3K9TA

Crystal structure of putative peptidase (np_348812.1) from clostridium acetobutylicum at 2.37 a resolution
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
435
structure length
422
Chain Sequence
GMEEINKYIQNSSETGGEIYNLIEELFPICRSITGNGVRKTMDIIRKHIPLEIHEVKSGTKVFDWTVPKEWNIKDAYVRNSKGEKVIDFKENNLHVMSYSVPVHKTMTLDELKPYLHTIPGNKDRIPYLTSYYKENWGFSLTQNKFDELCDDDYEVVIDSSLEDGSLTYGEYYIRGELEEEILLTTYTCHPSMCNDNLSGVALITFIAKALSKLKTKYSYRFLFAPETIGSITWLSRNEDKLKNIKMGLVATCVGDAGIKNYKRTKFGDAEIDKIVEKVLMHCGSEYYVADFFPWGSDERQFSSPGINLSVGSLMRSCYGFDGYHTSADNLCYMNKDGLADSYKTYLEVIYTIENNRTYLNLNPKCEPQLGKRGDEFAMFWVLNMSDGKNSLLDIAYKSGMEFRRIKYAADALYRVELLKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative peptidase (NP_348812.1) from CLOSTRIDIUM ACETOBUTYLICUM at 2.37 A resolution
rcsb
molecule keywords putative peptidase
molecule tags Hydrolase
source organism Clostridium acetobutylicum
total genus 139
structure length 422
sequence length 435
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09940 DUF2172 Domain of unknown function (DUF2172)
A PF16221 HTH_47 winged helix-turn-helix
A PF16254 DUF4910 Domain of unknown function (DUF4910)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k9tA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3k9tA01
3.50.30.90 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3k9tA02
3V8JA 3T8RA 2EA4A 4I7HA 1CP6A 2F7VA 2WYRA 3M8EA 2AFWA 1BJAA 1KU3A 4CZZA 1LOKA 1UB9A 2CW0F 4B8XA 1R7JA 4OIDA 3KEOA 1JHFA 2ZENA 3IFEA 2PJPA 1XFOA 3TGNA 2UZKA 2V77A 5CJ9A 3PB6X 2PE3A 4A38A 3DF8A 2JBJA 4EJWA 3G3ZA 3D7DA 3NQOA 1IRFA 3F8NA 1O3QA 2CGPA 3D7GA 3SI1A 4AWXB 1W7PB 2W24A 3WODF 3E5QA 3N97A 2EFPA 1XN7A 1S7AA 2G7UA 1KU2A 3FM5A 3H92A 4KICA 2XAFA 3BI0A 4ZI6A 2OA4A 4XLPF 3O3KA 1BPNA 4JBAA 5LYLA 3SI2A 5HOOA 4R1HA 4RGXA 2EB7A 3CO7C 3V4GA 3D0SA 1CF7A 2FA5A 4TV7A 3O6BB 2M87A 5H6RA 4O5VA 1HKQA 5JGFA 2I3CA 3H3UA 4IRIA 2YSRA 1BOAA 1ZRCA 3SFZA 3GUXA 2XAGA 3QOPA 1ZG3A 5H6QA 3F23A 3REOA 3FH4A 4A5MA 4UXNA 4FHTA 3KHZA 3WC6A 4MRIA 5HVGA 1FYLA 5E1ZB 3WTVC 4HF1A 3BP8A 2ZEPA 3V7ZA 1OKRA 3M8FA 2Z33A 2CWEA 3R60A 2LDUA 4PCQA 2DW4A 1SD5A 2DBBA 3V7CA 1WRJA 1MZBA 5DUKA 3ZMDA 1R23A 5E1XA 1KYWA 1LAMA 5ICCA 1E17A 4UIAA 2ZEMA 2DEAA 1I27A 2V1UA 2ZEFA 3RDIA 4L0ZB 3TO6A 4YIIA 2KIFA 5A2QZ 4H2KA 1LDKB 4QLCU 1PP7U 3ZMVA 1QZYA 5E8GA 3EYYA 1FLIA 4KMFA 3ZN1A 2PJCA 3WU0A 2HB6A 1OPCA 3S9LA 3FM3A 1CBXA 2QVOA 4XSZF 3WTTC 4R79A 5DS0A 3JAMK 4M6XA 1P4WA 5FLXZ 3CUOA 3GFIA 2DTRA 3LA3A 1WKMA 4Q5SF 1FSHA 4P55A 2GAUA 3I1UA 1K7AA 4KDPA 4P4IA 5HDGA 2XUBA 4G7ZF 3DPLC 1IN5A 3TOBA 4F8ZA 3KZWA 2QQBA 1ZHFA 1T39A 2ZEOA 4EWTA 1T2KA 3VFZA 1YIOA 5L3CA 2Y48A 4EGYA 1I6XA 4S04A 1VGYA 3B35A 4LB5A 4FT8A 1BI0A 5LGNA 4OP4A 3V8KA 2PJ3A 3GXOA 2MH9A 1XSVA 4A12A 4LB6B 4HQMA 1TBXA 4WXHA 2QQ9A 4FX0A 5FFZA 2H94A 3J80Z 3ZQ7A 4ESJA 1O3SA 3ZMZA 2V6CA 1JXSA 5HS8A 4W9YA 4ZZLA 4L9JA 4PXCA 5J1QA 3G73A 3HLPA 3BJAA 4EJTA 2C1CA 1Z6TA 1AOYA 1EV7A 1BI1A 5TRDA 4M73A 2MLGA 2E1CA 4L0YB 2PJBA 4R8HA 3T1BA 4R7MA 3V7SA 1S29A 5HS7A 4MTDA 3SXYA 2C6GA 5E8IA 1ZREA 1DTDA 4U0VA 3D7FA 1PUEE 1IRGA 2PFBA 4BHCA 3E6CC 2Q8KA 1U3EM 3H8EA 1ON2A 2C6PA 3KQXA 2V1DA 2ZJ2A 5ILVA 4A6EA 3F6VA 5DD8A 1S6LA 1QZZA 1XCBA 4ENNA 1U8RA 2M1BA 2NNYA 2O61A 2FNPA 3F3XA 2FBHA 3VOEA 2BEOA 3ABUA 3CT9A 3H8GA 2ABZA 4HLYA 1C0WA 3KETA 3CTAA 3TDUC 3FXRA 5EEHA 4HV5A 2LKPA 2LNBA 1J59A 2XEJA 6CPAA 4LG0A 1Z9CA 1R58A 2PJ2A 3MQ0A 1KQ0A 4RB1A 1NHAA 3BJOA 3GLXA 1YSJA 4A6DA 2O03A 4PPZA 2JZYA 1F2OA 3GF2A 1U5TA 4MHPA 1BBYA 1XMKA 2V8HA 3LWFA 4CXFA 2J9AA 3I53A 4G6DA 5FO5A 5HXDA 2IPQX 4EM0B 5LRKA 1G3SA 3TO9A 1YO5C 1FPQA 4E70A 1ODDA 2HR3A 1RTQA 3ZMTA 3M1EA 4IVNA 5D29A 5A2QK 4CICA 5LEJA 1UHWA 2RGVA 5LRRA 2PJ4A 3PB9X 2CG4A 1Q7LA 1TXRA 4NFRA 2K4JA 3PFEA 1FYMA 3JRUA 3K1MA 5LRGA 1JQGA 3J7AO 4A37A 4NGMA 1F9NA 1ULYA 2NRAC 3RYRA 3KZZA 1H9TA 4UNOA 1JHHA 4ON0A 3LWUA 3IWZA 1TQPA 5JVTA 3C1DA 4WWVA 2V8GA 1FSEA 2K7LA 1Z5RA 3CPAA 2GA1A 1R5GA 2D2WA 3B3WA 5BPIA 4MQ9F 2BYVE 2Z99A 3R6SA 3JTHA 4EV0A 1DP7P 3IC1A 5H20A 4BXUA 3JSPA 4LGWA 1CF7B 2L02A 4OIPF 5F6FA 1LVAA 4ZY2A 3C18A 1FYKA 1R3NA 3QNVA 3GZ5A 4RUHA 4Z65A 2ZNZA 2PMHA 4HBLA 1P2FA 2ETHA 5D8LB 5IT9Z 4X8IA 4A94A 3F8CA 1RUOA 4IAVA 1RIOH 1F5TA 1HXDA 2V8VA 3VARA 3GLJA 3KI9A 2CSOA 2VE8A 4PXEA 5E20A 2XAQA 2P6SA 2R7FA 2X4HA 3FMCA 4G7OF 2AS5F 4EJVA 3KP3A 2BCOA 3IWFA 2DT5A 1KA8A 2HYGD 1TW2A 3DGVA 2P5VA 3C7JA 3FVLA 4XSXF 3EQLF 4GXOA 3BDDA 4Q48A 1HW2A 3S2WA 3LA2A 3QU6A 3K9TA 4UVAA 3DXJF 4R76A 2P7CB 1GVJA 1U6GA 3ABTA 4HYEA 2LSOA 4RAZA 1D8JA 3OOPA 2L4AA 5D8NA 3GB0A 1YS7A 2CF4A 3CPXA 2QZ8A 1RI7A 5K8OA 2DAOA 3T0YA 5FD6A 4U0WA 4NGNA 3TOAA 1BAVA 2UXNA 3BZ6A 3F8BA 4PDKA 3E5UA 2QQAA 2CTBA 4P10A 2GREA 1W4MA 2K4BA 2ZOGA 4OMYA 4OC1A 1Z05A 3RYPA 4X2TA 3HHHA 1LEAA 2ZFWA 3Q9SA 5I4MA 4JQFA 1ZG9A 1FBQA 2MBFA 3I4PA 4O3MA 3TDZC 1BLLE 3IHUA 3V7RA 3W6KB 3FMQA 4ZY1A 1ARLA 1QMUA 1IXSB 3KR4A 1T6SA 1U5TC 1FNNA 4P4JA 3JTGA 3PQKA 5L3EA 2OZ6A 4OU0A 3R0AA 4MGRA 2PN6A 2VBYA 3I59B 1WI9A 1K78A 4OOIA 1V4RA 3NFZA 2BOAA 3WC7A 1J9IA 4A0YA 3ECHA 3GW2A 1BI2A 2P4WA 2IJZA 1JGSA 1R1UA 3FMSA 3KP4A 2OQGA 1LAPA 3R61A 4M9SA 2XEFA 2XAJA 4N0BA 1MJBA 3I64A 2HEOA 2TDXA 3I58A 4P6YA 1YW8A 4GGGA 4YIFA 1PYTB 3RAMA 1LCPA 1TF8A 4HX8A 2EWNA 2VT3A 2KKOA 3L7WA 2FMYA 2H6BA 3R4KA 3ULQB 1LQ1A 4HDVA 1MD0A 1I1GA 4UVBA 3FMRA 5IT3A 1ZLKA 3F21A 1LEBA 2G9WA 5BOXA 2VOPA 2XRNA 2FF4A 3GO5A 4UHTA 1CG2A 3HSRA 4UIBA 5J6XA 2A61A 1HW1A 1TKHA 2CIJA 4WF2A 2O53A 2BV6A 1H8LA 2A6EF 4BD9A 4YU9A 3K2ZA 2STWA 1EE3P 5LYDA 4N9HA 3IO1A 4I98B 3BI1A 2FSWA 3F8MA 3QU3A 3ISPA 3SQNA 2FNAA 2WTEA 2VL1A 5BQTA 2NS0A 1BIBA 1B59A 1MGTA 2K27A 4AIJA 2VC0A 2HWVA 1Z8LA 1B6AA 3I71A 5D5WB 5LHGA 4ONWA 4KIGA 5CVIA 4NQWA 3SJFA 3D67A 1A04A 4EM1A 4DQ2A 2Y75A 3ZMUA 1WSUA 4UUVA 1O57A 4CPAA 2OD5A 4RB0A 1RZ4A 4MEXF 3K69A 5IT9K 2GA2A 3F8FA 2AFZA 3FXQA 3QAHA 1FNOA 2V9VA 5DCFA 3T8TA 5LEKA 2A6HF 2M5WA 2PJ0A 2DQLA 3GX4X 1TQIA 1XDSA 3KP2A 2CQKA 5D4RA 5ELYA 4HOBA 1L0OC 1CP7A 3IEHA 4EGZA 3BROA 2KIUA 3ISZA 2POKA 4LG0B 2PJAA 2QVPA 4IPAA 3NH4A 2PJ9A 2E7WA 3C3WA 4CHUA 3ROUA 1D8KA 2Q4ZA 2IA0A 3V38A 3MWMA 5K1YA 2L4MA 3SZTA 2PIZA 3NEUA 5BPDA 3WABA 2YU3A 4A0ZA 2EFOA 1FP2A 3VH9A 4HX4A 2XVCA 2OQRA 1ELLP 2HQRA 5DCMA 1QBJA 5K5OA 3KGQA 2VBZA 1G4DA 3ISXA 1FBSA 3P9IA 1QGPA 1W5SA 1OMIA 3CO6C 2EJRA 2RV8A 3PBEA 2FQ3A 4HQEA 2XEGA 4IK2A 3KL9A 5E17F 2LF8A 5IB9A 2IJLA 3PB7X 1TTYA 2O6GE 2HKOA 4ZX9A 1XD7A 3EDPA 2AFXA 3L00A 2OOTA 3IRQA 4GCVA 4FX4A 2HGCA 1STZA 4L9TA 2L01A 2JEWA 2AFSA 3CJNA 2B0LA 3FWEA 3GZ6A 3NH5A 1YQAA 2RKHA 3BOQA 4M9ZA 4MEYF 1CPXA 1OYYA 4Y15A 4RAYA 4ENKA 5K8PA 1OYWA 2VT2A 1MDMA 2AFMA 3RBUA 4P45A 4UEZA 2WC2A 1TQMA 4HAMA 1SMTA 4K3NA 4XRFA 5BS6A 1J0RA 4RGSA 2P5KA 2QBYB 1ZG7A 2PJ5A 1KU9A 1ZLHA 4ZZDA 2Q43A 2EV0A 4UV9A 3LMSA 1D3YA 3J81Z 4UEEA 2G9DA 2EK8A 1XJOA 3KQZA 4JYWA 3GWZA 3FF3A 2BO9A 2ZCWA 3MZHA 4PGHA 4KA4A 1FY7A 3QRFF 4BYYA 4F9UA 3K2KA 3D4UA 4P9UA 1XGNA 5DYMA 3F72A 5CVJA 4U88A 4CO8A 5LLQA 3DP7A 4G8XA 5LRSA 2ISZA 1ZRFA 5D5VB 2NYXA 5ERIA 4HX7A 4LK1F 2D45A 3IL2A 1W7PA 2YR2A 3ZP5A 3BHXA 3B02A 2BE5F 4L9VA 1P4XA 3FEEA 1BIAA 1YW9A 1ZARA 1Y0UA 3RKYA 1WQ2A 4ZYGA 1FOKA 2ZMEA 3O2PE 4O6JA 2HQNA 4P96A 3GYHX 2G7HA 4WXDA 1LFWA 3FHZA 4ZH4F 1IAWA 3EYIA 1BM9A 2BGCA 2MD5A 1R22A 2HOEA 4ZX8A 3DQVC 4LK0F 2ISYA 4F9VA 2W25A 4HF0A 1K79A 4YFNF 3FZVA 4P44A 1FX7A 5LRJA 3U1DA 3LFKA 3RI4A 3LA7A 5ED4A 1FZPB 4OC3A 1GXPA 2JTVA 2DK5A 1ZG5A 2MLKA 3HRMA 1HQCA 2X0LA 2DLLA 1H9GA 4AVPA 4RGUA 4ZYQA 1V3FA 4HLXA 4XLNF 2XGXA 1HKSA 2DO7A 5L3BA 3KP5A 3D5LA 2Z9OA 3K1NA 2Q2EA 3E6BA 2W85A 4UEFA 1IXCA 5ICEA 3H3ZA 3ERED 3HRSA 1BC7C 1Z6RA 2PJ8A 2XKPA 3ZN0A 2VBWA 3HOTA 4MTEA 1O7LA 1O3TA 4OIWA 3JW4A 2WV0A 1TF9A 1SD6A 5FFXA 3FF5A 3E6MA 3RPQA 4OMZA 2KJCA 3TQNA 3L2CA 3HRTA 5KVRA 4P5OA 3I54A 5LYIA 2JRTA 4L5IA 2PIYA 3WG9A 4NJRA 2RDPA 2YPRA 1HW5A 3QPHA 4YG2F 4I01A 1AMPA 3PB4X 1GHCA 4G7HF 1XBUA 3DKWA 4G9YA 2IMOA 2PBIA 2K86A 4BHBA 1P4AA 4I02A 1YLOA 2QYOA 5FLXK 1UWYA 2EV5A 3E6DA 3GFMA 2ESNA 2ZEEA 1TLHB 2HC9A 1UHMA 3LAPA 1IN4A 1HEEA 3HTSB 3LQQA 1ZGAA 5D6FA 3SJEA 4P4BA 4LLNA 2OAZA 5HLIA 4WJBA 1F2PA 4LLGF 1EH6A 5K8NA 5DEQA 5LGUA 5CBMA 5DDGA 3WGIA 2ADUA 1SFUA 4MCSA 2ZOFA 2FBIA 1HBXG 2JBKA 3R0JA 3EETA 4L5JA 2GQQA 4MHGA 4HF2A 2PLYA 2GXBA 5CPAA 1RUNA 5LYFA 2Q51A 3VODA 4ETSA 1EH7A 2PI0A 2COMA 3J80K 1TKJA 5JR3A 4A5NA 3B3SA 3SZPA 1DPUA 4HA8A 4OMEA 4BAYA 4OC4A 2F8HA 2LF7A 2W84A 3IRRA 4A2UA 1G3YA 3HSFA 4EQQA 2Y0MA 3P7NA 4OC2A 1B9NA 4AIKA 2VONA 4ZYDA 3IIBA 3KEQA 3KZYA 4GYIA 3KP6A 3VB2A 4NB5A 4FWUA 5BMZA 2UWMA 1DUXC 2ANPA 2EFQA 1XB4A 4QWQA 3PFIA 4TNUA 5L3GA 1DE4C 1OBRA 3Q5FA 2GWRA 5JI6A 4BQAA 4U0YA 5F64A 1VIXA 5D5XB 2NNNA 1MJ9A 1ONVA 1ON1A 5HVHA 3LSTA 4NGRA 2GXGA 4PZJA 1H0MA 3MEXA 2DPUA 1B4AA 1LJ9A 3WTYC 2F5EA 2AXLA 1XSDA 1UFMA 1S8NA 1Y7EA 3F6OA 2HFHA 5HVFA 2A69F 4WX9A 2QWWA 3B3VA 3MCZA 3D68A 1AYEA 2PVVA 1YYVA 5THWA 4NGPA 2ZO4A 2D1HA 2ZXJA 4F7ZA 8CPAA 4IHSA 2R3SA 5K8MA 2ZBKA 1IZ1A 4PXDA 1TKFA 3IJ3A 2PRQA 1YW4A 1R43A 4MHZA 5HLGA 4IXAA 4M74A 2NAZA 2QLZA 1XMAA 3SHFA 1PP8F 2F5CA 1IN8A 1MDMB 4GYGA 2KIMA 3QPTA 4FAIA 4NGTA 1RNLA 2PVWA 3L2NA 3HOSA 2EV6A 4OKOA 2O8XA 2VOOA 3IWWA 5HDNA 3NH8A 4KN4X 4LQGA 3HYIA 3WTUC 3N5FA 3WGHA 3FECA 2IP2A 3ELKA 2AFOA 1ZN2A 5E18F 1SFXA 3KCCA 4O23A 4NHJA 3Q9VA 4WK8F 4I2OA 2OZUA 3SI0A 3GFJA 4CYDA 4P9FA 3RPUA 5AIQA 2M30A 1PCAA 2WZNA 2VN2A 4HDUA 1S7OA 2VBXA 4A39A 4KIBA 3CUQA 1XGOA 1IUYA 3AAFA 3KASA 2K02A 3ZMSA 1R1VA 5JM6A 2FBKA 3PB8X 1W5TA 3QP6A 4OIQF 2OR4A 4P4DA 1TW3A 4EMEA 4JK1X 5J8CA 2F5FA 3DV8A 4Q7AA 4N9IA 2P6TA 2E7XA 3ZPLA 3PQJA 4EM2A 3TKYA 4KFCA 3HSEA 1CPSA 3HUVA 1MJAA 2W57A 1YW6A 2ZMEB 4JZ0A 2GIVA 1ZGJA 5JHUA 2DFIA 2HTJA 3B2YA 3D66A 3CDHA 3WC5A 4MHYA 2P8TA 2UXXA 3CLOA 1CGPA 1QPMA 2FE3A 3BWGA 1B1BA 4GM5A 3I0TA 3GFLA 4I09A 2PJ1A 3DFGA 3W6JB 1JE8A 1KWMA 1FBUA 1ZLIA 1VHEA 1LDDA 2MA3A 2PMUA 1OR7A 1P6RA 5ILUA 3GEZA 4ZYHA 3BY6A 3WE2A 3N4MA 1XDUA 5ICFA 4A0XA 4BHPA 4Q47A 3HIFA 3MZYA 2OU2A 3U2RA 5CLSA 2VXZA 2STTA 5CVUA 5DD4A 4NGSA 1U5TB 3OV8A 1WWXA 5EEGA 4MCPA 3KR5A 2GU2A 3WT4A 3RZAA 1GXQA 2Z3YA 3FXUA 4NGQA 4I0AA 2VC1A 5FGMA 1R1TA 4EFDA 2HKXA 4KT5C 4YWYA 4KSIA 3KLOA 1HSTA 4OIOF 2XROA 5D5UB 5HS9A 1IGBA 4OIRF 4OC0A 3L09A 4ESFA 4ASNA 5AIPA 4Y13A 4LD5A 3T8WA 4HZFA 2GLFA 3E3VA 4CDGA 1EH8A 3S9NA 3VEPA 2E1NA 2HZTA 3B7IA 1IY7A 1FT7A 3F22A 4YFXF 1ZRDA 3U9GA 5JH9A 2PG4A 2FMLA 2PCUA 2XEIA 4Q4ZF 2XAHA 1YLFA 5CVRA 2V1XA 3V8LA 1O7FA 5HDKA 3TC8A 5F09A 3GVAA 2ESHA 2L3DA 2MC3A 4LJZF 4Z2YA 3WTWC 2IRFG 1J2XA 2C6CA 1XGMA 4RS8A 1F4KA 2FRHA 4M6YA 3I59A 4XBFA 1LANA 3B3TA 2FVGA 2F2EA 2FEZA 3K0LA 1ZLJA 1YMEA 1TNTA 3RTRA 3DEUA 2M8EA 3KP7A 2DQRA 3FX6A 2P5LC 5LGTA 4IRHA 4LFUA 3IKVA 2ZELA 1T0FA 4IRGA 4R6TA 3CUQC 1BI3A 1USSA 5FB2A 4M71A 1G3TA 1R00A 3WTXC 2V8DA 1AWCA 4GO1A 5D4SA 3BXMA 1PDNC 1ARMA 3HRUA 3LQRA 3PFOA 2QENA 4AD9A 1IW7F 2JPBA 1SD7A 2MH2A 1HDUA 4UV8A 4BH9A 4Y17A 3TX8A 4B6ZA 4PGGA 1QQIA 2ACJA 4U7BA 1ZH5A 3WTZA 1S3JA 1X3UA 3FX3A 2IA2A 1VHOA 1IF1A 5L3FA 3SJXA 1FWZA 3PBBA 3B73A 4G94A 4AXVA 2J5PA 1R36A 2KJBA 2V79A 1SMYF 1B9MA 2R7DA 3NRVA 2DPDA 4B09A 1UCRA 2GZWA 4X3RA 3GUDA 1Y0YA 5K5RA 2OBPA 1J75A 2WWYA 4MMOA 2PJ6A 3LAJA 1HSJA 2O0YA 1XGSA 1XRYA 1ZG8A 4YFKF 5LHIA 2NSMA 5L3DA 2RVCA 6PAXA 1F57A 3K1PA 4IHTA 1BN5A 2RB7A 5JFRA 1F1ZA 3KE2A 1MKMA 2AFUA 2DU9A 1L3LA 2JT1A 3B3CA 4WWCA 1YTYA 4MCRA 3IKTA 3HUGA 4WCGA 2HS5A 1K78B 4MCQA 2IT0A 4OC5A 3KFWX 4ZYEA 1DDNA 4M72A 5TJJA 4PXBA 1VTNC 2Q0OA 3PRTA 4EJUA 1XCVA 4OINF 1Z91A 1YW7A 2FXAA 1FC3A 3PEIA 1GYTA 2IW5A 1W7PD 2EWBA 1IXRC 3FJUA 4G6QA 4S05A 2QM3A 1YS6A 5DV5A 2KRFA 3TO7A 5K5QA 4DJLA 4RGRA 2QYVA 2EA2A 1I5ZA 1KQ9A 4I0BA 1CX8A 1G3WA 5KK1A 2CTCA 4RB2C 3L9FA 1Z7UA 3P9CA 1R5HA 2A07F 3VATA 1K6OA 2JSCA 4MQVA 1P92A 2ZEDA 1BC8C 2O4HA 1J5YA 3E97A 4WXCA 4HW0A 5CVVA 5ICGA 4KMUX 3JSOA 1XSXA 3CDXA 2RQPA 3CUQB 5DUIA 5FD5A 1HKTA 3E5XA 7CPAA 4P4EA 2C6YA 5HLHA 4EMSA 3WGGA 3MFKA 2CFXA 3COAC 2H6CA 2QUFA 3M7GA 1OYIA 3WTSC 1USTA 3KHXA 4HV6A 2QJ8A 2RC4A 1SFEA 1REPC 1KGSA 4LMYA 2PEXA 1Q1HA 3M9AA 3RIRA 2RNJA 1BPMA 5ILSA 1SAXA 2FU4A 4IJAA 1NSAA 1YG2A 2VE9A 4TWEA 4RB3C 1FP1D 3BPVA 1Z2LA 4P4FA 2EFNA 4DNCA 2J5OA 3NA6A 2BBYA 1KQ8A 1D5VA 3KLNA 4FUUA 3J81K 2L54A 3S9MA 2NYQA 1KYZA 3EUHA 2QBYA 3ML6A 1T98A 2D1VA 4IHMA 5LBQA 3MN8A 4BNCA 1G6NA 2ZEGA 2EK9A 1QO0D 2O3FA 4PQAA 1ZG1A 2YX7A 2IQ6A 4L18B 4MHNA 2CO5A 3H8FA 3DPTA 1QNTA 4FBEA 4UVCA 2EFWA 4ENMA 4KNYA 2IVMA 3FEDA 2XHKA 5D8KB 4H0EA 3SJGA 2A5YB 1IN7A 1T38A 3RKXA 3I5UA 3IC7A 2P7VB 1LDJA 1I1SA 4KYWA 2XIGA 2F5DA 3T5XA 2H09A 3QP5A 5CYVA 1SD4A 4EJOA 3HHGA 4DUKA 1U78A 5DCMB 4KUMA 2JPCA 2HDCA 1ELMP 3D7HA 1U2WA 5D6EA 2VODA 1Z1DA 4CGZA 4ENJA 4U7DA 1YFHA 1IN6A 2XV4S 2XKOA 3WU1B 3MAJA 1ZAOA 2FOKA 2HTSA 5LHHA 2GLJA 2DK8A 2CYYA 1LB2A 4MXUA 3RJPA 4R8FA 4LLLA 4L9NA 5AONA 3MRUA 1QQ9A 4AIHA 4KIFA 1Y0RA 4M9XA 3BJ6A 2A3SA 1O3RA 4G1PA 1LNWA 4DYOA 1HDQA 4NJQA 2EK5A 2IA1A 2Z5UA 4ESBA 3WE3A 5J8FA 2RFHA 2ZNYA 3BPXA 2RN7A 2ELHA 3JAMZ 1E2XA 1XMBA 4KN7X 1FT9A 5E1WA 2HYFA 3P9KA 4K2EA 4EVIA 3HTUA 2ZEHA 1J7KA 2PQ8A 4IF4A 4UF4A 2DI3A 4MNUA 4D0PA 3ECOA 2XASA 3DLJA 4ZY0A 2H27A 1M4LA 1KU7A 2PJ7A 3RKWA 2YX4A 1ZYRF 1DPRA 5F1RA 2ZKZA 5HVQC 1TNSA 2A68F 2M45A
chains in the Genus database with same CATH superfamily
3V8JA 2H1KA 1P4NA 2L2OA 2EA4A 1MMGA 3T8RA 5EG0B 4I7HA 4B4CA 5JLWA 2P6GA 1CP6A 2F7VA 3LSHA 2FJ1A 2WYRA 3M8EA 5K99A 3HPHA 2DODA 5FROA 4D7MA 2AFWA 1BJAA 2R5YB 3B6AA 1KU3A 4CAVA 4CZZA 2COBA 1LOKA 2R1IA 2XF7A 1UB9A 4IHYA 3QYEA 4C99A 2CW0F 2E19A 5EZGA 1R7JA 4B8XA 4OIDA 4ZTFA 3SDGA 2EZKA 3CJQB 3KEOA 2WV1A 1JHFA 2ZENA 3IFEA 2PJPA 2CQ7A 3TGNA 1XFOA 2IS1A 2UZKA 2DYRH 2V77A 2EZLA 5CJ9A 2ZW7A 2PE3A 3PB6X 4M3FA 4A38A 5EEAA 4UB6C 3DF8A 4GRIA 3FIXA 2JBJA 4EJWA 3G3ZA 3C2GA 3CZXA 3D7DA 4R3KA 3QQAA 3NQOA 1QSMA 3VWDA 1IRFA 1KZFA 1NMTA 3F8NA 1O3QA 2CGPA 4B12A 1D1CA 4DZPA 3D7GA 3SI1A 4CRYB 3BTCA 4AWXB 1W7PB 2HXIA 2W24A 5K7FA 3BCAA 5EGOB 4IF5A 4B14A 2E60A 5IP7J 3WODF 3K4BA 3E5QA 1FJLA 3N97A 5TISC 4C8CA 2EFPA 4XM3A 3SEZA 1XN7A 1MH4A 1S7AA 2HDWA 2G7UA 1RR7A 2DIKA 1KU2A 3FM5A 3H92A 4KICA 1RETA 5H84A 2XAFA 3BI0A 4ZI6A 2W1OA 3ZQFA 2WAQA 5KTCA 2F48A 1RO5A 2OA4A 4XLPF 1X1DA 2B3UA 3O3KA 3ZQGA 1BPNA 4JBAA 4Y33A 5IOYA 4RS2A 5IYCJ 5LYLA 3SI2A 5HOOA 1OCRH 4R1HA 4RGXA 2EB7A 3CO7C 3H4QA 3V4GA 3D0SA 4XR6A 5JQ4A 2XGDA 1CF7A 2FA5A 4PFOA 4TV7A 3JRHA 5C4XJ 3O6BB 2M87A 5H6RA 1ZKGA 3BJ8A 4R3LA 4O5VA 4RMNA 3K2AA 1HKQA 1Z8WA 2R5ZB 5JGFA 2I3CA 4OWRB 3JRFA 2AJ6A 1I21A 3H3UA 4IRIA 3W2AA 1VZ0A 3W2WA 1JI8A 2YSRA 1F43A 2KRCA 4CAFA 1BOAA 2FIAA 1ZRCA 3SFZA 4MJ8A 2HUZA 3GUXA 2XAGA 3QOPA 1ZG3A 2E2HJ 4NC7A 3QPLA 3WU2C 5H6QA 4F91B 3ZR8X 3F23A 2H8WA 3CCRI 2X7BA 5G1ZA 3REOA 3FH4A 4B1RA 2QEXI 4A5MA 4UXNA 4FHTA 3KHZA 4BEHB 5EDNA 3WC6A 2R82A 2CY2A 4B44A 4MRIA 1Z3YA 5F1JA 5HVGA 1FYLA 3LSKA 5E1ZB 3L2RA 4MBUA 4KISA 2EILH 3WTVC 4HF1A 3BP8A 3ZQIA 2ZEPA 3V7ZA 2XPWA 2EQRA 4A30A 1OKRA 1VQOI 3M8FA 2TCTA 3I3LA 2CWEA 4LIVA 2Q2EB 2Z33A 3R60A 1S72I 5GADJ 3DU5A 2LDUA 4DZJA 4DOZA 5EF6A 3FK7A 4CYCB 1X2NA 4C2YA 1ITYA 4CDKA 4XKCA 1HF0A 2NS8A 4PCQA 4ZDPA 2DW4A 1SD5A 2DBBA 3V7CA 2WA0A 4JP0A 1O4XA 1WRJA 4BXXJ 1MZBA 5DUKA 3ZMDA 2CW7A 4C84A 3NOJA 3CCSI 5J4YA 1R23A 4C9VA 3MVPA 3C2BA 5E1XA 1BW6A 1YI2I 3DTKA 4V2GA 4NEXA 5J1YA 2W7NA 1KYWA 4BY7J 4IO9F 3HZJA 4A2ZA 2WAQN 5JHFA 2HPIA 2LMDA 1LAMA 3TCVA 2G3AA 2VI7A 5ICCA 3S93A 1E17A 3G4SI 5J3LA 2ZSHB 4UIAA 4XLEA 2ZEMA 2LOOA 2Z3MA 2KCWA 3OY9A 1C30B 2DEAA 1ACIA 4FQGA 1QSNA 1I27A 2V1UA 1VQMI 3RDIA 2ZEFA 2IS2A 1TWCJ 4M3BA 4L0ZB 3TO6A 4YIIA 1I3QJ 4XPDB 2E1OA 4A3KJ 2JA2A 4YFJA 3HDDA 2KIFA 1CS0B 5A2QZ 2V9PA 4JX4A 4H2KA 1LDKB 3R9FA 4QLCU 1PP7U 3ZMVA 2DOEA 4C9EA 1A36A 1QZYA 3VPRA 1R4NB 3G1MA 3EYYA 5E8GA 2MFZA 1FLIA 4KMFA 4PJJA 3ZN1A 4JOMA 5JLXA 2BHYA 2PJCA 3WU0A 1SAUA 4IX7A 2HB6A 5AG6A 1OPCA 4DYCA 3R1KA 4CAWA 3ASNH 2B9SA 1N75A 4CGLA 3H0GJ 3S9LA 3FM3A 4CCKA 3DTEA 3WG7H 3GTQJ 1CBXA 3EO4A 4UWJA 2QVOA 3KIOA 4XSZF 2E1MC 5KCMA 4R79A 3WTTC 3P2HA 5DS0A 3A1YA 3JAMK 4IOAF 4A95A 3KKWA 2WUUA 4M6XA 1U9NA 1P4WA 3HGYA 3CUOA 4XOPA 5FLXZ 2DTRA 3GFIA 4CAXA 4E94A 2Y30A 3LA3A 1WKMA 3BQYA 2Z3LA 4Q5SF 2QKMB 4RDUA 1FSHA 3HPGA 4P55A 2GAUA 3T05A 3I1UA 3MN2A 1K7AA 4KDPA 2FSRA 5HDGA 3LMMA 1Y9WA 2WADA 2IGMA 2XUBA 4G7ZF 1BR1A 3DPLC 3TLEA 1IN5A 3TOBA 4F8ZA 3KZWA 2QQBA 1ZHFA 1T39A 4QPQA 2ZEOA 3DPUA 3H5RA 4EWTA 3CF2A 1MK4A 1T2KA 1QSRA 2DN0A 3TLYA 2F4IA 4HEA2 3VFZA 2K5TA 3ZQHA 4I99C 1QA6A 3DKXA 1K6YA 1YIOA 5L3CA 2FM4A 1BOBA 2VQHA 1HLVA 2Y48A 4R57A 2R7VA 5BNGA 4C8FA 4EGYA 1UHSA 3LD2A 3ZCOA 2VJ4A 1I6XA 4S04A 1VGYA 2P6FA 2ODFA 3B35A 4LB5A 4MI1A 3ZQQA 4FT8A 1BI0A 5LGNA 4OP4A 1JKOC 3V8KA 1XMXA 3GXOA 2PJ3A 3Q0UA 3GTOJ 2MH9A 5J1RA 3VDXA 1XSVA 4A12A 4LB6B 4HQMA 4B10A 4LG3A 1TBXA 2L9NA 4WXHA 2LFBA 2QQ9A 4FX0A 5FFZA 2H94A 4BUPA 2B7EA 2BXYA 3J80Z 4YN3A 3ZQ7A 4ESJA 1O3SA 3ZMZA 2V6CA 1JXSA 5BWAB 5HS8A 3S32A 4W9YA 2KL4A 4A33A 3M4OJ 4X1EA 4A3DJ 4ZZLA 1WZ2A 4L9JA 4CAEA 5GAEJ 4F55A 2KDOA 3G8WA 2UUZA 4PXCA 5J1QA 1KC7A 3G73A 2EBJA 3HLPA 1Y9KA 3BJAA 3WHCA 5F0FA 2HWGA 4EJTA 2C1CA 1Z6TA 3GKRA 1AOYA 1EV7A 2OLSA 1BI1A 3JUWA 3TFYA 1ZRSA 3H9GA 1CQTA 4UUTA 4JX6A 2LY1A 1YREA 1S5KA 5TRDA 3TW7A 4M73A 4IKFA 2MLGA 2LKXA 2M34A 2E1CA 4L0YB 3OSFA 3HOUJ 2PJBA 2ZW6A 1X3ZB 4R8HA 1G2HA 3TLCA 4DGWB 3T1BA 4R7MA 2FQ4A 3QAYA 2J8MA 3V7SA 1S29A 2X1EA 3ABLH 5HS7A 4MTDA 5CNPA 3NE8A 3IP4B 4FD4A 3SXYA 2C6GA 2Q4YA 5E8IA 2IS4A 4A3MJ 1ZREA 1DTDA 1NE9A 5C4JJ 4II3A 4F0YA 4U0VA 3D7FA 3MZ8A 1PUEE 1IRGA 2PFBA 2V1NA 4BHCA 2KDZA 3E6CC 2Q8KA 1U3EM 1LRZA 1Y39A 3H8EA 1ON2A 1WI3A 2BY1A 3SEQA 2C6PA 3KQXA 5JVLA 2V1DA 2ZJ2A 3B6CA 5ILVA 4HG2A 1YGHA 1R9TJ 4A6EA 3F6VA 5DD8A 3HOVJ 4DYRA 1BA5A 4ZBGA 1S6LA 2CV0A 1QZZA 1XCBA 5FKNA 5KTAA 4ENNA 2LH9A 4GDFA 1U8RA 2M1BA 1N78A 2CRGA 2HQYA 9ANTA 3OYJA 2NNYA 3ZZIA 2O61A 2FNPA 3F3XA 4C9AA 4BQNA 2FBHA 3VOEA 2F4MB 1N71A 4X5KA 4Y4RA 1M4IA 2BEOA 3I55I 1XF1A 3ABUA 2R0QC 4BDYA 3CT9A 3H8GA 2ABZA 4MIMA 2E36A 3FISA 4HLYA 1N77A 1C0WA 3KETA 3BTIA 1UELB 3CTAA 3J7ZI 3TDUC 3FXRA 5C3EJ 2E2IJ 1ERDA 5EEHA 4HV5A 2VUMJ 2LKPA 2LNBA 1J59A 1PJRA 2XEJA 6CPAA 1IG7A 4LG0A 2DMQA 4KJZA 1R58A 1Z9CA 3MQ0A 2PJ2A 1XEBA 1KBLA 3FRMA 2PX9A 1KQ0A 1QHGA 4RB1A 1NHAA 4BJTA 3BJOA 3GLXA 2VZYA 3TEDA 4M6GA 1YLEA 2VKHA 3JREA 4OADA 2ELJA 1YSJA 1MMSA 1Z8XA 3ERMA 3HM5A 2JA6J 2HI3A 1W1WE 3MKLA 1X10A 2DMPA 2CUJA 1GV5A 5EZHA 4A6DA 1WJCA 2O03A 3S3NA 2QGUA 2JZYA 2W00A 4F52A 1F2OA 3GF2A 4PPZA 1U5TA 1ZTRA 3KYCB 4MHPA 5F1YA 1BBYA 1XMKA 2V8HA 5F0CA 5B1AH 5KHDA 4KSAA 3TL4X 3AKZA 3LWFA 4CXFA 3J7YJ 2J9AA 2XSJC 3I53A 1H8AC 4G6DA 5FLMJ 3LODA 5FO5A 3G71I 5HXDA 2E1MB 2IPQX 1R5ID 1NSLA 1Q1VA 3DTIA 3CC2I 4EM0B 2LP0A 4CGNA 3ONQA 3AL0B 1G3SA 5LRKA 3TO9A 1A6QA 1YO5C 4XPLA 1WVMA 1FPQA 4E70A 2LG4A 1C3OB 1VQLI 1Z67A 5FRNA 2FS5A 1ODDA 2HR3A 3J7AY 1RTQA 1IV8A 2Y69H 3ZMTA 3V8IA 1LVKA 3M1EA 4IVNA 2VQYA 4KVXA 5A2QK 5D29A 2OJED 3H35A 4CICA 1IOFA 2R7TA 5LEJA 1UHWA 1D0ZA 4KOTA 3PGPA 2RGVA 5LRRA 3N7ZA 3L2VA 2PJ4A 3PB9X 2CG4A 2CV1A 1BL0A 3H3VK 1E0EA 2HOTA 5GP9A 1Q7LA 1TXRA 3H9QA 3KZIC 1AKHA 2K4JA 1YK3A 3PFEA 4NFRA 1FYMA 3CLQA 3JRUA 3K1MA 5LRGA 1K61A 1JQGA 4GXHA 3J7AO 3U1BA 4A37A 1Z77A 4NGMA 1F9NA 4IHWA 3LSJA 1UAAA 1Y8RB 2WPXA 1ULYA 2NRAC 3RYRA 3T9YA 2DYSH 3KZZA 2LD5A 1H9TA 4UNOA 1PYVA 1JHHA 4ON0A 3LWUA 4HNWB 3IWZA 1TQPA 5JVTA 3C1DA 5LD2C 4WWVA 2R7OA 2V8GA 1FSEA 2K7LA 1GT0C 1Z5RA 3CPAA 4B43A 3Q3SA 1S7KA 2GA1A 2VJJA 1R5GA 2D2WA 1MH3A 3B3WA 5BPIA 1LFPA 1ETKA 2QKLB 1AA7A 4LUAA 4MQ9F 3K4MA 3OYGA 3G3SA 4ZYAA 2Y2ZA 1IIDA 1FIAA 1BJZA 4AG9A 3IU2A 3JRIA 2BYVE 2Z99A 3R6SA 2KFDA 3FB3A 2Q4VA 1W5CC 3JTHA 4EV0A 1H88C 2TRTA 2Y0SA 1DP7P 3IC1A 5H20A 4BXUA 3JSPA 4LGWA 1V6CA 4BE2A 4G12A 1CF7B 2L02A 4XORA 4OIPF 5F6FA 2REFA 2DPSA 3CCMI 4R87A 1S60A 3P5JA 4FE4A 3M3YJ 1ZK8A 1WGXA 3BZKA 1LVAA 4C7IA 4ZY2A 1V0CA 3C18A 2GOMA 1FYKA 1R3NA 3QNVA 4AVAA 3GZ5A 4RUHA 4Z65A 2BVMA 2MYSA 2ZNZA 2CMPA 2PMHA 4HBLA 1P2FA 2ETHA 5D8LB 5IT9Z 3OSGA 2PR8A 3F8CA 1RUOA 4IAVA 4X8IA 4A94A 1CE8B 1RIOH 1MBEA 2X6OA 2QQ8A 3KPHA 1HXDA 3LNQA 1F5TA 2HDDA 2V8VA 3GLJA 3VARA 4P4IA 3KI9A 5IR2A 3BTJA 2CSOA 2VE8A 4PXEA 4LOCA 3IAS2 1VBGA 2DMNA 5E20A 2XAQA 3H5ZA 1QVTA 5E3LA 4J01A 4AB7A 2P6SA 2R7FA 4L8AA 3AG2H 2X4HA 3QOEA 1W36D 3FMCA 4G7OF 3OWCA 4A3LJ 1WJEA 4KUAA 2AS5F 3VSKA 2Z3NA 4EJVA 2HYJA 5J4VA 3KP3A 2BCOA 3F9KA 3IWFA 2DT5A 1KA8A 2HYGD 4XOTA 1U0JA 5EJCA 2M2EA 1XC5A 5E3MA 1TW2A 1PUFA 1RXTA 3DGVA 4XLCA 2P5VA 3PNVA 1EF4A 3C7JA 2FCKA 4MFKA 3FVLA 4XSXF 3EQLF 4GXOA 3BDDA 1YVKA 4Q48A 1MIJA 1GGOA 4DIQA 1HW2A 4KVME 3S2WA 3LA2A 3QU6A 3K9TA 4UVAA 1RKTA 3DXJF 4R76A 2L9VA 5E3OA 5CQEA 2LR8A 3A4CA 4DBRA 2P7CB 1GVJA 2ZXHA 1U6GA 3ABTA 4HNVA 3K70D 4HYEA 4I6ZA 2GBYA 2B4DA 4XRSA 2LSOA 2AXTC 4RAZA 1D8JA 3W91A 3OOPA 2L4AA 2JN6A 5D8NA 3HC7A 3GB0A 1YS7A 3PM1A 2CF4A 5GPAA 2QZ8A 3CPXA 2DT6A 1RI7A 4KZTA 5K8OA 3D5SC 3K6GA 2DAOA 1E3OC 3T0YA 5FD6A 4U0WA 3PUFA 3S15J 3TOAA 1BAVA 4NGNA 2UXNA 4XMYA 2K9NA 3BZ6A 4JVOA 3OIQA 3F8BA 2OPTA 4P1WA 1J09A 3E5UA 4PDKA 4UUSA 2QQAA 2CTBA 2Y0SN 3QPSA 3GTLJ 4IQ4A 1TT5B 4KLWA 4P10A 2VLAA 1A2ZA 2GREA 1W4MA 2K4BA 2ZOGA 2K9QA 2I10A 5B5EC 4OMYA 4OC1A 1K4JA 3T0TA 1NTCA 3QB8A 3OIPA 4CYPA 2DJIA 1Z05A 3RYPA 4X2TA 2K9MA 3HHHA 3K4LA 1E3PA 1LEAA 2NMTA 3OYFA 2ZFWA 3Q9SA 5CQGA 1WJFA 3GTJJ 4CS0B 3VYUB 4FTHA 1HC8A 5I4MA 4JQFA 1ZG9A 1FBQA 2MBFA 3I4PA 4O3MA 3TDZC 1BLLE 3IHUA 4GS4A 3TLGA 3V7RA 3W6KB 4MFQA 3FMQA 4UCNA 4ZY1A 1ARLA 1QMUA 1IXSB 3KR4A 1T6SA 1U5TC 5A28A 1Y8QB 4QB9A 1FNNA 4P4JA 3JTGA 3PQKA 1NXJA 3PNYA 4V2FA 2OZ6A 5L3EA 4OU0A 4BGDA 1M1DA 2LYCA 4BBSJ 3R0AA 1E3HA 1JT6A 4MGRA 2PN6A 2IXSA 2VBYA 2ZJQF 3I59B 1WI9A 3LSGA 5F9MA 1K78A 5G22A 5J47A 4OOIA 3C26A 2EZHA 2CFOA 2FOWA 1V4RA 2DCEA 3G1OA 3NFZA 2BOAA 3WC7A 4C8AA 3VYTB 1J9IA 1AUGA 4XQFA 2CJJA 4A0YA 4A3EJ 2F4OB 2V9KA 1Q5XA 5IYBJ 3EZAA 3IV5A 2XGEA 3ECHA 3GW2A 1BI2A 2MW8A 1CM0A 4KNGE 4JLYA 2P4WA 3KYLA 1S9HA 2KT0A 2IJZA 1XF8A 1JGSA 1R1UA 2FX0A 3FMSA 3KP4A 1SVMA 3S1QJ 2OQGA 1LAPA 3R61A 4M9SA 1A5JA 2XEFA 2JQ7A 2XAJA 4KITB 1FMWA 3HG9A 4N0BA 3RSNA 1KZHA 4DBQA 1MJBA 2ECBA 3I64A 2NVTJ 4TJXA 2HEOA 2TDXA 3I58A 4OAZA 3IAM2 1R71A 1UFHA 4KSFA 4P6YA 3DR6A 1YW8A 1LFUP 1VHSA 1LE8B 4GGGA 4YIFA 4I76A 1BW5A 1PYTB 3EXNA 1LCPA 4D5FA 1Z3XA 4HX8A 1TF8A 3RAMA 1P0HA 2X9DA 1Z0XA 1GDTA 2BY2A 2EWNA 2VT3A 2KKOA 3H36A 3L7WA 2FMYA 2H6BA 4KOYA 2PMZA 3EUAA 3R4KA 3ULQB 5FKOA 1LQ1A 4UBRA 4HDVA 5F49A 1MD0A 4QC6A 1I1GA 4UVBA 3FMRA 4H1HA 3AFHA 5IT3A 1ZLKA 3PIOF 2EH3A 3F21A 4MJXA 1JDEA 4BBRJ 1LEBA 2G9WA 5BOXA 2VOPA 5A27A 2R7ZJ 2XRNA 4M3SA 2JEVA 2FF4A 4UFWA 4LIUA 3GO5A 4UHTA 5FKMA 4A93J 3ESWB 5F48A 4M6HA 1CG2A 3HSRA 5FRMA 4UIBA 5J6XA 2A61A 1HW1A 4XICA 1TKHA 2CIJA 4EYSA 4WF2A 2O53A 2BV6A 4QBJA 1H8LA 2A6EF 1JUSA 4CCLA 1IUFA 3BZCA 4W97A 4BD9A 4YU9A 3K2ZA 4XLAA 2K40A 2STWA 1EE3P 5LYDA 3TTHA 1VI4A 4N9HA 3IO1A 4I98B 3BI1A 3FYNA 3ABKH 3EUHC 2FSWA 1X4PA 2DA1A 3F8MA 3QU3A 3ISPA 3SQNA 3D1NI 2PJRA 2R93J 2FNAA 3NWTA 2WTEA 2VL1A 3RYOA 2E34A 5BQTA 2NS0A 1BIBA 1B59A 4C2MJ 1MGTA 3AG4H 3ZRGA 5EC4A 2K27A 4AIJA 3HXLA 2VC0A 2HWVA 1PUAA 1Z8LA 4E0AA 1B6AA 2GOXB 2BHZA 3I71A 5D5WB 4QUSA 5LHGA 2Z3PA 2ECCA 2DDAA 1ETQA 4ONWA 4KIGA 5CVIA 4NQWA 4UFVA 3RCOA 1B8IA 3GTKJ 1TL8A 3SJFA 5F47A 3D67A 1A04A 4EM1A 2OTLI 3MKWB 4B5PB 1XTAA 4DQ2A 4CGPA 1FMVA 2KQRA 2Y75A 3X2QH 3ZMUA 3QODA 2LY2A 1WSUA 5DWMA 2EZBA 4UUVA 3AG3H 4YIRX 5M3MJ 3LOCA 4PK2A 4ZGYB 2JA5J 1O57A 4CPAA 1YRNA 4XL9A 1MBGA 2OD5A 2OF7A 2JRMA 3HJEA 3RPUD 4RB0A 5DS9A 1RZ4A 4MEXF 3K69A 5IT9K 2GA2A 3OR1C 4NC8A 4A3GJ 5H86A 3BR1A 3F8FA 3K10A 3HUGB 1WWZA 4L89A 4S0HB 2AFZA 2PMZN 3MD2A 3FXQA 3QAHA 1FNOA 2V9VA 5DCFA 4PJLA 3T8TA 1Z8TA 2XF5A 2A6HF 2M5WA 5LEKA 3I4MJ 2PJ0A 2DQLA 1OLTA 3GX4X 1TQIA 3UKGA 1XDSA 3KP2A 4MFDA 2ZFUA 4KOWA 1IGNA 3T90A 4XK4A 3HOXJ 2CQKA 2FIWA 5D4RA 5ELYA 3U1KA 4HOBA 3R9GA 1A35A 5IP6A 5JPHA 5FKLA 1L0OC 5B66C 1CP7A 4EGZA 3F0AA 3IEHA 3BROA 2KIUA 2LY9A 3ISZA 2POKA 2JDCA 4LG0B 2PJAA 4HNTA 1MNDA 1KONA 4DJAA 1JJ8C 1I39A 2QVPA 2ME6A 1WFXA 4IPAA 4RLQA 2PJ9A 3NH4A 2E7WA 4W1UA 2YU9J 3I9SA 4E7SA 3C3WA 4CHUA 2WY7Q 3ROUA 1D8KA 5DM7F 4ORFA 2WBMA 3GZNB 2IA0A 2Q4ZA 3V38A 3MWMA 4MO7A 2DJNA 1ZGWA 3RZOJ 3K9UA 5K1YA 2L4MA 3BR5A 3SZTA 2OTJI 2JVGA 2L9SA 1OQYA 2PIZA 3D3SA 2LBFA 3NEUA 5BPDA 3OOUA 4PUSA 3T07A 1WHUA 3WABA 1WJAA 1S7NA 4CGMA 2YU3A 1S5LC 4A0ZA 2MGQA 2EFOA 1FP2A 3VH9A 1IDYA 2VJ5A 4HX4A 4HKFA 2XVCA 1SANA 1QSOA 4CYQA 2OQRA 3D5RC 1ELLP 2M8GX 1I1DA 1SVOA 2HQRA 2BZTA 2KZGA 5DCMA 1QBJA 2GP4A 1GV2A 2E5NA 4M6VA 2FUG2 5K5OA 2YUSA 3KGQA 2VBZA 1WPKA 1G4DA 3ISXA 3VWBA 1FBSA 1R49A 3P9IA 1QGPA 2BL1A 3CCQI 4HNXB 1W5SA 1G8XA 1OMIA 3CO6C 2EZCA 2EJRA 2RV8A 3PBEA 1QRYA 3S6GA 2LKSA 1NBWA 2QA4I 2FQ3A 4MFEA 1VQ8I 3IGRA 4HQEA 1IV6A 2XEGA 3SZGA 1DU0A 4E7ZA 2O28A 4IIYA 4IK2A 3BLYA 3KL9A 1Q2CA 2A5WA 5E17F 1WJ5A 4H6ZA 4FD5A 2LF8A 5IB9A 2IJLA 5LFAA 1DQUA 4X6AJ 1L0CA 3PB7X 1TTYA 2O6GE 1KUYA 3TP3A 2HKOA 3FBIB 4NC6A 4ZX9A 1XD7A 2Z10A 5IX3A 2WAEA 3EDPA 4INJA 4PFPA 3EIFA 1VI0A 2AFXA 3L00A 1OCTC 2HVSA 1MBFA 2OOTA 2VB6A 4CCOA 3IRQA 2XGCA 2MP0A 2EZAA 4GCVA 3OL3A 4GFBA 4PJ0C 4FX4A 1FOYA 1STZA 2HGCA 4L9TA 1YX0A 3PFYA 2L01A 2JEWA 2AFSA 2L0KA 3ABMH 1FEXA 3CJNA 3OYAA 4NNJA 1N25A 2B0LA 1UG0A 3FWEA 3GZ6A 3NH5A 3S1NJ 2X0SA 1YQAA 2RKHA 3BOQA 1B72B 2BY3A 2XAUA 4M9ZA 1EA3A 4MEYF 1OYYA 4Y15A 1LFBA 1CPXA 3WHBA 1P9QC 4JX5A 2QECA 4RAYA 4ENKA 5K8PA 1OYWA 2VT2A 2Z3KA 1KUVA 4CYNA 2DMUA 4UB8C 4II9A 3SYTA 2Z16A 1MDMA 2CNTA 2AFMA 3RBUA 4P45A 3S3MA 4UEZA 2WC2A 1TQMA 4HAMA 5M5WJ 4KOSA 2QSFX 2E2JJ 1OCOH 1SMTA 1SVLA 1U9OA 3CJRB 4K3NA 1WH7A 4XRFA 2HQAA 1J0RA 5BS6A 4RGSA 1U6MA 2P5KA 3NAUA 2VQLA 2QBYB 1Z4EA 2JDDA 1WH5A 2JA8J 1ZG7A 2PJ5A 1KU9A 4A3IJ 2C27A 3S17J 1Y9ZA 4RI1A 1ZLHA 4ZZDA 2Q43A 2EV0A 4UV9A 3VTAA 2NOJB 3K4JA 4ANJA 3IWEA 3LMSA 1D3YA 3J81Z 1X1CA 4UEEA 1SFKA 2G9DA 3FXOA 2EK8A 3T5MA 1PU9A 1XJOA 3KQZA 4JYWA 4HSTA 5EG0A 2YJVA 1ETYA 1W0UA 2RQQA 3GWZA 3FF3A 2BO9A 2DDBA 1FOXA 2R5YA 2L7FP 2ZCWA 2R7XA 3FIWA 5C44J 3MZHA 2KMUA 4PGHA 3I4NJ 4OAEA 4A31A 2JA7J 4KA4A 1Z7LA 1FY7A 4AM3A 1PUFB 3QRFF 4NCZA 2YJTA 1GLNA 4BYYA 4F9UA 1ZL0A 1I6HJ 3K2KA 2A05A 3LSPA 3D4UA 2F6CA 4P9UA 1XGNA 5DYMA 3F72A 5CVJA 3JR9A 3BR6A 3FXMA 3JVNA 1APLC 3OWTA 4U88A 4BINA 4CO8A 5LLQA 3CCVI 3DP7A 1IRXA 4G8XA 5LRSA 3BR3A 3NARA 2ISZA 1Z9UA 4CZCA 1ZRFA 5D5VB 2NYXA 5ERIA 1ZR4A 4HX7A 4LK1F 1QSTA 2PRBA 2YNDA 1IYKA 2D45A 3IL2A 1W7PA 2YR2A 4DW6A 3S1MJ 5EGOA 3ZP5A 2MD0A 2AUMA 2AE6A 2R7HA 2EPFA 4BY1J 3EC4A 4XNHC 3BHXA 4Y52J 3B02A 2BE5F 4L9VA 4LX9A 1P4XA 3FEEA 5DTDA 2ZB9A 1BIAA 1YW9A 3JRCA 3GTGJ 3IU1A 1ZARA 3IH2A 1Y0UA 2OV7A 3RKYA 3DNSA 1WQ2A 1VQ5I 4ZYGA 4E5SA 2IGKA 1FOKA 2JLMA 2ZMEA 2DA5A 1MW7A 3O2PE 5IY5H 1RRJA 2X1DA 4O6JA 4E7HA 2HQNA 4P96A 3GYHX 2G7HA 4WXDA 4L5EA 1LFWA 2M7AA 3FHZA 4ZH4F 1IAWA 2QMLA 3EYIA 2WSAA 3KEYA 3PZJA 1BM9A 2BGCA 2MD5A 1R22A 3OYCA 4MFJA 2DOAA 2HOEA 4FASD 4ZX8A 2R5ZA 1JKQC 3DQVC 4LK0F 3OIOA 2MSYA 1MBKA 2ISYA 4E7KA 2W25A 4HF0A 1K79A 2R4GA 3FZVA 4YFNF 4F9VA 4P44A 1FX7A 4KOXA 4FD7A 5LRJA 5J40A 2DA6A 2M3AA 1Q2YA 3U1DA 3LFKA 3RI4A 3G2BA 3CCJI 1WCMJ 3LA7A 5ED4A 1FZPB 4OC3A 3TYXA 4J19A 2JTVA 2DK5A 1GXPA 1ZG5A 2MLKA 4C9UA 4QIWN 3HRMA 3OL4A 1HQCA 2X0LA 2DA2A 2DLLA 3F8KA 1OCCH 4BEHA 1H9GA 4XNFA 2BW3A 2VKVA 3N05A 4AVPA 3RKQA 4RGUA 4C30A 4ZYQA 1V3FA 4E4HA 4HLXA 3OMYA 4FISA 4XLNF 2XGXA 1HKSA 2DO7A 5L3BA 3KP5A 3D5LA 2Z9OA 5ISVA 4YRVA 3K1NA 4FD6A 2Q2EA 3E6BA 2A68F 2W85A 2XB5A 4CYCA 4UEFA 1IXCA 1V54H 2P6EA 5ICEA 4M85A 3H3ZA 2Z3OA 3ERED 3HRSA 3ZQLA 1T95A 1BC7C 4MI4A 5AGEA 3CZ6A 1Z6RA 3A01B 2PJ8A 3D8PA 2XKPA 3VYSB 2VKDA 3ZN0A 2VBWA 3HOTA 4MTEA 4IHVA 3F0CA 2IS6A 1O7LA 4IUSA 2VZZA 1XIXA 4FE7A 1O3TA 2I5UA 1MSFC 3JW4A 4OIWA 5B1BH 2WV0A 4IOCF 1TF9A 1SD6A 5FFXA 4J3GA 3FF5A 4M3GA 3E6MA 3RPQA 4OMZA 2ZPAA 4U9ZA 4N4NB 2KJCA 4RAFA 1ON0A 4NDLA 3TQNA 3L2CA 2N8GA 4A69C 2VXDA 4CGOA 3HRTA 5KVRA 3S1RJ 2Q0YA 4P5OA 2VKEA 3I54A 3H1CA 3KYDB 1YJWI 2VPLA 4BBHA 5LYIA 2JRTA 2E71A 4L5IA 2PIYA 3DSBA 3PJRA 3WG9A 4NJRA 2PCNA 4XRSG 2XC7A 2RDPA 3S6HA 2YPRA 3CD6I 1HW5A 3DEEA 3PP9A 1WVRA 3QPHA 4YG2F 1OCZH 2L7KA 2ZXWH 4I01A 1TWHJ 1AMPA 3PB4X 3PIPF 1GHCA 1M4DA 4G7HF 5M3FJ 1XBUA 5HLTA 3DKWA 4G9YA 4ZJZA 2IMOA 3RZDJ 2PBIA 2K86A 4BHBA 1D1AA 1YQEA 2OB0A 1OISA 1P4AA 4I02A 4AVZA 1YLOA 1MNEA 2JUGA 1VNDA 3K4CA 1ETWA 3OS2A 4JWPA 2D0PA 2QYOA 5FLXK 2LVSA 1D0XA 2PJRB 1UWYA 3G23A 2NVQJ 2EV5A 3E6DA 3GFMA 4YGOA 2ESNA 2V6EA 1R61A 2ZEEA 3K7AJ 4E8OA 1TLHB 2HC9A 1UHMA 3LAPA 1IN4A 2HQ5A 1NK3P 3E0KA 1HEEA 3HTSB 4H89A 1NG6A 3LQQA 3P2FA 1ZGAA 5HNHA 5D6FA 1SFOJ 5B3SH 2FT0A 3SJEA 4P4BA 4LLNA 2IBDA 2OAZA 5HLIA 4WJBA 1F2PA 4LLGF 1EH6A 1ETXA 2ID6A 4F6AA 5K8NA 5DEQA 5LGUA 3ZOBA 5CBMA 5DDGA 3WGIA 4PK4A 2ADUA 1SFUA 2HU9A 3FK6A 4HNYB 4MCSA 2ZOFA 2FBIA 1Q2DA 1HBXG 4KOVA 2HV2A 4XKWA 3BLNA 2RAEA 2YS9A 2JBKA 5E96A 1JUMA 3R0JA 1MBJA 3EETA 4L5JA 1S7LA 2EZIA 1IO2A 2GQQA 3G1LA 2LK2A 4MHGA 4BDZA 4HF2A 1D5YA 2HXOA 2PLYA 2GXBA 5CPAA 1RUNA 5LYFA 3TLAA 2Q51A 3R96A 3VODA 1XX5A 4ETSA 1EH7A 1POGA 1B6BA 2PI0A 2COMA 2CNSA 3J80K 3JTKA 4XN0A 1TKJA 1FTZA 2C5QA 3ICUA 3PSFA 5JR3A 4A5NA 3K4KA 2ZW4A 3B3SA 1XOVA 1MMAA 2CUFA 3SZPA 3H0DA 1DPUA 1M6VB 4HA8A 2PR1A 4OMEA 3O8GA 3A03A 2K3FA 4BAYA 4OC4A 4C7HA 2F8HA 4C2TA 2LF7A 3G6EI 4RN7A 2HOAA 2W84A 3IRRA 4A2UA 3F5BA 1G3YA 2ZMEC 3HSFA 4EQQA 2K85A 2Y0MA 1XG1A 4D5CA 3P7NA 1IU8A 3FBUA 3TE4A 3QWLA 4OC2A 2Z1DA 2DXIA 3EUKL 3R9EA 3CCEI 5IYDJ 2Q04A 1B9NA 4AIKA 3LSMA 1FTTA 2LBFB 2VONA 3HEFA 4ZYDA 2HOSA 5JVGF 3W2VA 3GLLA 3IIBA 3KEQA 3CP8A 3KZYA 4GYIA 4XKVA 3KP6A 3TW6A 2JK3A 5HH1A 3VB2A 4NB5A 2J8NA 3U21A 2DA3A 4DYQA 4NXYA 2DOFA 3FBNB 2R7UA 4FWUA 2QSGX 1VBHA 4BS9A 5BMZA 2DT7B 2UWMA 3JCUC 1DUXC 1V5GA 2EFQA 1XB4A 3PNTA 2QCOA 4NUBA 4QWQA 3PFIA 2ANPA 3UR3C 4KLVA 4OLLA 5L3GA 1DE4C 4TNUA 1X1BA 2Y9YA 1OBRA 3Q5FA 2GWRA 5JI6A 4BQAA 4U0YA 5EMIA 1R6RA 5F64A 2WY8Q 1SC7A 1VIXA 3DBHB 5D5XB 1UJ8A 1MJ9A 2NNNA 1ONVA 2RNGA 1GUUA 2E35A 3GCMA 5AG5A 3H9JA 1ON1A 1QVUA 4RBOA 5HVHA 3LSTA 4BXFA 4NGRA 2GXGA 4PZJA 5F0HA 1H89C 1H0MA 3MEXA 1LKXA 2DPUA 1B4AA 1LJ9A 2X48A 1K4SA 2P0WA 3WTYC 2LRDA 2F5EA 1ZR2A 5TGTA 2AXLA 1XSDA 3CJTB 1UFMA 4ZDLA 1S8NA 2M9HA 3F6OA 2HFHA 1Y7EA 1WJDA 5HVFA 2A69F 4WX9A 1TWGJ 1EZAA 4M8DA 1DGRM 2OC6A 2QWWA 3B3VA 3HOWJ 1UMQA 2CQQA 3FKJA 4MY3A 3MCZA 3D68A 1AYEA 2PVVA 1TZLA 4ZDOA 1RESA 5J1UA 1YYVA 5THWA 2AQFA 4NGPA 2ZO4A 3CP2A 3HBLA 3L2QA 2D1HA 2ZXJA 2EVNA 4RM2A 4F7ZA 2NS7A 4E7LA 4IHSA 8CPAA 2R3SA 1NH3A 5K8MA 2ZBKA 3FXTA 3TLBA 1IZ1A 4PXDA 4MFPA 2JSPA 2Q1ZB 2WAFA 3CDLA 1TKFA 5FD8A 3IJ3A 1JGGA 2PRQA 1JJ6C 1YW4A 1R43A 2LREA 5HLGA 4MHZA 5IPAA 4IXAA 2LTPA 1V5EA 1YJNI 1A6IA 4CCNA 4M74A 2CQXA 2NAZA 2QLZA 1XMAA 4XN3A 3SHFA 1R57A 5IOZA 3FDYA 1PP8F 2YNEA 2F5CA 4M3EA 5CPRB 3VSLA 4PSXA 1IN8A 4XONA 4GYGA 1MDMB 2ME0A 2KIMA 3QPTA 4H6UA 4XPDC 4FAIA 1VQ9I 1TIQA 4NGTA 1YR0A 1B87A 3DBRB 1RNLA 2PVWA 3L2NA 3HOSA 3I9V2 3OYHA 2X6XA 2YGWA 2EV6A 1JDBC 4OKOA 2CQNA 2O8XA 3DCFA 2VOOA 3IWWA 5HDNA 1JWQA 2L5QA 5KAFC 4KN4X 1QPIA 2BEIA 3NH8A 2D4OA 3HYIA 3WTUC 3N5FA 4LQGA 3WGHA 3FECA 5DWNA 2PC1A 2IP2A 5AG7A 3A2KA 3BQZA 3ELKA 2AFOA 1ZN2A 3R95A 4XRMA 4HNUA 5E18F 3K4IA 2GE3A 1SFXA 3KCCA 3FXKA 2VASA 4O23A 1FOWA 1YOVB 4Y7NJ 3SHPA 4NHJA 2ZSIB 3Q9VA 3S6KA 3CCUI 4WK8F 4I2OA 2OZUA 3H5NA 3SI0A 3GFJA 1HDDC 4CYDA 2B58A 4P9FA 4KOUA 4LQ6A 4F3QA 3RPUA 1AHDP 5AIQA 2M30A 1T36B 3TT2A 2Y9ZA 1OCPA 2NVXJ 3CMMA 1PCAA 2WZNA 4MLOA 1P7JA 2RREA 4B13A 3OYKA 2M0CA 2VN2A 4HDUA 2VBQA 1YE9A 2NVYJ 1S7OA 2VBXA 4CZ1A 3K70C 4A39A 4ZTJA 2R98A 4KIBA 3CUQA 3H5AA 1HCRA 1XGOA 1IUYA 5I0CA 2O8KA 4AVCA 3AAFA 3KASA 2K02A 4NBQA 1VQPI 3OR2C 3ZMSA 1R1VA 1V55H 5EYRA 2ZJRF 2FBKA 3PB8X 5JM6A 1W5TA 3QP6A 5C88A 1ETVA 4OIQF 2BOLA 2OR4A 4HPSA 4P4DA 1TW3A 4AVBA 4EMEA 2M4GA 4JK1X 3SFIA 2HVQA 1M4GA 1WJBA 5J8CA 2WPWA 2KRHA 1D0YA 2F5FA 3DV8A 4N9IA 3DDDA 2P6TA 4FETA 2E7XA 1XS9A 4Q7AA 5C82A 1ZELA 2K9LA 4Y49C 4B3AA 3ZPLA 4C85A 4KORA 4NF1A 3PQJA 1JKPC 2FXFA 4U87A 4J0NA 4EM2A 3TKYA 4KFCA 1S7FA 3EZBA 2K9SA 4ZC3A 3O8HA 3HSEA 3CDIA 1CPSA 3HUVA 1JTYA 4M3DA 2Q7SA 1MJAA 5KNLA 2W57A 5CKTA 3CF5F 1YW6A 2ZMEB 2B5GA 3S16J 4JZ0A 4JXQA 3UNGC 2GIVA 4C68A 3OYEA 1ZGJA 3K4NA 1Z21A 5JHUA 3LSIA 2GLOA 4B11A 2DFIA 2HTJA 3B2YA 3D66A 1V5FA 3BR2A 1OJLA 1IRZA 3CDHA 3NWSA 3WC5A 2W4SA 1LPQA 4MHYA 2VIXA 2P8TA 3I6SA 2CUEA 2UXXA 3CLOA 4BE1A 1CGPA 1QPMA 2FE3A 3OYLA 3BWGA 3BTLA 4D7NA 1B1BA 4GM5A 2V4JC 2G3TA 1A9XB 3I0TA 3GFLA 4I09A 2GXAA 2ZXIA 2PJ1A 4JYKA 4MHDA 3DFGA 3W6JB 1JE8A 1KWMA 1FBUA 1ZLIA 1VHEA 1LDDA 3OYMA 4Q36A 2MA3A 1Y1WJ 2PMUA 1OR7A 4II2A 3CQZJ 4XLHA 1P6RA 1X19A 3GEZA 2BW3B 4ZYHA 5ILUA 3S2HJ 3BY6A 3WE2A 4UY8I 2VL8A 3N4MA 1TP4A 3UY5A 1XDUA 5ICFA 4A0XA 4BHPA 4AYBA 3PO2J 5K7HA 1VQ6I 2R7SA 4R9MA 4Q47A 3HIFA 4B3XA 4IZZA 2Y31A 3MZYA 2OU2A 2FE7A 2AHQA 4RAGA 2GANA 3U2RA 5CLSA 1RR8C 4BQQA 2XPVA 2VXZA 3FXLA 4HPQA 2STTA 5CVUA 5DD4A 4NGSA 4CCJA 1Y7RA 2I00A 1F36A 1U5TB 3OV8A 1WWXA 5EEGA 4MCPA 3TBIA 4M6IA 3HKZA 2GU2A 2OZHA 3KR5A 2G0BA 4BE0A 1Z4RA 3WT4A 3DR8A 3RZAA 1GVDA 1GXQA 2DFEA 3L2WA 1A31A 5IB0A 2Z3YA 3FXUA 4IL6C 4NGQA 4I0AA 4B47A 2VC1A 1AU7A 5FGMA 1R1TA 2CNMA 4EFDA 2HKXA 4KT5C 4Y3OA 4YWYA 4KSIA 3ZJ0A 2W48A 3KLOA 1HSTA 4OIOF 2XROA 3IUOA 5HS9A 2IEKA 5D5UB 1J3LA 3ZGKA 3JRAA 2DFFA 4F0XA 4N4OB 4COBA 4AIDA 4OIRF 3OYBA 3L2UA 3CC4I 3VYRB 1IGBA 1FIPA 4OC0A 2VEZA 3S8PA 3L09A 2ID3A 4ESFA 5GAHJ 1RC9A 4ASNA 5AIPA 4Y13A 4LD5A 2HVRA 3T8WA 4HZFA 1UZCA 2GLFA 3E3VA 2NOGA 5JYBA 4CDGA 1AKHB 1MMNA 1EH8A 1Y6IA 2K5CA 3VEPA 2E1NA 2OZGA 3S9NA 4C8TA 2HZTA 2IGNA 3B7IA 4E7IA 3FXJA 1IY7A 2XRLA 2ZJPF 1FT7A 3F22A 4UCPA 1DP3A 5GTIC 3BR0A 4YFXF 4BU2A 2B0AA 1ZRDA 1BR4A 3U9GA 2IGOA 3A9LA 5JH9A 2PG4A 4HSRA 2FMLA 1RKWA 2PCUA 2XEIA 3LL7A 3WR7A 4Q4ZF 1WK4A 2XAHA 4MY0A 1YLFA 5CVRA 2B63J 4A3JJ 2V1XA 3V8LA 1O7FA 3BG6A 5HDKA 1U8BA 3TC8A 5F09A 3GVAA 2G0EA 3RQIA 1K83J 1T08B 4BMHA 2ESHA 2L3DA 5F08A 2JVHA 2MC3A 4LJZF 4Z2YA 4A3FJ 3WTWC 4AYBN 4RM3A 2IRFG 3GTPJ 4XKBA 1BXRB 2VPRA 2HZDA 3OYNA 2NVUB 1J2XA 3BG9A 1XGMA 2C6CA 4RS8A 1F4KA 2FRHA 2O7OA 4M6YA 3I59A 4XBFA 3HOZJ 1LANA 3GMEA 3B3TA 4EVYA 2FVGA 4XIDA 2F2EA 1IDZA 2FEZA 3K0LA 3V42A 3OYDA 3AL0C 3KX2A 2IL4A 1P7IA 1ZLJA 1YMEA 1TNTA 3RTRA 1S7EA 3A02A 3HKZN 3DEUA 2M8EA 1IICA 1ORKA 5AG4A 3KP7A 3M8JA 2DQRA 3C8OA 3FX6A 2P5LC 1IJWC 5LGTA 2CW8A 4IQJA 4IRHA 4LFUA 1I3AA 2Q44A 3IKVA 1J4JA 3DEWA 3FHNA 2ZELA 1T0FA 2EBIA 4E6KG 4IRGA 4R6TA 3BCBA 2V26A 3CUQC 4NSQA 1BI3A 1USSA 5FB2A 3HOYJ 4M71A 5G20A 3A0BC 4QVTA 1G3TA 1R00A 3WTXC 2V8DA 3Q0WA 3RO0A 1AWCA 4GO1A 5D4SA 1VQKI 3BXMA 4BJ5C 1PDNC 1LE8A 1ARMA 3HRUA 3CXQA 4Y49B 3LQRA 3PFOA 2XB0X 1IOIA 2QENA 4XPKA 4AD9A 3IH4A 4JXRA 3GJZA 1JKRC 4BL0B 1IW7F 2JPBA 3CMEI 3TMOA 4C2ZA 4XLFA 2CH0A 1SD7A 2MH2A 1HDUA 1R4MB 4UV8A 4BH9A 4D1QA 4Y17A 4CCMA 3CC7I 3AG1H 2ELKA 3TX8A 4B6ZA 4PGGA 1QQIA 2ACJA 4F92B 3EY5A 4U7BA 1ZH5A 3WTZA 1X1AA 2DXQA 2I8DA 3DU6A 2PDOA 3EFAA 1S3JA 1X3UA 1YIJI 3FX3A 4E2AA 2IA2A 1VHOA 2F5IA 5E79C 2DA4A 4BJ6C 5L3FA 1IF1A 2ARHA 3S6FA 3SJXA 2Z11A 4KUBA 1T33A 3SR3A 4QSHA 2MC4A 1FWZA 2NXNB 1W0TA 2B4DB 3CMYA 1QU3A 3PBBA 3B73A 4G94A 4CA0A 1X1PA 2V7FA 4AXVA 2J5PA 1R36A 1T8IA 4C2XA 1PVEA 4V19K 3FNCA 2KJBA 2V79A 2H8RA 1SMYF 2OCEA 1B9MA 2R7DA 3NRVA 3W3CA 2DPDA 4CH7A 4B09A 1UCRA 4A32A 2GZWA 4UUSB 2M0MA 4X3RA 5GPCA 3GUDA 1Y0YA 2PSWA 2VXKA 3OYIA 2DA7A 5K5RA 1CJWA 2OBPA 2KHMA 1J75A 2WWYA 4MMOA 1Y1VJ 2PJ6A 4YELA 1X3WB 3LAJA 5KAIC 1HSJA 2K3PA 5F04A 2R92J 5HODA 2O0YA 1VQ4I 1XGSA 1XRYA 1OR7C 4U9YA 1ZG8A 4UFXA 3QYBA 2J8RA 4YFKF 5LHIA 2XSDC 2NSMA 5FLVA 5L3DA 4C8PA 2RVCA 6PAXA 1F57A 2EIKH 3K1PA 4IHTA 3BJ7A 4B5PA 1BN5A 2RB7A 1Y0NA 5JFRA 3TLGB 4COGA 1F1ZA 3I56I 4AU7A 2XPUA 3KE2A 1X58A 1MKMA 3GYAA 3BG5A 1K4TA 5FJ8J 2OCCH 3I3GA 3MGDA 2AFUA 2DU9A 2H5MA 3LSRA 1L3LA 2JT1A 4PV6A 3B3CA 2BVLA 4WWCA 1YTYA 4MCRA 2MG4A 5GCNA 1ZYMA 1Y56A 3M1CA 3S14J 2VQGA 3IKTA 4Q38A 4AG7A 3HUGA 4WCGA 2HS5A 3EPZA 1K78B 3ASOH 4MCQA 2IT0A 4OC5A 4JJXA 3KFWX 4ZYEA 4C9RA 2R7WA 1DDNA 2B3VA 2E5ZA 4M72A 5TJJA 4PXBA 3W6SA 1VTNC 1RPWA 2Q0OA 3M07A 4BACA 3PRTA 4EJUA 1XCVA 2FD5A 4OINF 1Z91A 2GM4A 1YW7A 1YHQI 2FXAA 1FC3A 4PJMA 4CSWA 1LUJB 4Z6YA 1ZO0A 3PEIA 1ETOA 1GYTA 1XPXA 2IW5A 1W7PD 2EWBA 1IXRC 2VQCA 2DMTA 2X6WA 3FJUA 4G6QA 4S05A 3CCYA 2QM3A 4ABZA 4CUGA 1YS6A 2B5GB 2DF5A 5DV5A 1DGWY 2F5VA 2KPMA 2KRFA 3TO7A 3TLZA 4RA2A 4F93B 2JWTA 5K5QA 2E28A 4DJLA 4RGRA 3JRBA 2QYVA 1EZBA 2EA2A 2IAIA 2P81A 1I5ZA 2L7MP 2JMWA 3DWLE 3IH3A 4EATA 3SDBA 1KQ9A 4I0BA 2REEA 1CX8A 1G3WA 2L7ZA 2OUMA 3E0JB 5KK1A 2CTCA 4RB2C 3L9FA 4G6TB 1Z7UA 3P9CA 1ZQ3P 1OZPA 3SXNA 4C86A 3HL2A 3D2PA 4LITA 1R5HA 2A07F 3D2MA 3VATA 1YX3A 1K6OA 4C2UA 2R7QA 4X0GA 2VJIA 3I74A 1MSEC 4JD6A 2XF6A 3S2DJ 2HROA 2JSCA 3FKIJ 4MQVA 2EO8A 4BQOA 1VF9A 1D1BA 1P92A 2ZEDA 2OH1A 2XDVA 1BC8C 5HNFA 4HRIA 2O4HA 1J5YA 2LC2A 4QPOA 3E97A 3L1PA 3OS0A 3HGGA 4WXCA 5E3NA 2X85A 1VKCA 2KZVA 2CXAA 4HW0A 5CVVA 5G21A 4E7JA 3BG7A 1HOMA 3E1SA 2X6YA 4KMUX 5FKKA 5ICGA 2BSWA 1TC3C 2BUEA 1TT0A 3JSOA 1XSXA 3CDXA 2CU7A 2RQPA 3CUQB 4EEFG 4CYOA 5DUIA 5FD5A 4H4KC 1HKTA 2YNCA 4I49A 2JUCA 2AUNA 3E5XA 3HB9A 4AC0A 4P4EA 2MABA 1T0FC 7CPAA 2C6YA 5HLHA 4EMSA 3VWEA 3WGGA 1JUPA 2A6TA 3MFKA 4C8UA 2CFXA 3COAC 2H6CA 2ZW5A 2R8VA 2QUFA 3M7GA 1OYIA 2BY0A 2QIRA 3WTSC 3JRGA 1USTA 2WB1A 4HV6A 2QJ8A 3KHXA 2RC4A 3EZEA 4NQWB 3SJMA 3W6XA 1SFEA 1B8IB 1REPC 2X51A 4YEJA 1KGSA 3BT9A 4LMYA 2PEXA 2M4KA 3A0HC 4K30A 2W82A 1G59A 1Q1HA 3M9AA 3OS1A 2D4PA 4KS9A 5IP9J 4KVOE 4C3JJ 4QTRA 1B72A 3RIRA 2HNHA 2RNJA 4IEJA 4FCYA 1BPMA 5ILSA 3B8GA 1SAXA 2FU4A 3BG3A 1MNMC 1T56A 3C2HA 4IJAA 1IC8A 1YG2A 2VE9A 2DFHA 1YRNB 1NSAA 3DLLF 4TWEA 4RB3C 1FP1D 2QF7A 3BPVA 2L9RA 2ZC2A 1Z2LA 4P4FA 4PJNA 2EFNA 5F27A 4DNCA 1SQHA 2J5OA 4B48A 2BBYA 3CCLI 3NA6A 1KQ8A 3SXOA 1D5VA 5F5XA 3KLNA 1MMDA 4J00A 4FUUA 2B4BA 1KEEB 3J81K 3GY9A 2L54A 3S9MA 4XNHB 2NYQA 1BO4A 1EJ9A 3QYFA 3ZXSA 3RQ4A 1KYZA 3EUHA 2QBYA 3W6VA 3KRVA 3ML6A 1VQ7I 1T98A 2D1VA 4IHMA 5LBQA 2HI6A 3MN8A 3LACA 4BNCA 1G6NA 2ZEGA 5KTDA 3GBGA 1EKEA 1I50J 2EK9A 1QO0D 2O3FA 4PQAA 2BXZA 2YX7A 1ZG1A 4UCMA 2IQ6A 4L18B 2AQEA 4IIXA 2HPMA 4MHNA 2CO5A 3LFUA 3H8FA 1DIKA 3DPTA 1QNTA 4BKXA 4FBEA 3BC8A 2R7RA 1GHEA 4UVCA 2EFWA 4ENMA 3S3OA 4KNYA 1NG7A 2CS3A 2IVMA 3E7LA 3FEDA 2XHKA 5D8KB 2GFQA 4RLFA 4H0EA 3SJGA 1UG2A 3CMAI 2A5YB 4IHXA 1QZEA 2EUIA 4TJVA 1IN7A 1T38A 4YRHA 5EBVA 3PUBA 3RKXA 1SEUA 3I5UA 4MFLA 3IC7A 2P7VB 1LDJA 2M7BA 3JRDA 1I1SA 4KYWA 2XIGA 2F5DA 3T5XA 2KLOA 2H09A 3QP5A 3NE7A 3CESA 1OFCX 5CYVA 1SD4A 1VQNI 4EJOA 1XE4A 5HMNA 3DKYA 3HHGA 1HA8A 4DUKA 4ONUA 1U78A 5DCMB 2WB1N 4KUMA 4C3HJ 2JPCA 4OAYA 4PK3A 5GAGJ 2HDCA 1ELMP 5DM6F 3D7HA 1IB1E 1U2WA 2Z2SB 5D6EA 1Z1DA 4AUXA 5M5YJ 4CGZA 2VODA 4ENJA 3IWGA 2H1LA 2ICWG 3ZQCA 4UA3A 5GTHC 4U7DA 1YFHA 3MKYB 3RNZA 2QSHX 1I12A 1IN6A 2XV4S 3CXSA 2CV2A 2XKOA 1X12A 3WU1B 3MAJA 5F46A 1ZAOA 2UV1A 2FOKA 1MBHA 2HTSA 1NK2P 5LHHA 4PSWA 2GLJA 2DK8A 2CYYA 4CRZB 1LB2A 2Z0ZA 4MXUA 4KT6A 3RJPA 4R8FA 4LLLA 4L9NA 5AONA 1M44A 3MRUA 4A3BJ 3GTMJ 5M5XJ 2X1CA 3MMYB 1QQ9A 3PO3J 2KP6A 3DBLB 2Q7BA 2FL4A 4AIHA 4KIFA 1Y0RA 4M9XA 2KIQA 2DPTA 2EIMH 1YX5A 4C3IJ 3GIUA 4A3CJ 3BJ6A 2A3SA 2VI6A 4ITVA 1O3RA 4G1PA 1LNWA 4U5YA 1HDQA 4NJQA 4DYOA 2EK5A 3DLAA 2IA1A 2Z5UA 4ESBA 2GIZA 3WE3A 5J8FA 2RFHA 2ZNYA 1YITI 4B5OA 3BPXA 3PSIA 1M1EB 4MFZA 2RN7A 2ELHA 1KUXA 5K7ZA 3JAMZ 2O9LA 2KISA 1E2XA 1XMBA 4KN7X 1FT9A 5E1WA 2HYFA 1HDPA 3P9KA 2D0OA 2CUZA 4K2EA 1BR2A 1TWFJ 3TP0A 4UWIA 1X4OA 4C9YA 1JT0A 1YVOA 4CO9A 4EVIA 1S3ZA 3HTUA 2ZEHA 2EINH 1J7KA 2PQ8A 1ENHA 4IF4A 4UF4A 2DI3A 3PL8A 1IYLA 4MNUA 4D0PA 2LLKA 1JTXA 1X2MA 4CDJA 1YJ9I 3ECOA 2A4NA 3Q0VA 2XASA 3DLJA 4ZY0A 2AO9A 2H27A 2I79A 5IV0A 2ZXVA 2JJ7A 2EIJH 1M4LA 1TWAJ 1KU7A 4D9JA 2PJ7A 3RKWA 3MKZA 2YX4A 2D5VA 1XMTA 1QHHD 2ATRA 5H2FC 1ZYRF 1W36C 3CXPA 3A01A 2DTZA 1DPRA 5F1RA 2ZKZA 2YNCC 1DU6A 5HVQC 1TNSA 1VFCA 2O5RA 2M45A 5FVJA
chains in the Genus database with same CATH topology
3V8JA 3T8RA 2EA4A 4I7HA 1CP6A 2F7VA 2WYRA 3M8EA 2AFWA 1BJAA 1KU3A 4CZZA 1LOKA 1UB9A 4C99A 2CW0F 4B8XA 1R7JA 4OIDA 3KEOA 1JHFA 2ZENA 3IFEA 2PJPA 1XFOA 3TGNA 2UZKA 2V77A 5CJ9A 3PB6X 2PE3A 4A38A 3DF8A 2JBJA 4EJWA 3G3ZA 3D7DA 3NQOA 1IRFA 3F8NA 1O3QA 2CGPA 3D7GA 3SI1A 4AWXB 1W7PB 2W24A 3WODF 4C8CA 3E5QA 3N97A 2EFPA 1XN7A 1S7AA 2G7UA 1KU2A 3FM5A 3H92A 4KICA 2XAFA 3BI0A 4ZI6A 2OA4A 4XLPF 3O3KA 1BPNA 4JBAA 5LYLA 3SI2A 5HOOA 4R1HA 4RGXA 2EB7A 3CO7C 3V4GA 3D0SA 1CF7A 2FA5A 4TV7A 3O6BB 2M87A 5H6RA 4O5VA 1HKQA 5JGFA 2I3CA 3H3UA 4IRIA 2YSRA 1BOAA 1ZRCA 3SFZA 3GUXA 2XAGA 3QOPA 1ZG3A 5H6QA 3F23A 3REOA 3FH4A 4A5MA 4UXNA 4FHTA 3KHZA 3WC6A 4MRIA 5HVGA 1FYLA 5E1ZB 3WTVC 4HF1A 3BP8A 2ZEPA 3V7ZA 1OKRA 3M8FA 2Z33A 2CWEA 3R60A 2LDUA 4CDKA 4PCQA 2DW4A 1SD5A 2DBBA 3V7CA 1WRJA 1MZBA 5DUKA 3ZMDA 4C84A 1R23A 4C9VA 5E1XA 1KYWA 1LAMA 5ICCA 1E17A 4UIAA 2ZEMA 2DEAA 1I27A 2V1UA 2ZEFA 3RDIA 4L0ZB 3TO6A 4YIIA 2KIFA 5A2QZ 4H2KA 1LDKB 4QLCU 1PP7U 3ZMVA 4C9EA 1QZYA 5E8GA 3EYYA 1FLIA 4KMFA 3ZN1A 2PJCA 3WU0A 2HB6A 1OPCA 3S9LA 3FM3A 1CBXA 2QVOA 4XSZF 3WTTC 4R79A 5DS0A 3JAMK 4M6XA 1P4WA 5FLXZ 3CUOA 3GFIA 2DTRA 3LA3A 1WKMA 4Q5SF 1FSHA 4P55A 2GAUA 3I1UA 1K7AA 4KDPA 4P4IA 5HDGA 2XUBA 4G7ZF 3DPLC 1IN5A 3TOBA 4F8ZA 3KZWA 2QQBA 1ZHFA 1T39A 2ZEOA 4EWTA 1T2KA 3VFZA 1YIOA 5L3CA 2Y48A 4C8FA 4EGYA 1I6XA 4S04A 1VGYA 3B35A 4LB5A 4FT8A 1BI0A 5LGNA 4OP4A 3V8KA 2PJ3A 3GXOA 2MH9A 1XSVA 4A12A 4LB6B 4HQMA 1TBXA 4WXHA 2QQ9A 4FX0A 5FFZA 2H94A 4YN3A 3J80Z 3ZQ7A 4ESJA 1O3SA 3ZMZA 2V6CA 1JXSA 5HS8A 4W9YA 4ZZLA 4L9JA 4PXCA 5J1QA 3G73A 3HLPA 3BJAA 4EJTA 2C1CA 1Z6TA 1AOYA 1EV7A 1BI1A 5TRDA 4M73A 2MLGA 2E1CA 4L0YB 2PJBA 4R8HA 3T1BA 4R7MA 3V7SA 1S29A 5HS7A 4MTDA 3SXYA 2C6GA 5E8IA 1ZREA 1DTDA 4U0VA 3D7FA 1PUEE 1IRGA 2PFBA 4BHCA 3E6CC 2Q8KA 1U3EM 3H8EA 1ON2A 2C6PA 3KQXA 2V1DA 2ZJ2A 5ILVA 4A6EA 3F6VA 5DD8A 1S6LA 1QZZA 1XCBA 4ENNA 1U8RA 2M1BA 2NNYA 4C9AA 2O61A 2FNPA 3F3XA 2FBHA 3VOEA 2BEOA 1XF1A 3ABUA 3CT9A 3H8GA 2ABZA 4HLYA 1C0WA 3KETA 3CTAA 3TDUC 3FXRA 5EEHA 4HV5A 2LKPA 2LNBA 1J59A 2XEJA 6CPAA 4LG0A 1Z9CA 1R58A 2PJ2A 3MQ0A 1KQ0A 4RB1A 1NHAA 3BJOA 3GLXA 1YSJA 4A6DA 2O03A 4PPZA 2JZYA 1F2OA 3GF2A 1U5TA 4MHPA 1BBYA