3K9KA

Transposase domain of metnase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
233
structure length
211
Chain Sequence
KVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVRRKRPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYWTGINQLISRWQKCVDCNGSYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the human Hsmar1-derived transposase domain in the DNA repair enzyme Metnase.
pubmed doi rcsb
molecule keywords Histone-lysine N-methyltransferase SETMAR
molecule tags Transferase
source organism Homo sapiens
total genus 64
structure length 211
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2009-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01359 Transposase_1 Transposase (partial DDE domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3k9kA00
5CR4A 3F2KA 5HOOA 3K9KA 2F7TA 4MDAA 3HOTA 4MDBA 4U7BA 3HOSA 3K9JA 4R79A
chains in the Genus database with same CATH superfamily
1JLAA 4CIFA 3PSIA 3HOTA 1TKXA 1WBBA 1K8AO 3GDQA 3MN5A 4DR3K 3NF9A 1EX4A 1QS4A 3QBXA 3OS1A 5BR8K 1U49A 1Z26A 1RDBA 3LDOA 4CGHA 3LDSA 1LWCA 1GOAA 3CPWM 4KHPK 4CF2A 3RVCA 2HSTA 2RKIA 1NJXA 3KWIA 1RT1A 3BDPA 3CFPA 4FWMA 3ISNC 3THVA 4JKFA 1EWQA 3AGKA 1QVFM 2YNGA 4B1XB 4JKEA 2B5JA 4KHQA 3WXJA 2VG6A 2X6NA 4BRIA 1SL0A 2G8KA 2QEXN 1I39A 3EZWA 4BR5A 1N34K 3QESA 5CYMA 3LWMA 2ITGA 1RILA 4CF9A 4NYFA 4GMJB 3EE8A 4FWRA 3CJ1A 4XH4A 3D2FB 1N32K 1BHLA 3ZSOA 3SUNA 5JS1A 3O5BA 4GVMA 1MU2A 4NB4A 1YTAA 1YJNN 4PUOA 2GBZA 1C0TA 3QFUA 2ZM6K 3NVKA 3TR8A 4BR0A 3A5OC 3M6GA 3VGKA 3NH0A 3WUHA 3CQYA 3O4NA 3LDQA 1GLFO 2AP1A 4CJKA 2IIRA 1NGBA 2ASPA 4H0YB 3RRHA 1BA0A 3M8PA 2WUSA 2A6AA 3WEEB 5JVGL 2UU9K 2O8FA 3QETA 4CJSA 1ILYA 4DUZK 4B3OA 4BE0A 4WCEL 1VSLA 1I3AA 2OA8A 3DMJA 1NGGA 3D2EB 2VWBA 3TPQA 3S41A 3ZEUB 3IAYA 5M1PA 1SS6A 4CF8A 1IKYA 1S6PA 5C12A 3QEPA 2V7YA 4A59A 4BQZA 3QBWA 3VPZA 1W0HA 2B4JA 1RDDA 3QLHA 4DR6K 3H6EA 3OYIA 1U48A 1YT3A 5AQGA 3O9QA 4R5PA 1N6QA 2E2QA 3F73A 2PYLA 4Z4GA 5C2DA 5BR9A 5I3UA 3HJFA 1A5WA 4LSLA 3NGZA 3VQ5A 1TK8A 1BO5O 4EP5A 3HP9A 4JI1K 1KFSA 1P8ZA 5BPMA 4ELTA 3SQ2A 1YXQA 4J2EA 4BC2A 4ID5A 2HBLA 4M63C 4CVNE 1X9SA 5CYQA 4DU3A 2YI1A 4DUYK 3WNEA 4J8FA 5KPTA 3ZSQA 2A42A 2OPQA 3SV4A 3AVCA 5C15A 1NK6A 2WTUA 4H5WA 4DS4A 3D0PA 3L8BA 1WLJA 3D2EA 4L3QA 3TU5A 3V9UA 3A5MC 3ZEUA 3OYBA 5GADP 3VETA 1HNZK 4DCHA 3JS6A 4KB1A 4CI6A 1X9MA 2JLEA 4O0JA 2E88A 4ILGB 3UKUB 4IJAA 2CGLA 4JK9A 4YDUA 2PBDA 2YHBA 3G4SN 3ZX2A 4CECA 3T69A 1T8EA 4C8KA 3MN9A 5BN9A 1Y97A 1FW6A 3VEZA 3MCPA 5EX5A 1YJ9N 4KH4A 3DRSA 3WXLA 3TAPA 2YJEA 1OVQA 4H8KA 3HPHA 2HHTA 4E7HA 4MDAA 3DJCA 3MMVA 2DFFA 3NE6A 1NOYA 2Z1IA 2O8EB 4CZGA 1KLMA 4BE1A 1RTIA 4AHCA 3DXKB 3DWLA 3O4QA 2QM1A 4BRPA 4BRCA 1D8YA 4JI0K 4A62A 4FJJA 4YORA 2BDPA 5HRNA 3MDQA 3WXIA 4JHDB 1LV5A 4B9VA 4FLXA 3FZLA 3MX5A 3NVMA 3U3GA 3OW2M 4W5QA 3WNGA 4CEBA 4FXDA 4KB0A 4LD0A 4O0IA 3QNNA 4H03B 3A5NC 1KCFA 4E1NA 4CD3A 4CGFA 3C7NB 4CJ4A 5GIPA 4GKJK 3OYAA 1K9MO 3UKUA 3OYJA 4CEZA 1VQ8N 4W5TA 3CHWA 4CEOA 4NXMK 3HP6A 4B9TA 3O6WA 1ZBLA 2KW4A 4MQ3A 4AHSA 5CR4A 2VCPA 3MAQA 4IBNA 1U6ZA 3CCSN 5SWMA 4FO0A 1WSGA 3K9JA 4PKIA 4WQ4A 1BL3A 1KAZA 3S9HA 2O8EA 4CZFA 2IDOA 2ZF5O 5DMRA 5AQXA 1W2BM 3BP8A 5KPRA 1LOTB 4K8XA 4DFKA 4JK7A 1YHQN 4HUFA 3MXMA 3G6EN 1J9AA 1YVUA 3H46O 2G8UA 2FXUA 4GVEA 4JHDA 4N41A 4EZ9A 2YX6A 1CZBA 1N8RO 3QICA 1S6QA 3R6MA 2HBJA 1XMOK 2YNHA 4PL7A 4DSKA 1RDWX 2CGKA 3C7NA 1ZBIA 2HW3A 5BN8A 3CXCM 3VEYA 4LF8K 1BQNA 2KLAA 3P83D 4CCHA 2OCEA 1FKPA 5HRSA 4DR2K 1QQNA 4FPBA 1MWMA 5CZ1A 4W5OA 3CMAN 3ZSXA 5MLCQ 3PX4A 2IVPA 2WBNA 3VQAA 3L4IA 4OKEA 5HLFA 3ENHA 4X65K 4H5VA 4CGGA 2ITMA 4NXNK 3NGYA 1XUPO 3VF2A 4H0PA 5HROA 1RDCA 4YOUA 3QIPA 3WXMB 3CD6N 3LPUA 1L3VA 3LM2A 3LWLA 4B1UB 3G71N 1WAFA 2RHKA 4OVLA 3Q7BA 4G1QA 1L3SA 3G25A 3JYTA 2E6MA 2ZJPL 2OTLN 4BDZA 1RDUA 1RDAA 3VF6A 2W40A 4ILHA 3MCAB 1XNRK 3T1AA 4KRFA 1U04A 2Q0RA 3RR7A 2P1JA 2BUPA 1NK8A 3AVAA 4O44A 4BRMA 4JKCA 5F1XA 4FWLA 4KHNA 4DFPA 2QK9A 1JLFA 1U2VB 1WOQA 2O4IA 4DV2K 3CC4N 4IG3A 3WT0A 2KHOA 3THWA 3DRRA 4CIGA 4C1NK 1KVAA 5F0XA 1YITN 5C10A 3I0SA 2GWJA 1Q9YA 2NLXA 2P51A 2QTDA 4M42A 4CJ7A 1WNSA 3LP0A 5AQHA 4DTUA 3HVTA 1NLVA 3HYFA 2NRVA 3F5TA 1RBUA 4OPKA 4ZHRA 1JL1A 4TSXA 3IDHA 3L0QA 3O3HA 1JXBA 2GV9A 2Q1NA 4BRFA 4BR4A 1VSJA 2XRIA 4IEIA 1RFQA 3R1XA 3LZJA 2UUAK 3VQQA 5HBMA 4I7FA 4OPHA 3IS9A 3V6DA 4FJ9A 4Z0UA 1SV5A 3QNOA 3LZIA 3R9PA 3ZETB 1O13A 2P5OA 1BDGA 1VQ4N 3OYDA 4J2BA 3F9KA 4JI3K 4BDPA 2AA4A 1VSEA 5JICA 1BISA 4IDKA 3RRGA 1CZAN 4NLBA 4U7BA 4GV9A 4WE1A 1YTUA 1ZBHA 4M7XA 2NZTA 3KKSA 2YV0X 4BG9A 2Z1JA 3LPTA 3KLIA 3R3LA 4FVMA 4JI2K 2I7PA 2D1KA 5JMVA 4C8NA 3M1FA 4YOXA 1HPZA 1DGKN 1QE1A 2HOEA 2ASMA 5EU7A 2E2PA 2ZGYA 4FW1A 4IO9L 4CEAA 4IFEA 3AA4A 1RT2A 1LAWA 3LALA 3L4QA 3P5JA 3SJHA 1XMQK 1ATSA 3V9ZA 4B9SA 3PLAA 4ILJA 1QSSA 4FK4A 2QKKA 3CJ9A 1VSFA 1K8KB 3H3NO 3M8RA 3QFPA 3ZETA 3KD5E 4FJHA 4DTMA 3PX0A 3AO3A 2VWJA 5AQJA 2PYJA 1S9EA 5JS2A 4JYAK 4CHYA 1HRHA 2OZSA 4KBOA 1J53A 3U6FA 1IBMK 3A0IX 1S3XA 3CM5A 4KHWA 5T7BA 4RCHA 4AF1A 4FJNA 1OH7A 4AQYK 4BRLA 3QEXA 4FWNA 3CC2N 4JI8K 4CZHA 1TKDA 2IOCA 1NJWA 3A2FA 1IO2A 2XO7A 3ULEB 3RMAA 1KVBA 1NWKA 1U4BA 1E4GT 2Q36A 1DKGD 1TUUA 4BWJA 4JEPA 3CCQN 5AFUA 5M1KA 3E01A 1SUQA 2NRZA 3OS0A 2YCHA 1X3NA 1IJJA 4B1WB 5FPMA 4FWSA 3ZT2A 4OX9K 3AA3A 4JKBA 1ZBFA 2VQFK 1RTJA 3VQCA 2RE2A 4JV5K 1QQCA 3VQ9A 3PO4A 5AQUA 4ISEA 1KAXA 3AVNA 4HUGA 3OBYA 3U9ZA 4AHVA 4HTUA 1VSHA 2FSNA 2WFBA 1EQYA 3D7EO 5BPNA 1EETA 3K5OA 1RBRA 3KZBA 1BGXT 1DEJA 2V52B 4N5SA 3FR0A 1S1UA 4BG8A 4FLZA 3DOKA 3MN7A 3DLRA 4DV7K 3SPZA 3MX2A 3P38A 3HI0A 1HJRA 4BROA 3ULEA 1XHZA 3FFIA 4LFAK 1Y64A 2P9UB 2QWNA 3P1GA 5LY3A 4KHSA 1EKEA 1TUYA 2A1SA 1NKBA 1U45A 5E84A 4BY9C 3AVFA 4B8CA 3N4PA 3M8SA 4DTJA 2O8FB 1BU6O 1NGAA 2JWKA 3AO5A 2HHQA 3TWHA 3HOSA 2VGNA 1V4SA 3CFOA 2BTFA 2IVNA 3VGMA 1BWFO 4AM7A 3EZ5A 2D0PA 2E2OA 1B9FA 3VF4A 4BRNA 1SL1A 3RR8A 1OH6A 1ITGA 3AV9A 1A5VA 3VTHA 4I9QA 3EKSA 1HMVA 1FXXA 4FJIA 2B6AA 1W97L 1BIUA 4M3RA 3U3YA 5AR0A 4DLGA 4DTSA 4JI7K 4E89A 4WQ5C 4CK2A 4LF9K 1I94K 2FLOA 3ID8A 3H3OB 1NJIO 1BG3A 4KI6A 3CJAA 3OJSA 1REVA 4H5TA 2NRTA 2EHGA 2YHWA 4ISFA 1NM1A 2KFNA 2P9UA 3QMLA 3QO9A 1YJWN 1KTQA 3L2UA 1KRPA 1Q82O 4W5RA 3HL8A 3KIOA 4XIUA 3RWUA 1F21A 3EN9A 3GOIA 4DQSA 1KFDA 4KO0A 3RMBA 2GEMA 2X78A 2FSJA 2E1YA 3ZSZA 3G10A 5IWAK 3V9WA 2HVIA 4K25A 4GNIA 4BRKA 2ATQA 1IBLK 5AQYA 5AQVA 3VTIA 3SLCA 4FM1A 2GUIA 3SQ4A 2R7YA 3CCJN 2VYPA 3FZHA 4IEEA 4BRHA 2NUBA 2HNYA 3QEVA 2UXBK 4DF4A 4Z4EA 1XHXA 3NCIA 3THXB 1TAQA 1HYSA 3HTVA 4FLTA 3BZKA 3EL2A 4A5BA 1L3TA 4FWQA 2Q97A 1XI1A 2E20A 1FK9A 3OBWA 1S72N 5GAEP 1N36K 2W6KA 3VENA 4NO7A 3OJUA 1D5AA 2P9IB 2OTJN 1V4TA 2QKBA 1GLDG 3AO4A 1XNQK 4LC9B 3SJJA 5BREA 4DQ8A 4NYNA 3SQ1A 4DSLA 1HNVA 1RT7A 3L2QA 1JL2A 1E4FT 2P9PB 4YOYA 1X9JA 1SKRA 4O4GA 1EO1A 1LW0A 4C8LA 1KVCA 4X62K 4OGEA 4FM2A 4CZJA 1T03A 1UOCA 4CBUA 3S3OA 4UY8O 1CZ9A 3CCMN 1GOBA 2UYTA 3MWTA 5FROA 4PWDA 4YNQA 4IDHA 5CZ2A 1QZ5A 2QWOA 2W6LA 3M5RA 4JNEA 1W9HA 4A5AA 4AILC 4CJRA 4LF7K 3OYEA 1Q9XA 4N47A 1HR0K 3THXA 1NK0A 1RT3A 4JI6K 4BVPA 5ADXA 2E4LA 4BRDA 4FLUA 4M7YA 4GY2B 1W7AA 5BPLA 2F96A 2WOMA 4M3WA 3HXMA 2GTDA 2HHHK 4HUEA 4KREA 4JKDA 4CHOA 2IS3A 1HNIA 2P9IA 4H4OA 2YKMA 3LP1A 4OO1J 3J7AP 3NDKA 4OKJA 4E7IA 4BR7A 1VQKN 5FRNA 3DYAA 2P9PA 1TL1A 1CXQA 3SPYA 4WFNL 4CEEA 1JLBA 3LANA 1HNXK 2DFEA 4GV6A 3K5MA 2VWKA 3O9UA 3UKRB 3TI0A 4W5NA 3VA3A 2KZZA 4V19S 3QDKA 1RGIA 1WSHA 1A5XA 1NBWA 2FBXA 3L2RA 4JRPA 1VQ7N 3AAQA 4OLBA 1SL2A 4LSNA 1JKHA 4BVOA 1NGJA 1NGHA 3VQDA 5FPNA 4M41A 4FZYA 1T6DA 3LDPA 3MN6A 1VSMA 1XQSC 1X3MA 3H08A 3ZSRA 1MDUB 3ZT1A 3O9RA 2F8TA 2Z1HA 4CGDA 4K8ZA 4CZMA 1T7PA 3ZX0A 4JD2B 1S1VA 3VMFB 4QS8A 3HZ6A 3DLBA 2VG5A 5DK5A 3CCEN 4J2AA 4YFUA 1VRTA 4ELVA 4DU1A 4B9LA 4FCYA 3ZT4A 4Z4HA 3NF8A 2YNIA 3FZKA 4Z4IA 3NFAA 2GELA 4CK1A 2OPRA 3UKRA 3O9TA 2E1ZA 3DM2A 4QAGA 3QINA 3HBTA 3S3MA 5EXWA 1TKTA 1WBDA 3NMUA 4CFAA 1OH5A 3SMPA 4G9ZA 3SAGA 3J8AA 3BF3A 4E7KA 3DLLL 1ASWA 3K5NA 4B9NA 5AQPA 4YOWA 4BRAA 4CJPA 4KTQA 3THWB 4K0KK 5C24A 4CJVA 2OANA 3NGIA 3V9SA 4CJ5A 3TANA 1NMNA 2XY7A 3CETA 4YOVA 3P4IA 3L2VA 3TARA 4Y0WA 4NCBA 1HQUA 1VSKA 1VQPN 3ZCMA 1NKEA 5AJ3K 5JLHA 4JD2A 4X64K 1IG9A 4CFDA 1WSFA 1B92A 1TK0A 5C25A 3OYFA 3HM9A 2O4GA 4CW7B 4JI4K 1CLQA 1C0FA 4JLHA 2J4RA 4M45A 3BGRA 2G8FA 5DM6L 3AARA 3KK3A 4F3OA 4FJLA 2IGIA 4AHTA 3WQUA 4BR9A 4DLEA 3F9MA 3E9LA 3CI5A 3SYZA 3HPOA 5AQMA 3SUOA 1NGCA 3PUFA 4QOZB 4B3MK 2KZMA 4LFCK 1NNEA 3LM9A 1VAZA 2VGMA 1P90A 4CJUA 4DTRA 2BGGA 2HNZA 3ZSVA 2FBYA 3TSQA 2G8IA 1KXPA 5C0YA 5AQFA 4RW9A 4CJLA 4JKAA 1GLBG 4BRQA 5HRRA 3O4WA 1C0GA 5C42A 3VQ6A 1RT5A 5GIOA 4DV0K 2F8SA 3AO1A 3SNNA 3VA0A 3PX6A 1NGIA 3OS2A 4WQ4C 4IOAL 3EE9A 4B8AB 3O9SA 2IVOA 3SMSA 3OTOK 4NCGA 1JCGA 1Q81O 2QWLA 5M1FA 5BRFA 3O08A 4B3RK 1O1WA 2G8WA 2HMPA 4XH1A 3C6HA 2O8BA 3V1RA 2O8DA 4CJ3A 3RTVA 5LL6Z 2WC9A 3IMXA 3P31A 2VQEK 5TKWA 2E5LK 3AGRA 3HM8A 4FJXA 4IOXA 5J2QA 2Q31A 2RN2A 4RG8A 5HP1A 1XC9A 4DSEA 3IG1A 5AQNA 4FL9A 2BH1A 2F7TA 3O8MA 3VEVA 1KC8O 2BANA 4DV3K 4CGIA 3V1QA 4FW2A 1HJOA 2OPSA 2ETJA 4FPAA 5LJVA 2HHVA 3CQXA 4XH5A 4M3ZA 3K58A 3OA9A 3CERA 3NF7A 3NBPA 4DB3A 4Y1DA 1RBTA 4U67L 4DSFA 4KV8A 1TL3A 4HTLA 4CJFA 3DOLA 2E6LA 4I2QA 1QQOA 5SZTA 3C94A 1EWRA 5D3GA 2W41A 2E2NA 1ASVA 4RW4A 4B9MA 3C0BA 2OZMA 3WNHA 3WXKA 4DR5K 2HBMA 3FFKB 4PA1A 1YF5L 4OGCA 3WQTA 3KLFA 3SK3A 1QQMA 3KD1E 3J7YP 4BRGA 4NCAA 3K59A 2ZD1A 2Q0UA 1EP4A 4EHTA 4DTXA 4K43A 1BA1A 2FSKA 3LAKA 4IWVA 2Y1IA 1YUWA 3OYKA 3O3GA 2Z1GA 3AVKA 5FDLA 3F2KA 1VQ5N 3KLEA 3FE1A 3MEGA 3KLHA 3CFRA 3DRPA 2P9KB 4H0VB 4BC3A 5TKYA 1NG9A 3KVGA 3V9XA 4EHUA 1GLEG 1JLEA 2GX9A 2QWRA 4H0XB 3W0LA 2JWLA 2D0CA 3Q7CA 1G99A 1Q8IA 1YI2N 1ATRA 1IKVA 4CJEA 1JXEA 5J2NA 1JCFA 1S9GA 4O5BA 1UAXA 1ZBUA 3KLGA 3GE1A 4LF5K 2A40A 4A2AA 4WQ5A 1H1VA 1VQLN 1J6ZA 1ASUA 3MXIA 1WSJA 4DG1A 3B6PA 1SQKA 4B3TK 3CYMA 3ZX3A 1NJZA 4B1ZA 4M3UA 2FF6A 4CHZA 4EFHA 4CHQA 4FLYA 2FF3B 2HMIA 5AFUH 5EOYA 4AHRA 2F4VK 5AQTA 5GINA 3VQPA 4DFJA 1HNWK 1J5EK 2VG7A 2V51B 2YNFA 1C6VA 2DPNA 3BEXA 1S1TA 3ULDA 5J1EA 3TAMA 4CF0A 3EKUA 4ID1A 4JS4A 4FK2A 5HL7L 3THYB 1U47A 2F9TA 1J5OA 1Q7YO 3OYMA 3TSUA 2EX3A 3SBGA 4CEQA 2P9KA 3L2WA 4CZIA 1B9DA 3O3FA 1HLUA 3O1BA 2LSNA 4JK8A 4FJKA 3MWPA 2HHXA 3QB0A 1ZC6A 3EYZA 4MLEA 4M3YA 1Z6RA 1WUAA 2CH5A 3NH2A 1EXQA 2XHBA 4DV5K 3HT3A 2X6SA 2PY5A 1ZXOA 1TK5A 4K41A 4JN4A 5LMUK 3SBTA 4Z4FA 4DU4A 2ASOA 4FVUA 2YKNA 4DTOA 1HYVA 1RTDA 3UB5A 3VOVA 3KK7A 4F2RA 4RTFD 3SZ2A 2D5RA 4IOCL 3CF5L 4PQUA 3E9OA 5AQSA 1RT4A 1BIZA 2O8CB 1Z25A 3THYA 1FJGK 4FWKA 3B6OA 3CQ8A 4PKGA 3J7ZO 2FC0A 4MO5A 4WFAL 4MDBA 3C95A 3AVBA 4WF9L 4CZEA 4R79A 3H1VX 4E7LA 2EWSA 2HHWA 3OYCA 3T7ZA 1S5JA 3TTFA 1GOCA 3BY5A 4IFVA 4O55A 4IG0A 4ZTJA 1DT9A 5E41A 4FJ7A 2D0BA 4DKWA 1LAVA 2NNWA 4DR4K 3SQ0A 5KQ8A 4CJQA 4HCCA 1VQ6N 5M1QA 1LCUA 3J81O 3DXMB 5KGWA 4LH5A 2Y1JA 1XC3A 3ZYYX 2DY4A 1IV0A 5AQRA 4MO4A 3VN5A 4H5RA 3HSCA 4GKKK 2QWMA 3LP3A 4CERA 3I55N 5IT9O 4IZ9A 1D9FA 1OH8A 2XY8A 3C6TA 4WYBA 3AVIA 4CHNA 1GLJO 3E66A 4E1MA 1WB9A 3OY9A 3T19A 4FK0A 1IG8A 3JXUA 5KI6A 2A5XA 2HBKA 5KRTA 2QWQA 3O80A 1VHXA 2OPPA 2CH6A 2O8CA 3VQ4A 4AH9A 4EZ6A 4KH5A 4LF6K 4PY5A 1NK5A 4C1NI 2P5GA 1MA9B 4ELUA 1BCOA 1BOTO 1J54A 3SV3A 1JJ2M 1Q18A 5FRMA 1VK0A 3QEIA 4GV3A 5H1SQ 1NGEA 4FJ5A 4CHPA 3VEWA 2A1RA 1JLCA 3VEOA 1RT6A 3BUZB 3D2FA 4OJRA 4BQLA 1S1XA 4BR2A 1BI4B 2P9NB 3H45C 4KH6A 4IJNA 3OYGA 1IKXA 3DXMA 3K57A 3J80O 3OYLA 2ZGZA 1RBSA 3I8DA 4O8UA 1NMDA 4PKHA 1M1KO 1C1AA 1L5UA 2UUCK 2HHSA 3C6UA 1GLAG 3ITHA 1Q86O 5DM7L 3KK1A 1BUPA 3PV8A 4KI4A 1JCEA 3RSEB 3WEEA 2QA4N 5HRPA 1E3MA 1R0AA 5AQZA 2NRRA 3MEEA 3ENBA 3DLHA 1ZYQA 4RW8A 1G15A 3ASMA 3VQEA 3DAWA 1T44A 3IRXA 4UQGA 2I5JA 4F4KA 2BE2A 4B08A 4DWIA 4B9UA 3GG4A 4KFBA 4KPYA 3CPEA 1HUXA 1NGFA 5LJWA 3UE5A 2JGUA 4YOTA 1BI4A 2P9NA 1NJYA 2Q3SA 5ADXH 2X74A 3MECA 3WNFA 3NH1A 2Q2RA 1C1CA 1QZ6A 3CJ7A 3VESA 4B3SK 3CMEN 2QXLA 4E0DA 1YAGA 4DF8A 3OHRA 3N4QA 4J2DA 4NLCA 4E19A 1NK9A 1NU0A 1VRUA 5I9EB 4O5FA 2HVHA 1RTHA 2QI2A 3W3DA 4Z94A 3RSEA 1C1BA 5AQOA 1TVRA 4OPAA 4JAXA 4KTZA 5BRHA 3I56N 4ZTFA 1JLQA 4KHYA 1FKOA 3SAFA 4FZZA 2A41A 4FYDA 1MWKA 4BC5A 3SUPA 3KKRA 5EVZA 1IH7A 4H4MA 5GAHP 5KGXA 2YHAA 5F2RA 3CJBA 1WAJA 1RBVA 4C23A 2IC3A 4B1YB 3A8YA 3KHYA 4CZLA 3AVMA 3RMDA 1TV6A 3K2PA 4MLHA 1WN7A 3ID6A 3LDNA 3AO2A 5AQQA 3HO1A 5ELZA 2RPIA 4PL8A 3L3VA 4N76A 1NGDA 1TKZA 3ZSWA 4HWIA 5KRSA 3AY9A 4RW7A 3CCVN 5JLFA 3SAHA 4LF4K 1SKWA 4H5NA 3QEWA 1RCHA 1HKGA 1VSDA 3D45A 4N56A 3PIPL 5J2PA 3VQ7A 2HB5A 3HSTB 1IKWA 3FGUA 5E26A 3U8XA 4HVJA 3DXKA 1D4XA 1S1WA 1IBKK 1NK7A 2IAJA 4F8RA 1T3VA 3T1YK 3TAEA 3EEQA 3LP2A 4YDUC 3C65A 4A57A 1K6YA 1LWFA 4YY3K 4E7JA 4GW6A 2H3GX 3IUCA 4CZKA 3BF1A 1WSEA 3CIPA 3PY8A 2HHUA 2DTUA 3GBTA 3NHGA 5A2QO 3CCRN 2P9LB 3KK2A 5AZIB 3ZT3A 3CJCA 1K73O 5KQDA 3VQ8A 4CBXA 1R59O 4E1JA 3IKMA 1DTTA 2YJFA 1VSIA 4A61A 2ZJQL 2ZJRL 4JI5K 2AJQA 3CM6A 4DTNA 3HVRA 1N33K 2XY5A 3ZLJA 4L8RB 3KWGA 1VQMN 4DSIA 4CJTA 4DV1K 2O8BB 5LMNK 3ATUA 1HPMA 2HNDA 1X1PA 2PZSA 2F9WA 2O8DB 3MEDA 4H0TB 4BC4A 5I42A 1SKSA 4I6MB 2DFHA 1TGOA 4JS5A 4Y1CA 4BGAA 3BZCA 4IFYA 3ZSYA 3MK6A 1SZ2A 3DI6A 5AQLA 3IFRA 3PSFA 4K42A 3TAQA 1HKCA 4JRQA 4DTPA 2ZWHA 1NOZA 1GLLO 4JKGB 5M1OA 4M3XA 3FZMA 2OYQA 4CFBA 3TABA 4DR1K 4FOEA 4B9QA 5CE3A 3EY1A 3V4IA 4A2BA 2KFZA 1OVYA 5AQWA 2PFUA 3OVNA 4KKOA 4CJWA 3AVHA 3AVLA 3I0RA 1KSPA 1NKCA 4MFBA 1HYZA 1VQ9N 2D4WA 1D9DA 2P9LA 3JSMA 5AZIA 4Q0BA 2KQ2A 3C6AA 2NRXA 1QSLA 4YHHK 3A5LC 4KHUA 2PAVA 5JVHL 3HPGA 1X9WA 4E3SA 4HCBA 3SUQA 1HQEA 4CBWA 1T6CA 2G8HA 3G0ZA 3NAEA 1JLGA 4BACA 4RW6A 2D0AA 2NRHA 2P9SB 3SI6A 3EO3A 3LL3A 4FOIA 1KQSM 4ISGA 5FPEA 3K0SA 3S3NA 3ZT0A 4CESA 5AQIA 3H1QA 4DS5A 4I6MA 4DV6K 1SAZA 2YHXA 5AZJB 1QHAA 1TYQB 4F3TA 2WONA 4HHTA 4FLVA 1Z05A 4OLAA 4OKKA 4F2SA 4JKGA 4H0OA 2KTQA 4QS9A 3I33A 1KLNA 4LH4A 2QWPA 1YIJN 3TTDA 4BGBA 1WSIA 1GLCG 3E9PA 1QTMA 4FJGA 2I7NA 3ALYA 4CIEA 2V7ZA 1KAYA 2YHYA 4DR7K 3CCLN 4WFBL 4BDYA 4CGJA 3U4LA 1U2VA 3PIOL 1S22A 3ATVA 4CD1A 3AA5X 3TSPA 5KTQA 3M8QA 4EP4A 4I2PA 3K9KA 3QIOA 4Z4CA 4KTWA 2P9SA 1XWLA 3L6QA 4CE9A 5B8HA 3AAPA 3P39A 3K5LA 2D0OA 4IKFA 3T3FA 4CFCA 4X66K 3TAGA 4BREA 2ZQBA 3ENOA 4Q5VA 3E1YA 1BQMA 5AZJA 4FLWA 3DLGA 4JKHA 5GAGP 1TYQA 2UXCK 1RNHA 2UUBK 2W42A 5HOOA 4RWTA 1QSYA 1HX1A 2HF3A 3HK2A 1CXUA 4AM6A 4DQIA 3MXJA 4QCLA 5FLXO 4F9OA 4CEDA 3R8EA 2GUPA 5FPDA 3TAFA 1VQON 1TAUA 2RF2A 3HRGA 4FWOA 5CY4A 3U9DA 5CHIA 3CG7A 1UWBA 4O8KA 5J2MA 1UA0A 2XY6A 1LWEA 3VQBA 4DFMA 1T05A 4LY7A 1UA1A 3V1OA 1HKBA 4DQQA 1QVGM 2KKZA 4DSJA 3RMCA 1OKJA 4BE2A 3VGLA 4QS7A 4CF1A 3FZFA 3OYHA 2FBTA 3AA2A 5K14A 4KAZA 3VEXA 1ATNA 1DLOA 3V81A 3D6RA 3DLEA 4ICLA 4BWMA 3CCUN 5M1NA 3L3UA 4CK3A 2QXFA 3FLCO 4IO8A 4CEFA 4XEIA 1L3UA 2CGJA 2NRWA 1DTQA 3GL1A 4DV4K 1C0MA 1ZBSA 5C2FA 1KD1O 5EY4A 4IXCA 3DLKA 3VERA 3QERA 2GWKA 5BRDA 1LW2A 2ZE2A 5AQKA 2QW9A 4C8MA 1C0UA 4PHTX 3KJVA 4FZXC 4C8OA 3LDLA 4EIAA 3B8AX 1YVNA 3I8BA 3JAMO 3M3ZA 3UIQA 1VQNN 3TTCA 4M3TA 3AVJA 3SCXA 3T1HK 1K8KA 3CC7N 3LAMA 1M90O 3PO5A 2FBVA 1NK4A 4DHYA 1N5YA 3NF6A 1ESVA 5KPZA 3OYNA 3AVGA 4I9LA 4FSVA 4FWPA 4B1VA 2G8VA 4EAHD 1BCMA 1QHTA 3O1WA 4DMNA 4DQRA 2UXDK 2A3ZA 2HF4A 3KTQA 4DQPA 4OPJA 4FJ8A 2E8AA 4AHUA 4FJMA 4FM0A 4LFBK
chains in the Genus database with same CATH topology
2AA4A 3FZKA 5JICA 2GELA 1CZAN 3HOTA 4NLBA 4U7BA 4GV9A 3UKRA 3O9TA 2E1ZA 1K8AO 1GLAG 3GDQA 3MN5A 4M7XA 3HBTA 1Q86O 3QBXA 2NZTA 4BG9A 5DM7L 1BUPA 5EXWA 3NMUA 3R3LA 1JCEA 3RSEB 3WEEA 3SMPA 4G9ZA 2QA4N 2I7PA 3LDOA 2D1KA 3SAGA 3J8AA 5AQZA 2NRRA 3CPWM 3ENBA 3BF3A 5JMVA 3RVCA 2HSTA 3DLLL 3M1FA 5AQPA 4YOXA 4YOWA 1DGKN 4BRAA 3KWIA 4FWMA 3DAWA 2HOEA 2ASMA 1T44A 4JKFA 2OANA 3AGKA 1QVFM 4B1XB 2E2PA 4JKEA 2ZGYA 4IO9L 3CETA 4YOVA 4IFEA 3GG4A 3P4IA 3WXJA 4Y0WA 3CPEA 3L4QA 4BRIA 1HUXA 1NGFA 3SJHA 2QEXN 3EZWA 5LJWA 1VQPN 4BR5A 1ATSA 3UE5A 5JLHA 4JD2A 4YOTA 2P9NA 3PLAA 4ILJA 5ADXH 3EE8A 4FWRA 3CJ1A 3CJ9A 4XH4A 3D2FB 1K8KB 1C0FA 2Q2RA 2J4RA 3H3NO 3QFPA 1QZ6A 3CJ7A 3ZETA 3VESA 5DM6L 3CMEN 2QXLA 3AARA 5AQJA 3O5BA 1YAGA 3OHRA 3N4QA 4NB4A 4NLCA 3WQUA 4KBOA 4BR9A 1YJNN 3F9MA 3E9LA 3CI5A 3QFUA 5I9EB 4O5FA 5AQMA 3NVKA 3A0IX 1S3XA 1NGCA 4BR0A 4RCHA 3A5OC 3M6GA 3VGKA 4AF1A 2QI2A 3W3DA 3WUHA 3CQYA 4BRLA 4Z94A 3RSEA 3LM9A 3LDQA 4FWNA 3CC2N 4CZHA 1VAZA 1GLFO 2VGMA 5AQOA 2AP1A 4OPAA 1P90A 2IIRA 1NGBA 4JAXA 2ASPA 4H0YB 1BA0A 3TSQA 5BRHA 2WUSA 3ULEB 1KXPA 2A6AA 3WEEB 3I56N 5AQFA 5C0YA 5JVGL 3SAFA 4JKAA 1GLBG 2A41A 4BRQA 1ILYA 1NWKA 3O4WA 1C0GA 4WCEL 1MWKA 4BC5A 5GIOA 1E4GT 2Q36A 1DKGD 1TUUA 5EVZA 4JEPA 3CCQN 1NGIA 4WQ4C 5GAHP 1NGGA 3D2EB 5F2RA 4IOAL 3CJBA 5AFUA 3EE9A 2VWBA 3TPQA 5M1KA 3O9SA 3S41A 3ZEUB 2NRZA 2IVOA 2YCHA 3SMSA 5M1PA 1X3NA 1SS6A 1IJJA 4B1WB 4C23A 5FPMA 5C12A 2V7YA 4FWSA 4A59A 4BQZA 3QBWA 3VPZA 4B1YB 1JCGA 3A8YA 3KHYA 4CZLA 2QWLA 5M1FA 4JKBA 5BRFA 1Q81O 3O08A 3H6EA 2RE2A 4MLHA 2HMPA 3ID6A 5AQUA 4ISEA 1KAXA 3O9QA 5AQGA 3LDNA 3OBYA 5AQQA 3U9ZA 2E2QA 5ELZA 4XH1A 3C6HA 4PL8A 1NGDA 2FSNA 5C2DA 2WFBA 4HWIA 5BR9A 3AY9A 3CCVN 5JLFA 3SAHA 1EQYA 2WC9A 3D7EO 4H5NA 5BPNA 3IMXA 3P31A 1HKGA 3KZBA 3AGRA 3HM8A 5TKWA 1BO5O 3PIPL 1DEJA 2V52B 4IOXA 2Q31A 3FR0A 3FGUA 5E26A 4BG8A 3U8XA 3MN7A 1P8ZA 3DXKA 1D4XA 5BPMA 3MX2A 5AQNA 3P38A 4FL9A 2BH1A 1YXQA 2F7TA 3O8MA 3VEVA 4BC2A 2HBLA 4M63C 3HI0A 1T3VA 4BROA 1KC8O 2YI1A 3ULEA 1Y64A 2P9UB 2QWNA 4J8FA 5KPTA 5LY3A 2A42A 1TUYA 4YDUC 1HJOA 4FPAA 3C65A 5C15A 4A57A 5LJVA 5E84A 3CQXA 4XH5A 4BY9C 4H5WA 2H3GX 3OA9A 3CERA 3N4PA 4DB3A 3IUCA 4CZKA 4U67L 3BF1A 1BU6O 1NGAA 2JWKA 3D2EA 4L3QA 4HTLA 3HOSA 3TU5A 3CIPA 3A5MC 2VGNA 3GBTA 1V4SA 3ZEUA 1QQOA 3CCRN 2BTFA 2P9LB 5GADP 2IVNA 5AZIB 3VGMA 3CJCA 3VETA 1BWFO 2W41A 2E2NA 4AM7A 2D0PA 3JS6A 4DCHA 1K73O 5KQDA 4CI6A 2E2OA 4CBXA 3C0BA 3VF4A 4BRNA 1R59O 4E1JA 2E88A 4ILGB 3UKUB 3IKMA 4IJAA 3WXKA 2CGLA 4JK9A 2HBMA 4YDUA 2ZJQL 2YJFA 4A61A 3FFKB 2PBDA 3G4SN 2ZJRL 3VTHA 1YF5L 3ZX2A 3WQTA 3T69A 3SK3A 1QQMA 3EKSA 3MN9A 5BN9A 4BRGA 1W97L 3VEZA 3MCPA 2Q0UA 5EX5A 4EHTA 3KWGA 1VQMN 4K43A 1BA1A 1YJ9N 4KH4A 2FSKA 3WXLA 4IWVA 3ATUA 1HPMA 1YUWA 2YJEA 5AR0A 2F9WA 4H0TB 4BC4A 4I6MB 4WQ5C 3F2KA 1VQ5N 4MDAA 3FE1A 2FLOA 3DJCA 3ID8A 3MMVA 3H3OB 4BGAA 1NJIO 1BG3A 2P9KB 1SZ2A 3CJAA 3MK6A 4H0VB 5TKYA 4BC3A 5AQLA 4H5TA 2NRTA 4CZGA 3IFRA 2YHWA 3KVGA 4K42A 1HKCA 4ISFA 3DXKB 1NM1A 3DWLA 4EHUA 2QM1A 1GLEG 2ZWHA 1GLLO 2QWRA 2GX9A 2P9UA 3QMLA 3FZMA 4H0XB 4JKGB 5M1OA 2JWLA 3Q7CA 3W0LA 1G99A 4BRCA 1YJWN 1YI2N 4A62A 4FOEA 4B9QA 4YORA 5CE3A 1Q82O 1ATRA 4A2BA 1OVYA 3MDQA 3WXIA 4JHDB 5AQWA 2PFUA 1JCFA 3FZLA 3EN9A 3MX5A 3NVMA 3OW2M 3GE1A 2A40A 3GOIA 4A2AA 4WQ5A 1VQ9N 2GEMA 2D4WA 4H03B 1H1VA 3A5NC 1VQLN 1J6ZA 2FSJA 2E1YA 2P9LA 4CD3A 3C7NB 5AZIA 1SQKA 4K25A 4GNIA 4BRKA 3C6AA 5GIPA 5AQYA 2NRXA 3ZX3A 3A5LC 4B1ZA 2PAVA 5JVHL 2FF6A 4EFHA 3UKUA 1K9MO 2FF3B 5AQVA 3VTIA 3SLCA 1VQ8N 5AFUH 5EOYA 4CBWA 1T6CA 3CHWA 5AQTA 5GINA 3CCJN 2VYPA 3FZHA 4IEEA 4BRHA 3O6WA 2NRHA 2P9SB 2V51B 3EO3A 5CR4A 2VCPA 2DPNA 3BEXA 3LL3A 4FOIA 1KQSM 4ISGA 1U6ZA 5FPEA 3CCSN 4FO0A 3K9JA 5AQIA 3EKUA 3H1QA 4PKIA 4WQ4A 5HL7L 2F9TA 4I6MA 1Q7YO 1KAZA 1SAZA 3TSUA 2YHXA 5AZJB 1QHAA 3SBGA 3HTVA 2P9KA 4CZFA 4CZIA 1TYQB 2ZF5O 1Z05A 3EL2A 5AQXA 4A5BA 3BP8A 1W2BM 5KPRA 1LOTB 2Q97A 4FWQA 1HLUA 3O1BA 4JK8A 4JKGA 4H0OA 2E20A 4JK7A 3MWPA 4QS9A 1YHQN 3I33A 3OBWA 5GAEP 3QB0A 1S72N 3G6EN 1ZC6A 3VENA 3H46O 4NO7A 2QWPA 2FXUA 4MLEA 4GVEA 2P9IB 4JHDA 1YIJN 1V4TA 3TTDA 2OTJN 4BGBA 1GLDG 1Z6RA 1WUAA 2YX6A 1GLCG 3E9PA 4LC9B 2CH5A 3QICA 5BREA 1N8RO 3R6MA 2HBJA 4DQ8A 2I7NA 4PL7A 1E4FT 1RDWX 1KAYA 2CGKA 2P9PB 2V7ZA 2YHYA 3C7NA 4YOYA 3CCLN 1X9JA 1ZXOA 4WFBL 5BN8A 3CXCM 3VEYA 4K41A 4JN4A 2KLAA 1EO1A 3U4LA 1U2VA 3SBTA 3PIOL 2ASOA 1S22A 3ATVA 4FVUA 1QQNA 4FPBA 4CD1A 1MWMA 3CMAN 3TSPA 5MLCQ 3UB5A 2IVPA 3VOVA 2WBNA 3L4IA 3K9KA 4CZJA 3KK7A 4CBUA 4UY8O 3CCMN 2UYTA 3ENHA 4RTFD 3MWTA 4H5VA 2ITMA 4IOCL 2P9SA 3L6QA 3CF5L 1XUPO 3VF2A 5B8HA 3AAPA 3E9OA 3P39A 4H0PA 4IDHA 5AQSA 2D0OA 1QZ5A 2QWOA 4YOUA 3M5RA 4JNEA 4BREA 4A5AA 3ENOA 3WXMB 3E1YA 3CD6N 4FWKA 4PKGA 3J7ZO 4MO5A 5AZJA 4WFAL 4MDBA 4JKHA 4WF9L 4BVPA 4CZEA 1TYQA 3H1VX 5GAGP 4R79A 2EWSA 3LM2A 4BRDA 5ADXA 4B1UB 5HOOA 3G71N 4M7YA 3T7ZA 3TTFA 1HX1A 2HF3A 4GY2B 4RWTA 2RHKA 3Q7BA 5BPLA 3G25A 4AM6A 2GTDA 1DT9A 4JKDA 4DKWA 4F9OA 2ZJPL 2OTLN 3R8EA 2GUPA 2NNWA 2P9IA 1RDUA 5FPDA 1VQON 5KQ8A 3VF6A 4OO1J 2W40A 1VQ6N 4ILHA 3HRGA 5M1QA 1LCUA 3MCAB 4FWOA 3DXMB 3U9DA 5CHIA 4O8KA 1XC3A 3ZYYX 2Q0RA 4BR7A 2P9PA 1VQKN 5AQRA 2BUPA 4MO4A 4WFNL 4H5RA 3HSCA 2QWMA 3I55N 4BRMA 4GV6A 1HKBA 1QVGM 4IZ9A 4JKCA 5F1XA 2KKZA 4FWLA 3O9UA 4WYBA 3UKRB 1OKJA 3VGLA 1GLJO 3E66A 4QS7A 1U2VB 1WOQA 3FZFA 3CC4N 3VEXA 3WT0A 1ATNA 2KHOA 1IG8A 3D6RA 3JXUA 3CCUN 3QDKA 5M1NA 2A5XA 4BRPA 4C1NK 1YITN 5F0XA 2HBKA 3FLCO 1RGIA 4IO8A 5C10A 2GWJA 2NLXA 2QWQA 4XEIA 3O80A 1NBWA 2CGJA 2CH6A 2NRWA 2QTDA 3GL1A 4CJ7A 1VQ7N 3AAQA 4KH5A 5C2FA 1ZBSA 1KD1O 5AQHA 5EY4A 4C1NI 4BVOA 4IXCA 1NGJA 1MA9B 1NLVA 1NGHA 3VERA 2NRVA 3F5TA 5FPNA 1BOTO 1JJ2M 2GWKA 1Q18A 1T6DA 3LDPA 5BRDA 3MN6A 4GV3A 5H1SQ 3IDHA 1NGEA 1XQSC 2QW9A 1X3MA 3L0QA 5AQKA 1MDUB 4PHTX 2Q1NA 4BRFA 4BR4A 3VEWA 3O9RA 3LDLA 4EIAA 3B8AX 1YVNA 3I8BA 3VEOA 3M3ZA 4IEIA 1VQNN 1RFQA 3R1XA 3BUZB 4CZMA 3TTCA 3ZX0A 3D2FA 1K8KA 3CC7N 4BQLA 4JD2B 4BR2A 1M90O 3VMFB 2P9NB 4QS8A 3H45C 4OPHA 3HZ6A 4KH6A 4DHYA 5KPZA 1ESVA 4IJNA 3CCEN 3DXMA 4FSVA 4FWPA 4B1VA 4EAHD 3O1WA 3R9PA 3ZETB 2ZGZA 1O13A 2A3ZA 1BDGA 2HF4A 4O8UA 1VQ4N 1NMDA 2E8AA 4PKHA 1M1KO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CR4 A;  3F2K A;  5HOO A;  3K9K A;  2F7T A;  4MDA A;  3HOT A;  4MDB A;  4U7B A;  3HOS A;  3K9J A;  4R79 A; 
#chains in the Genus database with same CATH topology
 1JLA A;  4CIF A;  3PSI A;  3HOT A;  1TKX A;  1WBB A;  1K8A O;  3GDQ A;  3MN5 A;  4DR3 K;  3NF9 A;  1EX4 A;  1QS4 A;  3QBX A;  3OS1 A;  5BR8 K;  1U49 A;  1Z26 A;  1RDB A;  3LDO A;  4CGH A;  3LDS A;  1LWC A;  1GOA A;  3CPW M;  4KHP K;  4CF2 A;  3RVC A;  2HST A;  2RKI A;  1NJX A;  3KWI A;  1RT1 A;  3BDP A;  3CFP A;  4FWM A;  3ISN C;  3THV A;  4JKF A;  1EWQ A;  3AGK A;  1QVF M;  2YNG A;  4B1X B;  4JKE A;  2B5J A;  4KHQ A;  3WXJ A;  2VG6 A;  2X6N A;  4BRI A;  1SL0 A;  2G8K A;  2QEX N;  1I39 A;  3EZW A;  4BR5 A;  1N34 K;  3QES A;  5CYM A;  3LWM A;  2ITG A;  1RIL A;  4CF9 A;  4NYF A;  4GMJ B;  3EE8 A;  4FWR A;  3CJ1 A;  4XH4 A;  3D2F B;  1N32 K;  1BHL A;  3ZSO A;  3SUN A;  5JS1 A;  3O5B A;  4GVM A;  1MU2 A;  4NB4 A;  1YTA A;  1YJN N;  4PUO A;  2GBZ A;  1C0T A;  3QFU A;  2ZM6 K;  3NVK A;  3TR8 A;  4BR0 A;  3A5O C;  3M6G A;  3VGK A;  3NH0 A;  3WUH A;  3CQY A;  3O4N A;  3LDQ A;  1GLF O;  2AP1 A;  4CJK A;  2IIR A;  1NGB A;  2ASP A;  4H0Y B;  3RRH A;  1BA0 A;  3M8P A;  2WUS A;  2A6A A;  3WEE B;  5JVG L;  2UU9 K;  2O8F A;  3QET A;  4CJS A;  1ILY A;  4DUZ K;  4B3O A;  4BE0 A;  4WCE L;  1VSL A;  1I3A A;  2OA8 A;  3DMJ A;  1NGG A;  3D2E B;  2VWB A;  3TPQ A;  3S41 A;  3ZEU B;  3IAY A;  5M1P A;  1SS6 A;  4CF8 A;  1IKY A;  1S6P A;  5C12 A;  3QEP A;  2V7Y A;  4A59 A;  4BQZ A;  3QBW A;  3VPZ A;  1W0H A;  2B4J A;  1RDD A;  3QLH A;  4DR6 K;  3H6E A;  3OYI A;  1U48 A;  1YT3 A;  5AQG A;  3O9Q A;  4R5P A;  1N6Q A;  2E2Q A;  3F73 A;  2PYL A;  4Z4G A;  5C2D A;  5BR9 A;  5I3U A;  3HJF A;  1A5W A;  4LSL A;  3NGZ A;  3VQ5 A;  1TK8 A;  1BO5 O;  4EP5 A;  3HP9 A;  4JI1 K;  1KFS A;  1P8Z A;  5BPM A;  4ELT A;  3SQ2 A;  1YXQ A;  4J2E A;  4BC2 A;  4ID5 A;  2HBL A;  4M63 C;  4CVN E;  1X9S A;  5CYQ A;  4DU3 A;  2YI1 A;  4DUY K;  3WNE A;  4J8F A;  5KPT A;  3ZSQ A;  2A42 A;  2OPQ A;  3SV4 A;  3AVC A;  5C15 A;  1NK6 A;  2WTU A;  4H5W A;  4DS4 A;  3D0P A;  3L8B A;  1WLJ A;  3D2E A;  4L3Q A;  3TU5 A;  3V9U A;  3A5M C;  3ZEU A;  3OYB A;  5GAD P;  3VET A;  1HNZ K;  4DCH A;  3JS6 A;  4KB1 A;  4CI6 A;  1X9M A;  2JLE A;  4O0J A;  2E88 A;  4ILG B;  3UKU B;  4IJA A;  2CGL A;  4JK9 A;  4YDU A;  2PBD A;  2YHB A;  3G4S N;  3ZX2 A;  4CEC A;  3T69 A;  1T8E A;  4C8K A;  3MN9 A;  5BN9 A;  1Y97 A;  1FW6 A;  3VEZ A;  3MCP A;  5EX5 A;  1YJ9 N;  4KH4 A;  3DRS A;  3WXL A;  3TAP A;  2YJE A;  1OVQ A;  4H8K A;  3HPH A;  2HHT A;  4E7H A;  4MDA A;  3DJC A;  3MMV A;  2DFF A;  3NE6 A;  1NOY A;  2Z1I A;  2O8E B;  4CZG A;  1KLM A;  4BE1 A;  1RTI A;  4AHC A;  3DXK B;  3DWL A;  3O4Q A;  2QM1 A;  4BRP A;  4BRC A;  1D8Y A;  4JI0 K;  4A62 A;  4FJJ A;  4YOR A;  2BDP A;  5HRN A;  3MDQ A;  3WXI A;  4JHD B;  1LV5 A;  4B9V A;  4FLX A;  3FZL A;  3MX5 A;  3NVM A;  3U3G A;  3OW2 M;  4W5Q A;  3WNG A;  4CEB A;  4FXD A;  4KB0 A;  4LD0 A;  4O0I A;  3QNN A;  4H03 B;  3A5N C;  1KCF A;  4E1N A;  4CD3 A;  4CGF A;  3C7N B;  4CJ4 A;  5GIP A;  4GKJ K;  3OYA A;  1K9M O;  3UKU A;  3OYJ A;  4CEZ A;  1VQ8 N;  4W5T A;  3CHW A;  4CEO A;  4NXM K;  3HP6 A;  4B9T A;  3O6W A;  1ZBL A;  2KW4 A;  4MQ3 A;  4AHS A;  5CR4 A;  2VCP A;  3MAQ A;  4IBN A;  1U6Z A;  3CCS N;  5SWM A;  4FO0 A;  1WSG A;  3K9J A;  4PKI A;  4WQ4 A;  1BL3 A;  1KAZ A;  3S9H A;  2O8E A;  4CZF A;  2IDO A;  2ZF5 O;  5DMR A;  5AQX A;  1W2B M;  3BP8 A;  5KPR A;  1LOT B;  4K8X A;  4DFK A;  4JK7 A;  1YHQ N;  4HUF A;  3MXM A;  3G6E N;  1J9A A;  1YVU A;  3H46 O;  2G8U A;  2FXU A;  4GVE A;  4JHD A;  4N41 A;  4EZ9 A;  2YX6 A;  1CZB A;  1N8R O;  3QIC A;  1S6Q A;  3R6M A;  2HBJ A;  1XMO K;  2YNH A;  4PL7 A;  4DSK A;  1RDW X;  2CGK A;  3C7N A;  1ZBI A;  2HW3 A;  5BN8 A;  3CXC M;  3VEY A;  4LF8 K;  1BQN A;  2KLA A;  3P83 D;  4CCH A;  2OCE A;  1FKP A;  5HRS A;  4DR2 K;  1QQN A;  4FPB A;  1MWM A;  5CZ1 A;  4W5O A;  3CMA N;  3ZSX A;  5MLC Q;  3PX4 A;  2IVP A;  2WBN A;  3VQA A;  3L4I A;  4OKE A;  5HLF A;  3ENH A;  4X65 K;  4H5V A;  4CGG A;  2ITM A;  4NXN K;  3NGY A;  1XUP O;  3VF2 A;  4H0P A;  5HRO A;  1RDC A;  4YOU A;  3QIP A;  3WXM B;  3CD6 N;  3LPU A;  1L3V A;  3LM2 A;  3LWL A;  4B1U B;  3G71 N;  1WAF A;  2RHK A;  4OVL A;  3Q7B A;  4G1Q A;  1L3S A;  3G25 A;  3JYT A;  2E6M A;  2ZJP L;  2OTL N;  4BDZ A;  1RDU A;  1RDA A;  3VF6 A;  2W40 A;  4ILH A;  3MCA B;  1XNR K;  3T1A A;  4KRF A;  1U04 A;  2Q0R A;  3RR7 A;  2P1J A;  2BUP A;  1NK8 A;  3AVA A;  4O44 A;  4BRM A;  4JKC A;  5F1X A;  4FWL A;  4KHN A;  4DFP A;  2QK9 A;  1JLF A;  1U2V B;  1WOQ A;  2O4I A;  4DV2 K;  3CC4 N;  4IG3 A;  3WT0 A;  2KHO A;  3THW A;  3DRR A;  4CIG A;  4C1N K;  1KVA A;  5F0X A;  1YIT N;  5C10 A;  3I0S A;  2GWJ A;  1Q9Y A;  2NLX A;  2P51 A;  2QTD A;  4M42 A;  4CJ7 A;  1WNS A;  3LP0 A;  5AQH A;  4DTU A;  3HVT A;  1NLV A;  3HYF A;  2NRV A;  3F5T A;  1RBU A;  4OPK A;  4ZHR A;  1JL1 A;  4TSX A;  3IDH A;  3L0Q A;  3O3H A;  1JXB A;  2GV9 A;  2Q1N A;  4BRF A;  4BR4 A;  1VSJ A;  2XRI A;  4IEI A;  1RFQ A;  3R1X A;  3LZJ A;  2UUA K;  3VQQ A;  5HBM A;  4I7F A;  4OPH A;  3IS9 A;  3V6D A;  4FJ9 A;  4Z0U A;  1SV5 A;  3QNO A;  3LZI A;  3R9P A;  3ZET B;  1O13 A;  2P5O A;  1BDG A;  1VQ4 N;  3OYD A;  4J2B A;  3F9K A;  4JI3 K;  4BDP A;  2AA4 A;  1VSE A;  5JIC A;  1BIS A;  4IDK A;  3RRG A;  1CZA N;  4NLB A;  4U7B A;  4GV9 A;  4WE1 A;  1YTU A;  1ZBH A;  4M7X A;  2NZT A;  3KKS A;  2YV0 X;  4BG9 A;  2Z1J A;  3LPT A;  3KLI A;  3R3L A;  4FVM A;  4JI2 K;  2I7P A;  2D1K A;  5JMV A;  4C8N A;  3M1F A;  4YOX A;  1HPZ A;  1DGK N;  1QE1 A;  2HOE A;  2ASM A;  5EU7 A;  2E2P A;  2ZGY A;  4FW1 A;  4IO9 L;  4CEA A;  4IFE A;  3AA4 A;  1RT2 A;  1LAW A;  3LAL A;  3L4Q A;  3P5J A;  3SJH A;  1XMQ K;  1ATS A;  3V9Z A;  4B9S A;  3PLA A;  4ILJ A;  1QSS A;  4FK4 A;  2QKK A;  3CJ9 A;  1VSF A;  1K8K B;  3H3N O;  3M8R A;  3QFP A;  3ZET A;  3KD5 E;  4FJH A;  4DTM A;  3PX0 A;  3AO3 A;  2VWJ A;  5AQJ A;  2PYJ A;  1S9E A;  5JS2 A;  4JYA K;  4CHY A;  1HRH A;  2OZS A;  4KBO A;  1J53 A;  3U6F A;  1IBM K;  3A0I X;  1S3X A;  3CM5 A;  4KHW A;  5T7B A;  4RCH A;  4AF1 A;  4FJN A;  1OH7 A;  4AQY K;  4BRL A;  3QEX A;  4FWN A;  3CC2 N;  4JI8 K;  4CZH A;  1TKD A;  2IOC A;  1NJW A;  3A2F A;  1IO2 A;  2XO7 A;  3ULE B;  3RMA A;  1KVB A;  1NWK A;  1U4B A;  1E4G T;  2Q36 A;  1DKG D;  1TUU A;  4BWJ A;  4JEP A;  3CCQ N;  5AFU A;  5M1K A;  3E01 A;  1SUQ A;  2NRZ A;  3OS0 A;  2YCH A;  1X3N A;  1IJJ A;  4B1W B;  5FPM A;  4FWS A;  3ZT2 A;  4OX9 K;  3AA3 A;  4JKB A;  1ZBF A;  2VQF K;  1RTJ A;  3VQC A;  2RE2 A;  4JV5 K;  1QQC A;  3VQ9 A;  3PO4 A;  5AQU A;  4ISE A;  1KAX A;  3AVN A;  4HUG A;  3OBY A;  3U9Z A;  4AHV A;  4HTU A;  1VSH A;  2FSN A;  2WFB A;  1EQY A;  3D7E O;  5BPN A;  1EET A;  3K5O A;  1RBR A;  3KZB A;  1BGX T;  1DEJ A;  2V52 B;  4N5S A;  3FR0 A;  1S1U A;  4BG8 A;  4FLZ A;  3DOK A;  3MN7 A;  3DLR A;  4DV7 K;  3SPZ A;  3MX2 A;  3P38 A;  3HI0 A;  1HJR A;  4BRO A;  3ULE A;  1XHZ A;  3FFI A;  4LFA K;  1Y64 A;  2P9U B;  2QWN A;  3P1G A;  5LY3 A;  4KHS A;  1EKE A;  1TUY A;  2A1S A;  1NKB A;  1U45 A;  5E84 A;  4BY9 C;  3AVF A;  4B8C A;  3N4P A;  3M8S A;  4DTJ A;  2O8F B;  1BU6 O;  1NGA A;  2JWK A;  3AO5 A;  2HHQ A;  3TWH A;  3HOS A;  2VGN A;  1V4S A;  3CFO A;  2BTF A;  2IVN A;  3VGM A;  1BWF O;  4AM7 A;  3EZ5 A;  2D0P A;  2E2O A;  1B9F A;  3VF4 A;  4BRN A;  1SL1 A;  3RR8 A;  1OH6 A;  1ITG A;  3AV9 A;  1A5V A;  3VTH A;  4I9Q A;  3EKS A;  1HMV A;  1FXX A;  4FJI A;  2B6A A;  1W97 L;  1BIU A;  4M3R A;  3U3Y A;  5AR0 A;  4DLG A;  4DTS A;  4JI7 K;  4E89 A;  4WQ5 C;  4CK2 A;  4LF9 K;  1I94 K;  2FLO A;  3ID8 A;  3H3O B;  1NJI O;  1BG3 A;  4KI6 A;  3CJA A;  3OJS A;  1REV A;  4H5T A;  2NRT A;  2EHG A;  2YHW A;  4ISF A;  1NM1 A;  2KFN A;  2P9U A;  3QML A;  3QO9 A;  1YJW N;  1KTQ A;  3L2U A;  1KRP A;  1Q82 O;  4W5R A;  3HL8 A;  3KIO A;  4XIU A;  3RWU A;  1F21 A;  3EN9 A;  3GOI A;  4DQS A;  1KFD A;  4KO0 A;  3RMB A;  2GEM A;  2X78 A;  2FSJ A;  2E1Y A;  3ZSZ A;  3G10 A;  5IWA K;  3V9W A;  2HVI A;  4K25 A;  4GNI A;  4BRK A;  2ATQ A;  1IBL K;  5AQY A;  5AQV A;  3VTI A;  3SLC A;  4FM1 A;  2GUI A;  3SQ4 A;  2R7Y A;  3CCJ N;  2VYP A;  3FZH A;  4IEE A;  4BRH A;  2NUB A;  2HNY A;  3QEV A;  2UXB K;  4DF4 A;  4Z4E A;  1XHX A;  3NCI A;  3THX B;  1TAQ A;  1HYS A;  3HTV A;  4FLT A;  3BZK A;  3EL2 A;  4A5B A;  1L3T A;  4FWQ A;  2Q97 A;  1XI1 A;  2E20 A;  1FK9 A;  3OBW A;  1S72 N;  5GAE P;  1N36 K;  2W6K A;  3VEN A;  4NO7 A;  3OJU A;  1D5A A;  2P9I B;  2OTJ N;  1V4T A;  2QKB A;  1GLD G;  3AO4 A;  1XNQ K;  4LC9 B;  3SJJ A;  5BRE A;  4DQ8 A;  4NYN A;  3SQ1 A;  4DSL A;  1HNV A;  1RT7 A;  3L2Q A;  1JL2 A;  1E4F T;  2P9P B;  4YOY A;  1X9J A;  1SKR A;  4O4G A;  1EO1 A;  1LW0 A;  4C8L A;  1KVC A;  4X62 K;  4OGE A;  4FM2 A;  4CZJ A;  1T03 A;  1UOC A;  4CBU A;  3S3O A;  4UY8 O;  1CZ9 A;  3CCM N;  1GOB A;  2UYT A;  3MWT A;  5FRO A;  4PWD A;  4YNQ A;  4IDH A;  5CZ2 A;  1QZ5 A;  2QWO A;  2W6L A;  3M5R A;  4JNE A;  1W9H A;  4A5A A;  4AIL C;  4CJR A;  4LF7 K;  3OYE A;  1Q9X A;  4N47 A;  1HR0 K;  3THX A;  1NK0 A;  1RT3 A;  4JI6 K;  4BVP A;  5ADX A;  2E4L A;  4BRD A;  4FLU A;  4M7Y A;  4GY2 B;  1W7A A;  5BPL A;  2F96 A;  2WOM A;  4M3W A;  3HXM A;  2GTD A;  2HHH K;  4HUE A;  4KRE A;  4JKD A;  4CHO A;  2IS3 A;  1HNI A;  2P9I A;  4H4O A;  2YKM A;  3LP1 A;  4OO1 J;  3J7A P;  3NDK A;  4OKJ A;  4E7I A;  4BR7 A;  1VQK N;  5FRN A;  3DYA A;  2P9P A;  1TL1 A;  1CXQ A;  3SPY A;  4WFN L;  4CEE A;  1JLB A;  3LAN A;  1HNX K;  2DFE A;  4GV6 A;  3K5M A;  2VWK A;  3O9U A;  3UKR B;  3TI0 A;  4W5N A;  3VA3 A;  2KZZ A;  4V19 S;  3QDK A;  1RGI A;  1WSH A;  1A5X A;  1NBW A;  2FBX A;  3L2R A;  4JRP A;  1VQ7 N;  3AAQ A;  4OLB A;  1SL2 A;  4LSN A;  1JKH A;  4BVO A;  1NGJ A;  1NGH A;  3VQD A;  5FPN A;  4M41 A;  4FZY A;  1T6D A;  3LDP A;  3MN6 A;  1VSM A;  1XQS C;  1X3M A;  3H08 A;  3ZSR A;  1MDU B;  3ZT1 A;  3O9R A;  2F8T A;  2Z1H A;  4CGD A;  4K8Z A;  4CZM A;  1T7P A;  3ZX0 A;  4JD2 B;  1S1V A;  3VMF B;  4QS8 A;  3HZ6 A;  3DLB A;  2VG5 A;  5DK5 A;  3CCE N;  4J2A A;  4YFU A;  1VRT A;  4ELV A;  4DU1 A;  4B9L A;  4FCY A;  3ZT4 A;  4Z4H A;  3NF8 A;  2YNI A;  3FZK A;  4Z4I A;  3NFA A;  2GEL A;  4CK1 A;  2OPR A;  3UKR A;  3O9T A;  2E1Z A;  3DM2 A;  4QAG A;  3QIN A;  3HBT A;  3S3M A;  5EXW A;  1TKT A;  1WBD A;  3NMU A;  4CFA A;  1OH5 A;  3SMP A;  4G9Z A;  3SAG A;  3J8A A;  3BF3 A;  4E7K A;  3DLL L;  1ASW A;  3K5N A;  4B9N A;  5AQP A;  4YOW A;  4BRA A;  4CJP A;  4KTQ A;  3THW B;  4K0K K;  5C24 A;  4CJV A;  2OAN A;  3NGI A;  3V9S A;  4CJ5 A;  3TAN A;  1NMN A;  2XY7 A;  3CET A;  4YOV A;  3P4I A;  3L2V A;  3TAR A;  4Y0W A;  4NCB A;  1HQU A;  1VSK A;  1VQP N;  3ZCM A;  1NKE A;  5AJ3 K;  5JLH A;  4JD2 A;  4X64 K;  1IG9 A;  4CFD A;  1WSF A;  1B92 A;  1TK0 A;  5C25 A;  3OYF A;  3HM9 A;  2O4G A;  4CW7 B;  4JI4 K;  1CLQ A;  1C0F A;  4JLH A;  2J4R A;  4M45 A;  3BGR A;  2G8F A;  5DM6 L;  3AAR A;  3KK3 A;  4F3O A;  4FJL A;  2IGI A;  4AHT A;  3WQU A;  4BR9 A;  4DLE A;  3F9M A;  3E9L A;  3CI5 A;  3SYZ A;  3HPO A;  5AQM A;  3SUO A;  1NGC A;  3PUF A;  4QOZ B;  4B3M K;  2KZM A;  4LFC K;  1NNE A;  3LM9 A;  1VAZ A;  2VGM A;  1P90 A;  4CJU A;  4DTR A;  2BGG A;  2HNZ A;  3ZSV A;  2FBY A;  3TSQ A;  2G8I A;  1KXP A;  5C0Y A;  5AQF A;  4RW9 A;  4CJL A;  4JKA A;  1GLB G;  4BRQ A;  5HRR A;  3O4W A;  1C0G A;  5C42 A;  3VQ6 A;  1RT5 A;  5GIO A;  4DV0 K;  2F8S A;  3AO1 A;  3SNN A;  3VA0 A;  3PX6 A;  1NGI A;  3OS2 A;  4WQ4 C;  4IOA L;  3EE9 A;  4B8A B;  3O9S A;  2IVO A;  3SMS A;  3OTO K;  4NCG A;  1JCG A;  1Q81 O;  2QWL A;  5M1F A;  5BRF A;  3O08 A;  4B3R K;  1O1W A;  2G8W A;  2HMP A;  4XH1 A;  3C6H A;  2O8B A;  3V1R A;  2O8D A;  4CJ3 A;  3RTV A;  5LL6 Z;  2WC9 A;  3IMX A;  3P31 A;  2VQE K;  5TKW A;  2E5L K;  3AGR A;  3HM8 A;  4FJX A;  4IOX A;  5J2Q A;  2Q31 A;  2RN2 A;  4RG8 A;  5HP1 A;  1XC9 A;  4DSE A;  3IG1 A;  5AQN A;  4FL9 A;  2BH1 A;  2F7T A;  3O8M A;  3VEV A;  1KC8 O;  2BAN A;  4DV3 K;  4CGI A;  3V1Q A;  4FW2 A;  1HJO A;  2OPS A;  2ETJ A;  4FPA A;  5LJV A;  2HHV A;  3CQX A;  4XH5 A;  4M3Z A;  3K58 A;  3OA9 A;  3CER A;  3NF7 A;  3NBP A;  4DB3 A;  4Y1D A;  1RBT A;  4U67 L;  4DSF A;  4KV8 A;  1TL3 A;  4HTL A;  4CJF A;  3DOL A;  2E6L A;  4I2Q A;  1QQO A;  5SZT A;  3C94 A;  1EWR A;  5D3G A;  2W41 A;  2E2N A;  1ASV A;  4RW4 A;  4B9M A;  3C0B A;  2OZM A;  3WNH A;  3WXK A;  4DR5 K;  2HBM A;  3FFK B;  4PA1 A;  1YF5 L;  4OGC A;  3WQT A;  3KLF A;  3SK3 A;  1QQM A;  3KD1 E;  3J7Y P;  4BRG A;  4NCA A;  3K59 A;  2ZD1 A;  2Q0U A;  1EP4 A;  4EHT A;  4DTX A;  4K43 A;  1BA1 A;  2FSK A;  3LAK A;  4IWV A;  2Y1I A;  1YUW A;  3OYK A;  3O3G A;  2Z1G A;  3AVK A;  5FDL A;  3F2K A;  1VQ5 N;  3KLE A;  3FE1 A;  3MEG A;  3KLH A;  3CFR A;  3DRP A;  2P9K B;  4H0V B;  4BC3 A;  5TKY A;  1NG9 A;  3KVG A;  3V9X A;  4EHU A;  1GLE G;  1JLE A;  2GX9 A;  2QWR A;  4H0X B;  3W0L A;  2JWL A;  2D0C A;  3Q7C A;  1G99 A;  1Q8I A;  1YI2 N;  1ATR A;  1IKV A;  4CJE A;  1JXE A;  5J2N A;  1JCF A;  1S9G A;  4O5B A;  1UAX A;  1ZBU A;  3KLG A;  3GE1 A;  4LF5 K;  2A40 A;  4A2A A;  4WQ5 A;  1H1V A;  1VQL N;  1J6Z A;  1ASU A;  3MXI A;  1WSJ A;  4DG1 A;  3B6P A;  1SQK A;  4B3T K;  3CYM A;  3ZX3 A;  1NJZ A;  4B1Z A;  4M3U A;  2FF6 A;  4CHZ A;  4EFH A;  4CHQ A;  4FLY A;  2FF3 B;  2HMI A;  5AFU H;  5EOY A;  4AHR A;  2F4V K;  5AQT A;  5GIN A;  3VQP A;  4DFJ A;  1HNW K;  1J5E K;  2VG7 A;  2V51 B;  2YNF A;  1C6V A;  2DPN A;  3BEX A;  1S1T A;  3ULD A;  5J1E A;  3TAM A;  4CF0 A;  3EKU A;  4ID1 A;  4JS4 A;  4FK2 A;  5HL7 L;  3THY B;  1U47 A;  2F9T A;  1J5O A;  1Q7Y O;  3OYM A;  3TSU A;  2EX3 A;  3SBG A;  4CEQ A;  2P9K A;  3L2W A;  4CZI A;  1B9D A;  3O3F A;  1HLU A;  3O1B A;  2LSN A;  4JK8 A;  4FJK A;  3MWP A;  2HHX A;  3QB0 A;  1ZC6 A;  3EYZ A;  4MLE A;  4M3Y A;  1Z6R A;  1WUA A;  2CH5 A;  3NH2 A;  1EXQ A;  2XHB A;  4DV5 K;  3HT3 A;  2X6S A;  2PY5 A;  1ZXO A;  1TK5 A;  4K41 A;  4JN4 A;  5LMU K;  3SBT A;  4Z4F A;  4DU4 A;  2ASO A;  4FVU A;  2YKN A;  4DTO A;  1HYV A;  1RTD A;  3UB5 A;  3VOV A;  3KK7 A;  4F2R A;  4RTF D;  3SZ2 A;  2D5R A;  4IOC L;  3CF5 L;  4PQU A;  3E9O A;  5AQS A;  1RT4 A;  1BIZ A;  2O8C B;  1Z25 A;  3THY A;  1FJG K;  4FWK A;  3B6O A;  3CQ8 A;  4PKG A;  3J7Z O;  2FC0 A;  4MO5 A;  4WFA L;  4MDB A;  3C95 A;  3AVB A;  4WF9 L;  4CZE A;  4R79 A;  3H1V X;  4E7L A;  2EWS A;  2HHW A;  3OYC A;  3T7Z A;  1S5J A;  3TTF A;  1GOC A;  3BY5 A;  4IFV A;  4O55 A;  4IG0 A;  4ZTJ A;  1DT9 A;  5E41 A;  4FJ7 A;  2D0B A;  4DKW A;  1LAV A;  2NNW A;  4DR4 K;  3SQ0 A;  5KQ8 A;  4CJQ A;  4HCC A;  1VQ6 N;  5M1Q A;  1LCU A;  3J81 O;  3DXM B;  5KGW A;  4LH5 A;  2Y1J A;  1XC3 A;  3ZYY X;  2DY4 A;  1IV0 A;  5AQR A;  4MO4 A;  3VN5 A;  4H5R A;  3HSC A;  4GKK K;  2QWM A;  3LP3 A;  4CER A;  3I55 N;  5IT9 O;  4IZ9 A;  1D9F A;  1OH8 A;  2XY8 A;  3C6T A;  4WYB A;  3AVI A;  4CHN A;  1GLJ O;  3E66 A;  4E1M A;  1WB9 A;  3OY9 A;  3T19 A;  4FK0 A;  1IG8 A;  3JXU A;  5KI6 A;  2A5X A;  2HBK A;  5KRT A;  2QWQ A;  3O80 A;  1VHX A;  2OPP A;  2CH6 A;  2O8C A;  3VQ4 A;  4AH9 A;  4EZ6 A;  4KH5 A;  4LF6 K;  4PY5 A;  1NK5 A;  4C1N I;  2P5G A;  1MA9 B;  4ELU A;  1BCO A;  1BOT O;  1J54 A;  3SV3 A;  1JJ2 M;  1Q18 A;  5FRM A;  1VK0 A;  3QEI A;  4GV3 A;  5H1S Q;  1NGE A;  4FJ5 A;  4CHP A;  3VEW A;  2A1R A;  1JLC A;  3VEO A;  1RT6 A;  3BUZ B;  3D2F A;  4OJR A;  4BQL A;  1S1X A;  4BR2 A;  1BI4 B;  2P9N B;  3H45 C;  4KH6 A;  4IJN A;  3OYG A;  1IKX A;  3DXM A;  3K57 A;  3J80 O;  3OYL A;  2ZGZ A;  1RBS A;  3I8D A;  4O8U A;  1NMD A;  4PKH A;  1M1K O;  1C1A A;  1L5U A;  2UUC K;  2HHS A;  3C6U A;  1GLA G;  3ITH A;  1Q86 O;  5DM7 L;  3KK1 A;  1BUP A;  3PV8 A;  4KI4 A;  1JCE A;  3RSE B;  3WEE A;  2QA4 N;  5HRP A;  1E3M A;  1R0A A;  5AQZ A;  2NRR A;  3MEE A;  3ENB A;  3DLH A;  1ZYQ A;  4RW8 A;  1G15 A;  3ASM A;  3VQE A;  3DAW A;  1T44 A;  3IRX A;  4UQG A;  2I5J A;  4F4K A;  2BE2 A;  4B08 A;  4DWI A;  4B9U A;  3GG4 A;  4KFB A;  4KPY A;  3CPE A;  1HUX A;  1NGF A;  5LJW A;  3UE5 A;  2JGU A;  4YOT A;  1BI4 A;  2P9N A;  1NJY A;  2Q3S A;  5ADX H;  2X74 A;  3MEC A;  3WNF A;  3NH1 A;  2Q2R A;  1C1C A;  1QZ6 A;  3CJ7 A;  3VES A;  4B3S K;  3CME N;  2QXL A;  4E0D A;  1YAG A;  4DF8 A;  3OHR A;  3N4Q A;  4J2D A;  4NLC A;  4E19 A;  1NK9 A;  1NU0 A;  1VRU A;  5I9E B;  4O5F A;  2HVH A;  1RTH A;  2QI2 A;  3W3D A;  4Z94 A;  3RSE A;  1C1B A;  5AQO A;  1TVR A;  4OPA A;  4JAX A;  4KTZ A;  5BRH A;  3I56 N;  4ZTF A;  1JLQ A;  4KHY A;  1FKO A;  3SAF A;  4FZZ A;  2A41 A;  4FYD A;  1MWK A;  4BC5 A;  3SUP A;  3KKR A;  5EVZ A;  1IH7 A;  4H4M A;  5GAH P;  5KGX A;  2YHA A;  5F2R A;  3CJB A;  1WAJ A;  1RBV A;  4C23 A;  2IC3 A;  4B1Y B;  3A8Y A;  3KHY A;  4CZL A;  3AVM A;  3RMD A;  1TV6 A;  3K2P A;  4MLH A;  1WN7 A;  3ID6 A;  3LDN A;  3AO2 A;  5AQQ A;  3HO1 A;  5ELZ A;  2RPI A;  4PL8 A;  3L3V A;  4N76 A;  1NGD A;  1TKZ A;  3ZSW A;  4HWI A;  5KRS A;  3AY9 A;  4RW7 A;  3CCV N;  5JLF A;  3SAH A;  4LF4 K;  1SKW A;  4H5N A;  3QEW A;  1RCH A;  1HKG A;  1VSD A;  3D45 A;  4N56 A;  3PIP L;  5J2P A;  3VQ7 A;  2HB5 A;  3HST B;  1IKW A;  3FGU A;  5E26 A;  3U8X A;  4HVJ A;  3DXK A;  1D4X A;  1S1W A;  1IBK K;  1NK7 A;  2IAJ A;  4F8R A;  1T3V A;  3T1Y K;  3TAE A;  3EEQ A;  3LP2 A;  4YDU C;  3C65 A;  4A57 A;  1K6Y A;  1LWF A;  4YY3 K;  4E7J A;  4GW6 A;  2H3G X;  3IUC A;  4CZK A;  3BF1 A;  1WSE A;  3CIP A;  3PY8 A;  2HHU A;  2DTU A;  3GBT A;  3NHG A;  5A2Q O;  3CCR N;  2P9L B;  3KK2 A;  5AZI B;  3ZT3 A;  3CJC A;  1K73 O;  5KQD A;  3VQ8 A;  4CBX A;  1R59 O;  4E1J A;  3IKM A;  1DTT A;  2YJF A;  1VSI A;  4A61 A;  2ZJQ L;  2ZJR L;  4JI5 K;  2AJQ A;  3CM6 A;  4DTN A;  3HVR A;  1N33 K;  2XY5 A;  3ZLJ A;  4L8R B;  3KWG A;  1VQM N;  4DSI A;  4CJT A;  4DV1 K;  2O8B B;  5LMN K;  3ATU A;  1HPM A;  2HND A;  1X1P A;  2PZS A;  2F9W A;  2O8D B;  3MED A;  4H0T B;  4BC4 A;  5I42 A;  1SKS A;  4I6M B;  2DFH A;  1TGO A;  4JS5 A;  4Y1C A;  4BGA A;  3BZC A;  4IFY A;  3ZSY A;  3MK6 A;  1SZ2 A;  3DI6 A;  5AQL A;  3IFR A;  3PSF A;  4K42 A;  3TAQ A;  1HKC A;  4JRQ A;  4DTP A;  2ZWH A;  1NOZ A;  1GLL O;  4JKG B;  5M1O A;  4M3X A;  3FZM A;  2OYQ A;  4CFB A;  3TAB A;  4DR1 K;  4FOE A;  4B9Q A;  5CE3 A;  3EY1 A;  3V4I A;  4A2B A;  2KFZ A;  1OVY A;  5AQW A;  2PFU A;  3OVN A;  4KKO A;  4CJW A;  3AVH A;  3AVL A;  3I0R A;  1KSP A;  1NKC A;  4MFB A;  1HYZ A;  1VQ9 N;  2D4W A;  1D9D A;  2P9L A;  3JSM A;  5AZI A;  4Q0B A;  2KQ2 A;  3C6A A;  2NRX A;  1QSL A;  4YHH K;  3A5L C;  4KHU A;  2PAV A;  5JVH L;  3HPG A;  1X9W A;  4E3S A;  4HCB A;  3SUQ A;  1HQE A;  4CBW A;  1T6C A;  2G8H A;  3G0Z A;  3NAE A;  1JLG A;  4BAC A;  4RW6 A;  2D0A A;  2NRH A;  2P9S B;  3SI6 A;  3EO3 A;  3LL3 A;  4FOI A;  1KQS M;  4ISG A;  5FPE A;  3K0S A;  3S3N A;  3ZT0 A;  4CES A;  5AQI A;  3H1Q A;  4DS5 A;  4I6M A;  4DV6 K;  1SAZ A;  2YHX A;  5AZJ B;  1QHA A;  1TYQ B;  4F3T A;  2WON A;  4HHT A;  4FLV A;  1Z05 A;  4OLA A;  4OKK A;  4F2S A;  4JKG A;  4H0O A;  2KTQ A;  4QS9 A;  3I33 A;  1KLN A;  4LH4 A;  2QWP A;  1YIJ N;  3TTD A;  4BGB A;  1WSI A;  1GLC G;  3E9P A;  1QTM A;  4FJG A;  2I7N A;  3ALY A;  4CIE A;  2V7Z A;  1KAY A;  2YHY A;  4DR7 K;  3CCL N;  4WFB L;  4BDY A;  4CGJ A;  3U4L A;  1U2V A;  3PIO L;  1S22 A;  3ATV A;  4CD1 A;  3AA5 X;  3TSP A;  5KTQ A;  3M8Q A;  4EP4 A;  4I2P A;  3K9K A;  3QIO A;  4Z4C A;  4KTW A;  2P9S A;  1XWL A;  3L6Q A;  4CE9 A;  5B8H A;  3AAP A;  3P39 A;  3K5L A;  2D0O A;  4IKF A;  3T3F A;  4CFC A;  4X66 K;  3TAG A;  4BRE A;  2ZQB A;  3ENO A;  4Q5V A;  3E1Y A;  1BQM A;  5AZJ A;  4FLW A;  3DLG A;  4JKH A;  5GAG P;  1TYQ A;  2UXC K;  1RNH A;  2UUB K;  2W42 A;  5HOO A;  4RWT A;  1QSY A;  1HX1 A;  2HF3 A;  3HK2 A;  1CXU A;  4AM6 A;  4DQI A;  3MXJ A;  4QCL A;  5FLX O;  4F9O A;  4CED A;  3R8E A;  2GUP A;  5FPD A;  3TAF A;  1VQO N;  1TAU A;  2RF2 A;  3HRG A;  4FWO A;  5CY4 A;  3U9D A;  5CHI A;  3CG7 A;  1UWB A;  4O8K A;  5J2M A;  1UA0 A;  2XY6 A;  1LWE A;  3VQB A;  4DFM A;  1T05 A;  4LY7 A;  1UA1 A;  3V1O A;  1HKB A;  4DQQ A;  1QVG M;  2KKZ A;  4DSJ A;  3RMC A;  1OKJ A;  4BE2 A;  3VGL A;  4QS7 A;  4CF1 A;  3FZF A;  3OYH A;  2FBT A;  3AA2 A;  5K14 A;  4KAZ A;  3VEX A;  1ATN A;  1DLO A;  3V81 A;  3D6R A;  3DLE A;  4ICL A;  4BWM A;  3CCU N;  5M1N A;  3L3U A;  4CK3 A;  2QXF A;  3FLC O;  4IO8 A;  4CEF A;  4XEI A;  1L3U A;  2CGJ A;  2NRW A;  1DTQ A;  3GL1 A;  4DV4 K;  1C0M A;  1ZBS A;  5C2F A;  1KD1 O;  5EY4 A;  4IXC A;  3DLK A;  3VER A;  3QER A;  2GWK A;  5BRD A;  1LW2 A;  2ZE2 A;  5AQK A;  2QW9 A;  4C8M A;  1C0U A;  4PHT X;  3KJV A;  4FZX C;  4C8O A;  3LDL A;  4EIA A;  3B8A X;  1YVN A;  3I8B A;  3JAM O;  3M3Z A;  3UIQ A;  1VQN N;  3TTC A;  4M3T A;  3AVJ A;  3SCX A;  3T1H K;  1K8K A;  3CC7 N;  3LAM A;  1M90 O;  3PO5 A;  2FBV A;  1NK4 A;  4DHY A;  1N5Y A;  3NF6 A;  1ESV A;  5KPZ A;  3OYN A;  3AVG A;  4I9L A;  4FSV A;  4FWP A;  4B1V A;  2G8V A;  4EAH D;  1BCM A;  1QHT A;  3O1W A;  4DMN A;  4DQR A;  2UXD K;  2A3Z A;  2HF4 A;  3KTQ A;  4DQP A;  4OPJ A;  4FJ8 A;  2E8A A;  4AHU A;  4FJM A;  4FM0 A;  4LFB K; 
#chains in the Genus database with same CATH homology
 2AA4 A;  3FZK A;  5JIC A;  2GEL A;  1CZA N;  3HOT A;  4NLB A;  4U7B A;  4GV9 A;  3UKR A;  3O9T A;  2E1Z A;  1K8A O;  1GLA G;  3GDQ A;  3MN5 A;  4M7X A;  3HBT A;  1Q86 O;  3QBX A;  2NZT A;  4BG9 A;  5DM7 L;  1BUP A;  5EXW A;  3NMU A;  3R3L A;  1JCE A;  3RSE B;  3WEE A;  3SMP A;  4G9Z A;  2QA4 N;  2I7P A;  3LDO A;  2D1K A;  3SAG A;  3J8A A;  5AQZ A;  2NRR A;  3CPW M;  3ENB A;  3BF3 A;  5JMV A;  3RVC A;  2HST A;  3DLL L;  3M1F A;  5AQP A;  4YOX A;  4YOW A;  1DGK N;  4BRA A;  3KWI A;  4FWM A;  3DAW A;  2HOE A;  2ASM A;  1T44 A;  4JKF A;  2OAN A;  3AGK A;  1QVF M;  4B1X B;  2E2P A;  4JKE A;  2ZGY A;  4IO9 L;  3CET A;  4YOV A;  4IFE A;  3GG4 A;  3P4I A;  3WXJ A;  4Y0W A;  3CPE A;  3L4Q A;  4BRI A;  1HUX A;  1NGF A;  3SJH A;  2QEX N;  3EZW A;  5LJW A;  1VQP N;  4BR5 A;  1ATS A;  3UE5 A;  5JLH A;  4JD2 A;  4YOT A;  2P9N A;  3PLA A;  4ILJ A;  5ADX H;  3EE8 A;  4FWR A;  3CJ1 A;  3CJ9 A;  4XH4 A;  3D2F B;  1K8K B;  1C0F A;  2Q2R A;  2J4R A;  3H3N O;  3QFP A;  1QZ6 A;  3CJ7 A;  3ZET A;  3VES A;  5DM6 L;  3CME N;  2QXL A;  3AAR A;  5AQJ A;  3O5B A;  1YAG A;  3OHR A;  3N4Q A;  4NB4 A;  4NLC A;  3WQU A;  4KBO A;  4BR9 A;  1YJN N;  3F9M A;  3E9L A;  3CI5 A;  3QFU A;  5I9E B;  4O5F A;  5AQM A;  3NVK A;  3A0I X;  1S3X A;  1NGC A;  4BR0 A;  4RCH A;  3A5O C;  3M6G A;  3VGK A;  4AF1 A;  2QI2 A;  3W3D A;  3WUH A;  3CQY A;  4BRL A;  4Z94 A;  3RSE A;  3LM9 A;  3LDQ A;  4FWN A;  3CC2 N;  4CZH A;  1VAZ A;  1GLF O;  2VGM A;  5AQO A;  2AP1 A;  4OPA A;  1P90 A;  2IIR A;  1NGB A;  4JAX A;  2ASP A;  4H0Y B;  1BA0 A;  3TSQ A;  5BRH A;  2WUS A;  3ULE B;  1KXP A;  2A6A A;  3WEE B;  3I56 N;  5AQF A;  5C0Y A;  5JVG L;  3SAF A;  4JKA A;  1GLB G;  2A41 A;  4BRQ A;  1ILY A;  1NWK A;  3O4W A;  1C0G A;  4WCE L;  1MWK A;  4BC5 A;  5GIO A;  1E4G T;  2Q36 A;  1DKG D;  1TUU A;  5EVZ A;  4JEP A;  3CCQ N;  1NGI A;  4WQ4 C;  5GAH P;  1NGG A;  3D2E B;  5F2R A;  4IOA L;  3CJB A;  5AFU A;  3EE9 A;  2VWB A;  3TPQ A;  5M1K A;  3O9S A;  3S41 A;  3ZEU B;  2NRZ A;  2IVO A;  2YCH A;  3SMS A;  5M1P A;  1X3N A;  1SS6 A;  1IJJ A;  4B1W B;  4C23 A;  5FPM A;  5C12 A;  2V7Y A;  4FWS A;  4A59 A;  4BQZ A;  3QBW A;  3VPZ A;  4B1Y B;  1JCG A;  3A8Y A;  3KHY A;  4CZL A;  2QWL A;  5M1F A;  4JKB A;  5BRF A;  1Q81 O;  3O08 A;  3H6E A;  2RE2 A;  4MLH A;  2HMP A;  3ID6 A;  5AQU A;  4ISE A;  1KAX A;  3O9Q A;  5AQG A;  3LDN A;  3OBY A;  5AQQ A;  3U9Z A;  2E2Q A;  5ELZ A;  4XH1 A;  3C6H A;  4PL8 A;  1NGD A;  2FSN A;  5C2D A;  2WFB A;  4HWI A;  5BR9 A;  3AY9 A;  3CCV N;  5JLF A;  3SAH A;  1EQY A;  2WC9 A;  3D7E O;  4H5N A;  5BPN A;  3IMX A;  3P31 A;  1HKG A;  3KZB A;  3AGR A;  3HM8 A;  5TKW A;  1BO5 O;  3PIP L;  1DEJ A;  2V52 B;  4IOX A;  2Q31 A;  3FR0 A;  3FGU A;  5E26 A;  4BG8 A;  3U8X A;  3MN7 A;  1P8Z A;  3DXK A;  1D4X A;  5BPM A;  3MX2 A;  5AQN A;  3P38 A;  4FL9 A;  2BH1 A;  1YXQ A;  2F7T A;  3O8M A;  3VEV A;  4BC2 A;  2HBL A;  4M63 C;  3HI0 A;  1T3V A;  4BRO A;  1KC8 O;  2YI1 A;  3ULE A;  1Y64 A;  2P9U B;  2QWN A;  4J8F A;  5KPT A;  5LY3 A;  2A42 A;  1TUY A;  4YDU C;  1HJO A;  4FPA A;  3C65 A;  5C15 A;  4A57 A;  5LJV A;  5E84 A;  3CQX A;  4XH5 A;  4BY9 C;  4H5W A;  2H3G X;  3OA9 A;  3CER A;  3N4P A;  4DB3 A;  3IUC A;  4CZK A;  4U67 L;  3BF1 A;  1BU6 O;  1NGA A;  2JWK A;  3D2E A;  4L3Q A;  4HTL A;  3HOS A;  3TU5 A;  3CIP A;  3A5M C;  2VGN A;  3GBT A;  1V4S A;  3ZEU A;  1QQO A;  3CCR N;  2BTF A;  2P9L B;  5GAD P;  2IVN A;  5AZI B;  3VGM A;  3CJC A;  3VET A;  1BWF O;  2W41 A;  2E2N A;  4AM7 A;  2D0P A;  3JS6 A;  4DCH A;  1K73 O;  5KQD A;  4CI6 A;  2E2O A;  4CBX A;  3C0B A;  3VF4 A;  4BRN A;  1R59 O;  4E1J A;  2E88 A;  4ILG B;  3UKU B;  3IKM A;  4IJA A;  3WXK A;  2CGL A;  4JK9 A;  2HBM A;  4YDU A;  2ZJQ L;  2YJF A;  4A61 A;  3FFK B;  2PBD A;  3G4S N;  2ZJR L;  3VTH A;  1YF5 L;  3ZX2 A;  3WQT A;  3T69 A;  3SK3 A;  1QQM A;  3EKS A;  3MN9 A;  5BN9 A;  4BRG A;  1W97 L;  3VEZ A;  3MCP A;  2Q0U A;  5EX5 A;  4EHT A;  3KWG A;  1VQM N;  4K43 A;  1BA1 A;  1YJ9 N;  4KH4 A;  2FSK A;  3WXL A;  4IWV A;  3ATU A;  1HPM A;  1YUW A;  2YJE A;  5AR0 A;  2F9W A;  4H0T B;  4BC4 A;  4I6M B;  4WQ5 C;  3F2K A;  1VQ5 N;  4MDA A;  3FE1 A;  2FLO A;  3DJC A;  3ID8 A;  3MMV A;  3H3O B;  4BGA A;  1NJI O;  1BG3 A;  2P9K B;  1SZ2 A;  3CJA A;  3MK6 A;  4H0V B;  5TKY A;  4BC3 A;  5AQL A;  4H5T A;  2NRT A;  4CZG A;  3IFR A;  2YHW A;  3KVG A;  4K42 A;  1HKC A;  4ISF A;  3DXK B;  1NM1 A;  3DWL A;  4EHU A;  2QM1 A;  1GLE G;  2ZWH A;  1GLL O;  2QWR A;  2GX9 A;  2P9U A;  3QML A;  3FZM A;  4H0X B;  4JKG B;  5M1O A;  2JWL A;  3Q7C A;  3W0L A;  1G99 A;  4BRC A;  1YJW N;  1YI2 N;  4A62 A;  4FOE A;  4B9Q A;  4YOR A;  5CE3 A;  1Q82 O;  1ATR A;  4A2B A;  1OVY A;  3MDQ A;  3WXI A;  4JHD B;  5AQW A;  2PFU A;  1JCF A;  3FZL A;  3EN9 A;  3MX5 A;  3NVM A;  3OW2 M;  3GE1 A;  2A40 A;  3GOI A;  4A2A A;  4WQ5 A;  1VQ9 N;  2GEM A;  2D4W A;  4H03 B;  1H1V A;  3A5N C;  1VQL N;  1J6Z A;  2FSJ A;  2E1Y A;  2P9L A;  4CD3 A;  3C7N B;  5AZI A;  1SQK A;  4K25 A;  4GNI A;  4BRK A;  3C6A A;  5GIP A;  5AQY A;  2NRX A;  3ZX3 A;  3A5L C;  4B1Z A;  2PAV A;  5JVH L;  2FF6 A;  4EFH A;  3UKU A;  1K9M O;  2FF3 B;  5AQV A;  3VTI A;  3SLC A;  1VQ8 N;  5AFU H;  5EOY A;  4CBW A;  1T6C A;  3CHW A;  5AQT A;  5GIN A;  3CCJ N;  2VYP A;  3FZH A;  4IEE A;  4BRH A;  3O6W A;  2NRH A;  2P9S B;  2V51 B;  3EO3 A;  5CR4 A;  2VCP A;  2DPN A;  3BEX A;  3LL3 A;  4FOI A;  1KQS M;  4ISG A;  1U6Z A;  5FPE A;  3CCS N;  4FO0 A;  3K9J A;  5AQI A;  3EKU A;  3H1Q A;  4PKI A;  4WQ4 A;  5HL7 L;  2F9T A;  4I6M A;  1Q7Y O;  1KAZ A;  1SAZ A;  3TSU A;  2YHX A;  5AZJ B;  1QHA A;  3SBG A;  3HTV A;  2P9K A;  4CZF A;  4CZI A;  1TYQ B;  2ZF5 O;  1Z05 A;  3EL2 A;  5AQX A;  4A5B A;  3BP8 A;  1W2B M;  5KPR A;  1LOT B;  2Q97 A;  4FWQ A;  1HLU A;  3O1B A;  4JK8 A;  4JKG A;  4H0O A;  2E20 A;  4JK7 A;  3MWP A;  4QS9 A;  1YHQ N;  3I33 A;  3OBW A;  5GAE P;  3QB0 A;  1S72 N;  3G6E N;  1ZC6 A;  3VEN A;  3H46 O;  4NO7 A;  2QWP A;  2FXU A;  4MLE A;  4GVE A;  2P9I B;  4JHD A;  1YIJ N;  1V4T A;  3TTD A;  2OTJ N;  4BGB A;  1GLD G;  1Z6R A;  1WUA A;  2YX6 A;  1GLC G;  3E9P A;  4LC9 B;  2CH5 A;  3QIC A;  5BRE A;  1N8R O;  3R6M A;  2HBJ A;  4DQ8 A;  2I7N A;  4PL7 A;  1E4F T;  1RDW X;  1KAY A;  2CGK A;  2P9P B;  2V7Z A;  2YHY A;  3C7N A;  4YOY A;  3CCL N;  1X9J A;  1ZXO A;  4WFB L;  5BN8 A;  3CXC M;  3VEY A;  4K41 A;  4JN4 A;  2KLA A;  1EO1 A;  3U4L A;  1U2V A;  3SBT A;  3PIO L;  2ASO A;  1S22 A;  3ATV A;  4FVU A;  1QQN A;  4FPB A;  4CD1 A;  1MWM A;  3CMA N;  3TSP A;  5MLC Q;  3UB5 A;  2IVP A;  3VOV A;  2WBN A;  3L4I A;  3K9K A;  4CZJ A;  3KK7 A;  4CBU A;  4UY8 O;  3CCM N;  2UYT A;  3ENH A;  4RTF D;  3MWT A;  4H5V A;  2ITM A;  4IOC L;  2P9S A;  3L6Q A;  3CF5 L;  1XUP O;  3VF2 A;  5B8H A;  3AAP A;  3E9O A;  3P39 A;  4H0P A;  4IDH A;  5AQS A;  2D0O A;  1QZ5 A;  2QWO A;  4YOU A;  3M5R A;  4JNE A;  4BRE A;  4A5A A;  3ENO A;  3WXM B;  3E1Y A;  3CD6 N;  4FWK A;  4PKG A;  3J7Z O;  4MO5 A;  5AZJ A;  4WFA L;  4MDB A;  4JKH A;  4WF9 L;  4BVP A;  4CZE A;  1TYQ A;  3H1V X;  5GAG P;  4R79 A;  2EWS A;  3LM2 A;  4BRD A;  5ADX A;  4B1U B;  5HOO A;  3G71 N;  4M7Y A;  3T7Z A;  3TTF A;  1HX1 A;  2HF3 A;  4GY2 B;  4RWT A;  2RHK A;  3Q7B A;  5BPL A;  3G25 A;  4AM6 A;  2GTD A;  1DT9 A;  4JKD A;  4DKW A;  4F9O A;  2ZJP L;  2OTL N;  3R8E A;  2GUP A;  2NNW A;  2P9I A;  1RDU A;  5FPD A;  1VQO N;  5KQ8 A;  3VF6 A;  4OO1 J;  2W40 A;  1VQ6 N;  4ILH A;  3HRG A;  5M1Q A;  1LCU A;  3MCA B;  4FWO A;  3DXM B;  3U9D A;  5CHI A;  4O8K A;  1XC3 A;  3ZYY X;  2Q0R A;  4BR7 A;  2P9P A;  1VQK N;  5AQR A;  2BUP A;  4MO4 A;  4WFN L;  4H5R A;  3HSC A;  2QWM A;  3I55 N;  4BRM A;  4GV6 A;  1HKB A;  1QVG M;  4IZ9 A;  4JKC A;  5F1X A;  2KKZ A;  4FWL A;  3O9U A;  4WYB A;  3UKR B;  1OKJ A;  3VGL A;  1GLJ O;  3E66 A;  4QS7 A;  1U2V B;  1WOQ A;  3FZF A;  3CC4 N;  3VEX A;  3WT0 A;  1ATN A;  2KHO A;  1IG8 A;  3D6R A;  3JXU A;  3CCU N;  3QDK A;  5M1N A;  2A5X A;  4BRP A;  4C1N K;  1YIT N;  5F0X A;  2HBK A;  3FLC O;  1RGI A;  4IO8 A;  5C10 A;  2GWJ A;  2NLX A;  2QWQ A;  4XEI A;  3O80 A;  1NBW A;  2CGJ A;  2CH6 A;  2NRW A;  2QTD A;  3GL1 A;  4CJ7 A;  1VQ7 N;  3AAQ A;  4KH5 A;  5C2F A;  1ZBS A;  1KD1 O;  5AQH A;  5EY4 A;  4C1N I;  4BVO A;  4IXC A;  1NGJ A;  1MA9 B;  1NLV A;  1NGH A;  3VER A;  2NRV A;  3F5T A;  5FPN A;  1BOT O;  1JJ2 M;  2GWK A;  1Q18 A;  1T6D A;  3LDP A;  5BRD A;  3MN6 A;  4GV3 A;  5H1S Q;  3IDH A;  1NGE A;  1XQS C;  2QW9 A;  1X3M A;  3L0Q A;  5AQK A;  1MDU B;  4PHT X;  2Q1N A;  4BRF A;  4BR4 A;  3VEW A;  3O9R A;  3LDL A;  4EIA A;  3B8A X;  1YVN A;  3I8B A;  3VEO A;  3M3Z A;  4IEI A;  1VQN N;  1RFQ A;  3R1X A;  3BUZ B;  4CZM A;  3TTC A;  3ZX0 A;  3D2F A;  1K8K A;  3CC7 N;  4BQL A;  4JD2 B;  4BR2 A;  1M90 O;  3VMF B;  2P9N B;  4QS8 A;  3H45 C;  4OPH A;  3HZ6 A;  4KH6 A;  4DHY A;  5KPZ A;  1ESV A;  4IJN A;  3CCE N;  3DXM A;  4FSV A;  4FWP A;  4B1V A;  4EAH D;  3O1W A;  3R9P A;  3ZET B;  2ZGZ A;  1O13 A;  2A3Z A;  1BDG A;  2HF4 A;  4O8U A;  1VQ4 N;  1NMD A;  2E8A A;  4PKH A;  1M1K O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...