3K9TA

Crystal structure of putative peptidase (np_348812.1) from clostridium acetobutylicum at 2.37 a resolution
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
435
structure length
422
Chain Sequence
GMEEINKYIQNSSETGGEIYNLIEELFPICRSITGNGVRKTMDIIRKHIPLEIHEVKSGTKVFDWTVPKEWNIKDAYVRNSKGEKVIDFKENNLHVMSYSVPVHKTMTLDELKPYLHTIPGNKDRIPYLTSYYKENWGFSLTQNKFDELCDDDYEVVIDSSLEDGSLTYGEYYIRGELEEEILLTTYTCHPSMCNDNLSGVALITFIAKALSKLKTKYSYRFLFAPETIGSITWLSRNEDKLKNIKMGLVATCVGDAGIKNYKRTKFGDAEIDKIVEKVLMHCGSEYYVADFFPWGSDERQFSSPGINLSVGSLMRSCYGFDGYHTSADNLCYMNKDGLADSYKTYLEVIYTIENNRTYLNLNPKCEPQLGKRGDEFAMFWVLNMSDGKNSLLDIAYKSGMEFRRIKYAADALYRVELLKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative peptidase (NP_348812.1) from CLOSTRIDIUM ACETOBUTYLICUM at 2.37 A resolution
rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase
molecule keywords putative peptidase
total genus 139
structure length 422
sequence length 435
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09940 DUF2172 Domain of unknown function (DUF2172)
A PF16221 HTH_47 winged helix-turn-helix
A PF16254 DUF4910 Domain of unknown function (DUF4910)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k9tA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3k9tA01
3.50.30.90 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3k9tA02
4AIKA 2GLFA 3B3CA 3OV8A 4TNUA 3SJGA 1R5GA 3D66A 2X0LA 2EK9A 4IK2A 1JQGA 5ILUA 4OINF 1YTYA 4JZ0A 4UIAA 1F5TA 1HKTA 1R23A 1LJ9A 3JSOA 1FP2A 1FNNA 1CG2A 2M87A 1KYZA 2ISYA 4MHGA 3GXOA 3PRTA 1P92A 1RUNA 3B35A 2DK8A 4M6YA 3W6JB 3SJEA 4BD9A 1FBQA 4RS8A 2PJ3A 4HLXA 3LA3A 1Z6TA 1FYLA 2C6GA 4TWEA 2IJZA 3RDIA 2NRAC 4XSXF 2ZEMA 4HA8A 1XD7A 4RGRA 4IPAA 5D4SA 2PJCA 4P4IA 4A12A 3NH5A 2KRFA 1J9IA 3D7GA 3F22A 4MCPA 5L3DA 2C6YA 1ZG1A 3M9AA 1IN8A 3CJNA 1DE4C 5F64A 1TW2A 2OBPA 1YSJA 4A5NA 1W7PD 2PVVA 4ZY2A 5DCMA 3S9MA 3PB4X 4NGTA 5ERIA 3ELKA 1FX7A 1LDKB 1BI3A 2VE8A 3Q9VA 5E1ZB 3QAHA 1AOYA 5AONA 5K8OA 4ESJA 2AS5F 3I71A 1DPRA 1ZH5A 1HSJA 3KL9A 5H6RA 2HS5A 3WC6A 5DDGA 3GVAA 4ENNA 1PCAA 3Q9SA 2A61A 1VIXA 2UXNA 1TNSA 4UV8A 4LQGA 1DTDA 3I59A 1LAMA 3KHXA 1Q7LA 2JT1A 3BI1A 3EYYA 3KQZA 4XBFA 3K9TA 3RYRA 5IT9Z 2DW4A 4MHPA 4Q4ZF 5DUKA 4OMEA 1ZLIA 4G1PA 5J1QA 2FOKA 3WTTC 1FT7A 2CTCA 1GXPA 1Z6RA 1RIOH 3WGHA 2FE3A 5ILVA 3WU0A 4K3NA 4PXDA 3DLJA 2VOOA 2G7HA 4P55A 3E5XA 4ZZDA 3H8FA 2V1UA 2C6CA 1FPQA 4A5MA 4UVCA 3WT4A 4ZI6A 1TQMA 3D7FA 3NFZA 3MFKA 4HW0A 5BPIA 2FA5A 2ABZA 2CIJA 3H3ZA 1U5TA 2NSMA 2ZENA 3L2NA 4LK1F 4F8ZA 3L2CA 3R60A 5AIPA 3G73A 4O23A 1O7LA 1LDDA 4KMFA 2V1DA 1UB9A 4EFDA 3K0LA 4WXHA 1ELMP 5ICCA 3BXMA 3ZP5A 2QJ8A 1JE8A 2RGVA 1O3RA 5H6QA 1AMPA 1PYTB 1UFMA 5FD5A 2Z9OA 2ZOGA 4MXUA 3KE2A 2DI3A 1IXSB 2M45A 2IMOA 3I64A 4OC1A 5LGTA 3L9FA 1ZLKA 4OIRF 4ZYHA 1Z05A 2EV0A 1RZ4A 2XIGA 1NHAA 5D8NA 1MD0A 3T8RA 5L3FA 4L0ZB 2PJ0A 1R00A 3KEQA 3BI0A 4UV9A 2ETHA 3P7NA 3F72A 2V1XA 1KU7A 1EV7A 3W6KB 3R4KA 2EJRA 4EM2A 2K27A 4RGXA 4G7HF 5D8LB 4D0PA 1VHEA 2DT5A 3FJUA 5K8MA 3CTAA 1U2WA 3EQLF 1R1TA 4R8FA 4WCGA 4IRGA 2KJCA 2CW0F 4A37A 4Q47A 2VL1A 2IA2A 4HLYA 4MQ9F 3JTHA 5HVFA 4B09A 2XEJA 2E7XA 2G9WA 4UEFA 4ONWA 1B9MA 4IHTA 5CVVA 2O3FA 2MC3A 2LF8A 1Z2LA 1W5SA 4DYOA 4GYIA 3RJPA 5K5QA 1U5TC 5E17F 3K2ZA 2JRTA 2QYOA 1IF1A 1YW4A 5DD8A 1TF9A 3H3UA 3PQJA 4XLNF 1BIBA 1QBJA 1FC3A 2PJ9A 3GW2A 2QQBA 2LDUA 4JBAA 2M30A 1LQ1A 2ZEOA 3D67A 1S8NA 1QZYA 4N9HA 2PJPA 2HFHA 6CPAA 1ZYRF 2H6BA 3J81Z 2GIVA 3HSEA 2PJ5A 3HOTA 3L09A 1G6NA 4G9YA 5LRRA 4I02A 3FMRA 1WRJA 2RQPA 3KZZA 5EEHA 2VBWA 3ULQB 2BEOA 3KR5A 5FGMA 2PJ2A 1XGMA 1FZPB 1P6RA 2WWYA 3Q5FA 4FBEA 3LMSA 4BHCA 2HEOA 4XSZF 2DU9A 2PIZA 2DEAA 4A0ZA 2P5VA 1S7OA 2EFPA 3BROA 1XSDA 2ZEPA 4KSIA 4PGGA 3KETA 4RAYA 3ISPA 5CLSA 2B0LA 4ESBA 3FVLA 1KQ0A 2GA1A 2MH9A 5HDNA 2FXAA 1HXDA 3D5LA 4I98B 1D8JA 5JGFA 2O53A 4GYGA 5DV5A 5CPAA 3WTVC 2OAZA 1P2FA 3ISZA 1QO0D 3DQVC 1T39A 2QENA 3QP5A 1HQCA 2E7WA 3ZMDA 1L3LA 1I6XA 1EH6A 2E1NA 3V8JA 3E97A 3ECHA 2YR2A 4M73A 1SFEA 3F3XA 4I7HA 3IIBA 4M72A 3BY6A 2XVCA 2R7DA 2RKHA 4EWTA 1UWYA 2IQ6A 4ZYQA 1EE3P 2FF4A 4U0WA 4GM5A 2XKOA 1SD4A 2D2WA 3J81K 3BJAA 4HAMA 2NYXA 2O6GE 3RBUA 1LAPA 4HOBA 3AAFA 2IA0A 4PQAA 3IWZA 2CGPA 4GO1A 4ENJA 3V7CA 2PEXA 2FBKA 3FZVA 4NFRA 1KYWA 4AVPA 4HZFA 3SXYA 2V8DA 4RB2C 2LF7A 3V8LA 4CHUA 4FUUA 5KVRA 4A6DA 1T6SA 3WTXC 3LA7A 1ZN2A 4WX9A 1R58A 1YS7A 4KFCA 3HYIA 1SD5A 2PJ6A 5HS9A 3RPUA 2QVOA 5D5VB 1OKRA 5DS0A 3LWFA 3PB8X 2KJBA 1HDQA 2EFQA 4G94A 1O57A 5THWA 4MMOA 3FWEA 3M8FA 2JEWA 1KA8A 2DQRA 1D3YA 1CGPA 4MEYF 4NGNA 2VXZA 5JFRA 3MCZA 4OC0A 2ELHA 1MDMA 3O3KA 2PMUA 2YX7A 3E6BA 3KEOA 3BOQA 1FWZA 4A39A 1H9GA 2ZNZA 4BNCA 2ZEFA 2EWBA 4BAYA 1TTYA 1HKQA 2XV4S 1ZLJA 2O4HA 2ANPA 1KGSA 4BYYA 2PBIA 2XGXA 3D0SA 3D4UA 1F1ZA 3HOSA 1STZA 2MH2A 5K8NA 2HKOA 4KN7X 4YIFA 4R1HA 1AWCA 1MJ9A 4U0YA 3FEEA 1WSUA 4TV7A 2IRFG 2PJBA 3RZAA 3GWZA 4CYDA 3GFIA 4NGQA 2NNNA 2PVWA 4JK1X 3DPTA 4KIGA 3WTZA 1ZG5A 1XBUA 2FBHA 2V6CA 2PI0A 3C18A 2EFNA 3CUOA 3CO6C 4HYEA 1XJOA 2L4MA 1TQPA 4F9UA 1XMAA 4A2UA 2PG4A 5LRSA 5CBMA 2FNPA 4NB5A 3F6VA 4YWYA 3MEXA 4OC4A 1YW6A 4ZY0A 4B8XA 3IRQA 3VH9A 2MLKA 1OR7A 3S9LA 2PRQA 1RNLA 1YO5C 3ZQ7A 1BM9A 4P45A 1ZHFA 2ESHA 1XB4A 5DUIA 3F8CA 4PCQA 2YU3A 1U3EM 5E1XA 2HR3A 2AFZA 3T0YA 1ONVA 3H8EA 3LQQA 2FEZA 3D68A 1USTA 3LFKA 3GLJA 3B73A 2XKPA 4UUVA 3REOA 2K4BA 2ZMEA 1QQ9A 1KQ9A 2AFSA 2H6CA 1Q1HA 2EWNA 5LYFA 1J7KA 2NS0A 4XRFA 1XDSA 5ICEA 4KNYA 3BZ6A 2XRNA 5LRGA 2K02A 2XAQA 4UNOA 4X8IA 1AYEA 1FYKA 1FBSA 2QUFA 4M6XA 3SZTA 3QU6A 2DQLA 4L9JA 3KASA 2Z99A 4R8HA 3QNVA 1XMBA 3LWUA 3VB2A 1H8LA 3TC8A 2CG4A 2ZNYA 1MKMA 1MJBA 1XFOA 1R43A 5LGUA 4CDGA 2HOEA 2FRHA 4KN4X 3DFGA 3NRVA 2Y75A 3TOBA 1K6OA 3LSTA 4A0XA 3B3SA 1T98A 3ZN0A 3ZN1A 3BPXA 3P9IA 3GF2A 1D5VA 5J8FA 5L3GA 2QYVA 3H8GA 2DAOA 2ZBKA 4GGGA 1KWMA 5FB2A 5LBQA 3KP2A 3PFOA 1O7FA 2KKOA 5HVGA 5IT9K 1FNOA 3I54A 2HQNA 3U1DA 3TQNA 1P4XA 1T0FA 2RNJA 2ZMEB 2GLJA 1XRYA 3FXQA 2WV0A 4I2OA 5A2QK 5E8IA 2QBYA 1BI1A 1ARLA 2XAGA 3KZWA 4ZX8A 4AD9A 3FX3A 4FAIA 1CBXA 4EGYA 4WWVA 3ZMZA 3F6OA 3RKWA 4NGMA 4DUKA 4G8XA 1G3TA 1O3TA 4BXUA 1TF8A 4WWCA 3VFZA 5CYVA 4KMUX 3S9NA 4F9VA 4RUHA 3WGGA 5K1YA 1LDJA 4L5IA 5EEGA 5CJ9A 2O8XA 5J8CA 3COAC 4A38A 4X2TA 1BPMA 2EV5A 2W85A 1KU9A 3MQ0A 3FM3A 2DTRA 1DP7P 3GUDA 1LEAA 5LHHA 2QWWA 4EJUA 2A07F 4P44A 2Z3YA 4YIIA 3HLPA 1SFUA 3CUQA 3IWFA 3I58A 1NSAA 2WTEA 1IRGA 4KDPA 2ZEGA 1YS6A 1B59A 1BOAA 4FX4A 2H27A 3HHHA 5E20A 2L54A 4RGUA 1IXCA 3B02A 4R79A 5LYDA 2L01A 1X3UA 2BBYA 2F5FA 2V77A 2WZNA 2W25A 3T8TA 3VEPA 2PIYA 5HS7A 3CLOA 1LANA 1Z9CA 5LHIA 3N5FA 4HF0A 4CICA 2EA4A 2YPRA 1FT9A 2BCOA 5IT3A 1K79A 1G3SA 1FBUA 1OYWA 3GZ6A 3F8MA 4EJTA 3KP3A 2IA1A 2VT3A 4OOIA 1TKJA 1LVAA 3IKVA 1YLOA 1IZ1A 3FECA 2OD5A 4IHSA 4YU9A 1FOKA 3T1BA 3KFWX 2WC2A 2Z5UA 3KCCA 5LRJA 2HYGD 3TO6A 4ASNA 4Y15A 3CPXA 4ZYEA 1TKHA 4UXNA 4Y17A 5AIQA 3ML6A 3EUHA 5HLGA 4EV0A 3I0TA 2Y0MA 3HTUA 4HDUA 1YQAA 4P9UA 3CUQB 3FHZA 2XASA 4UEEA 1BAVA 2XUBA 4PDKA 5H20A 1VGYA 5F1RA 5ILSA 3FEDA 5CVJA 1K78A 4NJRA 2K7LA 3WTSC 4MHZA 2EFWA 3RKYA 2JBJA 3CUQC 1WKMA 2GREA 1HSTA 1F2PA 2DPDA 1MGTA 2C6PA 1YW9A 1K78B 2P5LC 5BQTA 3RTRA 2HYFA 2XAFA 4P4DA 1TLHB 2DO7A 4LB6B 1R1UA 2RVCA 2Q0OA 4KA4A 2W57A 1GYTA 4DQ2A 3LQRA 4HF2A 4KT5C 1FP1D 1QPMA 4EMEA 3ISXA 5E18F 1ZAOA 4ZYGA 4ENKA 3PB7X 3SJFA 3K1MA 3K2KA 3JAMK 4OIPF 1Z1DA 3P9KA 3RPQA 3U9GA 2CQKA 3HHGA 1T2KA 3NEUA 2HB6A 2IW5A 1ARMA 1Z5RA 1M4LA 3JAMZ 2Q2EA 4L0YB 1CPSA 1BBYA 4FX0A 3HRSA 1CPXA 3SQNA 1H9TA 3T8WA 3GFMA 4ZY1A 4GXOA 4OC5A 4JYWA 1VHOA 3TGNA 7CPAA 4S05A 1SFXA 3ABUA 3V7SA 1QNTA 3R0AA 3WTUC 3RKXA 2FMYA 3PFEA 3L00A 4S04A 1IRFA 4QLCU 4RB0A 3MWMA 5CVRA 3HUVA 4UIBA 3ZMSA 2E1CA 3LAPA 1VTNC 1TKFA 3GFLA 1SMTA 5FLXK 4MNUA 1BC7C 3BPVA 4AXVA 2GXGA 1XCVA 3GUXA 3DF8A 1LEBA 1IGBA 3SZPA 2F8HA 2ZXJA 4QWQA 1KU3A 2VC1A 3G3ZA 1YMEA 2WYRA 5K8PA 3N97A 2XAJA 2V8GA 4BHBA 2GA2A 1K7AA 4FT8A 1ZG8A 5FFZA 4DJLA 2JPCA 5D6FA 2W84A 2LSOA 3IHUA 5LHGA 2Q8KA 3QOPA 4P4BA 2COMA 3O6BB 4OP4A 1ELLP 3HUGA 5JR3A 2OR4A 1O3SA 3QPTA 2M1BA 1ZRCA 4M9XA 4HDVA 5E1WA 3SHFA 5HLIA 1EH7A 1HW1A 1YW7A 2F5CA 1ZRDA 2R7FA 3KLNA 3VARA 1J59A 4OIQF 4P4FA 3L7WA 1FSEA 3KP6A 2PQ8A 3WE3A 1OYIA 4IXAA 1Y0UA 1R1VA 2A69F 4MEXF 3HRMA 4ZX9A 3KZYA 4Q48A 4LG0B 1G3YA 1ZREA 2QBYB 3S2WA 3JW4A 2P8TA 4PXCA 1B4AA 2RV8A 2RN7A 1I27A 3CPAA 4M9SA 1HW2A 2FVGA 2BYVE 4CGZA 3CO7C 3R6SA 2JSCA 4WK8F 4AIHA 3DP7A 2VT2A 3NQOA 4P96A 3SI2A 1XGSA 3ZMTA 1Y0YA 4P10A 5ICGA 3PB6X 4ZZLA 3CDXA 4NGRA 3HSRA 3PFIA 5HDGA 2Q43A 1U78A 4UF4A 4P4JA 3PB9X 1R22A 2ZELA 2HTJA 3MAJA 4EQQA 1UCRA 1DDNA 2BOAA 3C7JA 3KQXA 2D1VA 3E6CC 1WQ2A 2GAUA 3E5QA 2FNAA 2DPUA 4X3RA 4WF2A 3I59B 1LOKA 4Z65A 2V8VA 5E8GA 5ELYA 3MZHA 2CF4A 1W5TA 1YYVA 5LYIA 2NYQA 4LK0F 1E17A 4P4EA 3U2RA 1WI9A 1J2XA 4ESFA 3FF3A 3WABA 4EMSA 3FMQA 4CO8A 3PEIA 2EK8A 4CPAA 3FMSA 2IJLA 2HQRA 2GZWA 2TDXA 2PJ1A 2UXXA 3CT9A 4OIWA 3RIRA 3DPLC 2EA2A 2VBZA 1XMKA 4ON0A 4NQWA 1OBRA 5LEKA 1QGPA 3D7DA 4LG0A 2POKA 4PZJA 3GZ5A 5LEJA 3PBBA 4P5OA 4L9TA 4OKOA 5D29A 1IN5A 1TW3A 3I5UA 1JHFA 2MD5A 4KUMA 2AXLA 3I4PA 5D5XB 2ZO4A 1LB2A 4EVIA 2PFBA 2PJ4A 3BWGA 1MZBA 4WXDA 2FSWA 2P6TA 3BJOA 2M5WA 4MTDA 2HC9A 4NHJA 4IHMA 5K5RA 4U88A 4CXFA 2PJ8A 2C1CA 1PUEE 2RB7A 4ZYDA 3DGVA 1DPUA 5D4RA 3F8BA 5HDKA 2ZEDA 4IRHA 3SI0A 2L02A 2PLYA 2VOPA 4UHTA 2PCUA 1F57A 4CZZA 4MRIA 1XDUA 1FLIA 3MRUA 2G7UA 4N9IA 3WU1B 3V4GA 1ULYA 1V3FA 2D1HA 5TJJA 4B6ZA 1YLFA 1CP7A 1BI2A 1QQIA 3TO7A 3VOEA 3P9CA 4FHTA 4Q7AA 5LYLA 5F6FA 5JVTA 1TQIA 3J80Z 1IN7A 2ZKZA 2GXBA 3IWWA 1UHWA 3SI1A 2OQGA 2KIUA 2G9DA 4HX4A 4L9NA 4R6TA 1ODDA 1LNWA 2EV6A 5I4MA 2BGCA 3GB0A 3WTYC 1PP7U 3ROUA 3GYHX 1GHCA 1U6GA 1SD7A 4H2KA 1ZLHA 4Z2YA 3V7ZA 4GCVA 4I0BA 2QLZA 2PE3A 3GFJA 2HKXA 1I5ZA 1YW8A 1USSA 3VATA 2Q51A 2YX4A 4HBLA 4Y13A 4KIBA 3WE2A 3OOPA 2P4WA 3WGIA 2R3SA 1R36A 5D8KB 2FBIA 1RUOA 3KLOA 4EJWA 2EK5A 3KHZA 2FQ3A 1ZARA 5BS6A 1HDUA 2VONA 1R7JA 1G3WA 2CTBA 3FXUA 3HRUA 2F7VA 3IRRA 2AFMA 4LMYA 4L5JA 3F23A 1BJAA 1SMYF 2QVPA 1H0MA 4NJQA 2PMHA 3R0JA 4ZH4F 4LB5A 3IO1A 2PN6A 2P7VB 2L4AA 3WC7A 3C1DA 4LD5A 2CO5A 1Z8LA 4HX7A 3WODF 5JH9A 3DV8A 4IJAA 4EM0B 2OQRA 3PBEA 5DD4A 1G4DA 5CVIA 3ZMUA 3F8FA 3HRTA 5DCFA 5TRDA 4UVAA 4XLPF 3GLXA 2RFHA 4I09A 1W4MA 1Z91A 2ZJ2A 1J5YA 3NH4A 4WJBA 4LLNA 4MHNA 1TBXA 3RI4A 2IP2A 3FF5A 1IN6A 2UWMA 2ZEHA 4Q5SF 4M9ZA 5FLXZ 1D8KA 3KI9A 2ISZA 4ENMA 4G7OF 1Z7UA 3K1PA 1E2XA 1FYMA 1J75A 4I01A 3E5UA 1GXQA 1I1SA 3H92A 1BLLE 2JPBA 4LGWA 4L9VA 3PQKA 4HQEA 5LRKA 1SD6A 2JBKA 5HXDA 4BH9A 2VBXA 2AFUA 3ECOA 2J5PA 2OA4A 4EGZA 1R3NA 4EJVA 1W7PB 3TX8A 4MCRA 2NAZA 5L3CA 1C0WA 2XAHA 2ZOFA 1S7AA 5ICFA 2QM3A 2HDCA 2AFWA 1V4RA 5D5UB 1Y0RA 3HIFA 2J5OA 1QMUA 2ZEEA 2A5YB 2O61A 5DEQA 4OMZA 1T38A 4A94A 4YFKF 3LA2A 5FO5A 5IB9A 1U5TB 2NNYA 1TNTA 3DEUA 3QPHA 1REPC 4MCQA 2DK5A 4FWUA 3IC1A 4MCSA 4W9YA 5F09A 1XSVA 4OMYA 2LNBA 4E70A 4IVNA 5JM6A 4N0BA 1ZRFA 4PGHA 4YG2F 4U0VA 2EB7A 1CP6A 2MLGA 1FY7A 3B3VA 2XEFA 5D5WB 1OMIA 2VE9A 3KR4A 2PJAA 4L18B 2CYYA 3SFZA 3IKTA 4G6DA 3B3TA 4M74A 5CVUA 3KP4A 5L3EA 4OU0A 2XEGA 4HQMA 2JZYA 1RI7A 3FXRA 4R76A 2IVMA 4O6JA 2X4HA 2PJ7A 2W24A 2STTA 2XEIA 3TKYA 3TDZC 4G7ZF 4EJOA 2CFXA 1HKSA 1PP8F 2STWA 4U7DA 5FFXA 5K5OA 3M1EA 4OIOF 3ZPLA 4NGPA 2KIMA 1P4WA 4OC2A 1Y7EA 4MTEA 1S6LA 2HGCA 2VC0A 1J0RA 3WG9A 2OZ6A 3BJ6A 3LAJA 1SAXA 1BN5A 2ESNA 2ZFWA 3C3WA 3KP7A 2BV6A 2DFIA 4K2EA 3ZMVA 3J80K 3SJXA 2ACJA 1KU2A 4H0EA 3B3WA 3EETA 2Y48A 3FH4A 4KICA 1CF7B 2H94A 4G6QA 1L0OC 3FX6A 4LFUA 1F4KA 3M8EA 4JQFA 1UHMA 2ZCWA 4MQVA 1OPCA 2YSRA 2AFOA 4BQAA 1XN7A 1KQ8A 1O3QA 1IAWA 3HTSB 3K1NA 3K69A 1MJAA 4MGRA 3DKWA 2AFXA 1YG2A 1BPNA 3ERED 1FSHA 2XROA 1EH8A 4U7BA 2BE5F 5HS8A 4P9FA 2D45A 1ON2A 3HSFA 5HVQC 1LFWA 1JGSA 3B2YA 2P7CB 4RB1A 1P4AA 2V8HA 2MBFA 3TO9A 1XGOA 3I1UA 3D7HA 3KGQA 4A6EA 5LGNA 2QQAA 4IF4A 4KYWA 3RAMA 3QP6A 3T5XA 2GWRA 3NA6A 4HV6A 1LCPA 1MDMB 1ZG9A 1YIOA 2QZ8A 2Q4ZA 4LLLA 8CPAA 4UEZA 3IEHA 1IN4A 3MN8A 1IW7F 2K86A 4I0AA 4O3MA 4HF1A 2A3SA 2A68F 1CF7A 2J9AA 3GO5A 3BDDA 1W7PA 1BI0A 2GU2A 1S3JA 2DBBA 4KIFA 3RYPA 5HVHA 1ZGJA 2ADUA 4BHPA 4NGSA 2OZUA 1F2OA 3QRFF 2I3CA 4O5VA 1HEEA 1TXRA 5KK1A 3J7AO 1XGNA 1BC8C 2GQQA 4HX8A 2M8EA 4WXCA 3EDPA 2HTSA 3QU3A 2RC4A 1DUXC 2O03A 2KIFA 1ON1A 1IUYA 2RDPA 3VODA 3DXJF 3ABTA 3CDHA 3JTGA 2OU2A 2F5EA 4DNCA 3NH8A 1BIAA 2IPQX 5ED4A 3WTWC 3JRUA 4PPZA 4MHYA 2VBYA 4RB3C 1CX8A 1F9NA 1B6AA 4A0YA 1A04A 4YFXF 2DLLA 2VN2A 5A2QZ 1HW5A 2OOTA 2UZKA 1HBXG 2FMLA 3TDUC 3KP5A 2O0YA 3GX4X 4PXBA 1ZG3A 3TOAA 2V9VA 1QZZA 4IRIA 3R61A 5JI6A 2F5DA 3MZYA 3M7GA 5HOOA 4OIDA 3E3VA 5FD6A 1S29A 1PDNC 1B1BA 3V8KA 2BO9A 3V38A 3E6DA 5BOXA 4P6YA 4RGSA 3B7IA 1ZGAA 4LLGF 2HZTA 4M71A 5DYMA 3I53A 2H09A 2L3DA 3F21A 1B9NA 3IFEA 4ETSA 3F8NA 6PAXA 4IAVA 2A6HF 2JTVA 1JHHA 2F2EA 5JHUA 1IXRC 4PXEA 3N4MA 1OYYA 1RTQA 4AIJA 2CSOA 1IY7A 5J6XA 3WC5A 2VODA 5L3BA 4RAZA 3IJ3A 2A6EF 5BPDA 2MA3A 1XSXA 5HLHA 3EYIA 2HWVA 1I1GA 1ZG7A 3IL2A 3BHXA 1WWXA 2CWEA 3IC7A 2K4JA 1XCBA 3E6MA 4UVBA 4R7MA 3JSPA 2LKPA 1U8RA 4YFNF 2P6SA 3FMCA 5D6EA 1JXSA 2Z33A 2V79A 4EM1A 5BMZA 3V7RA 3BP8A 5DCMB 1YFHA 2QQ9A 1GVJA 2XHKA 4OC3A 3O2PE 3FM5A 4F7ZA 2IT0A 4AWXB 5LLQA 2EFOA 2FU4A 4LJZF 4HV5A 1R5HA 2P5KA 3GEZA
chains in the Genus database with same CATH superfamily
4AIKA 2GLFA 3RO0A 3B3CA 3OV8A 3Q0VA 4E7HA 4TNUA 4ZDLA 3NOJA 1WVRA 3M07A 2E2HJ 2XRLA 2R7XA 3SJGA 1R5GA 4UUTA 3D66A 2X0LA 4IO9F 2P81A 3K70D 4IKFA 3FDYA 2EK9A 4IK2A 1X1CA 4LUAA 2DCEA 2FD5A 3VSLA 1JQGA 4CYCA 4FTHA 3ZXSA 5ILUA 1UFHA 4OINF 1YTYA 4JZ0A 2BXYA 4D7MA 1F5TA 2VQGA 4UIAA 1V5GA 4PSXA 1HKTA 1R23A 1Z67A 3RCOA 1LJ9A 3JSOA 1FP2A 1FNNA 1CG2A 2FIWA 4JXQA 2M87A 1GDTA 3OYEA 1MMAA 3U1BA 1KYZA 2ISYA 1LFBA 4PJLA 4MHGA 2L5QA 3DCFA 1LRZA 2B5GA 1R9TJ 3GXOA 4CCJA 4CDJA 5GCNA 3PRTA 1GT0C 1P92A 1RUNA 1BW6A 3B35A 1DU6A 2DK8A 3BG3A 2YJVA 4E4HA 5CPRB 2DA3A 3H9JA 1XMTA 4M6YA 3W6JB 5JHFA 3SJEA 4F52A 4BD9A 5HMNA 1OCZH 1FBQA 4RS8A 3GTMJ 4UFVA 2PJ3A 4HLXA 2RAEA 3BR5A 1Z6TA 3LA3A 1BR2A 1I50J 1FYLA 4OLLA 5CQGA 2C6GA 4TWEA 2Y0SA 4M3FA 3MGDA 2IJZA 4PK3A 1IB1E 3RDIA 2NRAC 4XSXF 3V42A 3DTKA 2ZEMA 2GBYA 5FKLA 1RPWA 4HG2A 3TP0A 4L5EA 4HA8A 1XD7A 4IHXA 3BQYA 2CRGA 3HEFA 4RGRA 4IPAA 5D4SA 2ZJPF 3MN2A 4JVOA 4CYOA 2PJCA 4P4IA 4A12A 3JRIA 3NH5A 2KRFA 1J9IA 1R4MB 3PFYA 5B1AH 1RRJA 4CS0B 1W0UA 3D7GA 2YS9A 3F22A 4MCPA 5L3DA 2OCEA 4QC6A 2C6YA 2HDDA 2DMTA 3GTGJ 4C85A 5DTDA 1ZG1A 3M9AA 1IN8A 2Y69H 3CJNA 3LSMA 2WSAA 1Y8RB 3PUFA 1DE4C 5F64A 1TW2A 1HC8A 3K6GA 4FASD 4H1HA 2OBPA 1YSJA 4A5NA 1YVKA 4BQOA 1Y9KA 1W7PD 2L7FP 2PVVA 2OJED 4ZY2A 5DCMA 4CAFA 3OYNA 5J4VA 2HOTA 1S7KA 3S9MA 3PB4X 4NGTA 2HVQA 5ERIA 3OYJA 1Y9WA 4L89A 1MNDA 3ELKA 4OADA 1FX7A 1LDKB 1BI3A 2VE8A 3Q9VA 5E1ZB 3QAHA 4HNUA 1EJ9A 5AONA 1AOYA 1SAUA 2VKEA 1NTCA 1FIPA 2R7QA 4XMYA 4IOCF 4ESJA 1U8BA 2AS5F 2G0BA 5K8OA 3TMOA 3I71A 1DPRA 5IYCJ 3H5ZA 1ZH5A 1HSJA 3MMYB 4R57A 3KL9A 5H6RA 2HQYA 1AU7A 2HS5A 3H1CA 3CF5F 2E5NA 5K7FA 2M8GX 4YRVA 3WC6A 4AG9A 5DDGA 1RO5A 2L9SA 5GP9A 4A3MJ 3GVAA 2R7WA 4ENNA 2B0AA 2N8GA 4FE7A 1PCAA 3Q9SA 2A61A 4E0AA 1VIXA 3K7AJ 2CUEA 2UXNA 3CMAI 1TNSA 3NE7A 4UV8A 4LQGA 1DTDA 5F49A 2B63J 2LC2A 5F5XA 3I59A 1LAMA 3KHXA 2QCOA 1Q7LA 2JT1A 3BI1A 3EC4A 3EYYA 3KQZA 4XBFA 3K9TA 2Z1DA 2VKDA 2BW3B 1LE8A 1R5ID 4J01A 3RYRA 5IT9Z 2DW4A 4MHPA 4Q4ZF 5DUKA 4OMEA 3W3CA 1ETQA 3PNVA 2LH9A 2JUGA 1ZLIA 4CCKA 4G1PA 5J1QA 2FOKA 1JUSA 2HU9A 3FKJA 1YX5A 3A01B 1IUFA 3BCBA 3GBGA 4XONA 2HQAA 4BINA 3WTTC 1FT7A 1M4IA 2CTCA 3J7AY 4C2XA 1GXPA 1Z6RA 1ZTRA 4HPQA 2DJNA 1RIOH 3WGHA 2FE3A 2K9NA 5ILVA 3WU0A 1Z7LA 4K3NA 4PXDA 3DLJA 2VOOA 2G7HA 4P55A 5C88A 3E5XA 1WVMA 4ZZDA 3H8FA 2V1UA 2H8RA 2C6CA 9ANTA 2CY2A 1FPQA 4A5MA 4UVCA 4MFZA 3OYAA 2XF7A 3WT4A 4XOTA 3JVNA 2ECCA 1JUMA 1SFKA 3GIUA 4ZI6A 1X4PA 1TQMA 3D7FA 3NFZA 3MFKA 4HW0A 5BPIA 2FA5A 3X2QH 2ABZA 2CIJA 1MK4A 2R93J 2EZLA 3H3ZA 1U5TA 2R98A 3PSIA 1IYKA 2NSMA 2QSFX 2ZENA 2HXOA 2D4OA 2FSRA 3L2NA 3IAM2 4RM2A 4LK1F 4F8ZA 1QRYA 1FOYA 3L2CA 4C8AA 3R60A 4NF1A 2E34A 3HC7A 5AIPA 3G73A 3LMMA 1O7LA 4O23A 1LDDA 4QVTA 4KMFA 1OISA 1S7LA 2V1NA 2V1DA 4UFXA 1M4GA 3EZBA 1UB9A 4EFDA 3CMYA 2E60A 3K0LA 3H0GJ 4WXHA 1W0TA 3FIWA 1ELMP 2KRCA 5ICCA 4A33A 3BXMA 3ZP5A 3LACA 1AUGA 2QJ8A 1JE8A 2RGVA 2WB1N 3PNTA 3LSRA 1O3RA 3Q0WA 5H6QA 1AMPA 1PYTB 1UFMA 5FD5A 2Z9OA 2ZOGA 2A05A 4MXUA 4A31A 1X1PA 3KE2A 2DI3A 1IXSB 4KSFA 2M45A 4D5FA 1VQ9I 2DDBA 2IMOA 4Y3OA 3IWEA 5AG6A 4C2YA 2O28A 3I64A 4OC1A 5LGTA 2BSWA 3W6XA 3L9FA 4DGWB 4V2FA 1ZLKA 2VQHA 4MFDA 3CESA 4OIRF 1NH3A 4ZYHA 1JDBC 1Z05A 2CUFA 2EV0A 4CGOA 1W36D 1RZ4A 1IJWC 1C30B 2XIGA 1NHAA 4FD4A 5D8NA 1MD0A 1J3LA 3T8RA 1PVEA 5L3FA 2EZBA 4L0ZB 2PJ0A 1R00A 3KEQA 1K6YA 3P2HA 3HUGB 3BI0A 5IYBJ 3GCMA 4UV9A 4ZJZA 5F9MA 2F48A 3HGGA 4MO7A 2ETHA 3HL2A 3P7NA 2A4NA 3F72A 2V1XA 2WV1A 2G0EA 3JR9A 4BS9A 3IH2A 3OYFA 1KU7A 4FISA 1EV7A 3W6KB 2D5VA 2W4SA 2KISA 3G23A 4A95A 3GKRA 2ZW5A 3R4KA 2K85A 2EJRA 4EM2A 2K27A 3TLBA 4JX6A 4RGXA 3ZQIA 4G7HF 2BL1A 2CQ7A 5D8LB 1I12A 1N77A 4D0PA 3KYDB 4RM3A 1VHEA 2DT5A 5F1YA 3FJUA 5K8MA 3EQLF 3CTAA 1U2WA 2Q1ZB 4M3GA 1R1TA 3CJTB 4R8FA 4WCGA 4IRGA 2KJCA 3GJZA 4XIDA 1P7JA 2CW0F 4U9ZA 4A37A 2GXAA 1F36A 2ZFUA 2BOLA 4Q47A 2HNHA 3QPLA 2IA2A 3SEZA 3G4SI 2VL1A 4HLYA 4MQ9F 3JTHA 5HVFA 3I3GA 4B09A 1PUAA 2XEJA 2QEXI 2E7XA 2G9WA 4UEFA 4QUSA 3JREA 5KTCA 1XOVA 2CJJA 4ONWA 1B9MA 2R7ZJ 2P6GA 4IHTA 5CVVA 1RKWA 2VI6A 2O3FA 4XLHA 2YUSA 2MC3A 4YEJA 2LF8A 3IU1A 1Z2LA 4MFQA 4CRZB 1BR4A 1W5SA 2Q7SA 4DYOA 4GYIA 3RJPA 1E3HA 5K5QA 1WZ2A 1U5TC 5E17F 3K2ZA 2JRTA 2JEVA 2MABA 2QYOA 1IF1A 4BBRJ 1YW4A 5DD8A 3BJ8A 1TF9A 1X19A 3H3UA 3PQJA 1BIBA 4XLNF 1Q2YA 4B4CA 1QBJA 1FC3A 4PK4A 5IY5H 3GW2A 1H89C 2PJ9A 2QQBA 2LDUA 4JBAA 2M30A 1LQ1A 2ZEOA 3D67A 1S8NA 3RPUD 1QZYA 4N9HA 5DM6F 2PJPA 2WAQN 2HFHA 3MVPA 2KDOA 6CPAA 2K5TA 1ZYRF 2CU7A 3CDLA 2H6BA 4DBRA 3J81Z 3ERMA 3FHNA 2GIVA 2JRMA 2XPWA 3HSEA 2PJ5A 2L9NA 3HOTA 3L09A 3TLEA 4UWIA 4IX7A 1G6NA 4G9YA 2OTJI 5LRRA 5C82A 4I02A 3FMRA 3FK6A 5A27A 1WRJA 3DEWA 2RQPA 3KZZA 2NMTA 4MLOA 3QWLA 1JKOC 4F92B 5EEHA 2LG4A 4PK2A 1X2NA 2VBWA 4XN0A 2BEOA 3ULQB 1S7NA 3KR5A 5G21A 2REEA 5FGMA 2PJ2A 1XGMA 3ZRGA 1P6RA 1X3ZB 3TP3A 1FZPB 2WWYA 3Q5FA 4FBEA 3LMSA 3K4IA 3R9EA 3CCJI 2I10A 4CYPA 2LR8A 4BHCA 2HEOA 4XSZF 2DU9A 2PIZA 2DEAA 4A0ZA 1IDYA 1WHUA 2P5VA 1S7OA 4MHDA 3TLAA 2EFPA 2E36A 3BROA 3QYFA 1XSDA 2ZEPA 2AQFA 1Q2CA 4KSIA 4A2ZA 3S1NJ 4PGGA 2B5GB 2R7HA 3KETA 4KOVA 3ICUA 4LIUA 3BLYA 4RAYA 4NC7A 2Q44A 1J09A 3ISPA 5CLSA 3FBNB 4B5OA 3HBLA 4B48A 1I3QJ 4RMNA 3WG7H 4KT6A 2K9QA 4N4OB 1YX0A 5JYBA 2B0LA 4IL6C 4ESBA 2Q0YA 5EF6A 3FVLA 2HI6A 3C26A 1KQ0A 2GA1A 2FUG2 2MH9A 4RA2A 3I3LA 2C27A 1CE8B 4LIVA 5HDNA 3TLZA 2FXAA 1HXDA 1Q2DA 2VBQA 3D5LA 4TJVA 2ZJRF 4I98B 1D8JA 2ME6A 1POGA 5F1JA 5JGFA 2O53A 4GYGA 4Y52J 5DV5A 3OWCA 5K99A 5CPAA 4IUSA 1A9XB 3WTVC 3R1KA 2OAZA 1P2FA 1WJBA 3ISZA 3OYCA 5GPCA 1QO0D 2DF5A 3QYBA 3DQVC 1FOWA 2CV1A 1T39A 2ZC2A 4R3LA 3O8HA 4U5YA 2QENA 1UELB 3PSFA 3QP5A 3L2RA 4Q38A 1HQCA 2E7WA 3KEYA 4C8CA 3ZMDA 2R7TA 4XNFA 4NNJA 4KVME 2ZW7A 4CSWA 1L3LA 1I6XA 1QZEA 1EH6A 1TT0A 2E1NA 3V8JA 5HODA 3E97A 3HOUJ 3ECHA 2YR2A 2K9SA 4JLYA 3SDBA 4M73A 4AYBN 1SFEA 3F3XA 3H5RA 1D0XA 2P5KA 4I7HA 1QHHD 3IIBA 4M72A 2O8KA 5HNHA 4P1WA 2F6CA 3BY6A 4N4NB 2XVCA 4D7NA 2R7DA 2RKHA 3AL0C 2Q7BA 4KITB 4EWTA 1WGXA 5JQ4A 2ICWG 5GPAA 1ZK8A 1UWYA 2IQ6A 4ZYQA 1EE3P 2FF4A 4U0WA 2GE3A 2XKOA 4GM5A 1SD4A 2D2WA 2XGDA 3J81K 3BJAA 3BJ7A 4HAMA 2NYXA 2O6GE 4PJNA 3BTCA 3RBUA 3DLLF 4BACA 2XPUA 1LAPA 1OCRH 2WB1A 4HOBA 2EBJA 3AAFA 1QSTA 4Y49B 1KEEB 3GZNB 2IA0A 4MI1A 4PQAA 1ENHA 3IWZA 2CGPA 2ID3A 4GO1A 2OUMA 4ENJA 4ZYAA 2PMZN 3V7CA 3FZVA 2FBKA 2L9RA 2PEXA 5B66C 4NFRA 5J3LA 1VF9A 1KYWA 1V5FA 4AVPA 2MW8A 4HZFA 3SXYA 2V8DA 3CCRI 5E3MA 4RB2C 1MNEA 2LF7A 4QSHA 3V8LA 1WI3A 2HI3A 4LOCA 4CHUA 4FUUA 4NQWB 5KVRA 2D4PA 4UFWA 4A6DA 1FOXA 5A28A 1BL0A 1OFCX 1T6SA 2VIXA 3WTXC 3LA7A 2E2IJ 4L8AA 1ZN2A 1GLNA 3PL8A 2DJIA 4WX9A 1R58A 2LD5A 2X0SA 1YS7A 4KFCA 4BXXJ 1YJNI 2L2OA 3D5SC 2CV0A 2X7BA 4CYCB 2XDVA 3LSJA 2ELKA 4XLFA 2LBFB 3EUHC 3HYIA 2W7NA 2Y9ZA 1SD5A 2PJ6A 5HS9A 3RPUA 2QSGX 2QVOA 3F0CA 5D5VB 1OKRA 3CMMA 2B58A 3DBLB 5DS0A 3LWFA 5GTHC 3PB8X 2DT7B 3W6VA 4UCNA 2KJBA 1SEUA 1HDQA 2VPRA 1QPIA 1X3WB 3PJRA 5J4YA 3LD2A 2EFQA 4G94A 4OAZA 1O57A 5THWA 4UCPA 1IV6A 4MMOA 3FWEA 3M8FA 2JEWA 4DZPA 1KA8A 4IQJA 4A3GJ 4CCOA 3KRVA 2DQRA 1D3YA 1CGPA 1MNMC 1Z9UA 2ODFA 5AGEA 4MEYF 4NGNA 2VXZA 2WAQA 5JFRA 3OYKA 2CNSA 3H5NA 1U0JA 3MCZA 4OC0A 2ELHA 1MDMA 4KUBA 3GTLJ 2CS3A 3K70C 3O3KA 3BR6A 3CXSA 1Z8TA 2PMUA 2YX7A 3E6BA 3KEOA 4AVCA 3BOQA 1FWZA 3G1LA 3CXPA 4A39A 3RQIA 1H9GA 2ZNZA 4BNCA 2DMPA 2ZEFA 2EWBA 4BAYA 1TTYA 5EBVA 2HZDA 1HKQA 2XV4S 2ZW4A 1ZLJA 2O4HA 2ANPA 2BHYA 1OCOH 1KGSA 4BYYA 2PBIA 1HDPA 2XGXA 3D0SA 3CC4I 3D4UA 3C2GA 1F1ZA 3HOSA 5KHDA 1STZA 2MH2A 3TW6A 5K8NA 1X2MA 2HKOA 4KN7X 1SC7A 4YIFA 4R1HA 1AWCA 1MJ9A 4U0YA 3A01A 2OZHA 3FEEA 4HNYB 1WSUA 4I76A 4TV7A 3S32A 2H1LA 2IRFG 2R7VA 3R9FA 2PJBA 3RZAA 5FVJA 4MBUA 3GWZA 4XK4A 1OR7C 4CYDA 3OYLA 5KTAA 3GFIA 4ZTFA 2L7ZA 4NGQA 2NNNA 2PVWA 4JK1X 3VPRA 5G22A 3DPTA 3G2BA 4KIGA 3WTZA 1ZG5A 2FBHA 2V6CA 2ZJQF 3S14J 3JRAA 2PI0A 1XBUA 2ZPAA 4KNGE 5JLWA 1ZELA 3GTJJ 4R3KA 3C18A 2EFNA 3CUOA 3CO6C 2IGOA 4HYEA 1XJOA 1ETXA 1TQPA 2L4MA 5G20A 1RKTA 1X10A 3CMEI 1XMAA 2B3UA 4F9UA 1I3AA 1U9OA 1Z21A 4A2UA 4B12A 2PG4A 5LRSA 5CBMA 2Q04A 4MFLA 2HYJA 3SXNA 1SVMA 2KZGA 2FNPA 4NB5A 2FJ1A 3F6VA 3L2UA 4YWYA 3MEXA 4OC4A 1TWGJ 3DR6A 1IYLA 1YW6A 2E19A 5AG4A 1TP4A 4ZY0A 4B8XA 3IRQA 2EUIA 3VH9A 2MLKA 1OR7A 4DYRA 5H2FC 1E3PA 3S6KA 2B3VA 3S9LA 2ZMEC 3T05A 2PRQA 3K4JA 1RNLA 2XB0X 5IP9J 4YGOA 1YO5C 3ZQ7A 1BM9A 2KFDA 1O4XA 4P45A 3TLGA 1ZHFA 2ESHA 3PUBA 3TBIA 1XB4A 3I55I 5DUIA 2FCKA 1D1BA 3F8CA 4PCQA 2YU3A 1U3EM 5E1XA 3CD6I 2IS6A 4LQ6A 3DKXA 4C68A 2HR3A 2AFZA 1F43A 3T0YA 2DA4A 2EQRA 1ONVA 1V0CA 1M1EB 3H8EA 2YNEA 3LQQA 1S72I 4E6KG 2XSJC 4XKBA 4KVXA 2FEZA 3PO2J 2H5MA 2CFOA 2HVRA 1USTA 3D68A 2YGWA 3LFKA 5F08A 3GLJA 5H84A 2RREA 3B73A 4MY0A 2XKPA 2CUZA 5CKTA 2PRBA 4F0YA 4UUVA 3R9GA 3FBUA 2JA2A 3REOA 2K4BA 5J1UA 5IV0A 2ZMEA 5CQEA 3OIOA 3S1RJ 1QQ9A 2JMWA 1KQ9A 3ZQGA 1Q1HA 2H6CA 3CF2A 4B3XA 2EWNA 5FRNA 2AFSA 5LYFA 1J7KA 2NS0A 2F4OB 3KYCB 3NAUA 1Z8XA 4XRFA 3SHPA 4KUAA 1XDSA 4MFKA 5ICEA 4KNYA 2I79A 1JGGA 3BZ6A 2XRNA 2EZCA 1IU8A 2V6EA 2K02A 5LRGA 5M3MJ 2OLSA 4CAWA 2XAQA 3S6HA 1WJCA 2ECBA 4UNOA 3A0BC 4BJTA 1AYEA 4X8IA 1M6VB 1FYKA 1JWQA 1FBSA 2QUFA 3CJRB 4M6XA 3SZTA 4LX9A 3QU6A 2NVXJ 2DQLA 2G3TA 4L9JA 4FD5A 3KASA 2Z99A 2CMPA 4R8HA 3QNVA 1XMBA 1OQYA 3LWUA 2AE6A 3VB2A 4RI1A 3M8JA 1H8LA 3TC8A 3DTIA 5EZHA 3DEEA 2MD0A 2CG4A 3T0TA 2ZNYA 5E3OA 2XB5A 3NARA 1MKMA 1MJBA 1AKHB 2CXAA 1B72A 1XFOA 1LE8B 1R43A 1VNDA 5LGUA 2ARHA 3FXLA 4CDGA 2CW7A 1HA8A 4M85A 2HOEA 2FRHA 4JOMA 2B7EA 2X1EA 4KN4X 3ZCOA 3FBIB 4A3DJ 1I39A 3BTLA 3DFGA 3NRVA 2Y75A 2OZGA 2R8VA 3TOBA 3TEDA 1K6OA 3S2DJ 3LSTA 4A0XA 1ZGWA 4C3JJ 4CDKA 1XE4A 4EEFG 3B3SA 3A0HC 2EPFA 1WH5A 1DQUA 1T98A 3LSHA 1K4JA 3ZN0A 3CQZJ 3ZN1A 2VKVA 3BPXA 1IV8A 3H35A 2FIAA 3P9IA 3GF2A 2XAUA 1D5VA 5J8FA 5J40A 1FMVA 5L3GA 2QYVA 3H8GA 2DAOA 1RESA 2ZBKA 4GGGA 1KWMA 3D2PA 1ZRSA 5FB2A 5GAHJ 5LBQA 3KP2A 1K61A 3PFOA 4B5PB 1O7FA 2GIZA 2IAIA 2KKOA 5HVGA 1WCMJ 5IT9K 3W6SA 1FNOA 1Q1VA 2HQNA 3I54A 3U1DA 3W2AA 3TQNA 1BW5A 3EZEA 1P4XA 1T0FA 1BA5A 2R7RA 2RNJA 2ZMEB 2GLJA 1K4SA 1XRYA 3FXQA 2EVNA 4XPLA 3WU2C 4Z6YA 2WV0A 2WA0A 4I2OA 5EYRA 5A2QK 1DP3A 2I5UA 3H4QA 2CV2A 3CCVI 2EZHA 2KZVA 5E8IA 4PFOA 3VYSB 4ZBGA 2QBYA 1BI1A 4BDYA 2XAGA 1ARLA 2E71A 3KZWA 4YRHA 3UY5A 1OJLA 4XNHB 4ZX8A 4AD9A 2AO9A 3FX3A 4FAIA 1CBXA 4NDLA 4EGYA 4E7JA 3HKZN 2AJ6A 1HF0A 4WWVA 3ZMZA 3F6OA 2JSPA 3RKWA 4NGMA 1ZR2A 3T07A 1IRZA 4DUKA 4G8XA 1FTZA 4XPKA 2LP0A 1G3TA 2F4IA 4BXUA 1O3TA 3G3SA 1TF8A 1SVLA 3KPHA 2DXIA 3L2QA 1FTTA 1LFPA 5DWMA 2QA4I 4WWCA 3VFZA 1DIKA 3CZXA 1N75A 4CCMA 3S16J 1ITYA 5CYVA 1B87A 2FXFA 1MBFA 3TW7A 4B3AA 4KMUX 5M5WJ 3S9NA 4F9VA 4RUHA 4AG7A 3WGGA 4DBQA 2HVSA 2Q4VA 5K1YA 1LDJA 4L5IA 5EEGA 3CCSI 5CJ9A 1XF1A 1SANA 2O8XA 3DKYA 4E7ZA 5J8CA 3COAC 4CAEA 4UB6C 4BU2A 4H89A 4E8OA 4A38A 5C3EJ 4X2TA 1BPMA 4A69C 2EV5A 2W85A 1KU9A 3MQ0A 4X6AJ 3FM3A 4CYQA 2DTRA 2L7MP 2L7KA 2VASA 2VJ4A 1DP7P 4M3EA 1T8IA 1A31A 2DN0A 1X12A 3H36A 2Y0SN 3GUDA 1LEAA 2PJRA 2P6FA 2LY9A 5LHHA 4DZJA 5JVGF 2QWWA 4EJUA 2A07F 2R0QC 4MFPA 4P44A 1YGHA 2Z3YA 3D1NI 4YIIA 3RQ4A 1X1DA 3HLPA 1KBLA 1DGRM 3BC8A 2OV7A 4F91B 1SFUA 3CUQA 4AU7A 3IWFA 1UZCA 1UJ8A 2CUJA 3LOCA 3PIOF 3I58A 1NSAA 3BG9A 2WTEA 1IRGA 1ZL0A 1NBWA 2A6TA 5FJ8J 4KDPA 2ZEGA 1YS6A 3JRCA 4C9VA 1B59A 1BOAA 4FX4A 2H27A 2JUCA 4E7IA 4A93J 3HHHA 5E20A 2L54A 2FQ4A 4RGUA 1RR8C 4NC6A 2DMNA 1IXCA 1S60A 3B02A 3FB3A 1I1DA 3G1MA 4R79A 5LYDA 2ZB9A 2Z3KA 2L01A 3TT2A 3S2HJ 4BXFA 4H6ZA 1X3UA 2KPMA 2BBYA 2F5FA 3BQZA 1APLC 2V77A 2WZNA 2W25A 3T8TA 5AG7A 3VEPA 5JPHA 4RAGA 4IIXA 1Z4EA 2PIYA 4HNWB 5HS7A 3CLOA 2JQ7A 1JDEA 4XORA 1LANA 2Z3MA 4KLVA 2Y9YA 1Z9CA 1V6CA 2F5IA 3DU6A 5LHIA 1YR0A 3VWEA 3IWGA 3JRGA 1VQMI 3OIQA 4F3QA 1IOFA 4B14A 4JP0A 3N5FA 4HF0A 4CICA 2EA4A 2YPRA 2ID6A 1FT9A 1TT5B 3CDIA 5IT3A 2VUMJ 2BCOA 1K79A 1G3SA 3C2HA 4RAFA 4PJ0C 1FBUA 4E2AA 1OYWA 3GZ6A 1RC9A 3F8MA 4EJTA 3KP3A 1TC3C 1A6QA 2IA1A 2VT3A 4OOIA 5M5XJ 1LVAA 3IKVA 3PIPF 1BR1A 1TKJA 1YLOA 4K30A 3MKYB 4NBQA 5FRMA 1CQTA 1IZ1A 3G6EI 1MBGA 3J7YJ 3AKZA 2OD5A 4IHSA 1ERDA 3FECA 1FOKA 4YU9A 2NOJB 3T1BA 4COBA 2F4MB 3KFWX 4NSQA 2DFHA 2DA6A 2WC2A 1FEXA 2Z5UA 2KLOA 1U6MA 3KCCA 5LRJA 2O5RA 1ZO0A 3GY9A 4HSTA 4C2TA 4M6HA 2HYGD 4PSWA 3TO6A 4ASNA 1A6IA 4Y15A 2BZTA 3CPXA 4JWPA 3S3NA 4ZYEA 1TKHA 3LODA 4UXNA 2OC6A 1PYVA 3KYLA 1YIJI 3VYTB 4Y17A 5AIQA 3ML6A 1JTYA 3EUHA 5HLGA 3DPUA 3I0TA 2Y0MA 4EV0A 3HTUA 4HDUA 1YQAA 4P9UA 3L2WA 1NE9A 2GP4A 4EYSA 3CUQB 4BQQA 2XC7A 2MG4A 5GAEJ 2XASA 3FHZA 4UEEA 1BAVA 4QBJA 4IEJA 2IGNA 2XUBA 4IHYA 4UUSB 4PDKA 5H20A 5TISC 2M34A 4A3KJ 1BJZA 1VGYA 5F1RA 5ILSA 3F9KA 5JVLA 2V7FA 3TYXA 3FEDA 5CVJA 3N05A 2E1MB 5IP6A 1K78A 4R9MA 3A1YA 1D1CA 4AVBA 4NJRA 2K7LA 5EJCA 3WTSC 4D1QA 2EFWA 3RKYA 2JBJA 3FXMA 3CUQC 1WKMA 1PJRA 2V9PA 3B6CA 3H9QA 4BUPA 4C9RA 4COGA 2GREA 2LK2A 2DDAA 1HSTA 1MBHA 3S93A 4ITVA 2VQYA 3QOEA 4XICA 3E1SA 1F2PA 2DPDA 2W1OA 4ZDOA 2R92J 3HOVJ 3V8IA 3S3MA 1M4DA 1P9QC 2EIKH 1MGTA 2C6PA 1YW9A 1K78B 2P5LC 5BQTA 3RTRA 2NVYJ 1JT6A 2HYFA 2XAFA 5IOZA 4P4DA 4JXRA 4C2MJ 1TLHB 2DO7A 2EINH 4LB6B 4KOYA 3HXLA 1T08B 1R1UA 5E3NA 3M4OJ 5GAGJ 5BNGA 1S5KA 2RVCA 2K5CA 2Q0OA 4KA4A 1JJ8C 3IH4A 4B47A 2JA5J 1B72B 2W57A 1GYTA 4DQ2A 3LQRA 5E96A 4HF2A 4KT5C 1FP1D 5TGTA 1QPMA 4EMEA 4G6TB 3ISXA 3OWTA 5E18F 3OYBA 3N7ZA 4C8UA 4GDFA 1ZAOA 3BZKA 4M3BA 4ZYGA 4ENKA 3PB7X 3SJFA 2B4BA 1WJEA 3K1MA 3JAMK 4OIPF 3K2KA 5F0FA 2I00A 4MIMA 1Z1DA 3ASNH 1WJFA 2FX0A 3P9KA 3RPQA 3U9GA 2LKXA 4C2UA 2CQKA 3HHGA 1T2KA 3NEUA 4C99A 3FRMA 2HB6A 2C5QA 2DYSH 2IW5A 1ARMA 1Z5RA 2HUZA 1M4LA 3JAMZ 2Q2EA 3QPSA 5FLMJ 2ZXIA 4L0YB 3VWDA 1CPSA 2Z0ZA 1IRXA 1BBYA 4FX0A 3HRSA 4IIYA 1S9HA 1CPXA 2JK3A 2PDOA 2ZSHB 4UBRA 3SQNA 4G12A 1H9TA 5KAIC 3T8WA 4QTRA 2DA2A 2LMDA 1JKQC 1ETOA 3GFMA 4AC0A 4ZY1A 4GXOA 4UCMA 4KORA 4CRYB 2EZKA 4OC5A 1KZHA 5DWNA 3UR3C 4JYWA 2O7OA 1VHOA 3TGNA 4INJA 4BE1A 7CPAA 4S05A 4A3FJ 2NVQJ 1SFXA 3FK7A 3ABUA 4H4KC 1XC5A 4M6VA 3V7SA 3RZDJ 4OAYA 1QNTA 4I99C 3R0AA 4X5KA 1B6BA 4C8PA 4I49A 3WTUC 3GTKJ 3BG5A 3EO4A 1YVOA 1N25A 3RKXA 2FMYA 3QQAA 3PFEA 3L00A 5FD8A 1PU9A 1AKHA 4S04A 1IRFA 4QLCU 4RB0A 3MWMA 3CJQB 5CVRA 3HUVA 1WPKA 2ZXWH 4BKXA 3SZGA 3S3OA 4UIBA 3ZMSA 2E1CA 3LAPA 4Q36A 1VTNC 4KOXA 1TKFA 4Y4RA 3GFLA 3EUKL 1SMTA 5FLXK 4MNUA 1BC7C 3VSKA 3BPVA 3BG6A 2X1CA 5FKOA 4AXVA 2GXGA 1XCVA 1Y8QB 5F04A 3GUXA 3DF8A 4CH7A 1LEBA 4TJXA 5B3SH 3S1QJ 1IGBA 4V2GA 3SZPA 3SFIA 2Y31A 4A3BJ 2F8HA 2ZXJA 4QWQA 4C84A 1KU3A 2VC1A 3PP9A 3G3ZA 4S0HB 1YMEA 5IX3A 5EC4A 2WYRA 4C9AA 4CZCA 4DYCA 5K8PA 3FNCA 3N97A 3T90A 2XAJA 4KISA 2YU9J 2V8GA 4BHBA 2GA2A 5FROA 4AVAA 1K7AA 2LREA 4XR6A 1Z0XA 1XEBA 4FT8A 1ZG8A 5FFZA 1X1BA 4DJLA 1X58A 3CXQA 2JPCA 1VQ5I 1OCTC 3MD2A 5D6FA 3LNQA 5DS9A 2MFZA 2W84A 2LSOA 3IHUA 5LHGA 2Q8KA 3S15J 3QOPA 4P4BA 2COMA 2M4GA 3O6BB 4OP4A 1ELLP 4RS2A 2CNTA 3KKWA 3HUGA 2DA5A 1B8IA 4CA0A 5JR3A 2OR4A 4FQGA 4BGDA 2OPTA 1O3SA 3QPTA 4CUGA 2FT0A 1J4JA 2M1BA 4YFJA 1MW7A 4UUSA 1ZRCA 2IBDA 4M9XA 4U9YA 4HDVA 1GHEA 4NXYA 5E1WA 3SHFA 2ZXVA 2DMQA 2VB6A 1A2ZA 5HLIA 2Q4YA 4ZTJA 1EH7A 2BY1A 1TWAJ 3D8PA 3DDDA 1HW1A 1Y39A 1YW7A 2F5CA 1ZRDA 2KT0A 2R7FA 2XF6A 2E1MC 1GV5A 3KLNA 3VARA 1XIXA 1J59A 4OIQF 2VI7A 3QODA 2A5WA 4P4FA 3L7WA 1FSEA 3KP6A 2PQ8A 3AG1H 3WE3A 1OYIA 4HNXB 1BXRB 2HWGA 4IXAA 4F0XA 3JRHA 2VZZA 1Y0UA 3Q3SA 1R1VA 4XKCA 2A69F 4MEXF 3HRMA 2QKLB 4HRIA 1BO4A 1NSLA 4ZX9A 3KZYA 4Q48A 4LG0B 4B10A 5HNFA 1G3YA 2LY1A 2E1OA 1ZREA 2QBYB 3BT9A 3IGRA 3S2WA 2AHQA 5E3LA 2K3FA 3JW4A 3DBHB 2P8TA 3OL3A 1LPQA 1B4AA 3D2MA 4PXCA 3D3SA 4CGLA 2VJ5A 2RV8A 5K7ZA 2RN7A 2CQQA 1I27A 5B5EC 3CPAA 4M9SA 1HW2A 2FVGA 2HQ5A 4MI4A 4FD6A 1VBGA 2BYVE 4CGZA 3CO7C 3R6SA 2KP6A 1FJLA 2FL4A 2JSCA 3FXOA 1S5LC 4WK8F 4AIHA 3DP7A 2VT2A 3NQOA 4P96A 3KZIC 1XGSA 1SFOJ 3SI2A 3ZMTA 3TLCA 1Y0YA 4F93B 3SXOA 1MBEA 2EBIA 4P10A 1QA6A 5ICGA 3PB6X 3HOXJ 4E7KA 2VLAA 2M0MA 3RNZA 2VXDA 4ZZLA 3RZOJ 1VQKI 3HSRA 3PFIA 5HDGA 2Q43A 3RKQA 3CDXA 1U78A 2VJJA 4UF4A 4P4JA 3PB9X 2UV1A 1R22A 3QYEA 2OH1A 2ZELA 4IF5A 2HTJA 2XPVA 3MAJA 2OB0A 4EQQA 1SVOA 1UCRA 1DDNA 4CYNA 2BOAA 3C7JA 2WAEA 1KC7A 4MY3A 3KQXA 2D1VA 3E6CC 3NE8A 1WQ2A 2GAUA 3E5QA 2FNAA 2DPUA 3WHBA 4H6UA 2JA7J 4WF2A 3I59B 1LOKA 4X3RA 3ZZIA 4Z65A 3C8OA 2EH3A 4AM3A 5E8GA 2V8VA 1T95A 5ELYA 4W97A 3MZHA 4ABZA 2CF4A 3IU2A 1IICA 3CLQA 4C9UA 2X48A 1W5TA 1YYVA 1R6RA 3L1PA 5LYIA 2NYQA 4LK0F 1E17A 1Z8WA 1MIJA 3JCUC 3VTAA 3JTKA 4P4EA 3U2RA 1WI9A 1J2XA 4UB8C 4ESFA 3FF3A 4EMSA 3WABA 3FMQA 4CO8A 3PEIA 2MYSA 3E0KA 1R61A 3LFUA 2EK8A 5FKNA 4CPAA 3FMSA 3RSNA 2IJLA 2HQRA 2GZWA 2TDXA 2PJ1A 2UXXA 3CT9A 4OIWA 3RIRA 4DOZA 2QECA 3NWSA 3DPLC 1YOVB 2EA2A 3CC2I 1OZPA 2WBMA 3OIPA 3H0DA 2VBZA 2X6XA 3FIXA 1XMKA 4ON0A 2PCNA 3W91A 4NEXA 1EZAA 4NQWA 3VYRB 4BL0B 1OBRA 5LEKA 1QGPA 3DSBA 3BR0A 3TLYA 4FD7A 3D7DA 3ZQLA 1TWFJ 1NK3P 2P6EA 3F0AA 2HXIA 1FIAA 4LG0A 2POKA 4PZJA 3GZ5A 2DOFA 5LEJA 1SQHA 1QU3A 3PBBA 3I74A 4OWRB 4P5OA 4L9TA 5C44J 4OKOA 5D29A 1YHQI 2BVMA 2W82A 1IN5A 4C9YA 2WPXA 1TW3A 2QIRA 3ZQCA 1R49A 4CGNA 1W36C 2AXTC 3I5UA 1S7EA 4DIQA 4MHZA 2P0WA 1JHFA 2QMLA 2MD5A 4KUMA 2L9VA 1D1AA 2VKHA 5C4JJ 2AXLA 1G2HA 4R87A 3I6SA 1EZBA 3T9YA 3I4PA 5D5XB 2ZO4A 1LB2A 4EVIA 1DU0A 5KCMA 2VQLA 2PFBA 1VQ4I 3QB8A 2PJ4A 3ZR8X 3BWGA 4KOTA 2GOMA 1MZBA 1QSRA 5GADJ 1V54H 2LRDA 2W48A 3JRDA 2MSYA 4WXDA 2FSWA 2P6TA 4C86A 3BJOA 2NS8A 2M5WA 4MTDA 3OYMA 3ZQFA 3M3YJ 2Z3NA 2Z16A 2HC9A 4NHJA 4IHMA 3FXJA 1TWHJ 1MMNA 2ELJA 2OCCH 4RLQA 2DA1A 5K5RA 4U88A 4CXFA 4C7HA 2PJ8A 3DTEA 4JYKA 5LD2C 2C1CA 1PUEE 3LSKA 2DFFA 1RXTA 4OAEA 3CC7I 4X0GA 2M7BA 2NS7A 1XTAA 4ZYDA 1DPUA 5D4RA 3F8BA 2RB7A 2O9LA 3DGVA 5HDKA 2ZEDA 2EIMH 4IRHA 5M5YJ 1K83J 2DYRH 1Z77A 3SI0A 4QPOA 4CO9A 1VQLI 2L02A 3PO3J 2YJTA 4C2ZA 4JX4A 2PLYA 2VOPA 4UHTA 3EXNA 2PCUA 1F57A 4CZZA 3VDXA 4D5CA 1KUYA 4MRIA 1XDUA 1FLIA 3MRUA 3QAYA 2G7UA 3R95A 4N9IA 3WU1B 3V4GA 1H88C 4XPDB 2HOSA 2YNCC 4M6IA 1ULYA 1V3FA 2D1HA 5TJJA 4B6ZA 1YLFA 3TCVA 1CP7A 5F0HA 1BI2A 1QQIA 3TO7A 3VOEA 3P9CA 4FHTA 4Q7AA 5LYLA 3TFYA 5F6FA 5JVTA 1TQIA 1GUUA 3J80Z 2LBFA 3MN8A 4CAXA 1IN7A 4FCYA 2ZKZA 2YNDA 4UA3A 2GXBA 4B43A 4II3A 3BTIA 3IWWA 2KQRA 1UHWA 3SI1A 1JUPA 2OQGA 1QSMA 2KIUA 2PJRB 2G9DA 2REFA 2FOWA 4HX4A 4L9NA 4IHWA 4R6TA 1ODDA 1JTXA 1LNWA 2EV6A 1VZ0A 5E79C 4BEHA 2KMUA 2BGCA 2PMZA 3GB0A 3S17J 3WTYC 5I4MA 1PP7U 3OYIA 4HKFA 3ROUA 3GYHX 1GHCA 1U6GA 1SD7A 4H2KA 4JD6A 5H86A 1ZLHA 4Z2YA 3V7ZA 2WUUA 2HPMA 4GCVA 4E94A 1D5YA 4I0BA 2VZYA 2QLZA 3PZJA 3M1CA 3FISA 2PE3A 3ZJ0A 1EF4A 5HH1A 2Z3LA 4A3CJ 3GFJA 4DJAA 2HKXA 3CP2A 3CCMI 1Y56A 4XKVA 1NMTA 2RNGA 2PSWA 4II9A 1I5ZA 1FMWA 3GYAA 1YW8A 3GTPJ 3U21A 2IS4A 1PUFA 1USSA 1Z3XA 2UUZA 3VATA 2TRTA 2YX4A 3A4CA 1VQ6I 2Q51A 2QF7A 4HBLA 4CCNA 4Y13A 4KIBA 3WE2A 4QB9A 3OOPA 5I0CA 2P4WA 3WGIA 2VJIA 2R3SA 1R36A 5D8KB 3T5MA 2LLKA 2FBIA 1RUOA 4XQFA 4ZGYB 1Q5XA 4QIWN 3KLOA 4EJWA 2DOAA 2EK5A 2CW8A 4XLCA 3KHZA 3ZQQA 3J7ZI 5FKKA 5C4XJ 5F46A 2FQ3A 1ZARA 5BS6A 1YRNB 1HDUA 2VONA 1R7JA 1YJWI 1G3WA 4YIRX 2HOAA 2CTBA 4KJZA 3FXUA 2NVUB 3HRUA 1I21A 2F7VA 3A02A 3OSFA 2KRHA 3IRRA 1LVKA 3CP8A 2AFMA 4LMYA 3HOYJ 4L5JA 4B1RA 3F23A 1BJAA 1SMYF 2QVPA 3G71I 3ZGKA 4A3IJ 3OMYA 2IEKA 1H0MA 2HV2A 4NJQA 2PMHA 3R0JA 5M3FJ 4A3EJ 2Z3PA 4ZH4F 2DOEA 4LB5A 3S6FA 4AIDA 3IO1A 2PN6A 2P7VB 2H8WA 2IGMA 2L4AA 4AB7A 5EG0B 3C1DA 3WC7A 4LD5A 4J19A 2CO5A 1Z8LA 2PX9A 4HX7A 3WODF 5JH9A 2RQQA 3DV8A 4IJAA 2OQRA 4EM0B 5DD4A 1MMSA 3PBEA 5CVIA 3ZMUA 1G4DA 3F8FA 1NG7A 3HRTA 4ANJA 5DCFA 5TRDA 3I4MJ 4UVAA 3HOWJ 1MH3A 4XLPF 1R57A 5IPAA 3GLXA 4XLAA 1VQ7I 4E5SA 3A2KA 2RFHA 4I09A 1W4MA 1Z91A 2WY8Q 2ZJ2A 1J5YA 3NH4A 4LG3A 4WJBA 3SYTA 3SEQA 3S1MJ 4LLNA 4MHNA 2DODA 1ETVA 1VQPI 1TBXA 3OL4A 3ABLH 2IP2A 3RI4A 3FF5A 4XKWA 2R7SA 1P0HA 1IN6A 3LSPA 2NOGA 2UWMA 1A36A 2ZEHA 4Q5SF 4M9ZA 5FLXZ 1D8KA 2GFQA 3KI9A 4BJ5C 2B4DB 2Z10A 2ISZA 4ENMA 4G7OF 1Z7UA 3K1PA 1QVUA 1T56A 1E2XA 1EA3A 1FYMA 1J75A 2AUNA 1WFXA 5JLXA 1Y1VJ 4I01A 3E5UA 4RBOA 1GXQA 1I1SA 2K9LA 3H92A 4HSRA 1XMXA 2JPBA 3OYDA 1BLLE 1KUVA 2K3PA 4F55A 4LGWA 1YI2I 3BCAA 4L9VA 3WHCA 3PQKA 3HDDA 4HQEA 4XRSG 2PR8A 3PGPA 5LRKA 3OS1A 1SD6A 1PUFB 1M44A 4GS4A 3WR7A 4E7LA 3HZJA 2JBKA 4XPDC 5BWAB 5HXDA 2WADA 4BH9A 3HOZJ 3FXKA 2AUMA 2VBXA 1VHSA 2AFUA 2LVSA 4FE4A 3ECOA 2J5PA 4PV6A 2OA4A 2QKMB 4EGZA 4EJVA 1W7PB 1R3NA 3TX8A 3BR2A 4MCRA 2F5VA 2NAZA 2B9SA 3FXTA 4NC8A 1V55H 5L3CA 1C0WA 4ZDPA 1WH7A 2XAHA 2ZOFA 5FKMA 1I6HJ 1VQ8I 4HEA2 4MFEA 2R82A 5IP7J 1Z3YA 1S7AA 5ICFA 2QM3A 2HDCA 2AFWA 1V4RA 5D5UB 5F47A 1Y0RA 3HIFA 2J5OA 2JVHA 2E2JJ 1QMUA 2ZEEA 2DA7A 4XM3A 4J3GA 1VI4A 2A5YB 2JWTA 2O61A 4FETA 5DEQA 3I4NJ 3K4LA 2COBA 3H5AA 4OMZA 4DW6A 1T38A 3EY5A 4BJ6C 4BBHA 4A94A 4YFKF 3LA2A 5FO5A 5IB9A 1U5TB 1TNTA 2NNYA 3DEUA 3QPHA 1REPC 4Y33A 4MCQA 2DK5A 4J0NA 4CCLA 4FWUA 2Q2EB 4UY8I 4M6GA 3IC1A 1WJDA 4MCSA 5F0CA 3GTOJ 1T0FC 2IS2A 4W9YA 5F09A 1XSVA 4OMYA 3E7LA 3ESWB 3OYHA 1S7FA 2LNBA 4E70A 4IVNA 1ZYMA 5IOYA 4RLFA 3CCLI 1XG1A 4GXHA 5JM6A 3G1OA 1JI8A 5IB0A 3BR3A 4N0BA 3PM1A 4UWJA 1OCCH 3VWBA 2R5ZB 1ZRFA 4PGHA 4YG2F 2PR1A 3IP4B 1VI0A 4BEHB 4U0VA 5EGOB 1QSNA 4JX5A 3OOUA 2H1KA 2EB7A 1CP6A 2MLGA 3KX2A 1FY7A 4YELA 3B3VA 2VXKA 4XNHC 3OY9A 4DYQA 5D5WB 2B4DA 3DLAA 2XEFA 4CZ1A 1OMIA 1ON0A 2VE9A 3KR4A 1NXJA 2PJAA 4KZTA 4L18B 4X1EA 2LY2A 4EATA 2CYYA 3L2VA 4AYBA 3SFZA 3IKTA 4G6DA 1GV2A 3B3TA 4M74A 5CVUA 2OTLI 3KP4A 5L3EA 1HLVA 3UNGC 4OU0A 1QSOA 1VFCA 3K4KA 4A3LJ 3ZQHA 2XEGA 4HQMA 3KIOA 1A5JA 3K10A 2AQEA 2JZYA 2QSHX 1RI7A 3BTJA 3FXRA 1HDDC 4R76A 2IVMA 2QQ8A 1LKXA 4O6JA 2X4HA 4EVYA 2HROA 1Y7RA 2PJ7A 2Z11A 2W24A 3MZ8A 2STTA 2M2EA 4Y49C 4J00A 3UKGA 2HDWA 3I9V2 4KS9A 2XEIA 3FYNA 3TKYA 3TDZC 4XN3A 4C9EA 4G7ZF 2XSDC 4EJOA 1LUJB 2BY3A 2CFXA 2CNMA 1HKSA 1MMDA 1PP8F 2WAFA 4U7DA 4C3HJ 2STWA 2IXSA 5FFXA 4V19K 1WK4A 5K5OA 3M1EA 2JDCA 4OIOF 2EZIA 3SR3A 4IOAF 4ONUA 3ZPLA 1U9NA 4NGPA 4PUSA 2LTPA 4HNVA 4GFBA 2KIMA 1P4WA 3P2FA 4OC2A 4MJXA 1K4TA 1R4NB 4AUXA 3VYUB 1Y7EA 2KHMA 2JN6A 4MTEA 1OLTA 1S6LA 5EMIA 2HGCA 2VC0A 1J0RA 1UG2A 2MGQA 3BZCA 3WG9A 2OZ6A 3IV5A 1JT0A 2W00A 2XGCA 2G3AA 3BJ6A 2WPWA 3HG9A 1XX5A 2I8DA 3IUOA 3LAJA 1SAXA 1BN5A 4XL9A 3A9LA 3K2AA 2ESNA 2M9HA 2ZFWA 5B1BH 3W2VA 1LFUP 3G8WA 3C3WA 4YN3A 3KP7A 2BV6A 2DFIA 4K2EA 3ZMVA 3J80K 1XPXA 3SJXA 2ACJA 3GLLA 1KU2A 2E35A 4GRIA 5J47A 2R5ZA 1YX3A 1CS0B 4H0EA 3B3WA 3HB9A 5EGOA 2X51A 2BW3A 3DWLE 3EETA 2FE7A 2YNCA 2Y48A 3I56I 3FH4A 4KICA 1D0ZA 3I9SA 2Y2ZA 3H9GA 2H94A 2LOOA 5J1YA 1CF7B 3CCYA 3DNSA 2X9DA 3ASOH 4G6QA 3AG3H 1L0OC 4CGPA 3FX6A 4LFUA 1F4KA 3M8EA 1N78A 4JQFA 1TL8A 1AHDP 2DPSA 1UHMA 2ZCWA 4RDUA 3CCEI 2TCTA 4MQVA 2R4GA 2BEIA 3F5BA 1OPCA 2YSRA 4AVZA 1VQNI 2AFOA 3OR2C 4BQAA 1XN7A 3IAS2 1KQ8A 1O3QA 3OS2A 1S3ZA 5IR2A 1IAWA 3HTSB 3K1NA 5CNPA 3K69A 1MJAA 2QGUA 4MGRA 1UHSA 1IO2A 3D5RC 3DKWA 5F27A 4I6ZA 1UAAA 1CJWA 2AFXA 2WY7Q 3AG4H 4LITA 1YG2A 1XF8A 1BPNA 3ERED 1FSHA 2XROA 4BY1J 1EH8A 2JJ7A 4U7BA 5DM7F 2D0PA 3CZ6A 2BE5F 2CQNA 5HS8A 4P9FA 2D45A 1ON2A 5AG5A 3HSFA 1ZQ3P 2K40A 3LSGA 3EUAA 2IS1A 5HVQC 1YE9A 4PJMA 1LFWA 2ZW6A 4MJ8A 2J8MA 4M3SA 2EZAA 1JGSA 2MC4A 1H8AC 3B2YA 1E0EA 2P7CB 1X1AA 1IG7A 3EIFA 4RB1A 1P4AA 5KNLA 3AFHA 5K7HA 2V8HA 2K9MA 1E3OC 2DIKA 2MBFA 1NG6A 3O8GA 1IIDA 4XLEA 3TO9A 2XGEA 1XGOA 4C30A 3I1UA 4E7SA 3K4MA 2X6OA 3JUWA 4KSAA 3D7HA 3KGQA 4A6EA 5LGNA 2QQAA 2LYCA 2ZSIB 4IF4A 3CCQI 1ETWA 4KYWA 3RAMA 3QP6A 1MBJA 4U87A 1DGWY 3T5XA 2GWRA 3NA6A 3MKLA 4HV6A 2R5YB 4C3IJ 1LCPA 4B11A 4CAVA 4C8TA 1MDMB 1ZG9A 1YIOA 2QZ8A 2KCWA 2Q4ZA 2OF7A 4W1UA 4LLLA 2JVGA 2V4JC 1RETA 1VKCA 1YK3A 4JJXA 5EEAA 8CPAA 3OS0A 4UEZA 1VBHA 3IEHA 1WWZA 1IN4A 4IQ4A 2FS5A 1NK2P 1IW7F 2K86A 3OR1C 4I0AA 2JA6J 4BY7J 1Y1WJ 2NVTJ 5F48A 1EKEA 2Z2SB 4O3MA 3FKIJ 3GMEA 4HF1A 3H3VK 2ATRA 2D0OA 2ZXHA 1W5CC 4CGMA 2A3SA 2A68F 1CF7A 2JLMA 2J9AA 2BY2A 3BDDA 3GO5A 1W7PA 2X6WA 1BI0A 3Q0UA 2GU2A 1S3JA 2DBBA 4KIFA 5G1ZA 3DBRB 3RYPA 5HVHA 1ZGJA 2ADUA 4NGRA 4BHPA 4NGSA 4KOWA 2OZUA 1F2OA 3RYOA 4C7IA 3QRFF 4KVOE 2I3CA 4O5VA 4PFPA 1HEEA 1TXRA 1Y0NA 5KK1A 4NUBA 3J7AO 1XGNA 1BC8C 2GOXB 3K4NA 1KUXA 4XRMA 2E5ZA 4HPSA 1ORKA 2XF5A 3ABKH 5HLTA 2BUEA 4B13A 4PJJA 1JKRC 2GQQA 5LFAA 2PC1A 3GTQJ 4HX8A 2M8EA 4WXCA 3EDPA 2HTSA 1KZFA 3QU3A 2RC4A 4BDZA 3BG7A 1DUXC 2O03A 3DU5A 3HJEA 2KIFA 1ON1A 1IUYA 2RDPA 3VODA 3DXJF 2Z3OA 4A3JJ 3ABTA 3CDHA 3JTGA 2OU2A 2F5EA 2L0KA 1W1WE 3LSIA 4DNCA 2J8RA 3NH8A 4IZZA 3JRFA 3U1KA 1BIAA 2IPQX 2IGKA 2FM4A 1JKPC 4D9JA 5ED4A 2HPIA 3WTWC 1L0CA 2X85A 3W2WA 1UG0A 5EG0A 3JRUA 3MKWB 3SJMA 4PPZA 4MHYA 2VBYA 4RB3C 1CX8A 4KOUA 1F9NA 1B6AA 3OSGA 3TLGB 2GLOA 2BXZA 2X6YA 1IGNA 3F8KA 5GTIC 2KDZA 1P7IA 3K4BA 4A0YA 1A04A 1M1DA 2LFBA 5EZGA 4YFXF 5FLVA 2DLLA 2VN2A 5A2QZ 1YLEA 1HW5A 2OOTA 2UZKA 1HBXG 1MBKA 1UMQA 1YQEA 3MKZA 2CH0A 2FMLA 2NXNB 1V5EA 3PNYA 2CQXA 3TDUC 2DFEA 3C2BA 3KP5A 4F6AA 2O0YA 2VEZA 3GX4X 4PXBA 1ETKA 1ZG3A 3TOAA 1GGOA 2V9VA 1QZZA 4IRIA 3ABMH 3R61A 5JI6A 1MH4A 2F5DA 2M3AA 3B6AA 2V9KA 3MZYA 4BE2A 3EPZA 3B8GA 1JJ6C 3M7GA 5HOOA 4OIDA 4C8FA 1YRNA 3E3VA 5FD6A 1S29A 1PDNC 3HPGA 4KLWA 5KTDA 1B1BA 3V8KA 3K9UA 1ACIA 4A30A 4BBSJ 1B8IB 2DPTA 1N71A 2BO9A 1T33A 5IYDJ 3V38A 2VQCA 3NWTA 3E6DA 5BOXA 2GM4A 4P6YA 3R96A 4RGSA 3TE4A 3B7IA 1AA7A 1ZGAA 3BR1A 4LLGF 2HZTA 2M4KA 1HCRA 4M71A 2V26A 5DYMA 2R7OA 4MFJA 1YJ9I 3I53A 2H09A 1IDZA 3HM5A 2Y30A 4M3DA 2VPLA 5J1RA 3HKZA 1IOIA 1Y6IA 2L3DA 1WJ5A 2R7UA 2MP0A 2KL4A 4Y7NJ 4HNTA 1B9NA 1TWCJ 3F21A 1P4NA 3IFEA 1X4OA 1XS9A 4KOSA 1IC8A 4ETSA 1YREA 3F8NA 2JDDA 6PAXA 4IAVA 4QPQA 2A6HF 3ZOBA 1OCPA 4XRSA 3S8PA 2BVLA 2EILH 2JTVA 1JHHA 2BY0A 2F2EA 5JHUA 4A32A 1IXRC 4PXEA 3N4MA 1OYYA 4NCZA 4BMHA 1MMGA 1RTQA 3HGYA 1QVTA 4AIJA 3S6GA 2CSOA 3OYGA 3JRBA 3TTHA 2LKSA 4II2A 1YITI 2JA8J 1IY7A 2M0CA 3E0JB 5J6XA 1QHGA 2J8NA 3K4CA 3WC5A 2VODA 5L3BA 4RAZA 3IJ3A 1C3OB 2A6EF 4B44A 1Z4RA 1CM0A 1HOMA 2DT6A 5BPDA 1BOBA 2MA3A 2EIJH 1MSEC 4M8DA 2E28A 1XSXA 5HLHA 4B5PA 1T36B 1GVDA 3EYIA 1A35A 1G8XA 2HWVA 1I1GA 1ZG7A 3IL2A 3BHXA 1WWXA 3SDGA 4RN7A 1ETYA 2CWEA 2R5YA 1WJAA 3A03A 1Y9ZA 3P5JA 3EZAA 4ORFA 4ZC3A 3IC7A 5EDNA 2GANA 2K4JA 1TZLA 1TIQA 1XCBA 2IL4A 2ME0A 3IH3A 3E6MA 1KONA 1RR7A 4UVBA 1R71A 4R7MA 3AG2H 3JSPA 2M7AA 2LKPA 1U8RA 5ISVA 4YFNF 2BHZA 2P6SA 3DR8A 1D0YA 3FMCA 5D6EA 3ONQA 1JXSA 2EO8A 1MSFC 2DXQA 2Z33A 2V79A 2R1IA 4EM1A 2DTZA 3TL4X 2VL8A 5BMZA 3V7RA 1G59A 3BP8A 5DCMB 3HPHA 4BE0A 4BQNA 1YFHA 1ZR4A 2QQ9A 1GVJA 2XHKA 4OC3A 2KIQA 3AL0B 3O2PE 3CCUI 4XOPA 3FM5A 4F7ZA 2IT0A 1ZKGA 5KAFC 4AWXB 5LLQA 4IHVA 3LL7A 2EFOA 2FU4A 4LJZF 3EFAA 4HV5A 1R5HA 3BLNA 1VQOI 2X1DA 2DMUA 3GEZA
chains in the Genus database with same CATH topology
4AIKA 2GLFA 3B3CA 3OV8A 4TNUA 3SJGA 1R5GA 3D66A 2X0LA 2EK9A 4IK2A 1JQGA 5ILUA 4OINF 1YTYA 4JZ0A 4UIAA 1F5TA 1HKTA 1R23A 1LJ9A 3JSOA 1FP2A 1FNNA 1CG2A 2M87A 1KYZA 2ISYA 4MHGA 3GXOA 4CDJA 3PRTA 1P92A 1RUNA 3B35A 2DK8A 4M6YA 3W6JB 3SJEA 4BD9A 1FBQA 4RS8A 2PJ3A 4HLXA 3LA3A 1Z6TA 1FYLA 2C6GA 4TWEA 2IJZA 3RDIA 2NRAC 4XSXF 2ZEMA 4HA8A 1XD7A 4RGRA 4IPAA 5D4SA 2PJCA 4P4IA 4A12A 3NH5A 2KRFA 1J9IA 3D7GA 3F22A 4MCPA 5L3DA 2C6YA 4C85A 1ZG1A 3M9AA 1IN8A 3CJNA 1DE4C 5F64A 1TW2A 2OBPA 1YSJA 4A5NA 1W7PD 2PVVA 4ZY2A 5DCMA 3S9MA 3PB4X 4NGTA 5ERIA 3ELKA 1FX7A 1LDKB 1BI3A 2VE8A 3Q9VA 5E1ZB 3QAHA 1AOYA 5AONA 5K8OA 4ESJA 2AS5F 3I71A 1DPRA 1ZH5A 1HSJA 3KL9A 5H6RA 2HS5A 3WC6A 5DDGA 3GVAA 4ENNA 1PCAA 3Q9SA 2A61A 1VIXA 2UXNA 1TNSA 4UV8A 4LQGA 1DTDA 3I59A 1LAMA 3KHXA 1Q7LA 2JT1A 3BI1A 3EYYA 3KQZA 4XBFA 3K9TA 3RYRA 5IT9Z 2DW4A 4MHPA 4Q4ZF 5DUKA 4OMEA 1ZLIA 4G1PA 5J1QA 2FOKA 3WTTC 1FT7A 2CTCA 1GXPA 1Z6RA 1RIOH 3WGHA 2FE3A 5ILVA 3WU0A 4K3NA 4PXDA 3DLJA 2VOOA 2G7HA 4P55A 3E5XA 1WVMA 4ZZDA 3H8FA 2V1UA 2C6CA 1FPQA 4A5MA 4UVCA 3WT4A 4ZI6A 1TQMA 3D7FA 3NFZA 3MFKA 4HW0A 5BPIA 2FA5A 2ABZA 2CIJA 3H3ZA 1U5TA 2NSMA 2ZENA 3L2NA 4LK1F 4F8ZA 3L2CA 4C8AA 3R60A 5AIPA 3G73A 4O23A 1O7LA 1LDDA 4KMFA 2V1DA 1UB9A 4EFDA 3K0LA 4WXHA 1ELMP 5ICCA 3BXMA 3ZP5A 2QJ8A 1JE8A 2RGVA 1O3RA 5H6QA 1AMPA 1PYTB 1UFMA 5FD5A 2Z9OA 2ZOGA 4MXUA 3KE2A 2DI3A 1IXSB 2M45A 2IMOA 3I64A 4OC1A 5LGTA 3L9FA 1ZLKA 4OIRF 4ZYHA 1Z05A 2EV0A 1RZ4A 2XIGA 1NHAA 5D8NA 1MD0A 3T8RA 5L3FA 4L0ZB 2PJ0A 1R00A 3KEQA 3BI0A 4UV9A 2ETHA 3P7NA 3F72A 2V1XA 1KU7A 1EV7A 3W6KB 3R4KA 2EJRA 4EM2A 2K27A 4RGXA 4G7HF 5D8LB 4D0PA 1VHEA 2DT5A 3FJUA 5K8MA 3CTAA 1U2WA 3EQLF 1R1TA 4R8FA 4WCGA 4IRGA 2KJCA 2CW0F 4A37A 4Q47A 2VL1A 2IA2A 4HLYA 4MQ9F 3JTHA 5HVFA 4B09A 2XEJA 2E7XA 2G9WA 4UEFA 4ONWA 1B9MA 4IHTA 5CVVA 2O3FA 2MC3A 2LF8A 1Z2LA 1W5SA 4DYOA 4GYIA 3RJPA 5K5QA 1U5TC 5E17F 3K2ZA 2JRTA 2QYOA 1IF1A 1YW4A 5DD8A 1TF9A 3H3UA 3PQJA 4XLNF 1BIBA 1QBJA 1FC3A 2PJ9A 3GW2A 2QQBA 2LDUA 4JBAA 2M30A 1LQ1A 2ZEOA 3D67A 1S8NA 1QZYA 4N9HA 2PJPA 2HFHA 6CPAA 1ZYRF 2H6BA 3J81Z 2GIVA 3HSEA 2PJ5A 3HOTA 3L09A 1G6NA 4G9YA 5LRRA 4I02A 3FMRA 1WRJA 2RQPA 3KZZA 5EEHA 2VBWA 3ULQB