3K9TA

Crystal structure of putative peptidase (np_348812.1) from clostridium acetobutylicum at 2.37 a resolution
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
435
structure length
422
Chain Sequence
GMEEINKYIQNSSETGGEIYNLIEELFPICRSITGNGVRKTMDIIRKHIPLEIHEVKSGTKVFDWTVPKEWNIKDAYVRNSKGEKVIDFKENNLHVMSYSVPVHKTMTLDELKPYLHTIPGNKDRIPYLTSYYKENWGFSLTQNKFDELCDDDYEVVIDSSLEDGSLTYGEYYIRGELEEEILLTTYTCHPSMCNDNLSGVALITFIAKALSKLKTKYSYRFLFAPETIGSITWLSRNEDKLKNIKMGLVATCVGDAGIKNYKRTKFGDAEIDKIVEKVLMHCGSEYYVADFFPWGSDERQFSSPGINLSVGSLMRSCYGFDGYHTSADNLCYMNKDGLADSYKTYLEVIYTIENNRTYLNLNPKCEPQLGKRGDEFAMFWVLNMSDGKNSLLDIAYKSGMEFRRIKYAADALYRVELLKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative peptidase (NP_348812.1) from CLOSTRIDIUM ACETOBUTYLICUM at 2.37 A resolution
rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase
molecule keywords putative peptidase
total genus 139
structure length 422
sequence length 435
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09940 DUF2172 Domain of unknown function (DUF2172)
A PF16221 HTH_47 winged helix-turn-helix
A PF16254 DUF4910 Domain of unknown function (DUF4910)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k9tA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3k9tA01
3.50.30.90 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3k9tA02
2LKPA 3F21A 3KR4A 5L3DA 2FMYA 1CPSA 2XHKA 1DPUA 3PBBA 2KJBA 2PJ5A 3Q9SA 3ECOA 3V7RA 3GLXA 5E20A 4S04A 5CVVA 2EA4A 3LA2A 5BOXA 4EM0B 3MWMA 3KETA 3F6OA 4FWUA 1GHCA 1HSJA 4IVNA 4FX0A 1SMYF 1ZGJA 2G9WA 2Z5UA 2C6CA 1VIXA 2HZTA 3HTSB 2VT2A 2PMUA 3PRTA 2XEFA 4Q48A 1O3TA 3IKTA 2VODA 2M8EA 3BPXA 5F1RA 2JEWA 5A2QK 2PN6A 4LGWA 3T0YA 1CPXA 2VOPA 4F8ZA 1KU2A 3HUGA 2CQKA 3KP4A 3FF3A 1J75A 4HBLA 5FFZA 3HSFA 2DK8A 2XKPA 1F2PA 2QBYA 3FM3A 2HWVA 2ZEPA 5CBMA 3FXRA 3GEZA 3GFMA 3NH8A 3B02A 3VOEA 1MKMA 1IN7A 2PEXA 4A6EA 5J1QA 1ZRCA 4U7BA 1H8LA 2DQRA 1GXPA 2EFPA 2XAJA 4HYEA 4EJTA 4P10A 3FMCA 3KZYA 4FBEA 2WV0A 2V1UA 2POKA 5L3FA 4YIIA 4MGRA 2GZWA 2HEOA 5HVFA 3U1DA 3C3WA 5E18F 3TKYA 4PDKA 3WGHA 1W7PA 3CUOA 1U3EM 4EFDA 2R3SA 2FE3A 5HVHA 1TW2A 3WG9A 4MHGA 2ZJ2A 3SZTA 3TO7A 2YX4A 4A5NA 1LOKA 6PAXA 1LJ9A 1IUYA 3MZHA 3J80Z 4HV6A 4JYWA 2ZEMA 5DD4A 2PVVA 1L0OC 5LBQA 4ZI6A 4WXHA 2ADUA 1WRJA 2XAFA 4XLNF 4AIHA 1FC3A 4P4DA 3E5QA 2JPBA 1BIBA 4M71A 3HHGA 3V7CA 4M9XA 5LGTA 4OC4A 4NQWA 1K79A 4NGNA 3ELKA 3F6VA 1EE3P 1CF7B 1FT9A 4HA8A 1D5VA 5EEHA 4OIQF 2PIYA 1ZG1A 1LNWA 2VE9A 1Y0UA 1HEEA 2JSCA 2FVGA 4P4BA 1SMTA 4U0WA 1L3LA 3FHZA 1DP7P 4NGPA 2KIUA 4HW0A 4HF1A 2KKOA 4RGSA 3I59B 4MTEA 5HS7A 3D7HA 3IJ3A 3B3CA 3PB4X 2RFHA 1WKMA 1SFUA 2VC1A 3KP5A 4UXNA 1R36A 5CLSA 1MJBA 3K1NA 3F22A 4GXOA 2JTVA 3SJEA 2O53A 2RV8A 5L3CA 3BJ6A 4LK0F 2STWA 3QP5A 3DPTA 1MD0A 1R3NA 1USTA 1QZYA 3QP6A 2Q51A 3HTUA 2F7VA 1F5TA 2NNYA 4B09A 5L3GA 1U8RA 1NSAA 1Y0YA 1Z2LA 1YIOA 4OU0A 3GF2A 3CT9A 3NQOA 3F8BA 2PJBA 3O6BB 5L3BA 3L09A 3R6SA 2AFOA 4F7ZA 1CGPA 4IHMA 4IF4A 2O3FA 4TNUA 3IO1A 2PJ3A 5CYVA 4OMEA 2D2WA 2EV6A 3ISZA 2EWBA 1REPC 4UV8A 5LEJA 3R60A 2BYVE 3F3XA 3PB7X 2XEGA 2JPCA 3WGIA 4WWCA 2VOOA 4HDUA 3I64A 1U5TB 1WWXA 3C18A 2PJ0A 2R7DA 3CPXA 4O23A 3RYRA 4LMYA 3E6DA 4GO1A 3SI0A 1HW2A 3OOPA 1HKSA 2PQ8A 4OOIA 2GU2A 4YWYA 2COMA 2XAHA 1ZRFA 4ENMA 4WF2A 1Y7EA 4Q4ZF 5E17F 3HOSA 3IRQA 2IQ6A 2VBYA 3TOAA 2C6YA 1VHOA 1ZGAA 4LLLA 3T1BA 3WTWC 3GFIA 4X3RA 3M9AA 2E1CA 2ZO4A 3ZPLA 5HDKA 1R7JA 3FXQA 3DKWA 2MLGA 1T38A 3GUDA 4ZH4F 1XSDA 1IXSB 1FX7A 4BAYA 2ETHA 4ZYHA 5LHGA 3SFZA 4XSZF 2GWRA 4G7OF 2KJCA 3K2KA 1A04A 2PJPA 2O8XA 3K1MA 2XVCA 1OR7A 2WZNA 3PB9X 5K1YA 2DBBA 3I0TA 2GXBA 1P4XA 1YG2A 2PRQA 4BYYA 4XSXF 4HX8A 2OBPA 1XMKA 2O4HA 4ESJA 2P6TA 4G9YA 1PUEE 3PFOA 4AD9A 3MZYA 4I0AA 4U88A 4L5IA 5BPIA 3TGNA 2UZKA 4UF4A 4N9HA 3T5XA 4ESFA 1AYEA 3R61A 2WYRA 3D4UA 4BHBA 3BJOA 3LAJA 4FUUA 1FSEA 3RTRA 2VBXA 4M9SA 1EH7A 1VHEA 2RNJA 2F5CA 3JAMZ 2P8TA 4UVAA 5JFRA 4ENJA 3Q5FA 3BWGA 1BBYA 3VARA 1QNTA 2QLZA 4I01A 4WCGA 2ZOFA 2CW0F 4LJZF 2ZMEB 2L4AA 3NRVA 2H27A 1IZ1A 2E1NA 3DEUA 4KN4X 2J9AA 4XLPF 1KU9A 4PPZA 5CVIA 5HLIA 3LA7A 4HX4A 4LQGA 5ICFA 4Y13A 2ZEOA 3PEIA 1D8JA 1FP2A 4EWTA 3SQNA 3R4KA 1ELMP 3JW4A 4M73A 3F23A 1KGSA 2QVOA 5LLQA 1ZLIA 1LEAA 3FWEA 1DUXC 2AFSA 1S3JA 4EJVA 3KGQA 2W57A 2AFXA 5BS6A 4LD5A 2CSOA 4FT8A 1P4WA 4LLNA 2IA1A 2BCOA 3I1UA 3D7FA 3SHFA 5LHIA 2EK9A 3MRUA 4NGSA 3SI1A 2IVMA 4AVPA 1XMBA 1Z91A 1SD7A 5CVRA 1JXSA 4NGMA 5HVGA 4LLGF 2OZUA 3L2NA 5I4MA 2KRFA 2FQ3A 5JHUA 4D0PA 3M7GA 4DJLA 1JHHA 2XV4S 3WODF 2D1VA 4H2KA 4EMEA 3DF8A 2WTEA 3H8GA 2O6GE 4YFXF 1EV7A 1TNSA 3P9CA 4P44A 3CUQA 3WC6A 1LB2A 2JRTA 4PGGA 3RDIA 2EK8A 1HQCA 2H94A 4UNOA 2I3CA 1IN8A 2MBFA 2ZBKA 3R0AA 3WTTC 3TDZC 2EWNA 1SAXA 2GXGA 3GB0A 4DYOA 1XGOA 1B4AA 2FOKA 1F57A 1R1VA 3QPTA 4HDVA 1RTQA 2BEOA 2ANPA 1I1GA 4NB5A 2GA2A 2NYQA 1FWZA 3L00A 1K7AA 2ZEFA 3KP3A 1VTNC 3MCZA 4OINF 2HKOA 1ULYA 5DCMB 4LG0A 1HDUA 2LF7A 2BGCA 1XBUA 2NSMA 1D3YA 5H6QA 5LYDA 5JR3A 2GQQA 3FVLA 2CF4A 5BQTA 5K8OA 1ZHFA 1BM9A 5HS8A 4L9TA 2CO5A 4ESBA 3MN8A 5FB2A 4XBFA 1O3RA 4RGUA 3TDUC 3Q9VA 2M30A 1FBSA 4OIRF 2Z99A 4GYGA 4AXVA 4OC3A 4IK2A 3DXJF 2LNBA 1I27A 1B59A 1B9NA 4HQMA 4O6JA 2HS5A 4KIBA 3BPVA 1WSUA 2QBYB 1JQGA 2BBYA 1ODDA 4HX7A 5ILUA 1RNLA 5FLXK 1R58A 1ZLJA 3BZ6A 5D4RA 1ZREA 5L3EA 3MFKA 2W85A 2VT3A 2PMHA 1G3SA 4P4IA 2VN2A 1SD6A 1TW3A 3KHXA 4M72A 1HDQA 2AFUA 5E1WA 3WC5A 1PP8F 4G1PA 2L3DA 4WXCA 3SZPA 5E8IA 2XEJA 2F8HA 2E7WA 2HQRA 2P7CB 2FEZA 5F64A 3SJFA 4G94A 3BI0A 3K2ZA 1IY7A 4DQ2A 4ZY1A 4TWEA 5JVTA 1OMIA 2QQBA 3RAMA 3KLOA 1UWYA 1O7FA 2ZEDA 4MCRA 2ELHA 3VB2A 2DFIA 2W24A 2Y48A 1YW8A 4MMOA 3LMSA 1T2KA 1XGMA 4ZX8A 3W6JB 2LSOA 3ROUA 3VATA 1XCVA 3HOTA 4UHTA 4PXDA 5HS9A 3KEOA 4R7MA 4MHYA 3FF5A 3SXYA 5LRSA 1E2XA 2G7UA 5LRGA 3N97A 5J8FA 1ZG8A 1R22A 1AWCA 4NGRA 3PFEA 3LAPA 1YS6A 3ZMZA 1J7KA 1IN6A 1BJAA 2Z3YA 1RZ4A 5KVRA 1G6NA 2VBWA 2O03A 3LSTA 3IL2A 1BPNA 1P2FA 4PCQA 3D66A 1Q7LA 3HHHA 4ENNA 2X0LA 2A07F 3GW2A 5IT9K 4BHPA 3ZP5A 1W5TA 4WXDA 1RUNA 2PJ6A 4MQVA 5D8LB 4NGQA 5LYLA 2K4BA 2ZFWA 2QZ8A 4UEEA 4BNCA 1IF1A 3OV8A 3G73A 2IRFG 4QLCU 3B3WA 4EQQA 1P4AA 3KZZA 4CDGA 4Q5SF 2AFMA 3EQLF 4Q7AA 3V38A 1IN5A 3GZ5A 1BN5A 2ZNZA 3BDDA 3N5FA 2DLLA 1QO0D 4HOBA 1TF8A 4ZYQA 2OQGA 4I0BA 4MTDA 1P6RA 1G3YA 1FSHA 3I5UA 1H9GA 3P9IA 3FEEA 1TKFA 3CUQB 4A0ZA 1UHMA 3F8FA 3LA3A 3JAMK 2IA0A 1TKHA 2DK5A 3PB8X 4G7HF 1J9IA 2FSWA 1Z6TA 1IRFA 1BLLE 3KL9A 3L2CA 4GM5A 1LFWA 2AFZA 2IJLA 2XGXA 2RVCA 2XAQA 2F5FA 4TV7A 3JTGA 1TLHB 4YFNF 3BY6A 2GA1A 4A0XA 1IXCA 2HDCA 5DCMA 1UB9A 4ONWA 3ULQB 4MEXF 2NAZA 3IHUA 4RAYA 4RGRA 3RPQA 3CDXA 4UVBA 2A3SA 4KNYA 3KQZA 3NH5A 3WTXC 4GCVA 4YU9A 4A2UA 4EGYA 1JGSA 2QQAA 3RKWA 5BPDA 3IWFA 4A38A 2A6EF 3DV8A 3WTZA 2G7HA 5D6EA 2J5PA 1ZH5A 3ECHA 2BO9A 3E6BA 4L9VA 4A94A 3D5LA 2Y75A 1K78B 1V4RA 5JGFA 1XDUA 1R5HA 3JRUA 1R43A 5IT9Z 1QMUA 4OIWA 3CTAA 2YPRA 2LDUA 1YLFA 1G3WA 1LANA 2ZNYA 2MC3A 1ZLKA 1KQ9A 2PJ1A 2PJ8A 2OD5A 4OC1A 3V8KA 1FBUA 1Z8LA 4EM2A 1YW6A 3BROA 5EEGA 1XCBA 5TRDA 5DDGA 4JQFA 1BI1A 3ZN0A 3WABA 5D5VB 2QENA 2IW5A 1O7LA 1R00A 1ON1A 4JK1X 1YMEA 3PQKA 4WWVA 2CFXA 1U6GA 4BXUA 4AIJA 2P5KA 2IT0A 4OMYA 2CWEA 4F9VA 2HQNA 2FBHA 3LFKA 4NFRA 4NHJA 2AXLA 1FZPB 5D29A 4HQEA 1VGYA 4OMZA 4YIFA 3ISPA 1YFHA 1FLIA 5K8MA 4UIBA 2EB7A 2R7FA 3QOPA 5HLHA 3DGVA 3ZN1A 2K27A 5CVUA 3JTHA 1STZA 1O57A 2DT5A 1FP1D 1YTYA 1U5TC 1R1UA 1UCRA 3EYYA 4BH9A 3GVAA 1Z1DA 2OU2A 5D5XB 2ZENA 2OQRA 5HDNA 5J8CA 1H0MA 4IRHA 3ZMUA 4L9JA 3QPHA 2M1BA 2V8DA 3KEQA 3CPAA 4MQ9F 3SJXA 2LF8A 3FECA 2XUBA 5K5OA 2QM3A 2Q8KA 4AWXB 3ZQ7A 2L02A 2Q0OA 4MCSA 2Q43A 1IRGA 1FNNA 1U2WA 5THWA 1QBJA 1F1ZA 4BD9A 2M45A 1RI7A 4JZ0A 3FZVA 1GXQA 2D1HA 1S7OA 1RUOA 1PP7U 2PJ9A 3E5XA 3EETA 3H3ZA 4PXBA 5LRKA 4Y17A 4NGTA 3TO6A 3BHXA 2FU4A 3IEHA 1CG2A 3VODA 4A0YA 3FMSA 3H8EA 4BQAA 4RB2C 3J81Z 4EM1A 1B9MA 1Q1HA 5H20A 2ZCWA 1CX8A 4PZJA 2BE5F 5AONA 5ELYA 2PIZA 2P5LC 5F09A 4I02A 3EUHA 1MJAA 2GIVA 2W25A 4ZYDA 1R23A 4Z65A 3B2YA 3WU1B 2VONA 1PYTB 2P4WA 4KDPA 1NHAA 2QVPA 4MXUA 3F8NA 4IAVA 5LYFA 4EJOA 2PBIA 5ERIA 1BI2A 1IN4A 3D67A 3H3UA 3P9KA 1CF7A 4KIFA 4UV9A 2ZEGA 4I7HA 4KICA 3I58A 1ARMA 3KR5A 2F5DA 3I71A 3I59A 2ZOGA 3NEUA 4IXAA 4G7ZF 1LEBA 3ZMDA 2NNNA 4MNUA 4RB3C 2FNPA 3GUXA 2EK5A 1FOKA 4R76A 1FNOA 4GGGA 3RIRA 1YO5C 1YSJA 3DFGA 3V7ZA 1OYYA 2XKOA 3KCCA 1ZLHA 4ZYGA 3WGGA 3SI2A 4N9IA 3LQQA 1H9TA 4ASNA 4KIGA 1LAMA 4ETSA 1HXDA 5J6XA 4UVCA 1BOAA 4ZY2A 3B3VA 1FPQA 2VBZA 2CTBA 1HW5A 4RB0A 2PJAA 5HLGA 2NRAC 4G6DA 4P5OA 1OKRA 3T8RA 1S6LA 2HKXA 1PDNC 4UEFA 1P92A 3SJGA 1K78A 3AAFA 1QQIA 4X8IA 2GLJA 1ARLA 4IPAA 1Z05A 2QYOA 2RB7A 4R8FA 3ZMSA 1J0RA 1LVAA 3KI9A 2DEAA 4P4FA 2M87A 3E97A 3IRRA 3ISXA 2HFHA 2PFBA 4KMUX 4FX4A 4OIDA 1DE4C 4IJAA 1KU7A 4P4JA 2F5EA 2Z33A 3V8LA 3MAJA 2EFNA 3B35A 4RS8A 5JH9A 1O3QA 3HYIA 4UUVA 3C7JA 3E5UA 3QAHA 3LQRA 4MCPA 5LRRA 2QUFA 3HSRA 2V1DA 1BC7C 5A2QZ 3GFJA 3K69A 1KQ0A 3RI4A 1TNTA 1PCAA 2AFWA 4OIPF 2P5VA 5LGUA 1YW7A 2BV6A 5HDGA 2FXAA 4EV0A 1CP7A 1I5ZA 1HW1A 1XFOA 3FX6A 3O2PE 4A37A 1XRYA 5ILSA 4Z2YA 3K0LA 2JZYA 2FNAA 2PJCA 3T8WA 1XN7A 8CPAA 3RBUA 2UWMA 4FAIA 1RIOH 5DYMA 4KSIA 3IC7A 3M8EA 5JM6A 2HOEA 4L0YB 1TBXA 1LAPA 2G9DA 1JHFA 5D8KB 2O0YA 2DQLA 2RKHA 5LGNA 5LEKA 3GYHX 3FMRA 3S9NA 2PVWA 4KFCA 4B6ZA 4IRGA 1B1BA 1YS7A 4W9YA 1T39A 3E3VA 2UXXA 2NYXA 2JBJA 3RJPA 3DQVC 4A39A 2H6BA 4HLXA 3RPUA 1ZN2A 4RGXA 1XGNA 2D45A 3COAC 2CIJA 2GREA 3VFZA 3CJNA 2MA3A 5FLXZ 1HKTA 2STTA 1BAVA 2XASA 5BMZA 1XSXA 3K9TA 1IAWA 2V77A 4KMFA 5HXDA 2XRNA 3S9MA 1TXRA 2PJ2A 2ZELA 5IT3A 3V8JA 4CGZA 4HV5A 4L5JA 1SFXA 3IC1A 4EJUA 3ML6A 4R8HA 3E6CC 2V8GA 1UFMA 4MCQA 4KYWA 3F8CA 1OBRA 2JBKA 4MHZA 2K02A 2XAGA 3IKVA 4E70A 1Z5RA 3C1DA 2PCUA 1S8NA 1J2XA 2ZEHA 2L4MA 2MD5A 5AIQA 1DDNA 4AIKA 1XDSA 2K7LA 4HZFA 2HGCA 3TX8A 3HRTA 1TTYA 2DO7A 3RZAA 3GWZA 2C6GA 1IXRC 3GLJA 2DW4A 5CPAA 1T98A 3HLPA 3PFIA 4NJRA 1SFEA 1XMAA 5DUIA 1J59A 2RC4A 2Q2EA 4Q47A 3M1EA 2HB6A 3IWWA 2AS5F 5D6FA 2HTSA 3D7DA 1QQ9A 3TO9A 1FBQA 5ILVA 4WK8F 1K6OA 4NJQA 1KYWA 3KFWX 1YLOA 3IFEA 5CVJA 2EA2A 1SD5A 3KE2A 2YU3A 2A61A 3I4PA 4EJWA 2CYYA 3WE2A 1QZZA 1W5SA 2A6HF 2YX7A 5E1ZB 2CG4A 1U78A 1KU3A 3GX4X 3I53A 3WE3A 4YG2F 1TKJA 3BOQA 5IB9A 1MDMB 3F72A 2HYGD 1X3UA 4OC2A 4WX9A 3HUVA 5DD8A 3R0JA 1Y0RA 3EYIA 2A69F 4LG0B 2XIGA 2JT1A 3F8MA 4CO8A 2OZ6A 1CP6A 1G4DA 4CPAA 2VC0A 2ZKZA 3KASA 5DV5A 4HF2A 2P6SA 4M6XA 1FYMA 2QJ8A 3HIFA 4A6DA 4ON0A 2FBIA 3L7WA 3KQXA 4P9FA 3WC7A 1KWMA 3ERED 4M9ZA 5HOOA 1BI3A 2IJZA 2IP2A 3KHZA 4R1HA 2A5YB 1JE8A 2ESHA 3CUQC 2VL1A 4YFKF 1S29A 3TC8A 3BXMA 4L9NA 1ZRDA 2P7VB 1ZG5A 1MJ9A 2H6CA 4ZZDA 3TOBA 3B3SA 5ICCA 2PJ7A 1LDDA 1F2OA 1HKQA 2PJ4A 1BC8C 1W7PB 3BP8A 4O5VA 2EV0A 5TJJA 2RN7A 3O3KA 1UHWA 2YR2A 2QWWA 1LDKB 2OR4A 1YW9A 2WC2A 3HRMA 4I09A 2C1CA 4ZYEA 4CXFA 4F9UA 2ZXJA 1I1SA 5ED4A 4P4EA 4WJBA 4P55A 1ZG7A 1YQAA 3P7NA 2FBKA 2KIMA 2QQ9A 4LB6B 4P6YA 5DS0A 1WI9A 2EJRA 4UEZA 3T8TA 3GZ6A 2M5WA 4BHCA 4P9UA 5FD5A 4K3NA 3CO6C 2HC9A 3KP2A 3WTYC 1FY7A 5FO5A 2PLYA 1TQMA 5E1XA 5DUKA 3DPLC 5DEQA 2MH9A 4PXEA 2EFWA 1AMPA 4A5MA 4OP4A 4PGHA 2FF4A 2OA4A 1T6SA 1YW4A 1ZARA 1T0FA 3H8FA 2ISYA 4MHNA 4MRIA 4M6YA 1F9NA 4O3MA 3LWUA 4IHSA 1EH8A 4FHTA 3K1PA 5D5UB 1DTDA 4G8XA 3NA6A 2GAUA 2OAZA 3J81K 1QPMA 2K86A 4HAMA 4XRFA 3S2WA 4P45A 3VH9A 5JI6A 3CLOA 2DPDA 1ON2A 3B7IA 3WU0A 1O3SA 1SD4A 2F2EA 5AIPA 2Z9OA 1IGBA 5CJ9A 2V79A 1ELLP 1M4LA 4I2OA 1J5YA 1EH6A 4B8XA 1D8KA 2K4JA 3WT4A 1WQ2A 1QGPA 4S05A 5LRJA 4GYIA 3ZMTA 3ABTA 1LQ1A 4KUMA 5ICEA 5FGMA 3D0SA 4R6TA 5K8PA 3FJUA 2ACJA 2NS0A 5ICGA 2Q4ZA 4A12A 3M8FA 2MH2A 2ZEEA 4ZX9A 4U0YA 1LCPA 1HBXG 3RKXA 2PG4A 3QRFF 2RDPA 1MZBA 1BI0A 1ZAOA 1MGTA 3FH4A 1ONVA 2ISZA 3BI1A 3MQ0A 3JSOA 2MLKA 2TDXA 3GFLA 2WWYA 1TQIA 4QWQA 4G6QA 3D7GA 2V6CA 4JBAA 4PQAA 1IW7F 1XD7A 5K5RA 1TQPA 2RGVA 3L9FA 4CZZA 2V8VA 2RQPA 2L01A 1I6XA 5HVQC 3V4GA 3WTSC 2V9VA 1BIAA 2VE8A 4L0ZB 3FM5A 4IRIA 4OIOF 1ZG9A 3IIBA 3TQNA 1KYZA 4Y15A 2GLFA 4LK1F 3G3ZA 3H92A 3I54A 2X4HA 3J80K 2PI0A 1MDMA 1W7PD 4N0BA 2W84A 4L18B 3HSEA 3DLJA 2DTRA 1GVJA 3E6MA 3BJAA 4LB5A 5K8NA 2DAOA 1G3TA 2E7XA 5D4SA 2CGPA 3HRUA 1GYTA 3IWZA 4P96A 3V7SA 3FX3A 3KP7A 3ABUA 2HYFA 2L54A 1W4MA 5DCFA 2A68F 5F6FA 4CHUA 3QU3A 2C6PA 2CTCA 5KK1A 4HF0A 1C0WA 2FMLA 2ABZA 4CICA 3MEXA 1BPMA 5D8NA 4ZZLA 3WTUC 4HLYA 4KT5C 3KZWA 3FEDA 1S7AA 2ESNA 1OYWA 5LHHA 3EDPA 4EVIA 1B6AA 4I98B 4LFUA 4KN7X 4EGZA 2EFQA 1R1TA 2VXZA 3U9GA 1FYKA 3PQJA 2XEIA 3S9LA 2ZMEA 2B0LA 4ZY0A 1KQ8A 3HRSA 3QU6A 1LDJA 3U2RA 4MHPA 4RB1A 3B3TA 2PE3A 3PBEA 5H6RA 3NFZA 3FMQA 1Z7UA 2V8HA 4U7DA 4OKOA 3J7AO 2DI3A 3CDHA 1ZYRF 2OOTA 1CBXA 4OC0A 3N4MA 1V3FA 4X2TA 1HSTA 2FRHA 1FT7A 2XROA 3B73A 1XSVA 3LWFA 5K5QA 1FYLA 1ZG3A 4PXCA 1DPRA 2IMOA 2HR3A 1Z9CA 1OYIA 4RUHA 1R5GA 1TF9A 1XJOA 3RYPA 4H0EA 1Z6RA 1E17A 3KLNA 7CPAA 2HTJA 5E8GA 2H09A 2UXNA 2O61A 1YYVA 3ZMVA 3VEPA 4RAZA 5FFXA 3CO7C 5FD6A 1OPCA 1USSA 2IA2A 4ENKA 3GO5A 3W6KB 3REOA 4R79A 5LYIA 2YSRA 2IPQX 1F4KA 3QNVA 4IHTA 4DUKA 3JSPA 2KIFA 3NH4A 5D5WB 1U5TA 1XB4A 4OC5A 2Y0MA 4K2EA 3DP7A 2EV5A 3FXUA 2DPUA 1KA8A 4MEYF 4UIAA 4EMSA 3KP6A 4DNCA 6CPAA 4KA4A 1AOYA 3GXOA 2EFOA 2V1XA 2QYVA 2J5OA 3D68A 4M74A 3PB6X 2DU9A 1XGSA 4CYDA 4U0VA 3WTVC 3RKYA 2BOAA 2FA5A
chains in the Genus database with same CATH superfamily
3F8KA 3JRFA 2VBQA 2LKPA 5FKNA 3F21A 1EF4A 3KR4A 3T90A 5L3DA 4N4NB 1IOIA 2FMYA 3W2WA 1CPSA 1G2HA 4B3AA 2XHKA 2VXKA 2CUEA 3LSMA 5G21A 4C9EA 1DPUA 4Q36A 4J3GA 3PBBA 5CKTA 2QSHX 2KZGA 1S5LC 2E35A 3FNCA 5EMIA 3LNQA 2KJBA 2P0WA 2PJ5A 3Q9SA 1ETXA 1PUFB 3ECOA 4C2UA 3V7RA 3GLXA 5E20A 2CQ7A 4S04A 4B43A 2LD5A 5CVVA 2EA4A 3LA2A 4I99C 5BOXA 4EM0B 3MWMA 3KETA 1QSNA 3F6OA 2ZXWH 4FWUA 4FISA 1GHCA 1HSJA 4IVNA 4FX0A 2W82A 2Z16A 1SMYF 1ZGJA 2G9WA 2Z5UA 2C6CA 4KSAA 3PM1A 4NDLA 3G1OA 3ZQQA 4F52A 4DZPA 1VIXA 2HZTA 3HTSB 2X85A 2VT2A 2PMUA 2YNDA 1KZHA 2XEFA 3PRTA 2VB6A 3A2KA 2BY0A 4Q48A 4XR6A 1O3TA 3IKTA 2VODA 2M8EA 3BPXA 5F1RA 4AVZA 2JEWA 4AG9A 4C8CA 5A2QK 3OYEA 2PN6A 4LGWA 3T0YA 1CPXA 3HM5A 2VOPA 4F8ZA 1KU2A 3ERMA 3HUGA 2CQKA 3KP4A 1VBHA 3FF3A 2XDVA 1J75A 1NXJA 4HBLA 5FFZA 3HSFA 2DK8A 2XKPA 1S72I 1F2PA 4M3FA 2QBYA 3FM3A 2DA3A 2HWVA 1W0UA 1OZPA 3RQ4A 2ZEPA 5CBMA 2DMQA 3FXRA 4C8PA 3GFMA 3GEZA 1Q2YA 2JMWA 3B02A 3NH8A 3VOEA 3DSBA 3FISA 2BEIA 1MKMA 1IN7A 2PEXA 1VZ0A 5CPRB 4A6EA 1ZRCA 5J1QA 2EZAA 2GIZA 4C99A 2DCEA 4U7BA 4RAFA 1H8LA 2DQRA 2QSFX 2F4OB 1GXPA 2EFPA 3OSGA 2XAJA 3BTCA 4HYEA 3UY5A 4EJTA 4P10A 1HF0A 3FMCA 4LIVA 3O8HA 3W6XA 4XOTA 3CCUI 3KZYA 4FBEA 2WV0A 2V1UA 4IOCF 2POKA 2W48A 5L3FA 4YIIA 2JSPA 4MGRA 2YU9J 2GZWA 2M7BA 1MMNA 3BLYA 2HEOA 1R71A 4A3DJ 5HVFA 3U1DA 3C3WA 5E18F 3TKYA 4PDKA 2CJJA 3WGHA 1W7PA 1A2ZA 2MW8A 2EO8A 2FE7A 3CUOA 3HZJA 1U3EM 2EZLA 4IQJA 4AB7A 2PJRB 4EFDA 3RYOA 2R3SA 5C82A 3DBHB 2BVLA 2FE3A 3D2MA 5HVHA 1TW2A 5FVJA 2K3FA 3WG9A 4MHGA 2ZJ2A 3SZTA 3TO7A 2YX4A 4V2FA 4A5NA 4BBSJ 1LOKA 6PAXA 4MI1A 1LJ9A 1UG0A 1IUYA 3BJ8A 3MZHA 3J80Z 1DIKA 4HV6A 4DBQA 4JYWA 2B3VA 2ZEMA 5DD4A 1A31A 2PVVA 1L0OC 5LBQA 4ZI6A 3H9QA 4WXHA 2ADUA 3HC7A 1WRJA 4C3JJ 1MBJA 2B9SA 1NK2P 3FXTA 1QHHD 2OZGA 1M1EB 2EZHA 2XAFA 4XLNF 4AIHA 1FC3A 4ABZA 4P4DA 3E5QA 2JPBA 1BIBA 3WHCA 4M71A 3HHGA 3V7CA 4M6HA 4HEA2 3H1CA 4M9XA 5LGTA 4OC4A 4NQWA 3FYNA 4A32A 5JLWA 1K79A 5FRMA 4NGNA 3LSRA 3JRBA 4U87A 3ELKA 4CCOA 3G3SA 4A3KJ 1YOVB 3F6VA 3H5RA 1OR7C 1EE3P 3VWDA 1CF7B 5IR2A 1FT9A 3I9V2 4HA8A 2VIXA 3KIOA 4JWPA 3KX2A 1D5VA 2LC2A 3LSKA 5EEHA 4OIQF 2PIYA 1ZG1A 4I49A 4RA2A 1LNWA 2VE9A 1Y0UA 1SEUA 1FTZA 1HEEA 2JSCA 2Z1DA 1OQYA 3A01A 1XX5A 2FVGA 4P4BA 1SMTA 2HOAA 4U0WA 3FHZA 1L3LA 1DP7P 2KIUA 2FIAA 2GLOA 4HW0A 4HF1A 2I79A 2NMTA 2KKOA 3R96A 4RGSA 1GGOA 4C8TA 3I59B 4MTEA 5A28A 5HS7A 4M85A 3D7HA 2B4DA 2Z0ZA 3DKXA 3IJ3A 2XF7A 1Z9UA 1J4JA 3B3CA 2ZW4A 3PB4X 2RFHA 2KQRA 4MFZA 1WKMA 4DYQA 2P6FA 2EPFA 1SFUA 2VC1A 3KP5A 4H6UA 2BW3A 4C7IA 4OWRB 4UXNA 1R36A 1Q1VA 2JA5J 1T33A 3TCVA 5CLSA 2VL8A 1MJBA 2NXNB 5M5YJ 4YEJA 3K1NA 2V9KA 3F22A 4GXOA 4IUSA 2JTVA 5J47A 2O53A 3SJEA 3QQAA 2RV8A 5L3CA 3K4NA 3BJ6A 4LK0F 2STWA 1J3LA 3QP5A 3DPTA 1MD0A 4B47A 3ASOH 1R3NA 1USTA 2KFDA 1QZYA 3CCYA 4X6AJ 3QP6A 2Q51A 3HTUA 2F7VA 5B5EC 1F5TA 4KOSA 4Y49C 2NNYA 1W0TA 3I4MJ 4C9AA 4B09A 5L3GA 1U8RA 1NSAA 1Y0YA 2VEZA 1Z2LA 1YIOA 4OU0A 3GF2A 4PSXA 5GCNA 2JDDA 3TT2A 3CT9A 2R4GA 3NQOA 3F8BA 4PFOA 2PJBA 1IGNA 3AG3H 1TZLA 3O6BB 3E0JB 3D5SC 3V8IA 2JA7J 2OJED 2Y0SN 5L3BA 3IWEA 2KIQA 2M7AA 3L09A 1MBHA 1I6HJ 4MFKA 3BQYA 2DMUA 3R6SA 2AFOA 4F7ZA 1N75A 1CGPA 5M3FJ 4IHMA 3BG6A 4IF4A 2O3FA 1T0FC 5LD2C 4TNUA 3IO1A 4A3MJ 3VPRA 2PJ3A 3DBLB 2P6GA 4HSTA 5CYVA 4A30A 3CLQA 1WWZA 4OMEA 2DJIA 2D2WA 4CAEA 2EV6A 3ISZA 2EWBA 1REPC 4BEHB 3TMOA 3CXQA 1V5FA 2X1EA 3R60A 4UV8A 2BYVE 3F3XA 5LEJA 3PB7X 4C8FA 4ZTFA 2XEGA 4UCNA 4BQOA 1K4SA 2JPCA 3WGIA 4WWCA 2VOOA 4PV6A 3I64A 4HDUA 1U5TB 1WWXA 3C18A 4IL6C 1YHQI 2R7DA 4BDYA 2PJ0A 4RN7A 2R0QC 1X1DA 3CPXA 2GE3A 1P4NA 4O23A 4BQQA 5GAEJ 4ZDPA 3RYRA 1WI3A 2YS9A 3E6DA 4LMYA 5AG5A 5F5XA 4GO1A 4X0GA 3SI0A 1HW2A 3OOPA 1HKSA 2PQ8A 3CC7I 4OOIA 4UWJA 1YQEA 5G20A 1LFPA 5IOYA 5DM7F 1TWHJ 2GU2A 4YWYA 2COMA 2B5GB 3S93A 1Q2DA 2XAHA 4ANJA 1ZRFA 1X10A 4ENMA 1A6IA 5IB0A 4WF2A 1Y7EA 5CQEA 4Q4ZF 5E17F 3HOSA 2OCEA 3IRQA 3D3SA 2IQ6A 2VBYA 4CGLA 1OFCX 3TOAA 2C6YA 1VHOA 2L7KA 4OLLA 2VLAA 1ZGAA 5J1YA 3DR8A 1N25A 4LLLA 3T1BA 3RNZA 4MO7A 3WTWC 1IRZA 3GFIA 2FT0A 4PJLA 3IU2A 3KZIC 4XPDB 4X3RA 3P5JA 4C3IJ 2LBFB 4D7MA 3M9AA 2E1CA 2ZO4A 3ZPLA 5HDKA 2OCCH 1R7JA 3FXQA 3DKWA 2OH1A 2HDDA 2MLGA 5KAFC 4YIRX 2R5YB 3EXNA 1T38A 2IS4A 2FD5A 3GUDA 4ZH4F 4RBOA 2QA4I 4UY8I 5IYDJ 3PFYA 1YVOA 4KSFA 4XLHA 1IC8A 1XSDA 1IXSB 2VKVA 1FX7A 3PUFA 2O7OA 3KPHA 4BAYA 2OLSA 2ETHA 4ZYHA 5LHGA 3CCJI 1YJNI 1IG7A 3SFZA 2WPWA 4XSZF 3L2QA 2GWRA 3JRAA 4G7OF 5B1BH 1WZ2A 2KJCA 3K2KA 1A04A 1S5KA 4XRMA 4MFQA 2PJPA 2O8XA 3GTKJ 4AU7A 3K1MA 2XVCA 1OR7A 2WZNA 5HNFA 1JT6A 3PB9X 5K1YA 5JQ4A 3U1BA 2JWTA 2IAIA 2DBBA 3I0TA 2F4IA 2GXBA 3BCBA 1P4XA 2E36A 3I4NJ 1YG2A 2M0MA 2PRQA 1BO4A 4BYYA 2HVSA 1T08B 4XSXF 4BKXA 4HX8A 2A6TA 1XMKA 2OBPA 2O4HA 4ESJA 2Z11A 4FE4A 2OV7A 3WU2C 4NSQA 2W00A 2P6TA 4G9YA 1PUEE 2N8GA 2ZXIA 1M44A 3PFOA 4AD9A 4MLOA 3MZYA 1YX3A 2WUUA 4I0AA 4U88A 4D7NA 4L5IA 4E7HA 3OYKA 5BPIA 3TGNA 2LK2A 4QPOA 4ZDLA 2UZKA 2VI7A 1V0CA 4UF4A 2DFHA 4N9HA 3T5XA 4E4HA 4ESFA 5IOZA 2DA7A 3HGYA 1AYEA 3K2AA 4CA0A 3R61A 2QQ8A 2WYRA 3D4UA 4BHBA 3VWEA 4IHWA 3PNVA 1QSOA 3BJOA 3LAJA 4FUUA 3I55I 1DGRM 2K5CA 1FSEA 1I3QJ 2EILH 3SXNA 3RTRA 5EZGA 1IO2A 2VBXA 4M9SA 1EH7A 3IV5A 1KUXA 2RNJA 1TIQA 2F5CA 3JAMZ 4D5FA 1VHEA 4ZYAA 1VQ4I 3S6GA 2P8TA 1XC5A 3HPHA 4C7HA 4UVAA 3I56I 4JVOA 5JFRA 4ENJA 4FD4A 4MI4A 3G8WA 4CCJA 4CYPA 3Q5FA 3AG1H 3BWGA 4FE7A 1BBYA 2IS1A 3VARA 4COBA 3CC4I 1OLTA 1QNTA 2QLZA 4I01A 4WCGA 4Q38A 2ZOFA 3PNYA 2CW0F 3JRIA 4LJZF 3K70C 2ME0A 2ZMEB 3ZXSA 3TP0A 2QMLA 1VQLI 2L4AA 3D8PA 3NRVA 2YNCA 4DOZA 4EVYA 3T0TA 4B48A 2H27A 3OYLA 2WAQA 1IZ1A 2JDCA 2E1NA 3DEUA 4KN4X 4J0NA 1O4XA 2J9AA 4W97A 2W7NA 4XLPF 1KU9A 3IWGA 4PPZA 5CVIA 5HLIA 3LA7A 1DU0A 4V19K 4BJTA 4HX4A 5B3SH 4LQGA 5ICFA 2FJ1A 4Y13A 2ZEOA 4I6ZA 4IHVA 3GBGA 3PEIA 1D8JA 2Z2SB 1FP2A 1Z21A 3SQNA 2DOAA 3R4KA 2J8NA 1ELMP 3JW4A 4EWTA 2HPMA 3G1MA 2DYRH 1E3PA 4M73A 3ZOBA 1KGSA 2QVOA 4KITB 5LLQA 1TWFJ 1LEAA 3F23A 1ZLIA 5AGEA 5HLTA 5AG7A 5CNPA 4E5SA 3FWEA 4E7LA 4CCLA 1DUXC 2AFSA 1S3JA 5EBVA 2VJ5A 4EJVA 3PUBA 1LFBA 4C3HJ 1YVKA 3KGQA 2QEXI 5E96A 2BY3A 3LL7A 2W57A 5DS9A 2AFXA 3FBUA 2CSOA 4LD5A 5BS6A 4FT8A 2IBDA 2Z3MA 1V5EA 1P4WA 4LIUA 5C4JJ 3ICUA 2CUZA 2IA1A 4LLNA 2BCOA 4E2AA 4A95A 2XF5A 4UBRA 1ITYA 3D7FA 3I1UA 3SHFA 4HSRA 5LHIA 2EK9A 3MRUA 4Z6YA 4A69C 2IVMA 3S14J 4NGSA 3SI1A 4AVPA 1XMBA 1Z91A 1SD7A 4M3GA 5CVRA 1JXSA 4NGMA 2Y0SA 5HVGA 4LLGF 4Y33A 2OZUA 2DXIA 4PJMA 3L2NA 3M1CA 5I4MA 4PFPA 2KRFA 3JRHA 2FQ3A 3OYBA 5JHUA 1SFKA 1IV8A 1MBKA 2DT6A 4D0PA 1K83J 5M5XJ 2WB1N 3M7GA 1W1WE 3C2HA 3CCLI 2F5IA 1ETKA 4DJLA 1JHHA 2XV4S 3WODF 2D1VA 4H2KA 2K9QA 1TP4A 4F93B 4EMEA 3DF8A 2WTEA 3H8GA 3FXOA 4B5PA 3ZQLA 2O6GE 2AQEA 3GTPJ 4YFXF 1EV7A 1TNSA 4RLQA 3P9CA 1LRZA 4P44A 3CUQA 3WC6A 1LB2A 2JRTA 4PGGA 3RDIA 2EK8A 4TJVA 1HQCA 2H94A 4UNOA 2I3CA 1ZKGA 2Y31A 2KT0A 1Z3XA 2CNTA 1IN8A 4F91B 2DDBA 2MBFA 2ZBKA 3R0AA 1AHDP 3WTTC 1Z8XA 2C5QA 4C8AA 2R5YA 3TDZC 2M8GX 4JP0A 5F0CA 2EWNA 3M4OJ 2FUG2 1SAXA 1RXTA 1Z67A 1Y8RB 2GXGA 3DEEA 3CMAI 2Z3OA 2D0OA 3OIPA 1VQOI 4U9YA 3VYRB 3GB0A 4DYOA 2JVHA 1XGOA 2OB0A 1YITI 1B4AA 2FOKA 1F57A 1R1VA 3QPTA 4HDVA 2AJ6A 1RTQA 2BEOA 2O8KA 2FL4A 1Y8QB 2ANPA 3J7YJ 1I1GA 3CMMA 4NB5A 1G8XA 2GA2A 2NYQA 1FWZA 5I0CA 1Q5XA 3L00A 4RS2A 1K7AA 2ZEFA 3KP3A 2GXAA 5KTCA 1VTNC 3MCZA 1POGA 4OINF 4A3CJ 2H5MA 2HKOA 2MG4A 1ULYA 5DCMB 4LG0A 5EF6A 5GPAA 4F55A 1HDUA 2LF7A 3KYLA 2BGCA 1XBUA 3ZQCA 2NSMA 2K40A 1OJLA 3ZQIA 1D3YA 5H6QA 3GTOJ 4HNTA 2CNSA 4E94A 5LYDA 5JR3A 4MJXA 1MSEC 2GQQA 2DA4A 4EEFG 1P0HA 3FVLA 2CF4A 4MFPA 3OYIA 1F36A 5BQTA 2HI3A 5GADJ 2HQYA 5K8OA 1ZHFA 2K9LA 4W1UA 1BM9A 1R6RA 2BXYA 4L9TA 5HS8A 2BSWA 2GBYA 2M3AA 2CO5A 2HDWA 2BUEA 4ESBA 3E1SA 2REEA 4HNYB 1M6VB 1FEXA 3MN8A 2EH3A 5FB2A 4XBFA 2R8VA 2VXDA 1O3RA 4M3EA 1E0EA 4BBHA 4RGUA 3TDUC 4H89A 3Q9VA 2M30A 2Q04A 1FBSA 2DJNA 2DFFA 2MYSA 2E19A 2Z99A 4OIRF 4GYGA 3C2GA 1QA6A 4AXVA 4G12A 3JRDA 3OYNA 4NC8A 4OC3A 4IK2A 3DXJF 1X1BA 2LNBA 1I27A 1B59A 1B9NA 1ETOA 5KHDA 4OADA 5TGTA 2NVXJ 1IICA 4HQMA 4O6JA 2HS5A 4UFWA 3DCFA 4KIBA 3VYTB 3JRGA 3F5BA 4BS9A 3OYDA 1B8IA 3BPVA 1MMDA 3IAM2 1Y9KA 2PDOA 1WSUA 2QBYB 1JQGA 2BBYA 1ODDA 3SFIA 1R9TJ 4C2YA 2QCOA 4LX9A 1I1DA 3I9SA 4HX7A 3TW7A 5ILUA 1JDBC 1RNLA 2E34A 5FLXK 1R58A 1ZLJA 3BZ6A 5D4RA 3QYBA 1ZREA 1EZBA 2BHZA 2M4GA 4M3SA 5L3EA 1CE8B 2YJTA 3MFKA 2EZIA 4BQNA 2W85A 2VT3A 1PU9A 1T8IA 4BBRJ 2WBMA 2PMHA 3K4KA 5IYBJ 4CCNA 2R7SA 1G3SA 3BCAA 4P4IA 1BR4A 2VN2A 1SD6A 1S7EA 2B3UA 1IOFA 2E5NA 1V55H 1TW3A 3KHXA 4M72A 1HDQA 2XSJC 2ODFA 2Q7SA 3KKWA 1SVOA 4XRSA 3HDDA 2A5WA 5E3OA 5E1WA 5F0HA 2AFUA 3JTKA 4L8AA 2HVRA 3TE4A 4COGA 3MN2A 3WC5A 1B72B 1BXRB 1PP8F 4E7ZA 2LMDA 4JYKA 2RNGA 2L3DA 4WXCA 2XAUA 1N77A 2QIRA 4G1PA 2GP4A 3SZPA 3QYFA 3DU5A 3VSLA 1F43A 2E28A 1JTXA 5E8IA 2LLKA 3S2HJ 2XEJA 3HG9A 4XM3A 2F8HA 5J4VA 2E7WA 3EIFA 2HQRA 1VKCA 2P7CB 2E2JJ 2FEZA 1X2NA 5F64A 3OWCA 3SJFA 4G94A 3BI0A 4CAVA 3K2ZA 1IY7A 4DQ2A 3K4BA 1H88C 2XGEA 4ZY1A 1OISA 4TWEA 5JVTA 4IX7A 3CMYA 1OMIA 2QQBA 3RAMA 1I21A 1NTCA 3PIPF 3KLOA 1QPIA 1UWYA 1O7FA 1R5ID 1HDDC 2O28A 1UG2A 1YJWI 2ZEDA 4BU2A 4MCRA 1KBLA 3CZXA 2ELHA 3VB2A 1RRJA 1VQ8I 4IIYA 2HZDA 4A2ZA 1BA5A 2DFIA 2W24A 2Y69H 1YW8A 2Y48A 4MMOA 1YGHA 3OYCA 3LMSA 1MNMC 1T2KA 1XGMA 2ZMEC 4ZX8A 1JKPC 3CP8A 1YX0A 3CCEI 3W6JB 1ZYMA 5FRNA 3MKYB 1PJRA 2LSOA 4Y7NJ 1AUGA 3NWTA 3H9GA 5HH1A 1BOBA 1XEBA 3ROUA 3OYHA 3VATA 2J8RA 1IV6A 4C84A 1XCVA 2Z3KA 4NQWB 3HOTA 3IGRA 4UHTA 4PXDA 5HS9A 1MW7A 3KEOA 4R7MA 1XS9A 3OS2A 4MHYA 3FF5A 3OR1C 4E0AA 3SXYA 1SC7A 4M3DA 1D0ZA 3N7ZA 3SEQA 5LRSA 3P2HA 4H6ZA 3FIXA 2JA2A 1E2XA 4BMHA 2G7UA 5LRGA 3N97A 2X48A 3S6HA 3A01B 5J8FA 3PNTA 2D4PA 5H84A 2HI6A 1ZG8A 4C9YA 1X4OA 4MFDA 2EBIA 4DBRA 3SDBA 4IIXA 3WHBA 1FOYA 3E7LA 3GYAA 4XIDA 1R22A 1AWCA 4NGRA 4CGNA 3CJTB 3RZDJ 4IEJA 1QSMA 3PFEA 3LAPA 5GPCA 3K9UA 2QF7A 1YS6A 3ZMZA 4XL9A 1AKHB 1I12A 5HODA 1J7KA 4MJ8A 1IN6A 5TISC 4UCPA 4B5OA 1BJAA 4YFJA 2Z3YA 3K7AJ 1RZ4A 5KVRA 4FCYA 1G6NA 2VBWA 2O03A 2X6WA 3LSTA 2QKMB 3IL2A 1JT0A 1BPNA 1P2FA 4GDFA 1X3ZB 2X6OA 4PCQA 3D66A 2R7VA 1Q7LA 2H8WA 3QYEA 1S7KA 3HHHA 3HOWJ 2KL4A 4KT6A 4IOAF 4ENNA 2X0LA 2A07F 3OIQA 3GW2A 1ZO0A 5IT9K 2CU7A 4FETA 4BHPA 3ZP5A 1W5TA 4WXDA 1RUNA 1XOVA 2JN6A 3PSIA 2PJ6A 4MQVA 5D8LB 4NGQA 5LYLA 1TT0A 2K4BA 1D1CA 2ZFWA 2QZ8A 2Q4YA 4UEEA 3AFHA 2M9HA 4UUSB 1VQPI 4BNCA 1IF1A 2XC7A 3OV8A 3G73A 3CCVI 4QLCU 2IRFG 2PRBA 1QRYA 4DIQA 3B3WA 3BR5A 4EQQA 4XPKA 2OC6A 1P4AA 2B63J 2OTJI 3KZZA 4CDGA 3CF5F 4Q5SF 4OAYA 1JWQA 3EQLF 2AFMA 4Q7AA 3W91A 2YGWA 4MFJA 3V38A 1IN5A 3GZ5A 2V6EA 1V54H 4FD5A 3A9LA 1BN5A 2ZNZA 3BDDA 3ESWB 5GAGJ 3L2UA 3N5FA 4XK4A 1GV5A 2E60A 5JLXA 2DLLA 1U8BA 4MHDA 3PSFA 1QO0D 4HOBA 3S1MJ 1TF8A 2MP0A 4ZYQA 2OQGA 4I0BA 1KONA 2H1LA 4MTDA 1P6RA 1IYLA 1G3YA 1FSHA 1X3WB 4LITA 1QVTA 3I5UA 1H9GA 3P9IA 2R5ZA 3FEEA 1TKFA 3CUQB 4A0ZA 4ZJZA 3S6KA 1UHMA 2L7FP 3F8FA 3LA3A 3JAMK 1B8IB 2IA0A 4V2GA 3R9FA 1TKHA 2DK5A 3PB8X 4G7HF 2D5VA 1J9IA 4RI1A 2F6CA 1Z6TA 2FSWA 2X1DA 4KUAA 4TJXA 3GTLJ 4F0YA 1IRFA 1BLLE 4K30A 4CH7A 1AU7A 3KL9A 1WH5A 3L2CA 4GM5A 1LFWA 2Y2ZA 5EG0A 2AFZA 2LP0A 3SHPA 2IJLA 3GCMA 4NNJA 2XGXA 2RVCA 3Q0UA 2G0BA 3UNGC 2XAQA 2F5FA 2WY7Q 3MKLA 4TV7A 3SYTA 4E7KA 3IU1A 1Y7RA 4ZGYB 4JD6A 5BNGA 4EATA 2ECCA 3JTGA 4CGPA 3BTJA 4UB8C 2K3PA 3ZCOA 1TLHB 2L7MP 2A4NA 2FCKA 4YFNF 3BY6A 1ERDA 2GA1A 1FIPA 4A0XA 1IXCA 2HDCA 2OPTA 5DCMA 1UB9A 4ONWA 3OIOA 3ULQB 4MEXF 2NAZA 1X12A 3IHUA 3RQIA 4HKFA 4RAYA 4RGRA 4PUSA 1UHSA 3RPQA 2LBFA 3CDXA 4UVBA 2A3SA 4KNYA 3KQZA 3MD2A 5G1ZA 3C8OA 3NH5A 3WTXC 4GCVA 2WAQN 1S7NA 4YU9A 3TLGB 3H5NA 4A2UA 4E7JA 4EGYA 1JGSA 2QQAA 3RKWA 5BPDA 3IWFA 4UA3A 4A38A 2DODA 1PVEA 2A6EF 3DV8A 1S60A 3WTZA 4I76A 2EZCA 1TWAJ 2VJJA 2G7HA 5D6EA 1U9NA 2J5PA 1ZH5A 2AE6A 3SDGA 2KDOA 3ECHA 2BO9A 2AUMA 4GXHA 2VQHA 2VJ4A 3BR2A 2BXZA 1X4PA 3E6BA 1MH4A 3LOCA 1Y9WA 4KVOE 2ZC2A 4QC6A 3LSPA 1JKQC 4L9VA 4A94A 3D5LA 2Y75A 1K78B 4XRSG 5J4YA 1V4RA 2DA2A 5JGFA 1XDUA 2IEKA 1R5HA 3G1LA 2Q2EB 2LREA 4IQ4A 3OL4A 2K85A 3QB8A 3JRUA 1R43A 3OYFA 1TC3C 2EIMH 5IT9Z 3RPUD 1VI0A 1ZL0A 4FASD 1D0XA 2JA6J 1JDEA 1QMUA 4OIWA 2LY1A 3CTAA 1OCPA 2YPRA 1UJ8A 2Q1ZB 2LDUA 3TFYA 2XPUA 1YLFA 1A35A 3AL0C 4CDJA 1G3WA 4PSWA 1LANA 4KUBA 1R49A 3ABLH 2ZNYA 2K9NA 2MC3A 3MKWB 2LRDA 2R7UA 3JREA 5EC4A 1ZLKA 2IS2A 4QB9A 2V4JC 1KQ9A 1RKWA 1XMXA 3A4CA 5LFAA 1H8AC 2PJ1A 2PJ8A 1H89C 1MMGA 2Q0YA 2OD5A 4OC1A 2R7OA 2VQYA 3V8KA 1FBUA 1HLVA 3H3VK 1Z8LA 1XTAA 4EM2A 1YW6A 3BROA 1UZCA 5EEGA 1XCBA 4CRZB 5TRDA 2I8DA 5DDGA 4JQFA 1BI1A 3CP2A 4BJ5C 1KC7A 2NS8A 3F0AA 4KOUA 1B72A 4B10A 3ZN0A 3CDLA 1FMWA 3BG7A 5B66C 1HDPA 4A3FJ 3WABA 4BINA 5D5VB 2QENA 2IW5A 4IO9F 2WY8Q 3LACA 2JUCA 1O7LA 3O8GA 2M34A 1R00A 1JJ8C 1ON1A 1ZR2A 4JK1X 2COBA 3C2BA 1XG1A 3PQKA 1YMEA 3EZBA 2CV2A 4WWVA 2CFXA 4M6GA 1U6GA 4BXUA 4AIJA 3B6CA 2HQ5A 1DQUA 2X51A 3S3NA 2P5KA 2IT0A 2CWEA 3CCSI 2IXSA 4OMYA 2HQNA 2FBHA 2WA0A 3LFKA 4F9VA 1PUFA 4NFRA 3HKZA 1T56A 3BZCA 4NHJA 2JUGA 2AXLA 1FZPB 1N71A 4LOCA 5IP6A 3HL2A 3S1RJ 3RKQA 5D29A 4HQEA 2VQLA 4C86A 4LUAA 2O5RA 1VGYA 4OMZA 5FROA 4YIFA 3ISPA 1YFHA 1FLIA 5IY5H 2ZXVA 5K8MA 1ETVA 3FK7A 3JUWA 2EB7A 2R7FA 3QOPA 4HPQA 5HLHA 4UIBA 2KISA 3DGVA 3ZN1A 2K27A 4CSWA 4ONUA 3KEYA 3JTHA 5CVUA 3EFAA 1STZA 3BZKA 1O57A 2DT5A 1FP1D 1YTYA 1U5TC 2ZW7A 4BY7J 1R1UA 1UCRA 1VQ7I 3OSFA 3EYYA 4BH9A 4CO9A 3S32A 3P2FA 3GVAA 1Z1DA 1X19A 2OU2A 4PJJA 4XN3A 5D5XB 2EQRA 3G4SI 2OQRA 2ZENA 2BZTA 4PK4A 4RM2A 3FKIJ 1Y9ZA 1L0CA 2LFBA 5HDNA 5J8CA 1MMAA 3T5MA 3E0KA 1H0MA 3HUGB 4IRHA 3ZMUA 4J01A 4L9JA 3QPHA 4CAWA 2M1BA 4KOYA 3HPGA 1VF9A 4DZJA 4RMNA 2V8DA 2I10A 4ZBGA 3R9GA 3KEQA 3NARA 3CPAA 4MQ9F 4KJZA 3SEZA 3SJXA 2LF8A 1E3OC 2DN0A 3FECA 1LE8B 5E3NA 5K7FA 2XUBA 4UB6C 5K5OA 4IHYA 2QM3A 4E6KG 2Q8KA 2EVNA 4AWXB 1JKOC 3ZQ7A 4KNGE 2L02A 2Q0OA 4KOTA 4MCSA 5EDNA 2Q43A 1IRGA 1FNNA 1U2WA 2ELKA 5THWA 4A3LJ 1QBJA 3LSGA 2AHQA 3SZGA 3QOEA 3I74A 3CXPA 1F1ZA 2PR1A 3BQZA 3MMYB 3PGPA 4BD9A 4IF5A 2M45A 4C8UA 1RI7A 2FS5A 2DYSH 4JZ0A 3FZVA 2V26A 1GXQA 1FIAA 1S7OA 2D1HA 1RUOA 3BR3A 4YRHA 1PP7U 2PJ9A 4C9VA 5IP9J 3E5XA 4NC6A 3EETA 3H3ZA 4PXBA 1RO5A 4JX4A 2JRMA 2LOOA 2VQCA 4Y17A 5LRKA 3FHNA 4NGTA 3TO6A 3G71I 3BHXA 2FU4A 3IEHA 3BC8A 1DU6A 1APLC 1CG2A 3FKJA 4C30A 3VODA 4R9MA 3SR3A 5JYBA 4A0YA 3FMSA 2F48A 4ZC3A 2CMPA 3J7AY 3H8EA 4BQAA 4RB2C 4CCKA 3J81Z 2JQ7A 4EM1A 3KYDB 3IH4A 3VYUB 1B9MA 2DIKA 2HPIA 4C9UA 1Q1HA 4XONA 2TRTA 5H20A 2ZCWA 1WJDA 1CX8A 4PZJA 2FQ4A 1JUPA 2BE5F 2ATRA 3DR6A 4M6VA 5AONA 2PIZA 2P5LC 1SAUA 2FX0A 5DTDA 5ELYA 5F09A 4I02A 5F47A 3EUHA 1Y39A 1MJAA 2GIVA 3IUOA 2GFQA 3PL8A 2D0PA 2YJVA 2W25A 4ZYDA 3S2DJ 1R23A 4Z65A 2W1OA 5C3EJ 3B2YA 3T9YA 1Z4RA 3WU1B 2VONA 1PYTB 4X1EA 2P4WA 4XLFA 2HOSA 4KDPA 1NHAA 2QVPA 4MXUA 3F8NA 4QPQA 3BR0A 4C85A 4IAVA 1D0YA 5LYFA 3A0HC 4BE1A 4EJOA 3H5AA 2PBIA 4RM3A 5ERIA 1GLNA 4F92B 2VZYA 1BI2A 1IN4A 2ID6A 2Z10A 3H3UA 3D67A 3P9KA 1CF7A 4KIFA 4UV9A 3CJRB 1C30B 2ZEGA 4I7HA 2CQQA 4ITVA 1WJAA 4XNHB 4KICA 2VUMJ 5IV0A 3CC2I 3D2PA 4KLWA 3I58A 3A1YA 1ARMA 1WK4A 3KR5A 5FJ8J 2L2OA 2F5DA 3I71A 3I59A 4XKCA 3NEUA 4IXAA 2ZOGA 1AA7A 4G7ZF 2ZW5A 5G22A 2ELJA 1LEBA 4OAEA 1RESA 2AQFA 1ZK8A 2CW8A 1OCCH 3ZMDA 2NNNA 4MNUA 4R3LA 4RB3C 2FNPA 1R4NB 3GUXA 2EK5A 1FOKA 2H8RA 1VI4A 4R76A 1XE4A 4KORA 4U5YA 1MK4A 2CH0A 1MSFC 1D5YA 4GGGA 3PO2J 1FNOA 3RIRA 1YO5C 1YSJA 4XN0A 2LY9A 3DFGA 3V7ZA 1PUAA 1OYYA 2XKOA 3KCCA 4XORA 1ZLHA 4ZYGA 2QGUA 3W6SA 3WGGA 3N05A 3SI2A 5M3MJ 4N9IA 3LQQA 1H9TA 4ASNA 4KIGA 4C68A 1LAMA 2DT7B 3CF2A 4ETSA 2KZVA 1XMTA 1HXDA 3S3MA 5J6XA 3JRCA 3L2RA 4BE0A 5KNLA 4PJNA 4UVCA 1BOAA 1X1PA 3B3VA 1FPQA 4ZY2A 2PJRA 3GTQJ 2VBZA 4KVXA 2CTBA 3H5ZA 4A93J 4AUXA 2L0KA 1HW5A 3ASNH 4RB0A 2PJAA 4QBJA 2XB0X 3HKZN 5HLGA 2NRAC 1UMQA 4G6DA 4XMYA 4P5OA 1OKRA 3T8RA 1HCRA 2E1OA 1MMSA 1W36D 1S6LA 1X2MA 3OYJA 1WJ5A 2HKXA 3HGGA 3DTEA 3V42A 1PDNC 3BG5A 4UEFA 4OAZA 3JR9A 1P92A 1Z77A 2VASA 3SJGA 1K78A 3AAFA 2ZJRF 1QQIA 1WHUA 4X8IA 2DOFA 2PX9A 2M0CA 2GLJA 2DA5A 4MY0A 1RPWA 4ZTJA 4C9RA 3OS0A 3I6SA 1OCRH 1MIJA 1ARLA 4IPAA 1Z05A 2Z3NA 4KZTA 2IGKA 3TLBA 3K70D 2O9LA 1JUMA 2QYOA 2RB7A 5F27A 1Z8WA 3TLZA 5K99A 2E1MC 1QHGA 3ZMSA 2IS6A 4R8FA 2ME6A 3AL0B 1JI8A 2CNMA 3BLNA 4MIMA 4JX6A 1MH3A 1J0RA 4II3A 3TLAA 3FK6A 1LVAA 4GRIA 4Y4RA 3KI9A 2EZBA 1KUYA 3MVPA 3BG3A 1Z8TA 2DEAA 2WPXA 1WGXA 3HJEA 4P4FA 2M87A 4II2A 4XQFA 1K4JA 1S7FA 3E97A 1QSRA 3TYXA 1LE8A 3IRRA 3S1NJ 3ISXA 2DA6A 2HFHA 3NWSA 2PFBA 4KMUX 4A3BJ 2YNEA 5C88A 4XKVA 4FX4A 4OIDA 1TT5B 2NVUB 2K9MA 1DE4C 2B5GA 5J1UA 4AIDA 3TTHA 1BL0A 4XKWA 4KS9A 4IJAA 1K61A 1KU7A 2XB5A 4CAXA 1FJLA 1VQ5I 4P4JA 2LKSA 2F5EA 2DDAA 2RQQA 3GMEA 3M8JA 2Z33A 3V8LA 3MAJA 2EFNA 5CQGA 2JA8J 4U9ZA 1ORKA 3B35A 3K4IA 2F4MB 4RS8A 5JH9A 3DTIA 2XGCA 3LSJA 1O3QA 3IAS2 2ECBA 3HYIA 1ZGWA 3DDDA 2KLOA 4UUVA 3C7JA 2A05A 3OOUA 2HU9A 1ETYA 1IU8A 3E5UA 3QAHA 3LQRA 4MCPA 5LRRA 2QUFA 2HUZA 5K7HA 3HSRA 2V1DA 1BC7C 5A2QZ 1KUVA 3GFJA 3K69A 1KQ0A 3RI4A 3ABMH 1TNTA 1VQ9I 4R3KA 3K10A 1PCAA 1QSTA 5IX3A 2IGNA 2AFWA 3NOJA 1IUFA 1GUUA 2UV1A 2ZPAA 3MGDA 1U0JA 4OIPF 5KTDA 2EUIA 2TCTA 2P5VA 5JHFA 5LGUA 1YRNA 2JK3A 2BY1A 4KISA 4XLEA 1VBGA 4B12A 2V9PA 1YW7A 2BV6A 4HPSA 5HDGA 3NE7A 2FXAA 4EV0A 1CP7A 4NBQA 1XPXA 1I5ZA 1HW1A 1XFOA 3TP3A 3FX6A 3O2PE 2LG4A 4A37A 1XRYA 1BW6A 2FXFA 1RETA 5ILSA 4QVTA 1WCMJ 4Z2YA 2NVQJ 3K0LA 2JZYA 4B44A 4CYNA 1D1BA 1KZFA 2FNAA 3I3GA 4QUSA 2PJCA 3HOYJ 2VKDA 3T8WA 3OYAA 1OCTC 3LSHA 3EPZA 1XN7A 4BEHA 3PO3J 8CPAA 3RBUA 2UWMA 1TWGJ 4J19A 4R87A 4FAIA 1RIOH 4XOPA 5DYMA 1XF1A 4KSIA 3IC7A 3M8EA 5JM6A 2HOEA 1LFUP 4L0YB 2D4OA 1TBXA 1LAPA 4AM3A 2ZJQF 1JHFA 5D8KB 2R92J 2G9DA 2AXTC 2DQLA 2O0YA 2RKHA 4M3BA 5LGNA 5LEKA 4HRIA 3GYHX 3FMRA 3S9NA 2PVWA 2E5ZA 4CRYB 4C2XA 4XNHC 1J09A 3CDIA 4KFCA 2DXQA 4IRGA 2R7HA 4B6ZA 1B1BA 1YS7A 4W9YA 1T39A 4NUBA 2V7FA 1FMVA 1T36B 3E3VA 2UXXA 2DFEA 3H0GJ 2FOWA 2NYXA 3ZQGA 2XPWA 2B7EA 5F1JA 2JBJA 3RJPA 1WH7A 1QZEA 2EZKA 2DF5A 3DQVC 3OS1A 4A39A 2H6BA 4HLXA 1XF8A 3QWLA 3RPUA 1ZN2A 1TL8A 1A5JA 4RGXA 1OCZH 3CZ6A 2JEVA 1XGNA 2D45A 3COAC 2CIJA 2GREA 3IP4B 4XLAA 3VFZA 3CJNA 2MA3A 5FLXZ 1HKTA 2STTA 1ACIA 1BAVA 1M1DA 3B8GA 4M6IA 4L5EA 5EYRA 5GP9A 2KHMA 4YRVA 2XASA 3DLAA 2CV0A 1BW5A 1Y56A 5C44J 5BMZA 1XSXA 3K9TA 2XGDA 3HEFA 4YN3A 2JVGA 1IAWA 2V77A 4KMFA 5HXDA 2XRNA 3DEWA 3S9MA 1TXRA 2PJ2A 1LKXA 2ZELA 4B11A 5IT3A 3V8JA 4CGZA 1BR1A 1A36A 2KRHA 3TBIA 4HG2A 4HV5A 4L5JA 3L2VA 2CFOA 4A3EJ 1S3ZA 1SFXA 3IC1A 4EJUA 2CW7A 1A9XB 3FIWA 3ML6A 2YUSA 4R8HA 3E6CC 4BE2A 2V8GA 1UFMA 4MCQA 4KYWA 3F8CA 1OBRA 2JBKA 4MHZA 5A27A 3H9JA 2REFA 3HOVJ 2NOGA 2K02A 2I5UA 2XAGA 1ZR4A 3H0DA 1X58A 2CY2A 5EGOA 1IDYA 3IKVA 4E70A 3BJ7A 1Z5RA 1ENHA 3C1DA 2PCUA 1S8NA 1K4TA 2E2HJ 1J2XA 3MKZA 2ZEHA 3NE8A 2L4MA 2OTLI 1NBWA 2MD5A 5AIQA 1M4DA 4CS0B 4NC7A 5E79C 3TLGA 5E3LA 2L9NA 4XPDC 1N78A 5F46A 1DDNA 9ANTA 4FD6A 3GKRA 4AIKA 1XDSA 2K7LA 4HZFA 2HGCA 4UFXA 3HOXJ 3TX8A 3HRTA 1TTYA 2QECA 2DO7A 3RZAA 5BWAB 1ETWA 3FRMA 3GWZA 2C6GA 3DU6A 3QPSA 1IXRC 4JX5A 4DJAA 1WJBA 3GLJA 4A3GJ 2DW4A 3WR7A 5DWNA 5CPAA 3LD2A 1T98A 1S9HA 3HLPA 2MFZA 4QIWN 3BR6A 3VDXA 5J3LA 5FD8A 3FXLA 3PFIA 4NJRA 1GVDA 1SFEA 2GANA 1XMAA 5DUIA 2X7BA 4LQ6A 5F49A 1J59A 2RC4A 2Q2EA 2BVMA 4Q47A 4F6AA 3M1EA 2LH9A 4BACA 2AS5F 5EEAA 2HB6A 3IWWA 3SXOA 5D6FA 2HTSA 2R7XA 1QQ9A 3D7DA 3TO9A 2OUMA 1VQ6I 1FBQA 2CUFA 3FBNB 5ILVA 4WK8F 4KOXA 1K6OA 4NJQA 2PC1A 4HNWB 5HMNA 3FXJA 5F9MA 1KYWA 4BXXJ 3KFWX 1YLOA 3IFEA 3CMEI 2PMZN 5CVJA 2L9RA 3H35A 3A03A 2EA2A 1SD5A 3KE2A 2VKEA 2YU3A 4A33A 4KOVA 2A61A 3I4PA 1CJWA 4MFEA 1ZELA 4EJWA 3H4QA 3W6VA 2CYYA 2LKXA 4IKFA 3WE2A 4JXRA 2DPTA 1QZZA 1W5SA 3ZQHA 3D5RC 4C2MJ 2A6HF 2VJIA 5IPAA 2YX7A 5E1ZB 2CG4A 1YRNB 1U78A 2JLMA 5J40A 2NOJB 2WSAA 2KP6A 2R7QA 3EUAA 5J1RA 1KEEB 1KU3A 3GX4X 3I53A 1XIXA 3WE3A 4D1QA 4YG2F 1TKJA 3BOQA 5IB9A 1MDMB 1W36C 3K4MA 3HOZJ 3F72A 2HYGD 3ZQFA 3G6EI 2FIWA 1X3UA 4JJXA 2UUZA 2HQAA 3VYSB 4OC2A 4WX9A 5AG4A 3HUVA 2OF7A 5DD8A 3R0JA 1Y0RA 3EYIA 4E7SA 3TEDA 2A69F 4LG0B 2XIGA 1IDZA 2BHYA 2JT1A 1I3AA 3F8MA 4CO8A 3TLYA 2OZ6A 3TW6A 1CP6A 1G4DA 1NSLA 3FDYA 4CPAA 2VC0A 1MNEA 1I39A 1YE9A 2ZKZA 3KASA 2WAFA 5DV5A 4HF2A 2P6SA 3K6GA 4M6XA 1FYMA 2QJ8A 3HIFA 4A6DA 4ON0A 2FBIA 1CM0A 3L7WA 4HNVA 4CZCA 3KQXA 4P9FA 4JXQA 2CS3A 3WC7A 5F1YA 4BUPA 2PMZA 1KWMA 3ERED 4M9ZA 3GZNB 4UFVA 3CCRI 2LVSA 5HOOA 1RR8C 1PYVA 1BI3A 2GOXB 1RR7A 2ZJPF 1WJEA 2IJZA 5E3MA 2Q7BA 1HC8A 3PIOF 1WPKA 2IP2A 3KHZA 4ORFA 4R1HA 3G23A 2A5YB 5FLMJ 2ESHA 1JE8A 3OR2C 3GTMJ 1M4IA 3F9KA 3CUQC 2VL1A 2X6XA 2IGMA 4YFKF 1S29A 5HNHA 2R7ZJ 2ZSHB 3TC8A 3BXMA 4NCZA 4L9NA 1LVKA 1ZRDA 2P7VB 1ZG5A 2Z3PA 4KVME 1MJ9A 3KRVA 4B5PB 3B6AA 2H6CA 4ZZDA 3TOBA 3B3SA 3FBIB 3WG7H 3DNSA 4DW6A 1NG6A 5ICCA 2PJ7A 1LDDA 4B13A 1F2OA 1HKQA 2PJ4A 1BC8C 2CQXA 1W7PB 4AG7A 1Y0NA 1DGWY 3BP8A 4O5VA 1G59A 2CXAA 2EV0A 1SVMA 3ABKH 5TJJA 4F0XA 2RN7A 3BT9A 3O3KA 5KCMA 3GTGJ 1UHWA 2X6YA 4P1WA 2YR2A 4CGOA 2QWWA 3OMYA 1LDKB 5F08A 2OR4A 5F04A 3R9EA 1YW9A 2WC2A 1HA8A 4GFBA 3QPLA 4RAGA 2CV1A 3S3OA 3HRMA 4I09A 4A3JJ 2M2EA 2CRGA 2VPLA 2C1CA 4ZYEA 4CXFA 5JPHA 2L9VA 2ZXJA 4F9UA 1I1SA 5ED4A 4XKBA 1W5CC 4P4EA 4WJBA 4CAFA 4P55A 1ZG7A 3IH3A 1YQAA 3P7NA 2FBKA 2Z3LA 1VQNI 4B3XA 2KIMA 2QQ9A 3AKZA 2R7TA 4LB6B 4P6YA 1Z7LA 2ZSIB 5DS0A 1WI9A 4B4CA 2EJRA 4UEZA 3T8TA 5IYCJ 2OZHA 3GZ6A 4NEXA 4MY3A 1MBFA 2M5WA 2MC4A 4N4OB 1QVUA 2E71A 3RSNA 4BHCA 4P9UA 1X1AA 3L1PA 5FD5A 4K3NA 3CO6C 2IL4A 4CDKA 1YR0A 2HC9A 3PJRA 1YLEA 3KP2A 3WTYC 1FY7A 5FO5A 2PLYA 1TQMA 2WADA 2X0SA 2LR8A 1Z0XA 5FKMA 5E1XA 4DYRA 3H36A 1WJCA 5DUKA 3DPLC 5DEQA 2DMNA 2MH9A 2JJ7A 1VHSA 4PXEA 4IZZA 3OWTA 2EFWA 1AMPA 4NF1A 4E7IA 4A5MA 4B14A 4Y52J 4OP4A 4PGHA 2FF4A 2OA4A 1T6SA 1ZQ3P 4Y49B 3KYCB 4G6TB 2ZB9A 4H1HA 3QAYA 3HOUJ 3EC4A 3TLCA 2H1KA 1YW4A 2G3AA 5GTIC 1ZARA 1T0FA 2HXOA 3H8FA 2ISYA 4MHNA 4MFLA 3BG9A 4MRIA 4M6YA 1F9NA 2HOTA 1ZTRA 4O3MA 4IHSA 3LWUA 1EH8A 2X9DA 4FHTA 4J00A 5FKLA 4JOMA 2B4BA 3K1PA 4CYQA 3GLLA 4Y3OA 3X2QH 3J7ZI 2VPRA 1HOMA 1FOXA 5D5UB 2F5VA 3PZJA 2PR8A 1K6YA 3LMMA 1DTDA 1P9QC 2Y9ZA 3HBLA 4BJ6C 4G8XA 2WV1A 4AYBA 2EIJH 3NA6A 1IRXA 2GAUA 2OAZA 4B1RA 3J81K 1QPMA 2K86A 4HAMA 4XRFA 3S2WA 4P45A 2CQNA 5DWMA 3VH9A 5JI6A 4CYOA 4M8DA 2AUNA 1WJFA 3CLOA 2BL1A 1SANA 1D1AA 4A3IJ 5GTHC 2KDZA 2R7WA 3HXLA 2DPDA 3LODA 1ON2A 3B7IA 2VQGA 3BR1A 5KTAA 3CCMI 3WU0A 1O3SA 2KCWA 2ZXHA 1SD4A 3ZRGA 4MBUA 2F2EA 4PJ0C 1QU3A 2CUJA 5AIPA 2L7ZA 2Z9OA 1IGBA 2K9SA 3S17J 5CJ9A 2V79A 3EUHC 1ELLP 1M4LA 3BTLA 4HNUA 4I2OA 1R4MB 1J5YA 1EH6A 2Y9YA 1LUJB 1AKHA 4B8XA 1B6BA 1D8KA 3F0CA 2K4JA 3A0BC 5F48A 3OYGA 3SJMA 3WT4A 1WQ2A 5EGOB 1QGPA 1YX5A 3CD6I 2MGQA 4S05A 1IIDA 3MZ8A 5JVLA 2HXIA 2Q44A 2R93J 1V5GA 5LRJA 4GYIA 4CZ1A 1NG7A 5GAHJ 3ZMTA 1VQKI 3ABTA 1LQ1A 4A31A 4KUMA 5ICEA 5FGMA 3VWBA 1UAAA 2WAEA 3D0SA 4R6TA 4UCMA 5K8PA 3S8PA 3FJUA 2ACJA 1V6CA 1SQHA 2NS0A 5ICGA 2Q4ZA 4A12A 3M8FA 2MH2A 2ZEEA 4ZX9A 2E1MB 4U0YA 2Y30A 1IJWC 1HBXG 1LCPA 1MNDA 3Q0WA 3RKXA 2PG4A 3QRFF 5AG6A 4UUSA 2RDPA 4PK3A 1MZBA 1BI0A 3OL3A 1ZAOA 1MGTA 3JCUC 3T05A 2VKHA 1JGGA 3TLEA 2G0EA 3FH4A 4BGDA 1ONVA 1Y6IA 2QSGX 4CYCA 2ISZA 1GV2A 3MQ0A 3JSOA 2MLKA 2FSRA 4AC0A 3BI1A 2TDXA 3GFLA 3T07A 2WWYA 1TQIA 3S1QJ 1DP3A 2AO9A 4QWQA 4G6QA 3D7GA 4X5KA 2XSDC 2V6CA 2W4SA 4JBAA 4D5CA 1JKRC 1R57A 2ARHA 1Q2CA 2J8MA 3VTAA 4PQAA 3VSKA 1IW7F 1XD7A 1WFXA 5K5RA 1TQPA 2RGVA 2IGOA 3L9FA 4CZZA 2V8VA 2RQPA 2P6EA 2L01A 1I6XA 3AG2H 2G3TA 1GHEA 2R82A 2VI6A 5HVQC 3RZOJ 3V4GA 5EZHA 3WTSC 2V9VA 1BIAA 2VE8A 3K4CA 3BTIA 3LFUA 4AVCA 4L0ZB 3FM5A 3M07A 3ZJ0A 3GY9A 3W3CA 3CCQI 4IRIA 4OIOF 5C4XJ 1ZG9A 1Z4EA 3K4LA 3IIBA 1OCOH 4YGOA 3A02A 5F0FA 3TQNA 1FOWA 3LSIA 4JLYA 4CGMA 1KYZA 4Y15A 2GLFA 2ID3A 2E2IJ 4LK1F 3R95A 1YJ9I 1E3HA 3G3ZA 3H92A 3I54A 1JJ6C 4KLVA 2X4HA 1VQMI 2M4KA 3J80K 2PI0A 3AG4H 1MDMA 4C2TA 2KRCA 1JUSA 1W7PD 4N0BA 3PP9A 2W84A 4L18B 1SVLA 3EUKL 4CCMA 3ZGKA 3HSEA 1B87A 3DTKA 3DBRB 2XF6A 3FXKA 3DLJA 2DTRA 1GVJA 2GOMA 3G2BA 2HYJA 3BJAA 3E6MA 2B58A 3EO4A 4II9A 2DMTA 3S15J 4LB5A 5JVGF 5K8NA 4IHXA 1U9OA 2FM4A 3RO0A 3CXSA 5IP7J 2DAOA 2HWGA 1G3TA 2E7XA 1T95A 5FKOA 5D4SA 1CQTA 2CGPA 4HNXB 1Y1VJ 4F3QA 3HRUA 1GYTA 4BL0B 3IWZA 4P96A 5M5WJ 1C3OB 2V1NA 2DPSA 3V7SA 3FX3A 1NE9A 3KP7A 3ABUA 2HYFA 4GS4A 1RKTA 2L54A 1CS0B 2ZFUA 2HROA 2ICWG 1W4MA 5DCFA 2KMUA 3EZEA 2GM4A 2LTPA 4UWIA 2A68F 1ETQA 5F6FA 2PCNA 4CHUA 3UR3C 3QU3A 2C27A 1TWCJ 4XPLA 3HB9A 2C6PA 2YNCC 2CTCA 3U21A 2DMPA 1NK3P 1JTYA 3IH2A 1ON0A 5KK1A 4HF0A 1C0WA 1GDTA 3DWLE 2FMLA 2ABZA 5ISVA 1EZAA 2KPMA 4CICA 2ZW6A 4FQGA 3MEXA 3DPUA 4YELA 1BPMA 5D8NA 4EYSA 4ZZLA 4ZDOA 4FD7A 3K4JA 3WTUC 4HLYA 3Q0VA 2MABA 2NS7A 4DGWB 4KT5C 3UKGA 1M4GA 2XRLA 3KZWA 3FEDA 2DTZA 1S7AA 5FKKA 2ESNA 3DLLF 2QKLB 2R7RA 4BY1J 1OYWA 5LHHA 3EDPA 2P81A 4EVIA 2R5ZB 1B6AA 2X1CA 4I98B 4LFUA 3R1KA 1R61A 4KN7X 1FTTA 4EGZA 2EFQA 4S0HB 2K5TA 3GIUA 1R1TA 2B0AA 2I00A 2VXZA 5K7ZA 1I50J 3Q3SA 4RDUA 4XLCA 3U9GA 1FYKA 2LYCA 3PQJA 5EJCA 1NH3A 2XEIA 1P7IA 3S9LA 2ZMEA 2BOLA 2RAEA 3W2AA 1Z3YA 2B0LA 4ZY0A 3GJZA 1EKEA 5EG0B 1KQ8A 1NMTA 1MBGA 2DOEA 4XICA 3I3LA 5KAIC 1S7LA 2L5QA 3W2VA 2MSYA 3S16J 1WVRA 3CQZJ 2B4DB 3U1KA 3HRSA 2HV2A 1SFOJ 3QU6A 1LDJA 3U2RA 4NXYA 4MHPA 1P7JA 4RB1A 3B3TA 2PE3A 3PBEA 1BR2A 5H6RA 4BDZA 3NFZA 4NGPA 3JVNA 3FMQA 1Z7UA 2Q4VA 4U7DA 2V8HA 5B1AH 4OKOA 1IB1E 1VNDA 3J7AO 2DI3A 3CDHA 1ZYRF 2OOTA 3EY5A 2MD0A 1CBXA 1GT0C 4R57A 4OC0A 3N4MA 1V3FA 4X2TA 4AYBN 1HSTA 3D1NI 2VZZA 2HNHA 2FRHA 1FT7A 3NAUA 3C26A 1YIJI 2XROA 3B73A 4FTHA 1RC9A 1XSVA 3LWFA 3OYMA 2BY2A 5K5QA 3CESA 3M3YJ 4H4KC 1FYLA 1ZG3A 4PXCA 1DPRA 2IMOA 2HR3A 1Z9CA 1OYIA 3TL4X 4RUHA 4UUTA 1R5GA 1TF9A 3ONQA 1XJOA 3RYPA 1MBEA 4H0EA 3L2WA 4D9JA 2L9SA 1Z6RA 1BJZA 1E17A 3KLNA 7CPAA 2HTJA 5E8GA 1UELB 2H09A 2UXNA 3FXMA 2O61A 3FB3A 2NVYJ 3ZZIA 4CYCB 1YYVA 4AVBA 3ZMVA 3VEPA 4RAZA 5FFXA 3CO7C 4BXFA 4LG3A 1X1CA 5FD6A 4PK2A 2WB1A 5DM6F 4E8OA 4CUGA 2EIKH 1OPCA 1USSA 2IA2A 4ENKA 1EJ9A 3GO5A 3OY9A 1EA3A 1LPQA 1YK3A 3W6KB 3REOA 4R79A 4AVAA 5LYIA 2YSRA 2IPQX 4RLFA 1ZRSA 1F4KA 3QNVA 3EZAA 2DA1A 4IHTA 2R98A 2HVQA 1YI2I 3JSPA 4DUKA 2KIFA 3NH4A 1IYKA 5D5WB 2EINH 1U5TA 1XB4A 4XNFA 4OC5A 2Y0MA 4K2EA 3QODA 2RREA 3DP7A 2EV5A 1WVMA 3FXUA 1VFCA 2DPUA 1KA8A 2LY2A 4L89A 2XPVA 4MEYF 1UFHA 2R1IA 1A6QA 5FLVA 4UIAA 3DKYA 4EMSA 3KP6A 4QTRA 5H86A 3ZR8X 4DNCA 6CPAA 1U6MA 4KA4A 1AOYA 3CJQB 3GXOA 2EFOA 2V1XA 4KOWA 2QYVA 2J5OA 3D68A 4M74A 1Y1WJ 3PB6X 4C2ZA 2DU9A 3RCOA 1XGSA 2EBJA 3S6FA 4CYDA 4U0VA 2NVTJ 4QSHA 4DYCA 3WTVC 1YREA 2BW3B 2PSWA 3RKYA 3GTJJ 4INJA 2BOAA 2FA5A 5H2FC
chains in the Genus database with same CATH topology
2LKPA 3F21A 3KR4A 5L3DA 2FMYA 1CPSA 2XHKA 4C9EA 1DPUA 3PBBA 2KJBA 2PJ5A 3Q9SA 3ECOA 3V7RA 3GLXA 5E20A 4S04A 5CVVA 2EA4A 3LA2A 5BOXA 4EM0B 3MWMA 3KETA 3F6OA 4FWUA 1GHCA 1HSJA 4IVNA 4FX0A 1SMYF 1ZGJA 2G9WA 2Z5UA 2C6CA 1VIXA 2HZTA 3HTSB 2VT2A 2PMUA 3PRTA 2XEFA 4Q48A 1O3TA 3IKTA 2VODA 2M8EA 3BPXA 5F1RA 2JEWA 4C8CA 5A2QK 2PN6A 4LGWA 3T0YA 1CPXA 2VOPA 4F8ZA 1KU2A 3HUGA 2CQKA 3KP4A 3FF3A 1J75A 4HBLA 5FFZA 3HSFA 2DK8A 2XKPA 1F2PA 2QBYA 3FM3A 2HWVA 2ZEPA 5CBMA 3FXRA 4C8PA 3GEZA 3GFMA 3NH8A 3B02A 3VOEA 1MKMA 1IN7A 2PEXA 4A6EA 5J1QA 1ZRCA 4C99A 4U7BA 1H8LA 2DQRA 1GXPA 2EFPA 2XAJA 4HYEA 4EJTA 4P10A 3FMCA 3KZYA 4FBEA 2WV0A 2V1UA 2POKA 5L3FA 4YIIA 4MGRA 2GZWA 2HEOA 5HVFA 3U1DA 3C3WA 5E18F 3TKYA 4PDKA 3WGHA 1W7PA 3CUOA 1U3EM 4EFDA 2R3SA 2FE3A 5HVHA 1TW2A 3WG9A 4MHGA 2ZJ2A 3SZTA 3TO7A 2YX4A 4A5NA 1LOKA 6PAXA 1LJ9A 1IUYA 3MZHA 3J80Z 4HV6A 4JYWA 2ZEMA 5DD4A 2PVVA 1L0OC 5LBQA 4ZI6A 4WXHA 2ADUA 1WRJA 2XAFA 4XLNF 4AIHA 1FC3A 4P4DA 3E5QA 2JPBA 1BIBA 4M71A 3HHGA 3V7CA 4M9XA 5LGTA 4OC4A 4NQWA 1K79A 4NGNA 3ELKA 3F6VA 1EE3P 5IR2A 1CF7B 1FT9A 4HA8A 1D5VA 5EEHA 4OIQF 2PIYA 1ZG1A 1LNWA 2VE9A 1Y0UA 1HEEA 2JSCA 2FVGA 4P4BA 1SMTA 4U0WA 1L3LA 3FHZA 1DP7P 4NGPA 2KIUA 4HW0A 4HF1A 2KKOA 4RGSA 4C8TA 3I59B 4MTEA 5HS7A 3D7HA 3IJ3A 3B3CA 3PB4X 2RFHA 1WKMA 1SFUA 2VC1A 3KP5A 4UXNA 1R36A 5CLSA 1MJBA 3K1NA 3F22A 4GXOA 2JTVA 3SJEA 2O53A 2RV8A 5L3CA 3BJ6A 4LK0F 2STWA 3QP5A 3DPTA 1MD0A 1R3NA 1USTA 1QZYA 3QP6A 2Q51A 3HTUA 2F7VA 1F5TA 2NNYA 4C9AA 4B09A 5L3GA 1U8RA 1NSAA 1Y0YA 1Z2LA 1YIOA 4OU0A 3GF2A 3CT9A 3NQOA 3F8BA 2PJBA 3O6BB 5L3BA 3L09A 3R6SA 2AFOA 4F7ZA 1CGPA 4IHMA 4IF4A 2O3FA 4TNUA 3IO1A 2PJ3A 5CYVA 4OMEA 2D2WA 2EV6A 3ISZA 2EWBA 1REPC 4UV8A 5LEJA 3R60A 2BYVE 3F3XA 3PB7X 4C8FA 2XEGA 2JPCA 3WGIA 4WWCA 2VOOA 4HDUA 3I64A 1U5TB 1WWXA 3C18A 2PJ0A 2R7DA 3CPXA 4O23A 3RYRA 4LMYA 3E6DA 4GO1A 3SI0A 1HW2A 3OOPA 1HKSA 2PQ8A 4OOIA 2GU2A 4YWYA 2COMA 2XAHA 1ZRFA 4ENMA 4WF2A 1Y7EA 4Q4ZF 5E17F 3HOSA 3IRQA 2IQ6A 2VBYA 3TOAA 2C6YA 1VHOA 1ZGAA 4LLLA 3T1BA 3WTWC 3GFIA 4X3RA 3M9AA 2E1CA 2ZO4A 3ZPLA 5HDKA 1R7JA 3FXQA 3DKWA 2MLGA 1T38A 3GUDA 4ZH4F 1XSDA 1IXSB 1FX7A 4BAYA 2ETHA 4ZYHA 5LHGA 3SFZA 4XSZF 2GWRA