHTA 1GMGA 3ETEA 2Q0OC 1K3EA 4MW3A 1MMMA 2Y0IA 4XBFA 2A3QA 1YJ9V 3H1KH 3SPCA 1M1KW 4QGPA 2RDCA 1OZ0A 4L8JA 5IT9N 3VQVA 2B1GA 3MHHC 5B1AB 3SJCC 1FXKB 2BOCC 5L3EA 3D36C 4LNUB 2A06H 3W7XA 4GX5A 3LDCA 3RYHB 1BGYH 1ZLZA 2QWQB 4DYLA 1BCCH 4B3SB 4TV8B 3OMAB 3OE7G 3A0HZ 4KHPO 1TAEA 3P3PA 5FL7G 2AZ2A 4DR6O 2B9ZA 2VRZA 2Z0AA 3SPHA 2Y48A 3G6BA 5B5EZ 1VIBA 3RYCA 3KZIZ 2EJRA 4WBNA 1ROPA 2IJJA 2GBOA 3F5TA 4P2ZA 5GONA 5FPOA 3BA9A 1R6TA 2Y4TA 5LXTB 4BIOA 3BHPA 1VQ9V 1FJGO 2OT5A 4MT8A 1JQ0A 4NTWA 4CC5A 1CP9A 2AHZA 2XHBA 4TOIA 1AJQA 3CWBH 2KQXA 3N2KB 2QWRB 3HKBB 4DV4B 3QG5A 3H01A 3VOUA 2UU9O 2Y4UA 1PPJH 3QO5A 2GDSA 2LW1A 3C90A 3JAKB 2WLLA 4X1KA 2PZSA 3JAWB 4RUFA 1TVKB 1US6A 2RNBA 4IYIA 3APQA 3CXHF 2UXDB 1PV0A 4RAIA 3T1YB 1KKDA 3NXSA 4R7CA 2UXBB 3L9DA 1B06A 1XMOO 4OXSA 1SQFA 4I9QA 3CRRA 1THZA 2L35A 5JJJB 3CCSV 3FYIB 2WLIA 5E79Z 4JYAB 4I50B 2UUAB 4RO2A 1N34O 1G6UA 5TISZ 1QCEA 5LP6A 1VQ8V 4OPAA 3FYEB 1HP8A 3MHSC 4YHHB 3M99B 1G4YB 2XAHA 5CB4A 4B7KA 3E22B 4DR2B 3S3XA 4FLVA 1VQKV 5BXZA 3MDSA 1KU9A 5H6RA 4DR7B 1QVFU 2LQTA 5B1BB 4B3RO 1Q82W 3JALB 2DYSB 4U3JB 2MK3A 2UXCO 4CBCA 2WAMA 4JI1B 3SPIA 1MG1A 3ZMTA 1K97A 1NKDA 2AW9A 2E75B 1ZX3A 4LF6O 1SQQH 5B3SB 1ORQC 5B1NA 1IBKB 4MTXA 1I7FA 1DGSA 4LFCO 2ADPA 2QJ1A 4CC6A 1QQCA 4TSFG 2K9PA 2FKXA 3OUFA 2EIKC 1NTMH 1VQMV 2JK5C 4JYCA 2NLJC 4UB6Z 2CUGA 4FLTA 4I55A 2OWOA 3FD9A 1K4DC 2CTPA 4U3FH 1NQTA 3RYHA 1NZ6A 2JVDA 2YDEA 4I4TB 3K04A 4DR4B 2R9IA 2WA4A 4ZOLB 3ZIAG 4YJ3B 1W59A 2DOSA 4O4JB 3JASB 4X65B 5JWPA 4UV8A 5B66Z 4QNHB 3QVNA 2JS5A 2IU3A 2ATKC 3H1IH 4I7ZB 1Y67A 2F95B 1FD9A 1PL0A 2BTQA 1JFFB 1CPYA 1SQXH 3M8AA 5CBFA 2QDOA 4X66B 1S5HC 4YIOA 1WP8A 5FNVA 4LF9B 1SQBH 3OTFA 4MVQA 2EBOA 1NTZH 2W0XA 4LF7B 3TGUH 1AJPA 2XTAA 1Y66A 4O4IA 3EVKA 4LF8O 5CA1B 2XOKG 5HFLA 4DR5O 2YUAA 3JAKA 5IWAB 1H38A 3LNMB 2OCCB 3OEHG 5H5NA 3ABLC 1HR0B 3A0RA 4Z1VA 3K9SA 4P9PA 3JATB 3CRMA 2EJ7A 2H8PC 3I5DA 3ZX6A 3CC2V 1K34A 4FPPA 4OPHA 1XHXA 3B8NA 4ABMA 3RT3C 4UVCA 1OCRB 5H9CA 1TUBB 4DV4O 3Q4HA 2EZOA 2UUCB 3CCRV 2EINC 4DV1B 4WFBV 3FB6C 1VQ6V 2BSKA 3ZN1A 1Y76B 4NXNO 3DC6A 5E1AC 1RFYA 3IC7A 4AQYB 2Q68A 3RVZA 4JI4O 4H13B 2LP7A 3L75H 2XUMA 4JI7B 3H1HH 2X6CA 3HB3B 5JCOC 3UKMA 2PY5A 1PM9A 3E22A 4AI8A 4KP4A 5D5QA 1SZXA 5BMVB 1HDJA 2ZDIC 5L3GA 4FM2A 2ITCC 2P5OA 3JD0A 2JIZG 4WFGA 3R65A 1V55B 3T1CA 4C7UA 5JJNB 2QM4A 4JYAO 2B5UA 5CBHA 3R66A 1XEQA 2OIGA 4KL1A 5LGUA 5IE9A 4LFBB 1JOYA 1VQNV 2OTLV 3EXAA 4YHHO 3ASOC 5CA3A 3JYCA 4FZ1A 5JVDA 1G8MA 3STZC 4EFBA 4BIZA 2JEXA 3QTCA 2P90A 3BABA 1GO3F 4O4HA 3VQWA 3CCVV 4JI1O 4WCEV 4DK1A 3ASNC 4MVSA 5H6QA 5DEDA 4WFAV 5A2QN 1F4NA 1Q90D 1Q6HA 2QE7G 4UVAA 1Z5VA 4X88A 1FKAO 3WU2Z 2IBZH 2WLKA 4DUZO 5KHKA 3CXCU 3CE2A 2ILMA 1QU7A 2YIBD 3J7AU 2O57A 1Z2GA 4B08A 2Y69C 1ZWIC 1FPOA 4PD4F 3SJAC 3T2MA 5JQGB 1QLEC 3I56V 4JAVA 4WBNB 4J80A 3FX7A 3FKSG 5GONB 3E86A 1L1FA 4HNAB 5L3BA 3DGEA 5GTIZ 5HFMA 3ICXA 3ABUA 5J2UB 2N05A 1ZUQA 2IJIA 4X65O 3SJBC 4JI0O 3IGAC 4JV5O 3FFQA 3AG3C 5FPRA 3WB0A 3N27A 2JDIG 1KB9F 1XBLA 4GX1A 4GLXA 1IVSA 1WB8A 2F4VO 4YJ2A 1A32A 1Q6UA 2X0LA 3RWRD 2Q73A 2HFEC 2Q8VA 2WLLB 2H94A 3QNEA 4X1KB 4JI5O 3AG4B 4OGQB 1YDXA 1JMKC 4JI2O 1UFIA 1AVMA 1HWYA 1B3QA 4G27B 3JD3A 1XNQB 4FMTA 2OIEA 2M6YA 5KHGA 2HR3A 4TT3G 2LGWA 4IGGA 3KCYA 1YHQV 1PP9H 3X2QB 1U96A 5KX5A 1JR9A 1X4TA 2WLIB 3SPGA 4IIJA 1V54C 1SQPH 4DR1B 4FLXA 4LH6A 1FYJA 4H0LB 5BMVA 2A7WA 5KHHA 1VQ4V 5LP6B 5KLVH 3JCZA 1JJOA 1AB3A 1I5YA 2UUCO 4O4LA 4J10A 2YI9A 5CB4B 2XNDG 3LDEA 1PKXA 2ZE8A 3EHBB 1E1RG 4GKKB 2WSSG 1MA1A 4LF4O 4JI8O 4UB8Z 1VEWA 1WA8A 3B40A 1XL6A 1OHHG 3OGIB 2E5LO 3JSNA 1NS1A 2YIDA 5B1AC 1XI1A 1FXKC 1RP3B 1AI4A 3K9AA 3THOA 1DTOA 2JJ1G 2LFRA 1KQSU 3ETGA 2FB5A 3IAYA 1DK1A 4DK0A 4FLYA 2LJ2A 4X64O 1D5NA 3K5OA 2LFSA 3AK3A 1NR7A 4DV7O 3ML0A 3KCXA 1CXZB 1HW7A 4K35A 3BEHA 1M5IA 3RW0A 2BOBC 4GUNA 2DQ3A 4LC1A 2EIJB 4X1YA 4I55B 2VQEB 3T1HB 2ETNA 2QGNA 3ZBHA 4CH5A 2BE3A 1E79G 1BMFG 4NYKA 2JS3A 5EZYA 1RPRA 4Q20A 5JQGA 3B09A 2C2AA 2F1MA 4R8CA 3L70H 3BAAA 1QR8A 2KG7A 2QWPB 3JD2A 4BR6A 1GM8A 1XMQB 1HNZB 4HNAA 2BTQB 1F4MA 2FYUH 4NKGB 3P30A 5DM6V 5J2UA 1SETA 1RM1B 1N32B 4TQFA 4X9QA 5IJ9A 1O9HA 5FNVB 5IYBO 3CCQV 4YY3B 3FB8C 4GYCB 4X8AA 1K33A 1VQOV 5K1PA 4O4IB 1WJZA 5IYZB 2IM9A 4DO2A 2OCHA 2UXXA 4XDKA 1J5EB 4K8XA 1NH2B 1QHTA 4MTFA 4DV5O 5KAFZ 4XDJA 2X6AA 4DXWA 4FVMA 3OTOO 4X20A 5CA0A 2YXYA 1AI6A 2A79B 1B04A 2QWNB 4J7KA 5KHJA 3AG2B 1U97A 3Q4HB 5C93A 2CDYA 1Y6XA 5EIBD 4X62B 1I0HA 4FLWA 2ZE5A 1H2KA 2BSKB 3GVMA 3SR2C 5BR8B 1LUWA 2CK3G 3RVYA 1ENVA 4NTXA 4W4LA 2QKAA 3RFRA 4MW8A 1XHZA 4FFKA 2PGGA 4Z2WA 1AILA 3M7MX 3S3WA 1NI8A 1KUQA 5B3SC 2F23A 4B3MO 3DTUB 1JJ2U 1QR9A 1OCZB 1N36B 1XQ8A 1Q8IA 4J7JA 4JZ2A 1H2LA 2DMXA 1AI5A 1JX9A 1SA0A 5IJ0A 5C8YA 4OX9B 3ZRSA 3CMEV 1GN2A 2P7TC 3D3IA 2OYQA 2ZM6O 4X89A 1QLNA 5KMGB 1Y74B 1LUVA 1KECA 2Q9LA 5A9GA 3F5WC 1P84F 5IDJA 1M90W 2JGDA 1HNWB 2CTRA 1N33B 5JVDB 4GZRB 1I08A 2HJDA 4G2KA 1YIJV 2QA4V 1NH2D 1DF5A 4DV2B 1IBLO 5EC1C 4RUEA 1K92A 4O4HB 2PUSA 3JD1A 3T4DA 3E8HA 4PDRA 2M7WA 1GKFA 1ZTEA 1PNLA 1BSMA 2WLNA 3E8FA 5LBQA 1NBMG 1UJWB 4D7SA 3OW2U 4MVMA 1YSCA 3K0GA 3IJ4A 3CC4V 3F7VC 4UUJC 3BPZA 1H2SB 1KMIZ 2WLJA 2OCCC 1WLEA 2QM7A 1GM7A 2ZT9B 1I94B 1PD3A 5H2FZ 5LA6A 3OEEG 2Q7EA 2PYJA 1JCHA 1L0LH 1YXBA 1S77D 1OCCB 1GN3A 4B3SO 4LFAB 1SS3A 3D36A 2R72A 5K1XA 5LHGA 3K0DA 1OCRC 3ZHRA 3ABKB 3CCJV 2OTJV 5IYZA 1SF9A 1O9GA 2B1IA 5CBGA 1K9MW 1VARA 4GT1A 4O2AA 3RYIA 1HNZO 1JVMA 3E89A 4YJ2B 2DYRC 2V1DA 3WG7B 1KKCA 4DRXA 4MTOA 2ZD9A 2HEPA 1SQVH 4YXWG 1MZFA 1Q3EA 4JTAB 4R50A 4K0KB 4MSWC 3E8BA 2ZXWB 2VWKA 5LHIA 3ZRWA 4FK5C 3RGBA 3WB2A 4EKWA 1FFTB 1V55C 1Y4MA 3CCEV 3CCMV 1EBOA 1J5EO 1KP2A 2EIMB 3OR7C 5LOVB 4QE7A 2ZIMA 5KX5B 1IX9A 4QJFB 1VF6C 3BFRA 2UXDO 3OUSA 4IIJB 1JPXA 3T1YO 4DW1A 2UXBO 1IXMA 3O9OA 3N2GA 3UO3A 4O4LB 4JI3B 1W0KG 3TJTA 3K5NA 4CS4A 3QF7A 1GM9A 1GN6A 1HNXB 2JEUA 2UUAO 1SZTA 5BR8O 4DR3B 3BRCA 4JF3A 3FAVA 1M93A 3K58A 4PA9A 4XDLA 5KMGA 4BAYA 1Y74A 1WA8B 2GTAA 4NXMB 1EFRG 3ZRXA 2Q0AA 5BZBA 1Q86W 5LMNB 1FAFA 5GTHZ 4DR2O 4DV0B 1XDCA 5CMUA 5EBLC 3EFFK 4YIPA 2LO1A 1VQ7V 2FTKA 1VMGA 4DR7O 3D8CA 3CC7V 2Q4PA 2CGNA 3K3WA 4MVZA 3U11A 3ZEDA 3ETQA 3C3TA 3HPLC 3SYOA 1Q43A 3ZHVA 3CP1A 5LGTA 2UXNA 4GX0A 4MVOA 4ZHQA 3T4ZA 3UO2A 5AG2A 2CTQA 1NT2B 1GH6A 2ZNJA 4WFFA 3H1LH 4UXNA 3K5LA 3W7UA 1RSOA 2R9RB 1EN4A 2K1EA 4UV9A 3B4SA 1IBKO 4LWSA 4ICGA 5DN6G 4X1YB 3SPJA 1SC5B 4DR6B 2QSAA 1YZBA 4U7OA 4JAUA 2AHYA 2AGAA 4FM0A 2FL4A 4BW9A 1QVGU 2E76B 5EZYB 1AP5A 2NNUA 1KD1W 1OJHA 5LYJA 2PI4A
chains in the Genus database with same CATH topology
1QCEA 1VQ8V 1Q81W 3FYEB 3MHSC 3ZN0A 1GTOA 2LFSA 1G4YB 2XAHA 3M99B 1NR7A 3AG4C 2ZQMA 1W2BU 3ML0A 1LNQA 1VQKV 3BEHA 4JTCB 1VQLV 3RW0A 2BOBC 5H6RA 3SYQA 2DWDC 2DQ3A 2GHYA 2X7RB 1K8AW 4LC1A 2ZR3A 1WPXA 1QVFU 5B1BB 4PA7A 2EIJB 1Q82W 2DYSB 2MK3A 2QTOA 3K06A 3VBBA 3UM7A 4CBCA 2WAMA 2Q67A 5KUKA 1BHBA 1K5SA 1F23A 1E79G 3ZRVA 3CMAV 4MVUA 3ABLB 4HAMA 3SPIA 4LBEC 2EILB 3X2QC 3CD6V 1MG1A 1BMFG 3ABMB 3ZMTA 1K97A 1PNKA 1NKDA 3ZMSA 1RPRA 4Q20A 1S3JA 2DYRB 5B3SB 1ORQC 5B1NA 2C2AA 2WLMA 3KG2A 3AG1B 4R8CA 1I5XA 3SYPA 4MTXA 1YTFD 1QR8A 2HG5C 1MABG 3OMIB 2Q69A 3B77A 3JD2A 4PDMA 1GM8A 3OGCC 4WFHA 1VQPV 4UVBA 4N23A 4TSFG 3OUFA 1F4MA 4P30A 4ZBMA 2EINB 2EIKC 1VQMV 3OAAG 2IH1C 2JK5C 4JYCA 3P30A 2NLJC 5DM6V 1SETA 1RM1B 4H33A 4PDVA 2YSUB 1K4DC 4PELA 5IYBO 2DW4A 2YEVB 4MVRA 3CCQV 1NQTA 4R6ZA 4J9ZB 3FB8C 1N8RW 3WFVA 4X8AA 1K33A 1DLBA 1VQOV 2DWEC 3FB7C 4G28B 3SJQC 3TCUA 3K04A 2R9IA 4DO2A 1R3IC 3PJSK 3E35A 1H2GA 2UXXA 4XDKA 5IYDO 3ZIAG 1S0VA 4I5SA 3GWOA 1VQ5V 1NH2B 4MTFA 4XDJA 2X6AA 4DXWA 3RBZA 4UV8A 1H8EG 4QNHB 3LSQA 4U7NA 2IU3A 3BY6A 2ATKC 1YI2V 2P67A 1K4CC 1AI6A 2A79B 1NVPD 1CEZA 1PL0A 3AG2B 1M57B 3OR6C 1CPYA 1P4RA 1K7DA 5CBFA 3W7TA 4I9WA 1S5HC 1M56B 1OCOB 2IJKA 3I55V 5B1OA 5C93A 2XASA 3SYAA 5EK0A 2HJFC 5LHHA 2YEVA 4MVQA 3AEIA 3ASOB 2EBOA 2EIJC 3G71V 5IYCO 3LDDA 1RPOA 2CK3G 3RVYA 1AJPA 1Y66A 1ENVA 1J95A 3MD0A 2XOKG 5HFLA 4LCUC 1YJNV 1H38A 3IFXA 3LNMB 4MW8A 4QIWF 2OCCB 2HLDG 3OEHG 3ABLC 1DF4A 2W0FC 2EILC 3A0RA 2WWWA 3TETA 1NJIW 2XAQA 3ABMC 2WLHA 4P9PA 3K03A 1NVPB 2H8PC 1YITV 1SERA 1XL4A 2ZDIA 1M9NA 4JYBA 3QO8A 5B3SC 4QE9A 4QPJA 3CC2V 1K34A 3DTUB 3AG1C 4FPPA 3ASNB 5IY5B 1AR1B 4P9OA 1PNMA 5J9PC 1JJ2U 4H37A 1TUEB 1QR9A 3B8NA 1OCZB 3LUTB 2W6JG 2P6JA 1EZJA 3ABTA 4RQEA 5KA5A 1FS0G 1AI5A 4UVCA 1JX9A 1OCRB 5H9CA 2X6BA 2W6IG 3B8MA 3E8GA 3OMNB 2EZOA 3ZCCA 3E83A 4QPKA 1K5QA 3CCRV 2EINC 3ZRSA 4WFBV 3FB6C 3CMEV 1VQ6V 4JASA 2P7TC 3D3IA 3ZN1A 4RQFA 1P7BA 1RM1C 2XAJA 4KUMA 4X89A 2HVKC 1QLNA 5E1AC 1R3JC 2KB1A 1R6KA 4Z1MG 1KECA 2QKSA 3IC7A 1FXVA 3F5WC 2Q68A 3RVZA 3CPWU 5IDJA 2A0LA 1M90W 2LP7A 2Y69B 1R6NA 4MS2A 1H8HG 1E1QG 4G2KA 4JTDB 1B6QA 2X6CA 3HB3B 3K79A 4JPRA 2QA4V 1YIJV 3UKMA 1QLEB 1NH2D 1DF5A 3ZMZA 3TK1A 4KP4A 1S72V 2EZPA 5EC1C 5L3FA 1GK9A 3W7SA 3FB5C 1SRYA 2GSMB 4PA3A 4RUEA 4MTGA 2ZDIC 5L3GA 2ITCC 1K92A 2Q6AA 4N21A 1R73A 2XAFA 3JD0A 2JIZG 4WFGA 3JD1A 3R65A 1V55B 5EC2C 3T1CA 3T4DA 3E8HA 3OFNG 2M7WA 1GKFA 3OM3B 4PDRA 2B5UA 3AG2C 1PNLA 1M57C 2IH3C 2IJHA 1AJNA 1FXHA 5CBHA 1M56C 1OCOC 2WLNA 3E8FA 5L3CA 3ZMUA 5LGUA 5LBQA 3AG3B 1NBMG 1UJWB 1JOYA 1VQNV 2DQ0A 2HVJC 3OW2U 2OTLV 4MVMA 3ASOC 5CN0A 5EBMC 5CA3A 3JYCA 1YSCA 3K0GA 1F51A 3CC4V 4PA4A 1BHAA 1KC8W 3F7VC 4UUJC 4J9YB 1G8MA 3STZC 4BIZA 2A9HA 3QO7A 2JEXA 2WLJA 2OCCC 2Z5UA 1WLEA 2QM7A 1GM7A 4ASUG 1R3KC 2P90A 3JD4A 4JGSA 1GO3F 1PD3A 3OEEG 3SYCA 1JCHA 2PI5A 3STLC 3CCVV 4WCEV 3ASNC 5IY5C 1S77D 4MVSA 5H6QA 3ZRWB 2F43G 1OCCB 4WFAV 1S76D 1OCZC 5KUMA 1F4NA 3D36A 2WPDG 5B1BC 1W0JG 2D3OW 2QE7G 4UVAA 4X88A 2DYSC 4GX2A 1AROP 3P32A 5LHGA 3K0DA 1OCRC 4FJCC 3K08A 3ABKB 3CCJV 2OTJV 4KFMA 1V54B 4TWKA 4ZKIA 2ZR2A 4BW5A 4HZ3A 2WLKA 2B1IA 1YJWV 5CBGA 1K9MW 3CXCU 4GT1A 2QEXV 1GMGA 1JVMA 3E89A 3ETEA 2DYRC 1K3EA 2V1DA 4MW3A 3WG7B 2Y69C 4XBFA 1YJ9V 1NR1A 1ZWIC 5KA6A 4MTOA 3SPCA 4PDLA 1QBZA 3T2MA 1M1KW 2ZD9A 1QLEC 2IU0A 4YXWG 3I56V 1KP3A 4JAVA 1MSWD 4JTAB 4R50A 1OZ0A 4MSWC 3E8BA 2ZXWB 5LHIA 3ZRWA 4FK5C 3FKSG 4EKWA 2B1GA 3E86A 1L1FA 1FFTB 1V55C 3MHHC 5L3BA 1Y4MA 3CCEV 3DGEA 5B1AB 1EBOA 3CCMV 4PA6A 1FXKB 5HFMA 2BOCC 5L3EA 1KP2A 2EIMB 3OR7C 4QE7A 3ABUA 3W7XA 2IJIA 3ZMVA 3CCUV 4QJFB 2IW5A 3IGAC 2JJ2G 1K73W 3AG3C 4GX5A 3LDCA 3OUSA 4L87A 2JDIG 2V7QG 4GX1A 1JPXA 2XAGA 1BL8A 2X0LA 3OMAB 3OE7G 1IXMA 2HFEC 3G6EV 2WLLB 2H94A 3QNEA 5FL7G 4WF9V 3AG4B 3SPHA 1W0KG 2Y48A 2EJRA 1HWYA 1GM9A 2JEUA 3G4SV 1ROPA 1SZTA 2IJJA 4G27B 3JD3A 3LSSA 4P2ZA 3W7WA 4FMTA 4JF3A 1Q7YW 4LP8A 4PA9A 4XDLA 2HR3A 1OCCC 4TT3G 4BAYA 1VQ9V 1FXKA 2OT5A 1YHQV 2Z3YA 1JQ0A 4MT8A 1CP9A 2AHZA 1EFRG 3X2QB 3ZRXA 4FIPC 5BZBA 1Q86W 4HYOA 2HKOA 1AJQA 2ITDC 2WLIB 3ABKC 5CMUA 3SPGA 5EBLC 3EFFK 1V54C 3H01A 1VQ7V 3ETDA 3VOUA 1SESA 2FTKA 3QO5A 4CZZA 3CC7V 1VQ4V 1YTFB 3K3WA 2WLLA 4MVZA 2QM8A 3JCZA 4RUFA 1I5YA 1R3LC 4E2LA 3HPLC 3SYOA 3WG7C 5LGNA 4BIUA 3CP1A 5LGTA 2UXNA 2XNDG 3CYOA 3LDEA 4GX0A 2EIKB 4MVOA 3T4ZA 1PKXA 3EHBB 1E1RG 2WSSG 3E2EA 5EBWC 4RAIA 4WFFA 4UXNA 3W7UA 2R9RB 1KKDA 3NXSA 2K1EA 4F4LA 4UV9A 2ZXWC 4R7CA 1AI7A 3GB7C 3ZJZA 5DN6G 4OXSA 3CCLV 1XL6A 1THZA 3SPJA 1OHHG 5B1AC 3CCSV 1FXKC 3FYIB 2WLIA 4U7OA 1MOFA 2EIMC 3F7YC 4JAUA 1AI4A 3K9AA 2AHYA 1DTOA 4RO2A 2JJ1G 4WFEA 2LFRA 5L3DA 1QVGU 1KQSU 3ETGA 1COWG 5GW7A 2NNUA 1KD1W 2PI4A 4GCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFL A;  1QCE A;  4G2K A;  3B77 A;  5KA5 A;  4JPR A;  5H9C A;  3B8M A;  1DF4 A;  1JPX A;  2EZO A;  4JF3 A;  3MHS C;  1F23 A;  1DF5 A;  3M99 B;  4JGS A;  4FK5 C;  4N23 A;  2EZP A;  1I5Y A;  1MG1 A;  2OT5 A;  4E2L A;  1JQ0 A;  1DLB A;  1MOF A;  3GWO A;  3MHH C;  5CN0 A;  1Y4M A;  4FIP C;  3CP1 A;  3P30 A;  3K9A A;  1K34 A;  3CYO A;  1EBO A;  4N21 A;  2EBO A;  5HFM A;  2X7R B;  2M7W A;  1QR9 A;  5CMU A;  3B8N A;  5KA6 A;  2LP7 A;  2P6J A;  1I5X A;  1Y66 A;  1ENV A;  1QBZ A;  3H01 A;  3WFV A;  4FJC C;  1QR8 A;  1K33 A;  1SZT A;  2MK3 A; 
#chains in the Genus database with same CATH topology
 2QR4 A;  2KKW A;  1EZV H;  2E3C A;  2KG7 B;  3RN4 A;  1D5A A;  4DV3 B;  2CH7 B;  3AG4 C;  1W2B U;  1LNQ A;  4DR4 O;  4I0X B;  1VQL V;  3SYQ A;  2UU9 B;  3G67 A;  2GHY A;  4UCV A;  1K8A W;  4CH3 A;  1WPX A;  4AHC A;  3CHX A;  5IJ9 B;  2QTO A;  5F2V O;  3K06 A;  3VBB A;  3UM7 A;  2Q67 A;  1BHB A;  1F23 A;  4NR1 A;  4B3T B;  3CD6 V;  4HAM A;  3X2Q C;  3A2F A;  2EIL B;  4LBE C;  1I94 O;  1KBH A;  3ABM B;  4X66 O;  3DXR A;  2N74 A;  3ZMS A;  1AP6 A;  1S3J A;  4LF9 O;  2WLM A;  3D3Q A;  3AG1 B;  3KG2 A;  4EFE A;  3SYP A;  1XMO B;  3HKD A;  1MAB G;  4LF7 O;  2YXH A;  4O2B A;  4X20 B;  5LP6 C;  5CA0 B;  4PDM A;  4FFB B;  1VQP V;  5IWA O;  2QTS A;  3CX5 F;  4D7T A;  4H44 B;  2DJV A;  1HR0 O;  1BT8 A;  5LOV A;  1D2D A;  1N34 B;  2YSU B;  4MVR A;  2CAZ C;  3ZHU A;  4J9Z B;  2DE0 X;  1XNR B;  2DWE C;  3FB7 C;  4G28 B;  2H3O A;  3SJQ C;  3TCU A;  5DEC A;  4FLZ A;  4UFZ A;  2LGQ A;  3UCS C;  3E35 A;  2WA3 A;  1S0V A;  3GWO A;  1Z5W A;  1ZSP A;  4DV1 O;  4B3R B;  3A0B Z;  3RBZ A;  3LSQ A;  2UXC B;  5JJE B;  4RWU A;  2YIA A;  2P67 A;  4IL6 Z;  1JA8 A;  4AQY O;  2UUB B;  1K4C C;  1NVP D;  1CEZ A;  2RCV A;  1M57 B;  3OR6 C;  3W7T A;  1MNG A;  3O65 A;  4I9W A;  2PTM A;  1M56 B;  1OCO B;  4JI7 O;  1SA0 B;  2XAS A;  3L71 H;  5EK0 A;  5IJ0 B;  5C8Y B;  5EIB C;  2HJF C;  5LHH A;  2YEV A;  3AEI A;  4DUY B;  2E74 B;  2EIJ C;  3G71 V;  1BS3 A;  4LFC B;  2YS8 A;  3G80 A;  2ADQ B;  1J95 A;  3MD0 A;  4LCU C;  1YJN V;  5FLX N;  2JGD B;  1DF4 A;  2W0F C;  4AIL C;  5D5P A;  4ZI7 A;  1N0J A;  1IDS A;  4JZG A;  5J2T A;  2XAQ A;  2WLH A;  4TV9 A;  1PL4 A;  2ZDI A;  3BA8 A;  1M9N A;  3QO8 A;  4LFB O;  4QPJ A;  2XT9 A;  3SDL A;  5IY5 B;  4NXM O;  4P9O A;  1PNM A;  1WAZ A;  1X59 A;  4H37 A;  1H2N A;  1Q5O A;  1FFX B;  3JSL A;  2W6J G;  5LMN O;  1EZJ A;  3ABT A;  4RQE A;  3LSU A;  4DV0 O;  1Q6I A;  3E8G A;  1OV9 A;  3E83 A;  4F6R A;  1K5Q A;  2VS0 A;  3J80 N;  1L8D A;  3K5M A;  2F66 C;  1RM1 C;  2XAJ A;  4KUM A;  3U10 A;  3ZHQ A;  1R3J C;  4Z1M G;  3VQX A;  4A5U B;  1R6N A;  2G38 A;  4MS2 A;  2EX3 A;  1B6Q A;  2ZCE A;  4JPR A;  3K57 A;  2CH7 A;  2RMK B;  1WPB A;  2YIC A;  3TK1 A;  4I0X A;  1S72 V;  2EZP A;  4LF5 B;  1GK9 A;  3FB5 C;  2GSM B;  4PA3 A;  4MTG A;  2VWJ A;  5LA6 B;  2Q6A A;  4UCR A;  1R73 A;  2XAF A;  5EC2 C;  4LF8 B;  4DR5 B;  3OFN G;  3OM3 B;  3U0Z A;  2NN4 A;  3AG2 C;  2GUZ A;  2IH3 C;  2LW7 A;  4K3A A;  2YXL A;  4X1I A;  1AJN A;  1FXH A;  2MW2 B;  1EN6 A;  2DQ0 A;  3UT5 B;  2ARH A;  2VQF B;  4B7E A;  5CN0 A;  5EBM C;  4DV3 O;  4O2A B;  4BWA A;  3RYF A;  3RYI B;  4J9Y B;  2A9H A;  3QO7 A;  1NU1 H;  2R70 A;  2Z5U A;  4FFB A;  1XOU A;  4DRX B;  4NXN B;  4ASU G;  1IBM B;  1T5E A;  1GRJ A;  1R3K C;  1M4U A;  3JD4 A;  4JAA A;  4JGS A;  2EUL A;  1IZ3 A;  1WB7 A;  4JI4 B;  3ZRW B;  4B3T O;  2F43 G;  4TUY A;  1MZE A;  1OCZ C;  5KAI Z;  1S76 D;  2WPD G;  5B1B C;  2DYS C;  4GX2 A;  3TXS A;  1ARO P;  3P32 A;  2HHH B;  1WN7 A;  4KFM A;  4ZKI A;  1YEW A;  3ZHS A;  4IHJ A;  1YJW V;  4JI6 B;  1XNQ O;  2QEX V;  1YF2 A;  2HP8 A;  3BCC H;  4D6T H;  4ZIB A;  1URF A;  1MSD A;  1F7Y A;  1EM1 A;  3OD4 A;  1NR1 A;  1AR4 A;  3CJH A;  5KA6 A;  5JH7 A;  3N2G B;  4W4K A;  4PDL A;  1QBZ A;  2P4K A;  2IU0 A;  1KP3 A;  2DN9 A;  3HKE A;  1MSW D;  4DR1 O;  1XNR O;  1EN5 A;  3FAV B;  4PV1 B;  5EYP B;  4PA6 A;  4TQD A;  4J42 A;  5ITZ A;  3ZMV A;  4EB6 B;  3CCU V;  2IW5 A;  1LR1 A;  2JJ2 G;  1K73 W;  1BQZ A;  2Q7G A;  4L87 A;  2V7Q G;  4GKK O;  2UUB O;  2XAG A;  4DV6 B;  1BL8 A;  3DSQ A;  3G6E V;  2RQ6 A;  1FFX A;  4WF9 V;  4E4E A;  2YI8 A;  4DUY O;  3G4S V;  4ZHQ B;  4DUZ B;  2P22 C;  3LSS A;  4PHZ A;  2BTO A;  3W7W A;  1Q7Y W;  4UCT A;  1RSO B;  4UCU A;  4LP8 A;  4LWS B;  1OCC C;  3NR7 A;  1FXK A;  1XIL A;  2Z3Y A;  4LNU A;  4LR3 A;  1G1X B;  4FIP C;  1BZK A;  3WB1 A;  4HYO A;  2HKO A;  3CB2 A;  4NB5 A;  2ITD C;  3ABK C;  3A8T A;  1XUQ A;  3BVO A;  3ETD A;  1SES A;  4TV8 A;  3CRQ A;  5BY1 A;  4CZZ A;  5LYJ B;  1YTF B;  4J7Z A;  2QM8 A;  2VQE O;  3T1H O;  1ZL8 B;  1R3L C;  2YC0 A;  4E2L A;  3WG7 C;  5LGN A;  4BIU A;  3CYO A;  3PN1 A;  4JI0 B;  4JV5 B;  2EIK B;  3UQ8 A;  1QNM A;  2Q7H A;  3E2E A;  5EBW C;  2KSD A;  5LXT A;  4F4L A;  2F4V B;  2ZXW C;  1AI7 A;  3GB7 C;  3ZJZ A;  3UT5 A;  3CCL V;  1R1B A;  1IXB A;  4JI5 B;  4LH7 A;  1BQ0 A;  1XMQ O;  4JI2 B;  5LMU B;  1MOF A;  2EIM C;  3F7Y C;  3N2K A;  3HKB A;  4LF5 O;  4WFE A;  4HBN A;  5L3D A;  3DXR B;  1COW G;  3HKC B;  5GW7 A;  1N32 O;  2GTS A;  4GCZ A;  1IUR A;  3JAW A;  1TVK A;  1Q81 W;  4YY3 O;  3HR0 A;  3HKD B;  3ZN0 A;  1GTO A;  1YCI A;  4O2B B;  3CSX A;  1WNS A;  4GKJ B;  2ZQM A;  2Y0P A;  4JTC B;  2CE4 A;  2VQF O;  3J81 N;  2DWD C;  2X7R B;  2ZR3 A;  2ZIN A;  4PA7 A;  3TXQ A;  3K59 A;  3JAR B;  4DW0 A;  5KHI A;  3CRA A;  3AG7 A;  5KUK A;  4CH6 A;  3MAQ A;  1K5S A;  4KXR A;  3ZRV A;  3CMA V;  3H1J H;  3ABL B;  4MVU A;  1IBM O;  4I50 A;  4IYH A;  4PI0 A;  1PNK A;  1P7G A;  3AK2 A;  4X62 O;  2DYR B;  2QWO B;  4LF4 B;  4JI8 B;  1I5X A;  1S5J A;  1YTF D;  2HG5 C;  3OMI B;  2Q69 A;  3B77 A;  4FLU A;  2E5L B;  3OGC C;  4WFH A;  2HHH O;  4UVB A;  2N04 A;  4N23 A;  5EYP A;  4P30 A;  2V4D A;  4ZBM A;  2EIN B;  3P3N A;  3OAA G;  2IH1 C;  4EEQ A;  4JI6 O;  4CS3 A;  3JAL A;  2FML A;  3GWK C;  4H33 A;  4PDV A;  4UCS A;  4U3J A;  4EB6 A;  4PEL A;  4J41 A;  2DW4 A;  4X64 B;  2YEV B;  4R6Z A;  1N8R W;  3WFV A;  1DLB A;  4DV7 B;  2R9A A;  2CTW A;  1N36 O;  4NVP A;  1R3I C;  3PJS K;  1H2G A;  3ZS8 C;  5IYD O;  4ZI7 B;  3OT7 A;  4I5S A;  5J2T B;  1VQ5 V;  4OX9 O;  3C3S A;  4TV9 B;  1SQG A;  1H8E G;  1TA8 A;  1VF5 B;  4U7N A;  3BY6 A;  2ZE7 A;  1YI2 V;  3B2E E;  5LL6 Y;  2P4V A;  3CEI A;  1HNW O;  1P4R A;  1K7D A;  1N33 O;  4KHP B;  3JCU Z;  2IJK A;  3I55 V;  5B1O A;  4FZ0 A;  1N4C A;  3SYA A;  4IT5 A;  1XRE A;  1P49 A;  4F6R B;  3L73 H;  4DV6 O;  4DV2 O;  2ZKO A;  2ZNI A;  3ASO B;  5IYC O;  3LDD A;  1RPO A;  4PJ0 Z;  4I4T A;  1BE3 H;  3IFX A;  4ZOL A;  4QIW F;  2HLD G;  1ZL8 A;  2EIL C;  1FJG B;  2WWW A;  4YJ3 A;  3TET A;  1NJI W;  3ABM C;  1L0N H;  3K03 A;  2ZE6 A;  4O4J A;  3JAS A;  1NVP B;  1YIT V;  1SER A;  1XL4 A;  4JYB A;  2AXT Z;  4JYY A;  2RN9 A;  4QE9 A;  4K8Z A;  2AZ0 A;  3AG1 C;  3ASN B;  1AR1 B;  2GV9 A;  1GN4 A;  5J9P C;  4Q6G A;  1TUE B;  2D2C B;  3LUT B;  1JFF A;  2P6J A;  3RYC B;  5KA5 A;  1FS0 G;  3LNN A;  2X6B A;  2W6I G;  3B8M A;  2GUZ B;  3OMN B;  3ZCC A;  4QPK A;  4X1I B;  4DV5 B;  4JAS A;  4RQF A;  1P7B A;  1YVW A;  2HVK C;  3OTO B;  2NR5 A;  2KB1 A;  3JAM N;  1R6K A;  2JGU A;  1GAX A;  1SKV A;  3HKC A;  1TGO A;  4F6E A;  2QKS A;  1FXV A;  5CA1 A;  3CPW U;  2A0L A;  1WP7 A;  2ZIO A;  2JRI A;  2Y69 B;  2P06 A;  4LFA O;  3RYF B;  2PYL A;  3CS5 A;  1H8H G;  3DC5 A;  1E1Q G;  3SGI A;  4JTD B;  3K79 A;  3JAT A;  2QKC A;  1QLE B;  3ZMZ A;  1H2M A;  5L3F A;  3L74 H;  3W7S A;  1SRY A;  3H9V A;  4UCO A;  4N21 A;  3JAR A;  5LMU O;  2Q5Z A;  4TUY B;  1TUB A;  1M57 C;  2CGO A;  3CRC A;  2IJH A;  1M56 C;  1OCO C;  1Y76 A;  5L3C A;  4J11 A;  1S5L Z;  3ZMU A;  4CH4 A;  2PF4 E;  3AG3 B;  1VF7 A;  4CS2 A;  2L6L A;  2BCC H;  2HVJ C;  4B3M B;  1ZAU A;  3L72 H;  4K0K O;  2YIB A;  4IHJ B;  4GKJ O;  4NTY A;  1F51 A;  4PA4 A;  1BHA A;  1KC8 W;  2ODM A;  3CJH B;  5JH7 B;  2ZM6 B;  3SYC A;  3VQY A;  3KKY A;  1AR5 A;  1VP7 A;  3HKE B;  2PI5 A;  1N0N A;  3STL C;  1NTK H;  5IY5 C;  4LF6 B;  2F93 B;  1V9P A;  2RJZ A;  1KYO F;  5KUM A;  1W0J G;  2D3O W;  3APO A;  1UPG A;  1VF6 A;  4FM1 A;  4FJC C;  3IC9 A;  3K08 A;  5ITZ B;  4JI3 O;  5JCO A;  1IBL B;  1V54 B;  4TWK A;  2ZR2 A;  4PI2 A;  4HZ3 A;  4BW5 A;  1HNX O;  3AK1 A;  4DR3 O;  3ZHT A;  1GMG A;  3ETE A;  2Q0O C;  1K3E A;  4MW3 A;  1MMM A;  2Y0I A;  4XBF A;  2A3Q A;  1YJ9 V;  3H1K H;  3SPC A;  1M1K W;  4QGP A;  2RDC A;  1OZ0 A;  4L8J A;  5IT9 N;  3VQV A;  2B1G A;  3MHH C;  5B1A B;  3SJC C;  1FXK B;  2BOC C;  5L3E A;  3D36 C;  4LNU B;  2A06 H;  3W7X A;  4GX5 A;  3LDC A;  3RYH B;  1BGY H;  1ZLZ A;  2QWQ B;  4DYL A;  1BCC H;  4B3S B;  4TV8 B;  3OMA B;  3OE7 G;  3A0H Z;  4KHP O;  1TAE A;  3P3P A;  5FL7 G;  2AZ2 A;  4DR6 O;  2B9Z A;  2VRZ A;  2Z0A A;  3SPH A;  2Y48 A;  3G6B A;  5B5E Z;  1VIB A;  3RYC A;  3KZI Z;  2EJR A;  4WBN A;  1ROP A;  2IJJ A;  2GBO A;  3F5T A;  4P2Z A;  5GON A;  5FPO A;  3BA9 A;  1R6T A;  2Y4T A;  5LXT B;  4BIO A;  3BHP A;  1VQ9 V;  1FJG O;  2OT5 A;  4MT8 A;  1JQ0 A;  4NTW A;  4CC5 A;  1CP9 A;  2AHZ A;  2XHB A;  4TOI A;  1AJQ A;  3CWB H;  2KQX A;  3N2K B;  2QWR B;  3HKB B;  4DV4 B;  3QG5 A;  3H01 A;  3VOU A;  2UU9 O;  2Y4U A;  1PPJ H;  3QO5 A;  2GDS A;  2LW1 A;  3C90 A;  3JAK B;  2WLL A;  4X1K A;  2PZS A;  3JAW B;  4RUF A;  1TVK B;  1US6 A;  2RNB A;  4IYI A;  3APQ A;  3CXH F;  2UXD B;  1PV0 A;  4RAI A;  3T1Y B;  1KKD A;  3NXS A;  4R7C A;  2UXB B;  3L9D A;  1B06 A;  1XMO O;  4OXS A;  1SQF A;  4I9Q A;  3CRR A;  1THZ A;  2L35 A;  5JJJ B;  3CCS V;  3FYI B;  2WLI A;  5E79 Z;  4JYA B;  4I50 B;  2UUA B;  4RO2 A;  1N34 O;  1G6U A;  5TIS Z;  1QCE A;  5LP6 A;  1VQ8 V;  4OPA A;  3FYE B;  1HP8 A;  3MHS C;  4YHH B;  3M99 B;  1G4Y B;  2XAH A;  5CB4 A;  4B7K A;  3E22 B;  4DR2 B;  3S3X A;  4FLV A;  1VQK V;  5BXZ A;  3MDS A;  1KU9 A;  5H6R A;  4DR7 B;  1QVF U;  2LQT A;  5B1B B;  4B3R O;  1Q82 W;  3JAL B;  2DYS B;  4U3J B;  2MK3 A;  2UXC O;  4CBC A;  2WAM A;  4JI1 B;  3SPI A;  1MG1 A;  3ZMT A;  1K97 A;  1NKD A;  2AW9 A;  2E75 B;  1ZX3 A;  4LF6 O;  1SQQ H;  5B3S B;  1ORQ C;  5B1N A;  1IBK B;  4MTX A;  1I7F A;  1DGS A;  4LFC O;  2ADP A;  2QJ1 A;  4CC6 A;  1QQC A;  4TSF G;  2K9P A;  2FKX A;  3OUF A;  2EIK C;  1NTM H;  1VQM V;  2JK5 C;  4JYC A;  2NLJ C;  4UB6 Z;  2CUG A;  4FLT A;  4I55 A;  2OWO A;  3FD9 A;  1K4D C;  2CTP A;  4U3F H;  1NQT A;  3RYH A;  1NZ6 A;  2JVD A;  2YDE A;  4I4T B;  3K04 A;  4DR4 B;  2R9I A;  2WA4 A;  4ZOL B;  3ZIA G;  4YJ3 B;  1W59 A;  2DOS A;  4O4J B;  3JAS B;  4X65 B;  5JWP A;  4UV8 A;  5B66 Z;  4QNH B;  3QVN A;  2JS5 A;  2IU3 A;  2ATK C;  3H1I H;  4I7Z B;  1Y67 A;  2F95 B;  1FD9 A;  1PL0 A;  2BTQ A;  1JFF B;  1CPY A;  1SQX H;  3M8A A;  5CBF A;  2QDO A;  4X66 B;  1S5H C;  4YIO A;  1WP8 A;  5FNV A;  4LF9 B;  1SQB H;  3OTF A;  4MVQ A;  2EBO A;  1NTZ H;  2W0X A;  4LF7 B;  3TGU H;  1AJP A;  2XTA A;  1Y66 A;  4O4I A;  3EVK A;  4LF8 O;  5CA1 B;  2XOK G;  5HFL A;  4DR5 O;  2YUA A;  3JAK A;  5IWA B;  1H38 A;  3LNM B;  2OCC B;  3OEH G;  5H5N A;  3ABL C;  1HR0 B;  3A0R A;  4Z1V A;  3K9S A;  4P9P A;  3JAT B;  3CRM A;  2EJ7 A;  2H8P C;  3I5D A;  3ZX6 A;  3CC2 V;  1K34 A;  4FPP A;  4OPH A;  1XHX A;  3B8N A;  4ABM A;  3RT3 C;  4UVC A;  1OCR B;  5H9C A;  1TUB B;  4DV4 O;  3Q4H A;  2EZO A;  2UUC B;  3CCR V;  2EIN C;  4DV1 B;  4WFB V;  3FB6 C;  1VQ6 V;  2BSK A;  3ZN1 A;  1Y76 B;  4NXN O;  3DC6 A;  5E1A C;  1RFY A;  3IC7 A;  4AQY B;  2Q68 A;  3RVZ A;  4JI4 O;  4H13 B;  2LP7 A;  3L75 H;  2XUM A;  4JI7 B;  3H1H H;  2X6C A;  3HB3 B;  5JCO C;  3UKM A;  2PY5 A;  1PM9 A;  3E22 A;  4AI8 A;  4KP4 A;  5D5Q A;  1SZX A;  5BMV B;  1HDJ A;  2ZDI C;  5L3G A;  4FM2 A;  2ITC C;  2P5O A;  3JD0 A;  2JIZ G;  4WFG A;  3R65 A;  1V55 B;  3T1C A;  4C7U A;  5JJN B;  2QM4 A;  4JYA O;  2B5U A;  5CBH A;  3R66 A;  1XEQ A;  2OIG A;  4KL1 A;  5LGU A;  5IE9 A;  4LFB B;  1JOY A;  1VQN V;  2OTL V;  3EXA A;  4YHH O;  3ASO C;  5CA3 A;  3JYC A;  4FZ1 A;  5JVD A;  1G8M A;  3STZ C;  4EFB A;  4BIZ A;  2JEX A;  3QTC A;  2P90 A;  3BAB A;  1GO3 F;  4O4H A;  3VQW A;  3CCV V;  4JI1 O;  4WCE V;  4DK1 A;  3ASN C;  4MVS A;  5H6Q A;  5DED A;  4WFA V;  5A2Q N;  1F4N A;  1Q90 D;  1Q6H A;  2QE7 G;  4UVA A;  1Z5V A;  4X88 A;  1FKA O;  3WU2 Z;  2IBZ H;  2WLK A;  4DUZ O;  5KHK A;  3CXC U;  3CE2 A;  2ILM A;  1QU7 A;  2YIB D;  3J7A U;  2O57 A;  1Z2G A;  4B08 A;  2Y69 C;  1ZWI C;  1FPO A;  4PD4 F;  3SJA C;  3T2M A;  5JQG B;  1QLE C;  3I56 V;  4JAV A;  4WBN B;  4J80 A;  3FX7 A;  3FKS G;  5GON B;  3E86 A;  1L1F A;  4HNA B;  5L3B A;  3DGE A;  5GTI Z;  5HFM A;  3ICX A;  3ABU A;  5J2U B;  2N05 A;  1ZUQ A;  2IJI A;  4X65 O;  3SJB C;  4JI0 O;  3IGA C;  4JV5 O;  3FFQ A;  3AG3 C;  5FPR A;  3WB0 A;  3N27 A;  2JDI G;  1KB9 F;  1XBL A;  4GX1 A;  4GLX A;  1IVS A;  1WB8 A;  2F4V O;  4YJ2 A;  1A32 A;  1Q6U A;  2X0L A;  3RWR D;  2Q73 A;  2HFE C;  2Q8V A;  2WLL B;  2H94 A;  3QNE A;  4X1K B;  4JI5 O;  3AG4 B;  4OGQ B;  1YDX A;  1JMK C;  4JI2 O;  1UFI A;  1AVM A;  1HWY A;  1B3Q A;  4G27 B;  3JD3 A;  1XNQ B;  4FMT A;  2OIE A;  2M6Y A;  5KHG A;  2HR3 A;  4TT3 G;  2LGW A;  4IGG A;  3KCY A;  1YHQ V;  1PP9 H;  3X2Q B;  1U96 A;  5KX5 A;  1JR9 A;  1X4T A;  2WLI B;  3SPG A;  4IIJ A;  1V54 C;  1SQP H;  4DR1 B;  4FLX A;  4LH6 A;  1FYJ A;  4H0L B;  5BMV A;  2A7W A;  5KHH A;  1VQ4 V;  5LP6 B;  5KLV H;  3JCZ A;  1JJO A;  1AB3 A;  1I5Y A;  2UUC O;  4O4L A;  4J10 A;  2YI9 A;  5CB4 B;  2XND G;  3LDE A;  1PKX A;  2ZE8 A;  3EHB B;  1E1R G;  4GKK B;  2WSS G;  1MA1 A;  4LF4 O;  4JI8 O;  4UB8 Z;  1VEW A;  1WA8 A;  3B40 A;  1XL6 A;  1OHH G;  3OGI B;  2E5L O;  3JSN A;  1NS1 A;  2YID A;  5B1A C;  1XI1 A;  1FXK C;  1RP3 B;  1AI4 A;  3K9A A;  3THO A;  1DTO A;  2JJ1 G;  2LFR A;  1KQS U;  3ETG A;  2FB5 A;  3IAY A;  1DK1 A;  4DK0 A;  4FLY A;  2LJ2 A;  4X64 O;  1D5N A;  3K5O A;  2LFS A;  3AK3 A;  1NR7 A;  4DV7 O;  3ML0 A;  3KCX A;  1CXZ B;  1HW7 A;  4K35 A;  3BEH A;  1M5I A;  3RW0 A;  2BOB C;  4GUN A;  2DQ3 A;  4LC1 A;  2EIJ B;  4X1Y A;  4I55 B;  2VQE B;  3T1H B;  2ETN A;  2QGN A;  3ZBH A;  4CH5 A;  2BE3 A;  1E79 G;  1BMF G;  4NYK A;  2JS3 A;  5EZY A;  1RPR A;  4Q20 A;  5JQG A;  3B09 A;  2C2A A;  2F1M A;  4R8C A;  3L70 H;  3BAA A;  1QR8 A;  2KG7 A;  2QWP B;  3JD2 A;  4BR6 A;  1GM8 A;  1XMQ B;  1HNZ B;  4HNA A;  2BTQ B;  1F4M A;  2FYU H;  4NKG B;  3P30 A;  5DM6 V;  5J2U A;  1SET A;  1RM1 B;  1N32 B;  4TQF A;  4X9Q A;  5IJ9 A;  1O9H A;  5FNV B;  5IYB O;  3CCQ V;  4YY3 B;  3FB8 C;  4GYC B;  4X8A A;  1K33 A;  1VQO V;  5K1P A;  4O4I B;  1WJZ A;  5IYZ B;  2IM9 A;  4DO2 A;  2OCH A;  2UXX A;  4XDK A;  1J5E B;  4K8X A;  1NH2 B;  1QHT A;  4MTF A;  4DV5 O;  5KAF Z;  4XDJ A;  2X6A A;  4DXW A;  4FVM A;  3OTO O;  4X20 A;  5CA0 A;  2YXY A;  1AI6 A;  2A79 B;  1B04 A;  2QWN B;  4J7K A;  5KHJ A;  3AG2 B;  1U97 A;  3Q4H B;  5C93 A;  2CDY A;  1Y6X A;  5EIB D;  4X62 B;  1I0H A;  4FLW A;  2ZE5 A;  1H2K A;  2BSK B;  3GVM A;  3SR2 C;  5BR8 B;  1LUW A;  2CK3 G;  3RVY A;  1ENV A;  4NTX A;  4W4L A;  2QKA A;  3RFR A;  4MW8 A;  1XHZ A;  4FFK A;  2PGG A;  4Z2W A;  1AIL A;  3M7M X;  3S3W A;  1NI8 A;  1KUQ A;  5B3S C;  2F23 A;  4B3M O;  3DTU B;  1JJ2 U;  1QR9 A;  1OCZ B;  1N36 B;  1XQ8 A;  1Q8I A;  4J7J A;  4JZ2 A;  1H2L A;  2DMX A;  1AI5 A;  1JX9 A;  1SA0 A;  5IJ0 A;  5C8Y A;  4OX9 B;  3ZRS A;  3CME V;  1GN2 A;  2P7T C;  3D3I A;  2OYQ A;  2ZM6 O;  4X89 A;  1QLN A;  5KMG B;  1Y74 B;  1LUV A;  1KEC A;  2Q9L A;  5A9G A;  3F5W C;  1P84 F;  5IDJ A;  1M90 W;  2JGD A;  1HNW B;  2CTR A;  1N33 B;  5JVD B;  4GZR B;  1I08 A;  2HJD A;  4G2K A;  1YIJ V;  2QA4 V;  1NH2 D;  1DF5 A;  4DV2 B;  1IBL O;  5EC1 C;  4RUE A;  1K92 A;  4O4H B;  2PUS A;  3JD1 A;  3T4D A;  3E8H A;  4PDR A;  2M7W A;  1GKF A;  1ZTE A;  1PNL A;  1BSM A;  2WLN A;  3E8F A;  5LBQ A;  1NBM G;  1UJW B;  4D7S A;  3OW2 U;  4MVM A;  1YSC A;  3K0G A;  3IJ4 A;  3CC4 V;  3F7V C;  4UUJ C;  3BPZ A;  1H2S B;  1KMI Z;  2WLJ A;  2OCC C;  1WLE A;  2QM7 A;  1GM7 A;  2ZT9 B;  1I94 B;  1PD3 A;  5H2F Z;  5LA6 A;  3OEE G;  2Q7E A;  2PYJ A;  1JCH A;  1L0L H;  1YXB A;  1S77 D;  1OCC B;  1GN3 A;  4B3S O;  4LFA B;  1SS3 A;  3D36 A;  2R72 A;  5K1X A;  5LHG A;  3K0D A;  1OCR C;  3ZHR A;  3ABK B;  3CCJ V;  2OTJ V;  5IYZ A;  1SF9 A;  1O9G A;  2B1I A;  5CBG A;  1K9M W;  1VAR A;  4GT1 A;  4O2A A;  3RYI A;  1HNZ O;  1JVM A;  3E89 A;  4YJ2 B;  2DYR C;  2V1D A;  3WG7 B;  1KKC A;  4DRX A;  4MTO A;  2ZD9 A;  2HEP A;  1SQV H;  4YXW G;  1MZF A;  1Q3E A;  4JTA B;  4R50 A;  4K0K B;  4MSW C;  3E8B A;  2ZXW B;  2VWK A;  5LHI A;  3ZRW A;  4FK5 C;  3RGB A;  3WB2 A;  4EKW A;  1FFT B;  1V55 C;  1Y4M A;  3CCE V;  3CCM V;  1EBO A;  1J5E O;  1KP2 A;  2EIM B;  3OR7 C;  5LOV B;  4QE7 A;  2ZIM A;  5KX5 B;  1IX9 A;  4QJF B;  1VF6 C;  3BFR A;  2UXD O;  3OUS A;  4IIJ B;  1JPX A;  3T1Y O;  4DW1 A;  2UXB O;  1IXM A;  3O9O A;  3N2G A;  3UO3 A;  4O4L B;  4JI3 B;  1W0K G;  3TJT A;  3K5N A;  4CS4 A;  3QF7 A;  1GM9 A;  1GN6 A;  1HNX B;  2JEU A;  2UUA O;  1SZT A;  5BR8 O;  4DR3 B;  3BRC A;  4JF3 A;  3FAV A;  1M93 A;  3K58 A;  4PA9 A;  4XDL A;  5KMG A;  4BAY A;  1Y74 A;  1WA8 B;  2GTA A;  4NXM B;  1EFR G;  3ZRX A;  2Q0A A;  5BZB A;  1Q86 W;  5LMN B;  1FAF A;  5GTH Z;  4DR2 O;  4DV0 B;  1XDC A;  5CMU A;  5EBL C;  3EFF K;  4YIP A;  2LO1 A;  1VQ7 V;  2FTK A;  1VMG A;  4DR7 O;  3D8C A;  3CC7 V;  2Q4P A;  2CGN A;  3K3W A;  4MVZ A;  3U11 A;  3ZED A;  3ETQ A;  3C3T A;  3HPL C;  3SYO A;  1Q43 A;  3ZHV A;  3CP1 A;  5LGT A;  2UXN A;  4GX0 A;  4MVO A;  4ZHQ A;  3T4Z A;  3UO2 A;  5AG2 A;  2CTQ A;  1NT2 B;  1GH6 A;  2ZNJ A;  4WFF A;  3H1L H;  4UXN A;  3K5L A;  3W7U A;  1RSO A;  2R9R B;  1EN4 A;  2K1E A;  4UV9 A;  3B4S A;  1IBK O;  4LWS A;  4ICG A;  5DN6 G;  4X1Y B;  3SPJ A;  1SC5 B;  4DR6 B;  2QSA A;  1YZB A;  4U7O A;  4JAU A;  2AHY A;  2AGA A;  4FM0 A;  2FL4 A;  4BW9 A;  1QVG U;  2E76 B;  5EZY B;  1AP5 A;  2NNU A;  1KD1 W;  1OJH A;  5LYJ A;  2PI4 A; 
#chains in the Genus database with same CATH homology
 1QCE A;  1VQ8 V;  1Q81 W;  3FYE B;  3MHS C;  3ZN0 A;  1GTO A;  2LFS A;  1G4Y B;  2XAH A;  3M99 B;  1NR7 A;  3AG4 C;  2ZQM A;  1W2B U;  3ML0 A;  1LNQ A;  1VQK V;  3BEH A;  4JTC B;  1VQL V;  3RW0 A;  2BOB C;  5H6R A;  3SYQ A;  2DWD C;  2DQ3 A;  2GHY A;  2X7R B;  1K8A W;  4LC1 A;  2ZR3 A;  1WPX A;  1QVF U;  5B1B B;  4PA7 A;  2EIJ B;  1Q82 W;  2DYS B;  2MK3 A;  2QTO A;  3K06 A;  3VBB A;  3UM7 A;  4CBC A;  2WAM A;  2Q67 A;  5KUK A;  1BHB A;  1K5S A;  1F23 A;  1E79 G;  3ZRV A;  3CMA V;  4MVU A;  3ABL B;  4HAM A;  3SPI A;  4LBE C;  2EIL B;  3X2Q C;  3CD6 V;  1MG1 A;  1BMF G;  3ABM B;  3ZMT A;  1K97 A;  1PNK A;  1NKD A;  3ZMS A;  1RPR A;  4Q20 A;  1S3J A;  2DYR B;  5B3S B;  1ORQ C;  5B1N A;  2C2A A;  2WLM A;  3KG2 A;  3AG1 B;  4R8C A;  1I5X A;  3SYP A;  4MTX A;  1YTF D;  1QR8 A;  2HG5 C;  1MAB G;  3OMI B;  2Q69 A;  3B77 A;  3JD2 A;  4PDM A;  1GM8 A;  3OGC C;  4WFH A;  1VQP V;  4UVB A;  4N23 A;  4TSF G;  3OUF A;  1F4M A;  4P30 A;  4ZBM A;  2EIN B;  2EIK C;  1VQM V;  3OAA G;  2IH1 C;  2JK5 C;  4JYC A;  3P30 A;  2NLJ C;  5DM6 V;  1SET A;  1RM1 B;  4H33 A;  4PDV A;  2YSU B;  1K4D C;  4PEL A;  5IYB O;  2DW4 A;  2YEV B;  4MVR A;  3CCQ V;  1NQT A;  4R6Z A;  4J9Z B;  3FB8 C;  1N8R W;  3WFV A;  4X8A A;  1K33 A;  1DLB A;  1VQO V;  2DWE C;  3FB7 C;  4G28 B;  3SJQ C;  3TCU A;  3K04 A;  2R9I A;  4DO2 A;  1R3I C;  3PJS K;  3E35 A;  1H2G A;  2UXX A;  4XDK A;  5IYD O;  3ZIA G;  1S0V A;  4I5S A;  3GWO A;  1VQ5 V;  1NH2 B;  4MTF A;  4XDJ A;  2X6A A;  4DXW A;  3RBZ A;  4UV8 A;  1H8E G;  4QNH B;  3LSQ A;  4U7N A;  2IU3 A;  3BY6 A;  2ATK C;  1YI2 V;  2P67 A;  1K4C C;  1AI6 A;  2A79 B;  1NVP D;  1CEZ A;  1PL0 A;  3AG2 B;  1M57 B;  3OR6 C;  1CPY A;  1P4R A;  1K7D A;  5CBF A;  3W7T A;  4I9W A;  1S5H C;  1M56 B;  1OCO B;  2IJK A;  3I55 V;  5B1O A;  5C93 A;  2XAS A;  3SYA A;  5EK0 A;  2HJF C;  5LHH A;  2YEV A;  4MVQ A;  3AEI A;  3ASO B;  2EBO A;  2EIJ C;  3G71 V;  5IYC O;  3LDD A;  1RPO A;  2CK3 G;  3RVY A;  1AJP A;  1Y66 A;  1ENV A;  1J95 A;  3MD0 A;  2XOK G;  5HFL A;  4LCU C;  1YJN V;  1H38 A;  3IFX A;  3LNM B;  4MW8 A;  4QIW F;  2OCC B;  2HLD G;  3OEH G;  3ABL C;  1DF4 A;  2W0F C;  2EIL C;  3A0R A;  2WWW A;  3TET A;  1NJI W;  2XAQ A;  3ABM C;  2WLH A;  4P9P A;  3K03 A;  1NVP B;  2H8P C;  1YIT V;  1SER A;  1XL4 A;  2ZDI A;  1M9N A;  4JYB A;  3QO8 A;  5B3S C;  4QE9 A;  4QPJ A;  3CC2 V;  1K34 A;  3DTU B;  3AG1 C;  4FPP A;  3ASN B;  5IY5 B;  1AR1 B;  4P9O A;  1PNM A;  5J9P C;  1JJ2 U;  4H37 A;  1TUE B;  1QR9 A;  3B8N A;  1OCZ B;  3LUT B;  2W6J G;  2P6J A;  1EZJ A;  3ABT A;  4RQE A;  5KA5 A;  1FS0 G;  1AI5 A;  4UVC A;  1JX9 A;  1OCR B;  5H9C A;  2X6B A;  2W6I G;  3B8M A;  3E8G A;  3OMN B;  2EZO A;  3ZCC A;  3E83 A;  4QPK A;  1K5Q A;  3CCR V;  2EIN C;  3ZRS A;  4WFB V;  3FB6 C;  3CME V;  1VQ6 V;  4JAS A;  2P7T C;  3D3I A;  3ZN1 A;  4RQF A;  1P7B A;  1RM1 C;  2XAJ A;  4KUM A;  4X89 A;  2HVK C;  1QLN A;  5E1A C;  1R3J C;  2KB1 A;  1R6K A;  4Z1M G;  1KEC A;  2QKS A;  3IC7 A;  1FXV A;  3F5W C;  2Q68 A;  3RVZ A;  3CPW U;  5IDJ A;  2A0L A;  1M90 W;  2LP7 A;  2Y69 B;  1R6N A;  4MS2 A;  1H8H G;  1E1Q G;  4G2K A;  4JTD B;  1B6Q A;  2X6C A;  3HB3 B;  3K79 A;  4JPR A;  2QA4 V;  1YIJ V;  3UKM A;  1QLE B;  1NH2 D;  1DF5 A;  3ZMZ A;  3TK1 A;  4KP4 A;  1S72 V;  2EZP A;  5EC1 C;  5L3F A;  1GK9 A;  3W7S A;  3FB5 C;  1SRY A;  2GSM B;  4PA3 A;  4RUE A;  4MTG A;  2ZDI C;  5L3G A;  2ITC C;  1K92 A;  2Q6A A;  4N21 A;  1R73 A;  2XAF A;  3JD0 A;  2JIZ G;  4WFG A;  3JD1 A;  3R65 A;  1V55 B;  5EC2 C;  3T1C A;  3T4D A;  3E8H A;  3OFN G;  2M7W A;  1GKF A;  3OM3 B;  4PDR A;  2B5U A;  3AG2 C;  1PNL A;  1M57 C;  2IH3 C;  2IJH A;  1AJN A;  1FXH A;  5CBH A;  1M56 C;  1OCO C;  2WLN A;  3E8F A;  5L3C A;  3ZMU A;  5LGU A;  5LBQ A;  3AG3 B;  1NBM G;  1UJW B;  1JOY A;  1VQN V;  2DQ0 A;  2HVJ C;  3OW2 U;  2OTL V;  4MVM A;  3ASO C;  5CN0 A;  5EBM C;  5CA3 A;  3JYC A;  1YSC A;  3K0G A;  1F51 A;  3CC4 V;  4PA4 A;  1BHA A;  1KC8 W;  3F7V C;  4UUJ C;  4J9Y B;  1G8M A;  3STZ C;  4BIZ A;  2A9H A;  3QO7 A;  2JEX A;  2WLJ A;  2OCC C;  2Z5U A;  1WLE A;  2QM7 A;  1GM7 A;  4ASU G;  1R3K C;  2P90 A;  3JD4 A;  4JGS A;  1GO3 F;  1PD3 A;  3OEE G;  3SYC A;  1JCH A;  2PI5 A;  3STL C;  3CCV V;  4WCE V;  3ASN C;  5IY5 C;  1S77 D;  4MVS A;  5H6Q A;  3ZRW B;  2F43 G;  1OCC B;  4WFA V;  1S76 D;  1OCZ C;  5KUM A;  1F4N A;  3D36 A;  2WPD G;  5B1B C;  1W0J G;  2D3O W;  2QE7 G;  4UVA A;  4X88 A;  2DYS C;  4GX2 A;  1ARO P;  3P32 A;  5LHG A;  3K0D A;  1OCR C;  4FJC C;  3K08 A;  3ABK B;  3CCJ V;  2OTJ V;  4KFM A;  1V54 B;  4TWK A;  4ZKI A;  2ZR2 A;  4BW5 A;  4HZ3 A;  2WLK A;  2B1I A;  1YJW V;  5CBG A;  1K9M W;  3CXC U;  4GT1 A;  2QEX V;  1GMG A;  1JVM A;  3E89 A;  3ETE A;  2DYR C;  1K3E A;  2V1D A;  4MW3 A;  3WG7 B;  2Y69 C;  4XBF A;  1YJ9 V;  1NR1 A;  1ZWI C;  5KA6 A;  4MTO A;  3SPC A;  4PDL A;  1QBZ A;  3T2M A;  1M1K W;  2ZD9 A;  1QLE C;  2IU0 A;  4YXW G;  3I56 V;  1KP3 A;  4JAV A;  1MSW D;  4JTA B;  4R50 A;  1OZ0 A;  4MSW C;  3E8B A;  2ZXW B;  5LHI A;  3ZRW A;  4FK5 C;  3FKS G;  4EKW A;  2B1G A;  3E86 A;  1L1F A;  1FFT B;  1V55 C;  3MHH C;  5L3B A;  1Y4M A;  3CCE V;  3DGE A;  5B1A B;  1EBO A;  3CCM V;  4PA6 A;  1FXK B;  5HFM A;  2BOC C;  5L3E A;  1KP2 A;  2EIM B;  3OR7 C;  4QE7 A;  3ABU A;  3W7X A;  2IJI A;  3ZMV A;  3CCU V;  4QJF B;  2IW5 A;  3IGA C;  2JJ2 G;  1K73 W;  3AG3 C;  4GX5 A;  3LDC A;  3OUS A;  4L87 A;  2JDI G;  2V7Q G;  4GX1 A;  1JPX A;  2XAG A;  1BL8 A;  2X0L A;  3OMA B;  3OE7 G;  1IXM A;  2HFE C;  3G6E V;  2WLL B;  2H94 A;  3QNE A;  5FL7 G;  4WF9 V;  3AG4 B;  3SPH A;  1W0K G;  2Y48 A;  2EJR A;  1HWY A;  1GM9 A;  2JEU A;  3G4S V;  1ROP A;  1SZT A;  2IJJ A;  4G27 B;  3JD3 A;  3LSS A;  4P2Z A;  3W7W A;  4FMT A;  4JF3 A;  1Q7Y W;  4LP8 A;  4PA9 A;  4XDL A;  2HR3 A;  1OCC C;  4TT3 G;  4BAY A;  1VQ9 V;  1FXK A;  2OT5 A;  1YHQ V;  2Z3Y A;  1JQ0 A;  4MT8 A;  1CP9 A;  2AHZ A;  1EFR G;  3X2Q B;  3ZRX A;  4FIP C;  5BZB A;  1Q86 W;  4HYO A;  2HKO A;  1AJQ A;  2ITD C;  2WLI B;  3ABK C;  5CMU A;  3SPG A;  5EBL C;  3EFF K;  1V54 C;  3H01 A;  1VQ7 V;  3ETD A;  3VOU A;  1SES A;  2FTK A;  3QO5 A;  4CZZ A;  3CC7 V;  1VQ4 V;  1YTF B;  3K3W A;  2WLL A;  4MVZ A;  2QM8 A;  3JCZ A;  4RUF A;  1I5Y A;  1R3L C;  4E2L A;  3HPL C;  3SYO A;  3WG7 C;  5LGN A;  4BIU A;  3CP1 A;  5LGT A;  2UXN A;  2XND G;  3CYO A;  3LDE A;  4GX0 A;  2EIK B;  4MVO A;  3T4Z A;  1PKX A;  3EHB B;  1E1R G;  2WSS G;  3E2E A;  5EBW C;  4RAI A;  4WFF A;  4UXN A;  3W7U A;  2R9R B;  1KKD A;  3NXS A;  2K1E A;  4F4L A;  4UV9 A;  2ZXW C;  4R7C A;  1AI7 A;  3GB7 C;  3ZJZ A;  5DN6 G;  4OXS A;  3CCL V;  1XL6 A;  1THZ A;  3SPJ A;  1OHH G;  5B1A C;  3CCS V;  1FXK C;  3FYI B;  2WLI A;  4U7O A;  1MOF A;  2EIM C;  3F7Y C;  4JAU A;  1AI4 A;  3K9A A;  2AHY A;  1DTO A;  4RO2 A;  2JJ1 G;  4WFE A;  2LFR A;  5L3D A;  1QVG U;  1KQS U;  3ETG A;  1COW G;  5GW7 A;  2NNU A;  1KD1 W;  2PI4 A;  4GCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...