3K9TA

Crystal structure of putative peptidase (np_348812.1) from clostridium acetobutylicum at 2.37 a resolution
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
435
structure length
422
Chain Sequence
GMEEINKYIQNSSETGGEIYNLIEELFPICRSITGNGVRKTMDIIRKHIPLEIHEVKSGTKVFDWTVPKEWNIKDAYVRNSKGEKVIDFKENNLHVMSYSVPVHKTMTLDELKPYLHTIPGNKDRIPYLTSYYKENWGFSLTQNKFDELCDDDYEVVIDSSLEDGSLTYGEYYIRGELEEEILLTTYTCHPSMCNDNLSGVALITFIAKALSKLKTKYSYRFLFAPETIGSITWLSRNEDKLKNIKMGLVATCVGDAGIKNYKRTKFGDAEIDKIVEKVLMHCGSEYYVADFFPWGSDERQFSSPGINLSVGSLMRSCYGFDGYHTSADNLCYMNKDGLADSYKTYLEVIYTIENNRTYLNLNPKCEPQLGKRGDEFAMFWVLNMSDGKNSLLDIAYKSGMEFRRIKYAADALYRVELLKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative peptidase
publication title Crystal structure of putative peptidase (NP_348812.1) from CLOSTRIDIUM ACETOBUTYLICUM at 2.37 A resolution
rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase
total genus 139
structure length 422
sequence length 435
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09940 DUF2172 Domain of unknown function (DUF2172)
A PF16221 HTH_47 winged helix-turn-helix
A PF16254 DUF4910 Domain of unknown function (DUF4910)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k9tA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3k9tA01
3.50.30.90 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3k9tA02
4UHTA 3L09A 2XROA 4NGPA 3QU6A 4IHTA 2COMA 2O53A 4KYWA 3ZMDA 4OKOA 4UUVA 4HDVA 4ZY1A 3T5XA 2XASA 2VOOA 3RPQA 1W7PA 1KQ9A 1QBJA 5D5UB 1WWXA 2QM3A 2HEOA 3ZQ7A 2ZCWA 2FBHA 4OIOF 1R00A 4G8XA 3MCZA 2P7CB 4RB2C 1QMUA 1TF8A 1VHOA 4ZX9A 2CWEA 2HZTA 2Z99A 4YU9A 4OOIA 1IUYA 3C18A 1LEAA 2HKOA 3H3ZA 2PJ0A 1XMBA 4G6QA 1KWMA 4CPAA 2O03A 5DDGA 5LYFA 3Q5FA 5IB9A 3F8NA 3K69A 1M4LA 2AFXA 3GW2A 4F7ZA 2KIUA 3ECHA 3FF5A 5FLXZ 2XEFA 2CFXA 1B59A 4EGZA 3DF8A 3MWMA 3F8MA 2NYQA 1Z6TA 5LYLA 1LAMA 3CPXA 3SJEA 4EM2A 2OOTA 1WQ2A 3CJNA 5FD5A 3PFEA 1HDUA 3RDIA 4BD9A 2X0LA 1LB2A 3SJXA 5DYMA 4A6EA 4P10A 2XVCA 3IRQA 3K2KA 2AS5F 2E1NA 2EB7A 4MEXF 4OIWA 4MXUA 3IC7A 2JPCA 2ABZA 4KN4X 1T98A 4ZX8A 4RAZA 1ODDA 3R4KA 1QQIA 2QZ8A 1ZHFA 4WXHA 2ZEGA 4CO8A 3SZPA 3JTGA 4AWXB 1EH8A 3B73A 3G3ZA 1LDJA 2WYRA 2Z3YA 3B2YA 1XN7A 1MGTA 4YFNF 1OBRA 3KGQA 1IN4A 2GAUA 1BIAA 2ZFWA 3KEQA 5KVRA 1R58A 3KQZA 1G3YA 3KP7A 3V8KA 3N97A 1JHFA 3TX8A 1YYVA 4MCSA 2OU2A 2NNNA 1BC7C 3BHXA 1DDNA 1IN7A 5LHGA 2E7WA 4JYWA 3DFGA 3KP3A 4B8XA 4A39A 3MAJA 4MCQA 4PGGA 2BCOA 5H20A 2NYXA 3LA3A 3FXRA 1Y0UA 2EK5A 3KETA 2D1HA 1BM9A 3GX4X 3RKXA 2GLJA 4LG0A 3TC8A 1RTQA 1D8JA 3HRMA 4L18B 2C6YA 1W4MA 1ZREA 1D3YA 1V3FA 4PDKA 5AIPA 5L3DA 2F5DA 1QO0D 4MRIA 2XGXA 1I27A 2L4MA 3CLOA 1SD4A 3KLOA 2P7VB 1ELMP 2NS0A 3PB6X 2Q2EA 1F2PA 2PRQA 2QUFA 1DP7P 1S3JA 2JPBA 2YX7A 4KNYA 1TQIA 3V7RA 2BGCA 2DT5A 3SZTA 4G6DA 3VB2A 1J7KA 4AD9A 4A5NA 4WXCA 5E1WA 2M30A 4L0ZB 2UXNA 2VONA 2ESNA 1IW7F 4UVAA 2NSMA 2QVPA 5F1RA 2GXBA 4ON0A 2H6BA 4H2KA 4NGMA 1S6LA 1G3WA 3GEZA 4DJLA 2ZMEB 3F8CA 1Z2LA 2O3FA 4F8ZA 1S7OA 4OMZA 2PG4A 2XEJA 2STWA 5E20A 2Q4ZA 1ARMA 4FBEA 3GB0A 1ZARA 4ZYEA 1HXDA 2P5VA 4S04A 4ZH4F 3H8FA 4HQMA 2V1UA 3KP4A 4DQ2A 1KQ0A 2PJBA 2PI0A 5FO5A 4AIJA 2WWYA 1TLHB 4EGYA 1LCPA 2G7UA 1W7PD 2OA4A 3BI0A 4ZZLA 3IWFA 2YSRA 4OC1A 3F23A 2DQRA 1XDUA 3T8TA 3CUQB 1G6NA 3TKYA 4TWEA 5D29A 4LGWA 4GO1A 2DI3A 1LANA 3IWZA 2ZEMA 4ZY2A 4PZJA 5ILVA 3PB7X 1WI9A 4KN7X 4F9UA 4A0ZA 3F8FA 3D7FA 4A37A 3J80K 2R7FA 2GLFA 1R23A 3O3KA 4BH9A 4CICA 5L3BA 2K02A 4EQQA 4L9NA 1S7AA 2E1CA 4WK8F 1TQMA 2ETHA 3BJOA 2ISYA 2X4HA 3CUQA 3PFOA 2WC2A 3F21A 5K5OA 3CPAA 2XAHA 3ZMZA 1YW7A 2J9AA 5LRKA 4HF0A 3GLJA 4LMYA 3KZYA 1BI1A 3M1EA 4I0BA 4UV8A 2V8HA 4EWTA 2G7HA 2W24A 3LA7A 4NQWA 3ISXA 1QNTA 1PDNC 4YFKF 3LQRA 4BHBA 2H27A 4Y17A 3H8EA 5LRGA 1IN8A 5LYDA 1KU7A 5JI6A 4Z65A 1H9GA 3BPXA 3FM3A 2F8HA 3BP8A 5HVHA 1XRYA 5CBMA 3IFEA 3ISPA 3PQJA 3E6BA 3WTWC 3WGIA 1F57A 4M73A 3REOA 4P4FA 5LHIA 1KU2A 5FFZA 3J81Z 2KIMA 3B3VA 2EA4A 1HW1A 1GHCA 2QWWA 1XD7A 1XGOA 1R1VA 2FU4A 3F72A 3H3UA 4MGRA 2W57A 4IHMA 5DV5A 4HLYA 2V1DA 5ICFA 1T38A 4G94A 3HRUA 3ISZA 5H6QA 4L5JA 3IKVA 3U1DA 4ENKA 3KHZA 1ON1A 4DNCA 1QZZA 2IPQX 2QQAA 5D4RA 2JEWA 1FX7A 4JK1X 5E8GA 4U0WA 1V4RA 4BHPA 3R60A 2XAQA 4MHNA 4KA4A 4TNUA 1ZG7A 2P4WA 3K1NA 4KFCA 1USTA 4EFDA 4P96A 2PJCA 1ULYA 2RFHA 2O0YA 5FD6A 1RZ4A 2FBKA 1ZG3A 2PJ2A 4NJRA 2GXGA 2BOAA 4U0VA 5JHUA 1XB4A 2XIGA 4OP4A 1JXSA 1SMYF 4HAMA 5D4SA 3PEIA 1P4XA 2IW5A 3TOAA 3KEOA 1YIOA 1T6SA 3SXYA 5BPDA 1CGPA 2HWVA 1BI2A 2R7DA 4WXDA 5A2QZ 5JR3A 4WJBA 1YLOA 1XCVA 1MDMB 3FECA 4RAYA 2P6TA 5L3CA 4CZZA 1RUNA 1CF7B 2H09A 4PXEA 3R61A 1U78A 3KASA 2P8TA 3D66A 3ELKA 4RUHA 1KA8A 3SHFA 4PQAA 1QQ9A 2OQGA 3D7DA 2LDUA 3V38A 2L3DA 2EA2A 2BEOA 3GFIA 1LVAA 4BQAA 2AXLA 2BE5F 4R76A 1MDMA 5BMZA 2RDPA 5LGTA 1ON2A 2PJ3A 3RPUA 1XGNA 4FX0A 3FJUA 1CF7A 1MJAA 3F6OA 5LBQA 1ZG1A 3D68A 2YR2A 3W6JB 4NGNA 4HX4A 3WU1B 1R5HA 3B02A 4CGZA 3FHZA 4IJAA 3R0AA 3GLXA 3FEDA 3WABA 2MH9A 1J0RA 1WSUA 1WKMA 4KMFA 4A0XA 4M9ZA 3J7AO 1P4WA 3GUXA 1ZYRF 1HKTA 2W25A 4ESJA 1XFOA 2CG4A 3C7JA 4IAVA 4MMOA 5TJJA 4R1HA 3M8FA 4P4BA 4UIBA 3GWZA 3R0JA 4O5VA 4MEYF 3V7SA 4A38A 4NGSA 4GYIA 1TBXA 3WC5A 1R36A 1O7LA 3GXOA 1GXQA 3IRRA 5D5VB 1ARLA 3N4MA 4DUKA 2NAZA 1BIBA 1TXRA 3IC1A 3S2WA 2IA1A 1FNNA 3TO7A 4BAYA 2JTVA 5DD8A 1FWZA 5HLGA 2EK8A 3BDDA 3TGNA 2AFUA 1B9MA 1R3NA 5DUKA 1IF1A 5HVGA 2CYYA 4P4IA 2ZEEA 1YS7A 3E3VA 1LFWA 2UWMA 4U7BA 1K6OA 3BXMA 1I5ZA 3FVLA 3C1DA 3E6MA 2RKHA 3CT9A 4I09A 4LK0F 1UWYA 2PJ5A 2TDXA 5THWA 4RS8A 4ENMA 4EJVA 3KP6A 1Z1DA 3GO5A 1YFHA 3B7IA 1ZAOA 4EJTA 3RKWA 3P7NA 3M8EA 5L3GA 3PBEA 4G7HF 1BPMA 1Y0YA 2PIYA 5HOOA 2FA5A 1G3SA 1BAVA 4YIIA 3SJGA 2LNBA 5J8FA 1FSEA 1TW2A 2M1BA 2F5FA 2MLKA 1B9NA 1EE3P 2B0LA 4NB5A 3OV8A 5HXDA 4G7OF 3CUQC 1KYZA 2JBJA 5LRSA 2FVGA 3I0TA 2M8EA 1F9NA 4FX4A 1FSHA 3L9FA 4ZZDA 5LHHA 3KP5A 1U3EM 4O3MA 7CPAA 2OR4A 5ELYA 2QLZA 2IQ6A 3CDXA 1ZG9A 2ISZA 1FBQA 1A04A 4A2UA 1U6GA 4A94A 3L00A 3KR5A 2E7XA 4HLXA 2L02A 4G1PA 2WV0A 2A69F 1CBXA 1XMKA 1D8KA 3HTSB 3E6DA 2XEGA 4OMEA 4PXCA 3FWEA 1ZLHA 4UVCA 1ZG5A 1IGBA 4BHCA 4L9TA 4ESFA 1Y7EA 5ILSA 4MQVA 1Q7LA 5BPIA 1S8NA 3EYYA 3E5XA 4G9YA 3HHGA 3NA6A 2OAZA 1XGMA 3WTSC 3NH4A 1ZGAA 1SMTA 1C0WA 4HOBA 5IT3A 2HTSA 4R8HA 1KYWA 1XBUA 2ZNYA 3TDUC 2HB6A 3ZN1A 3MFKA 5HS7A 5DCMB 4GCVA 2O4HA 3E6CC 4IHSA 1YW9A 4MTDA 1OYYA 2HYGD 1LQ1A 3VATA 1ZG8A 1T2KA 2VBYA 5DCFA 1Z7UA 1HW2A 1VHEA 3JSOA 1CP7A 1UHMA 5K8MA 4U88A 3JW4A 2V77A 4NFRA 3ZMUA 2XV4S 5CVVA 3L2NA 5D8LB 4MTEA 4KT5C 3PRTA 5HS9A 1J2XA 1T0FA 5L3EA 3H92A 2AFSA 5DCMA 2V9VA 4BYYA 3D4UA 1W5TA 1ZGJA 3TOBA 3QRFF 3LA2A 3FH4A 1HBXG 2C6GA 2J5PA 3O6BB 2VL1A 3HOSA 3BZ6A 2ESHA 1FZPB 1USSA 4RB0A 3NRVA 3WT4A 2RN7A 1QZYA 2VBWA 1VTNC 5LEJA 2QQBA 2EV5A 4LLLA 4NJQA 2DQLA 3WODF 2VE9A 1UCRA 2C6PA 3DV8A 4RGSA 3GZ6A 3JSPA 1R1UA 2ZOGA 2VXZA 4A6DA 4KIFA 4FUUA 3RJPA 1CG2A 5EEGA 4I7HA 3T8WA 4M71A 1DTDA 4OIPF 1IXRC 2VBXA 5HLIA 5D5XB 3S9NA 2QENA 4CYDA 1PP8F 4OC5A 1Q1HA 2LSOA 4KMUX 2QYOA 4HX7A 2VODA 1O3QA 4L9JA 4OIRF 5HVFA 5CVIA 2PVVA 1XSDA 2STTA 1W5SA 5ERIA 2CO5A 3HSEA 1IRFA 4ZYGA 3FZVA 2LKPA 3CDHA 2L4AA 4HV6A 3E5UA 2EK9A 4U7DA 2HC9A 1BI0A 2JRTA 2PN6A 3WGGA 2ZMEA 1U5TB 3QU3A 4TV7A 4Q5SF 2PMUA 2FNAA 2GWRA 5AIQA 1H0MA 3BWGA 3FM5A 3J80Z 3FX6A 4FAIA 1TW3A 5CVUA 2PJ4A 2V8VA 3VFZA 3SI1A 1YW4A 2K4BA 1UHWA 4JBAA 1YQAA 6CPAA 3ML6A 8CPAA 5K8NA 1IAWA 1BLLE 4CHUA 4EVIA 3ABTA 5F6FA 4L9VA 1FLIA 5HLHA 2CTCA 1F1ZA 4O23A 2FBIA 3IIBA 3E97A 4YWYA 2DBBA 1HSTA 3P9CA 4MCPA 2NRAC 1L3LA 2FE3A 2XAGA 1NHAA 4HF2A 4ENJA 1AOYA 3KFWX 2A5YB 2HTJA 3CO7C 3WGHA 2ZXJA 1ZLKA 3S9LA 2ANPA 3L2CA 4HF1A 1MZBA 4XSZF 1LOKA 3BY6A 4Z2YA 4P9UA 4EJWA 4KUMA 3RZAA 2FRHA 3ABUA 2Z5UA 2HR3A 1YO5C 1LJ9A 2CW0F 2ZBKA 2ZKZA 2DW4A 1E2XA 3ZN0A 2A61A 4LK1F 3KLNA 3GFMA 1HDQA 3MZHA 4EM0B 2YX4A 2R3SA 1DE4C 2PIZA 2HDCA 2PJPA 1BJAA 1HEEA 1SFUA 1PP7U 1PYTB 3WTZA 1GXPA 1Z05A 3O2PE 3GVAA 2XHKA 3ULQB 2CQKA 4QLCU 1R22A 4EMEA 3ERED 1LDKB 2YPRA 2Y0MA 4MHPA 2BV6A 4GM5A 4XLNF 5CJ9A 4I02A 3C3WA 2JT1A 4CXFA 2IVMA 4KDPA 2XEIA 1VGYA 3FMCA 3I71A 1G4DA 5TRDA 4R8FA 1VIXA 1K78B 3BOQA 3EDPA 4FHTA 1EH7A 5BQTA 3WTXC 1XSVA 3FF3A 1R1TA 3FMSA 2FNPA 4HDUA 4HZFA 3LMSA 3HUGA 4XRFA 2M45A 1ELLP 4OMYA 1IN6A 3GYHX 4ZYHA 3Q9SA 4AVPA 2FOKA 4EJOA 4NGQA 4X3RA 1BOAA 2GQQA 1QGPA 2CSOA 1B6AA 1OMIA 2KJBA 2AFWA 3DLJA 3E5QA 4OINF 4ASNA 1Z8LA 5F09A 1K78A 1P4AA 2QQ9A 4XLPF 3N5FA 3L7WA 4OC2A 4PCQA 2V1XA 4UVBA 2EV6A 3CTAA 4Y15A 3BJ6A 3HSFA 2EFWA 1H9TA 4UEFA 2L54A 2FMYA 5BOXA 2CTBA 2PJ1A 2ZENA 2V8DA 1BBYA 2MH2A 5ICEA 4DYOA 1IXCA 2F7VA 1KU3A 3TQNA 3PQKA 2ZEDA 4P9FA 4M6YA 3WTUC 2OBPA 5FGMA 2Q0OA 1XJOA 2JBKA 2NNYA 5CPAA 2ZO4A 2VT2A 2O8XA 2ZEPA 4EV0A 1FOKA 2C6CA 2IJLA 4P5OA 4WX9A 3QOPA 3EYIA 1Y0RA 1YS6A 2EFPA 3KP2A 4Q7AA 5JGFA 2POKA 3GZ5A 4M72A 2OZ6A 2GA1A 1ONVA 2PEXA 4F9VA 5E1XA 2DK8A 1J9IA 4PXDA 3NEUA 1QPMA 4KIBA 3GF2A 2XKPA 2F2EA 1TQPA 2RGVA 4N9IA 3B3CA 4BNCA 2O6GE 3WU0A 1P6RA 2ZEHA 2JZYA 2P6SA 4R79A 1FY7A 2Z33A 1TKHA 2CIJA 3B3WA 1IRGA 3D7HA 5K5QA 1XMAA 3WC7A 3BPVA 4ZYQA 4YG2F 3ECOA 4Q48A 2HQNA 3CO6C 4GXOA 1BC8C 2CGPA 2AFZA 3FEEA 2Y75A 3DPLC 3WE2A 3QNVA 2EWBA 3KHXA 1O7FA 2XUBA 3GFJA 3QP5A 4P45A 3Q9VA 2IA2A 1YLFA 2OQRA 2PVWA 1XCBA 2DLLA 4P6YA 5K1YA 1T39A 4N0BA 2PJ9A 2MD5A 1STZA 2PE3A 4OIQF 2PLYA 2EFQA 3IJ3A 3RIRA 3VODA 3U9GA 1AMPA 2EV0A 1P2FA 4UXNA 2XRNA 4A12A 2IRFG 1SAXA 5HVQC 1IY7A 2ZNZA 3D0SA 2ADUA 4LFUA 5K5RA 3K2ZA 3JAMK 4P4JA 4PPZA 1O57A 2GZWA 2Q8KA 4H0EA 1B4AA 1U5TC 1RUOA 2QYVA 4WWCA 4YIFA 2HKXA 3I1UA 4OC3A 2XAJA 5F64A 4GYGA 2DPUA 1OPCA 5HDNA 2Q43A 3DGVA 4MCRA 2PQ8A 1SD7A 3PB8X 2H6CA 5DD4A 1FP1D 4HBLA 3KCCA 1L0OC 3ZP5A 5LRJA 3IL2A 2A68F 2ZEFA 4CDGA 1R43A 2IA0A 5D6EA 3IKTA 4RGXA 4K3NA 1XGSA 4M6XA 1JQGA 4HV5A 2FQ3A 4RB1A 2EJRA 1FYLA 5D8KB 4LJZF 2WZNA 3WC6A 5J6XA 6PAXA 4WCGA 1EV7A 4ZYDA 1TTYA 5J8CA 3CUOA 2EWNA 2A3SA 2VE8A 1RNLA 1XSXA 4R7MA 3VOEA 1H8LA 3D67A 5ICGA 3PFIA 2DU9A 2Q51A 2K7LA 2VT3A 2DO7A 3HIFA 3IEHA 3RYPA 1SD6A 3TDZC 2DAOA 2KKOA 3KE2A 3QAHA 3RAMA 1F2OA 2IT0A 2DPDA 5FLXK 5HDGA 3V7CA 5ED4A 4ZY0A 2V79A 2M87A 4IRHA 1J5YA 1ZLIA 3I64A 2P5KA 4WF2A 3I5UA 1O3RA 3LAJA 2VN2A 3WE3A 2ACJA 5E8IA 2PFBA 5DUIA 5LYIA 3R6SA 1R5GA 2VC0A 5FFXA 1U8RA 3GUDA 3D5LA 5E17F 2MLGA 4HA8A 5LGUA 3NH5A 4LG0B 3KL9A 1TNTA 3HRSA 3ZMVA 2O61A 4BXUA 2V6CA 2DK5A 2M5WA 5ILUA 4AIHA 5H6RA 2D45A 3K0LA 2MA3A 4X8IA 3HSRA 5K8OA 4IPAA 3LQQA 4PGHA 1ZH5A 4I01A 3KI9A 3KQXA 5E1ZB 1MKMA 3PB9X 1FBSA 1ZRDA 5KK1A 3QPHA 5ICCA 3AAFA 1JHHA 3HOTA 2I3CA 3K9TA 4A5MA 2V8GA 4M9XA 1YMEA 3SJFA 4LLGF 2P5LC 2PMHA 2LF8A 5CYVA 4O6JA 4KICA 3F22A 3DP7A 2Z9OA 3MEXA 2L01A 3IHUA 3M9AA 1R7JA 5HDKA 3I58A 1CX8A 2PJ6A 3MQ0A 3NFZA 5JH9A 1NSAA 2HS5A 3VH9A 1HKSA 1OYWA 1ZLJA 2BO9A 4L5IA 1BN5A 2K86A 3U2RA 3LSTA 5LEKA 3P9IA 4P44A 3S9MA 2HOEA 3M7GA 3COAC 2AFOA 4UF4A 4UV9A 3ROUA 4I0AA 2FEZA 4A0YA 2RQPA 3T8RA 3F8BA 3VARA 4Y13A 5CLSA 1MJBA 4ESBA 5FB2A 2J5OA 4X2TA 3VEPA 2H94A 2D2WA 3F3XA 4UEZA 1OKRA 1BPNA 4N9HA 4Q47A 1FNOA 4YFXF 3FMQA 1E17A 1LNWA 2FMLA 2ZEOA 3DPTA 2UXXA 4MNUA 3V7ZA 1BI3A 1LEBA 4EM1A 3ZMTA 2UZKA 4KSIA 3TO9A 1D5VA 1MD0A 1U5TA 3FX3A 3OOPA 2PBIA 1ZN2A 1GVJA 3SI2A 2MC3A 3GFLA 3DXJF 3SI0A 2IP2A 1HKQA 4M74A 4ZI6A 1IN5A 3PB4X 1I1SA 3RYRA 3LWUA 3I54A 1FT7A 4LB5A 1HQCA 1UB9A 2PCUA 1REPC 1FBUA 1HW5A 2QVOA 5LRRA 4NGRA 5LLQA 4P4EA 2PJ8A 4QWQA 5K8PA 2OD5A 4XSXF 4JZ0A 5D6FA 3V4GA 3FXUA 2FF4A 4LD5A 2XAFA 4Q4ZF 3HRTA 1TKJA 4IRIA 1TNSA 3HYIA 2F5CA 1IZ1A 2BYVE 2KJCA 5L3FA 1EH6A 4D0PA 5I4MA 3EUHA 5LGNA 1SFEA 4I98B 3ZMSA 3DKWA 3HTUA 4GGGA 4WWVA 2VC1A 1FPQA 3G73A 3V8JA 2FSWA 1IXSB 5JFRA 2G9DA 1S29A 1FP2A 1UFMA 4LB6B 3ZPLA 4FWUA 4ETSA 1RIOH 4FT8A 4HYEA 4EMSA 2G9WA 5JVTA 1AWCA 1JGSA 1U2WA 4KIGA 3HUVA 4IVNA 3P9KA 1DUXC 3I59B 4AIKA 3WTTC 2FXAA 2GA2A 1YSJA 1FYMA 1SD5A 3RI4A 4NGTA 3JRUA 4MHYA 1CP6A 3J81K 2PJAA 2RC4A 2GIVA 3MN8A 4R6TA 3SFZA 4S05A 4EJUA 1KU9A 2VOPA 1I1GA 2ZELA 1FYKA 2RV8A 3FXQA 1AYEA 2EFNA 4U0YA 2QJ8A 4B09A 2IMOA 3SQNA 1WRJA 1TF9A 3I59A 2HYFA 5AONA 5E18F 3WG9A 3LAPA 3KZZA 1FT9A 4LLNA 3FMRA 4E70A 3MRUA 2LF7A 4IK2A 5DS0A 3HLPA 4M9SA 4ONWA 1CPXA 4I2OA 5HS8A 1O3SA 1B1BA 1Z6RA 3DEUA 2EFOA 3HHHA 2WTEA 1J75A 2F5EA 3BJAA 3NQOA 4IRGA 1OYIA 2GREA 2YU3A 4XBFA 1DPRA 4OC4A 1CPSA 5CVJA 2KIFA 1ZRCA 5IT9Z 1GYTA 4IXAA 3LFKA 4AXVA 5CVRA 4P55A 4G7ZF 5A2QK 4ENNA 1LAPA 5IT9K 2K4JA 3V8LA 3B35A 1YG2A 3I4PA 1PUEE 1F4KA 1O3TA 3PBBA 2GU2A 2OZUA 3F6VA 1SFXA 2A6HF 1PCAA 2JSCA 2ELHA 5J1QA 1DPUA 4IF4A 4UEEA 3RTRA 5JM6A 1YW6A 2W84A 5D5WB 3K1PA 2ZJ2A 2K27A 2QBYB 3QPTA 3KZWA 5D8NA 3EETA 4HQEA 2MBFA 1Z9CA 3B3SA 2D1VA 3B3TA 2DTRA 1K7AA 4NHJA 3TO6A 1Z91A 2BBYA 3BI1A 4PXBA 2Y48A 3QP6A 4W9YA 3BROA 3RKYA 1JE8A 1I6XA 4L0YB 2RVCA 3EQLF 1Z5RA 4MHGA 1X3UA 2RB7A 2HGCA 1P92A 3MZYA 1LDDA 2QBYA 4OC0A 5DEQA 3JTHA 2KRFA 2DFIA 4HW0A 1TKFA 1YW8A 2AFMA 1KGSA 3IWWA 1RI7A 2A6EF 3D7GA 3T1BA 2A07F 2HFHA 4OIDA 3KR4A 4MQ9F 3W6KB 4RGUA 2IJZA 2PJ7A 2C1CA 3DQVC 1MJ9A 4UNOA 3WTYC 2ZOFA 2W85A 4UIAA 4RGRA 1XDSA 3WTVC 4JQFA 1K79A 3I53A 3JAMZ 1FC3A 1HSJA 3NH8A 4HX8A 1OR7A 2XKOA 3K1MA 3IO1A 1J59A 4MHZA 1F5TA 4P4DA 1ZRFA 4LQGA 2DEAA 4K2EA 4B6ZA 1W7PB 2HQRA 2CF4A 4OU0A 2RNJA 3LWFA 1KQ8A 5BS6A 3H8GA 5EEHA 3RBUA 3T0YA 1G3TA 1YTYA 4RB3C 2VBZA
chains in the Genus database with same CATH superfamily
4UHTA 4B4CA 3TTHA 3OS1A 3L09A 2NVXJ 2XROA 3LFUA 4NGPA 3QU6A 4IHTA 2COMA 1DIKA 2O53A 4KYWA 2H8WA 3ZMDA 4UUVA 4OKOA 3VWEA 1BXRB 2YNCA 3Q0WA 3IH3A 2NVUB 4HDVA 3A9LA 4ZY1A 2VJJA 3A1YA 3T5XA 2XASA 3CJTB 1IIDA 4CYOA 2VOOA 3RPQA 1VQ5I 2QEXI 1W7PA 2BSWA 1X2NA 2KHMA 4A3MJ 1QPIA 4FD7A 3MGDA 1KQ9A 4MLOA 1QBJA 2QECA 4MJXA 5D5UB 3PNVA 2GLOA 2HVRA 1WWXA 2VASA 2QM3A 2HEOA 4MBUA 3ZQ7A 3I9V2 2ZCWA 3OYNA 2FBHA 1FOWA 1R00A 4G8XA 3MCZA 2P7CB 4OIOF 5GCNA 4RB2C 2L9NA 2EPFA 1QMUA 3S14J 1TF8A 4E4HA 1VHOA 2P0WA 4HSRA 4ZX9A 4IIYA 2CWEA 2IS6A 4Y4RA 1OCCH 2HZTA 2Z99A 4YU9A 1R4MB 4OOIA 4XPDC 1IUYA 4XKWA 3C18A 3WU2C 1VQMI 1LEAA 5KCMA 4XK4A 2HKOA 2PMZA 4C85A 4W1UA 2O28A 2K9SA 3H3ZA 2PJ0A 2A6TA 2ZSIB 3PUFA 1XMBA 3U21A 5B1BH 2OUMA 4MI4A 1C30B 3EUHC 3K4NA 1E3PA 4G6QA 1KWMA 1OISA 3FHNA 4CPAA 2O03A 5DDGA 1YVOA 1X19A 5LYFA 3Q5FA 2OZGA 3F8NA 3K69A 1M4LA 5IB9A 2AFXA 3GW2A 4F7ZA 2KIUA 3ECHA 3FBIB 3FF5A 5FLXZ 1FTZA 1IV8A 2F6CA 4F92B 4UY8I 2CFXA 1B59A 2XEFA 4EGZA 3DF8A 2BL1A 2R7ZJ 3MWMA 3F8MA 2NYQA 1Z6TA 2DA5A 1LAMA 3CPXA 1NSLA 5LYLA 4RAGA 3SJEA 2KDOA 4EM2A 2OOTA 4A31A 1WQ2A 3CJNA 5FD5A 3PFEA 1HDUA 3RDIA 2VQYA 4BD9A 1DGWY 3RYOA 2OZHA 2X0LA 1D0XA 2Z11A 1SVOA 1LB2A 2DPSA 3SJXA 5DYMA 4A6EA 3BG3A 4OADA 1IDZA 4P10A 2XVCA 3IRQA 2NXNB 3P5JA 3K2KA 2AS5F 1VKCA 2E1NA 5LD2C 1WVMA 2EB7A 4BJTA 4MEXF 4OIWA 4D5CA 3TLAA 4MXUA 3IC7A 1Z0XA 2JPCA 3DEWA 4JOMA 2ABZA 4KN4X 1T98A 3FXMA 4ZX8A 2EIMH 4RAZA 4UCPA 2M34A 1ODDA 3HPGA 3R4KA 3BG9A 1QQIA 2QZ8A 2EZBA 4BGDA 1ZHFA 4WXHA 2ZEGA 2R7WA 4CO8A 3SZPA 3JTGA 4AWXB 1I1DA 1MIJA 4TJXA 1EH8A 3B73A 3G3ZA 4IHWA 1VQNI 1LDJA 2WYRA 2Z3YA 1VZ0A 3RPUD 1XN7A 3B2YA 1OFCX 1LVKA 1MGTA 1AUGA 4YFNF 1OBRA 3KGQA 1IN4A 2FX0A 3TP3A 2GAUA 2JUCA 1BIAA 2ZFWA 4CCNA 3KEQA 1B72B 5KVRA 1R58A 1VQ4I 3KQZA 4H1HA 1G3YA 4FASD 4QB9A 3KP7A 2DFFA 3V8KA 5K7ZA 3N97A 3FXTA 1JHFA 3TX8A 3K10A 1YYVA 4MCSA 2OU2A 5JLXA 1V5FA 3I4MJ 2NNNA 1BC7C 1QA6A 2V7FA 3BHXA 1P7JA 2PX9A 1JJ6C 1DDNA 4JLYA 1IN7A 5LHGA 2DA2A 2E7WA 4V19K 2FXFA 4JYWA 3DFGA 1OCOH 3KP3A 4B8XA 4A39A 3HXLA 3MAJA 4I99C 1OQYA 3G3SA 4MCQA 4PGGA 3DR6A 2Z2SB 2BCOA 5KTDA 5H20A 2NYXA 3LA3A 3FXRA 1Y0UA 1TWGJ 2Q2EB 3FKIJ 5DM6F 4KVXA 3OSFA 1W1WE 1NK2P 2EK5A 3KETA 2D1HA 1BM9A 3GX4X 4BACA 1Z4RA 1YX3A 4EVYA 2VIXA 3RKXA 2GLJA 4LG0A 3I4NJ 2L9VA 5JPHA 3D5SC 1O4XA 1B72A 1RTQA 1D8JA 3HRMA 1KZHA 4L18B 2VBQA 4KZTA 3TC8A 2C6YA 2DIKA 1H89C 1W4MA 1ZREA 4A2ZA 1D3YA 1V3FA 4PDKA 5AIPA 5L3DA 1LFPA 3EZAA 4N4NB 2F5DA 1QO0D 4MRIA 4C2XA 3OYLA 1M44A 2XGXA 1NH3A 2ZB9A 2MC4A 2FIAA 1I27A 4ZDLA 2L4MA 1WJDA 3SDGA 2DDAA 3CLOA 1SD4A 2IS2A 3GLLA 3KLOA 2P7VB 1ELMP 2NS0A 2E1MC 3ABLH 4MFQA 2W00A 2HU9A 3PB6X 5IR2A 2E34A 2Q2EA 2VKDA 1F2PA 2PRQA 2QUFA 1DP7P 1S3JA 2EH3A 2JPBA 2YX7A 2EZHA 4KNYA 1TQIA 4G12A 3V7RA 4DOZA 3FNCA 2BGCA 2DT5A 4ZJZA 3SZTA 3CXSA 1YVKA 1WWZA 4E7HA 2JVHA 4G6DA 3VB2A 1J7KA 3LSHA 4AD9A 2R92J 2MW8A 4A5NA 1B8IB 4WXCA 5E1WA 2F5IA 2M30A 3H5AA 5CQEA 1S60A 3VYUB 3GY9A 3EZBA 1M4GA 2Q7BA 4L0ZB 2UXNA 3SYTA 1Y6IA 3B6AA 4E7SA 2VONA 4F52A 2ESNA 1IW7F 3BLYA 4MFEA 4DZJA 4UVAA 2NSMA 2QVPA 3OR2C 5F1RA 4BL0B 2GXBA 3KRVA 4ON0A 2H6BA 4H2KA 1WJ5A 4NGMA 2XAUA 3S1QJ 5IOYA 2AHQA 4U5YA 1S6LA 2Z16A 1Y7RA 3DKXA 1G3WA 3GEZA 4DJLA 4QC6A 2FT0A 2ZMEB 1RKTA 3F8CA 4XRSA 1Z2LA 4D7MA 2FL4A 2O3FA 4F8ZA 1S7OA 4OMZA 2VQCA 1WJFA 2PG4A 2XEJA 2STWA 4AB7A 4BXXJ 5E20A 3FXLA 2Q4ZA 3OR1C 1ARMA 4FBEA 3K4KA 3GB0A 1I50J 4FE4A 1ZARA 2KP6A 2LRDA 2O5RA 3I3LA 4ZYEA 1HXDA 2P5VA 3T90A 1B8IA 4S04A 1GV2A 4ZH4F 1X2MA 4HQMA 1FIAA 3KP4A 2V1UA 1Q2DA 3H8FA 4DQ2A 2K85A 1KQ0A 1N77A 2HOSA 2PJBA 4FD6A 1J3LA 3C2BA 2YU9J 3S6GA 2PI0A 4KSFA 5FO5A 5F0CA 4AIJA 2IGOA 1HOMA 2WWYA 1TLHB 4EGYA 2FJ1A 1LCPA 5AG4A 1GGOA 2G7UA 1W7PD 2OA4A 3SZGA 3BI0A 3BC8A 4ZZLA 1Y1WJ 4PK3A 3IWFA 3OMYA 2YSRA 5TISC 2GM4A 1YR0A 4H6ZA 4OC1A 3F23A 2DQRA 1XDUA 3T8TA 2CQQA 3CUQB 4NC6A 5F9MA 2JMWA 3D2MA 2F4MB 1G6NA 2KRCA 3G1MA 3TKYA 2PRBA 4TWEA 5D29A 4LGWA 4H4KC 4B48A 4OLLA 4GO1A 1ITYA 2DI3A 3DCFA 2HDDA 1IUFA 3VPRA 1LANA 3IWZA 2DA6A 2ZEMA 3CXQA 4ZY2A 4PZJA 1VBHA 5ILVA 3RZDJ 3PB7X 1WI9A 4KN7X 4F9UA 4NQWB 4A0ZA 3F8FA 4UUTA 2CXAA 3D7FA 4BBSJ 1IC8A 3RCOA 4J00A 5DTDA 2W7NA 4A37A 4F55A 3J80K 2R7FA 2GLFA 1KBLA 2HXOA 1R23A 1GLNA 3O3KA 4BH9A 4CICA 5L3BA 2K02A 4EQQA 1A35A 1A36A 2ARHA 2ID3A 4L9NA 1S7AA 1JTXA 4BEHB 3AG4H 2E1CA 4WK8F 3CCSI 1TQMA 2ETHA 1OCPA 3GIUA 3RZOJ 4PSWA 3BJOA 1W0TA 4PJNA 2ISYA 2X4HA 1XOVA 3CUQA 4IOCF 3PFOA 4A33A 2WC2A 2BOLA 1ETVA 3F21A 5K5OA 1OR7C 3CPAA 4F91B 2XAHA 3IAS2 5J3LA 3ZMZA 1YW7A 2J9AA 5LRKA 4HF0A 3DWLE 3GLJA 2ZXIA 2R82A 5HH1A 2ID6A 2D0OA 4LMYA 3DR8A 3KZYA 5E3LA 1BI1A 3LMMA 3M1EA 2JEVA 3IU1A 4I0BA 2VXDA 4UV8A 2V8HA 4EWTA 1CQTA 2G7HA 2W24A 3LA7A 4NQWA 4E2AA 1OJLA 1YK3A 1QNTA 3ISXA 1PDNC 4YFKF 4RS2A 3LQRA 2Q0YA 4BHBA 1YJNI 2H27A 2NVYJ 2Q1ZB 1RXTA 2XF5A 4Y17A 3H8EA 5LRGA 1IN8A 5LYDA 4BEHA 1KU7A 5JI6A 5JVGF 3QPLA 4EEFG 4Z65A 2QF7A 1JDEA 1H9GA 3BPXA 3FM3A 2F8HA 3BP8A 5HVHA 2X85A 1XRYA 2C27A 5H86A 5CBMA 1PU9A 4A93J 2YNCC 3IFEA 1K4JA 2M7BA 2DT6A 3ISPA 2VUMJ 4MFPA 3EZEA 2DT7B 4XR6A 3G2BA 3OYKA 3L2VA 3PQJA 3E6BA 2UV1A 4C9YA 1WJBA 4X0GA 2DN0A 3WGIA 3WTWC 3GTQJ 5E79C 1F57A 4DW6A 5FKLA 5FROA 2EILH 1Y56A 3CP8A 4M73A 4K30A 3REOA 4P4FA 2HV2A 2EIKH 2E2HJ 2D0PA 5LHIA 2Z3LA 2P6FA 1KU2A 5FFZA 2QSFX 3QQAA 2DJIA 1I3QJ 2P81A 2G3TA 4BQOA 2ECBA 3J81Z 2KIMA 4D1QA 2BY3A 1K61A 1U0JA 3B3VA 2EA4A 1HW1A 1I3AA 1PUFB 1GHCA 1S5LC 2QWWA 1QSTA 1XD7A 3S16J 1XGOA 2VJ5A 3O8GA 4DIQA 4QTRA 1R1VA 4F6AA 2FU4A 4XIDA 2IS4A 3F8KA 3C2GA 3F72A 1QHGA 3TLGB 1ETOA 3H3UA 4MGRA 2W57A 4C8FA 4IHMA 5DV5A 5E96A 2LG4A 4HLYA 2V1DA 2ZSHB 2JK3A 5ICFA 1T38A 4G94A 3HRUA 2CS3A 2OH1A 3ISZA 5H6QA 4L5JA 3IKVA 1F43A 3JRAA 3U1DA 1V55H 5GP9A 5F1JA 5EEAA 4ENKA 3K4IA 3AG2H 2EZCA 2DYRH 3HUGB 3KHZA 3S32A 4A3CJ 1ON1A 4DNCA 5C88A 1QZZA 2IPQX 1BR4A 2QQAA 3BCAA 5D4RA 2JEWA 1MBFA 1FX7A 4JK1X 5E8GA 4U0WA 1V4RA 4BHPA 3R60A 1ETYA 2XAQA 4MHNA 4KA4A 3DPUA 4TNUA 1PUFA 1ZG7A 2P4WA 3K1NA 3CCRI 1Y8RB 4KFCA 1USTA 4EFDA 4P96A 3OOUA 2PJCA 4A3LJ 1ULYA 4Q36A 3TLGA 4BU2A 3A03A 2O0YA 4E7ZA 3W2AA 2RFHA 5FD6A 1RZ4A 2G0BA 1DP3A 2FBKA 4FISA 1ZG3A 2HROA 2PJ2A 4JJXA 2DA4A 2GXGA 1IB1E 2BOAA 4NJRA 2X51A 4U0VA 5JHUA 1XB4A 2XIGA 4OP4A 1JXSA 2L5QA 3GTJJ 3PZJA 1SMYF 4HAMA 5D4SA 4A3JJ 3PEIA 2KIQA 1P4XA 3TW7A 5CQGA 2IW5A 2Q44A 3TOAA 3DU6A 3KEOA 1A6QA 1YRNA 4YN3A 3H3VK 2MFZA 1YIOA 3P2FA 4A3KJ 4Y33A 1Y9ZA 3QPSA 2JDCA 3S15J 1T6SA 5A28A 3VYRB 2WAFA 3SXYA 1JKRC 5BPDA 4C3JJ 4DBQA 1CGPA 2E5ZA 3FBNB 4CAFA 2CQ7A 2HWVA 4MFZA 2M8GX 1I21A 1BI2A 1Z3XA 2R7DA 4WXDA 5A2QZ 5JR3A 4WJBA 3E7LA 2JQ7A 1YLOA 2HPIA 1XCVA 1MDMB 1SEUA 3FECA 3DTKA 4RAYA 2P6TA 1W36D 3HKZN 2MABA 4CZZA 5L3CA 1RUNA 2JLMA 2BHZA 3ZQIA 4KVME 2IGNA 3TCVA 1XF1A 4II3A 2LH9A 1CF7B 1IG7A 2H09A 3SXNA 5DWNA 4PXEA 3R61A 3GTMJ 1U78A 4PK2A 1MK4A 3N7ZA 1KONA 2VEZA 1GV5A 2EINH 4AYBA 3KASA 1XTAA 3GTLJ 2P8TA 3D66A 3ELKA 2BY0A 3HL2A 5EF6A 4RUHA 1VFCA 1KA8A 3SHFA 4PQAA 2EZAA 1QQ9A 3DEEA 2KRHA 2OQGA 2LDUA 3D7DA 1QZEA 4DGWB 4RI1A 5CPRB 3V38A 2L3DA 4BQQA 4CA0A 2EA2A 2BEOA 3M3YJ 3GFIA 1LVAA 4BQAA 2AXLA 2BE5F 4R76A 1MDMA 5IOZA 5BMZA 2ZFUA 2RDPA 4HNYB 5LGTA 1ON2A 5GAEJ 2A5WA 2ZXVA 2KL4A 3SEQA 3CLQA 2X1EA 3RPUA 1X1DA 1XGNA 4FX0A 1CF7A 2PJ3A 3FJUA 3LODA 4UCMA 1R4NB 2MYSA 1MJAA 3KEYA 1LFUP 2M0CA 3F6OA 2ZC2A 2Y2ZA 5LBQA 4OAZA 4V2FA 1ZG1A 4XN0A 4M3GA 3D68A 2YR2A 3I55I 3OYCA 2WV1A 4F93B 4IKFA 3W6JB 4NGNA 4BMHA 3CJRB 4KISA 2CW7A 4HX4A 3OY9A 3WU1B 1R5HA 1S9HA 3B02A 4CGZA 3HB9A 3FHZA 4IJAA 2DFHA 3R0AA 3GLXA 3FEDA 3WABA 2VQLA 2MH9A 4C30A 4KLVA 1J0RA 1WSUA 3R9EA 4KLWA 5DM7F 1WKMA 3A4CA 4A0XA 4KMFA 4M9ZA 2F4OB 3GTOJ 1XMTA 3FISA 2WY8Q 3J7AO 1P4WA 3MD2A 3GUXA 1ZYRF 1HKTA 4CDKA 4B14A 3BG6A 2W25A 4FD5A 4ESJA 3ZRGA 2P6EA 5HODA 4YIRX 1WJEA 1XFOA 2KZVA 2OPTA 4OWRB 2CG4A 3C7JA 4RA2A 4IAVA 4MMOA 3FXOA 4I49A 5TJJA 3CMMA 4R1HA 3M8FA 3RQIA 4BJ6C 4P4BA 4UIBA 3S6FA 1MBHA 1HDDC 3R1KA 1BW5A 3EY5A 3GWZA 1IGNA 2PCNA 3R0JA 4O5VA 4MEYF 3V7SA 3S8PA 4A38A 3Q3SA 4NGSA 4GYIA 2D4OA 4YELA 3CCVI 1D0ZA 2DYSH 2R5YB 2BW3B 1TBXA 4XKCA 4B11A 3LL7A 2XRLA 5AG5A 3WC5A 1R36A 2X0SA 4C8AA 1O7LA 1J4JA 3GXOA 1GXQA 3G1LA 3IRRA 5F0HA 5D5VB 1VHSA 1ARLA 3BCBA 3N4MA 1P0HA 4DUKA 3BR6A 3GZNB 2NAZA 4HG2A 2A4NA 1BIBA 1TXRA 3IC1A 4KOUA 3S2WA 2IA1A 4ITVA 1FNNA 3TO7A 2DA7A 1CM0A 4CAWA 4RM2A 4BAYA 1ORKA 2JTVA 4Y7NJ 3TFYA 2XF6A 5DD8A 1FWZA 5HLGA 2EK8A 3BDDA 3TGNA 2JA6J 2AFUA 4MY3A 1B9MA 4CDJA 1R3NA 2DF5A 5DUKA 3IP4B 1IF1A 2CYYA 2HVSA 5HVGA 4AUXA 2FSRA 4P4IA 2ZEEA 1YS7A 2KZGA 3E3VA 5M5XJ 2UWMA 4UB6C 1LFWA 4U7BA 1K6OA 1N71A 3BXMA 1I5ZA 2BW3A 4QUSA 3FVLA 1ZYMA 3C1DA 5KNLA 3E6MA 2RKHA 3CT9A 2XB0X 4I09A 4LK0F 1UWYA 1V6CA 2PJ5A 2TDXA 5THWA 4RS8A 1NBWA 2CY2A 4ENMA 5AG6A 3CD6I 2OF7A 4EJVA 2NS8A 3ICUA 3KP6A 1Z1DA 2BHYA 3GO5A 1YFHA 3H0GJ 2R7SA 3B7IA 3M1CA 1ZAOA 4EJTA 3K4LA 3RKWA 2NMTA 3P7NA 3M8EA 3OL3A 5L3GA 4XLAA 3PBEA 4C3HJ 3J7YJ 5FJ8J 2JRMA 4HNWB 1UMQA 4G7HF 3BT9A 4A3GJ 1BPMA 4GRIA 1Y0YA 2PIYA 2Z3KA 5JVLA 5HOOA 1S72I 3W6XA 2XF7A 2FA5A 5DS9A 4CGLA 1G3SA 1BAVA 4YIIA 3SJGA 4NXYA 2LNBA 5J8FA 2DXIA 1FSEA 1TW2A 2ICWG 2M1BA 2FOWA 4CCOA 2F5FA 4E8OA 4CGPA 2MLKA 1B9NA 4JYKA 2W1OA 2LD5A 2B0LA 4NB5A 2LREA 1EE3P 3D5RC 3OV8A 5HXDA 4G7OF 2B7EA 4IUSA 1HLVA 3CUQC 2JWTA 2K40A 2H5MA 1KYZA 1TWFJ 2JBJA 4XLHA 3L2UA 1YE9A 1HF0A 1U6MA 5LRSA 1QSMA 3HG9A 2FVGA 3I0TA 2GIZA 4R9MA 2M8EA 1X58A 3ZXSA 1F9NA 1XEBA 4FX4A 1FSHA 1UG0A 3ZQFA 3L9FA 4ZZDA 3MKWB 5LHHA 5FLVA 4C86A 1SANA 3LSRA 1V5EA 3KP5A 3LSKA 1U3EM 4O3MA 3LD2A 2OR4A 3TMOA 5ELYA 1Y39A 1YI2I 2QLZA 2R7OA 1KUXA 2B3UA 1IRZA 2IQ6A 3L2QA 3CDXA 3I56I 1ZG9A 1TT5B 2NS7A 1VQ8I 2ISZA 2JN6A 1FBQA 1A04A 4A2UA 1U6GA 1T08B 4A94A 2LFBA 4C9VA 2DOFA 1WVRA 5GTIC 2ZJRF 4CYCB 2E71A 2CNMA 5J1YA 3L00A 4ZDPA 3WHCA 5E3MA 2K5TA 2E7XA 3KR5A 4HLXA 3QYFA 5KAFC 4KOTA 4R87A 2G0EA 2L02A 3ONQA 2L7KA 4G1PA 4GXHA 4M3SA 3IWGA 3AG3H 2WV0A 3QYBA 3I6SA 4FCYA 2A69F 1CBXA 1XMKA 1Y9WA 3CDLA 1D8KA 2H1KA 3HTSB 3E6DA 2XEGA 4X5KA 3NOJA 4E7JA 4OMEA 2ELJA 4PXCA 2LP0A 3G1OA 2JVGA 4A95A 3CJQB 3HPHA 3FWEA 1ZLHA 4UVCA 1ZG5A 1IGBA 1BW6A 4BHCA 1UJ8A 4L9TA 4ESFA 2VL8A 1TC3C 1Y7EA 5ILSA 4MQVA 1Q7LA 5BPIA 1YIJI 4ZBGA 1A6IA 1S8NA 3E5XA 3EYYA 3HHGA 4G9YA 4CYCA 5J40A 3LSPA 5H84A 3T05A 2ZW4A 1QSNA 3K4CA 3MMYB 3LNQA 1BR2A 3NA6A 1CE8B 2HXIA 1JWQA 2OAZA 3PNYA 1Z4EA 3DU5A 2E35A 1VF9A 4BY1J 5F46A 1XGMA 4HEA2 3WTSC 3NH4A 3NAUA 1ZGAA 1SMTA 5JYBA 4C3IJ 5GADJ 4FQGA 4ABZA 1C0WA 4MJ8A 2FD5A 2ME0A 4HOBA 5IT3A 2HTSA 4R8HA 1KYWA 4A30A 1WJAA 1XBUA 2ZNYA 4PUSA 3TDUC 4KORA 3W3CA 2CUZA 3ZN1A 2HB6A 1S7FA 1TIQA 4AVZA 3MFKA 2Z1DA 4Y52J 1L0CA 5HS7A 5DCMB 3E0KA 3CMAI 3GCMA 4GCVA 2X48A 2O4HA 3A02A 2B63J 5CKTA 2DDBA 2R7RA 1BJZA 3GTPJ 3E6CC 5F04A 4IHSA 1AKHB 1YW9A 5EDNA 4MTDA 1OYYA 2HYGD 1LQ1A 4KOVA 3SFIA 1ZG8A 1YX5A 2VBYA 2X6OA 3KYCB 5DCFA 1T2KA 3EC4A 3HC7A 3W2WA 1Z7UA 2A05A 1HW2A 1VHEA 3JSOA 5IYDJ 1ENHA 1CP7A 1UHMA 3H36A 4KOYA 5K8MA 4U88A 2B4DB 4ZYAA 2HQ5A 3JW4A 1V54H 2V77A 4NFRA 2KDZA 4YRHA 3TBIA 3ZMUA 2L9SA 2XV4S 5CVVA 2ATRA 3L2NA 5D8LB 3ESWB 4MTEA 4AIDA 5IY5H 4KT5C 1GT0C 3PRTA 3Q0VA 4C7IA 1EA3A 5HS9A 1J2XA 4D9JA 1T0FA 4F0XA 4C2TA 3CXPA 5L3EA 3H92A 2AFSA 5DCMA 1LE8B 2V9VA 4BYYA 3D4UA 4NCZA 4LG3A 2UUZA 4KSAA 2XSJC 3BZKA 1W5TA 1ZGJA 3WG7H 3TOBA 3QRFF 4KUAA 4QBJA 4ZC3A 1TT0A 1AKHA 3LA2A 2I8DA 1WGXA 3FH4A 4AG7A 1HBXG 5GAGJ 1P7IA 1XG1A 4XKVA 2C6GA 5G22A 4KNGE 1SFKA 2J5PA 3O6BB 2KT0A 3HOSA 1S5KA 2VL1A 3BZ6A 2ESHA 4MFKA 5FRMA 2CNSA 1FZPB 2B4DA 1USSA 4RB0A 4C8CA 3VTAA 3NRVA 2BVLA 3WT4A 2RN7A 3BQYA 1QZYA 2VBWA 2EQRA 1VTNC 5LEJA 2OTLI 2QQBA 4A3DJ 1G2HA 3QAYA 2EV5A 4LLLA 4H6UA 4GS4A 2ZXHA 1X4PA 3WR7A 4NJQA 2DQLA 3WODF 4BS9A 4M6HA 2VE9A 1UCRA 1LE8A 5F47A 1IYKA 2QMLA 2Y31A 2C6PA 3DV8A 2DPTA 1T8IA 4RGSA 3GZ6A 3JSPA 2BVMA 1R1UA 1RC9A 4BXFA 2ZOGA 3DSBA 2HWGA 2VXZA 4A6DA 4C99A 4KIFA 3KPHA 3EPZA 4FUUA 3RJPA 4L89A 4XKBA 1CG2A 5EEGA 1EF4A 3A0HC 5J47A 3FK6A 4I7HA 4M71A 3T8WA 1TL8A 2R98A 4BY7J 1SAUA 1DTDA 1RR7A 4OIPF 2WY7Q 1IXRC 2VBXA 5HLIA 3EO4A 3PM1A 5D5XB 2WAQA 2TRTA 3S9NA 1RETA 2QENA 4CYDA 4C8UA 1PP8F 1A2ZA 4OC5A 3SJMA 5EYRA 1Q1HA 2LSOA 4KMUX 3IV5A 2QYOA 3CCQI 4HX7A 2GXAA 4IHYA 2X6YA 2DMNA 3HDDA 2VODA 4RN7A 2AUMA 1O3QA 3DKYA 3KYLA 3GBGA 4L9JA 4OIRF 5CVIA 5GTHC 2R7QA 3OYEA 2PVVA 5HVFA 1XSDA 4XNHB 5C82A 2WA0A 3OYFA 2STTA 1JUMA 1W5SA 3D8PA 4N4OB 3LSMA 2IGMA 5ERIA 3R96A 2CO5A 3HSEA 1H8AC 1IRFA 4ZYGA 3TT2A 3FZVA 1VQLI 2K9MA 3CCYA 2LKPA 3CDHA 4LITA 2L4AA 4PJ0C 1E0EA 4HV6A 2IXSA 4RLQA 2QCOA 2XGCA 4Y3OA 3E5UA 1ZK8A 4YRVA 4U7DA 2EZLA 2EK9A 2HC9A 3S1RJ 2EBIA 1BI0A 2M0MA 3W6SA 2JRTA 2PN6A 3WGGA 2ZMEA 2Q4VA 4C84A 1U5TB 3QU3A 4TV7A 4Q5SF 1YQEA 2HOAA 3NE8A 2L7MP 2PMUA 2R7HA 2FNAA 3DBRB 2GWRA 5AIQA 5FKMA 1H0MA 3BWGA 3FM5A 2CUFA 3UR3C 4CSWA 3J80Z 3FX6A 4FAIA 2L7FP 4XICA 1TW3A 2VQGA 3QWLA 5CVUA 2PJ4A 2V8VA 4IQ4A 3VFZA 1QU3A 4HPSA 3VWDA 3SI1A 1YW4A 2K4BA 1UHWA 2WB1A 2HOTA 4JBAA 1YQAA 3BR0A 4L5EA 4EATA 6CPAA 3ML6A 8CPAA 1IV6A 5BNGA 3HGGA 3RQ4A 5IP7J 5K8NA 1IAWA 1HCRA 4LUAA 4B47A 4NEXA 1BLLE 4CHUA 1QRYA 4EVIA 2EUIA 3BJ7A 4U9ZA 4KOWA 5FKNA 4MFDA 3LACA 2HYJA 4NDLA 3ABTA 1S3ZA 1T95A 5F6FA 3P2HA 5G20A 3H9JA 4L9VA 1FLIA 2VI7A 5HLHA 2CTCA 2B5GB 1F1ZA 4CO9A 4JP0A 4XNFA 4O23A 2FBIA 3IIBA 3S2HJ 3E97A 4YWYA 2V1NA 2FM4A 4XN3A 4CCLA 3OIOA 4XPDB 5I0CA 2EZKA 2YJTA 4NSQA 1XPXA 2DBBA 2LYCA 2R93J 4J0NA 1HSTA 1MBGA 1ZRSA 4A3IJ 1D1CA 2P6GA 4FD4A 4RLFA 1WH5A 3MKLA 3P9CA 2DODA 2WPXA 4MCPA 2K3PA 2LTPA 1X1CA 2E36A 1M6VB 2NRAC 1L3LA 2FE3A 2XAGA 3VSLA 4C2MJ 3L2WA 1NHAA 1JGGA 3PO2J 1IRXA 2ODFA 4HF2A 1VI0A 1P4NA 4ENJA 1AOYA 1M1DA 1DGRM 2Z0ZA 1E3OC 3IGRA 2KISA 2NVTJ 3KFWX 2A5YB 2HTJA 3CO7C 1VQOI 3WGHA 3OYIA 2ZXJA 5EJCA 3GJZA 3OYAA 1R9TJ 1ZLKA 3BLNA 2B5GA 3U1BA 3S9LA 2LBFB 2ANPA 2RNGA 3L2CA 4HF1A 4UA3A 4AG9A 5GAHJ 1MZBA 4XSZF 1LOKA 3BY6A 4Z2YA 4P9UA 4EJWA 4KUMA 2BEIA 3RZAA 2FRHA 1JJ8C 5C4XJ 2Z3NA 3ABUA 2I79A 4KS9A 2Z5UA 2LY9A 2DMTA 2HR3A 3LSIA 2M4KA 5F1YA 3R95A 1YO5C 1LJ9A 2CW0F 1RO5A 2ZBKA 5GPCA 5FKKA 2ZKZA 2R7UA 3IWEA 2DW4A 1E2XA 1SVMA 3ZN0A 2A61A 2MGQA 4LK1F 2LVSA 3K70D 3TLYA 4E94A 4BKXA 3KLNA 1PYVA 4RAFA 5HNFA 3GFMA 4D5FA 4LIUA 1HDQA 1CS0B 2DMPA 1Y9KA 3MZHA 4EM0B 5DWMA 2YX4A 4AVCA 2R3SA 1DE4C 2PIZA 3WHBA 2HDCA 2PJPA 1BJAA 4PFPA 2QIRA 4AVBA 1HEEA 1SFUA 1YOVB 1PP7U 2AQEA 4IQJA 1PYTB 3WTZA 1YREA 4PK4A 1JKQC 1GXPA 2EO8A 3EFAA 1BOBA 1Z05A 1GUUA 3HEFA 3O2PE 1JT0A 3HOXJ 3GVAA 2XHKA 5JQ4A 3ULQB 2CQKA 4KOXA 3W6VA 1XIXA 3CCJI 1LKXA 3G6EI 4QLCU 1D0YA 3JCUC 4XL9A 2HI6A 4YFJA 1R22A 4EMEA 3ERED 1LDKB 2YPRA 2Y0MA 1VQPI 4IF5A 2BV6A 1ZQ3P 4GM5A 4JD6A 4XLNF 4MHPA 5K99A 5CJ9A 1IO2A 1IJWC 4I02A 2V6EA 1I6HJ 1LPQA 4Q38A 3C3WA 4C8TA 2JT1A 4CXFA 2IVMA 2XGEA 4IHXA 3H4QA 2DMQA 1Z77A 4C68A 1YITI 4KDPA 3K2AA 2XEIA 1WPKA 1OLTA 3QODA 1VGYA 3FMCA 3I71A 5IYCJ 1G4DA 5TRDA 1HA8A 4R8FA 1VIXA 3JRDA 3BOQA 3EDPA 1K78B 4BBHA 2KMUA 1EH7A 2KLOA 4FHTA 1KC7A 5BQTA 3WTXC 1XSVA 2LC2A 4R57A 3FF3A 2VQHA 1TWAJ 1R1TA 3FMSA 2FNPA 4HDUA 5B66C 4HZFA 2CNTA 2REFA 2MG4A 1LFBA 1ETQA 4CCKA 3LMSA 3HUGA 4XRFA 1EZBA 3A01B 2M45A 1QSOA 2ZXWH 5G21A 1ELLP 7CPAA 4OMYA 2KQRA 1IN6A 3GYHX 4DBRA 4ZYHA 3Q9SA 4E7KA 2NVQJ 3HOVJ 4HRIA 4AVPA 2FOKA 4EJOA 4NGQA 3S6KA 4X3RA 1BOAA 2GQQA 1QGPA 2CSOA 1N75A 3VDXA 1VQKI 1B6AA 1OMIA 2KJBA 4MFJA 2AFWA 3C2HA 1MNEA 3DLJA 3E5QA 4OINF 4B10A 4ASNA 1Z8LA 5F09A 1K78A 4I76A 2MP0A 1P4AA 2QQ9A 2XPUA 3TYXA 4XLPF 3N5FA 2FUG2 3L7WA 1Z7LA 4QIWN 4PCQA 2V1XA 4UVBA 4OC2A 1GDTA 5J1RA 3PGPA 2EV6A 4CCJA 4PJJA 3CTAA 4Y15A 3BJ6A 3HSFA 2EFWA 3DBLB 1H9TA 2L54A 2FMYA 5BOXA 1DU6A 4UEFA 2CTBA 1K6YA 1MMNA 3BTLA 2PJ1A 2ZENA 4UBRA 3K70C 1BBYA 2MH2A 1IDYA 5ICEA 1UFHA 2V8DA 1IXCA 1UZCA 4HNVA 4ZTFA 1Q5XA 1WH7A 2LY1A 3PUBA 2F7VA 3TE4A 2PJRB 1KU3A 4LX9A 2QKMB 3TQNA 2G3AA 1A5JA 3PQKA 2ZEDA 4CZ1A 1PVEA 4UUSB 4II9A 4BE1A 1T0FC 4KT6A 4B13A 4NC8A 4P9FA 4M6YA 3WTUC 1VI4A 2M4GA 4KITB 4MFLA 1RESA 2XSDC 2OBPA 5FGMA 3ERMA 4DZPA 4R3LA 2Q0OA 4M85A 1XJOA 1X1PA 2JBKA 4JX4A 1WFXA 2NNYA 5CPAA 3MN2A 2YNDA 2AQFA 2ZO4A 2XC7A 2K9LA 5FLMJ 2HQAA 2VT2A 3IH4A 2AE6A 2O8XA 2PMZN 2RAEA 3AKZA 2ZEPA 4KOSA 2B0AA 4EV0A 4BE0A 1FOKA 2D5VA 2C6CA 2IJLA 4P5OA 4WX9A 2VPRA 3QOPA 3EYIA 2Y0SA 1Y0RA 2X1DA 2QSGX 1Y8QB 4D7NA 1YGHA 1YS6A 2EFPA 3CZ6A 3KP2A 1EJ9A 2PJRA 1GHEA 4Q7AA 5JGFA 4CGMA 3CZXA 2M9HA 2DXQA 3GZ5A 4M72A 4UUSA 2POKA 3PP9A 2OZ6A 2GA1A 3CP2A 1ONVA 2PEXA 1SFOJ 2QSHX 2ZJQF 4F9VA 3S93A 5HNHA 5J4VA 2AXTC 5E1XA 5KHDA 2PDOA 2DK8A 1J9IA 4PXDA 3NEUA 1QPMA 4KIBA 3TLEA 2W48A 2XKPA 3GF2A 2F2EA 1JKPC 2AUNA 1W0UA 1TQPA 1G59A 2RGVA 4N9IA 4CAEA 2EZIA 3B3CA 3G23A 1W5CC 4BNCA 1QHHD 4CGNA 2O6GE 1NTCA 3WU0A 2JA8J 1P6RA 1T56A 5FKOA 4ZDOA 2JZYA 2P6SA 2ZEHA 5KTCA 4R79A 1FY7A 2Z33A 2R7VA 3AFHA 1TKHA 3OL4A 2CIJA 1BO4A 5M3FJ 3B3WA 4ZTJA 1IRGA 5EGOB 2B3VA 3D7HA 5K5QA 2GOXB 1XMAA 3RNZA 3WC7A 3BPVA 1W36C 4II2A 3M07A 1OCRH 3CCLI 4ZYQA 4YG2F 3ECOA 4Q48A 2BY1A 3JRGA 2HQNA 3LOCA 4GXOA 3CO6C 1BC8C 2CGPA 4UFXA 3PSFA 5J1UA 4QVTA 1IU8A 2AFZA 3FEEA 4COBA 2Y75A 4INJA 3DPLC 1XS9A 3VATA 5GPAA 3WE2A 3QNVA 4XPLA 4BQNA 3GKRA 2EWBA 3KHXA 4XLEA 1O7FA 2XUBA 3GFJA 3QP5A 4P45A 3FB3A 3Q9VA 2IA2A 3MKYB 2B9SA 3ZR8X 4B3AA 2O7OA 5IP6A 1YLFA 2V9KA 2OQRA 3PFYA 1MH4A 2PVWA 1XCBA 5FRNA 2DLLA 4P6YA 3T0TA 5K1YA 1T39A 2JA2A 3AL0B 4XOTA 4N0BA 1DU0A 4CUGA 5EGOA 1VBGA 3NWTA 2Q7SA 2IS1A 2PJ9A 2MD5A 9ANTA 1STZA 3VWBA 2PE3A 2ZMEC 3BR1A 3LSJA 2R5YA 4OIQF 1KUYA 2PLYA 1LRZA 2EFQA 2QGUA 3ZGKA 3IJ3A 2CRGA 3RIRA 3VODA 3U9GA 1AMPA 2EV0A 2F4IA 1WK4A 3HGYA 2GFQA 1P2FA 3B6CA 4XNHC 1YX0A 2CQXA 4JX5A 4UXNA 1X12A 2O9LA 2XRNA 4A12A 1RRJA 1SAXA 2IRFG 3O8HA 1VQ7I 5HVQC 3OYBA 4KUBA 1IY7A 4LIVA 3S3MA 1RKWA 2R0QC 5IB0A 2H8RA 2ZNZA 1ZKGA 3D0SA 5IP9J 2ADUA 4LFUA 5K7FA 5K5RA 1N25A 2ZW7A 4C2ZA 1XMXA 3FIXA 3K2ZA 3JAMK 4P4JA 2BY2A 5JHFA 4PPZA 2GP4A 1O57A 2GZWA 4EYSA 2GE3A 2Q8KA 4H0EA 1B4AA 1U5TC 2Y69H 5B5EC 1ZR2A 4WWCA 1RUOA 4YIFA 2HKXA 2QYVA 3I1UA 5IX3A 4OC3A 2HI3A 2CV0A 2XAJA 5F64A 4GYGA 2VZYA 3T07A 5C3EJ 4HSTA 5E3NA 2FE7A 3TEDA 1VQ6I 2DPUA 1OPCA 1JKOC 5HDNA 2Q43A 4UCNA 1JDBC 3OIPA 3DGVA 1EZAA 1JTYA 4MCRA 2PQ8A 1PUAA 1SD7A 3PB8X 4DYOA 2L2OA 3UNGC 2C5QA 2H6CA 3ZQHA 1MH3A 5DD4A 2RQQA 1FP1D 4HBLA 1FMWA 1X3WB 3KCCA 1L0OC 3W91A 3ZP5A 4PSXA 2XGDA 3CF2A 3IL2A 2A68F 5LRJA 2ZEFA 3SXOA 1TP4A 1D1AA 4CDGA 5EG0B 1R43A 2X9DA 2IA0A 3PIOF 4M3BA 5D6EA 4NUBA 4U9YA 3DLAA 2ZW5A 2E28A 3IKTA 4RGXA 4K3NA 1XGSA 4M6XA 1JQGA 1Z3YA 2W4SA 4HV5A 2FQ3A 3EXNA 4RB1A 3K4BA 1MNDA 2IEKA 4PV6A 4XM3A 3ZCOA 2HQYA 2WAQN 3TP0A 3H5RA 3FYNA 3C26A 2EJRA 4AM3A 2CUEA 1FYLA 5D8KB 4LJZF 1ZTRA 1E3HA 2WZNA 1WZ2A 3FIWA 3WC6A 5J6XA 6PAXA 2GOMA 2X1CA 1APLC 3FXKA 2VZZA 2LLKA 2CV2A 2DFEA 3GTKJ 4WCGA 1EV7A 4ZYDA 1TTYA 5J8CA 2KPMA 3CUOA 2EWNA 1FOXA 2A3SA 1Z8TA 2VE8A 5EG0A 2HZDA 1RNLA 1XSXA 4FTHA 4XONA 4R7MA 3VOEA 1H8LA 3D67A 2CUJA 3CQZJ 5ICGA 3DTEA 3CDIA 1VQ9I 4UWIA 1YHQI 1WHUA 2LKSA 2DU9A 3PFIA 2Q51A 4CS0B 2K7LA 2VT3A 2DO7A 3HIFA 1C3OB 3IEHA 2REEA 3RYPA 1G8XA 3F5BA 2JA5J 1SD6A 3W2VA 3JTKA 3TDZC 2DAOA 5BWAB 2KKOA 3KE2A 1UELB 3QAHA 3ZQCA 2QA4I 3RAMA 3FK7A 1F2OA 1P9QC 4BBRJ 3PSIA 3B8GA 2IT0A 2DPDA 4IEJA 5FLXK 5HDGA 3V7CA 3BTCA 5ED4A 2Q04A 4ZY0A 3S1MJ 2V79A 2M87A 1ZO0A 3JUWA 3ZJ0A 4IRHA 1J5YA 3N05A 1ZLIA 3I64A 1MMDA 2P5KA 4WF2A 3I5UA 3JR9A 1O3RA 3GMEA 2R7XA 3LAJA 3CMEI 3PJRA 2VN2A 2WB1N 4RBOA 2IGKA 2K9NA 4P1WA 4QPQA 3DBHB 3WE3A 1WJCA 1MNMC 2ME6A 1ETXA 3AG1H 4CYNA 2ACJA 2XPVA 5E8IA 3UY5A 2PFBA 5DUIA 5LYIA 3ABKH 2MSYA 3R6SA 3MZ8A 3KYDB 5KTAA 1R5GA 2VC0A 5FFXA 1U8RA 4UFVA 3GUDA 3D5LA 4V2GA 2MLGA 4HA8A 5E17F 2K9QA 2J8NA 3MKZA 5LGUA 3ASNH 3TL4X 3MVPA 4LG0B 3NH5A 3DNSA 2R7TA 3K4MA 2YS9A 1WCMJ 5F08A 3KL9A 1TNTA 4YGOA 3HRSA 5H2FC 3ZMVA 2O61A 2EVNA 2HUZA 4BXUA 2V6CA 2DK5A 1Y0NA 1NG6A 2M5WA 1OZPA 5ILUA 4AIHA 5H6RA 2D45A 3K0LA 2L0KA 5J4YA 2MA3A 2B4BA 2R8VA 4X8IA 4BJ5C 2OV7A 4AVAA 4XPKA 3K4JA 1AA7A 3HSRA 2Z10A 4C9EA 5K8OA 4IPAA 1R57A 2I00A 2X6XA 4FE7A 2FQ4A 3LQQA 4PGHA 1ZH5A 1S7KA 4I01A 3KI9A 3KQXA 4M6IA 4XLFA 5E1ZB 3QOEA 1MKMA 3PB9X 1FBSA 1ZRDA 3M4OJ 1M4IA 1DQUA 5KK1A 3QPHA 5ICCA 4BDZA 3S2DJ 4PJLA 4C2YA 5AG7A 3AAFA 4JVOA 1MSFC 5EC4A 1JHHA 3HOTA 2I3CA 2L9RA 3K9TA 4A5MA 2V8GA 2X7BA 4CRZB 2FIWA 4M9XA 2ECCA 4UFWA 1AHDP 3HOUJ 1BR1A 1YMEA 3SJFA 4LLGF 2WADA 4M6VA 2IBDA 1JUPA 2P5LC 3A2KA 2PMHA 2LF8A 5CYVA 4O6JA 2VI6A 2VB6A 4KICA 3F22A 4C9AA 2BXYA 3DP7A 2Z9OA 2H1LA 4IX7A 5EZGA 3DLLF 3MEXA 1N78A 2L01A 3IHUA 3PL8A 3CMYA 5A27A 3M9AA 4X1EA 4ONUA 1V0CA 2E60A 1R7JA 5HDKA 3I58A 3K9UA 5JLWA 1CX8A 4M8DA 3CC2I 1Z21A 2PJ6A 1QVUA 3MQ0A 4Y49B 4DYQA 3NFZA 5JH9A 1RPWA 2O8KA 4CAXA 4B5OA 5TGTA 1NSAA 2HS5A 3VH9A 2Z3MA 1HKSA 2E2IJ 1NXJA 1OYWA 1ZLJA 1FTTA 2F5VA 2VKEA 2LR8A 3S17J 1IYLA 2HVQA 1Z8XA 4L5IA 2BO9A 1BN5A 2K86A 4DJAA 4KVOE 5B1AH 3U2RA 2AO9A 3OYGA 3LSTA 2M2EA 5LEKA 3P9IA 2PR1A 4P44A 3S9MA 3G71I 2XB5A 4E6KG 3CCUI 4IIXA 3G4SI 2HOEA 3M7GA 3COAC 2AFOA 4MHDA 4UF4A 1A31A 1ETWA 4UV9A 3ROUA 1V5GA 4I0AA 4OAEA 4A3EJ 2FEZA 4KJZA 2DJNA 4A0YA 2TCTA 2HDWA 3JRIA 2RQPA 3CC7I 4CAVA 3T8RA 3F8BA 3VARA 2YUSA 3JRFA 1ZGWA 4LOCA 1POGA 4Y13A 5CLSA 3SHPA 1XF8A 3VSKA 2KFDA 1MJBA 4ESBA 1KUVA 1IOIA 4Z6YA 5FB2A 4QSHA 2J5OA 4NC7A 4AC0A 4IHVA 4X2TA 5F0FA 3VEPA 1UG2A 2Z3OA 2H94A 2D2WA 4YEJA 3F3XA 1NG7A 5M5WJ 4UEZA 1OKRA 5F27A 1BPNA 4N9HA 2Z3PA 3DDDA 4Q47A 1FNOA 4YFXF 3FMQA 3UKGA 3NE7A 3L1PA 1LNWA 2FMLA 2OTJI 1E17A 4DYCA 2F48A 2GBYA 3IH2A 3DPTA 2ZEOA 1JT6A 2UXXA 5LFAA 1QVTA 2CFOA 4E7IA 2OB0A 4MNUA 3H35A 4JWPA 3V7ZA 1BI3A 2Y9ZA 1LEBA 3IU2A 1AU7A 4ZGYB 4JXRA 2CJJA 2DA3A 3H9QA 4CCMA 4EM1A 3ZMTA 1NK3P 2WAEA 2UZKA 4KSIA 3IAM2 1KZFA 3K7AJ 1X3ZB 3H5ZA 3TO9A 4B1RA 1D5VA 3ABMH 1MD0A 2VPLA 1U5TA 3TLZA 3FX3A 3HJEA 2ELKA 3OOPA 2PSWA 2PBIA 1ZN2A 2IAIA 3JREA 4F3QA 2CH0A 2OC6A 1MSEC 1R5ID 3QYEA 1GVJA 2K3FA 2QQ8A 3CESA 3SI2A 2MC3A 3OS2A 3GFLA 3DXJF 4FETA 2IP2A 1HKQA 3BR3A 4M74A 3SEZA 1NMTA 3SI0A 4ZI6A 1IN5A 1Z67A 2JSPA 3BG5A 3BJ8A 3PB4X 1I1SA 3RYRA 4AYBN 3J7ZI 3LWUA 2VKVA 3I54A 1FT7A 4LB5A 1HQCA 1UB9A 2PCUA 1Y1VJ 1REPC 4HPQA 3ZZIA 1FBUA 1HW5A 2M3AA 2D4PA 2QVOA 2V4JC 2GANA 2HPMA 5LRRA 2CQNA 1SC7A 4NGRA 3C8OA 2CV1A 5F5XA 5LLQA 4P4EA 4HKFA 2PJ8A 3H9GA 4QWQA 5K8PA 2I5UA 2OD5A 3S6HA 3F9KA 3PO3J 4XSXF 1JUSA 3E0JB 4JZ0A 2PC1A 2X6WA 3AL0C 3FRMA 3DTIA 5D6FA 4HNTA 3V4GA 1FOYA 2DOAA 3FXUA 4IOAF 5F48A 3OS0A 2FF4A 5EBVA 2E5NA 2XAFA 3BG7A 4LD5A 3KKWA 3T5MA 4Q4ZF 3HRTA 3EIFA 1TKJA 4IRIA 1TNSA 3OYJA 4HNUA 3J7AY 3X2QH 1Q2CA 4TJVA 3HYIA 2Y0SN 2F5CA 1IZ1A 2BYVE 2KJCA 3E1SA 1EH6A 5L3FA 4D0PA 4A32A 5AGEA 5I4MA 1ACIA 2YGWA 3EUHA 1MW7A 5LGNA 3I9SA 3KX2A 1SFEA 3RO0A 4I98B 1FMVA 1U8BA 3FBUA 3ZMSA 3DKWA 3HTUA 4GGGA 4XOPA 4UB8C 3CCMI 2LKXA 3S1NJ 4WWVA 2VC1A 1FPQA 2R5ZB 3HOZJ 3PIPF 3G73A 1BL0A 2XPWA 3V8JA 3K6GA 3HBLA 2FSWA 4CGOA 2L7ZA 1IXSB 5JFRA 2VLAA 1R61A 2G9DA 3FKJA 1LUJB 1S29A 1XX5A 2E1OA 4CH7A 3JRBA 1FP2A 2LBFA 4A3BJ 4R3KA 1UFMA 5FD8A 4MO7A 1WI3A 2VJIA 4LB6B 3ZPLA 3U1KA 2PR8A 3D3SA 2NOGA 4ETSA 3JRCA 4FWUA 1RIOH 3OWTA 4FT8A 1ETKA 2G9WA 2W82A 4HYEA 4EMSA 5JVTA 1AWCA 2KCWA 1JGSA 1U2WA 3JRHA 5FVJA 2FCKA 4KIGA 3ASOH 4J3GA 4NBQA 3HUVA 4IVNA 3P9KA 3V8IA 1DUXC 3I59B 4AIKA 1YLEA 2LK2A 3WTTC 2FXAA 4M6GA 2GA2A 1YSJA 5CNPA 3OYHA 3BTJA 1FYMA 1SD5A 3RI4A 1MMSA 4NGTA 4X6AJ 3JRUA 5F49A 4MHYA 1CP6A 5M5YJ 2V26A 3D2PA 1R6RA 3J81K 3V42A 1Q1VA 2R5ZA 4MI1A 3KIOA 1M4DA 2PJAA 2RC4A 2GIVA 2LMDA 3MN8A 4R6TA 3SFZA 4F0YA 4C9UA 4S05A 1MBKA 4XRMA 4COGA 4M3DA 4EJUA 3FDYA 1KU9A 3BR5A 4C7HA 2VOPA 1I1GA 1X10A 5IYBJ 2K5CA 2ZELA 4MIMA 4UWJA 2J8RA 1A9XB 4BINA 5HMNA 1YRNB 1I12A 2AJ6A 1MBJA 3ZOBA 2RV8A 1FYKA 3FXQA 3I74A 1AYEA 2EFNA 2EIJH 4XLCA 4U0YA 1OCTC 2QJ8A 2WUUA 4NF1A 4B09A 2DA1A 3TW6A 1IICA 2IMOA 3QB8A 2QKLB 3SQNA 1WRJA 1TF9A 3I59A 4JX6A 2HYFA 5AONA 2VJ4A 4S0HB 1X1BA 1UHSA 2OCEA 4XRSG 3WG9A 5E18F 3R9GA 4C8PA 3LAPA 5B3SH 3KZZA 2FS5A 1FT9A 2VKHA 4G6TB 4LLNA 3FMRA 4E70A 2WSAA 3MRUA 1X4OA 2JA7J 3TLBA 1R49A 2LF7A 4IK2A 1S7LA 5DS0A 3HLPA 4M9SA 1D1BA 3ZQGA 2ZPAA 2OLSA 4ONWA 1KEEB 4M3FA 2E1MB 4RM3A 5HLTA 5E3OA 1CPXA 2B58A 4I2OA 4B5PB 3NARA 4HNXB 5HS8A 1O3SA 5IV0A 2CMPA 1Q2YA 1M1EB 1B1BA 1Z6RA 3LSGA 3D1NI 1J09A 4CYPA 2DOEA 4B43A 3DEUA 2EFOA 1EKEA 3HHHA 2WTEA 1J75A 1NE9A 2M7AA 2F5EA 2OCCH 3BJAA 3NQOA 4M3EA 2E2JJ 3OIQA 4IRGA 1OYIA 3A01A 4ORFA 2GREA 1B6BA 2YU3A 4XBFA 1DPRA 4OC4A 4OAYA 1CPSA 1SVLA 3F0CA 4BE2A 5CVJA 4A69C 2KIFA 1ZRCA 5IT9Z 4XMYA 1OCZH 1GYTA 1T33A 4IXAA 4C9RA 4DYRA 3LFKA 3OSGA 4B3XA 1XE4A 4AXVA 3TLCA 4J01A 1MMAA 3BR2A 5CVRA 2NOJB 3BZCA 3EUAA 4P55A 4G7ZF 5A2QK 4ENNA 5KAIC 1K4TA 2V9PA 5IT9K 1LAPA 2K4JA 1Z9UA 4B5PA 4PJMA 2YJVA 3V8LA 3H0DA 3B35A 4CRYB 1GVDA 1YG2A 2LOOA 4RDUA 3VYTB 3I4PA 1PUEE 1F4KA 1F36A 4A3FJ 2EBJA 1O3TA 3ZQQA 3PBBA 3CCEI 2GU2A 5G1ZA 2OZUA 2MD0A 3F6VA 1SFXA 2IL4A 2A6HF 4J19A 3OWCA 2R1IA 2JUGA 1PCAA 4MY0A 1S7NA 2JSCA 4W97A 2J8MA 5EZHA 2ELHA 5J1QA 3I3GA 1DPUA 4IF4A 4UEEA 2DMUA 3RTRA 1QSRA 3BTIA 5JM6A 1YW6A 4IO9F 1PJRA 5EMIA 2W84A 5D5WB 1U9OA 2ZJ2A 2K27A 3K1PA 2QBYB 1VNDA 2CW8A 2OJED 3T9YA 3QPTA 3KZWA 3PNTA 3VYSB 5C4JJ 5D8NA 2COBA 2LY2A 3EETA 4HQEA 1HC8A 3CC4I 1K83J 2MBFA 1Z9CA 3B3SA 3G8WA 4IL6C 4B44A 4ANJA 3OYMA 2D1VA 2VXKA 3EUKL 2DTRA 3HOYJ 3B3TA 2HNHA 1K7AA 4GDFA 4NHJA 5C44J 3TO6A 1Z91A 1ZELA 2BBYA 1YJWI 5IPAA 2BZTA 3NWSA 3FXJA 3BI1A 4PXBA 2Y48A 3ZQLA 1B87A 3QP6A 4W9YA 3BROA 3RKYA 4CZCA 1BA5A 1JE8A 1I6XA 1SQHA 4L0YB 4E5SA 2RVCA 3EQLF 1Z5RA 1TWHJ 3F0AA 1I39A 1ON0A 2DCEA 4MHGA 1X3UA 2RB7A 2HGCA 2Y30A 1P92A 4C2UA 3MZYA 3RSNA 1LDDA 2RREA 3L2RA 2QBYA 4OC0A 5DEQA 3JTHA 4JXQA 4LQ6A 2KRFA 1ZL0A 4XORA 2DFIA 3SDBA 1FIPA 3KZIC 4HW0A 5M3MJ 1TKFA 1YW8A 2AFMA 4E0AA 3SR3A 1KGSA 2ZW6A 3IWWA 2Q4YA 3IUOA 1RI7A 2Y9YA 1H88C 1T36B 2E19A 2I10A 2XDVA 2A6EF 5K7HA 1ZR4A 3H5NA 3D7GA 2JDDA 3T1BA 2BXZA 2A07F 2HFHA 4QPOA 4OIDA 1Z8WA 3KR4A 4MQ9F 4Y49C 3W6KB 1JI8A 4RGUA 2IJZA 2PJ7A 4IZZA 4I6ZA 2C1CA 2WBMA 1S7EA 3DQVC 4GFBA 1MJ9A 1YJ9I 4UNOA 3WTYC 3OYDA 2ZOFA 2R4GA 2W85A 3S3NA 4UIAA 3GTGJ 3BQZA 2YNEA 2N8GA 4RGRA 1FJLA 1XDSA 2WPWA 4L8AA 3WTVC 4JQFA 1K79A 3R9FA 1K4SA 1D5YA 4AU7A 4U87A 3I53A 3JAMZ 1FC3A 3A0BC 1HDPA 1HSJA 3NH8A 1XC5A 3HZJA 4BDYA 4HX8A 4H89A 1TZLA 3GYAA 1OR7A 2XKOA 3K1MA 3IO1A 1CJWA 4B12A 1J59A 4MHZA 1U9NA 1UAAA 1X1AA 3HOWJ 1F5TA 4P4DA 3HM5A 1TWCJ 4PFOA 1ZRFA 3JVNA 2DEAA 4K2EA 4LQGA 4B6ZA 1W7PB 2HQRA 1RR8C 1MBEA 2CU7A 2CF4A 4OU0A 4E7LA 1FEXA 4BUPA 2BUEA 1MMGA 1IOFA 3Q0UA 2DTZA 3M8JA 2RNJA 3LWFA 1KQ8A 5BS6A 3S3OA 4NNJA 3CF5F 3RKQA 4XQFA 1ERDA 3H8GA 5EEHA 2JJ7A 3RBUA 2ZJPF 3T0YA 1G3TA 1R71A 5ISVA 1YTYA 3HKZA 4RB3C 3H1CA 4CYQA 2VBZA 4RMNA
chains in the Genus database with same CATH topology
4UHTA 3L09A 2XROA 4NGPA 3QU6A 4IHTA 2COMA 2O53A 4KYWA 3ZMDA 4OKOA 4UUVA 4HDVA 4ZY1A 3T5XA 2XASA 2VOOA 3RPQA 1W7PA 1KQ9A 1QBJA 5D5UB 1WWXA 2QM3A 2HEOA 3ZQ7A 2ZCWA 2FBHA 4OIOF 1R00A 4G8XA 3MCZA 2P7CB 4RB2C 1QMUA 1TF8A 1VHOA 4ZX9A 2CWEA 2HZTA 2Z99A 4YU9A 4OOIA 1IUYA 3C18A 1LEAA 2HKOA 4C85A 3H3ZA 2PJ0A 1XMBA 4G6QA 1KWMA 4CPAA 2O03A 5DDGA 5LYFA 3Q5FA 5IB9A 3F8NA 3K69A 1M4LA 2AFXA 3GW2A 4F7ZA 2KIUA 3ECHA 3FF5A 5FLXZ 2XEFA 2CFXA 1B59A 4EGZA 3DF8A 3MWMA 3F8MA 2NYQA 1Z6TA 5LYLA 1LAMA 3CPXA 3SJEA 4EM2A 2OOTA 1WQ2A 3CJNA 5FD5A 3PFEA 1HDUA 3RDIA 4BD9A 2X0LA 1LB2A 3SJXA 5DYMA 4A6EA 4P10A 2XVCA 3IRQA 3K2KA 2AS5F 2E1NA 1WVMA 2EB7A 4MEXF 4OIWA 4MXUA 3IC7A 2JPCA 2ABZA 4KN4X 1T98A 4ZX8A 4RAZA 1ODDA 3R4KA 1QQIA 2QZ8A 1ZHFA 4WXHA 2ZEGA 4CO8A 3SZPA 3JTGA 4AWXB 4TJXA 1EH8A 3B73A 3G3ZA 1LDJA 2WYRA 2Z3YA 3B2YA 1XN7A 1MGTA 4YFNF 1OBRA 3KGQA 1IN4A 2GAUA 1BIAA 2ZFWA 3KEQA 5KVRA 1R58A 3KQZA 1G3YA 3KP7A 3V8KA 3N97A 1JHFA 3TX8A 1YYVA 4MCSA 2OU2A 2NNNA 1BC7C 3BHXA 1DDNA 1IN7A 5LHGA 2E7WA 4JYWA 3DFGA 3KP3A 4B8XA 4A39A 3MAJA 4MCQA 4PGGA 2BCOA 5H20A 2NYXA 3LA3A 3FXRA 1Y0UA 2EK5A 3KETA 2D1HA 1BM9A 3GX4X 3RKXA 2GLJA 4LG0A 3TC8A 1RTQA 1D8JA 3HRMA 4L18B 2C6YA 1W4MA 1ZREA 1D3YA 1V3FA 4PDKA 5AIPA 5L3DA 2F5DA 1QO0D 4MRIA 2XGXA 1I27A 2L4MA 3CLOA 1SD4A 3KLOA 2P7VB 1ELMP 2NS0A 3PB6X 5IR2A 2Q2EA 1F2PA 2PRQA 2QUFA 1DP7P 1S3JA 2JPBA 2YX7A 4KNYA 1TQIA 3V7RA 2BGCA 2DT5A 3SZTA 4G6DA 3VB2A 1J7KA 4AD9A 4A5NA 4WXCA 5E1WA 2M30A 4L0ZB 2UXNA 2VONA 2ESNA 1IW7F 4UVAA 2NSMA 2QVPA 5F1RA 2GXBA 4ON0A 2H6BA 4H2KA 4NGMA 1S6LA 1G3WA 3GEZA 4DJLA 2ZMEB 3F8CA 1Z2LA 2O3FA 4F8ZA 1S7OA 4OMZA 2PG4A 2XEJA 2STWA 5E20A 2Q4ZA 1ARMA 4FBEA 3GB0A 1ZARA 4ZYEA 1HXDA 2P5VA 4S04A 4ZH4F 3H8FA 4HQMA 2V1UA 3KP4A 4DQ2A 1KQ0A 2PJBA 2PI0A 5FO5A 4AIJA 2WWYA 1TLHB 4EGYA 1LCPA 2G7UA 1W7PD 2OA4A 3BI0A 4ZZLA 3IWFA 2YSRA 4OC1A 3F23A 2DQRA 1XDUA 3T8TA 3CUQB 1G6NA 3TKYA 4TWEA 5D29A 4LGWA 4GO1A 2DI3A 1LANA 3IWZA 2ZEMA 4ZY2A 4PZJA 5ILVA 3PB7X 1WI9A 4KN7X 4F9UA 4A0ZA 3F8FA 3D7FA 4A37A 3J80K 2R7FA 2GLFA 1R23A 3O3KA 4BH9A 4CICA 5L3BA 2K02A 4EQQA 4L9NA 1S7AA 2E1CA 4WK8F 1TQMA 2ETHA 3BJOA 2ISYA 2X4HA 3CUQA 3PFOA 2WC2A 3F21A 5K5OA 3CPAA 2XAHA