3K9FC

Detailed structural insight into the quinolone-dna cleavage complex of type iia topoisomerases
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
226
structure length
222
Chain Sequence
b'KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVDFSIEANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKKGKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA topoisomerase 4 subunit A
publication title Structural Basis of Gate-DNA Breakage and Resealing by Type II Topoisomerases
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Isomerase/dna
total genus 56
structure length 222
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.-:
pdb deposition date 2009-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k9fC00
2XKKA 2XCTB 2RGRA 4J3NA 3KSAC 3RAFC 4FM9A 3RADC 4G0WA 2XKJE 4G0VA 4KPEC 4Z4QA 2XCQA 4Z53A 3K9FC 1BJTA 1BGWA 4KPFC 3L4JA 4Z3OA 4G0UA 3FOEC 2XCOA 4KOEC 3L4KA 2XCRB 4I3HA 2XCSB 5EIXA 3QX3A 3LTNC 3KSBC 3FOFC 3RAEC
chains in the Genus database with same CATH superfamily
3M5DA 2W6PA 1EXWA 4PYRA 1OXTA 4C3ZA 1BVYF 1KOJA 2LRHA 4TKMA 3RC9A 3RIMA 2VBIA 1KYVA 3FNEA 1Q0HA 2F3SA 2QDXA 4RNCA 2W98A 1KNXA 4HSEA 1VP9A 3TIIA 4ZALA 1N2GA 2CZGA 2PO5A 2QRHA 3P7MA 4W9RA 1OYWA 2JFQA 2REXB 3MGCA 5EXTA 4HBZA 1XZQA 4YGYA 3RGWS 4ML3A 3LMKA 1IQ0A 2H16A 1E9BA 3CPSA 1ZGBA 3L6RA 3AYZB 5KB3A 1W36B 4IQ8A 4PYMA 3P4UA 2XTMA 2P27A 4IDOA 1VE7A 1MA3A 3TVDA 1UOQA 2HCFA 4JEUA 4JL8A 2DFTA 3M1IA 2VA9A 3G8DA 3NORA 4IMPA 3SC6A 3UXEA 4R01A 5IK2A 1M2OA 1YZVA 3MXOA 1D9ZA 2C03A 1Z7EA 4K26A 4RTLA 4ZPJA 1WDWB 1M1ZA 2NZYA 4P3YA 5H68A 5KQRA 2O8FB 4PIVA 3SYLA 4FHFA 3H4TA 1S2DA 1S3SA 4PG5A 4I1IA 4AZTA 1T4BA 1T9AA 3ESYA 4H2DA 4JYAB 4FK8A 3MB5A 3LM8A 2OBXA 1AA6A 4F9GA 5AD1A 3LX6A 3FWKA 1GG8A 5B4VA 4XWYA 1ZOOA 3NIGB 5J1SB 1N25A 4WOKA 4MA5A 1VZ3A 3OH8A 4O4HB 2JS7A 2FA9A 4PPNA 4WKGA 5DI3A 3IERA 4I8XA 4V03A 3Q7RA 1Q2UA 4NU8X 3VHXA 2D3WA 4KMSA 3WMWA 4OQXA 1VG1A 3RASA 5HWSA 4K6KA 4ENPA 3QPUA 3GRFA 1AGPA 1ISSA 1DOAA 1G9XA 5ALPA 4NCNA 3GT0A 4A82A 1V2HE 3B6MA 3G59A 3WGQA 4ZYYA 1EHYA 2P11A 4IEFB 3JD1A 4IW3B 4X91A 1YS1X 2FB9A 2RGNA 1DEKA 3BD7A 4OM8A 1ESMA 2MSEB 3HABA 3LVFO 5LD2B 3OQOA 7ABPA 2Y71A 3GD5A 2L2QA 4OPMA 2FEAA 1DMRA 4B71A 4R3NA 1NQWA 1T91A 3W4IA 3RK4A 1UBUS 1W4ZA 1JHOA 1MAWA 3PQ6A 2C7PA 1JFFA 1U3WA 3FLMA 1G21A 3HB1A 3NBUA 3VOTA 1H8HA 1CZOA 1GUFA 3TRDA 3B9RA 4O0LA 4QTZA 3LV8A 2PS3A 2XEXA 4HGPA 4MP6A 1RNLA 1A82A 1QVVA 1T9GR 3L6DA 1XZCA 3QBEA 4R8LA 5AHOA 1ORHA 4ZDWA 3S81A 3KQTA 4L8GA 3R75A 2VJAA 4R84A 4EPXA 3RKSA 1H8ED 4M8LA 4X7RA 4AZ3A 1O97D 3T1TA 1RBZA 1Q91A 3QEMA 3DWGA 3BRCA 5D3ZA 2D2EA 5AVKA 1DDIA 3KHSA 4OX9B 2XNDA 2UYHA 3HJFA 2A8YA 3PI7A 1FQOA 3SLGA 3BE5A 4PN7A 1KI3A 2Q4TA 3QZUA 5IWCA 3DHYA 2LP4Y 2PH1A 3A3PA 4MVJD 4JOBA 3CJRA 1CJCA 1RP7A 4FMCB 3WL6A 3SM9A 4RV9A 1T29A 4QFBA 1H6AA 5CURA 5L3ZA 3THXA 1GZ5A 5LL6P 1NFQA 1MAHA 3UBMA 3HVKA 6REQA 1HYEA 1T35A 5DTEA 5C81A 1YRLA 5AT1A 1AV7A 3EZ2A 1AUQA 3O95A 1XMSA 2DCMA 3VYUB 3HKBB 4TYWA 1TAUA 1J8QA 3WO1A 1OW3B 2GD0A 2W2LA 2A4KA 2ZE6A 4IO0A 5JLAA 3VR4A 2O2IA 3ZE2B 5BWBA 3JASA 5HZHA 1M8GA 3WLEA 5JCJD 4B84A 3CISA 4WA8A 2DQSA 4XXHA 3DCNA 1I33A 3O8OA 2O0LA 5AKKA 1XZPA 2CLKB 3F3KA 3IQHX 5BSUA 3WFIA 2IF2A 3IOYA 2ZDGA 3R3ZA 4L9SA 3H86A 1DJMA 1FDTA 3D4BA 1QXSA 3OQ1A 1IPEA 1COWD 1TO1E 5ENZA 4IRXA 4FGUA 3GJ8A 4WEOA 5ALZA 2VS1A 4KUHA 4IR7A 4FEEA 4TZTA 2WWIA 4N9WA 2YQZA 3ZHRA 1QIFA 2B20A 2EYUA 4B82A 2V4MA 3NGXA 4JC5A 3QUTA 1QK5A 1WX1A 1M1NA 4ZV9A 3GPLA 3EWNA 1Q0TA 4C7OA 3P27A 4IVPA 3TTTA 1NUUA 3ZQ6A 4EUKA 3PC8A 4GUDA 3FCCA 1CQZA 1QHIA 2JATA 4HZUB 1JU9A 2QZ9A 4MVWA 4QUBA 2ZS8A 3GT3A 5E9WA 2QP9X 8ADHA 2C7VA 1UZLA 1TZKA 3QWIA 2ZSUA 5DX8A 1K06A 3WLKX 1V1JA 1D2RA 1RMYA 4RLHA 2Y1OA 4ZVTA 2Y9MB 3MNFA 2D0OB 3WRYC 1ZFNA 2BHRA 3SLRA 2YWFA 2GJAA 2GUGA 3LC1O 3LUJA 2A1TS 3UJ6A 4IWNA 1ENYA 4Z5XA 1OH7A 4EJSC 1FFEA 1DBQA 4B3HA 3GQBA 5GM2A 2V4ZA 5CH3A 3KT6A 3RSCA 2WHXA 2G17A 2OB1A 3TOSA 4CKYA 1YZUA 1WQ4A 3DZ8A 3QLUC 2JGDB 2WU0A 3DH0A 3RS2A 1N5IA 3HUFA 4GIBA 4UAUA 5CJ2A 4UTPA 2HYIC 1COZA 2CLFB 3FFTA 5HF9A 3ZJUA 2JLYA 2PBRA 3H1PA 221PA 1H85A 3TLMA 1VB3A 3GJTA 3AEKA 3QKUA 1WBDA 4EPWA 1N78A 3HXPA 2O2JA 3FRJA 2O7QA 3WKCA 1RFGE 4DA6A 4BTEA 1XJCA 1OKKA 2JHCA 3LXUX 4TUYB 4JSTA 2YUIA 1OIXA 1MJ5A 4MGHA 4QYIA 1NBHA 2RGDA 3K9NA 3GLFB 4PVDA 3PQ8A 1V4BA 2ZR7A 2OGWA 1PQUA 4KDCA 4QUGA 4G24A 2BMDA 3A9VA 2ZJBA 5D87A 5KTNA 2HXSA 2O3UA 2P40A 3BBPA 3NALA 4FFSA 5DN6D 5IVPA 1PR2A 3E22A 3DHEA 2BSXA 1KQPA 3HCDA 3VR5D 1WEHA 2R3SA 4HWKA 3K0BA 2JIPA 4QJ5A 5ADVA 2F3TA 1EFLA 1O87A 1ZPDA 1LDNA 3JZDA 1DX4A 3HCFA 2OZLB 2FMIA 5DHTA 1QG2A 4YREA 2V0NA 1O95D 4QUJA 2YZMA 5EYPA 5HS6A 5AKYA 4U8GA 3UHJA 1AK9A 3Q2OA 2P91A 2VPZA 1JA1A 3HP4A 1H0KA 2AKAB 3FETA 4YMIA 4BVEA 4CQNA 1HTTA 2P2GA 2QY6A 2VYQA 1P61B 3NATA 1SXGA 3K9BA 3WYNA 2FXVA 4B6FA 1NW6A 3NDRA 1GA4A 1SCNE 1X1DA 4AO6A 4E11A 2O9JA 1I01A 2Z4TA 2OMKA 1SVMA 4X6YA 3SFZA 1R64A 3CTMA 1URPA 1KEEA 5KJEA 1SXPA 6ABPA 4JLDA 5ESWA 3KZMA 1Z45A 3DMFA 2X4DA 5FTNA 1RM4A 2YXPX 3LT4A 2J9FA 3R7BA 3AKZA 2JF0A 3EZGA 5C8XA 1IK4A 1WDLA 3K4HA 4KXMA 3T54A 5C32A 1F6WA 1FYDA 3SG0A 2Z6UA 1OB5A 1KEKA 5FLXA 3WDMA 4R5HA 4GZ5A 4RK0A 4CL0A 4EATA 1AMUA 3H5WA 4NJMA 2ZIXB 1BOFA 2IDMA 4EJSA 2JIMA 5BORA 4DOMA 5CGQB 2H29A 5ADHA 4W6ZA 3AF0A 4L28A 1SNYA 3T8YA 4BNYA 2DERA 2W0SA 4OHYA 4K8OA 1BEEA 2NW6A 2ZBRA 2DULA 3Q0IA 4RMJA 1XN1A 3D6UA 2HDNB 5KUTA 3BAZA 2QTBA 1RLMA 5DHPA 2BRUA 3L8ZA 2KBEA 3IMKA 4DHEA 2X14A 2QE6A 2I3ZA 3K35A 1DVRA 3HJBA 4D80A 2C5GA 3NWBA 1X87A 1XJWA 5AXDA 1I5RA 5A03A 1U0TA 5CX1B 2X0IA 1OASA 2IZ6A 2YRWA 2Z1DA 1IOWA 3LC2O 4OQFA 3D59A 2HHCA 4N8SA 5TQ2A 4Z3OA 1RXUA 4WLUA 3C3WA 5JE8A 5FL3A 4BNHA 3I76A 4J4TA 1G2OA 3L4KA 1WOMA 4JLKA 3LX4A 4WE3A 4MHOA 1A9OA 1FP4A 4O2AF 3V4SA 3HR7A 4WDQA 5LUAA 4YPVA 1CIPA 1GWNA 1V8DA 4I5DA 4WK2B 3FNIA 2A7XA 1JIVA 2IUFA 2Y05A 2WK1A 3DF7A 3DO8A 4GYYA 1R4ZA 3UVEA 3K0AA 4Y1RB 4DM3A 1EDEA 2GQ0A 2ZUSA 3HY4A 2ZIGA 4H18A 4LJ5A 2J0SA 1IK6A 2O1EA 5KPJA 4IV5A 5KYWB 3ZHZA 2KE5A 3GBPA 5K6RA 3HKEB 2P8SA 3WNQA 4Z0NA 3WBFA 3KKMA 1F1BA 2EGGA 2OBFA 1H2BA 3C15C 3C4JA 3JQRA 5B53A 4DIFA 1PSDA 1HT1E 1RT9A 3SXJA 3C8MA 2HIHA 3RQIA 4B5LA 3QNUA 2BFMA 3IAUA 2I8LA 2J8ZA 2QMOA 2XB4A 4ALNA 2PJDA 5HW0A 4DLPA 5ICSA 3PWTA 1JDBB 3UOAB 3K0SA 4TKUA 4X6UA 2RAFA 3UJ9A 1U80A 2G8NA 3SZUA 3MIIA 4IOMA 4QUAA 3EVDA 1X15A 3CZ4A 1IQPA 1G8SA 1OBCA 4UM7A 3ICVA 3L82B 1YFJA 1UKVY 3AEQB 3W9YA 4UHJA 3D8SA 2QLLA 1HDCA 4XUEA 1R8XA 3H87A 4ND2A 3LFTA 3RTDA 4FLEA 1QDLB 2C0QA 4UCWA 4BE9A 4J0KA 3BMNA 2B3TA 1NU8A 3CNBA 1WSWA 3NHRA 4B83A 5DIZA 2O3SA 3FY4A 1GM5A 2CVFA 1XMOB 6AT1A 4OHUA 1YZTA 4NJEA 1V1RB 1J8MF 5CVCA 3PX2A 2IIPA 1B0UA 1VIYA 2FFHA 3A6LA 3G2OA 3BRSA 5KDDA 5KS2A 4OJKA 1K8ZB 2OB2A 4FILA 1AZTA 1J5PA 3V4VB 3O73A 3WISA 5ADWA 1EBUA 1NI3A 1EU1A 3NEJA 5A5FA 3CNHA 2BE9A 3EWIA 2DY0A 1JEOA 1J2JA 3CUVA 1L5NA 3JQPA 3Q12A 1JI3A 3R0XA 1II0A 2XD9A 1S02A 1TD9A 3WK6A 4L75A 4QU9A 3INYA 2BFDA 3FNBA 1OY1A 3KR2A 1FEZA 2ATCA 5FI1B 3DB1A 3NASA 1BRMA 4TMYA 4I55A 5SYNA 3S5JA 4DLLA 4K03A 2CXSA 2PH7A 2ZRAA 3CE9A 5IS2A 4D4HA 3D0RA 2OD9A 1WDTA 2GPNA 2LW7A 4R4JA 5IAKA 1C0LA 2X8JA 2YC2C 1E92A 3UY4A 1Y3DE 4DR6B 3A9RA 4M6WA 4F86A 2C0PA 1NJ2A 4NCHA 3B12A 5IT9A 1DFGA 1T3HA 5CHEA 1V8BA 4MRMB 4BMCA 1B26A 3FUVA 4HI0E 4CM4B 5CFZA 4DMLA 1R0WA 3CONA 2XTNA 1RAGA 1ZXXA 4TL8A 4QDUA 4MMYB 1H9CA 2QVYX 4XD7D 3WHIA 4IFIA 1E9CA 1TGYA 5I47A 4CKXA 3EGVA 3QYAA 5G4KB 1ZMRA 3AB7A 1N92A 3R5FA 4Y6GB 3ZCVA 5DWVA 1DO0A 4PRLA 4F4DA 4YAGA 3D5TA 3R8FA 3ZVKA 4J7CA 3O4IA 1K4YA 2EJBA 3ZWWA 4F72A 1B16A 2HU7A 5BV8A 3SGLA 1Z0DA 1BXRA 1MC4A 3ON5A 3E70C 2ECFA 1PNOA 2XUAA 5IXYA 4RVUA 2R1VB 1KU6A 3PR3A 5K05A 2VC2B 4KO4S 1D4AA 3TGPA 4I14A 1JN0A 2KSQA 4UEJA 1B6TA 4ARSA 3DW3X 2GTPA 4XIFA 5EHQA 3BSFA 4YAOA 5JRZA 1AUVA 3TW0A 4RGVA 4BAGA 3W8FA 1ZNQO 3N2GA 2VAWA 3SQOA 2AN3A 1FNNA 1FPMA 4G81A 5FOSA 3CUUA 1DKQA 3DMDA 3STWA 2GDZA 3EGXB 3H97A 3TLAA 3KKNA 3PXCX 1AXGA 3ESCA 2B2NA 2FPIB 2HLDA 1LPPA 3BVPA 3IHWA 3OZ7A 3PQ5A 3AUKA 4Q19A 3EISA 5E2AA 3DDUA 1U7WA 3FCEA 2BGKA 4WFIA 4DA9A 3CVWA 4EHFA 3BWBA 4IIFA 2GM9A 5CXXA 1HQKA 1W25A 2C96A 1CY6A 4TXMA 3UJAA 3PDIB 3VR1A 5CFNA 1FYVA 4LRXA 3NKVA 2LDXA 3VPSA 2AW5A 2CXTA 2PYIA 2BBOA 2WB4A 5JT1A 1NT4A 1F3LA 3DF9A 4H6XA 4N76A 3NJRA 2PWZA 4GWLA 4B85A 2YASA 2Q7OE 5JXIA 3O8QB 2OFOA 4MB6A 2J32A 4NBVA 2GYVA 5FBRB 2W6OA 5ALLA 1QYWA 2J46A 3A2LA 3DC2A 3LX5A 2ALJA 2VTBB 1EFRD 4I1OA 3UTDA 3WJ2A 3H2BA 4IS2A 2P90A 3FPHA 1IN6A 3LUFA 3P2KA 1P2UA 1R4MB 1BROA 1D8TA 1F9AA 1WRBA 2D5AA 2QMZA 3ELUA 3KKZA 3L4SO 1L4NA 1XVIA 3BL6A 1I4DD 4D9GA 1I7QB 5FWYB 4IXMA 5K2MA 4CUZA 1XVLA 4MV6A 1CHDA 4YS6A 5CDTA 3HCOA 1V8FA 1YRBA 4CQLB 2VKTA 2BFPA 2FMXA 2XD4A 3AXTA 5AQEA 5JPIA 1U8AA 1YE8A 3QRWA 3EXHB 1XEAA 5K0BA 4JXZA 5EJGA 5TPZA 1W19A 2G63A 5IN5A 3DEJA 3KFXA 3E8SA 4LBYA 5AVZA 4CLOB 3EIFA 2P5SA 2IEDA 3EGOA 1ZAKA 4DA8A 2OBMA 2P1ZA 3PGKA 3UANA 1S2IA 4YRJA 1YD7A 4J0JA 3EA0A 3HHPA 1VHJA 3JQBC 3OLQA 1BA2A 2ZAIA 1T10A 1BJKA 1JR3A 4Q3BA 4QUHA 3RK1A 3BWCA 4F5YA 1EVQA 4C3OB 3KQYA 5K45A 1BHSA 1POXA 1Z0KA 1BJTA 1WW8A 2G06A 3GAZA 3DA8A 3PQCA 3ONWA 3ITEA 2XCUA 5FQNA 2EJCA 2QENA 5AI0A 3WA7A 4R2KA 1ADJA 3RF6A 1SUWA 2MINA 3RI3A 3OFND 1JTVA 3TZ6A 3WE7A 1K27A 2P30A 2P75A 4ME6A 4DVGA 1CR1A 4OLFA 3BRQA 3UJNA 2FZEA 1VPDA 1MB9A 3P2JA 4QXMA 4ZQIA 2VF4X 3NWPA 3Q1LA 1YS4A 1LUAA 2JNWA 3GUHA 2NNLD 4FOLA 1J90A 4GI7A 4QIHA 1PUXA 3PI6A 3H5NA 5H4HA 3WLPA 1Z0FA 1T1EA 3BN3A 1K4MA 3B2EA 4WFQA 4YO7A 1ZG3A 1HLGA 5DPMA 5LP6C 4ZVNA 4EG7A 3THWA 4IIHA 1BVHA 1Z0UA 1WZNA 4KQIA 5LLTA 5E7JA 1GT91 1ZD8A 3IKVA 3K1YA 1P2DA 4L0MA 1CUHA 4NYIR 4X8OA 3EUAA 3L7IA 1E96A 3GFTA 1OYYA 2YV1A 4KLCA 4K2HA 1XTZA 1EK0A 1M1UA 1XU4A 3L7OA 1JBQA 4TRMA 1NKVA 5EZ5A 5J5AA 4PYJA 4UQLA 5G0WA 1N0HA 1E5QA 1Z17A 1ZD2P 1JJ7A 7GPBA 2L42A 4Z4IA 3TK1A 4LHXA 4GL4A 3RC1A 3SBDA 1KI2A 1D0SA 3ANTA 5LYJF 2D7DA 1YU6A 1HLDA 4AZ0A 1ZCBA 1U9ZA 2ZWAA 4C7VA 2YJ4A 1UBCA 4QTUB 1E2IA 5GAJA 2OBBA 2H2IA 2WWWA 5HGJA 4NU6A 5D7BA 4QQNA 4C08A 1QGUA 3LHIA 4L8YA 1A5AB 3D3KA 1FUYB 1IWOA 5IAOA 2EKQA 1UBEA 4JLUA 3K6SA 3GT7A 1V5GA 3DAHA 1FNSA 2O57A 3QY0A 3RSZA 4DBZA 3Q7IA 2JVKA 5AVUA 2Q8QA 1TGVA 2Q1SA 3RFUA 4EB8A 3EH1A 1OX4B 3F49S 3RAPR 2V6FA 4CHGA 2PMEA 1QHYA 1PV2A 1MOQA 3O4RA 4DS3A 4FQ5A 4UAVA 5A5DA 1C4WA 2XRFA 3W9SA 2A1TR 5E6UA 4JXKA 3GPIA 3NTRA 3T5GA 2WABA 1Z5WA 1D8AA 1JSCA 2RAUA 3HLKA 4LK2A 5SICE 3TQFA 1O6BA 1U4NA 4I50F 4RIEA 4Q9DA 4X5OA 3EIOA 3FJOA 1Q14A 4PNHA 4QUEA 5JG7A 5ITZB 4ARIA 3VR6D 4MGEA 2UZ4A 5ERGB 1M2FA 1Z6YA 5TMPA 2YV2A 5EZYF 5IDVA 1CUUA 4OOFA 3ZWYA 3RSGA 4YN3A 2X0RA 3UENA 1NATA 1Y7PA 2BM8A 2ZAMA 3P52A 2O5EA 3L8MA 4GFDA 3M3DA 1E1CA 1X8JA 2XUOA 2E87A 1XMXA 2QL7A 3B8HA 2D1TA 4EHKA 3S2ZA 4X61A 3FI9A 1GGMA 2I4OA 1VYTA 3ANNA 2G0AA 1F48A 5AVQA 4PRZA 2WWFA 2CXNA 4NIMA 2ANBA 4MXDA 3R76A 4C06A 5LIPA 5TIIA 4MVJA 1CU1A 1KTIA 1EWVA 2QT9A 5GONB 1J23A 2QM7A 3GK3A 4LJKA 4YDHB 3ODPA 4G9EA 2DE0X 3K2BA 1YE5A 3UGJA 1NRIA 2CBGA 5CH8A 3TB6A 3PJDA 1E3JA 1T8TA 2IVZA 4XQ0A 5LP6A 1H6BA 2HF8A 3NTQA 2X0KA 4L0QA 4BLOA 3OJWA 3RLFA 1QANA 1KARA 2Q50A 4OVKA 3B9BA 5D00A 5IKOA 4RKEA 3IKMB 1IMJA 3BS4A 4H3KB 4S0XA 3M81A 4DANA 3U7GA 5LBUA 2WNIA 3AX6A 5HNKA 3HA3A 4O4IA 4I4NA 2J4CA 2BWJA 3GLUA 5JCJA 3V2GA 1RC8A 1DBVO 3GMSA 2I6SA 4MQ6A 2QV7A 2QD1A 3I9LA 5KVAA 1E2KA 2VNJA 3HJAA 1U5BA 5ALFA 3ZG6A 4AAYA 2IYNA 4FR0A 3ZEAA 1PJSA 2CC2A 4BNLA 3M9WA 1COWA 2FW6A 2GWHA 1C0EA 4WHMA 1W4AA 2OORC 3AF2A 3GLKA 3H13A 2QT0A 1KZ7B 2P65A 3GRRA 4BV8A 3PDHA 3L1KA 2B35A 2J30A 1ZKMA 2H17A 1M0SA 4KXNA 1U7TA 3MWDA 1E6KA 3OC6A 4GPZA 3G0CA 4YH1A 2Q4OA 2I9PA 3CRVA 5DYWA 5B7GA 4Z2AA 2IZ5A 4CPDA 4DLAA 1E94E 1C9DB 1F0YA 2H4XA 3MTAA 3VISA 1SZPA 3DNFA 4FSDA 3NU1A 3OZRA 3TI9A 1XQXA 2H5IA 1Y5MA 3L7KA 1Z0SA 1NWCA 4I4CA 2BUCA 1O8CA 2XADA 4NZNA 3C8ZA 4FW9A 5JAUA 4BNUA 3OWXA 4GLJA 5F1YA 2H18A 3G1WA 4P3KA 4N0PA 1DDGA 3ACDA 3JR7A 1Z5PA 4GLFA 3HXTA 1ZW6A 4C7XA 2P0YA 4J4HA 1O4VA 4XB6B 2ID8A 1PQPA 4V1CA 1EGHA 3O83A 1Y4ZA 2I4MA 4J9VA 5B2ZA 2JFVA 4ZYZA 2B4AA 4WUTA 2FETA 1EP9A 5IARA 3EWAA 5T3UA 1CK4A 2E3JA 4Y2RA 3V42A 4KPYA 3UT5A 1DQNA 3NV7A 5HE8A 3WDSA 4OB8A 3AM4A 4KRYA 4C0AC 2IK8A 3JAWB 4EPYA 5BVHA 2CD9A 3AF5A 1WMSA 4GX0A 4I3HA 4B46A 2OYSA 2MR5A 4KKXB 4HX9A 3SZGA 4GOJA 4NK5A 5FO0A 3RIGA 2Q28A 3OO0A 3PPIA 3QJ5A 4Y8VA 3SZLA 4PNZA 2QX9A 3CUWA 3UGQA 3WIBA 1O2DA 1S2GA 2QPAA 4BGDA 4AY6A 3DOIA 3AR9A 1B4DA 4IHQA 1TFUA 2A2ZA 4C4YA 1NAIA 4JI0B 3DMTA 1FVFA 1SKQA 2UXCB 5DOVA 2B6HA 2Y66A 5CDFA 1A7JA 4JOCA 3CR8A 4BKPA 3SX0A 4IIJA 4P7FA 3LRXA 2R7NA 2O0JA 4R05A 1GRNA 3NZEA 3SDSA 1ZGCA 3DDWA 1E1RD 3MGBA 4DEYA 4RJJA 1KDPA 3HJNA 4RJLA 1QHEA 2J4FA 1QPZA 2RGEA 3UW1A 3H5AA 2Q3MA 3T7IA 5FLKA 4X60A 1Q1QA 2XVAA 2HEIA 2ZRFA 4IIEA 4OIFA 1KMNA 3R5HA 4YUZA 1ONBA 2NACA 2XNSA 1OXKB 1QZ3A 2ONKA 3KB8A 1FC0A 3SEFA 5TNXA 3S2IA 2OCDA 2WSBA 4BB6A 4TLEA 4YAKA 4OSEA 5GZ1A 1EFUA 5AJZA 1ZM4A 3KPJA 1ZJ5A 3K6KA 1ODCA 5AIAA 2Q3LA 1UPXA 1BQ3A 3L40A 1IN5A 1OLXA 1B93A 1I80A 1XFAA 3MERA 4H27A 2NWQA 4BMOB 4Y7DA 2O0HA 2NSDA 2PUJA 2HMTA 3G7NA 2G82A 1G3UA 3OM1A 1YS2X 4FFBB 3A2KA 2UZ1B 3UC5A 3NIWA 3RW9A 2D8AA 2CWDA 1E4EA 1II8A 1VM6A 1ZSYA 2ZU6A 3DBHB 4MWSA 4OLJA 4X45A 2IX3A 1XRQA 3ZU2A 4YLEA 3VNQA 3E5MA 3I5XA 1I4TD 2YWHA 4ITRC 4M1SA 4IS3A 4NBUA 4CI9A 3WJ1A 3AR3A 4PANA 4DQLA 3DXFA 1F0NA 1JAXA 1S6YA 2C4KA 2P6OA 4ZO4A 2OYCA 3RV3A 3UA4A 3W8NA 2QQ5A 3C1AA 5IT0A 3C6KA 5I8WA 1A69A 1WVMA 1XEXA 5LXTF 1T34A 1R0RE 4E03A 2H1VA 2WTBA 3GXBA 3MAJA 1K6XA 3FN4A 1MJHA 2JFBA 3JVVA 4L2IA 1PR1A 1T8UA 2JFWA 1TPZA 1MC1A 3AO0B 1T5HX 4OXQA 1DGQA 1DTWA 2GCOA 3TM4A 3NVDA 5B36A 9ABPA 2ROQA 3N8HA 3W9UA 3QIAA 2P68A 2WYOA 3DWIA 1WZIA 3ILSA 4L0CA 4RK6A 2E6UX 1Y5IA 4MYUA 2PJRA 5BV1A 3N0VA 4XIIA 3A0UA 1K98A 3IEUA 2EZ4A 3JYHA 3QG5A 3DW1X 4M86A 3VO2A 3LX8A 3DMHA 3UA3A 4DA0A 5C80A 1NVAA 2ZPAA 5ECWA 1ZLXA 2QMHA 3K4PA 2FE1A 1AMOA 1WE2A 3REQB 3T7CA 1EBFA 5D5HA 1Y6JA 3HYRA 2YWCA 1QYDA 2YICA 1XTPA 1HFKA 1IBKB 2OILA 1N6PA 2VQDA 3VPGA 2R97A 3CCFA 4R1PA 2BCGY 2H4JA 3CX3A 2YFYA 4N7RA 3GJ7A 3QKTA 1W9HA 4O02B 3L1JA 4TTJA 1P1JA 3NONA 3Q2IA 4FMDF 4UHEA 1HKHA 2FW1A 3VNSA 5F5NA 1V3QE 2Z58A 3GJ0A 2CLIB 1RI2A 2QXUA 1LLCA 1YNOA 5HKKD 2NO9A 5CT9A 4AJLA 5MFPA 3KJXA 1NGSA 4WJKB 4WZ6A 4YJGA 3V2UA 2GXSA 3PHBE 3GFRA 4I7EA 4DR7B 2DECA 3V1KA 1T5DX 1PJQA 2O2XA 5AHRA 5DW3A 4PV7A 3FW1A 3OWOA 3PNQA 3UICA 2BGUA 1PX0A 3ACCA 5HDBB 2CVQA 2Z56A 2QTCA 1GNQA 4JY7A 1MO6A 5FL7A 1NYQA 1CEXA 2A4MA 2OY0A 1Y3FE 2B37A 4C4ZA 4U2KA 2KM1A 3NETA 4ZOQI 2HBZA 2PT5A 1WO8A 2O7RA 2IPNA 1UEXC 4POAA 5IT5A 4H3VA 3B2NA 4WA7A 3WG9A 1O5OA 5JD4A 1X0VA 4XCXA 4AWBA 1M2OB 1ESNA 1R8JA 3LUBA 2AB0A 3LSYA 4E4YA 4XVCA 5M7EA 1TM2A 1ZGHA 1L7MA 3PXUA 2DWCA 4Q16A 1E61A 3C3KA 5KTMA 5COBA 3R4VA 2QYSA 5THXA 3HLTA 4C01A 2C2KA 2ICAA 1THMA 3RSOA 1G21E 1GUYA 1OBOA 2O1WA 2OEPA 2TMDA 4M9ZA 4WZBB 3BULA 1QHFA 3LPLA 4XQCA 4X8LA 3T3HA 1D2NA 2H1CA 2EDAA 2W2QA 1ABEA 2OSBA 2QY9A 4MQ4A 1VL0A 2EW8A 3TTYA 5E38A 1N7GA 1V6CA 3IAS1 4UEWA 5DI3B 4B1FA 3AEXA 4C3VA 2RHMA 7MDHA 2ZTVA 1TIPA 3VHXB 4BV3A 4C0QC 5I5EA 1CS4C 1PU2A 1Q1EA 4IIUA 1Q7CA 4TTSA 5HOQA 3ZS8A 1BDJA 1T5BA 1S3IA 2E85A 1Y37A 2LCFA 2Q99A 1D1SA 2Y1LA 3BC1A 4DR4B 3TE7A 2ZCJA 1MUUA 1PIWA 2ZRNA 4S24A 2WSSD 2A1UA 1XV5A 2X1VA 5FOUA 5FR2A 3VH2A 4Z7JA 2BGIA 1L5WA 3JZIA 4NU0A 4UBOA 1NBIA 3WLIA 4O2LA 4R40A 4BP1A 4A8PA 3PR2B 1XRPA 5HTKA 1D5CA 1BMQA 3QBJA 5C1IA 3TPCA 1VBFA 2PKQP 1M0TA 2F90A 1JFFB 3IVAA 5LQNA 2VK4A 1HE2A 1G21B 3PSAA 4UCXA 1U0FA 2Q0SA 2V65A 4JKIA 2EJWA 3HU2A 5ALGA 1Z8HA 1N2SA 3L7LA 1PK9A 3R5JA 2XA2A 3ULKA 2C83A 3D54D 5DBFA 5ES4B 4UUAA 2E49A 3H7IA 3RVSA 1L7RA 2H2FA 1E2MA 3MJFA 1X9GA 4NH4A 2OFFA 3TPZA 4FUQA 4B7UA 3FFXA 1ONPA 4LSWA 5ER6A 1HLFA 4AZ3B 1Z2EA 3ROEA 4HNVA 1KTVA 2ZB2A 1JDVA 3ASUA 4RTJA 1VPWA 1IRIA 5LMNB 3JWHA 3OMWA 3VZBA 1P6XA 1OFIA 4M89A 2RK4A 1Y42X 1WUYA 3T95A 2KQUA 5EUBA 3DDZX 1HFWA 4GDFA 3N8GA 4QUDA 2PMWB 1EUQA 2C8KA 5FI5A 2B4YA 4CL8A 4UDYX 3P1JA 1LK5A 3N2LA 2GZRA 4DF3A 4EH1A 3Q88A 3THXB 3BEOA 4H7KA 1QHXA 4CFYA 5HUJA 4A2CA 5GWXA 3IDFA 4ZI2A 6REQB 4LXQA 1NXQA 2FZWA 2I3AA 4KLNA 1Z73A 5DH9A 2YNMD 1LBHA 5AMXA 5FP0A 3RT7A 4QT4A 3GIWA 5A4MS 3ASVA 3BWVA 1X94A 3ZW9A 3AZQA 5TEVA 1NR7A 3FVVA 3BORA 5KU7A 3JASB 3IV9A 3ELYA 4QELA 4K6FA 5CYFA 5CFOA 2Q27A 1SURA 1PD0A 1FSSA 1QGYA 2LVBA 3B1JA 3IQDB 3ML1A 1MB4A 2G04A 3ME5A 2FG7C 1H5NA 1CV2A 3KU1A 1CQJA 3H5TA 1OXXK 4C7BA 1KOGA 3ZOKA 4MQLA 3U0BA 1NUTA 2HM7A 1FDUA 1YVUA 1EFRA 1QFMA 3GAFA 3RBZA 5C5IA 4Z4GA 3AVTA 1NVFA 3UMVA 3TZKA 1CY7A 1A9RA 4MGKR 4Y6QA 4TZ6A 1CSEE 4ALMA 4ZEMA 3FROA 4PXAA 2ZR8A 1U94A 4QDTA 1YHYA 4RABA 8MHTA 1W2WB 1W5EA 2GBPA 2BTOA 1X8XA 2XTZA 1NJSA 1M1NB 2PZLA 3EDOA 5JXWA 5C35A 4LOJA 1NJ1A 3I0MA 1W88A 3R2JA 1SU7A 4KPEC 3HG7A 2V7EA 4GOKA 4OFXA 5E9JA 2R6DA 5HVNA 1ZHOA 4RORA 1GRCA 2Q3FA 3JV7A 5KYTA 5MDHA 5JEEA 1G5FA 3LUGA 4CBVA 2D5LA 1GDHA 2POCA 2Y0CA 1Z7BA 1T8WA 3PRJA 4FW8A 4XD7A 4V0SA 1EP1B 3REOA 3UJCA 4WSOA 2QPLA 4L6AA 4RK4A 4OK6A 2OGUA 4G5GA 2PWBA 3MCZA 1RLUA 4LDAA 4M1QA 4NICA 2M6KA 1QS0A 4O5OA 1MVLA 1DRWA 3OEHA 1ZJZA 1SHTX 1Y0BA 1TYCA 2PFSA 1XLWA 2ZZMA 1VECA 4B6GA 2BGMA 1O3YA 3GQBB 2LNDA 3KT0A 3RV4A 1JHPA 1P8JA 3A4TA 1XZFA 3PUYA 4QRHA 2ZU0C 3KAQA 4BX9A 3R3VA 1T4DA 3UPTA 1U3CA 3H5VA 3E2IA 4FD2A 4XFJA 4YPFA 4GKBA 1MIOA 1IHOA 1DB3A 3HCRA 3KR9A 1BH2A 1QOZA 1TO2E 4TV9F 4CMCA 2HLPA 2EBHX 4AJ1A 2REOA 2NAFA 3AEKB 3OZBA 3Q3EA 1F20A 4L8LA 3DD5A 2BMWA 3JZFA 4NABA 2A94A 4BVFA 2M6LA 2B6NA 5F52A 4ALLA 1YIDA 1AHIA 3AG6A 4KXFB 1DKUA 2FOLA 2XXJA 4JUAA 1FDRA 1RE1A 1RWXA 3DT6A 4K46A 1S4MA 2FRVA 1U0SY 1CY1A 2Q21A 5L3VA 2VDRB 3PNOA 4QYIB 1SHJA 1MX1A 1Z5NA 4I3FA 4PC6A 4Q37A 1JKJB 4D02A 5IMSA 1HYQA 4YACA 4DW8A 1HBJA 4ESOA 1CTQA 3TZHA 1U8EA 1IM2A 1W59A 2W2XA 3KZKA 3HU3A 3CX6A 3M9XA 4KXYA 5P21A 4CIDA 4DJFC 3I3SR 3KDAA 2OXTA 5J4HA 3E22B 3TSYA 4ZZ3A 4HX2A 3Q7QA 1JT2A 1USVA 3TCKA 2ZQ5A 5EUMA 5JMPA 3DKIA 3K70B 4H7IA 5JO9A 1N57A 1PT6A 3FDJA 1VRWA 3ZCSA 5LQRA 3K71B 1HQDA 2VP4A 4RENA 5EYPB 4UNQA 1SOWA 4KVFA 1A9ZA 3V8RA 4EUHA 4BL5A 3WMRA 4ZT7A 1Y4SA 4ZJPA 2V97A 1U2PA 3BWEA 1YV9A 4EARA 3FTEA 1NVWQ 3AUTA 2ZZKA 3VR3D 2ZWMA 4XD2A 1NOJA 5IAJA 1XKQA 5KTRA 2DUUA 1HGXA 2N46A 3U3RA 1EJ6A 1PJ8A 3LKDA 4TTVA 5FBKA 2ZBEA 3UMGA 4F3RA 2AN5A 2GCEA 3A1CA 1G7TA 5ESRA 1BQ4A 1DUIA 3BJIC 1R9GA 4PCLA 2XUHA 1JHZA 1XPUA 4AJPA 1Z13A 2J9FB 1IEVA 4OQ4A 3VJKA 5ALKA 3MG9A 4DR1B 3LY7A 2QAJA 4NYIQ 2EZTA 2AFIA 2IOFK 3NM6B 1AUXA 1XJ0A 3BMOB 2HAEA 2NZ2A 1RQGA 1XA4A 4YRDA 2PYDA 4NJMB 1BWSA 4KN9S 5JSFA 2QTNA 3KPUA 3NH9A 5H7XA 3BGIA 3A4LA 3VYRB 2AE1A 1ARZA 1MX9A 1JLMA 2E4WA 4MWEA 1G8KA 2VSXA 3AJAA 3IT1A 4X65B 1J2RA 2AMVA 4QAQA 3CH4B 4R1QA 4D4MA 5AESA 2WNSA 4IDCA 1V3TA 1ZK2A 3H2ZA 3LECA 4LNHA 4QL3A 4AVYA 3KLNA 3AGQA 1JR4A 4GPD1 4QTTB 5EXXA 1NURA 3TEFA 4CKBA 1RXIA 1H69A 4OFBA 1JEQA 2JFHA 1XRLA 1EFPA 2AX4A 2WJAA 4U6SA 3JAKA 3HYTA 3MJTA 4XA8A 3DMGA 1HE3A 2ZG6A 3H5IA 4WCFA 4A6EA 1OAOC 3NC4A 4NXMB 1FP4B 1UDCA 2QE7A 3P0RA 3O4VA 4JBHA 2P79A 3RD5A 1RHUA 4GOXA 5JJLA 2VRCA 2AG6A 5DLYA 4KIGA 2FQ1A 4P4TA 3BRWA 3NO4A 5A6SA 5IM4F 1NYRA 4AJIA 2ERYA 4DV6B 4WNIA 2Q6TA 1QZUA 2NVBA 2VHQA 1A88A 5TMEA 4BO0A 4LXHA 4ETIA 4HMPA 4L4SA 1T3LA 4Y2GA 1EWYA 2ZKIA 4K3VA 1WV1A 1I0LA 5AM3A 2TSYB 4AQ7A 4CUKA 2QM8A 2PY6A 2XODA 2ZIEA 2QTMA 1I5EA 3FG9A 4WXPA 5KWEA 5KSPA 1PJRA 3FX2A 1ES9A 4MZDA 4E30A 4F38A 2VCYA 4GMFA 4ND6A 4CDRA 3BHMA 2FWMX 2QM0A 3GRPA 2B9EA 4B6EA 3PEEA 1R0KA 4UBJA 4QOFA 2ZXFA 4GVPA 1TEZA 2SECE 4G2NA 1SBIA 3SYTA 2DPGA 2WP8J 3KAPA 3E4CA 4M98A 4WY5A 3WWYA 3ZHUA 4EL0A 1WKBA 3L07A 5JBQA 4Q1EA 3NEAA 4EK9A 9LDBA 3ETDA 3ZZTA 5DN9A 1RWMA 4IAOA 3AR7A 3RU9A 1K8XB 2CNOA 5JH7A 1G6KA 3PWZA 3QI7A 1TF2A 2IS4A 4BKOA 3SEZA 3C6YA 1Y7LA 1LY1A 2IY9A 3UJBA 1MW8X 1UMDA 4WLEA 2H1RA 2R44A 3RYTC 2QOEA 4CLDA 1P9WA 3MZ0A 3SE0A 4ARCA 5HILA 2N1BA 3NANA 1R8SA 1XA0A 1G8JA 2H5JA 3ONVA 5EJIA 2HDOA 4B43A 5FBWB 5EFZA 2QX7A 2Z57A 3GGOA 1QQ6A 1P0MA 2P2YA 4E13A 3F0TA 2VZ9A 3ZUPA 2F8LA 2WKSA 2ZJ2A 1V47A 3BB4A 3E15A 5I8PA 4FYYA 3CVOA 1ZBDA 1Y6GA 5JS8A 3WBJA 4X41A 1ZL0A 4BY9E 2ERCA 1F38A 1JLKA 2QRPA 2ZS7A 5FBVB 5I3CA 1SQFA 3DMRA 5ARCA 3BQMB 3ZHYA 3T9CA 1QP8A 3TSAA 3W3ZB 2HCJB 1DC6A 4LOAA 5DTJA 3RRXA 3UCEA 4MDEA 3TZEA 2BFDB 1SCAA 2AHRA 1B73A 3CYFA 1E3LA 3TLBA 2CDNA 3DTVD 4I55B 3NOOA 2UYOA 4PHCA 3G9TA 3U3ZA 4R1UA 4DRYA 3HVRA 1RJWA 3NLLA 1FW8A 1NHWA 3MHPA 3FHTA 2I6UA 2AFVA 2WAOA 2WJWA 2X8JB 2XE8A 1TMKA 1ZSNA 1L4UA 2AFHA 4M6WB 3ZW7A 2AQKA 2G1PA 1PLKA 1FX1A 3BDVA 4JP3A 1FPQA 4GYWA 1GRVA 1XCMA 4KFRA 4XX1A 5ALVA 1FFYA 1P4SA 4OXKA 2Q4DA 4BUZA 3EG5A 3P97A 1PZHA 1U0BB 3CFYA 4XB1A 3IBFA 1SIUA 2DR3A 3NEPX 4S0ZA 5COAA 4NOKA 2CJFA 2DFNA 5SV2A 3DQZA 1F12A 1NNEA 4CLXA 2IP2A 4IO1A 3D6AA 2FEMA 2WUFA 4IHJA 4LXXA 2HBRA 3GLHA 5HKLA 3C5HA 4D3ZA 2VHCA 1WB5A 5LUBA 4DLYA 1LWOA 1RKQA 1X86B 3NHLA 4M8KA 1M74A 1D4FA 2B21A 4P6VF 2GJKA 1BXRB 3U31A 3WZMA 1QMPA 4OF4A 5IJ0B 4PYIA 2B7LA 1BMDA 2EJUA 2H4WA 2RHTA 5FJIA 2QJRA 3WYAA 2RIRA 4G5QA 1PV4A 4RCYA 3F5MA 4Q4LA 4BNDA 4EDHA 3I6ZA 4II3A 3E03A 2Z3VA 3N2GB 2SICE 3RGGA 4AMVA 3K73O 1N0VC 1BGXT 4C3UA 5TQVA 5BQXA 1CFJA 4QM6A 1XB2A 3PPXA 3IJEB 1EEHA 4KWHA 4KYUA 2MSDB 3LO8A 5EJ7A 1ZK0A 1GG2A 3T1NA 2EKBA 2RMKA 3KSDO 3ZBPA 2XNCA 3UHFA 1YQXA 5JROA 1O08A 3CR3C 2YIDA 5JXHA 3BQ9A 2BGGA 4EGSA 1CVRA 1TEVA 1TUEA 1E59A 1NVEA 3G6KA 3HNOA 3JD4A 3UAOA 3AONB 4O29A 4AJ2A 4F5EA 5BN4A 2WPDD 5K99A 3UYKA 1CY4A 1M7GA 1E63A 5A2QA 2GFHA 3ES9A 5F7XA 5T6BA 1K66A 5BO5A 3B36A 5F35A 2QUKA 1W1IA 1WSBA 3FZQA 3GRVA 4RV4A 2X8WA 3FGNA 3QP9A 3WHLA 4BEVA 2ZPTX 3PTAA 2VUUA 3LYLA 3LDHA 1Z2PX 4BNVA 1L5QA 1CF2O 2P6RA 2BBTA 1S1MA 1G1AA 2ZIAA 5EFOA 5I7FA 5HF8A 4HEHA 4HXYA 1AS0A 4JR1A 2HIAA 3K8QA 3RO7A 4HUJA 3F9IA 4MGIR 4OHMA 1J0AA 1WNTA 2WIFA 3EDCA 3EQZA 2X19A 3IJRA 3I53A 3O8NA 3PCTA 2R8PA 2V3WA 4R3WA 4R8RA 2D54A 4DTCA 3IT2A 3D31A 5D85A 5KTYA 2XQIA 1UAAA 3VJMA 1M8FA 2YCLA 2J85A 3GYGA 1RCTE 5H5JA 2F4VB 4WUVA 4B5KA 5HIAA 2IYSA 3BD9A 1WPGA 4KVZA 4ZQBA 4IDAA 3TKYA 3E48A 2Y93A 1UH5A 1U98A 4WERA 3LBYA 1X7DA 1VDZA 4JNCA 3TVYA 1B6GA 2AQIA 2ZVQX 3GMDA 3BFPA 4GSKA 1ESEA 4URXR 5ALYA 1WP4A 1SD1A 1I2CA 2IPLA 4TYQA 3EAGA 4FS8A 1M34E 1QCCA 2C5HA 2MINB 3TLEA 1SQSA 2D00A 2H48A 3OETA 3UK1A 4X6LA 4OI4A 1NYLA 5C8YF 3H42B 4DBLC 4QFDA 5DM1A 1IVSA 3UMSA 2UYGA 3QLVC 2FPSA 3RARA 4OIMA 3R9XA 5HIJA 2GUWA 2V7BA 4QHYA 4RS3A 5J2TF 1L1FA 3MOSA 4HS4A 4FQ8A 3TOZA 2X6TA 2W00A 2ZR9A 2ZBQA 4KYVA 2BHNA 5DHSA 1UBGA 1TL7C 4ZGGA 4RXUA 3SC2A 3D8NA 3WBBA 3UV7A 1SUBA 5FR1A 1VFPA 5FNVF 1PYGA 4KNYA 5KPDA 3UB3A 2SCUA 1C50A 4JC8A 5G53C 3P32A 4XPZA 1XI2A 4WK6A 3I2GA 4P08A 3TXAA 3NH6A 5LQMA 1C3LA 4HY3A 1N0UA 1VE3A 1QFYA 1QF7A 5AK4A 3OU6A 1ZD5A 3RT9A 4A0FA 1B14A 1DC3A 4WWHA 5K4AA 4KAXA 4CZ2A 1YRQA 4TS4A 4BLSA 9GPBA 3QMVA 4DJDC 4NOJA 2B5OA 4BYMA 2PGXA 3LFHA 4AZ0B 2D7JA 1T9ZA 4HQLA 2B5WA 4YRZA 1EESA 2IXTA 1M72A 5DULA 2HYDA 3WYGA 2PFKA 2GHIA 2ZVDA 1CS0A 3KYIB 3QXSA 4DJ5X 4PNPA 3K6SB 1DQRA 5IU6A 4BLVA 2IU4A 1KYQA 2QKYA 3B6EA 5JI3E 4AZSA 3I9MA 4KGDA 2DTDA 5ALHA 4MJ3A 4MVJE 2PT9A 5JS6A 2GM5A 5K8JB 1VCOA 4DCSA 3QHPA 1SC1A 2BCJQ 2RC5A 2Z9DA 3DDOA 2C9ZA 3QPAA 3GP8A 1EE2A 1RWQA 2VK2A 3DAGA 4KQ1A 5BSMA 2FFAA 4BFXA 2CF5A 3Q15C 1L8AA 1BRTA 1S8OA 1Y3BE 2CYBA 3GWZA 1P1BA 4JT8A 5JSQA 3IEVA 4HZIA 2VP3A 5E6UB 2H1SA 4HNGA 4V0OA 2YXNA 2G1JA 2V59A 3M5WA 1ANKA 5ECYA 4J29A 4LJLA 3TQTA 2IW3A 1S8FA 1PG5A 3AF3A 1XKTA 3FR8A 2NV6A 3Q85A 2GMWA 2QDKA 2X41A 4NP6A 1DCFA 4UPDA 5TDHA 1KFEB 1SOUA 1VJGA 4HWTA 5G1NA 2H3HA 3CG0A 1FFCA 2R0QC 5FOTA 4I50B 4Y6OA 2Q2OA 3IEPA 1YC2A 3K0FB 3SQWA 1LFAA 1E9VA 3RVJA 2G71A 1PJ4A 1GU7A 2AEEA 4PSCA 1YVRA 4WD3A 2I3BA 1Z8FA 4HLUC 1NF9A 1I1QB 1IB0A 1VSVA 4RZ3A 5EZYB 1VFNA 2I4LA 5KVCA 2X3FA 4MVCA 5CB4A 3N8KA 4NMWA 1SCQA 2GEVA 1JILA 1P1HA 3BMCA 5EAIA 2VXCA 2E4XA 4JLMA 5IAGA 1PR5A 4QDJA 2XDWA 3N2KA 4FGKA 1SBYA 4PAWA 4P80A 1I2DA 3K30A 1E5LA 1Y1RA 1HLPA 2RK6A 5I45A 4FFOA 4IDQA 2CNWD 3GJ3A 4L02A 4LWZA 4BEBA 1Q0LA 3MPOA 1CC1S 2BZSA 1TMGE 2P77A 1KE2A 2BL4A 3RNLA 3GFQA 2ZRKA 4B4OA 4CM5A 2ORYA 3PX7A 4YJ2A 4F5ZA 3C6ZA 1KJNA 4L8WB 1EJ0A 1GL6A 1DLIA 1WP9A 3UK7A 2X22A 2QNBA 2YNMA 3F6EX 2XOXA 3H1AA 2PWAA 2FUEA 1Z4LA 1A5ZA 5IVHA 1LTKA 5CIQA 5EWJA 5HF6A 5DYGA 4DG8A 5LVAA 3KSBC 3HMKA 1FU8A 2C57A 4O4IB 4ZAGA 2QROA 2RGXA 2XUJA 2OV1A 2XB9A 5EPOA 2Q5FA 1G8AA 3TBFA 3SXUA 2WJ3A 4OFWA 3SDBA 3TOCA 4O8ZA 5AKHA 1P0CA 4R9RA 3DOCA 1NXTA 3ADPA 5FPHA 2QVXX 2DFDA 3PIRA 4FX2A 2Y99A 3IALA 3ZHOA 4CNBA 4EZIA 1PQYA 3KS9A 1G42A 2PLAA 2GZDA 1T1IA 1XDUA 3NRCA 4G86A 1KAEA 4X3OA 5BT9A 3RHFA 4C0LA 3DWFA 4B8ZA 3MWDB 1WY7A 1DC5A 1RYDA 1VMAA 1W5FA 2BT4A 2QTVA 3GGGA 3QVLA 3MCWA 5GJCA 1KI7A 3HNRA 5C3UA 3RHTA 1IHDA 5LQUA 5JNLA 1IJKA 2ZDHA 4TMKA 1SUCA 4EX6A 3AI3A 5CDFE 5E4YA 3FSGD 1AO0A 2BMVA 2VK8A 2CW5A 5BMVF 2DLCX 4IY1A 2I34A 2JPDA 4UD6A 3IE0A 4UUOA 4A91A 5LQCA 1G5IA 3BHNA 2GRJA 1OZAA 4G6ZA 4NE9A 3U61B 1EFVA 2Q5JA 1QO9A 1BGVA 1JJAA 1N8KA 1KR5A 2DWPA 2ZS9A 3C0KA 1RM0A 3LAWA 3DE4X 4QBGB 2ZWVA 1D0IA 3U26A 5IC4A 2ID9A 4RL4A 2FSUA 3UK2A 2G83A 3R3JA 4PZ0A 3DLCA 4R2HA 1K9SA 3UT5B 1J7JA 1PKXA 1ZN2A 3NVAA 4JD5A 2RAPA 3IP7A 1A76A 4QA9A 1NMYA 1T0BA 3E9CA 3FB4A 5BVHB 5KNCH 3EHEA 4MI1A 5CTJA 1U5AA 4KAFA 4ZK2A 1MO3A 2GNPA 1NZFA 4R1OA 1P2TA 1QGED 1HDYA 1KMCA 3N2ZB 1SUFA 1RFLA 2B1IA 1CQXA 2VUHB 3PRKE 4JWTA 4RPJA 2MSLA 4O33A 1GPKA 2OCBA 3AP3A 3H8VA 3WB2A 4DJJA 2GLXA 4ZZ1A 5GZ3A 2XCLA 1AKYA 4ZVOA 1GQOA 3KV3O 3BE4A 4M36A 2VRBA 5IUKC 2BKXA 3F6YA 1BMFA 5E3JA 4IIJB 4UZEA 1HOTA 2CL7X 3U3JA 5AOAA 2W8ZA 1GCGA 2UUOA 1KJWA 2YWBA 2HR1A 1DNPA 5IN4A 1NVBA 5DHFA 4EI9A 1R6AA 2G6BA 3MMNA 4F2HA 1G41A 4QNMA 1GZ3A 1UXOA 2H92A 4M99A 1H1DA 1NBEA 5SY4A 1N7IA 3CF4A 2QIOA 3D4PA 3MJCA 4HXFB 5DCWA 4X97A 2PA3A 4PSUA 2FV8A 3HDQA 4WKOA 3EW7A 2D74A 1BYUA 4MWCA 3OJXA 1UPFA 3ETLA 4M0UA 4G07A 5BUSA 2AN1A 3BSYA 1XRMA 4G1MB 4H08A 3UKOA 2RDMA 2XQFA 4L5BA 2JJ1A 2UZAA 3T38A 3LT1A 3ZIUA 4JOQA 4AWXA 1QRDA 4DWVA 2VDLB 3KHUA 1QDUA 4HN2A 4UVHA 2DR2A 1OLXB 3TMAA 2NLOA 5TEWA 1EFHA 3ZKAA 3JPWA 3VR3A 2BKAA 2CWWA 3G23A 3NBFA 3HB0A 1PNTA 2WKWA 2M1XA 5JAZA 1E79A 1NE7A 1KP9A 3HXMA 1KK3A 2GCNA 4RVFA 5B3KA 3PEYA 4X24A 2Y1EA 1YDFA 5FB3A 1RQLA 2C07A 2X7HA 1II8B 5FORA 1M0EA 2YXLA 4GP9A 2Q8NA 4KRFA 2CXUA 1J6UA 2WU3A 3BGVA 1PR0A 1C1XA 1W35A 3WY9A 3WGIA 3HVHA 4KE9A 3BILA 3RVBA 1NJGA 1OI4A 5KHOC 1SB8A 4K81B 5AM5A 4ILKA 2IWHA 3HWSA 2JA1A 5GZ6A 4B2IA 1YHZA 1ZJ4A 2O0MA 4FEGA 4JP8A 2V6IA 3EDMA 4ZOLF 1XEXB 3SVTA 2WVGA 4RTSA 5D1HA 4HQOA 4BBZA 4EHDA 3P2MA 4G1UC 4HGOA 1M2WA 4JBYA 3GCDA 3JW8A 4ZT6A 1DTWB 2GCOB 1J49A 3GUZA 4P1ZA 5BQFA 1ZITA 3DKRA 2I2XB 3ENVA 1RKVA 3JD2A 2ZJ1A 4IDPA 2PSFA 4JB2A 3RRYA 3ZXXA 4C87A 1N34B 1FYXA 3RWBA 2CHUA 2BMAA 3GBSA 2H07A 3NT2A 1NVVQ 4R16A 2CL6X 1QF6A 2Z9BA 5A5EA 3T3PB 5ITSA 3UKDA 4X54A 1TVMA 2ODEA 4G0PA 4YHHB 4XR9A 4AD8A 5DGCA 1IUKA 1NONA 5CYGA 5HXAA 3L79A 1VJRA 5DBGA 2REBA 4UHKA 2BLNA 4FFWA 5AVJA 3SMVA 2VYCA 2V58A 3H04A 4BNIA 3E3LA 1JVNA 4M1MA 9LDTA 4Z8YA 3O84A 3ORHA 3ZY6A 4C6RA 3ZZNA 4GLOA 4M2LA 4LKRA 1LVGA 4FDAA 4MUIA 2AI1A 3A58B 1UOEA 4HAWA 3W2IA 1MRZA 4ND1A 1RYNA 3ILYA 1HTBA 1A98A 1YQDA 1Z22A 2ODBA 3TKLA 4FMDB 4GP6A 3U81A 3PPWA 4BFZA 1OLOA 1PRYA 1WMFA 2PH3A 4LPKA 4ISBA 4YJGB 3QEBZ 4ZTUB 2FOIA 5DTRA 3SE7A 2P2CA 4QQRA 4H7FA 3RS0A 3U16A 2YTZA 4PFQA 4JVOA 1KOLA 1DWPA 5AW1A 2HXYA 4ZKEA 3AVQA 1S2LA 5EVJA 2YMLA 4CIVA 3T5AA 4OXNA 3STYA 4AC9A 3CZPA 3FSJX 3I34X 1PR9A 3DEHA 3LQQA 3NAGA 1XZ8A 2X15A 4URYR 5ALDA 4BYGA 2ZIVB 3PIIA 4IIGA 1S1CA 1NP7A 1GCOA 4TM7A 3TXYA 2RONA 3WMGA 4WBNA 4B3SB 2XTAA 1J21A 4LF6B 1M2VA 1SXHA 3A4YA 4OK3A 4ZHQF 3BTOA 5BW8A 2NZUG 3EFOA 1SVKA 4DDKA 1S5PA 1K8YB 3VZRA 3D5QA 5JS7A 2O8VA 2OFPA 3DV0A 3AB3A 4RK7A 2R1TA 4XW2A 2PRSA 5JZ9A 5FX2A 4RHFA 1REQB 3OEYA 4XQEA 2H51A 1NP3A 2DH6A 1L7OA 4EKIA 1MQ9A 3WC4A 5AVYA 4F2PA 5JOQA 3QE9Y 5K6TA 1TRHA 1BH6A 3T7TA 4WGFA 4CODB 4DCGA 3UWSA 3W2FA 3W5IA 1HDXA 4UVGA 2J0QA 3I9V1 2GXQA 2DKNA 3AR6A 3CLHA 2XRMA 2D1YA 2EHDA 2OCKA 5FD8A 1GKLA 3NG1A 4XGNA 2E82A 4X63A 1JBEA 5CW1A 4BRSA 3I5YA 2D59A 2JZNA 4FGZA 1MH1A 3S29A 3A1NA 2YS6A 1ISJA 3NTUA 3PD0A 4TLMB 6YASA 4AKHA 3EK2A 2HSZA 4XWGA 5EGSA 3K9LA 5CB0A 1WHSA 1BDMA 2ZQZA 3ONEA 1KBOA 4DKXA 1GNSA 2H31A 3U4IA 3U7FB 5ELMA 3FBGA 3TOVA 3C5VA 2ISSD 3S5UA 5KJFA 1G4AE 4DILA 1DP4A 1TCCA 5FLYA 2A1UB 1NUSA 2C00A 4H7DA 4QPPA 1PT9A 5HCNA 3BWDD 4HDNA 4MIOA 1Q12A 1RADA 1GTRA 4XJSA 2BGTA 3C43A 2O23A 3BA6A 3GNSA 3M3PA 1G2QA 4L7VA 3W6OA 3L0YA 3WWZA 4B09A 5DK6A 4CM9A 4P0QB 3WLMA 1KO7A 1RRPA 4H7JA 2NT3A 3QWBA 4P36A 3KLOA 4PYKA 5CNMA 1T26A 4EYOA 1GITA 1L3BA 1XOIA 3D7LA 5EXPA 1E0AA 5EN4A 1Q3TA 2QTLA 3SEQA 5HJ5A 1JKXA 1RJ9A 2B83A 5KO2A 1DTSA 2WIDA 3PRHA 4N6OA 3H9EO 2JGMA 3OLYA 4MW2A 2V3CC 3EMVA 3FTCA 4OD0A 4YQZA 5BSKA 5HFAA 1IUPA 3KAKA 4ZIRA 1MX3A 2NV2B 3E9EA 3H1FA 2YVLA 1UT5A 2RGUA 2VEDA 3COZA 1C9JA 3G9ZA 3KSZO 3QWAA 4RYLA 5K20A 1MCZA 3ORYA 4B3FX 2V7TA 1AZSC 2PRZA 3M34A 1IN1A 4ZI7F 5A71A 5KQPA 1FY2A 4WT7A 1DKRA 5HKAA 3K2EA 2R25B 4ALIA 4UHBA 2HF7A 1RAFA 3DPUA 1G5PA 3FVQA 3EPJA 2X2FA 1QGDA 4LTDA 1L5HA 3OMLA 4XH9B 3KG2A 2FW7A 4E2WA 3LJKA 4EJ0A 3CT6A 3PJRA 1KVTA 3UJDA 5HRCA 2YHUA 3E3AA 3W5VA 4QOSA 4EHJA 4KI7A 3IUPA 3N58A 4YAEA 2IODA 1BCSA 2H4HA 3AFIA 5H3HA 3ZK8A 1I4EB 3G2PA 3BZUA 1L1RA 3RSFA 1L5YA 1UKCA 1V5EA 4C4PA 3QVOA 3V4RA 2R86A 4Y9TA 3PU6A 3OCCA 1PG0A 1DO2A 1C29B 2PIAA 1P1RA 3RRNA 2BI4A 1UQUA 3A9CA 4ZVUA 4ZMBA 1PBTA 5KI6A 1NQOA 2VL7A 1P33A 2EQAA 2Q3JA 4WQMA 3P9ZA 2Q41A 4PAOA 3GJZA 3OZXA 2WILA 1CQJB 3QVUA 2WYWA 5DCLA 4ZPXA 1YF3A 3VUFA 3EVBA 4B6JA 1ENZA 5E3IA 3GJQA 5HJ2A 4TVKA 1CR2A 1V39A 4EY6A 5E9QA 4BPBA 2W42A 4ETMA 2N75A 4QPJC 3TAHA 3K09C 2H0QA 1XDBA 2EP7A 1DBIA 1E6CA 1U0OC 3HA5A 4KBYA 2GF0A 4ZT3A 3HGMA 4QVGA 4DE5A 4JK3A 3K0KA 2X42A 4G1BA 4PPGA 4D97A 3WFJA 4BKRA 3MJEA 1W88B 2PJUA 4WOBA 2G1UA 4U4AA 1LLQA 2PM8A 4C0XA 3ZV3A 5F64A 1HRKA 3TDMA 2PMBA 2XCOA 1NDHA 3EFBA 4D4JA 4DR2B 1JV2B 1ID8A 4Q9NA 1KO5A 4P5DA 4X0EA 4FC6A 3E2PA 3FRIA 4DMGA 1KPIA 1Y5LA 5HR5A 5FUMA 1HK7A 1R5BA 2B78A 3AESA 3IPXA 4FTWA 2OGSA 2ZRQA 2EW1A 2BGRA 2IU6A 4EFDA 1I4OA 4K0RA 2VDKB 3ZVRA 4I1RA 1J9GA 4BLTA 3P4XA 1KEUA 2GEFA 2XZDA 3M0EA 2FEPA 1LDMA 5TJ9A 1FBTA 1VGVA 5CFRA 1XCBA 2NPFA 4QTXA 1W96A 2PZ8A 2ECOA 1MIOB 3D0QA 3OFJA 1CDDA 5K5EA 2J9XB 2XUFA 4MR9A 1SBZA 1XQWA 1OLSB 3QKIA 1J07A 3TW4A 1RYBA 1XN4A 5H8WA 4PIMA 1G6OA 1RAEA 4YJ3F 2JD1A 5DBOA 4IUBS 4X94A 4YECA 3ZZ0A 3UMRA 4R98A 3A2MA 1TEHA 3LLSA 1KEZA 4MINA 4KGVA 3LWBA 4YRLA 2WJZB 3UW3A 5J5VA 3STHA 3VTFA 2H52A 1ZKDA 3S4YA 4BWFB 3JU3A 4WL0A 1P45A 2VJMA 1GA1A 3SJZA 4PZUA 1MZVA 1BWQA 2I8CA 2RG7A 2XUDA 1SELA 3N7TA 2AOUA 1EDOA 2GD2A 3SDZA 3HJHA 1FMJA 2GPBA 2IZOA 4P8RA 4XSVA 3SWWA 2HU2A 4PHGA 2FZ5A 4UUPA 3V8QA 2H54A 3PKZA 1LVUA 1TAHA 4XRRA 1E1DA 4PQFA 3CO0S 1SD2A 4XWWA 2WP0A 3STTA 1EAYA 1N4DA 2V7GA 4D56A 1UBMS 2X2PA 3ZHQA 4BRWA 1BE8A 2W9XA 3EBOA 4ZJZA 5EE9A 2HJSA 2OECA 3L41A 4BJ1A 4C9BA 2FPRA 4E7OA 5J23A 2A0WA 3HEBA 4OG2A 5A1JA 4QO8A 5BNIA 4EELA 4W1QA 3D4LA 2C2GA 1ZO8A 3UF0A 2NTNA 3JSXA 2ODAA 4MR8A 2VUSA 4OMUA 5AW7A 5CCXA 2JAWA 4KYIB 4F4IA 2WWGA 3D7MA 3M89A 1TUGA 5AJYA 3V97A 4PSDA 4JQZA 2MOKA 3UN1A 3OEWA 3VYVA 5LP6F 2PUCA 1GGVA 3TRFA 5J59A 3RUPA 1SEPA 5CEEA 1U1CA 4R8MA 4ZYVA 2WUEA 4HKTA 2FNAA 1S8AA 1A9YA 4JBLA 4PY2A 4GZ6A 5AKZA 3AHIA 5AUPB 1J9ZA 2AFIB 2V7WA 2VWGA 3AM3A 4QPDA 4NMMA 4RVDA 1GNVA 3SHFA 2DTEA 3UMJA 3VAAA 3DLTA 5ENDA 2CXRA 3C6BA 4DLNA 3TI7A 5LBIA 4DV5B 3L8CA 1SVOA 3WGKA 3WKEA 4A8JA 2WHYA 4RZ2A 4GQAA 2UYYA 4O59O 3ZHCA 4DIKA 2V45A 1U9IA 4LZAA 3TD2A 4YWJA 1PD1A 3B5IA 4HOYA 4Y2UA 5DLEA 2XVXA 3OIYA 1J42A 1YJCA 3K9GA 1G8YA 3CRQA 2GRUA 3OX3A 4PQRA 4QDXA 1B6SA 1XTQA 4QREA 4CRWB 3H0KA 4S3MA 4WN9A 4FD3A 2IBMA 4OLAA 4AJNA 3I6MA 1MNQA 3SVZA 4Y2HA 4CKBB 5IXJA 2WKPA 2YWGA 4D92A 1JEQB 3HDHA 4PS0A 1EFPB 3Q8WA 3FE2A 4Y30A 4ZT5A 1XEFA 3JAKB 4YT5A 2YFQA 1OR8A 1TYBE 4Q7KA 4WCFB 2A58A 3TZBA 4BMPB 4DRXA 5I9NA 1UJBA 2VATA 1TTPB 1XLTC 2LKDA 3R0ZA 1RWBA 3IOBA 3K1AA 1N2IA 4IKPA 2VTKA 3BZWA 4AF6A 4FGLA 3IQWA 1WLYA 1WTCA 1VL6A 1LDBA 4C7KA 1QFXA 2WZDA 1BHO1 1SU8A 4B6SA 2O8CB 2J45A 4J07A 4EO9A 5KWVA 1J56A 1ZGZA 5L95A 5HS4A 3T9DA 1R0CA 3LPAA 1KKUA 5J2UA 1CRPA 5H81A 3L7AA 3NIBA 4CKWA 4QATA 4QYWA 5EPEA 2ZIFA 4YP6A 4BRZA 4BXOA 3JWIA 4V3BA 3DLPX 1OPXA 1P7WA 2IYYA 3MT0A 3N86A 3OEED 4YFYA 5DX0A 1KVSA 4HGYA 5LZ9A 2OHIA 2Q49A 1L4EA 3ORRA 1QQBA 4AL4A 3EFHA 4Q9HA 2PUFA 5LOVA 4K9QA 2EFCB 4JJKA 1KYWA 4G1CA 1P2SA 3OTOB 2WR8A 4IMRA 5ALJA 5EXDA 4IINA 4N9QA 4OGGA 1RQNA 4ZAWA 2BZ0A 5L4NA 4D96A 3CINA 4LQCA 1X8LA 3RROA 4ZN6A 3FSGA 1FU7A 2HA3A 3L9WA 5FI0B 4ZK6A 1XKLA 4C1NA 1QH8A 3CB2A 2C4MA 3M6AA 2AFHE 3OVMA 3VO1A 5JH7B 5K0CA 4N0EA 2BPOA 1UXJA 5B2FA 3N5KA 2IHJA 2JI8A 4JROA 1PZEA 3B2QA 3OPYI 2VHZA 3VSDA 1MNAA 4AG5A 3LZDA 4NEGA 4XYMA 3LIIA 2FFJA 2V4UA 3NHFA 3ZGYA 3ZLVA 4OX9Y 2FR8A 1BU8A 2Y6UA 2ID7A 3DFFA 1B0ZA 3KSAC 3CUYA 4JCCA 3LS2A 4JELA 2Z2JA 2JDID 2QUBA 3GLHE 3VPFA 3BDAA 1S8NA 3JS5A 1P91A 2ZYRA 1HMPA 1UWCA 4DNXA 1J0BA 3AHFA 1VHQA 1H05A 3C5CA 4I8IA 2Y1FA 5CRIA 2IQ5A 4DT1A 5B2EA 2QRJA 5IHPA 4FUTA 4RFVA 3BWMA 1JLHA 4ISCA 3OQMA 1JLLA 3AU9A 5IDWA 2RI6A 1KI1A 3ESRA 3K7EA 1LEHA 2B94A 3MJ4A 2OO5C 4QGGA 3F1LA 1YVDA 3LYUA 4X92A 3I61A 4GW3A 2V5UA 1GV0A 3R77A 3AHCA 1ACJA 3RQSA 3LY8A 2GAAA 4YNBA 1P7PA 2H7CA 2K6GA 3PGMA 3JQ9C 3RHZA 5A62A 5K3FA 1JP7A 2AFHB 1KFJB 2CHVA 2WFZA 3A31A 1JFRA 3ETNA 4YK7A 1YMVA 4IJVA 3IPYA 5AVTA 1E8DA 4GQBA 3G7SA 2OFWA 1R9MA 4M0LA 4TQUS 4UBKA 5HBGA 1LC3A 3LL4A 3LFUA 2EERA 1ZN7A 1H2AS 3B1FA 1IHXA 3SNKA 2RH9B 2R6JA 5L7WA 3OAAD 3C5WP 1TK2A 3ETJA 4F4UA 4CMHA 1GCIA 1KQNA 2ECPA 1YZYA 4IHJB 3RYFA 3GLHB 4RD4A 4DUGA 3KVOA 4IL5A 3LGXA 2VF7A 3D2AA 1SOVA 1SQ0A 1CUEA 4RNDB 5MHTA 4LWQA 2NSHA 3TAXA 3AM5A 1ODFA 4FHCA 4KQHA 3X1DA 2VQSA 4N47A 4HTAA 5AJTA 1GVNB 1W4CA 3EA5A 2XKAA 4IIDA 3ZLBA 4ARBA 4QBIA 1M2EA 1ULSA 3SN6A 3T7SA 1NR5A 3INGA 3ADBA 4ZZ0A 2C8JA 3MJRA 2GX6A 4DYVA 2BMFA 3QEKA 4M76B 1U81A 3AVPA 4B87A 2HK7A 3ZDRA 2VJCA 3UXHA 1LX7A 1OILA 2R68A 1GSIA 2RHHA 4Z51A 4PTZA 5JCZA 2HHJA 2JGAA 1X8KA 3C8DA 3DGFC 1ZNWA 1ETHA 1JHAA 1VCHA 2NYUA 1W52X 1Z4JA 5FUVA 2OVBA 2YYSA 5A05A 1W1UA 3UKJA 2B1GA 5LBTA 1K6IA 3KLMX 2VF2A 1BZYA 4NKRA 1QAOA 1UDWA 1E9RA 4GBJA 4Q0MA 3T1YB 1FXWF 1IN4A 3B1ZA 1NBOA 4CFZA 3VKUA 2GM3A 2YIMA 4G25A 2NQ8A 4O8CA 1SB9A 1RZRD 4QASA 3CMMA 5DLPA 5BN4B 1RHKA 3R0VA 5AVXA 2PT6A 4UJ3A 1M8KA 1CY2A 5DEIA 5IT4A 1UIMA 4AMYA 2CUZA 1T0IA 2W83A 2IH4A 4LHWA 4X20A 4B8WA 2JAUA 5GIOE 1UBRS 3BXPA 1NRWA 4PAMA 3M5PA 4H59A 2KHZA 3LQ1A 2COEA 4RULA 2YWEA 2HXGA 4DQKA 3LVRE 1CJKC 1R8QA 2W2VA 1TMOA 1Z33A 3HXLA 3IDQA 3JXEA 5BMOA 3HV2A 1J2YA 2H1HA 3DKPA 3AIKA 3K9WA 4AECA 4PX2A 5LC1A 3JQ9A 4MWDA 4EVIA 2VDVE 3GAAA 4LVNA 3OA2A 5JATA 1A7AA 2P6UA 4TYPA 3I8SA 5J9FA 1YVPA 4ONEA 1T0JB 3IS3A 1EG7A 5JMTA 3EIWA 3Q72A 4O2BF 4BFCA 1XU7A 1OU0A 2AD1A 2HRRA 3C7AA 4A4DA 3V32A 2Z08A 4LY9A 3PF8A 4AF7A 1WA5A 3GEIA 4GR9A 5C0OE 1C0PA 3SSMA 3V4LA 3N39C 4CT4B 3WJAA 4JIGA 1KMIY 2I7CA 3AZOA 3NQ41 1DJPA 1FVOA 2R5NA 1PFGA 1ZU4A 2QN7A 3H9QA 3IPAA 5ICCA 1Y7IA 3UHOA 1BKDR 1NKTA 4F6CA 3TJRA 5ABPA 4REQA 2E4VA 4LRQA 4J0IA 4LAFA 4L72A 2PX0A 4J3JA 2PVPA 3L4BC 1M0WA 5I9IA 2BFAA 1Y9EA 4F92B 1ZEMA 2ZSAA 2P5TB 3R9XB 4I1VA 2YMQA 4X6XA 4CIAA 1DKPA 4P7KA 3ABIA 3WNDA 1LPOA 3GY0A 3JQFC 3DLHA 4X9XA 3IAM6 5DSXA 1L5KA 3D3NA 3ZQJA 1QG4A 1QMGA 5K0LA 3QNWA 4MRNA 2F1KA 1UFKA 2FN8A 2ORVA 2OK7A 2VPPA 3SC2B 1KIAA 3OOJA 2FWJA 1FMFA 1YBHA 2PG3A 3PHJA 2LE0A 2DR0A 1JXMA 1NMEA 2APJA 1H2XA 2H5EA 2SCUB 2ZYIA 4OHVA 4Y98A 1RJDA 2Q3CA 3FUCA 2M6SA 5T64A 1GKYA 3HRKA 3ZWQA 4PTLA 1GNPA 3JQ7A 3HJTA 4IX9A 4H31A 1JDPA 4OQPA 4XOUA 5IVDA 3RS5A 4BP3A 4C5CA 5LQKA 4FQ7A 5FPPA 3WAJA 3MWYW 1E7WA 1AF4A 1RC1A 4HRXA 4UDOA 1NLMA 1U0HC 2G25A 3ECAA 3PEFA 1WZUA 2QLJA 1GPDG 2IEBA 3DZGA 3KDSE 3M7IA 3B3GA 4UNIA 1GDTA 2IKQA 2BFWA 2OZVA 2QTFA 4JI5B 1CZKA 4Q9LA 2J5BA 1ENPA 2XUZA 4TT8A 1KRXA 4JASB 3RNOA 5CDSA 3GZNB 1IY8A 4NULA 3VU0A 4E1AA 2GSDA 2MIIA 3KT3A 4NBWA 1CS0B 3M4ZA 4DBLE 2VF5X 1BDIA 4KE8A 1N3YA 2Q0XA 3L06A 4OI1A 4MUKA 5K0FA 1NV9A 3Q9SA 4NVRA 2PZEA 4WXMA 3VNRA 2Y1GA 5FOWA 1EA5A 3ASYA 3QMPA 4UMFA 3ZE6A 4ZMSA 1YJ5A 1YA6A 4KAAA 4CMIA 5JQWA 1S3FA 2PT7A 3CWCA 3OQPA 3OT5A 1NMXA 1V5FA 2AXPA 2ODNA 2B4KA 2ZRIA 3BIOA 1QIHA 1V9LA 2CLSA 1N2CA 3LTEA 4LF7B 1NN5A 3IR7A 1QDEA 3KVYA 2E21A 5CX4A 5HBRA 3TR5A 3UMFA 3C41J 4GAEA 1SA0A 3I0ZA 1CULC 5E7IA 4F91B 3OKPA 4Q4HA 1WHTA 3F3YA 1UWLA 2ONJA 3V5NA 3MRXA 1ZESA 4JLNA 4RTKA 1Z38A 2D0IA 3VNVA 3G8BA 5DGIA 3L6OO 3QYFA 2X8BA 1T4CB 4M0CA 5ECGC 1ISGA 1KH3A 4FR2A 1MB3A 4Q9IA 1J0EA 1PJCA 4XASA 5AM0A 5HCUA 4LBVA 2ENWA 5A2GA 1HE5A 2R4QA 1A3CA 1E69A 2P9CA 4FVTA 3O8CA 1G5TA 1AX9A 2GAOA 2QHXA 4FKBA 5K3BA 2VQEB 2BFBA 3G2QA 3IBSA 1SOMA 1K7YA 3L4BA 3ISVA 2BGWA 3BMCB 4MKIA 1FP2A 1GVHA 2V7QA 2VJBA 3EULA 2X58A 3N2KB 3I52A 2OZPA 3W2TA 1JZQA 3FDZA 2PUBA 1RS0A 2A9PA 2XYVA 3WV5A 1DPGA 4LECA 2IXBA 1O4WA 3WIDA 5L3RA 3TD9A 1BFUA 1Z8DA 1MU0A 2EC5A 2ABWA 2W5UA 3WFZA 4KQKA 2CDBA 4YJ2B 4JR2A 3RKRA 3I9KA 1RXYA 2EF0A 3GP5A 2IXFA 3A6HA 4BJ6A 2ZREA 5CA1A 3LOQA 2WD9A 4QJIA 4C6TA 4QAJA 1DMSA 5EWJB 3ZZMA 2C42A 3DBLA 2JZOA 2QN8A 4ZCSA 1I7PA 4IOKA 3WI7A 1JQ5A 5HPYB 3SXUB 1YAHA 2RBGA 3ITDA 1FFDA 2XMRA 5JTTA 3HI4A 2J3MA 2WKRA 3HVJA 1OFUX 4DVJA 5LJIA 1OAAA 2JVJA 1Z6PA 1L4MA 4QU8A 1XQ9A 2HX1A 1TM5E 3C7TA 3DPIA 2B69A 1WDKA 3M70A 4HSGA 4KSYA 3AV0B 4L3VA 4NC9A 2NAPA 4WBXC 3W06A 4DQ0A 2QAGC 4TYYA 3MFQA 4RIIA 3W3AD 2TMYA 2XIJA 4GI1A 1CE8B 2QTVB 2NPOA 3GG2A 5DP2A 1T13A 1DS6A 1QR6A 1U3DA 4LE2A 1G7SA 2DBQA 5KZMB 3QEOA 1KPGA 1E7SA 1QTNA 2NTJA 2PD6A 3MJSA 3IESA 3ERCA 4TLCA 2VBGA 2I5PO 3MELA 1GAEO 4MSUA 3L6UA 5TF4A 3LNCA 4QU0A 4J03A 2WIGA 3IQEA 1A0OA 5CNIA 1GCUA 5MN5A 1XNJA 3UAWA 2ZEJA 10MHA 4D0LB 1T9DA 1EJ2A 3OY2A 1FYEA 3CLTC 3SI7A 1EFVB 4WZZA 2BKUA 4XWTA 3N53A 2VRWA 2PXAA 3L01A 4P54A 4Z3KA 2IYWA 3IE2A 1WKVA 3MGAA 3FFAA 2I1QA 2CJYA 2AGVA 3C1TA 4GR5A 3A36A 4JVSB 3C3JA 4CM8A 4KH1A 2EFEB 4HT3B 1YULA 2JIQA 3PE6A 3OCUA 5KYXA 4AKIA 1CVLA 2R48A 3H8SA 2ODWA 1NFRA 3KWFA 3C3XA 3PNYA 5EMJA 3IPCA 4BGIA 3P9XA 1ZWKA 3JD3A 3PXDA 1NQAO 1OD6A 1XRSB 3I37X 3NEYA 4ZAVA 3V4PB 2Q5QA 4ABTA 1DDOA 4RO0A 5EWLA 5K3EA 3OPMA 3PA8A 5UKDA 2MJLA 3X2SA 3KX2A 2HMAA 1OFVA 3NHYA 1V45E 1XUOA 4MWTA 4RM2A 4BQQA 2WTXA 3LA6A 2O8NA 4XVRA 5HRUA 1G7RA 3S2YA 4YT2A 1IXYA 5B3LA 1W36C 1NP6A 4ZVMA 1Z5UA 1O0CA 3RJ9A 3UFBA 4TSFD 2RHBA 1FFSA 1DRKA 1XG5A 4G4JA 3WO0A 3TSCA 1JI0A 5B57C 4CV0A 4IDEA 1V3VA 3C5EA 3E5RA 3K0EA 3L1HA 4MYCA 3PWSA 4IFEA 3NWEA 4PLFA 4D3SA 4ZQEA 1LXCA 3VFDA 1ORVA 4LCEA 1C2YA 1TNDA 1KK1A 1N6RA 4PCUA 3CMCO 2ZXUA 1C8LA 1GPMA 1FSGA 2MSCB 3DZBA 3Q41A 4J0GA 3SOPA 2XB8A 1SXJD 4A0RA 3FB1A 1WTAA 3ECSA 3QLJA 2WMOB 4TROA 3S8MA 3UHAA 1CERA 1V4NA 1WMDA 2EFHB 3NOQA 2O7VA 5A02A 4CF7A 1FP1D 3CSUA 3HO6A 1CDOA 5JBNA 1ABBA 3ZHVA 2CFTA 1W48A 3FCXA 1QZTA 1RQXA 3K8ZA 3PFHA 2G1KA 2WSMA 4MS3A 3V8NA 1CYDA 3L18A 1EGVB 4JJ6A 5CPFA 1V71A 1WV0A 3AJ9A 4NBSA 2Z83A 5EIOA 5IEJA 5T7BA 1WCV1 1GQRA 2QAGA 4EHHA 1T1SA 5IM5A 5K03A 4X44A 3YASA 1Y1LA 5AJHA 3EPRA 2XAAA 3CLSD 1C7ZA 4C0SA 2NXJA 4FHDA 4J7XA 3IB6A 4GKAA 1C1XB 2XBLA 3VVMA 1RBYA 3UAXA 4BFVA 3SYMA 4Y2TA 2UYCA 1C2TA 2XCIA 5LD2C 4RFLA 4J90A 1DAMA 1VLZA 3AY0A 2Z5GA 3ENNA 4NZ9A 1SC3A 4B34A 3AM1A 1I1OA 3JWEA 3W05A 4DYDA 1BHJA 4LJAA 2FMHA 2ZSDA 2H2DA 4N1AA 1Z18A 2FPGA 4EVQA 4Q48A 1ZI9A 3Q8KA 3MHTA 2NUTB 4NEHB 1IATA 4CDGA 2YCBA 3OQHA 3ROQA 5B3JC 3SU8A 3OBIA 1GARA 3HB7A 2X1HA 4H0CA 4ZDIA 2YJZA 1DPFA 3O38A 1U63A 1BVUA 4N6GA 2IIBA 3O03A 3IP8A 1BN6A 3MMPA 3RFXA 1VSQA 1ZI6A 2W58A 2KLBA 3TTSA 5CDUA 1RRFA 2IDKA 3MILA 4LRTB 2BY4A 2B2CA 2X0EA 3ILXA 3I01M 4UNNA 2VDOB 2OAGA 1GAWA 3RABA 4ZCMA 2GPJA 2WYVA 4BASA 2X77A 3EMBA 4BTLA 2O0KA 2O5RA 2IZ0A 1H5QA 2P9ZA 3IAHA 1PK7A 3NHKA 3A4IA 3P20A 1E4OA 3DVSX 4HLQB 1OYVA 4HAOA 3RG2A 2WW8A 1T3GA 2Q3HA 2F9LA 2AN9A 3L92A 4M1EA 4ZAXA 3B13B 4FDTA 2YMPA 1GQ2A 4E5YA 1O94C 1U1EA 2CLMB 3GCWA 2IYEA 2GOYA 3AW8A 4MZXA 4RPGA 4YJHB 3REFA 3STXA 2F67A 1U3FA 1WSAA 4N4AA 3U2QA 3TUZC 2ZYSA 5J47A 2FF7A 1PZNA 7MHTA 3O4HA 4IHKA 2PA0A 1TCBA 1Y8QA 3TMKA 4L51A 5C46F 3G6WA 1LSJA 3G49A 1CQPA 2NZXA 2WTAA 1H4TA 1P31A 3HPQA 3KQWA 4N41A 2Z2IA 2GARA 3WHPA 3IH5A 4RAOA 4LV5B 1DXHA 2H59A 3BTVA 1BX1A 1QX3A 1GL9B 4EA6A 5F3RA 2YR0A 2OHHA 1H2FA 1RQPA 3DFUA 3HN6A 4G26A 3L7DA 3R7WA 3W7BA 4AK9A 3EC1A 4O4HA 1X77A 4H0NA 4KR0A 1Z56C 3C48A 1L4BA 4I6JA 2I8AA 1ZRMA 4QQKA 1WABA 1B42A 4BO3A 4YCMA 1YC5A 2AG1A 1FOEB 3PT5A 1NXOA 2L17A 4UUNA 1XF9A 1HFJA 2QN9A 1VHLA 4HMOA 5CM9C 5FOVA 1QKKA 1E64A 1QONA 4WBNB 4BEJA 4BFLA 3QNMA 1SBHA 3A9WA 5DYNA 2YBEA 4I6EA 2HFJA 4GXRA 3EFOB 2YQ5A 1GYPA 3OFKA 4EPTA 1A2KC 3PFBA 2H4YA 1TIBA 3TX2A 3H1BA 4US2R 2J1LA 5L51A 2LR0A 2ZYVX 3DV0B 4M0KA 1HDGO 4BQEA 2UV8A 2R1TB 1IG0A 4DG9A 2XXAA 1U7HA 5FV4A 3U80A 1B00A 3KTFA 1RKUA 2EOAA 1JG1A 5B3JA 1I7DA 3EUEA 1JG3A 2FP3A 3E9NA 1ZY2A 3F74A 5CVJA 4JBNA 3GCXA 3IEIA 3PR1A 1PGPA 5IZCA 5K3DA 4AXBA 1OZGA 2FHPA 2VJKA 3OJLA 1TW3A 4J6FA 2WT9A 3DMNA 4B48A 5JI2E 5J4YA 3IUMA 5I51A 3QVXA 1IY9A 4HNSA 4BZPA 4NCAA 3U48A 3K16A 4LHZA 2GDJA 3EF1A 2LD4A 3JVDA 1ZD9A 3GH3A 2ACKA 4PYLA 5T6MA 1FTGA 4DIBA 3Q8LA 3AMVA 4RQAA 4P3XA 5D8DA 2P9QA 3KOMA 4UFPA 1Q77A 1CNMA 5A4FS 1RYYA 4GM1A 4TRRA 5T41A 4E3ZA 1WUHS 4FFPA 1EWTA 2GHQA 4ZVVA 4G8DA 4MLZA 2GPSA 3DTVB 4BGUA 4ZDKA 2JLZA 1D6MA 3OZDA 5CLLA 1JDSA 1KSGA 4Z49A 2C9YA 4AYTA 2AVDA 1PLLA 1O94A 2J0UA 3QH4A 1DKMA 4HDNB 1R66A 2D4HA 1RPAA 1X1BA 2HB6A 2W2OA 1PDOA 1XRNA 3IURA 3KEGA 4R1MA 3R0JA 1KAQA 4OKNA 5JYCA 4HQFA 1MDFA 2XY4A 2Z3ZA 5DISB 1IBCA 5HK8A 3H2JA 3KVNA 1A2BA 2Y1XA 5U4QA