3K9TA

Crystal structure of putative peptidase (np_348812.1) from clostridium acetobutylicum at 2.37 a resolution
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
435
structure length
422
Chain Sequence
b'GMEEINKYIQNSSETGGEIYNLIEELFPICRSITGNGVRKTMDIIRKHIPLEIHEVKSGTKVFDWTVPKEWNIKDAYVRNSKGEKVIDFKENNLHVMSYSVPVHKTMTLDELKPYLHTIPGNKDRIPYLTSYYKENWGFSLTQNKFDELCDDDYEVVIDSSLEDGSLTYGEYYIRGELEEEILLTTYTCHPSMCNDNLSGVALITFIAKALSKLKTKYSYRFLFAPETIGSITWLSRNEDKLKNIKMGLVATCVGDAGIKNYKRTKFGDAEIDKIVEKVLMHCGSEYYVADFFPWGSDERQFSSPGINLSVGSLMRSCYGFDGYHTSADNLCYMNKDGLADSYKTYLEVIYTIENNRTYLNLNPKCEPQLGKRGDEFAMFWVLNMSDGKNSLLDIAYKSGMEFRRIKYAADALYRVELLKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative peptidase
publication title Crystal structure of putative peptidase (NP_348812.1) from CLOSTRIDIUM ACETOBUTYLICUM at 2.37 A resolution
rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase
total genus 139
structure length 422
sequence length 435
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09940 DUF2172 Domain of unknown function (DUF2172)
A PF16221 HTH_47 winged helix-turn-helix
A PF16254 DUF4910 Domain of unknown function (DUF4910)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k9tA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3k9tA01
3.50.30.90 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3k9tA02
4K3NA 3MCZA 1J5YA 5HVGA 1YLFA 2JPCA 2P7VB 3TO9A 4O5VA 2BBYA 4AWXB 3DLJA 4NGSA 5LEJA 3WGIA 2R7FA 1OR7A 2OBPA 3KE2A 4IJAA 4ENNA 1F5TA 5DUIA 1EV7A 2CWEA 4UF4A 3B7IA 5HVFA 1SMYF 1GXQA 2V1DA 3FMSA 3GF2A 3KQXA 4Q48A 2VBWA 3ELKA 3F8MA 3E5XA 4UNOA 4ON0A 2QLZA 2VC1A 4WXHA 4OC5A 2H09A 5DS0A 4KMUX 5AIPA 2M5WA 3PQJA 3K0LA 3R4KA 2ANPA 4XLPF 1IN4A 1LEAA 4MCSA 1MGTA 1USTA 1R23A 2PRQA 5E8GA 2ZNZA 2FMLA 4M9ZA 1HXDA 3CLOA 3FX6A 3F3XA 5E1WA 2EFWA 4LG0A 3BPVA 3H8EA 3FX3A 5DD8A 2DQRA 5D8LB 2FF4A 1YS7A 3ISZA 1DPRA 5CBMA 1E17A 3GYHX 3CPXA 2RGVA 3QP5A 3RBUA 1L0OC 2HDCA 3WTZA 1TTYA 1ZG7A 2HKXA 1XSDA 1O7FA 1ZLKA 3P7NA 5K8MA 3CUOA 1NHAA 1X3UA 3H3UA 3NA6A 3CPAA 1IY7A 3HRMA 4CHUA 2PMUA 3BZ6A 3RKWA 4PZJA 4FBEA 4LK0F 3TDZC 3HUVA 3KP3A 3LMSA 3TOBA 1K78A 1MZBA 1ON1A 3JAMZ 1LAPA 2O61A 2EB7A 3DXJF 4B6ZA 2V77A 4XLNF 2XIGA 1Y7EA 2JEWA 3R6SA 4RGXA 3L09A 1YO5C 2KJBA 4N0BA 1DUXC 1S8NA 4MNUA 3QU6A 3BP8A 1FP2A 2QYOA 5F64A 2MH9A 1TKFA 2VONA 2V8HA 3RKYA 3WE2A 1YFHA 2JTVA 4HLYA 3SI0A 4DQ2A 6PAXA 1YYVA 2GXGA 2PJ3A 4NGNA 3MFKA 2PJ5A 1HBXG 2PJ6A 1XN7A 3RYRA 4KMFA 2H27A 4MQ9F 2XGXA 2FNAA 4YIIA 3LQQA 3BXMA 2BV6A 5HDKA 1ZLHA 2F5DA 1YW4A 4WK8F 3I5UA 3IWFA 3HTSB 4G8XA 2AFSA 1FYMA 1IRFA 5L3DA 1RUOA 4HLXA 1Z1DA 3H8GA 1FP1D 1S29A 4I01A 3DFGA 5LYDA 2PJ7A 3QNVA 3RPQA 3L7WA 1P6RA 1R7JA 4JQFA 1IGBA 3V8JA 2UWMA 1JGSA 5K8OA 2C1CA 3DV8A 4A5MA 5F1RA 3D66A 1Z6TA 5E8IA 2VBZA 2V6CA 3PB4X 4Y13A 2IJLA 3BJAA 1IUYA 4HA8A 1IZ1A 2Q43A 3D7DA 1ZH5A 3IIBA 5LRJA 2POKA 4I02A 3MEXA 2ZNYA 5HLIA 4MCQA 5ICEA 3ABUA 5EEGA 1W5TA 1TW3A 1YSJA 2MC3A 4FUUA 4EFDA 1ARLA 4TV7A 3KP2A 3IC1A 3LSTA 1ARMA 4FWUA 4EJTA 2PBIA 3ULQB 2YU3A 7CPAA 4IRGA 4IHMA 4XSZF 3LA2A 4YFKF 4YIFA 2K02A 4LD5A 2UXXA 4ESBA 1CF7A 1HKQA 4P45A 2L01A 1XCBA 3BJOA 4IF4A 5D6FA 1MDMA 3GFLA 2BO9A 2EFNA 3CO7C 4EM1A 3J7AO 4FHTA 2J9AA 2PJ2A 4BNCA 1HDUA 4HF1A 3ROUA 3WG9A 2R3SA 3WTTC 1SD4A 2VL1A 4NGPA 3NH5A 2CIJA 4Q5SF 3WT4A 2HTSA 1XCVA 2NNNA 4OU0A 4ZZDA 4P4JA 4EJUA 4YWYA 3I0TA 4P55A 3GZ6A 3B3VA 2ELHA 3FM5A 2EK9A 2Z3YA 4KNYA 4AIHA 2O8XA 3WODF 4HF0A 2PLYA 2RVCA 5ERIA 1XFOA 5DCMB 4U0YA 1WQ2A 3R0AA 3WTWC 2A5YB 3M7GA 2PIYA 4ZX9A 2CF4A 1T2KA 3GX4X 1PP7U 3PB6X 3I71A 3TOAA 4RAZA 5L3EA 1LVAA 4HYEA 1JE8A 1DDNA 3GEZA 5TJJA 3WC7A 2G9DA 4OIOF 2PJ9A 4LLNA 2PCUA 5A2QZ 1ON2A 3BI0A 5E1XA 4CYDA 1XSVA 4A6DA 4NJRA 3FEDA 2EFOA 8CPAA 1XBUA 3MN8A 3J80Z 1AMPA 4CZZA 1IXRC 4Q4ZF 5LYLA 4A12A 1O3TA 3JSOA 5ICGA 3C18A 2KIMA 3F22A 2K7LA 1ZG5A 3WC5A 3NH4A 3H3ZA 3IO1A 2ZOFA 1FBQA 2GA2A 3RYPA 2PJBA 2P4WA 3PB8X 4EV0A 2WTEA 5K5OA 4KDPA 1SD5A 3K1NA 5BPIA 2FBHA 2ESNA 2ZEHA 2F5FA 3E6CC 2OZ6A 3KCCA 3I53A 2KRFA 3G3ZA 4LG0B 2MBFA 1BPMA 5ILSA 1F57A 3N5FA 4P44A 1FZPB 2O53A 1ZHFA 1IN7A 2WZNA 4R8HA 2HYFA 3F8FA 1F1ZA 2Y0MA 2ZJ2A 5THWA 2A61A 1AWCA 5D8NA 3WGGA 4P5OA 3KL9A 2EV5A 3HTUA 1R22A 1FOKA 2Q4ZA 2GLJA 2QUFA 2A68F 2AFWA 1UFMA 1QNTA 3WTYC 1IN5A 3P9IA 3B3SA 3U1DA 4HF2A 1R5HA 3E3VA 2DTRA 2EV0A 4OMEA 1PYTB 2HS5A 2DI3A 1U5TA 3CDXA 3D7HA 1K78B 1VHOA 1BIAA 1FNOA 2LNBA 3ISXA 5ILUA 3V7CA 1L3LA 4GO1A 4B09A 2AFOA 3I58A 3K1MA 2C6GA 4LB5A 4ZI6A 3GFJA 3ZMVA 1LDDA 1XDSA 3C3WA 4OC1A 2CGPA 5HVQC 2IRFG 1FT9A 4EGZA 3B35A 2XHKA 4DYOA 1WWXA 1P4WA 2FNPA 2UXNA 2ZBKA 3T8RA 1YG2A 3HRUA 4HBLA 4IRIA 5LYIA 1B6AA 2QENA 4P9UA 2XEJA 3IHUA 5L3FA 2RKHA 1SAXA 1LEBA 3B3CA 5L3GA 1TQPA 4FX4A 5FFZA 1CP6A 1D8KA 4LLLA 2OQGA 1U5TC 2STWA 3MZHA 1R00A 4M6XA 4OC2A 3GLXA 1F2PA 2CW0F 2ADUA 4A0XA 2ZKZA 2PEXA 2ZELA 1XD7A 2ZEGA 2LDUA 3P9CA 4N9IA 3VATA 3GFMA 4M72A 3E5QA 4BHPA 3TO6A 4MEYF 3DGVA 3C7JA 2MLKA 2COMA 4HAMA 3U2RA 3WTUC 4P9FA 1HSTA 2Q2EA 2VODA 2PVVA 1USSA 2FMYA 4FX0A 4ENKA 3J81Z 1LB2A 2BOAA 2AFXA 1OPCA 2STTA 1KU2A 2PJAA 4L5JA 3EYIA 4YU9A 4LQGA 3RKXA 5FD5A 3ECHA 2JBJA 3WC6A 5CVRA 1TNSA 1D8JA 2A69F 3EETA 2PI0A 1CGPA 2DK8A 3F8CA 2F7VA 2RDPA 4L18B 1O3SA 4UIBA 3SJFA 2RNJA 1GXPA 3NRVA 3BPXA 5FFXA 5LHHA 4A5NA 1BC8C 1MKMA 4OIPF 4I7HA 4JYWA 3C1DA 2P6TA 1KU9A 2BE5F 3ZQ7A 1CF7B 1LOKA 1YW7A 4P10A 1P2FA 2KKOA 1MDMB 2PJPA 2HQNA 1Q1HA 2K4BA 1Q7LA 2M8EA 1U78A 4HX8A 1YW9A 2LKPA 2VBXA 4GYIA 1ZRCA 4ZYEA 4CICA 4RB2C 2PMHA 1IAWA 5J8CA 5IT9Z 5EEHA 4ZYDA 1YW8A 3D67A 5E1ZB 1B59A 3PEIA 3EQLF 2HKOA 4ESJA 4GCVA 2XASA 1M4LA 4ZYGA 4KIGA 2GAUA 2PQ8A 2D1VA 3OV8A 1ZARA 1TNTA 2XAJA 1ZAOA 3QP6A 1XGMA 3KASA 2F2EA 1HKSA 2CTBA 3KETA 3ZMTA 3E6DA 4B8XA 2MH2A 3NEUA 2V1XA 4KYWA 4A94A 4NB5A 3SJXA 3T8WA 5JHUA 1BM9A 2VT3A 4RGUA 2W24A 2ZEFA 4L9TA 4WXDA 2RQPA 4R6TA 1KQ9A 4WXCA 3F23A 3B02A 2DO7A 3CT9A 5AIQA 2FQ3A 2V8DA 3I54A 1FLIA 3HSFA 5DDGA 4KA4A 4BHBA 3QOPA 3G73A 1J59A 1JHFA 2OOTA 2HC9A 2M87A 3HHHA 4AIKA 3M1EA 1MJ9A 3F21A 4H2KA 1V4RA 3BI1A 2ISYA 1ZYRF 3HRTA 4HQMA 5LYFA 2YX4A 2JPBA 4R1HA 4WJBA 2FEZA 1Z5RA 3SHFA 3SI1A 2VOOA 3PBEA 4KIFA 2NSMA 2EK8A 1JHHA 2MLGA 4KICA 1NSAA 4UVAA 3ZMDA 1PUEE 2P5KA 1KYZA 5FD6A 1Z8LA 4MHNA 5BS6A 3KLOA 1YIOA 3WU1B 1DP7P 4DUKA 4X3RA 4NFRA 2RN7A 4OIWA 1ZREA 2HB6A 2IMOA 2W25A 4L0YB 1Z91A 1FSHA 3D4UA 2PN6A 1W7PA 1AOYA 5BMZA 5JR3A 2RV8A 2J5OA 4ZY0A 2Q0OA 1EH6A 1Z9CA 5D4RA 2PIZA 2PJ0A 3QU3A 2ISZA 3S9MA 3O6BB 2W57A 5H6QA 1U5TB 5L3CA 3KLNA 4Y17A 3L2CA 2G7HA 2PFBA 5CVVA 2M1BA 3VEPA 4EVIA 4UEZA 2K4JA 5TRDA 1QO0D 2DT5A 2FOKA 3VARA 3IRQA 5CVJA 1C0WA 3FF3A 2AS5F 1D5VA 4GGGA 2D1HA 2UZKA 1H0MA 1RZ4A 2OU2A 2RB7A 2DBBA 3L9FA 1OYWA 4NGMA 1JQGA 2EFQA 1S7AA 5LGTA 1P92A 3OOPA 3RDIA 3ZN0A 3FMCA 3FJUA 2Z9OA 3PQKA 2EJRA 3IKVA 5J1QA 3DF8A 2K86A 5JM6A 1SFXA 3KFWX 5BQTA 1OMIA 3KQZA 4RAYA 1R36A 5HLGA 4KIBA 1H9TA 1CP7A 4I2OA 4MCRA 3CUQA 2GLFA 2ZEEA 4EJOA 1LDJA 3Q5FA 2XRNA 1P4AA 3GZ5A 2VOPA 4RB0A 4O6JA 5CVIA 3JTGA 3CTAA 1R1VA 2HOEA 4DJLA 4HX4A 2IA1A 4L5IA 3ML6A 3I59A 3HHGA 1F4KA 3O3KA 3I64A 2CO5A 3BY6A 4CDGA 2EK5A 2RFHA 1G3TA 2M30A 1ZRFA 4P4IA 1WRJA 4UXNA 3B3WA 1KA8A 1FNNA 1Z7UA 5HXDA 2Q8KA 2P6SA 4AD9A 4XBFA 4ONWA 2VXZA 3BJ6A 3MZYA 3WU0A 2GXBA 1I27A 2ZMEA 3IKTA 2E1NA 3CUQC 4UVBA 2F8HA 3M8FA 3V7SA 4NQWA 3FVLA 4YFNF 1TF8A 2NNYA 1LANA 2V79A 1STZA 1GHCA 2VN2A 1BIBA 2ZOGA 5ICCA 3N97A 2EA4A 1LJ9A 4PGHA 3JTHA 1J75A 3VH9A 5D6EA 3T5XA 4BYYA 3HSRA 2X0LA 4CGZA 2XAFA 4HV5A 4KUMA 3KP5A 1HW1A 4KFCA 1VHEA 2QVPA 5H6RA 3FXUA 2C6PA 2H94A 3M8EA 3RPUA 5E18F 1VIXA 3K2KA 4WF2A 5HS8A 4UVCA 4CXFA 5ICFA 1R1UA 3V38A 4Z2YA 3B3TA 3D7GA 4ZYHA 5A2QK 1RI7A 2DU9A 3IWZA 1G3WA 4M9XA 2ACJA 5D4SA 2B0LA 3GXOA 3V4GA 4HDUA 1TKJA 4MHYA 1ZG9A 1IXCA 3LQRA 2F5CA 3SQNA 1T0FA 2QBYA 2PE3A 5DV5A 1ODDA 2TDXA 2DK5A 3P9KA 4P4FA 1ZGJA 3ISPA 3MRUA 4ZZLA 2CG4A 4FAIA 3GFIA 4HV6A 3PB9X 2HTJA 2Z99A 1U2WA 5DD4A 3D68A 1O57A 4UV9A 2OAZA 2E7XA 1FPQA 1HW2A 4R8FA 4KN7X 3QPHA 1FYLA 4WX9A 3ZMZA 2Y75A 2OR4A 2XUBA 1Y0YA 2VE9A 3IJ3A 4F8ZA 1KQ0A 4O23A 4IPAA 2OQRA 1FT7A 3SZTA 4EGYA 2QZ8A 1FC3A 3KHZA 2XAGA 4MRIA 4OINF 4MTDA 4ETSA 1BI3A 2PJCA 5LGUA 4U7DA 1YTYA 3PB7X 2O0YA 5DCFA 5HOOA 2GU2A 2ZEPA 1J9IA 1RIOH 4RGRA 2HEOA 1BN5A 2FU4A 1HEEA 1HKTA 1SD6A 2QM3A 5DEQA 1R58A 3PBBA 5FB2A 3KZZA 3SXYA 3LFKA 4G7OF 4UIAA 1ZG8A 3DEUA 4P96A 2JRTA 1TF9A 2V8VA 1R1TA 3F72A 3JW4A 1P4XA 3Q9VA 1W4MA 4ZX8A 3SI2A 2MD5A 4PQAA 2GZWA 1B9NA 5D8KB 4MHZA 4AVPA 2LF7A 2GIVA 1W7PB 3T8TA 4A38A 2ZEOA 1Y0UA 4MTEA 3VODA 4P4EA 4GXOA 3KI9A 1HQCA 4Q47A 3ZMSA 2JT1A 5JFRA 4IRHA 1W7PD 3HIFA 3EYYA 3HLPA 3K2ZA 4U0WA 4UHTA 3ABTA 5JI6A 2JSCA 1EH7A 3SJEA 2DAOA 4M6YA 4M73A 2Z5UA 1ZG3A 1H9GA 3AAFA 2ZFWA 4MGRA 4EMSA 1XMBA 3FEEA 1RTQA 4HW0A 1XMAA 5J8FA 4EM2A 2BEOA 5LHGA 1I1SA 1U8RA 4S04A 1CPXA 4OC3A 3HOTA 5LEKA 1YLOA 2L54A 4PDKA 5FLXZ 2YR2A 3BROA 2I3CA 3RI4A 3W6JB 3EUHA 4MMOA 2O6GE 3JRUA 2QWWA 2IA2A 1UHWA 1JXSA 5ELYA 2KIFA 3LA3A 1H8LA 1T98A 1S7OA 2DFIA 3E6MA 1K7AA 3HOSA 5K5QA 3LWUA 2CYYA 2H6CA 2OA4A 4NGTA 3COAC 3PRTA 4EWTA 3CUQB 3J81K 5D29A 2XV4S 5F09A 2QQBA 1SFUA 4WWVA 1YMEA 1BBYA 2BYVE 2H6BA 3JSPA 2NRAC 2JZYA 3WABA 1ELMP 1XMKA 2HZTA 3I59B 4MHGA 2AXLA 5J6XA 2A6HF 4G6QA 3WTVC 3KR4A 4PXCA 4LMYA 4MXUA 1FYKA 2XKOA 2L4AA 1F2OA 2W84A 4LJZF 4DNCA 5AONA 1BPNA 5LLQA 3GO5A 3E6BA 2EA2A 1TW2A 1T6SA 3SFZA 5HS9A 4M9SA 1J0RA 1ZGAA 4BHCA 1DPUA 1Y0RA 3D5LA 5H20A 4MQVA 1G6NA 2C6CA 3E5UA 2ZMEB 3VOEA 2C6YA 5HVHA 4G9YA 5IT9K 3KEOA 1SMTA 3R0JA 2A3SA 1IXSB 2EV6A 3GLJA 4M74A 4RB1A 3DPLC 3DQVC 4MEXF 1MD0A 2DW4A 1BI2A 5HDGA 4GYGA 5LBQA 3GW2A 1BAVA 1HSJA 3FM3A 5K1YA 4OP4A 4G6DA 2HGCA 4HOBA 1OYIA 4U0VA 3VB2A 3DP7A 4BAYA 1QMUA 4F9VA 2CSOA 5CPAA 2XVCA 4G7ZF 1KGSA 3GUXA 3LWFA 4KN4X 2HWVA 1GYTA 3D7FA 1FBUA 2PJ8A 1XGNA 3KP6A 3MAJA 1G3YA 3K69A 3ZP5A 3TO7A 4A0ZA 2P5LC 4R7MA 4BH9A 1FSEA 3KGQA 4YG2F 1G4DA 1TQIA 2NYXA 1I5ZA 1CG2A 2BCOA 2PJ1A 3IFEA 6CPAA 1J7KA 4ESFA 1HDQA 1E2XA 5K8NA 2QBYB 1LAMA 2KIUA 5IT3A 3FXQA 2FXAA 2GA1A 3JAMK 5FGMA 3N4MA 5HDNA 4YFXF 3BHXA 4ZYQA 3TDUC 1K79A 5ILVA 4EMEA 2RC4A 4BD9A 4NJQA 1O3QA 3HRSA 4F9UA 3ECOA 4EQQA 3DKWA 4FT8A 1QQIA 2IA0A 1YW6A 3PFEA 2GREA 4PPZA 4IXAA 1SFEA 4HQEA 4P4DA 1WSUA 2QYVA 1OBRA 3KHXA 2V1UA 3ZMUA 5JH9A 3F6VA 2PVWA 3MWMA 1U3EM 3TC8A 2XEIA 1BC7C 5LHIA 3TX8A 2A07F 2P7CB 2K27A 3I4PA 4A2UA 4BXUA 2OD5A 4I0BA 4OKOA 4PGGA 4IVNA 4G1PA 5LRRA 4ENJA 1WI9A 4A39A 4TNUA 1W5SA 4OOIA 3TKYA 5D5WB 4PXEA 5I4MA 3W6KB 4EM0B 2IPQX 4K2EA 1QZZA 3FF5A 2ZENA 4P6YA 2WWYA 2IJZA 2DLLA 3M9AA 1BJAA 2G7UA 1FX7A 4I0AA 4JK1X 4PXDA 2WYRA 2LF8A 3KR5A 1YS6A 3RAMA 4RB3C 4NHJA 1PCAA 2O3FA 3KZWA 3HSEA 1XB4A 4CO8A 3PFOA 4X8IA 3L2NA 4IAVA 4KSIA 2DQLA 4LFUA 3K9TA 3E97A 2PG4A 3RIRA 3PFIA 2ZEMA 1R3NA 3NH8A 2L02A 1SD7A 1V3FA 3LAPA 3GUDA 4R76A 1PP8F 4U7BA 4IHTA 5KVRA 2NYQA 2EWBA 2M45A 2GQQA 2R7DA 4X2TA 1UWYA 4HZFA 3I1UA 1WKMA 3F6OA 2QQAA 3HUGA 4Y15A 2JBKA 3F8NA 3NQOA 1IW7F 3LAJA 4PXBA 1BOAA 3S2WA 2IVMA 3KEQA 2V8GA 3BDDA 1KWMA 2O03A 1LFWA 3S9LA 1A04A 4WCGA 4BQAA 3WGHA 2IP2A 3T0YA 5CJ9A 2Q51A 2XAHA 3GWZA 2FBIA 1R5GA 3ZPLA 1XJOA 2ZO4A 2L4MA 1KYWA 4LGWA 1Z6RA 3WTXC 4OC0A 1TXRA 2IW5A 3TGNA 2OZUA 2D45A 4OIRF 1ZLJA 1BI1A 3IRRA 1QZYA 1MJAA 4Q7AA 4E70A 1YQAA 2FBKA 2LSOA 2HYGD 1BLLE 3IWWA 2D2WA 2ESHA 2X4HA 4UEFA 3EDPA 3KZYA 4ZY2A 2WC2A 1I6XA 4ZH4F 2YX7A 4IK2A 2CFXA 3FMRA 1TKHA 4EJWA 3FH4A 1J2XA 4S05A 1ZRDA 3CO6C 1ELLP 3SZPA 4GM5A 5JVTA 4IHSA 4Z65A 5K5RA 1B1BA 1S6LA 1O7LA 1XSXA 3RTRA 4L0ZB 1I1GA 3MQ0A 3GB0A 1VTNC 5D5VB 3GVAA 5LGNA 2AFZA 5DYMA 4G7HF 1QPMA 1IRGA 3IC7A 2F5EA 2XEGA 4P4BA 2P8TA 3LA7A 3J80K 1B9MA 3RJPA 1ULYA 1LQ1A 1MJBA 4OIQF 2AFUA 4EJVA 2WV0A 2VC0A 4CPAA 1DE4C 5F6FA 1XDUA 1GVJA 3NFZA 4UEEA 4W9YA 1EH8A 1LNWA 5HS7A 1Z05A 3FWEA 4OMZA 2FE3A 2BGCA 1REPC 3V7ZA 2E1CA 4N9HA 1CX8A 2GWRA 2HFHA 2O4HA 1RNLA 2ABZA 4LLGF 3QRFF 2ETHA 2QVOA 2XKPA 2YPRA 5K8PA 4OIDA 1RUNA 3V8LA 1TLHB 3D0SA 2E7WA 3IEHA 5IB9A 1FBSA 4QLCU 2W85A 1D3YA 2QQ9A 3O2PE 3HYIA 5ED4A 4OC4A 1QGPA 1VGYA 3FXRA 4PCQA 3WTSC 2FRHA 4MHPA 4A6EA 3TQNA 2NAZA 1OKRA 2VBYA 4ENMA 1KU3A 4A0YA 3T1BA 5FO5A 1O3RA 1U6GA 2HR3A 1XRYA 4D0PA 3QPTA 3S9NA 2L3DA 2FA5A 1CPSA 1ZN2A 1G3SA 4MCPA 1DTDA 4O3MA 2DEAA 1QQ9A 4UUVA 4L9NA 3FMQA 3IL2A 2FVGA 2XROA 2ZXJA 4NGRA 3DPTA 5KK1A 1R43A 4G94A 1ZLIA 4L9JA 1CBXA 2QJ8A 4OMYA 5BOXA 1T39A 1XGOA 4RS8A 3WE3A 2VT2A 2HQRA 5E17F 2XEFA 1F9NA 2MA3A 1TBXA 2IQ6A 4RUHA 3Q9SA 4LK1F 1TQMA 4TWEA 4L9VA 3R61A 4H0EA 2NS0A 1PDNC 4XSXF 5L3BA 2A6EF 4QWQA 5D5UB 3KP7A 3L00A 4U88A 3REOA 2IT0A 3SJGA 1T38A 4ZY1A 2FSWA 1IN8A 3CJNA 4JBAA 5CLSA 3V8KA 2EFPA 3H92A 2Z33A 1Z2LA 3BWGA 4RGSA 1EE3P 1ONVA 1S3JA 4HDVA 2CQKA 2ZEDA 3B73A 5LRSA 2YSRA 4M71A 2G9WA 2VE8A 5LRGA 5D5XB 1FY7A 1K6OA 3H8FA 3F8BA 4NGQA 2EWNA 3B2YA 1OYYA 1UCRA 1QBJA 1XGSA 1B4AA 3VFZA 4AIJA 1LCPA 3K1PA 4LB6B 1IN6A 1ZG1A 5E20A 1IF1A 2DPUA 2DPDA 1KQ8A 4AXVA 3CDHA 4JZ0A 2V9VA 5LRKA 3U9GA 1FWZA 5HLHA 1HW5A 3QAHA 5JGFA 2ZCWA 3BOQA 1KU7A 5FLXK 5DUKA 4WWCA 2KJCA 3ERED 1UHMA 2P5VA 4R79A 3KP4A 2CTCA 4XRFA 5CYVA 1AYEA 5BPDA 4F7ZA 4ASNA 3ZN1A 2AFMA 2Y48A 5CVUA 4A37A 1BI0A 2PJ4A 4UV8A 3R60A 3V7RA 1LDKB 3FHZA 3RZAA 4I09A 4I98B 2XAQA 5DCMA 4HX7A 2J5PA 1UB9A 3FECA 3FZVA 4KT5C
chains in the Genus database with same CATH superfamily
2G0BA 3TEDA 1A6IA 4K3NA 1SVOA 2HDDA 2CS3A 3QAYA 3MCZA 4DYCA 4C9EA 2DMPA 1MNEA 3KX2A 3GTGJ 1J5YA 5HVGA 1YLFA 2FE7A 2JPCA 3OYCA 2P7VB 4V19K 2ZSIB 4O5VA 2BBYA 3TO9A 4AWXB 2ZXVA 3DLJA 5LEJA 4NGSA 3WGIA 3I74A 3HJEA 2R7FA 1OR7A 2OBPA 3KE2A 4IJAA 4ENNA 4II9A 4BE2A 3TLZA 4EATA 1XPXA 3GYAA 1F5TA 5DUIA 5IR2A 3CCUI 1EV7A 2CWEA 4UF4A 4KOWA 3B7IA 5HVFA 1SMYF 1GXQA 2FOWA 2V1DA 3BQYA 5H2FC 4KISA 2V1NA 1B6BA 3FMSA 3GF2A 3KQXA 4Q48A 4XRSG 2B3VA 2VBWA 1VHSA 4FASD 1YIJI 3ELKA 3F8MA 3E5XA 4UNOA 4ON0A 3A0BC 2CH0A 3JRBA 2J8MA 2QLZA 2VC1A 4OAYA 2K9SA 4WXHA 4OC5A 2H09A 5DS0A 4KMUX 5AIPA 4KITB 1T56A 2Q44A 2R5YB 2M5WA 3PQJA 3K0LA 3R4KA 4RLQA 2ANPA 2RREA 4XLPF 1IN4A 1LEAA 5FVJA 4CRZB 3A1YA 5JQ4A 1NK3P 4UY8I 4MCSA 4ZBGA 4AIDA 1G59A 1MGTA 3CZ6A 1USTA 3W6VA 1R23A 2JLMA 2PRQA 5EGOB 3CD6I 5E8GA 2ZNZA 2F5VA 1FIAA 2NVYJ 2FMLA 2DT6A 4M9ZA 4KS9A 1HXDA 3P2FA 5FLVA 3CLOA 3FX6A 2FJ1A 3F3XA 1Y9ZA 5E1WA 2R5ZA 1D1BA 5HODA 2EFWA 4LG0A 3BPVA 1JJ8C 3H8EA 3FX3A 5DD8A 4LX9A 2DQRA 5D8LB 3GTPJ 2FF4A 1YS7A 2VB6A 3ISZA 3KEYA 1F36A 3CC4I 3RCOA 4MBUA 1DPRA 2VPRA 5CBMA 1ETXA 2NS8A 2MSYA 3GYHX 1D5YA 1E17A 1R71A 1S7FA 3BG9A 5EDNA 3CPXA 1OR7C 2RGVA 2DF5A 3QP5A 3RBUA 4BXXJ 1L0OC 3M07A 2HDCA 5G20A 3T5MA 3C8OA 4Y33A 4A3MJ 2QECA 3OYNA 4BL0B 3WTZA 3CF2A 3L2WA 2Y9YA 1M44A 4UB8C 2PR8A 1TTYA 2ZJQF 1A5JA 3LSKA 3CCMI 2HKXA 1XSDA 1ZG7A 5GAEJ 1O7FA 2NS7A 1X1PA 3P7NA 3CUOA 4BJTA 1NHAA 1X3UA 2BY2A 3H3UA 5K7HA 2FXFA 5K8MA 1FTZA 3NA6A 1I3AA 3CPAA 1I1DA 3B8GA 4CH7A 1IY7A 3SDGA 3UKGA 3HRMA 4NC6A 3BZCA 3GJZA 4CHUA 2PMUA 3BZ6A 2VKDA 3RKWA 4PZJA 4FBEA 3EIFA 2CW7A 4LK0F 2ZW7A 3B6CA 3TDZC 3HUVA 2ID3A 2RQQA 3KP3A 3LMSA 3TOBA 1K78A 1MZBA 1ON1A 4A32A 1MNDA 3JAMZ 1Z3XA 1LAPA 4LOCA 2O61A 1YVOA 3S2DJ 2EB7A 2EIKH 2X6YA 2JJ7A 3DXJF 3ZQFA 1H89C 4B6ZA 5DM7F 1CS0B 3BR1A 2V77A 4XLNF 2JA6J 2R7ZJ 2XIGA 3OYEA 1ETYA 4NXYA 2CNSA 1MSFC 4XPDC 3ERMA 4CAFA 3HDDA 2XRLA 1Y7EA 5EJCA 2JEWA 3R6SA 4COGA 1VQ8I 3R1KA 1T8IA 4IIXA 4RGXA 1VQ9I 3L09A 2WAFA 1YO5C 2KJBA 3N05A 4N0BA 1DUXC 1S8NA 4MNUA 4PJMA 3QU6A 3BP8A 4BXFA 1FP2A 2B0AA 1FOXA 2QYOA 4CCKA 5F64A 2MH9A 1TKFA 2VONA 2V8HA 2FM4A 4NNJA 3RKYA 3WE2A 1YFHA 2JTVA 4HLYA 3SI0A 4DQ2A 6PAXA 1YYVA 3P2HA 3QB8A 4MJ8A 2K9QA 2GXGA 3HPGA 2PJ3A 4QSHA 4NGNA 3MFKA 1JGGA 3GZNB 1NSLA 2PJ5A 2X7BA 1IV6A 2ATRA 1AA7A 2AQFA 1HBXG 2KT0A 3A2KA 1FMWA 1YE9A 2W1OA 1IV8A 2PJ6A 2IS2A 4YRVA 4Y49C 3DBHB 2Q7SA 3GTQJ 4C9AA 1XN7A 3RYRA 4KMFA 4C2YA 2H27A 4MQ9F 2XGXA 1U9OA 2FNAA 2ZPAA 4YIIA 4DOZA 2CV1A 2FUG2 3LQQA 1Y9KA 2WAQA 3BXMA 1LFPA 4B3AA 2WADA 2BV6A 1H88C 5HDKA 5FKMA 1YX3A 1TP4A 1ZLHA 2F5DA 3PM1A 1Z21A 3GTOJ 1YW4A 2C5QA 4WK8F 1M4DA 2BSWA 3I5UA 3IWFA 4UCPA 3HTSB 4G8XA 4KUAA 4R9MA 3PO3J 3JRCA 3RKQA 3T90A 2AFSA 2DPTA 2MFZA 1IRFA 5TISC 1FYMA 5L3DA 1RUOA 4UFXA 4HLXA 3LOCA 1Z1DA 3H8GA 1FP1D 1N78A 1Q1VA 2EUIA 1S29A 4I01A 3IU2A 3FHNA 3JUWA 5KTCA 3DFGA 4C2XA 5DTDA 5LYDA 2PJ7A 3NE8A 3QNVA 3I4MJ 2LP0A 3RPQA 3H9GA 3L7WA 1P6RA 1R7JA 4JQFA 4B5PA 2FD5A 1IGBA 3V8JA 2IGNA 2UWMA 1JGSA 5K8OA 2C1CA 3DV8A 4A5MA 2TRTA 2MD0A 1FOWA 4BJ5C 5F1RA 1Z6TA 5E8IA 2VBZA 3JR9A 3D66A 5GPAA 2V6CA 2DFFA 2UUZA 2R7TA 3PB4X 2IBDA 2O5RA 2XPVA 4Y13A 2IJLA 5JVLA 5EZHA 3BJAA 3DKXA 3GTJJ 1QVUA 1IUYA 4HA8A 1IZ1A 4BS9A 2Q43A 1SANA 3D7DA 5ISVA 3U1KA 1ZH5A 2W4SA 3IIBA 3W6SA 5LRJA 2POKA 3I9SA 2Y2ZA 4I02A 3MEXA 1IYKA 2ZNYA 5FROA 1D1AA 5HLIA 1TWHJ 4D5CA 3DKYA 5KHDA 5ICEA 3M4OJ 3ABUA 5FKKA 4MCQA 4UUTA 4F52A 2VQGA 5EEGA 4N4OB 1YJ9I 4KOYA 1W5TA 4KSAA 1TW3A 1YSJA 5C3EJ 2MC3A 4FUUA 4EFDA 2E19A 1ARLA 1K6YA 2QKMB 2BZTA 2X6OA 4B1RA 4TV7A 3KP2A 5KNLA 3LSTA 1ARMA 3IC1A 4EJTA 1HC8A 4FWUA 4CGMA 1APLC 2X1CA 5C4XJ 2PBIA 2EZKA 3ULQB 1S72I 1K4JA 2YU3A 3Q0VA 2O28A 4XLHA 2EZCA 1YI2I 3HBLA 2JVHA 7CPAA 2DYRH 4IRGA 2D4OA 4IHMA 1BJZA 4XSZF 3Q0WA 5JLXA 3LA2A 2O7OA 4YFKF 1QSMA 2CUJA 4YIFA 2K5CA 2K02A 2Z3OA 4ITVA 4LD5A 2UXXA 3A01A 4ESBA 1CF7A 1IGNA 1HKQA 4P45A 3HOUJ 2KQRA 2L01A 3QPSA 4QPOA 1XCBA 3BJOA 4IF4A 5D6FA 1MDMA 3GFLA 2BO9A 4JYKA 4B4CA 3QQAA 2EFNA 3FBUA 2GE3A 1VQ4I 2G0EA 3CO7C 4EM1A 4B43A 3QODA 3J7AO 4DBRA 4QUSA 4RN7A 3NWTA 4FHTA 2BL1A 4RI1A 2J9AA 3ZXSA 2PJ2A 4BNCA 4CYCB 1HDUA 1ZK8A 5FKLA 4HF1A 3ROUA 3RNZA 3WG9A 3DU5A 1W0TA 2ZJRF 2R3SA 3WTTC 1SD4A 2VL1A 2W7NA 1NG7A 4H89A 4NGPA 3NH5A 4CAEA 4M3EA 3OYAA 5C88A 4MFZA 3K4IA 2KRHA 3EUKL 3FXLA 2YJTA 4C8PA 2CIJA 4Q5SF 3K7AJ 1MMDA 2KLOA 3DEWA 3RQ4A 3WT4A 2HTSA 1XCVA 3IWGA 2NNNA 1X1DA 4OU0A 4ZZDA 4P4JA 4EJUA 2D4PA 4AYBN 4YWYA 3I0TA 4P55A 5AGEA 2LKSA 3GTMJ 3GZ6A 4YELA 3B3VA 2ELHA 3FM5A 3GMEA 2R7WA 2EK9A 2Z3YA 4KNYA 4AIHA 2O8XA 3C2GA 1I3QJ 3WODF 3GY9A 4HF0A 1IDZA 2PLYA 2RVCA 2FX0A 4INJA 2FT0A 3V8IA 3FBNB 5ERIA 1VQNI 1XFOA 1K83J 3K4LA 2EO8A 4YGOA 5DCMB 3HOZJ 4U0YA 1WQ2A 3R0AA 1PVEA 3WTWC 2R1IA 2QEXI 2A5YB 3M7GA 2PIYA 5CNPA 4ZX9A 2CF4A 1T2KA 1Z67A 4BE1A 3GX4X 2HOAA 3VDXA 2DXIA 1PP7U 3PB6X 2CW8A 1OCTC 3I71A 1QVTA 1MMAA 3TOAA 4RAZA 5L3EA 1LVAA 4HYEA 1JE8A 1DDNA 3GEZA 5TJJA 3WC7A 3L2QA 2G9DA 4BBRJ 4OIOF 2PJ9A 4LLNA 1Y0NA 2PCUA 4MFKA 4CA0A 5HH1A 5A2QZ 1ON2A 1D0XA 3BI0A 1ZRSA 1QSOA 1TZLA 5E1XA 3SR3A 4CYDA 1XSVA 4IQ4A 4A6DA 1JKPC 3S2HJ 4NJRA 2IXSA 1GV5A 2EZBA 3FEDA 4MHDA 5F9MA 2EFOA 8CPAA 4S0HB 1XBUA 5J4YA 3MN8A 3J80Z 4JP0A 1AMPA 4C7IA 4V2GA 5A27A 4CZZA 2J8NA 1IXRC 1U9NA 4Q4ZF 3RZDJ 5LYLA 4A95A 4A12A 4N4NB 1O3TA 1NH3A 3JSOA 4LG3A 5ICGA 3W2AA 4BMHA 3C18A 2KIMA 1A2ZA 2R92J 1B8IA 4C68A 3FXOA 3F22A 2K7LA 1MMNA 1ZG5A 2CNMA 2QF7A 3WC5A 3QYFA 3NH4A 3H3ZA 4V2FA 2W82A 3SDBA 4B10A 3IO1A 3EZEA 1X4PA 3DTEA 1LKXA 3S15J 4F92B 1FBQA 2GA2A 3RYPA 2ZOFA 3HKZN 2VASA 2PJBA 2P4WA 4AUXA 2JUCA 4EV0A 3PB8X 2WTEA 5K5OA 4KDPA 1SD5A 3K1NA 1IUFA 4BBHA 1IOIA 5BPIA 2FBHA 3I9V2 2ESNA 1Y39A 2ZEHA 2F5FA 3E6CC 2OZ6A 3I53A 3KCCA 2R5ZB 2KRFA 3G3ZA 4LG0B 2DIKA 2DOFA 2MBFA 3TLGA 5AG7A 4KOXA 1BPMA 4XOTA 3DNSA 5IP7J 5ILSA 4XPDB 4LIUA 4PJJA 1EKEA 3OYJA 1F57A 3S1RJ 3CP8A 3N5FA 2WAEA 4D7NA 4P44A 3FXMA 1FZPB 2O53A 1ZHFA 1IN7A 2WZNA 4R8HA 3NARA 2HYFA 5K7FA 3F8FA 1XTAA 4R3KA 1OCOH 1F1ZA 2Y0MA 2ZJ2A 3BR3A 5THWA 2A61A 3S6GA 5C82A 1VQOI 1AWCA 5D8NA 3WGGA 2DA5A 4PK2A 3BG3A 4E2AA 4P5OA 3KL9A 2EV5A 3OWTA 4JX4A 3HTUA 1R22A 3KYLA 4A3CJ 1FOKA 2Q4ZA 2GLJA 3HEFA 2QUFA 1DGWY 2A68F 1I39A 3AFHA 1U0JA 3TLAA 2AFWA 3VYUB 5GADJ 3VYTB 4XRMA 2QSFX 1UFMA 3ASNH 4XK4A 1QNTA 3WTYC 1IN5A 4NEXA 4Y49B 3P9IA 3B3SA 3U1DA 2PC1A 2CV2A 1R5HA 4HF2A 4MLOA 1OFCX 2HVQA 2DTRA 2EV0A 3E3VA 4J01A 4OMEA 4AVBA 4BY1J 1PYTB 2UV1A 3FRMA 2HS5A 2DI3A 1U5TA 3CDXA 3D7HA 1K78B 2HOSA 1VHOA 3HOXJ 4BQQA 2EZIA 1BIAA 1WJEA 4OAEA 4MFJA 4RA2A 2LD5A 4KNGE 3D8PA 1FNOA 2LNBA 3ISXA 5ILUA 4Y52J 2K40A 2XPWA 2OZHA 3LACA 3V7CA 5FRMA 1L3LA 4GO1A 3BG6A 3DLAA 2KCWA 1A9XB 4B09A 4XLAA 2WAQN 4BGDA 1KUYA 1UZCA 1XX5A 2AFOA 3I58A 4AC0A 4NCZA 3K1MA 2ZW6A 2R93J 3HGYA 5B1AH 2ODFA 1MNMC 4QTRA 2C6GA 4PV6A 4LB5A 4ZI6A 3GFJA 3ZMVA 1MBFA 5F49A 5EMIA 1LDDA 1XDSA 3C3WA 4OC1A 2H8WA 3A02A 3NOJA 2CGPA 3X2QH 1FTTA 5HVQC 4CGOA 2IRFG 2DODA 1XF1A 4PFPA 2IS6A 1FT9A 3BT9A 3ZOBA 4EGZA 1KUXA 3B35A 2XHKA 1WVRA 4F6AA 4DYOA 1BXRB 4FTHA 1WWXA 1S9HA 5IOYA 1P4WA 2FNPA 2UXNA 2ZBKA 1WWZA 3T8RA 1JI8A 1YG2A 3HRUA 4HBLA 4IRIA 1AUGA 1B6AA 5LYIA 2QENA 5HMNA 4I6ZA 4P9UA 2XEJA 1NTCA 2R7OA 4IHXA 3IHUA 5L3FA 4Y7NJ 2RKHA 1WK4A 1W36D 1SAXA 1LEBA 5L3GA 1XMTA 1TQPA 3B3CA 4FX4A 5FFZA 1CP6A 4J0NA 1D8KA 4LLLA 2OQGA 2E5NA 1WJCA 1U5TC 3TYXA 3HPHA 2STWA 3MZHA 1R00A 2E71A 4LIVA 4M6XA 4OC2A 2XF7A 1AHDP 4HNWB 4HNVA 1R57A 3GLXA 1F2PA 3D3SA 4C99A 2CW0F 2ADUA 4A0XA 3HM5A 2ZKZA 2DA2A 1S60A 4BUPA 2PEXA 1Z3YA 2EVNA 2ZELA 3G1MA 3VWBA 1N77A 1KONA 4A30A 2QMLA 1XD7A 2ZEGA 2LDUA 3P9CA 2HROA 4N9IA 3S16J 3ZQGA 2K85A 3GFMA 3BTIA 4M72A 1B87A 4FD4A 3VATA 4B5PB 3E5QA 4PJLA 4BHPA 3TO6A 5GAGJ 4MEYF 2O8KA 2P6FA 3PUFA 5B5EC 3L2RA 3K4NA 2OTLI 3DGVA 2CUEA 4IUSA 3R95A 3C7JA 2MLKA 2COMA 4HAMA 3U2RA 3G1OA 4MFQA 3WTUC 1B72B 2E5ZA 4P9FA 1HSTA 4F91B 2Q2EA 2VODA 4B12A 2PVVA 1S7EA 4IZZA 1USSA 2FMYA 5J1YA 2BW3A 4FX0A 3WG7H 4DYQA 1G8XA 3TMOA 3J81Z 4ENKA 1LB2A 5IB0A 1NXJA 3I4NJ 2BOAA 4IQJA 2LLKA 1OPCA 2STTA 1KU2A 3BR6A 2AFXA 2AJ6A 2PJAA 4L5JA 3T05A 1VNDA 3FBIB 3EYIA 4YU9A 2VKHA 4LQGA 3RKXA 5FD5A 3ECHA 2JBJA 3WC6A 2JN6A 1OCPA 5CVRA 4PK3A 1TNSA 1VI0A 4XICA 1D8JA 4LITA 2A69F 3SEZA 1D0YA 3EETA 2PI0A 1CGPA 2DK8A 3F8CA 2F7VA 4YN3A 2QKLB 5IY5H 2RDPA 2L7FP 4L18B 1O3SA 4UIBA 3SJFA 2RNJA 1GXPA 3NRVA 3BPXA 2YNDA 2L7ZA 5FFXA 3TLYA 5LHHA 1VQMI 4A5NA 4QPQA 3DBLB 1BC8C 1EA3A 3R9GA 2MP0A 1MKMA 2JUGA 4OIPF 1OJLA 4I7HA 5FRNA 4JYWA 2ZFUA 1BR1A 3C1DA 2P6TA 2REFA 4UBRA 1KU9A 2BE5F 2XSJC 2BOLA 2MG4A 3HXLA 3ZQ7A 4MFPA 3A01B 3CMYA 2YJVA 5F5XA 1CF7B 1AU7A 1LOKA 1YW7A 2KRCA 2OUMA 5J47A 4P10A 1P2FA 2KKOA 2PJRA 3H4QA 2AQEA 1MDMB 4C9YA 2PJPA 2HQNA 1Q1HA 2GANA 3IU1A 2K4BA 1Q7LA 2M8EA 4AYBA 5CQGA 1U78A 2ZSHB 1EF4A 4L89A 2MABA 4HX8A 2VIXA 4PJ0C 1X1AA 1YW9A 2LKPA 2ME0A 2VBXA 3EZAA 2XGCA 3DEEA 2Q04A 4GYIA 5M3MJ 2DFEA 4B44A 3KYCB 1ZRCA 1M1EB 4CUGA 4RBOA 4ZYEA 4E6KG 4CICA 4RB2C 5BWAB 1QSTA 1X2NA 2PMHA 4DIQA 3K70C 3CXPA 5EYRA 5J8CA 1IAWA 5IT9Z 2COBA 5EEHA 1UELB 3D5RC 3MKWB 1YJNI 4ZYDA 1YW8A 3D67A 1SFKA 5E1ZB 4A3GJ 1B59A 3CESA 3PEIA 3TE4A 1WFXA 4AG7A 3C26A 4CCMA 3EQLF 1POGA 3PL8A 2HKOA 4ESJA 1HLVA 4GCVA 3AG3H 2XASA 2V9KA 3S1QJ 2KIQA 3G3SA 1M4LA 4B11A 2ZW4A 4ZYGA 4KIGA 2Q4VA 2L0KA 4II2A 4M6HA 2AO9A 3VYRB 1ZTRA 1ITYA 4AG9A 3F5BA 4C3IJ 2GAUA 4G6TB 3DR6A 2PQ8A 3VSLA 2D1VA 3OV8A 3CCEI 1ZARA 1TNTA 1A6QA 2XAJA 3JRHA 1ZAOA 1WVMA 5B1BH 1MBJA 2X85A 3QP6A 1XGMA 3KASA 2F2EA 1HKSA 2CTBA 4XKCA 2WPXA 2H5MA 3KETA 4JJXA 2EIMH 4C9RA 1LE8A 4M85A 4D5FA 3ZMTA 3E6DA 1V54H 3GBGA 3OL3A 4M3DA 5BNGA 4B8XA 2MH2A 1X10A 4UA3A 3NEUA 2V1XA 1ETOA 4KYWA 4A94A 3BR0A 4NB5A 2VXKA 3SJXA 3ESWB 5J1RA 3T8WA 2D5VA 5JHUA 1BM9A 2E34A 2VT3A 4RGUA 2W24A 2ZEFA 4L8AA 1ZL0A 4L9TA 4WXDA 2RQPA 4JVOA 4R6TA 2OC6A 1KQ9A 4WXCA 3F23A 1TWGJ 3B02A 2DPSA 2HYJA 2DO7A 4D7MA 3CT9A 3W2WA 5AIQA 3HKZA 2FQ3A 3G1LA 2V8DA 1WH7A 3I54A 3K6GA 9ANTA 4NC7A 2VI7A 1IDYA 1FLIA 4CDJA 3HSFA 5DDGA 4UCMA 4KA4A 4BHBA 3QOPA 1VQ5I 3G73A 2FSRA 4BACA 1RXTA 1X3WB 2DA3A 2M9HA 3B6AA 1JHFA 1J59A 2HC9A 2M87A 3HHHA 2OOTA 3PGPA 3FDYA 4AIKA 3M1EA 1MJ9A 1Z8WA 4E4HA 2Z3PA 4E0AA 1VI4A 2R0QC 2EPFA 3F21A 3MVPA 4H2KA 1V4RA 1B8IB 3BI1A 2ISYA 1ZYRF 2I8DA 1KC7A 3HRTA 3JRIA 4HQMA 2P0WA 4W1UA 3CCSI 2FQ4A 5LYFA 2YX4A 4XLCA 2JPBA 4R1HA 4WJBA 4Y4RA 3AL0C 2WB1A 2FEZA 1Z5RA 3SHFA 2YU9J 1ZQ3P 1N71A 3SI1A 2VOOA 2JDCA 3JRGA 1JUSA 3PBEA 1Z4EA 4KIFA 2NSMA 2EK8A 4DZJA 1JHHA 2MLGA 2PMZN 4IL6C 4KICA 1NSAA 3BTJA 4UVAA 1U8BA 3ZMDA 3LSIA 2P5KA 1PUEE 1KYZA 1I6HJ 1X3ZB 5FD6A 3DU6A 1Z8LA 3TLGB 4MHNA 5BS6A 2VQLA 3IUOA 2V6EA 1V5EA 3KLOA 5AG5A 1YIOA 3FIWA 1Y56A 3WU1B 1DP7P 2QSHX 4BE0A 3CXQA 2ELKA 2XPUA 4DUKA 4X3RA 4NFRA 2RN7A 4OIWA 1ZREA 5GP9A 2HB6A 2IMOA 4KVXA 4XNHC 1P7IA 2ZXHA 4B3XA 3DLLF 2ZJPF 2FL4A 4CS0B 2X0SA 2W25A 5DWMA 3HG9A 4C9VA 4L0YB 1Z91A 1FSHA 1UG0A 1LPQA 5IX3A 3D4UA 2PN6A 1IICA 4MFDA 4G12A 1W7PA 3OOUA 1JDBC 4U87A 1AOYA 4A3JJ 1JWQA 3BCAA 5BMZA 5JR3A 2RV8A 5FLMJ 2J5OA 2VL8A 3QYBA 2IGOA 4ZY0A 2Q0OA 1EH6A 3RO0A 1Z9CA 2E35A 5D4RA 2PIZA 2DA7A 2PJ0A 4HRIA 4IOAF 3HB9A 3QU3A 4M3GA 3OYHA 2Z1DA 2ISZA 1YQEA 3O6BB 3EXNA 4JXRA 3S9MA 2W57A 1CE8B 5H6QA 1U5TB 5L3CA 3KLNA 4NUBA 3Q0UA 4RMNA 1JTYA 4Y17A 4B48A 4R57A 1WJAA 3L2CA 2G7HA 2GLOA 1C3OB 1LVKA 2JDDA 2PFBA 3S3NA 5CVVA 5GCNA 2M1BA 1Y6IA 4NBQA 3VEPA 4EVIA 3SJMA 4UEZA 2K4JA 5TRDA 1QO0D 4IHVA 2DT5A 1I21A 1VQLI 2FOKA 4CZ1A 3BG5A 3QPLA 3VARA 4KZTA 3IRQA 1PUAA 5EF6A 4KOUA 5CVJA 1C0WA 1TT5B 3FF3A 2AS5F 4KVOE 1D5VA 1Z0XA 4GGGA 2D1HA 2CU7A 2L9NA 4QIWN 1QZEA 2UZKA 1H0MA 1RZ4A 2LY9A 2OU2A 1T08B 1XOVA 2R8VA 2REEA 2OLSA 2RB7A 1GVDA 5IYDJ 2DBBA 3L9FA 3MN2A 2VLAA 2X1EA 1OYWA 4NGMA 1JQGA 2EFQA 1S7AA 3LSHA 2VKEA 5LGTA 1P92A 3OOPA 3RDIA 3ZN0A 3FMCA 3FJUA 2Z9OA 3CJTB 3PQKA 4IKFA 2EJRA 3CP2A 2CUFA 4KSFA 3IKVA 5J1QA 3DF8A 2ZC2A 3PSFA 2K86A 5JM6A 1ETKA 2AXTC 1SFXA 3KFWX 5BQTA 1OMIA 4C30A 2HUZA 3KQZA 4MI4A 2AHQA 4RAYA 2WPWA 3DBRB 1R36A 4HSRA 4KIBA 3S8PA 2L9RA 5HLGA 1JKOC 1M1DA 1H9TA 1CP7A 2B7EA 3OYFA 4IX7A 1Y8QB 3FK7A 4I2OA 1Q5XA 3BLNA 2B5GA 4MCRA 3CUQA 2RAEA 2GLFA 2ZEEA 2LVSA 5F27A 4EJOA 4ZJZA 1XF8A 4DGWB 1MMGA 4IHYA 3OYDA 1LDJA 2XRNA 4YIRX 3Q5FA 1P4AA 3GZ5A 4BBSJ 3SXOA 1JDEA 1UJ8A 2VOPA 3QOEA 4RB0A 4A3BJ 4O6JA 2X9DA 5CVIA 3TP3A 3JTGA 3CTAA 2VI6A 2ARHA 1R1VA 2DT7B 1HCRA 1OCZH 2HOEA 4DJLA 4HX4A 5DWNA 2IA1A 4MIMA 4E7IA 2PSWA 4L5IA 2EH3A 3ML6A 4A3KJ 2CMPA 3I59A 1EZAA 1ZYMA 5K99A 3HHGA 2QQ8A 1NK2P 4OWRB 2BVMA 1F4KA 1M4GA 3O3KA 3LODA 3I64A 3BJ8A 1BOBA 1MW7A 3O8GA 2CO5A 4CYNA 3BY6A 4BQOA 2NVTJ 2LC2A 4A3FJ 2JK3A 4CDGA 1T36B 4JLYA 2NVQJ 5CPRB 2EK5A 3JCUC 1EJ9A 1G3TA 2JQ7A 2RFHA 4U9YA 2M30A 1ZRFA 4P4IA 2HQ5A 4KLVA 4C7HA 1WRJA 4UXNA 3B3WA 1KA8A 4FISA 1FNNA 4EEFG 1Z7UA 1W5CC 4B47A 1K4SA 5HXDA 1NBWA 2Q8KA 1YX0A 1SVMA 2BHYA 2P6SA 4BY7J 3FK6A 3IH3A 4XBFA 4AD9A 4ONWA 4A2ZA 2VXZA 3BJ6A 3MZYA 4C3JJ 1E3OC 2Q2EB 4B14A 3WU0A 1GT0C 1E3PA 3DWLE 2BW3B 4XOPA 3CZXA 2GXBA 5JVGF 2KDOA 4DZPA 5H86A 2DMQA 4C8FA 1I27A 2ZMEA 4HNYB 3IKTA 1S3ZA 2E1NA 3CUQC 2BUEA 1V6CA 2DN0A 4UVBA 2DDAA 2EBJA 2F8HA 3M8FA 3V7SA 4NQWA 3K4KA 3S6HA 2R82A 3CMMA 4COBA 3FVLA 5GTIC 4YFNF 4F3QA 1TF8A 2DXQA 2NNYA 3K70D 1E3HA 1LANA 2V79A 1STZA 4ZGYB 2XC7A 1GHCA 2VN2A 1BIBA 2ZOGA 1OZPA 4HEA2 5ICCA 1IRZA 5LFAA 4A3IJ 4CCOA 5LD2C 1DQUA 3N97A 2HI6A 2EA4A 1LJ9A 4XLEA 1O4XA 2XB5A 5M5YJ 4PGHA 3JTHA 2F4IA 2HWGA 1J75A 1WCMJ 2HQYA 4D9JA 3H0GJ 3HGGA 4DYRA 1YHQI 3VH9A 5D6EA 3T5XA 1Z77A 4RAGA 4BYYA 4C8TA 3HSRA 1IIDA 2VUMJ 2X0LA 4CGZA 2PJRB 3AG1H 2XAFA 1EZBA 4CZCA 4HV5A 4KUMA 1XE4A 1YR0A 3DCFA 3KP5A 2OPTA 1HW1A 3RSNA 4KFCA 1VHEA 3JVNA 2QVPA 3R9FA 4D1QA 4KOTA 5H6RA 3SYTA 1VQPI 1CQTA 2XF6A 3FXUA 1IC8A 1R6RA 3OMYA 4H1HA 3I6SA 2C6PA 4MJXA 2H94A 3M8EA 3RPUA 3HL2A 2K5TA 3G23A 3S1NJ 5KTDA 1ETVA 5E18F 1VIXA 3K2KA 3K2AA 3ZRGA 3ONQA 4WF2A 5HS8A 4UVCA 4CXFA 5ICFA 1R1UA 3V38A 3KIOA 4Z2YA 2ZMEC 3B3TA 3D2PA 3D7GA 2CY2A 3UY5A 4ZYHA 5G22A 5A2QK 3GKRA 1RI7A 4M6VA 2DU9A 2B58A 1VZ0A 3IWZA 1G3WA 4M9XA 2A5WA 2ACJA 1SVLA 2LFBA 5D4SA 2B0LA 3GXOA 3V4GA 4HDUA 1JKRC 1TKJA 3P5JA 1DP3A 4MHYA 1ZG9A 3SFIA 1IXCA 1ETQA 3LQRA 2LREA 5KCMA 5JLWA 2F5CA 3SQNA 1T0FA 3OIOA 2QBYA 2PE3A 2DOEA 4FE7A 4QBJA 2ID6A 5DV5A 5F0CA 1ZGWA 1ODDA 3VWEA 3HOYJ 2R7HA 2VZYA 4U5YA 2TDXA 2DK5A 3P9KA 4JX5A 4XONA 2DOAA 4P4FA 1ZGJA 3ISPA 4IEJA 2HDWA 3AL0B 4XN3A 3MRUA 1WHUA 4ZZLA 2LY1A 1IRXA 4HNUA 4OAZA 1FJLA 2XDVA 1LE8B 4XLFA 2CG4A 4FAIA 4BEHA 5F47A 3GFIA 4HV6A 3PB9X 3PO2J 4X5KA 5C44J 2HTJA 2Z3MA 4LUAA 2Z99A 1U2WA 5DD4A 1U6MA 1ON0A 1BW5A 2WB1N 3D68A 4JD6A 1O57A 2Z3KA 3LSJA 3ZZIA 4UV9A 3LSMA 3ZQIA 4E7LA 2KISA 2WY7Q 2OAZA 2P6GA 2E7XA 1FPQA 3CCJI 1X2MA 3JTKA 3KRVA 5H84A 5HLTA 1WH5A 3S6FA 1BA5A 2Q7BA 5C4JJ 2EQRA 1HW2A 1NE9A 4R8FA 4XNHB 2F4OB 4KN7X 1P0HA 3E0JB 3G4SI 3CMAI 3EUAA 3QWLA 2QSGX 3QPHA 1FYLA 3PNTA 4A93J 3K4JA 2Z3LA 4WX9A 3ZMZA 2PMZA 1GLNA 3K4BA 2Y75A 2OR4A 4BDZA 2XUBA 1Y0YA 2PR1A 2VE9A 3IJ3A 1JTXA 1YOVB 2HXIA 3WHBA 3KZIC 3CCYA 1W1WE 2HXOA 3L1PA 1CJWA 5E96A 4F8ZA 4C8CA 1KQ0A 2Y69H 1T0FC 1M4IA 4O23A 4IPAA 2CRGA 5AG6A 4P1WA 2M8GX 2L7KA 4MFLA 2OQRA 3KYDB 3SZTA 1VFCA 1FT7A 4EGYA 3FISA 1P4NA 1OQYA 2QZ8A 5G1ZA 5AG4A 1FC3A 1ENHA 3SXNA 1IYLA 3K4MA 3OWCA 2CUZA 1SAUA 1YRNA 3KHZA 2XAGA 4MRIA 4OINF 4MTDA 3AG4H 5I0CA 1ETWA 4ETSA 1FOYA 1BI3A 1P7JA 1SFOJ 2PJCA 1WJBA 5J3LA 5LGUA 1RETA 4U7DA 1YTYA 3PB7X 2O0YA 2WUUA 2A05A 2IS1A 5DCFA 2BVLA 5HOOA 2GU2A 4J00A 2ZEPA 1J9IA 1RIOH 3N7ZA 4RGRA 4ANJA 1MK4A 2ELJA 3OSFA 5HNHA 2E1OA 2VEZA 2HEOA 2HNHA 1BN5A 4AB7A 2FU4A 1HEEA 1HKTA 4MFEA 1SD6A 2QM3A 5DEQA 1WI3A 1X1CA 4UFWA 1R58A 3BTLA 3PBBA 5FB2A 5B3SH 3KZZA 3SXYA 3LFKA 4DJAA 2GM4A 4F0YA 1IU8A 4G7OF 2DFHA 2JVGA 4UIAA 1ZG8A 3DEUA 4P96A 2JRTA 2M34A 1W0UA 1TF9A 3IAS2 3VYSB 2V8VA 1LFBA 1R1TA 3F72A 3JW4A 1P4XA 1TWFJ 2OCCH 3Q9VA 4H6ZA 1W4MA 1Y9WA 4ZX8A 2Q1ZB 3SI2A 3RYOA 2MD5A 4XKBA 4PQAA 1KBLA 1R4MB 1BR4A 2GZWA 1B9NA 5D8KB 3KPHA 4AVPA 3OIPA 2LF7A 3NE7A 2GIVA 4MHZA 1W7PB 3T8TA 5E79C 5FKOA 4A38A 2ZEOA 2D0OA 1Y0UA 4MTEA 3VODA 2FCKA 4P4EA 2C27A 3MKLA 2GBYA 4II3A 3DPUA 4GXOA 2JEVA 3KI9A 4KOSA 4CCNA 1HQCA 2F48A 2ICWG 4Q47A 3WU2C 3ABMH 3ZMSA 3LL7A 3I56I 2JT1A 5FD8A 2PX9A 5JFRA 4RDUA 4X0GA 3HZJA 4CYQA 2I00A 3MMYB 4IRHA 1W7PD 2JRMA 3HIFA 3EYYA 1TC3C 1Y7RA 3K2ZA 3HLPA 4U0WA 4UHTA 2NXNB 3ABTA 4OLLA 5JI6A 3MGDA 2VKVA 2JSCA 2JMWA 1TWAJ 1EH7A 3OY9A 2VPLA 3SJEA 2DAOA 4M6YA 4M73A 2Z5UA 3S14J 4MY0A 2MW8A 4UWJA 1ZG3A 1H9GA 2F4MB 2VXDA 3AAFA 2ZFWA 3CDLA 2Z16A 4MGRA 4EMSA 1XMBA 3FEEA 1RTQA 4HW0A 1XMAA 1ZR4A 2RNGA 5J8FA 1HDDC 3FKIJ 4EM2A 1VQ7I 2WA0A 2DJIA 3E7LA 2BEOA 5LHGA 4AVZA 2Y9ZA 4KJZA 2Q4YA 1I1SA 2V26A 4M3BA 1U8RA 1Y8RB 3GTKJ 3U1BA 4S04A 1I12A 4K30A 1CPXA 4OC3A 3OYGA 3HOTA 4C85A 3E1SA 2K3PA 5LEKA 1YLOA 2L54A 3PP9A 2R7RA 4PDKA 5FLXZ 3EPZA 2YR2A 3BROA 5J1UA 4TJVA 2I3CA 3EO4A 1SEUA 2BXYA 3RI4A 4ZC3A 3W6JB 3CJRB 3EUHA 1AKHA 4F93B 3TW7A 1RO5A 4MMOA 2O6GE 3JRUA 1Z7LA 2QWWA 2CQNA 2IA2A 3H3VK 2D0PA 1UHWA 1MBGA 1JXSA 3AKZA 4C2TA 5ELYA 1WJDA 4UB6C 1JT0A 2KIFA 3W6XA 3LA3A 1H8LA 1ZLKA 4PUSA 3L2VA 1T98A 3H5RA 1S7OA 4FD5A 2DFIA 3E6MA 1K7AA 2IEKA 3HOSA 2EZLA 5M3FJ 1YGHA 3VTAA 3PUBA 4X6AJ 3TTHA 1JUMA 1JKQC 5K5QA 3LWUA 4BINA 4YEJA 2CYYA 1OCCH 2H6CA 2OA4A 3IH4A 4NGTA 2G3AA 2XSDC 3COAC 1ZR2A 2JA5J 4XIDA 2B5GB 4QC6A 2JSPA 3PRTA 4FD7A 4EWTA 3CUQB 3J81K 2CNTA 5D29A 2XV4S 5F09A 4XN0A 3D1NI 2XGDA 2QQBA 3ASOH 1SFUA 4WWVA 3IV5A 1YMEA 3CDIA 4QVTA 1WPKA 3LD2A 1TT0A 2B63J 1BBYA 2X48A 2BYVE 4CGLA 2H6BA 2A6TA 3IH2A 1L0CA 1BR2A 3TL4X 3JSPA 2NRAC 2B9SA 1OLTA 2JZYA 2Z0ZA 1ELMP 3WABA 1LUJB 1X58A 1XMKA 2HZTA 4CGNA 3OYMA 3FXKA 3I59B 4J3GA 5F48A 4MHGA 3OL4A 2AXLA 5J6XA 2A6HF 4G6QA 3WTVC 3KR4A 4PXCA 2LH9A 2LTPA 4LMYA 4MXUA 4JX6A 2IL4A 1FYKA 1VF9A 2BY1A 2L4AA 2XKOA 2HPMA 2W84A 2X6XA 1F2OA 2BEIA 2LRDA 3U21A 1YITI 2VJ4A 4XMYA 4LJZF 3EUHC 4DNCA 1ACIA 2M7BA 3EFAA 5CKTA 3PJRA 5AONA 1BPNA 2B3UA 5LLQA 4KOVA 3GO5A 2XB0X 2XAUA 3E6BA 2EA2A 1PUFA 1ZO0A 2Y30A 4CRYB 3M3YJ 1TW2A 1T6SA 3PFYA 3SFZA 5HS9A 5K7ZA 3I55I 4M9SA 1J0RA 1ZGAA 4BHCA 3CCQI 2E2JJ 1DPUA 5E3MA 1Y0RA 5EEAA 5JYBA 3D5LA 3ZCOA 5H20A 4MQVA 4C2UA 1G6NA 2C6CA 3E5UA 2FS5A 2ZMEB 4PFOA 3V42A 3VOEA 2C6YA 5HVHA 4G9YA 5F04A 4CSWA 1IOFA 4L5EA 3KEOA 5IT9K 5IOZA 1SMTA 3R0JA 4NQWB 3LMMA 1DU6A 2A3SA 4RM3A 2DTZA 5EG0A 1IXSB 2EV6A 2F5IA 3GLJA 3R9EA 4M74A 4RB1A 2HVSA 3DPLC 3DQVC 5IP6A 4MEXF 2EIJH 2M7AA 2QIRA 1MD0A 5DM6F 1RC9A 2DW4A 4C9UA 1BI2A 5HDGA 2KDZA 4GYGA 5LBQA 1VKCA 3GW2A 1BAVA 2CQXA 1HSJA 3FM3A 5K1YA 2K9NA 2JA8J 4HNXB 4Q36A 4CYOA 3F9KA 4OP4A 3ZQHA 1OCRH 1VQKI 2HOTA 4A33A 3Q3SA 4IIYA 2P6EA 4OADA 4ZYAA 4G6DA 2HGCA 4HOBA 2DA1A 4M3FA 1OYIA 4U0VA 3VB2A 1MH3A 1TWCJ 4E7HA 3H1CA 3DP7A 4BAYA 1QMUA 4F9VA 4ABZA 2CJJA 2BY0A 2CSOA 5CPAA 2N8GA 2XVCA 3MD2A 4G7ZF 1KGSA 3C2HA 2K9LA 3GUXA 3LWFA 4CDKA 4KN4X 4PSXA 2HWVA 3G8WA 1GYTA 4CAXA 2Y0SN 3D7FA 4Q38A 2DJNA 3ZGKA 1FBUA 4A31A 1RR8C 1Z9UA 2PJ8A 4C8UA 1XGNA 3KP6A 3MAJA 1G3YA 1A35A 2BY3A 3NAUA 3FB3A 2LR8A 3K69A 2I5UA 3ZP5A 3TO7A 3DTIA 3KKWA 3PNYA 4A0ZA 2P5LC 1V55H 1MH4A 4E7KA 3BC8A 2HV2A 4R7MA 1NMTA 4BH9A 3G6EI 1FSEA 2DDBA 2GIZA 3T0TA 3KGQA 4KVME 4YG2F 1G4DA 4HSTA 5F46A 3RPUD 1TQIA 2HZDA 2VJIA 2NYXA 4E7SA 1I5ZA 4XQFA 2NVXJ 1IG7A 2M0MA 1CG2A 2BCOA 2PJ1A 3IFEA 1J7KA 3D5SC 4KORA 3TT2A 4XRSA 1QSNA 4B5OA 6CPAA 4BKXA 4ESFA 1E2XA 1HDQA 2QBYB 1FEXA 1LAMA 5K8NA 2O9LA 2KIUA 3ABLH 3H9QA 2H1LA 3CC2I 3CMEI 3F0AA 3MKYB 2DCEA 2JWTA 5IT3A 2I10A 3T9YA 3FXQA 2FXAA 2K9MA 2GA1A 3S3MA 1LFUP 3JAMK 2X1DA 5FGMA 2E1MC 3N4MA 5EBVA 5HDNA 2LG4A 4YFXF 3BHXA 4H4KC 4I99C 3TDUC 1PJRA 5ILVA 1K79A 1WZ2A 4EMEA 1KEEB 1C30B 2RC4A 4BD9A 1ZKGA 4BEHB 1O3QA 1ORKA 4NJQA 1VBGA 3HRSA 4B13A 4DW6A 4F9UA 3ECOA 4BU2A 4RAFA 4GXHA 4HG2A 3DKWA 3H9JA 4FT8A 4EQQA 3HOWJ 1QQIA 2IA0A 2LK2A 2DA4A 1YW6A 3PFEA 3GTLJ 1PU9A 2GREA 4X1EA 3HC7A 1HF0A 4IXAA 3A0HC 1SFEA 1UAAA 2OTJI 4PPZA 4HQEA 1QPIA 1MBKA 1GUUA 4P4DA 1WSUA 2QYVA 1OBRA 5EZGA 5KTAA 3PIOF 3KHXA 2CQQA 2V1UA 1XEBA 3CCVI 4E94A 3H5ZA 3OYIA 3ZMUA 5JH9A 3F6VA 2PVWA 1XG1A 2I79A 1UFHA 2AUMA 1X4OA 3MWMA 2B4DA 1U3EM 1S7KA 1YX5A 3TC8A 2XEIA 4Z6YA 1BC7C 3W91A 5LHIA 3TX8A 3BG7A 2A07F 3IWEA 1MSEC 2P7CB 2K27A 3H5NA 3I4PA 4A2UA 4BXUA 4C86A 2OD5A 4FE4A 4I0BA 4PGGA 4IVNA 4Y3OA 3G71I 1J4JA 4G1PA 4OKOA 4C2ZA 2L9SA 5LRRA 4ENJA 1WI9A 4A39A 4R87A 3F8KA 4TNUA 4XM3A 2KFDA 3GIUA 2KL4A 1YRNB 1RESA 1Q2YA 1PYVA 1W5SA 4OOIA 3TKYA 5D5WB 3G2BA 4PXEA 3WR7A 2M2EA 3LNQA 5I4MA 1QA6A 3W6KB 4EM0B 2VJ5A 1RR7A 2IPQX 2GP4A 4K2EA 3BCBA 4CCJA 1QZZA 2JA2A 2LMDA 3VWDA 3FF5A 2NMTA 2ZENA 2E2IJ 4MI1A 3GLLA 2PRBA 4P6YA 2WWYA 2IJZA 4XPKA 1XIXA 1FMVA 3WHCA 2DLLA 3H5AA 1BJAA 3M9AA 4PK4A 2G7UA 3OYBA 1QSRA 4HKFA 1FX7A 4I0AA 4JK1X 4UWIA 4PXDA 2WYRA 2LF8A 2V7FA 1IO2A 3KR5A 1YS6A 2NOGA 3TBIA 3RAMA 2WY8Q 1TIQA 4RB3C 4NHJA 4IHWA 3TW6A 3LSRA 1PCAA 2LBFA 2O3FA 3KZWA 4BDYA 1YREA 4GRIA 3HSEA 1W36C 1XB4A 4TJXA 4CO8A 3VSKA 2FIWA 3S93A 3PFOA 3L2NA 4X8IA 3ZJ0A 4AVAA 4IAVA 5E3NA 2F6CA 2W48A 4KSIA 2DQLA 4LFUA 1B72A 1Z8TA 2KHMA 3K9TA 1BL0A 3E97A 2KPMA 2PG4A 3RIRA 3PFIA 2ZXIA 3HOVJ 2ZEMA 1R3NA 3NH8A 2L02A 2KMUA 1SD7A 1E0EA 1V3FA 1HDPA 3CJQB 3LAPA 3SZGA 5EC4A 3GUDA 3K4CA 4R76A 1DIKA 3PSIA 1PP8F 2V9PA 4U7BA 2IS4A 4IHTA 1VQ6I 5KVRA 1VBHA 2NYQA 3FXTA 1JUPA 2EWBA 2M45A 3K10A 4UUSA 5IP9J 1BW6A 4ONUA 5F0FA 2GQQA 2R7DA 3BLYA 3FNCA 4MY3A 4AU7A 4E8OA 4X2TA 3OR1C 1UWYA 2YGWA 4HZFA 3I1UA 1WKMA 3F6OA 1DGRM 3J7ZI 4NSQA 2QQAA 3PZJA 3HUGA 4Y15A 3NWSA 3F8NA 3NQOA 2JBKA 4BJ6C 1IW7F 3UNGC 3LAJA 4PXBA 2AUNA 1KUVA 1BOAA 5IPAA 1GGOA 2VQYA 3S2WA 3CXSA 3SEQA 2DMUA 2IVMA 3KEQA 2V8GA 1M6VB 2L9VA 3BDDA 1S5LC 1KWMA 2MC4A 2O03A 2FIAA 1LFWA 3A9LA 3S9LA 2L7MP 1MBHA 1GDTA 1QU3A 2GXAA 5GPCA 1A04A 4RLFA 4WCGA 4BQAA 4A3LJ 3WGHA 2IP2A 3T0YA 4H6UA 1D0ZA 2KZGA 2MGQA 3W2VA 3J7AY 1AKHB 4M6IA 4JXQA 5CJ9A 2Q51A 3DR8A 2XAHA 3ZR8X 3GWZA 3DDDA 2FBIA 1R5GA 4XNFA 3ZPLA 1XJOA 1IJWC 2R4GA 2ZO4A 2L4MA 1KYWA 3OS2A 1OISA 1GV2A 4LGWA 1XMXA 1R5ID 1UMQA 1RKWA 1V0CA 1Z6RA 3WTXC 4OC0A 3S6KA 1R61A 2G3TA 4GFBA 3I3LA 1YVKA 2HI3A 3CCRI 1J3LA 3OR2C 2LYCA 1TXRA 2IW5A 3TGNA 2OZUA 3AG2H 2D45A 2R5YA 4CO9A 1UHSA 1ZLJA 4OIRF 3EY5A 1KZHA 1JJ6C 2OJED 4NDLA 5JHFA 4FCYA 1R9TJ 4YFJA 1BI1A 1N25A 2M3AA 3IRRA 3K9UA 4UCNA 3OIQA 4AM3A 4FQGA 1DU0A 5IYCJ 1QZYA 1MJAA 3LSGA 5E3OA 5EGOA 4KLWA 4Q7AA 4E70A 1YQAA 1LRZA 2FBKA 3OS0A 1Z4RA 2LSOA 2HYGD 5DS9A 1BLLE 3IWWA 2D2WA 2EZAA 4C84A 2ESHA 2X4HA 4ZDPA 4UEFA 3EDPA 4I49A 1XC5A 3KZYA 4ZYQA 3RZOJ 3BZKA 4ZY2A 2WC2A 1I6XA 4ZH4F 2YX7A 3BJ7A 4IK2A 2YS9A 3D2MA 2VQCA 3SHPA 2CFXA 2PDOA 3BR2A 2L2OA 4AVCA 3FMRA 3DSBA 1TKHA 4EJWA 3ZQLA 3FH4A 1J2XA 4XKWA 4S05A 1ZRDA 3CO6C 1ELLP 3SZPA 4GM5A 4U9ZA 2GOMA 5JVTA 1G2HA 4IHSA 4Z65A 4HNTA 5K5RA 3ZQCA 1B1BA 1S6LA 3C2BA 1O7LA 2E36A 2R7QA 1XSXA 3QYEA 3RTRA 1Z8XA 4KUBA 3GCMA 2ZW5A 4L0ZB 1I1GA 1WJ5A 5TGTA 1PUFB 1YK3A 5CQEA 4XR6A 4CAWA 3MQ0A 4YRHA 3GB0A 1VTNC 3EZBA 5D5VB 3GVAA 3M8JA 4HPQA 2ECCA 3BQZA 1H8AC 1HOMA 5LGNA 4BQNA 5DYMA 3ABKH 1QPMA 4G7HF 1IRGA 1S7LA 2AFZA 2VBQA 3IC7A 2Z11A 2F5EA 2R98A 5F08A 2XEGA 2P8TA 4P4BA 3LA7A 4C8AA 1KZFA 1YLEA 5GTHC 3J80K 3JRDA 1B9MA 3RJPA 2M4GA 2P81A 1ULYA 4JOMA 1LQ1A 2H1KA 3R96A 1MJBA 2GOXB 1TL8A 4OIQF 1S7NA 5EG0B 5IV0A 2AFUA 4EJVA 2EBIA 2WV0A 2VC0A 4CPAA 3TFYA 4I76A 1DE4C 1JT6A 2Y0SA 2DMTA 5F6FA 3PIPF 1XDUA 1GVJA 2HQAA 4ZTFA 3NFZA 3S3OA 5IYBJ 1A31A 4UEEA 4W9YA 1EH8A 1LNWA 5HS7A 1Z05A 3FWEA 4OMZA 2FE3A 3A03A 2BGCA 1RPWA 3W3CA 5E3LA 1REPC 2H8RA 2E1CA 3V7ZA 4N9HA 1CX8A 4QB9A 2E1MB 2GWRA 2HFHA 2O4HA 3CCLI 1RNLA 1YJWI 2ABZA 2OB0A 4E7ZA 1X1BA 4LLGF 2XF5A 4C3HJ 2ETHA 3QRFF 2X6WA 3E0KA 2QVOA 2XKPA 4F55A 2YPRA 3VPRA 1T33A 5F0HA 4M6GA 5K8PA 3L2UA 4A3EJ 4LQ6A 4OIDA 1V5GA 1RUNA 3V8LA 1TLHB 2XGEA 3D0SA 1MBEA 2E7WA 3IEHA 5IB9A 1FBSA 4M8DA 4QLCU 1Y1VJ 4IO9F 2W85A 1D3YA 2QQ9A 1SC7A 3O2PE 3HYIA 4CAVA 5ED4A 1UG2A 1X12A 4OC4A 2VQHA 1QGPA 4J19A 1VGYA 4EVYA 3FXRA 2EINH 4A69C 3S32A 2IAIA 4PCQA 3WTSC 2FRHA 2OF7A 3DTKA 1QRYA 2YNEA 4NC8A 2ZB9A 4A6EA 4MHPA 3TQNA 3FYNA 2NVUB 4GS4A 2NAZA 3I3GA 5M5WJ 1HA8A 1OKRA 2KP6A 2VBYA 5HNFA 1I50J 1KU3A 4ENMA 3IGRA 4A0YA 2LY2A 3T1BA 5FO5A 1O3RA 1U6GA 4CYPA 5A28A 2HR3A 1XRYA 4D0PA 3QPTA 5KAFC 3S9NA 2L3DA 3TP0A 3H0DA 5G21A 1Q2CA 1ERDA 2FA5A 2LKXA 1R49A 1CPSA 4RM2A 3CF5F 2AE6A 3EC4A 2PCNA 1RKTA 4E5SA 1ZN2A 2CQ7A 3OYKA 1XS9A 4CGPA 1G3SA 1ZELA 4MCPA 1DTDA 2OZGA 3OS1A 4O3MA 1S5KA 3FXJA 2L5QA 2DEAA 4M3SA 3OYLA 1QQ9A 3FKJA 4ZDOA 3PNVA 4UUVA 4L9NA 3FMQA 3IL2A 3T07A 2NOJB 2FVGA 2XROA 2ZXJA 4NGRA 2WBMA 3DPTA 2QCOA 1R4NB 2ZXWH 5KK1A 1R43A 5F1YA 4G94A 1ZLIA 2ECBA 4L9JA 1CBXA 2QJ8A 2R7SA 4OMYA 1K61A 5BOXA 1T39A 3RQIA 4FD6A 1Y1WJ 3F0CA 1XGOA 3CQZJ 4RS8A 3H35A 3WE3A 4A3DJ 2M4KA 2VT2A 3IP4B 2HQRA 2MYSA 2TCTA 1A36A 3S1MJ 5E17F 1F9NA 2XEFA 1QHHD 2MA3A 1J09A 1TBXA 2IQ6A 5M5XJ 4RUHA 3Q9SA 2OH1A 4EYSA 4LK1F 1TQMA 4TWEA 4XORA 4L9VA 3R61A 4H0EA 3ICUA 2JA7J 2NS0A 2E60A 4XSXF 5L3BA 1N75A 2A6EF 4QWQA 3CLQA 4PSWA 5D5UB 1PDNC 3KP7A 1P9QC 2Y31A 3LSPA 3L00A 2IGKA 4PJNA 2VJJA 2HPIA 2OCEA 1MIJA 4U88A 2B4DB 3JREA 3REOA 2IT0A 3SJGA 2EILH 1T38A 4ZY1A 4ORFA 2FSWA 1IN8A 3CJNA 4JBAA 5CLSA 3V8KA 4JWPA 2X51A 2EFPA 3BR5A 3H92A 3JRFA 2Z33A 4F0XA 1Z2LA 4C2MJ 2V4JC 3BTCA 2ME6A 4NF1A 3BWGA 4RGSA 2QGUA 1EE3P 1ONVA 2E2HJ 1S3JA 4ZDLA 4HDVA 4GDFA 2CQKA 1CM0A 2ZEDA 3IAM2 3B73A 1WJFA 5LRSA 2YSRA 4M71A 3TLEA 2G9WA 2IGMA 2VE8A 5LRGA 1GHEA 1X19A 5D5XB 1FY7A 1K6OA 2CXAA 2J8RA 2E28A 2YNCA 4XL9A 3CC7I 2EZHA 2LOOA 3J7YJ 2W00A 3TLCA 2BXZA 4MO7A 3H8FA 3F8BA 3A4CA 2Z3NA 4NGQA 2EWNA 2Z2SB 1WGXA 3B2YA 3LFUA 2K3FA 1OYYA 1UCRA 1QBJA 1Q2DA 1XGSA 1BO4A 1B4AA 3VFZA 4AIJA 2R7XA 1LCPA 5GAHJ 3K1PA 3H36A 4LB6B 4CCLA 1IN6A 1V5FA 5F1JA 5E20A 1ZG1A 1IF1A 3O8HA 2QA4I 2DPUA 2DPDA 1KQ8A 2VZZA 2Z10A 3FIXA 5FKNA 4E7JA 1QHGA 4AXVA 2DYSH 3CDHA 5KAIC 2WV1A 4KT6A 3UR3C 2DA6A 2V9VA 4JZ0A 5LRKA 1NG6A 3U9GA 4CYCA 1FWZA 2LBFB 5HLHA 4IOCF 4ZTJA 1HW5A 2CV0A 1MMSA 1RRJA 3QAHA 5JGFA 2ZCWA 4W97A 5FJ8J 2HU9A 3BOQA 2A4NA 2R7UA 1KU7A 5FLXK 4UFVA 5DUKA 4WWCA 1K4TA 1F43A 2KJCA 2WSAA 3S17J 1SQHA 2R7VA 3ERED 2DMNA 3TLBA 2CFOA 3M1CA 1UHMA 5J40A 2HVRA 1IB1E 5JPHA 4R3LA 1FIPA 2P5VA 3MKZA 2KZVA 3ZQQA 4R79A 3KP4A 2CTCA 4XRFA 4DBQA 5CYVA 1AYEA 2B4BA 4IF5A 5BPDA 4F7ZA 4ASNA 4FETA 3ZN1A 2AFMA 2Y48A 2YUSA 5CVUA 2GFQA 4A37A 1BI0A 5J4VA 2PJ4A 4UV8A 2YNCC 3R60A 3V7RA 1LDKB 3FHZA 4UUSB 3RZAA 2Q0YA 3TCVA 4I09A 4I98B 4HPSA 2XAQA 5DCMA 4HX7A 4XPLA 2J5PA 2BHZA 3MZ8A 1UB9A 2OV7A 2M0CA 1D1CA 3OSGA 3JRAA 3FECA 5B66C 4RS2A 3FZVA 4XKVA 4KT5C 1T95A 3HUGB
chains in the Genus database with same CATH topology
4K3NA 3MCZA 4C9EA 1J5YA 5HVGA 1YLFA 2JPCA 2P7VB 3TO9A 4O5VA 2BBYA 4AWXB 3DLJA 4NGSA 5LEJA 3WGIA 3I74A 2R7FA 1OR7A 2OBPA 3KE2A 4IJAA 4ENNA 1F5TA 5DUIA 5IR2A 1EV7A 2CWEA 4UF4A 3B7IA 5HVFA 1SMYF 1GXQA 2V1DA 3FMSA 3GF2A 3KQXA 4Q48A 2VBWA 3ELKA 3F8MA 3E5XA 4UNOA 4ON0A 2QLZA 2VC1A 4WXHA 4OC5A 2H09A 5DS0A 4KMUX 5AIPA 2M5WA 3PQJA 3K0LA 3R4KA 2ANPA 4XLPF 1IN4A 1LEAA 4MCSA 1MGTA 1USTA 1R23A 2PRQA 5E8GA 2ZNZA 2FMLA 4M9ZA 1HXDA 3CLOA 3FX6A 1Y9ZA 3F3XA 5E1WA 2EFWA 4LG0A 3BPVA 3H8EA 3FX3A 5DD8A 2DQRA 5D8LB 2FF4A 1YS7A 3ISZA 1DPRA 5CBMA 1E17A 3GYHX 3CPXA 2RGVA 3QP5A 3RBUA 1L0OC 2HDCA 3WTZA 1TTYA 1ZG7A 2HKXA 1XSDA 1O7FA 1ZLKA 3P7NA 5K8MA 3CUOA 1NHAA 1X3UA 3H3UA 3NA6A 3CPAA 1IY7A 3HRMA 4CHUA 2PMUA 3BZ6A 3RKWA 3EIFA 4PZJA 4FBEA 4LK0F 3TDZC 3HUVA 3KP3A 3LMSA 3TOBA 1K78A 1MZBA 1ON1A 3JAMZ 1LAPA 2O61A 2EB7A 3DXJF 4B6ZA 2V77A 4XLNF 2XIGA 1Y7EA 2JEWA 3R6SA 4RGXA 3L09A 1YO5C 2KJBA 4N0BA 1DUXC 1S8NA 4MNUA 3QU6A 3BP8A 1FP2A 2QYOA 5F64A 2MH9A 1TKFA 2VONA 2V8HA 3RKYA 3WE2A 1YFHA 2JTVA 4HLYA 3SI0A 4DQ2A 6PAXA 1YYVA 2GXGA 2PJ3A 4NGNA 3MFKA 2PJ5A 1HBXG 2PJ6A 4C9AA 1XN7A 3RYRA 4KMFA 2H27A 4MQ9F 2XGXA 2FNAA 4YIIA 3LQQA 3BXMA 2BV6A 5HDKA 1ZLHA 2F5DA 1YW4A 2C5QA 4WK8F 3I5UA 3IWFA 3HTSB 4G8XA 2AFSA 1FYMA 1IRFA 5L3DA 1RUOA 4HLXA 1Z1DA 3H8GA 1FP1D 1S29A 4I01A 3DFGA 5LYDA 2PJ7A 3QNVA 3RPQA 3L7WA 1P6RA 1R7JA 4JQFA 1IGBA 3V8JA 2UWMA 1JGSA 5K8OA 2C1CA 3DV8A 4A5MA 5F1RA 3D66A 1Z6TA 5E8IA 2VBZA 2V6CA 3PB4X 4Y13A 2IJLA 3BJAA 1IUYA 4HA8A 1IZ1A 2Q43A 3D7DA 1ZH5A 3IIBA 5LRJA 2POKA 4I02A 3MEXA 2ZNYA 5HLIA 4MCQA 5ICEA 3ABUA 5EEGA 1W5TA 1TW3A 1YSJA 2MC3A 4FUUA 4EFDA 1ARLA 4TV7A 3KP2A 3IC1A 3LSTA 1ARMA 4FWUA 4EJTA 2PBIA 3ULQB 2YU3A 7CPAA 4IRGA 4IHMA 4XSZF 3LA2A 4YFKF 4YIFA 2K02A 4LD5A 2UXXA 4ESBA 1CF7A 1HKQA 4P45A 2L01A 1XCBA 3BJOA 4IF4A 5D6FA 1MDMA 3GFLA 2BO9A 2EFNA 3CO7C 4EM1A 3J7AO 4FHTA 2J9AA 2PJ2A 4BNCA 1HDUA 4HF1A 3ROUA 3WG9A 2R3SA 3WTTC 1SD4A 2VL1A 4NGPA 3NH5A 4C8PA 2CIJA 4Q5SF 3WT4A 2HTSA 1XCVA 2NNNA 4OU0A 4ZZDA 4P4JA 4EJUA 4YWYA 3I0TA 4P55A 3GZ6A 3B3VA 2ELHA 3FM5A 2EK9A 2Z3YA 4KNYA 4AIHA 2O8XA 3WODF 4HF0A 2PLYA 2RVCA 5ERIA 1XFOA 5DCMB 4U0YA 1WQ2A 3R0AA 3WTWC 2A5YB 3M7GA 2PIYA 4ZX9A