3K9TA

Crystal structure of putative peptidase (np_348812.1) from clostridium acetobutylicum at 2.37 a resolution
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
435
structure length
422
Chain Sequence
GMEEINKYIQNSSETGGEIYNLIEELFPICRSITGNGVRKTMDIIRKHIPLEIHEVKSGTKVFDWTVPKEWNIKDAYVRNSKGEKVIDFKENNLHVMSYSVPVHKTMTLDELKPYLHTIPGNKDRIPYLTSYYKENWGFSLTQNKFDELCDDDYEVVIDSSLEDGSLTYGEYYIRGELEEEILLTTYTCHPSMCNDNLSGVALITFIAKALSKLKTKYSYRFLFAPETIGSITWLSRNEDKLKNIKMGLVATCVGDAGIKNYKRTKFGDAEIDKIVEKVLMHCGSEYYVADFFPWGSDERQFSSPGINLSVGSLMRSCYGFDGYHTSADNLCYMNKDGLADSYKTYLEVIYTIENNRTYLNLNPKCEPQLGKRGDEFAMFWVLNMSDGKNSLLDIAYKSGMEFRRIKYAADALYRVELLKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative peptidase (NP_348812.1) from CLOSTRIDIUM ACETOBUTYLICUM at 2.37 A resolution
rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase
molecule keywords putative peptidase
total genus 139
structure length 422
sequence length 435
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09940 DUF2172 Domain of unknown function (DUF2172)
A PF16221 HTH_47 winged helix-turn-helix
A PF16254 DUF4910 Domain of unknown function (DUF4910)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k9tA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3k9tA01
3.50.30.90 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3k9tA02
3HRUA 2D1HA 1Q7LA 3ZN1A 1F2PA 3PB6X 1ZG3A 2QVPA 4JZ0A 4A6DA 3GUDA 2R7FA 1IW7F 5BOXA 4PCQA 2OZ6A 4PPZA 1W5SA 3FMRA 2GLJA 2QYVA 3WTUC 1H0MA 1T6SA 4OC4A 1Z5RA 2DT5A 1I5ZA 3NRVA 5HVFA 1MJBA 1FBUA 3BPVA 1KU7A 2W57A 1LJ9A 2P7VB 1DP7P 4A37A 2FBIA 2AFWA 2V77A 3HHHA 3NH5A 1O7FA 4ESBA 1QMUA 1EE3P 2X4HA 3H8EA 1XD7A 4FBEA 4AIKA 4HX8A 3PEIA 1O3TA 1XSDA 1HW5A 4G7ZF 3FM5A 5CVIA 2MBFA 1R7JA 3V7ZA 3RKYA 1L3LA 1UFMA 3CDHA 3CTAA 4IRGA 5HDNA 5ICCA 1YFHA 2L54A 2ZNYA 1ZG7A 3TKYA 3N5FA 1WRJA 4A39A 4JQFA 3I58A 4LGWA 5IT9K 1KYZA 4KMFA 3FMCA 3BDDA 1TXRA 1C0WA 2VC1A 1TNTA 3WTVC 5HDKA 1T38A 4M72A 3CT9A 1TKHA 4U0VA 2PQ8A 2L01A 4RB0A 3WTWC 5K8MA 3GFMA 2HYGD 3N4MA 3T1BA 3B7IA 3QAHA 3F8BA 4L9JA 3F6OA 3GO5A 4Q48A 1ZGJA 5JFRA 1FC3A 3WTYC 4ESJA 2ZEOA 4FUUA 1LEAA 1CX8A 1S8NA 4YFXF 3IIBA 1XCVA 5LYLA 3SZPA 1BBYA 2PIYA 1YYVA 4P4BA 4M9XA 2NYQA 2W84A 3L7WA 1R00A 3S9MA 5DCFA 4U0WA 3B3SA 3I1UA 1VHOA 2EK8A 4OIWA 4ENMA 1ELMP 1Y0YA 2ANPA 1P6RA 2WZNA 3I64A 5FFXA 3W6JB 3P9KA 2VOPA 5CPAA 1K78A 1XJOA 1TBXA 1ZHFA 5DUIA 3H8FA 1SMTA 2PJ8A 2HQRA 1TF9A 5H6RA 2BOAA 3F23A 3SJXA 4NGRA 1IRFA 3K1PA 4G8XA 1R23A 4M6YA 3DFGA 2ZOFA 3PBEA 2J5OA 1B1BA 4L9TA 3SJGA 3HOTA 3IJ3A 4EJWA 1ON1A 2H6CA 4A38A 4LMYA 1RUNA 3EETA 2E1NA 4E70A 4AXVA 3IHUA 3ZMTA 4OKOA 3L9FA 4KT5C 4XSXF 1JGSA 4Y17A 2P5VA 5L3BA 5L3GA 1ZRFA 5IB9A 1XFOA 3HSEA 4TV7A 4EGYA 4IRHA 1YSJA 2XAQA 2VBZA 4G94A 1QQIA 2ACJA 1DDNA 1F57A 1YW8A 3C7JA 2EV6A 4MEYF 1XMBA 2HB6A 3MZHA 4AD9A 5BMZA 3IFEA 3DEUA 1G4DA 2DPDA 3BJOA 1FBSA 3GWZA 1OKRA 1XSVA 2PRQA 4PXBA 3VEPA 3QP5A 2DQRA 4UUVA 3E5XA 3TDUC 5FD5A 2CSOA 2K86A 2GIVA 2CF4A 5LRSA 4R8FA 3D7DA 3LSTA 3F8NA 4EJUA 2C6CA 1XB4A 1MDMA 3WC6A 2R3SA 3FWEA 3IRQA 1U5TB 2HDCA 3KP2A 4A0ZA 1SD7A 3KHZA 3GFLA 3VH9A 3O6BB 4YU9A 2NRAC 5HS8A 3IO1A 2JBJA 1IN6A 4RB3C 1EV7A 1YS7A 2ABZA 5DYMA 3FF3A 2O4HA 2Y48A 4CO8A 3GX4X 1QZZA 1R1TA 5FO5A 3JTGA 3IWFA 2ISZA 2EFNA 3V8KA 4ONWA 5E1XA 3MN8A 4OINF 4AIHA 5DDGA 2KKOA 3NH4A 2D45A 5BPDA 1EH8A 1VIXA 3J80Z 1FYLA 2IRFG 3WGGA 4UV8A 3KP7A 1YIOA 2F8HA 2EA2A 4KSIA 1IN4A 1FT7A 2VXZA 1J59A 4CICA 5ILUA 1O7LA 2P8TA 3B02A 4EWTA 2V8DA 2PJPA 1QO0D 3O2PE 4LLGF 2YPRA 2EV0A 3CO6C 2IQ6A 2IW5A 1SFEA 2FNAA 1R1UA 1S7AA 3GFIA 4OC3A 1HSJA 4LB5A 5FLXZ 3KL9A 4NJQA 2C1CA 1IXSB 4ZYQA 2OA4A 3HIFA 1YTYA 2CTCA 4B6ZA 3AAFA 4Q7AA 2A3SA 2MC3A 1D8JA 2ELHA 4I2OA 4I01A 3ELKA 3JSOA 3D0SA 5HLGA 3B2YA 4A2UA 1RNLA 5E18F 3HRSA 3C18A 3T8TA 4BHPA 2ZEDA 3LA7A 4FX0A 4S04A 3DP7A 4R79A 1BC7C 2VONA 2LSOA 1O3RA 4BQAA 1LEBA 2ZEPA 2RV8A 1P4AA 3RYRA 4HYEA 2EFQA 2Y0MA 2E7WA 1UWYA 3SXYA 4P55A 1Z6TA 4P45A 4R76A 1ZGAA 4KIBA 1CGPA 1OBRA 4Z2YA 5CVUA 5CVJA 1CP7A 3WGIA 4NGSA 4P96A 3E5UA 3RPUA 4HA8A 2WC2A 6PAXA 3GFJA 4EJVA 2O3FA 3M7GA 1OYYA 2XGXA 1Z2LA 1TF8A 1KQ8A 2ZEFA 4EQQA 5H6QA 4MHZA 1R36A 2O8XA 3EYYA 1SMYF 4L9VA 2V8HA 4RGUA 7CPAA 3WE3A 1MDMB 2F5FA 2IA0A 4F7ZA 1B4AA 1D8KA 2XASA 2L4AA 4HQMA 4XRFA 2MLGA 1JXSA 4LD5A 3CLOA 3LWUA 1PUEE 1VGYA 1P4WA 5JR3A 4R8HA 3MQ0A 2YU3A 1CF7B 2BCOA 2ZEHA 1BLLE 3KP6A 3SZTA 5LRJA 2IJLA 3H92A 2ESNA 2QWWA 1B9MA 3IC7A 3QU3A 1SD6A 2M5WA 5K8OA 1FLIA 3D67A 1FP1D 2BE5F 2M1BA 2QVOA 4M6XA 1LAPA 3REOA 2FF4A 4UHTA 3DKWA 5D6EA 5F6FA 2KRFA 3D68A 5EEHA 2VE8A 5TJJA 1Z9CA 4P4JA 2OZUA 1KA8A 1HW2A 1KU2A 4GYIA 2KJBA 2GZWA 1H9GA 5KVRA 1T98A 1AMPA 3WC7A 1J5YA 2V1DA 2LF8A 1PP7U 1FNOA 4ZZLA 1IY7A 3R4KA 1ZH5A 4UEFA 5BS6A 1OYWA 4LK1F 5J6XA 4YIFA 4RS8A 3C3WA 1IZ1A 1R1VA 1QNTA 6CPAA 1F4KA 4HBLA 2HKOA 3T8WA 3VFZA 1T0FA 4Q4ZF 1JE8A 3DF8A 4IHSA 4N9HA 3QNVA 5CVVA 5D4SA 5HXDA 5DD8A 3KP5A 3I0TA 1IRGA 5JI6A 2GA1A 2PJ0A 1NSAA 5LLQA 3P9CA 4IHMA 5LRRA 2OU2A 3CPAA 1X3UA 4RUHA 5BPIA 2NNYA 2LKPA 5LRGA 2P6SA 1Y0UA 4JBAA 2PE3A 4HZFA 3BXMA 2V79A 5F1RA 1XCBA 1LAMA 1IN5A 4HDVA 2FA5A 2ZENA 4XBFA 4ZYDA 2ESHA 3D4UA 3FH4A 3B3CA 1FT9A 1XSXA 2COMA 3U9GA 5JH9A 3M8FA 4IAVA 4IK2A 3QPTA 2BGCA 2P6TA 5ILVA 4G7OF 1I1GA 1YW7A 3ZN0A 2K7LA 2ZO4A 4ZYHA 4BHBA 4DUKA 3M8EA 2O61A 3BI0A 3WG9A 3JAMZ 3ABTA 2I3CA 3PB4X 4NJRA 1ONVA 3K9TA 1H9TA 4O23A 2CGPA 3RKXA 3TOAA 4XLPF 3KE2A 4HDUA 2LDUA 1HW1A 4Y15A 2Q0OA 3R0AA 4KICA 1FBQA 4OIQF 1B59A 4LLLA 4K2EA 3F8FA 3LMSA 5DEQA 1LDDA 3D7GA 1KGSA 3KR4A 4P4EA 1TQMA 1UCRA 2RQPA 3V8JA 4X3RA 1J7KA 2PJAA 2V8VA 3GZ6A 2PJ4A 3F8MA 5L3FA 2G7HA 1M4LA 1YW9A 5KK1A 4WF2A 4PDKA 1MKMA 3LWFA 4HLXA 1H8LA 2DO7A 3RPQA 1YLOA 2JPBA 4DNCA 1DUXC 4GO1A 3LA2A 3KASA 4A6EA 4P44A 1W7PB 1TTYA 2E1CA 2P7CB 2A69F 5E17F 4MXUA 2B0LA 1DPUA 4OIPF 3DV8A 2RDPA 4XLNF 3ERED 3OOPA 5FD6A 4EMEA 3M1EA 2MA3A 4RGSA 3R60A 4LG0A 2QYOA 2K4JA 3FXRA 2PJCA 1BOAA 2J5PA 4QWQA 4G7HF 3TO9A 3C1DA 2GXBA 4ZI6A 4F8ZA 2CO5A 2ZMEB 2PVWA 3FM3A 4OC2A 3RI4A 1P92A 3RZAA 1ZLKA 2NS0A 1TLHB 4EJOA 5HVHA 2PJ3A 1K6OA 1J75A 4KYWA 4PQAA 4NGMA 4NB5A 1SD4A 4IF4A 4UIBA 4CZZA 3T5XA 1GVJA 5DV5A 4CXFA 3D7HA 2FRHA 3GF2A 3ZMDA 1HSTA 2DBBA 4CHUA 1TW3A 2O53A 2RN7A 1BJAA 3QP6A 3LAJA 2R7DA 1G3YA 3IEHA 3BHXA 1W5TA 4BH9A 4MHPA 2NNNA 4LQGA 2O0YA 5E8GA 1IN7A 2L02A 3RDIA 2ZELA 4TWEA 4GXOA 3J7AO 4HX4A 3HRMA 4LB6B 4L9NA 4UVCA 5E20A 4I0AA 2Y75A 5THWA 1L0OC 1RZ4A 1Z6RA 5K8PA 1J0RA 1AOYA 3IWWA 2O6GE 1LANA 1JHFA 2FEZA 4HLYA 4OMYA 3Q9SA 2A68F 5JM6A 2P5LC 4UNOA 2XRNA 1I1SA 4M74A 3LFKA 2FMLA 4M73A 2RC4A 2MH9A 1R5GA 3GXOA 3V7SA 1USTA 1U5TC 2HS5A 4ZY1A 3LAPA 3ISXA 5LHIA 4HX7A 1V4RA 4IXAA 2DI3A 1BI2A 2RKHA 4CGZA 1RIOH 2PJ5A 2EJRA 4N0BA 3KETA 3LA3A 5LYIA 3BJAA 5HLIA 1YW6A 4DJLA 2PN6A 2QLZA 2AFXA 3K69A 3MFKA 2OOTA 3BI1A 2CG4A 2JRTA 2F2EA 2JBKA 4ASNA 2DLLA 3DGVA 2EWNA 3H8GA 3E6CC 5D8LB 3Q5FA 5LYDA 2HYFA 4WWCA 1LFWA 1IN8A 2EK5A 3H3UA 3V7RA 2OBPA 3HRTA 1ZLIA 1KWMA 1R22A 4F9UA 3GEZA 1R58A 1IXRC 3J81Z 2FVGA 4ETSA 3MEXA 2PJ2A 2MD5A 2NSMA 2EA4A 1J2XA 1BI1A 3GLJA 5DS0A 3TO7A 2QM3A 1SFUA 2Q8KA 1KQ9A 1U8RA 3R6SA 1W7PD 2QQAA 3Q9VA 3F21A 2V1UA 1REPC 2AFUA 4MCQA 1F1ZA 5ICFA 1PDNC 3SFZA 3SQNA 2XUBA 1KYWA 4EJTA 1ZG8A 4UVBA 3RTRA 4YIIA 2JT1A 5E8IA 3HTSB 2A07F 2ZBKA 2DAOA 1FY7A 1S7OA 2CYYA 1Z8LA 4KFCA 3R0JA 1UHWA 4L5IA 5ICGA 4UV9A 3PB7X 2HKXA 1FP2A 4G6QA 4JK1X 2UXXA 3MAJA 3PQJA 4OC1A 2XEFA 4KN7X 2HWVA 4EM0B 4X2TA 4GYGA 4PXCA 4LFUA 3D7FA 1B9NA 5ED4A 5D29A 1HQCA 1NHAA 5F64A 1CP6A 2HQNA 1PP8F 4CDGA 2YR2A 4PXEA 2L4MA 3JRUA 2Q4ZA 4OU0A 4PGHA 3QOPA 4OIRF 3CJNA 4NFRA 3E6DA 1KQ0A 4N9IA 1O3SA 2QUFA 3F3XA 4KDPA 4UIAA 3KCCA 2G9WA 2XAJA 1IXCA 4UEEA 1BAVA 4MCSA 3CUOA 3TDZC 4H0EA 3L2NA 2Z3YA 1BI0A 5HS7A 2HR3A 1ZREA 2CTBA 1U6GA 4G9YA 1WI9A 1XMKA 2PJ6A 3E5QA 2Z33A 2M45A 3HHGA 2H09A 5ICEA 2AXLA 1ARMA 3IRRA 2HFHA 2RB7A 3ISZA 3WTXC 1T2KA 1MD0A 4HF2A 1GYTA 1HKQA 2RNJA 3KEOA 4KIFA 4XSZF 3TQNA 4OP4A 3P7NA 2D1VA 4NGQA 4YFKF 4K3NA 2YX7A 1CF7A 4HAMA 1Z7UA 3HTUA 4CYDA 5ELYA 2IMOA 2WYRA 3PFIA 3T0YA 3KLNA 2JZYA 5JGFA 2A6EF 5E1ZB 4YWYA 2HOEA 1GXQA 4KNYA 2XKPA 2W24A 1PYTB 1LDKB 5EEGA 1YW4A 1Y7EA 2ZXJA 1OR7A 1OMIA 1FZPB 4GGGA 4O5VA 5HOOA 1FPQA 5I4MA 4L18B 3G3ZA 4WK8F 4OC0A 4KIGA 4MTEA 1YO5C 2PCUA 3PFEA 2E7XA 3EYIA 3J81K 1USSA 4OIOF 2LNBA 2ZEGA 1JHHA 3T8RA 1LVAA 1YG2A 3FMSA 4FX4A 3TOBA 4ZY2A 3GLXA 5LEKA 3QU6A 5K5RA 2VBWA 3VOEA 4WJBA 5E1WA 3ECOA 1BPMA 4UF4A 3V8LA 3DLJA 3B3VA 1FSEA 2GLFA 3RBUA 4P10A 3NEUA 1BC8C 2HGCA 3K0LA 2ZKZA 1YQAA 2PJ9A 2A61A 3V38A 4MTDA 4DYOA 2K27A 2Z99A 1BIBA 5LGNA 3WTTC 4NQWA 3KP3A 2F7VA 4QLCU 4UEZA 2STTA 4WXCA 4FHTA 1MGTA 2DU9A 4HQEA 4RB2C 3WU1B 3ZMSA 5CYVA 1I27A 4A0YA 3D5LA 4HV6A 2H6BA 2KIMA 2FBHA 4P4IA 3SHFA 3I54A 2PIZA 3WGHA 4LK0F 2K4BA 4OMZA 1SD5A 2ADUA 1MJAA 2IT0A 4D0PA 2GA2A 4IRIA 3KZZA 1HKSA 4ESFA 5H20A 1D3YA 2PVVA 5F09A 4P9FA 1LCPA 2D2WA 2KIFA 1U5TA 4HF1A 2FOKA 3RIRA 4M71A 2CW0F 1S29A 2IA1A 3PFOA 1ZLHA 5JHUA 5L3CA 1A04A 4MQVA 3RKWA 2AS5F 4L5JA 5FGMA 4P9UA 4H2KA 4RGRA 1FWZA 3E6MA 4U7BA 2AFSA 1W4MA 3L09A 4A5MA 1UB9A 4B8XA 2CFXA 3P9IA 3PRTA 4PGGA 2DK8A 4MRIA 5D6FA 2AFZA 3K1MA 1CBXA 4AIJA 1T39A 3GW2A 2XEIA 1HEEA 3FJUA 3IWZA 1FYKA 1ZRCA 3FEDA 3ZMVA 1J9IA 4TNUA 2JSCA 2V8GA 1G3SA 3E97A 1DPRA 1K79A 3E6BA 3TO6A 4RB1A 5D5XB 5HLHA 5HVGA 2XV4S 3KQZA 2EK9A 2DEAA 1XGNA 5A2QZ 3FECA 1CG2A 3S9NA 4EGZA 1P2FA 5JVTA 1QGPA 5AONA 3IKTA 1PCAA 2PFBA 4RAZA 3IKVA 5LBQA 5LGTA 4ENKA 2EB7A 5IT3A 3GUXA 4R6TA 3I71A 1D5VA 2LF7A 1BM9A 4EM1A 1ON2A 3KZWA 4MGRA 1B6AA 4OIDA 3SI2A 2WV0A 2YX4A 5DCMA 2O03A 2DPUA 3L00A 3SJFA 5TRDA 5D5VB 4P5OA 3JW4A 2K02A 1TNSA 2BYVE 1LOKA 3VB2A 1U2WA 3KI9A 4MCRA 2Z9OA 2UZKA 1ULYA 2FU4A 3S9LA 4G6DA 2BV6A 1QQ9A 3ZPLA 1XDSA 4ZX9A 4ZX8A 4R7MA 3NA6A 1YLFA 3KEQA 4UXNA 1VTNC 5FFZA 1OYIA 3FXUA 4MQ9F 3SJEA 1YS6A 3GYHX 4LG0B 3QRFF 2P5KA 2IA2A 3CUQB 1ZARA 1HDQA 3DPTA 2PBIA 4W9YA 4WCGA 1XGMA 3FEEA 2HEOA 1V3FA 3DPLC 2HZTA 2M87A 1QPMA 1Z91A 4KA4A 1ELLP 4Q47A 4Y13A 2RGVA 1DTDA 4ZH4F 2XAFA 1BPNA 2OAZA 1MJ9A 2EV5A 2IP2A 4FAIA 1XN7A 2DW4A 1LDJA 4OMEA 2V1XA 3G73A 1WWXA 3TX8A 5J8CA 2QZ8A 2ZFWA 4JYWA 1ODDA 1IF1A 1E17A 1BIAA 3V4GA 4BYYA 4X8IA 3DXJF 4MCPA 2G9DA 1R5HA 1STZA 2W85A 3ZQ7A 4I98B 3U2RA 3VARA 2FSWA 2P4WA 1FX7A 5IT9Z 1U78A 5D5WB 2VBYA 4MHGA 1ZG9A 4B09A 2FXAA 3MZYA 4GCVA 2XVCA 2HTJA 3K2KA 3EQLF 3N97A 1K78B 2PJBA 5HVQC 5CVRA 2FNPA 4MHNA 1FYMA 2C6YA 4MMOA 1ZRDA 3EDPA 2PLYA 5FLXK 2GU2A 3B35A 2VOOA 4R1HA 2PJ1A 2XAGA 1U3EM 1ZG5A 1TQIA 1LQ1A 5K8NA 3BZ6A 1Z05A 2ETHA 2XEGA 2EFWA 3ISPA 4WXDA 3JTHA 2NYXA 2KIUA 3O3KA 3WODF 5LHGA 1RTQA 2STWA 5D8NA 3NQOA 2GXGA 4AWXB 3KR5A 2CQKA 2EFOA 4IJAA 1Q1HA 2IJZA 2L3DA 4DQ2A 5LEJA 3GB0A 3J80K 2FQ3A 3B3TA 4M9ZA 3GZ5A 1R43A 1FSHA 2BBYA 2C6GA 2V9VA 4WXHA 3E3VA 4ENNA 3WABA 2VODA 4U88A 2M8EA 3MRUA 2C6PA 3WC5A 4KMUX 4F9VA 2XIGA 3IC1A 5DD4A 2CWEA 3FVLA 5D5UB 5CLSA 4NHJA 4U7DA 3L2CA 1S6LA 5AIPA 2HTSA 3U1DA 4A5NA 4O3MA 4ZYGA 1XDUA 1S3JA 1W7PA 3HLPA 1XGSA 4I02A 8CPAA 4IPAA 1WSUA 1GXPA 3WE2A 3WT4A 3K2ZA 2PJ7A 1G3TA 2BO9A 1ARLA 5LGUA 2ZOGA 2VT3A 1HDUA 4PXDA 4ZY0A 3HUVA 3MCZA 1F2OA 4I0BA 2ZCWA 2IVMA 3WTSC 2OD5A 1F9NA 2CIJA 3V7CA 1LB2A 2GWRA 5HS9A 2ZMEA 1ZN2A 2VE9A 4Z65A 1XGOA 4FWUA 4EM2A 3K1NA 1FNNA 1Z1DA 4IVNA 4RGXA 2JTVA 2TDXA 1UHMA 2MLKA 1MZBA 1TKFA 2VT2A 2V6CA 4M9SA 2VC0A 5LRKA 2PEXA 3ZMZA 3I5UA 2RFHA 4YFNF 5D8KB 2NAZA 2WTEA 4P4DA 3TC8A 2J9AA 2QBYA 3TGNA 2MH2A 2ISYA 4AVPA 4P4FA 3HUGA 4A94A 3CUQC 1Y0RA 3GVAA 5LHHA 1RUOA 3D66A 2ZJ2A 2KJCA 1E2XA 3BPXA 5AIQA 2QQBA 2VN2A 3FF5A 3BP8A 4MHYA 4O6JA 2DK5A 2QBYB 2WWYA 3FMQA 4KN4X 4BHCA 3M9AA 2BEOA 3KQXA 2F5DA 2JPCA 2W25A 2QJ8A 1SAXA 3F6VA 1IAWA 5A2QK 1ZG1A 4BD9A 5J1QA 1XBUA 3KP4A 4CPAA 3LQRA 4ON0A 2M30A 1O57A 2AFMA 4NGNA 1GHCA 1TKJA 1BI3A 3VATA 3FX6A 3S2WA 5K5QA 2FMYA 1QZYA 1IGBA 3PB8X 2DQLA 3F72A 1QBJA 3CDXA 4HW0A 3NH8A 3KHXA 2UXNA 3I59A 2POKA 2OQGA 2IPQX 4FT8A 5K1YA 2X0LA 1HBXG 2ZEMA 3PBBA 2XHKA 4UVAA 3HSRA 1LNWA 1F5TA 4MNUA 5L3DA 3BROA 2Q51A 3RYPA 2OQRA 2VL1A 1WKMA 1YMEA 1G3WA 2VBXA 5DCMB 4A12A 2DFIA 3HYIA 3ABUA 2GQQA 4HOBA 4U0YA 5J8FA 2EFPA 3PB9X 5ERIA 5D4RA 1EH6A 1SFXA 4YG2F 5L3EA 3JSPA 1AWCA 4ZYEA 1RI7A 3BWGA 5FB2A 3KLOA 2UWMA 3BJ6A 3F8CA 4I7HA 2QENA 3ZP5A 2Z5UA 3EUHA 3ZMUA 4BNCA 5CBMA 3HSFA 1IUYA 2ZEEA 3IL2A 2YSRA 3NFZA 4G1PA 4P6YA 1TQPA 2PG4A 3ROUA 1XRYA 2DTRA 4BXUA 1AYEA 3ECHA 3I59B 1I6XA 4WX9A 2F5CA 2A5YB 1WQ2A 2Q2EA 5ILSA 3H3ZA 1K7AA 4EMSA 1TW2A 2AFOA 2GAUA 1KU9A 4OOIA 3CPXA 2ZNZA 3BOQA 3QPHA 3ULQB 3KZYA 4MEXF 4EV0A 1EH7A 3RAMA 4EVIA 4LJZF 3ML6A 3CO7C 4BAYA 3OV8A 2F5EA 5BQTA 2H94A 1CPXA 3B73A 2H27A 3R61A 2XROA 4A0XA 3MWMA 2XKOA 5K5OA 4IHTA 1FOKA 2PMHA 4PZJA 4Q5SF 3I53A 3CUQA 3WTZA 4EFDA 1KU3A 2Q43A 3B3WA 1BN5A 4OC5A 3KFWX 2A6HF 2RVCA 4LLNA 1HKTA 1OPCA 4L0YB 1G6NA 2FBKA 2PI0A 2HC9A 3SI0A 2XAHA 3VODA 4HF0A 3BY6A 1R3NA 4ZZDA 2QQ9A 3DQVC 2JEWA 4I09A 5DUKA 2XEJA 3FXQA 3F22A 3RJPA 2G7UA 5CJ9A 3I4PA 4NGPA 3SI1A 3LQQA 1P4XA 1O3QA 3KGQA 4RAYA 4S05A 2FE3A 1HXDA 3FHZA 4NGTA 3WU0A 1ZYRF 5HDGA 2EWBA 2PMUA 1JQGA 4L0ZB 1XMAA 1CPSA 3PQKA 2GREA 4ENJA 1VHEA 4WWVA 3HOSA 1ZAOA 3JAMK 3FX3A 4KUMA 4GM5A 3COAC 5LYFA 1ZLJA 4HV5A 3W6KB 2OR4A 1DE4C 3FZVA
chains in the Genus database with same CATH superfamily
3CESA 3HRUA 2D1HA 1Q7LA 1S7LA 3ZN1A 4UUSB 1F2PA 3PB6X 1ZG3A 1U8BA 1GV2A 3M3YJ 2QVPA 2NVYJ 4A6DA 3ABKH 1YLEA 4B4CA 2DA3A 1NG7A 3GUDA 1Y7RA 2R7FA 1IW7F 2M0MA 5BOXA 1U6MA 4UFXA 3HM5A 4PCQA 2IL4A 4YIRX 1MNEA 2GLOA 1VBGA 2OZ6A 4PPZA 2JWTA 1W5SA 4HKFA 2Y69H 1ZO0A 3FMRA 4CZCA 1IB1E 2GLJA 5JLWA 2QYVA 1RO5A 3WTUC 3ZOBA 1V55H 4YEJA 1H0MA 3IWEA 1T6SA 4OC4A 2XC7A 3AG3H 1EJ9A 1Z5RA 2ODFA 2DT5A 1I5ZA 3NRVA 5HVFA 1OJLA 2XPVA 1MJBA 2ATRA 2ZW4A 4JVOA 5HNHA 1FBUA 4A31A 3BPVA 3LSRA 1KU7A 3K4CA 2W57A 1LJ9A 2P7VB 1DP7P 4A37A 4FE7A 4CRZB 1SC7A 2FBIA 3GZNB 4QSHA 2AFWA 4AU7A 3FIXA 4Y3OA 2X1EA 2V77A 3HHHA 3NH5A 4HEA2 1O7FA 1RR8C 4ESBA 2Q44A 1QMUA 1EE3P 2X4HA 3H8EA 3DTIA 1XD7A 2BW3B 4CAWA 4FBEA 4AIKA 1VQ5I 4JYKA 4HX8A 3PEIA 1O3TA 1LE8A 3BCBA 1XSDA 1HW5A 1W0UA 4G7ZF 4GFBA 5GAHJ 4C84A 5DWMA 3PIOF 3FM5A 5FROA 3G1LA 5CVIA 5ISVA 2GIZA 2MBFA 1R7JA 4Z6YA 3V7ZA 3RKYA 4CGPA 3RNZA 1L3LA 4X6AJ 1UFMA 3CDHA 2CW7A 3CTAA 4IRGA 5HDNA 1TL8A 2VXKA 5ICCA 1YFHA 2L54A 4Y52J 5M5WJ 2ZNYA 1ZG7A 3TKYA 1JGGA 3BQYA 2VUMJ 4XOPA 4BXFA 3N5FA 3H36A 1Y8QB 2XF7A 4NF1A 3JRIA 1AHDP 1Y9WA 1WRJA 4A39A 4JQFA 3I58A 4LGWA 5IT9K 1YRNB 3GTPJ 1KYZA 4CDKA 4KMFA 1AU7A 2F6CA 3FMCA 4C9YA 3BDDA 2X6XA 5FKOA 1TXRA 4XLEA 2VJ5A 1C0WA 4B12A 1MBHA 2VC1A 1TNTA 3WTVC 5G1ZA 5HDKA 2IS4A 1T38A 4M72A 1YQEA 3CT9A 1TKHA 3RO0A 4U0VA 2HWGA 3C26A 2MD0A 2PQ8A 2L01A 4RB0A 3WTWC 4A32A 3GFMA 5K8MA 2HYGD 3N4MA 3T1BA 5EEAA 2ZJPF 4H6ZA 2VPLA 3B7IA 2R7RA 1UMQA 3QAHA 3F8BA 4L9JA 2NMTA 3F6OA 2HVSA 4H1HA 3H4QA 3LSHA 3GO5A 4Q48A 1ZGJA 5JFRA 1RKWA 3HEFA 1FC3A 5IYCJ 3WTYC 3S2HJ 2MG4A 1H88C 4IHWA 4ESJA 2B63J 3LOCA 2ZEOA 2C27A 1NTCA 4FUUA 1LEAA 2XSDC 1S8NA 4YFXF 1CX8A 1FOWA 1XCVA 4B47A 4DBQA 3IIBA 5C88A 5LYLA 1XTAA 2ELKA 3SZPA 1BBYA 2PIYA 1YYVA 4JLYA 4P4BA 4BJ5C 4M9XA 2NYQA 2KHMA 2RREA 4X5KA 2W84A 5DM6F 4Y49B 3L7WA 1YK3A 1R00A 3S9MA 5DCFA 3H9QA 4U0WA 3B3SA 2O9LA 3I1UA 1VHOA 2EK8A 4BGDA 4OIWA 4ZDLA 4QC6A 4ENMA 1ELMP 1Y0YA 2ANPA 5KTAA 1P6RA 1X3ZB 2HXIA 3DLAA 3I64A 2WZNA 4C2XA 3TLGA 5FFXA 3W6JB 3CZXA 1YIJI 3P9KA 2VOPA 2JVGA 1K78A 5CPAA 1XJOA 1TBXA 1ZHFA 5DUIA 3MKYB 2M8GX 1T33A 3BR3A 2EIMH 1XIXA 3H8FA 1SMTA 3PIPF 2PJ8A 4CYQA 2HQRA 3Q0WA 1TF9A 5J1UA 5H6RA 2BOAA 3F23A 2R5YA 3SJXA 2GM4A 4NGRA 1IRFA 3K1PA 4G8XA 1R23A 1ZGWA 1FOXA 4M6YA 1OCOH 3DFGA 2ZOFA 3PBEA 4IQ4A 2J5OA 1B1BA 1IYLA 5A28A 3CCLI 3IWGA 1RKTA 4L9TA 3SJGA 3HOTA 1MSEC 3IJ3A 4EJWA 1ON1A 4HSTA 2H6CA 4A38A 1V54H 4LMYA 3LSJA 4MY0A 1RUNA 2FSRA 4H89A 3EETA 1YHQI 2Z3MA 2J8MA 1I3QJ 3LODA 2GXAA 2E1NA 2Z3OA 1EA3A 3RQIA 4B44A 4E70A 3S3NA 4AXVA 3IHUA 3A9LA 2R7XA 3ZMTA 4OKOA 3G71I 2OCEA 4GS4A 3L9FA 2MYSA 4KT5C 3CMAI 2HOAA 4XSXF 3OYKA 1JGSA 4Y17A 3MKZA 3HPHA 3UKGA 2AHQA 2P5VA 5L3BA 5L3GA 1ZRFA 3GTKJ 5IB9A 1XFOA 3HSEA 3PO3J 2FOWA 2VL8A 3LFUA 3I9SA 4TV7A 3AL0B 4EGYA 4IRHA 1YSJA 1ZR4A 2IS2A 2XAQA 2VBZA 4G94A 1EKEA 2IBDA 3OYCA 2CQXA 3DLLF 1DP3A 2Q4YA 1QQIA 4IIXA 5LFAA 2ACJA 1G2HA 1DDNA 1F57A 1YW8A 2M0CA 2DCEA 3C7JA 2EV6A 4MEYF 1XMBA 3OR2C 4RAFA 2HB6A 5E79C 3MZHA 2LC2A 3H5ZA 2A6TA 4AD9A 3MD2A 3KX2A 5BMZA 4LIVA 1MK4A 1R6RA 2LBFB 3IFEA 3DEUA 1G4DA 2DPDA 4E7KA 4C7IA 2XAUA 3H5NA 3KEYA 4DZJA 4A3MJ 2NVXJ 3BJOA 1KBLA 1FBSA 3DPUA 3GWZA 1OKRA 1WVMA 3EUHC 1XSVA 2F4MB 1P7JA 2PRQA 4PXBA 5FKLA 3VEPA 3QP5A 4YN3A 2DQRA 2ZMEC 2E19A 4UY8I 4BACA 4AG7A 4UUVA 2CQQA 3E5XA 4CYPA 3TDUC 5IB0A 4LIUA 5FD5A 4BY1J 5FRMA 2CSOA 2K86A 5JLXA 1R57A 2GIVA 2CF4A 4M3FA 4N4NB 5LRSA 3TT2A 4CGNA 1TWFJ 4KOVA 4R8FA 3D7DA 3LSTA 3F8NA 4EJUA 2C6CA 1TZLA 1Z4EA 1IJWC 1XB4A 1MDMA 2F5VA 3WC6A 2R3SA 4XMYA 3FWEA 3IRQA 4CYOA 2W4SA 1U5TB 5I0CA 2HDCA 1ZL0A 3KP2A 3D5RC 3MN2A 4A0ZA 1SD7A 1HLVA 3KHZA 3GFLA 3VH9A 1DIKA 3O6BB 3TLZA 3OYDA 4BEHA 4YU9A 4QPOA 3DR8A 2EZBA 2HZDA 2NRAC 4XIDA 5HS8A 4UCPA 2DPTA 3A0BC 4EEFG 2TCTA 3IO1A 1YR0A 2L7KA 2DODA 1IN6A 2JBJA 3G1OA 1NK3P 2LK2A 4RB3C 4FISA 1EV7A 1YS7A 2ABZA 1NXJA 5DYMA 2M2EA 4KNGE 4MFPA 1CJWA 3FF3A 2O4HA 2Y48A 1ZELA 4CO8A 3GX4X 4I76A 1QZZA 1R1TA 2DOEA 5FO5A 2QCOA 3JTGA 4K30A 2DIKA 3IWFA 2JA8J 2ISZA 2EFNA 2FIAA 3V8KA 3FHNA 2CU7A 4ONWA 5E1XA 2L9NA 2W7NA 2YNEA 3K4KA 2E28A 2KL4A 3MN8A 4OINF 4AIHA 3HC7A 5DDGA 2KKOA 3F0CA 1ON0A 1QSTA 1ETXA 3VTAA 3NH4A 1ZRSA 2D45A 1QSNA 4CUGA 4LITA 5KAFC 5BPDA 1EH8A 1VIXA 3Q0UA 3J80Z 2LMDA 2W48A 1FYLA 2IRFG 1X1BA 1X4OA 3WGGA 1NSLA 4UV8A 2Z11A 2LR8A 3KP7A 3SDGA 1BJZA 1YIOA 3KRVA 2Y0SN 4M6VA 2F8HA 1V6CA 4BINA 1QHHD 4II2A 2EA2A 4KSIA 1IN4A 2LREA 2BVMA 5EZHA 3S15J 1FT7A 1K61A 4F0YA 2VXZA 3VYSB 4CICA 3L2WA 1J59A 3ZGKA 5ILUA 1O7LA 2B3UA 4R9MA 5AG7A 2P8TA 3SXOA 4XOTA 3B02A 5KNLA 4EWTA 5IP9J 2PJPA 1Z77A 4A69C 2V8DA 5JVGF 1QO0D 3O2PE 2ZSHB 3CZ6A 5J1YA 4L89A 2JN6A 4NQWB 4LLGF 4MFJA 2YPRA 2EV0A 3CO6C 2DF5A 2IW5A 2IQ6A 1S7KA 1SFEA 2FNAA 1R1UA 2KMUA 1S7AA 4FQGA 4XLFA 3GFIA 2E34A 2D5VA 1HSJA 4LB5A 5FLXZ 3KL9A 4J3GA 2C1CA 4NJQA 4B5PA 1IXSB 4ZYQA 2KRCA 2OA4A 4IO9F 3BCAA 3HIFA 1YTYA 2BXZA 1B6BA 2FIWA 2CTCA 4XONA 3ZQCA 2R98A 3BLYA 5H86A 4B6ZA 2XB0X 5AGEA 3AAFA 4Q7AA 2A3SA 4UWJA 2MC3A 4KLVA 1OISA 1D8JA 2ELHA 4I2OA 2M4GA 4I01A 2ZB9A 3ELKA 5EG0B 1AKHA 2HVRA 3FKIJ 4AM3A 5F1JA 3M8JA 5CPRB 2QSHX 3R9EA 3JSOA 3BTIA 3D0SA 4BL0B 5HLGA 3B2YA 5KTDA 2D4OA 4A2UA 2IEKA 1RNLA 1L0CA 5E18F 2QSFX 1MW7A 3WG7H 2Z10A 3HRSA 2LKXA 3C18A 3GTLJ 3T8TA 5IOYA 2L5QA 4BHPA 3D5SC 3PL8A 1DU6A 3CC7I 2ZEDA 3TLAA 3PSIA 2CS3A 3PM1A 3LA7A 4FX0A 1I39A 4MO7A 4S04A 3DP7A 4R79A 1BC7C 3V8IA 2VONA 2PMZA 2LSOA 1O3RA 4BQAA 1Z4RA 1LEBA 2ZEPA 2RV8A 1P4AA 2WAEA 3CQZJ 3RYRA 1DU0A 2JDDA 4ORFA 1JDBC 1FMVA 4HYEA 2Q1ZB 3TLCA 3TW7A 2EFQA 2Y0MA 2E7WA 1UWYA 4M6IA 3SXYA 1YI2I 4P55A 1Z6TA 4P45A 1WHUA 4R76A 1ZGAA 4KIBA 1MBFA 1CGPA 1OBRA 2GOXB 4Z2YA 5CVUA 3DTEA 5CVJA 4DGWB 3QAYA 2DMPA 1CP7A 3FXOA 3WGIA 4P96A 3E5UA 4NGSA 2BVLA 4U5YA 3RPUA 4HA8A 5GTIC 2EIJH 2DYRH 2WC2A 1T8IA 3HOVJ 1M44A 6PAXA 3GFJA 4EJVA 2O3FA 3M7GA 1YX0A 3DDDA 2EQRA 1VKCA 1OYYA 2XGXA 5JPHA 1IDZA 3M4OJ 1Z2LA 4E0AA 4HNUA 9ANTA 1TF8A 4PFOA 4OWRB 1KQ8A 2HQAA 2ZEFA 4EQQA 5H6QA 3TMOA 4MHZA 1R36A 1TWCJ 2O8XA 3EYYA 3BI1A 1SMYF 4L9VA 2V8HA 4RGUA 2DPSA 3WE3A 1MDMB 7CPAA 2F5FA 2R8VA 3DR6A 2IA0A 4F7ZA 3OYBA 1B4AA 1D8KA 1LFPA 3ASOH 2XASA 3CDLA 2L4AA 5KAIC 4HQMA 1ETYA 1D0YA 5IR2A 1BR1A 3CCYA 4XRFA 1KZFA 4KT6A 2MLGA 1JXSA 2K85A 4LD5A 4C86A 4S0HB 3ZQLA 1M1DA 1A36A 5H2FC 2JK3A 3CLOA 3LWUA 1PUEE 1VGYA 5KTCA 2R7HA 3K2AA 2A5WA 1P4WA 5JR3A 4IHXA 3HKZA 4R8HA 3MQ0A 4KVXA 4KOXA 2YU3A 1CF7B 3TL4X 2BCOA 2ZEHA 1A6QA 1BLLE 3KYCB 2EZIA 2WBMA 4NBQA 3KP6A 1YX5A 1BL0A 1EZBA 3SZTA 3DKXA 4A3IJ 4CRYB 1P9QC 3VDXA 5LRJA 2IJLA 2KCWA 3H92A 2ESNA 3I6SA 1Y9ZA 2MGQA 2O7OA 2QWWA 2PR8A 4QUSA 4YGOA 4XLHA 3G6EI 1B9MA 3IC7A 2XF5A 3QU3A 1SD6A 2M5WA 5K8OA 4FD6A 3CCJI 1FLIA 1S9HA 5A27A 3EUKL 4MJXA 3D67A 1FP1D 2BE5F 2DMUA 1LVKA 2M1BA 2K9SA 2QVOA 2K5CA 4M6XA 5HODA 4BE2A 1Y39A 1LAPA 1UFHA 4DJAA 3REOA 2YNCA 4U9YA 2FF4A 4UHTA 3DKWA 5D6EA 2K3FA 2KRFA 5F6FA 2H1KA 3D68A 5EEHA 2VE8A 5TJJA 3OYHA 3GTGJ 4PSXA 4KSAA 1Z9CA 4P4JA 2OZUA 1IOFA 1WH5A 1KA8A 1RC9A 3LSKA 1HW2A 3HDDA 4EVYA 4C99A 3N05A 1KU2A 3BJ7A 3HGGA 2KJBA 2GZWA 4GYIA 2CV0A 1H9GA 5KVRA 2CQ7A 1T98A 4BQQA 2VIXA 1ZYMA 3H1CA 1AMPA 2HVQA 3WC7A 2EH3A 3L2RA 1J5YA 2V1DA 2LF8A 1PP7U 1KEEB 3JRBA 3CF5F 3H0GJ 2UUZA 1FNOA 1OFCX 1TWAJ 4ZZLA 1IY7A 3A4CA 3R4KA 3JRGA 1ZH5A 4D5CA 4UEFA 5BS6A 3TW6A 1OYWA 4LK1F 5J6XA 2P81A 3GCMA 3IP4B 2Y30A 4CCMA 4RLQA 4DYCA 3MKLA 3HXLA 4YIFA 2R5ZB 3ZQFA 2Y9YA 4RS8A 4UA3A 3C3WA 1IZ1A 4C9UA 2B4DB 1R1VA 3D2MA 1QNTA 4E2AA 2JRMA 6CPAA 1F4KA 4IL6C 1UAAA 1CM0A 1E0EA 4HBLA 4HPSA 3L1PA 3BG9A 1I21A 1HDDC 2VB6A 3PSFA 4FE4A 2HKOA 1LPQA 3T8WA 3VFZA 5B1AH 3S2DJ 1FTZA 1T0FA 5EDNA 4Q4ZF 4HSRA 4JX5A 3DF8A 4MFDA 1JE8A 4IHSA 4N9HA 3QNVA 5CVVA 5D4SA 5HXDA 3R9FA 5DD8A 3KP5A 5GAEJ 3ABLH 3I0TA 1AUGA 4RM2A 1IRGA 5JI6A 2GA1A 1EF4A 1NSAA 1G59A 2PJ0A 5LLQA 3P9CA 2L2OA 2CNMA 4IHMA 1B87A 5LRRA 2OU2A 2PDOA 3CPAA 2DOFA 1SVOA 4C8FA 2EINH 1X3UA 1SQHA 2X6OA 3O8HA 2LKPA 2NNYA 3S3MA 5BPIA 1JT6A 2A4NA 2P6SA 5LRGA 4F6AA 3EZEA 2L7ZA 1D0ZA 1Y0UA 4ZDPA 4B3XA 2IGOA 4JBAA 2PE3A 2X1DA 4HZFA 2XDVA 1JKQC 3BXMA 2V79A 5F1RA 3LACA 3EZAA 5F08A 4A3JJ 4PV6A 1XCBA 2AJ6A 5M3FJ 1LAMA 1IN5A 3CC4I 1X3WB 4HDVA 2DMNA 2FA5A 2M7AA 3OYIA 5F27A 5CNPA 3OWCA 2ZENA 2DFHA 1U0JA 4XBFA 4YRHA 4I99C 2EO8A 4B10A 1ZTRA 1H89C 4ZYDA 2F5IA 2ESHA 3D4UA 3FH4A 2E60A 2KZVA 2VJJA 3B3CA 3LD2A 1FT9A 1XSXA 2COMA 3JCUC 3U9GA 1MMSA 5JH9A 3M8FA 1BR2A 4BE1A 4ZDOA 4IAVA 3QPTA 1V5GA 2BGCA 4IK2A 2P6TA 5ILVA 4G7OF 1R61A 1I1GA 4MBUA 1X12A 1YW7A 1JKOC 3ZN0A 2Y31A 2K7LA 2ZO4A 4ZYHA 4BHBA 4DUKA 3IU1A 3JRCA 5IY5H 4DYQA 3M8EA 4A3KJ 3IH2A 2O61A 2IS1A 4KLWA 3LSGA 3BI0A 1LE8B 3BT9A 3TTHA 3QPLA 3WG9A 3JAMZ 3D8PA 4B5OA 3ABTA 3HOUJ 2I3CA 3PB4X 4NJRA 2B5GB 2Q4VA 1ONVA 3K9TA 1H9TA 4O23A 2CGPA 3RKXA 3TOAA 1Z3XA 2L7FP 4XLPF 3OSGA 3KE2A 5G20A 4HDUA 2LDUA 1HW1A 4Y15A 2Q0OA 1MH4A 3J7ZI 4BQOA 2VEZA 3R0AA 4KICA 1FBQA 3Q3SA 4OIQF 1B59A 4LLLA 4K2EA 1ZKGA 3F8FA 3F0AA 3LMSA 2GANA 5DEQA 1LDDA 1JTXA 2W82A 3ONQA 3D7GA 3P2HA 3FXMA 2LYCA 1VQ9I 1KGSA 1OCPA 4BJTA 3KR4A 4P4EA 1TQMA 1UCRA 2RQPA 3V8JA 4X3RA 2EBJA 1J7KA 4ZTFA 1ZR2A 4RDUA 1M4GA 2PJAA 2V8VA 4MI1A 2QGUA 3GZ6A 3IH4A 1VQ8I 2PJ4A 4HNWB 4CS0B 3T0TA 3F8MA 3S14J 5L3FA 5F46A 2G7HA 1M4LA 1LKXA 3O8GA 1YW9A 2BY2A 5KK1A 1WK4A 4E7SA 3T05A 1ITYA 4WF2A 2ARHA 3DBRB 2VPRA 2B4DA 4JX6A 5J4YA 4PDKA 5F9MA 3CXQA 3C2BA 2DA5A 5FLVA 2B4BA 3H5AA 5AG4A 1MKMA 3LWFA 4HLXA 4JOMA 2MFZA 1X2MA 5FKKA 4RMNA 3S1MJ 1H8LA 2DO7A 3RPQA 5HNFA 4D1QA 3UNGC 1YLOA 4FD4A 3S8PA 2JPBA 4DNCA 1DUXC 4GO1A 3HOYJ 2YNCC 3LA2A 4ZBGA 3KASA 4A6EA 3X2QH 5E3MA 4P44A 1WJAA 1W7PB 5G21A 1TTYA 2E1CA 3DTKA 2P7CB 2A69F 2KLOA 3QQAA 5E17F 2VQYA 4M3SA 3CDIA 2B0LA 4MXUA 1DPUA 4OIPF 3DV8A 2RDPA 4XLNF 3ERED 3OYFA 3PGPA 4PFPA 3OOPA 5FD6A 4EMEA 3W6VA 2Q04A 4UUTA 3M1EA 3JVNA 2MA3A 1X58A 2R7OA 3R60A 4RGSA 1WI3A 4LG0A 2KDZA 2QYOA 2K4JA 1A2ZA 3AG2H 3FXRA 1HA8A 2PJCA 2EVNA 1KC7A 1BOAA 1UG2A 2J5PA 4QWQA 2V6EA 1NG6A 4G7HF 4ZYAA 2EIKH 3SEQA 3C1DA 3TO9A 2GXBA 3V42A 4CGOA 1K4JA 2R1IA 4C3JJ 4ZI6A 1X1DA 4DOZA 1OR7C 4F8ZA 1X4PA 2CO5A 1J3LA 1WPKA 1NMTA 3DU6A 4XNHC 2M9HA 4I6ZA 2ZMEB 1N75A 2PVWA 3IV5A 3FM3A 4NEXA 4OC2A 2I8DA 1P92A 1V5EA 4IEJA 5IP7J 3RI4A 1OCCH 3RZAA 2Q2EB 1YJ9I 1AKHB 1ZLKA 5B1BH 2NS0A 1TLHB 4EJOA 5HVHA 2DA6A 2JA6J 4NDLA 1MNMC 2PJ3A 2KDOA 3ZQIA 1QHGA 1K6OA 2CQNA 1J75A 1XF1A 3CJQB 4ZC3A 4A3FJ 4KYWA 1IUFA 4PQAA 2DOAA 4XKWA 4NGMA 1RXTA 4NB5A 3HOWJ 1SD4A 2VQCA 1TT0A 4BDYA 1WJDA 4B1RA 4IF4A 4IQJA 4UIBA 4E6KG 2LY9A 2XPWA 5CQEA 5B66C 3FYNA 4CZZA 3T5XA 5GCNA 2EZAA 3QPSA 4XPDB 1GVJA 5DV5A 4CXFA 4OLLA 3D7HA 2FRHA 4XK4A 1IGNA 3S6KA 3OSFA 2OZGA 4JX4A 3GF2A 2WPXA 3CJTB 4KOTA 3ZMDA 4AVBA 1HSTA 2LH9A 4BEHB 2LD5A 3F5BA 2DBBA 4CHUA 3OS1A 1WJ5A 1TW3A 4C9RA 2X85A 2O53A 4MIMA 4CAXA 4C68A 1D1CA 2PJRB 4C2YA 4KITB 3OMYA 2RN7A 1BJAA 3QP6A 3LAJA 2R7DA 2DXIA 2P6GA 5HLTA 3FNCA 4HG2A 1R71A 1NH3A 1G3YA 1Y1VJ 3S1QJ 3IEHA 3IGRA 3ZQHA 3BHXA 1VQ6I 1W5TA 2LFBA 4BH9A 4HNXB 4MHPA 1T36B 2NNNA 4LQGA 2O0YA 4C2ZA 5E8GA 1ETKA 3LSIA 2DXQA 1IN7A 2L02A 3RDIA 2ZELA 4TWEA 4MHDA 4OC3A 2X51A 2R7SA 4GXOA 3J7AO 2LLKA 2YJTA 4HX4A 2K5TA 1MMDA 4C8CA 3HRMA 1QSRA 4LB6B 3OYEA 4L9NA 2CNTA 4UVCA 5C44J 5E20A 5BNGA 5JHFA 2ZC2A 4UFWA 2DMTA 4I0AA 2Y75A 4C8UA 5THWA 4FTHA 1UG0A 1L0OC 1RZ4A 1Z6RA 5K8PA 1J0RA 1AOYA 5IYBJ 2AQEA 3IWWA 1WVRA 3GY9A 2HQYA 2C5QA 2O6GE 1LANA 2E1MB 1Q2DA 1JHFA 2FEZA 3M07A 4F91B 4H4KC 4HLYA 3Q9SA 4OMYA 1HOMA 4MI4A 2M34A 3W91A 2A68F 5JM6A 4PJ0C 2P5LC 4KJZA 2R0QC 4UNOA 2XRNA 1I1SA 4M74A 3HGYA 3LFKA 2FMLA 3UR3C 2PR1A 4H6UA 4M6GA 4D7MA 1MMGA 4C2TA 2XSJC 4M73A 3ZRGA 2RC4A 2EZHA 5EYRA 2NVUB 2EBIA 4D9JA 2MH9A 1R5GA 3FDYA 2JMWA 5C3EJ 3FXJA 3GXOA 3LSPA 4V2GA 3K70D 2HPIA 3V7SA 5B3SH 4PSWA 1XG1A 3JR9A 4XNFA 1KUYA 1USTA 1XF8A 4XNHB 1J09A 1U5TC 1X10A 2F4OB 4C8PA 3BR0A 3G2BA 4CYCA 2HS5A 2P0WA 4U87A 4ZY1A 3LAPA 3GTMJ 3AL0C 3ISXA 4CH7A 5LHIA 1GUUA 1V4RA 4HX7A 4IXAA 2VZZA 1OCZH 4E7ZA 2BEIA 4CO9A 2PRBA 3TFYA 2DI3A 1BI2A 1A31A 5IYDJ 2B5GA 2RKHA 4CGZA 1RIOH 4Y7NJ 2PJ5A 3PZJA 3BQZA 3W2WA 2EJRA 4N0BA 3ZXSA 3ZQGA 3KETA 2R5YB 3S3OA 1MMAA 3LA3A 3CXPA 3BJAA 5LYIA 5HLIA 2BZTA 1BO4A 1YW6A 1MBGA 2REEA 4IKFA 4DJLA 2PN6A 2QLZA 2BY0A 3VYUB 3FXLA 2AFXA 3K69A 4BS9A 2I79A 3IAS2 2CV1A 3MFKA 4RI1A 3P5JA 2X9DA 3BTJA 2OOTA 4XKVA 1ETQA 1POGA 2Z3KA 1PUFA 3OS0A 4F92B 2CG4A 3S93A 3C2HA 2JRTA 3VWBA 2ZFUA 1VQ7I 2F2EA 2JBKA 4R57A 2WY8Q 3S17J 4ASNA 2DLLA 3BG3A 2EWNA 3DGVA 3H8GA 3E6CC 2R7QA 5D8LB 5F0FA 3PFYA 3Q5FA 2BSWA 5LYDA 1S7FA 3QWLA 2HYFA 4WWCA 1ETWA 3FRMA 4NC6A 1LFWA 3DBLB 1IN8A 1VI0A 3JREA 5E3OA 2EK5A 1X2NA 1IV8A 3H3UA 3V7RA 2OBPA 4XKBA 1UZCA 3HRTA 4KUAA 1ZLIA 2JA2A 2R7WA 4A3BJ 1KWMA 1MMNA 5C4JJ 2B9SA 1R22A 4F9UA 1U9NA 1UHSA 4V19K 1JKRC 4HRIA 3GEZA 4XLCA 3RCOA 2EZCA 1R58A 1IXRC 5FKNA 3J81Z 1PJRA 2OTLI 2FVGA 3W2AA 4ETSA 3MEXA 2PJ2A 1R4NB 2AO9A 2MD5A 4B43A 4RA2A 2EA4A 1J2XA 2ZJQF 1Y9KA 1BI1A 2NSMA 2ZW5A 2O8KA 1WWZA 4FD5A 2KZGA 3QYBA 3KYLA 3GLJA 2Z1DA 1VI4A 5DS0A 1QSOA 3TO7A 4A95A 2QM3A 1SFUA 4KOUA 2Q8KA 4CZ1A 1KQ9A 1U8RA 3R6SA 3MVPA 1W7PD 2QQAA 3K4NA 3Q9VA 3OYGA 3F21A 4GXHA 1G8XA 1R4MB 2YUSA 2V1UA 4XKCA 2KP6A 2LOOA 3M1CA 3JRHA 1REPC 4CSWA 1I6HJ 5HH1A 2AFUA 4M3BA 4MCQA 2X48A 1F1ZA 5ICFA 4BU2A 1TT5B 2HU9A 1PDNC 3SHPA 3FK6A 3SFZA 2Z3PA 3SQNA 2XUBA 1VNDA 4F52A 1KYWA 2Z2SB 3EZBA 1TWHJ 2O5RA 3SZGA 2F4IA 1JUMA 1YRNA 4EJTA 2ELJA 1ZG8A 2ZXIA 4AYBN 1KUVA 4UVBA 3RTRA 1O4XA 4YIIA 2JT1A 2V7FA 5E8IA 3HTSB 1Y56A 2A07F 2ZBKA 2DAOA 2BXYA 4II3A 1FY7A 1S7OA 2CYYA 2W00A 1S5KA 3DEEA 3K7AJ 1Z8LA 4KFCA 3OWTA 3R0JA 3VSKA 3U1KA 1UHWA 4C2UA 1P0HA 4MFKA 4AVCA 4L5IA 2XGDA 4UV9A 5ICGA 3PB7X 2HKXA 1FP2A 4G6QA 3IU2A 2NOGA 3MKWB 4JK1X 2UXXA 3MAJA 3PQJA 5KCMA 5K7ZA 4OC1A 3HPGA 2XEFA 4KN7X 2HWVA 4JXRA 4EM0B 4X2TA 4GYGA 5DTDA 4PXCA 4LFUA 1S7EA 1EZAA 4QIWN 2E5NA 3D7FA 2NS7A 3IAM2 1B9NA 5ED4A 5D29A 1HQCA 2DDBA 1D1AA 1NHAA 5F64A 4IHVA 1CP6A 4JJXA 2HQNA 3BZKA 1PP8F 2DT6A 4CDGA 2YR2A 4PXEA 2L4MA 2LY1A 2VKHA 2WAQA 2ZXWH 1IYKA 3JRUA 4F93B 1XE4A 3S6GA 4UCMA 2Q4ZA 5IV0A 4OU0A 4RM3A 4BJ6C 4PGHA 2FD5A 3QOPA 3R95A 4OIRF 2FUG2 3JRAA 5HMNA 2J8RA 3CJNA 5TGTA 3CD6I 2FS5A 2VQHA 2PJRA 4NFRA 4CYNA 3E6DA 1KQ0A 5FKMA 4N9IA 4HNTA 4A2ZA 3LMMA 1O3SA 4UCNA 5G22A 3ZQQA 4PK3A 2QUFA 3F3XA 4PK2A 2DFFA 4KDPA 3AG1H 4UIAA 4B14A 3KCCA 2G9WA 2XAJA 1IXCA 4UEEA 4BBRJ 2DFEA 2ECCA 1BAVA 4MCSA 3CUOA 3TDZC 4H0EA 3PUBA 4DIQA 3L2NA 4QVTA 1W36D 2Z3YA 1BI0A 5HS7A 2HR3A 1ZREA 2ICWG 4UUSA 2CTBA 1U6GA 3BJ8A 3H9GA 4G9YA 4A30A 1X19A 1WI9A 3HJEA 1PYVA 1XMKA 3CCSI 3E5QA 2PJ6A 3FBUA 2AXTC 3TLYA 1MIJA 2Z33A 3ABMH 3RSNA 2M45A 4ABZA 3FISA 3HHGA 4LUAA 2H09A 3I9V2 1YJWI 5ICEA 4BE0A 2AXLA 1ARMA 3IRRA 1VHSA 1XX5A 4HNYB 3R9GA 4PUSA 2HNHA 1CS0B 2HFHA 2V4JC 5FJ8J 2RB7A 1IRZA 1SAUA 1LUJB 4AB7A 3ISZA 3WTXC 1T2KA 1MD0A 2FJ1A 4D7NA 4HF2A 1GYTA 4M8DA 1HKQA 1D5YA 2RNJA 2E1MC 3DEWA 3KEOA 4KVME 1T08B 2DA7A 4KIFA 4XSZF 2EUIA 4R87A 3TQNA 4OP4A 3P7NA 3SEZA 2D1VA 1T95A 3OYNA 3CMMA 4FASD 4NGQA 1E3OC 5J3LA 3VSLA 5GADJ 5IPAA 4YFKF 4K3NA 2YX7A 1TWGJ 1CF7A 4PK4A 1RESA 3CMYA 4IIYA 4HAMA 3I74A 1Z7UA 2X6WA 3H5RA 4BQNA 3HTUA 4CYDA 5ELYA 2IMOA 2OLSA 2WYRA 3BTLA 3PFIA 3U21A 1Y6IA 1IDYA 3OL3A 4CAFA 1P4NA 1LFBA 3DU5A 3T0YA 1WJFA 4CAEA 3KLNA 2JZYA 5JGFA 2VJ4A 2A6EF 4XN0A 1HDPA 5E1ZB 5C82A 4YWYA 2WADA 4XLAA 2HOEA 1GXQA 4KNYA 1FTTA 2XKPA 2W24A 3FBIB 3HUGB 1PYTB 3EFAA 1LDKB 5EEGA 3CCEI 1M4DA 1SEUA 1YW4A 1Y7EA 3JUWA 2ZXJA 1IU8A 1GHEA 1K6YA 4X1EA 1OR7A 1OMIA 1FZPB 4GGGA 4O5VA 5HOOA 1FPQA 3HOZJ 5I4MA 1JI8A 1XEBA 4L18B 2OCCH 3G3ZA 1PUFB 4WK8F 1GVDA 4KIGA 4MTEA 4E7JA 1YO5C 1V0CA 2PCUA 3PFEA 4OC0A 3TLEA 3KIOA 4ZJZA 2Z16A 2HQ5A 2E7XA 2V9PA 2XF6A 3EYIA 4XICA 3J81K 3FBNB 5J47A 1M1EB 5F04A 4NC8A 2E2JJ 1GT0C 1USSA 4CGLA 1OCTC 4OIOF 5GPAA 2LNBA 3DCFA 2ZEGA 1JHHA 3NOJA 3T8RA 5F5XA 1LVAA 2CFOA 1YG2A 3H9JA 3FMSA 4FX4A 3L2UA 4BXXJ 2VXDA 3TOBA 4ZY2A 3GLXA 5LEKA 3QU6A 1MBJA 1W5CC 5K5RA 2M4KA 2LP0A 2LRDA 2VBWA 1NE9A 3VOEA 2HI3A 5E1WA 2NVQJ 4WJBA 3ECOA 1BPMA 2AE6A 4UF4A 3V8LA 3DLJA 2R7TA 2BY3A 3B3VA 1Z67A 2LG4A 1FSEA 2GLFA 2YU9J 3RBUA 3EC4A 4E7HA 2IXSA 1GV5A 4E7IA 2NVTJ 3NEUA 1BC8C 4P10A 3ZJ0A 1GGOA 2HGCA 3A02A 1Z7LA 3QODA 3K0LA 2ZKZA 3JRFA 1YQAA 2K9NA 3IH3A 2PJ9A 4EATA 4C3IJ 2OTJI 5CKTA 3TYXA 2RQQA 4GDFA 1VQKI 1XMXA 3ASNH 2A61A 2FT0A 3V38A 1Q2YA 4MTDA 4DYOA 2K27A 4XN3A 3ZZIA 2Z99A 5IX3A 2OV7A 4C3HJ 4CDJA 4XQFA 1BIBA 2WAQN 5LGNA 3WTTC 4NQWA 3KP3A 2F7VA 1IO2A 1YOVB 4QLCU 4UEZA 2STTA 4WXCA 3F8KA 4FHTA 1MGTA 4UB6C 1YJNI 3CCMI 2DU9A 4HQEA 2ZW7A 2KPMA 4YRVA 4RB2C 3WU1B 2WSAA 3ZMSA 5CYVA 3L2QA 1I27A 4A0YA 2BY1A 3D5LA 4HV6A 2H6BA 3T07A 2QKMB 2KFDA 4BBHA 2KIMA 4XORA 2FBHA 4QTRA 3BLNA 4P4IA 3SHFA 3I54A 3T90A 1WJBA 2PIZA 3D3SA 2FQ4A 5K7FA 1VQNI 3WGHA 4LK0F 5EC4A 2K4BA 4F3QA 1K4SA 4OMZA 1Q1VA 1YE9A 2G0EA 1SD5A 4KOWA 2ADUA 2QKLB 2ZXHA 4EYSA 1MJAA 4CYCB 2IT0A 2OZHA 4D0PA 4A3DJ 4DYRA 5DM7F 1VZ0A 2JSPA 1XS9A 2GA2A 4IRIA 3KZZA 1HKSA 4ESFA 4XM3A 2Y9ZA 4YELA 2H5MA 3TLBA 5H20A 2ME0A 5F0CA 4A33A 1D3YA 1QVUA 3G23A 3OY9A 3G1MA 2PVVA 1LRZA 5F09A 2AUNA 4B5PB 4P9FA 4C30A 1LCPA 3OIOA 2D2WA 2KIFA 3T9YA 1U5TA 3MZ8A 2FOKA 2K9QA 4HF1A 3RIRA 2VQLA 4M71A 3QYEA 1TIQA 3U1BA 2CW0F 5E3NA 1S29A 2IA1A 1M4IA 4AC0A 3PFOA 1XOVA 1UELB 4J01A 1ZLHA 1HC8A 3A01B 5JHUA 5L3CA 1A04A 3FXTA 4L5EA 4C8TA 4MQVA 4MFQA 3LNQA 3RKWA 2AS5F 2DT7B 4L5JA 5FGMA 4MJ8A 4P9UA 3NWTA 2JLMA 4RGRA 4H2KA 4JXQA 1FWZA 3E6MA 1X1AA 4U7BA 2AFSA 1W4MA 5M5YJ 3L09A 4A5MA 1UB9A 1BW6A 4AG9A 4B8XA 4DW6A 2N8GA 4COBA 1GLNA 2CFXA 3P9IA 3K9UA 3PRTA 4PGGA 2DK8A 4MRIA 5D6FA 2AFZA 3K1MA 1Z9UA 1CBXA 4AIJA 3GW2A 5GTHC 1T39A 2XEIA 3L2VA 1HEEA 3S32A 4LX9A 1BXRB 3FJUA 1S72I 4II9A 1QRYA 4JP0A 2L9RA 4G12A 3IWZA 1FYKA 2R7VA 1T0FC 1ZRCA 4CCJA 2IGKA 3TE4A 4CA0A 2ZPAA 2QIRA 3FEDA 3ZMVA 1J9IA 4IX7A 4U9ZA 1YITI 3CJRB 1IICA 1C3OB 4JD6A 4TNUA 2JSCA 1N71A 2V8GA 2B7EA 1G3SA 3E97A 4C7HA 4OAZA 1DPRA 1K79A 3E6BA 1ZQ3P 3GTQJ 3TO6A 4RB1A 5D5XB 5HLHA 5HVGA 2XV4S 5EZGA 3FIWA 4UB8C 4BBSJ 4BY7J 2DEAA 2QF7A 1XGNA 5A2QZ 2EK9A 3BR1A 3DKYA 3FECA 3WR7A 1A6IA 3TP3A 1E3HA 1CG2A 3S9NA 2WUUA 1IV6A 1SVMA 4EGZA 1ACIA 1P2FA 5JVTA 1QGPA 3OYAA 5AONA 5FRNA 3IKTA 2BHZA 2PFBA 1ZK8A 4RAZA 4D5FA 3IKVA 1PCAA 5LBQA 5LGTA 4ENKA 2EB7A 5IT3A 3GUXA 4R6TA 2EPFA 3I71A 1YGHA 1D5VA 3OIPA 2LF7A 1BM9A 2KRHA 4MFZA 3VPRA 2DA4A 4EM1A 3VWEA 1ON2A 1VQMI 3KZWA 4MGRA 1J4JA 1B6AA 4OIDA 3SI2A 3K70C 2WV0A 5F1YA 2UV1A 2YX4A 3CCUI 4R3LA 5DCMA 2O03A 3S1RJ 3L00A 2DPUA 3SJFA 4AYBA 5D5VB 3TBIA 4P5OA 5TRDA 1IIDA 3JW4A 2K02A 4IOCF 1TNSA 2BYVE 4M3EA 2MW8A 3FXKA 3ERMA 1LOKA 3VB2A 4FD7A 4QB9A 1U2WA 2B0AA 3KI9A 4MCRA 2Z9OA 4IHYA 4IUSA 1LFUP 2UZKA 1ULYA 4UBRA 2FU4A 2L0KA 2E36A 4G6DA 4Y33A 2CNSA 3S9LA 2BV6A 1QQ9A 2WV1A 3ZPLA 4TJXA 1XDSA 4JWPA 4ZX9A 1SFOJ 4ZX8A 4R7MA 3PUFA 3K4BA 3NA6A 3K10A 1D1BA 3BZCA 2X1CA 1MBEA 1PVEA 4E5SA 2LKSA 1TP4A 1Y8RB 1YLFA 3KEQA 4UXNA 2XGEA 5FFZA 1OYIA 3FXUA 4MQ9F 1VTNC 3SJEA 1YS6A 5C4XJ 3GYHX 1VQOI 4LG0B 2OB0A 1R5ID 3QRFF 2P5KA 1R49A 2VQGA 2IA2A 3CUQB 1ZARA 1HDQA 1Q5XA 3DPTA 4Q38A 2JA5J 2FX0A 2PBIA 2VKDA 4W9YA 4C2MJ 2X0SA 4WCGA 1XGMA 3HL2A 2GP4A 3FEEA 2HEOA 1V3FA 3DPLC 2Y0SA 2HZTA 1QPMA 1Z91A 2M87A 5J40A 4KA4A 1ELLP 4Q47A 2VBQA 1VQ4I 2ZW6A 2Z3NA 3B6AA 2JVHA 4Y13A 3DNSA 2RGVA 1DTDA 4ZH4F 4JZ0A 4CGMA 1P7IA 2XAFA 1KUXA 1BPNA 1APLC 2OAZA 3GYAA 2PSWA 1MJ9A 2EV5A 2IP2A 4FAIA 1XN7A 3H3VK 2DW4A 1FIAA 1LDJA 4W97A 4OMEA 2V1XA 3CLQA 1WJEA 3DWLE 3ZR8X 1SVLA 1WWXA 3G73A 4KISA 3TX8A 4C9AA 3S6HA 5J8CA 2QZ8A 2ZFWA 3CP2A 4JYWA 1ODDA 2LY2A 5EMIA 3ESWB 4B11A 2HV2A 2VLAA 2KQRA 4J0NA 3CCVI 2AQFA 1IF1A 2HUZA 1E17A 5AG5A 1BIAA 1Y0NA 3V4GA 1WCMJ 4BYYA 4X8IA 3DXJF 4MCPA 2G9DA 3RZOJ 2OC6A 1R5HA 2DYSH 1STZA 2W85A 4RBOA 3ZQ7A 1WJCA 3PNTA 4GRIA 4I98B 1GDTA 2CMPA 3U2RA 4UFVA 3VARA 2FSWA 2P4WA 1FX7A 5IT9Z 3A1YA 3N7ZA 1U78A 2HOTA 5D5WB 2VBYA 2L9SA 4MHGA 2ECBA 2XPUA 1MNDA 3BR2A 1ZG9A 4B09A 2K9MA 1FMWA 2FXAA 4PJMA 3CP8A 2IS6A 3MZYA 5J4VA 1FJLA 4ZTJA 4GCVA 3OS2A 1JDEA 2XVCA 2XB5A 5GPCA 2HTJA 3PO2J 1Z8TA 3K2KA 4COGA 3EQLF 5E96A 3LL7A 3N97A 2R4GA 1K78B 2REFA 1C30B 2PJBA 3PP9A 5HVQC 5CVRA 2CXAA 4R3KA 1CE8B 2FNPA 3OYLA 1XMTA 4MHNA 1BR4A 1FYMA 2C6YA 3IUOA 4MMOA 4NSQA 5CQGA 1ZRDA 3EDPA 4CCLA 1AA7A 2PLYA 1U9OA 5FLXK 4J19A 1ETOA 2HDDA 1NK2P 1VQLI 2GU2A 2JJ7A 3B35A 2VOOA 4R1HA 2PJ1A 2XAGA 1SANA 1U3EM 1ZG5A 1TQIA 1N25A 5IOZA 1LQ1A 5K8NA 4OADA 3BZ6A 1Z05A 2ETHA 2X7BA 2DA2A 1ORKA 2XEGA 2EFWA 3GLLA 3ISPA 5E3LA 4X0GA 2FL4A 4WXDA 3JTHA 2NYXA 2R7UA 2AUMA 2KIUA 3JTKA 1JJ8C 3O3KA 3WODF 5FD8A 3HBLA 3W3CA 2OF7A 5LHGA 2STWA 2MABA 5FLMJ 3NQOA 3VYTB 3JRDA 1RTQA 2GXGA 4AWXB 5D8NA 3KR5A 2MP0A 2CQKA 2EFOA 1MSFC 4IJAA 1Q1HA 4M85A 3I56I 4TJVA 2IJZA 1DGRM 2L3DA 1JUPA 4CCNA 4DQ2A 5LEJA 3RKQA 3T5MA 3GB0A 3J80K 5LD2C 2FQ3A 4XPKA 3MGDA 4RN7A 2CRGA 3B3TA 4M9ZA 3GZ5A 2FXFA 4A3EJ 1R43A 3K4IA 1FSHA 4INJA 2BBYA 4AVZA 2C6GA 2NOJB 2V9VA 4WXHA 2QSGX 3EY5A 3E3VA 2CUEA 1JUSA 4ENNA 4E94A 4P1WA 1KZHA 2ME6A 3WABA 2WAFA 2VODA 4XR6A 4U88A 5H84A 2M8EA 3MRUA 2C6PA 2NXNB 3WC5A 4KMUX 5AG6A 4M3GA 4F9VA 2ID3A 1KONA 2V9KA 2XIGA 5K99A 4HPQA 3IC1A 5DD4A 2CWEA 3EIFA 3FVLA 4Y4RA 5D5UB 4LQ6A 2YGWA 5CLSA 2Z0ZA 3RYOA 4E4HA 2E71A 4NHJA 3J7AY 4V2FA 4U7DA 3L2CA 1S6LA 5AIPA 1UJ8A 2HTSA 3U1DA 4A5NA 3B6CA 4BKXA 5KHDA 1W36C 4O3MA 4ZYGA 1XDUA 1S3JA 1W7PA 3C2GA 3HLPA 3QB8A 3W6SA 1XGSA 3AFHA 4I02A 5M3MJ 4IPAA 1QU3A 1WSUA 1GXPA 3WE2A 3GTOJ 4KUBA 8CPAA 1A35A 5IP6A 4BMHA 3WT4A 3K2ZA 2PJ7A 1G3TA 1D0XA 2BO9A 1ARLA 5LGUA 1VFCA 2R5ZA 2VASA 2ZOGA 2VT3A 2ZXVA 2JEVA 2V1NA 1HDUA 4ONUA 4PXDA 4A3GJ 1A5JA 3K4LA 2F48A 1PUAA 4ZY0A 4AIDA 4NNJA 3SYTA 3HUVA 2EILH 3MCZA 3CCRI 1F2OA 4I0BA 2ZCWA 3GJZA 1QA6A 1V5FA 2IVMA 3WTSC 2OD5A 4DBRA 1F9NA 2VKEA 2CIJA 3V7CA 3UY5A 1LB2A 5F47A 2GWRA 5HS9A 4XL9A 3C8OA 1W0TA 3K4JA 2ZMEA 4KS9A 1ZN2A 1SFKA 3OOUA 2VE9A 3G8WA 4Z65A 2LTPA 1S60A 5DWNA 1XGOA 5TISC 4FWUA 3A0HC 4EM2A 3K1NA 1FNNA 2WB1N 4XRMA 1Z1DA 4IVNA 4RGXA 2JTVA 2KISA 2L7MP 3OYMA 2TDXA 1UHMA 2MLKA 1MZBA 1TKFA 2VT2A 2BOLA 2V6CA 4M9SA 4CCOA 4M6HA 2H1LA 2VC0A 1B72B 2QQ8A 2A05A 4MFLA 5LRKA 3HG9A 3FK7A 2PEXA 4PJNA 3ZMZA 4UWIA 3I5UA 4NXYA 1VBHA 2RFHA 2D0OA 4YFNF 3RQ4A 5D8KB 3SR3A 2HDWA 2NAZA 2WTEA 2Q7SA 1Y1WJ 4P4DA 3TC8A 2J9AA 1M6VB 1CQTA 2QBYA 1N77A 2GOMA 3TGNA 5BWAB 2KIQA 3NARA 3EPZA 1BW5A 4QPQA 2JUCA 3H35A 2MH2A 2DJIA 2ISYA 2PX9A 2LBFA 1K4TA 3GBGA 1BOBA 2R82A 4AVPA 5EJCA 3I4NJ 3G3SA 3NE7A 5FVJA 1TC3C 3HUGA 4P4FA 2CJJA 3MMYB 4A94A 1A9XB 3CUQC 3SJMA 1XC5A 1K83J 5K7HA 1Y0RA 2Z3LA 3P2FA 3GVAA 3VYRB 5LHHA 1RUOA 3D66A 2P6FA 2ZJ2A 2KJCA 3D1NI 2P6EA 1E2XA 1RPWA 3BPXA 3I3LA 5AIQA 2QQBA 1HF0A 1HCRA 2Q0YA 3FB3A 4KVOE 2VN2A 2WPWA 3FF5A 4RS2A 3BP8A 5B5EC 5EBVA 3BG5A 4XPDC 4MHYA 4O6JA 4C8AA 1Z8WA 2DK5A 4XRSA 2QBYB 2WWYA 3FMQA 4KN4X 4BHCA 2CH0A 3WHBA 2ZSIB 3M9AA 1QZEA 2BEOA 2V26A 1S5LC 2TRTA 3KQXA 1F43A 2F5DA 2JPCA 2W25A 3G4SI 2QJ8A 4PJLA 4RAGA 1SAXA 3I55I 3F6VA 3GKRA 1IAWA 5A2QK 3CMEI 2COBA 1ZG1A 4BD9A 5J1QA 3KZIC 2HOSA 1XBUA 3KP4A 3BTCA 3WU2C 4CPAA 3LQRA 2I5UA 4ON0A 2KT0A 2JQ7A 2K9LA 2M30A 1O57A 3A01A 2AFMA 3CXSA 1FOYA 2E2HJ 1GHCA 4I49A 1S3ZA 4NGNA 4NC7A 1VQPI 4E8OA 1TKJA 2QECA 3TLGB 1BI3A 2BW3A 2K40A 2B3VA 2NS8A 2E5ZA 2G3TA 3VATA 3F9KA 3FX6A 3S2WA 5K5QA 1WH7A 2IGNA 4LG3A 2FMYA 2M3AA 2R93J 1QZYA 2CUFA 1IGBA 3PB8X 2DQLA 3F72A 5GAGJ 1RRJA 1QBJA 4W1UA 5EG0A 3CDXA 4HW0A 3NH8A 5JVLA 4C9VA 3KHXA 2UXNA 3I59A 1FIPA 2POKA 2OQGA 2IPQX 1Q2CA 4FT8A 3OIQA 4A3LJ 5K1YA 2OPTA 4KORA 2HROA 2X0LA 1HBXG 2ZEMA 1B72A 3PBBA 3S1NJ 1MH3A 2VJIA 3WHCA 4F0XA 1YREA 2XHKA 1OCRH 4UVAA 2HPMA 3I4MJ 3HSRA 2XRLA 3PNVA 4KOYA 1LNWA 1F5TA 4MNUA 5L3DA 3DBHB 3BROA 2Q51A 4FCYA 3RYPA 2OQRA 2VL1A 1WKMA 1YMEA 2E2IJ 2G3AA 5EGOB 1G3WA 3H0DA 2VBXA 5DCMB 4A12A 4N4OB 1I50J 2DFIA 1OLTA 3HYIA 3ABUA 2GQQA 2VI6A 4HOBA 4KZTA 4U0YA 1H8AC 4BDZA 1Z0XA 4AUXA 1QPIA 5J8FA 4Y49C 1NBWA 3E1SA 2E1OA 1YVKA 3A03A 2EFPA 3PB9X 5ERIA 5F0HA 5D4RA 1BA5A 1EH6A 1SFXA 1X1CA 2DDAA 3OYJA 2ZJRF 4YG2F 5L3EA 4MLOA 2Q7BA 3JSPA 1Z21A 4BUPA 1AWCA 3QOEA 5JYBA 3R96A 2JDCA 2MSYA 4XPLA 4ZYEA 1JWQA 3EUAA 1RI7A 3K4MA 2GFQA 3W2VA 3BWGA 5FB2A 3OR1C 2RNGA 3KLOA 4XRSG 2EZKA 2CV2A 3BJ6A 2UWMA 4Q36A 3OL4A 4LOCA 3F8CA 5EGOA 4MY3A 4I7HA 2QENA 3ZP5A 2GBYA 1ERDA 2Z5UA 5EF6A 3EUHA 1RETA 1FEXA 3ZCOA 3ZMUA 2OUMA 3NWSA 4BNCA 1IOIA 3D2PA 5CBMA 3BR6A 3HSFA 1IUYA 1DQUA 4PJJA 2ZEEA 3IL2A 3TP0A 2YSRA 4F55A 4YFJA 2QMLA 3NFZA 3KPHA 3PJRA 5DS9A 4G1PA 4P6YA 1WFXA 1TQPA 2PG4A 3ROUA 1XRYA 2VI7A 4C85A 2DTRA 4BXUA 4DZPA 1AYEA 3TCVA 3ECHA 3I59B 3EXNA 2CY2A 1I6XA 4WX9A 3J7YJ 2F5CA 3KKWA 2A5YB 2CW8A 1WQ2A 2Q2EA 5ILSA 3W6XA 2R92J 2FE7A 2BL1A 1Z3YA 1I12A 3A2KA 3VWDA 3H3ZA 2E35A 1K7AA 1JTYA 2WB1A 3PNYA 4EMSA 1TW2A 3E0KA 2H8WA 1X1PA 2AFOA 2GAUA 1KU9A 1RR7A 4OOIA 1JJ6C 2ZNZA 3CPXA 3GIUA 1T56A 2WA0A 3BOQA 3SXNA 4FETA 3NE8A 3QPHA 2GE3A 3ULQB 3KZYA 4MEXF 4EV0A 1EH7A 3RAMA 2DJNA 4E7LA 2PMZN 4EVIA 4LJZF 3ML6A 3QYFA 3NAUA 3CO7C 4OAYA 4BAYA 3I3GA 3OV8A 2YNDA 3SDBA 4C9EA 2F5EA 2IGMA 2H94A 5BQTA 4ZGYB 2XGCA 2OH1A 1CPXA 3B73A 2H27A 4IF5A 1QVTA 3B8GA 2JA7J 4HNVA 3CC2I 3R61A 2VKVA 2XROA 3RZDJ 1IC8A 2R7ZJ 4CAVA 3FKJA 2HXOA 2RAEA 2DMQA 2XKOA 3BC8A 3HKZN 3MWMA 4A0XA 1I3AA 2DA1A 5K5OA 1FOKA 4IHTA 1N78A 2Y2ZA 4MFEA 3EO4A 2PMHA 3K6GA 1WGXA 3S16J 3E0JB 5F49A 4PZJA 4RUHA 4Q5SF 3I53A 2I10A 2M7BA 4QBJA 1OZPA 3CUQA 4RLFA 3WTZA 2X6YA 4EFDA 1KU3A 2O28A 2YS9A 2Q43A 1JT0A 3B3WA 1BN5A 2K3PA 3HB9A 3Q0VA 3GTJJ 4OC5A 2G0BA 2FM4A 3BG6A 1JKPC 2EZLA 2WY7Q 4KSFA 3BG7A 3CCQI 3KFWX 3SFIA 2A6HF 3KQZA 4B48A 2RVCA 1OQYA 4LLNA 4ITVA 3KYDB 1HKTA 2BUEA 1ENHA 4IOAF 1OPCA 2HI6A 4L0YB 4J00A 1G6NA 2YJVA 2FBKA 4G6TB 2I00A 1B8IA 2PI0A 2HC9A 2D0PA 3AKZA 2PC1A 2FCKA 4M3DA 3SI0A 2XAHA 3VODA 4HF0A 1PU9A 3S6FA 2LVSA 1S7NA 3BY6A 1R3NA 2QA4I 2VZYA 1I1DA 3E7LA 4ZZDA 1VF9A 2QQ9A 3DQVC 3RPUD 2JEWA 4I09A 3DSBA 4B3AA 5DUKA 2XEJA 2QEXI 4NUBA 1QSMA 3FXQA 3F22A 2OJED 1E3PA 1IG7A 1YVOA 5GP9A 1ETVA 4NCZA 2DN0A 4AVAA 3HOXJ 3RJPA 1R9TJ 2G7UA 4ANJA 5CJ9A 2CUJA 2DTZA 3I4PA 4KOSA 4L8AA 3LQQA 1P4XA 4NGPA 1O3QA 3SI1A 4B13A 2IAIA 1Z8XA 3TEDA 4RAYA 3KGQA 4S05A 2FE3A 3R1KA 1HXDA 3FHZA 3GMEA 4CCKA 2H8RA 4NGTA 1B8IB 3WU0A 1ZYRF 5HDGA 2EWBA 2ID6A 2PMUA 1JQGA 4L0ZB 2J8NA 5JQ4A 1XMAA 1CPSA 3PQKA 2GREA 4ENJA 1XPXA 2CUZA 2MC4A 4A93J 1VHEA 2L9VA 1MBKA 3LSMA 5M5XJ 4IZZA 1DGWY 1YX3A 4OAEA 2PCNA 4WWVA 3HOSA 2D4PA 1F36A 3AG4H 1ZAOA 3HZJA 3JAMK 3BR5A 3FX3A 4KUMA 1W1WE 4GM5A 5J1RA 3CF2A 5F48A 2BHYA 1IRXA 3COAC 2B58A 2W1OA 5LYFA 4A3CJ 2JUGA 3ICUA 1ZLJA 4HV5A 3W6KB 1WZ2A 2OR4A 2HYJA 1DE4C 3FZVA
chains in the Genus database with same CATH topology
3HRUA 2D1HA 1Q7LA 3ZN1A 1F2PA 3PB6X 1ZG3A 2QVPA 4JZ0A 4A6DA 3GUDA 2R7FA 1IW7F 5BOXA 4PCQA 2OZ6A 4PPZA 1W5SA 3FMRA 2GLJA 2QYVA 3WTUC 1H0MA 1T6SA 4OC4A 1Z5RA 2DT5A 1I5ZA 3NRVA 5HVFA 1MJBA 1FBUA 3BPVA 1KU7A 2W57A 1LJ9A 2P7VB 1DP7P 4A37A 2FBIA 2AFWA 2V77A 3HHHA 3NH5A 1O7FA 4ESBA 1QMUA 1EE3P 2X4HA 3H8EA 1XD7A 4FBEA 4AIKA 4HX8A 3PEIA 1O3TA 1XSDA 1HW5A 4G7ZF 4C84A 3FM5A 5CVIA 2MBFA 1R7JA 3V7ZA 3RKYA 1L3LA 1UFMA 3CDHA 3CTAA 4IRGA 5HDNA 5ICCA 1YFHA 2L54A 2ZNYA 1ZG7A 3TKYA 3N5FA 1WRJA 4A39A 4JQFA 3I58A 4LGWA 5IT9K 1KYZA 4CDKA 4KMFA 3FMCA 3BDDA 1TXRA 1C0WA 2VC1A 1TNTA 3WTVC 5HDKA 1T38A 4M72A 3CT9A 1TKHA 4U0VA 2PQ8A 2L01A 4RB0A 3WTWC 5K8MA 3GFMA 2HYGD 3N4MA 3T1BA 3B7IA 3QAHA 3F8BA 4L9JA 3F6OA 3GO5A 4Q48A 1ZGJA 5JFRA 1FC3A 3WTYC 4ESJA 2ZEOA 4FUUA 1LEAA 1CX8A 1S8NA 4YFXF 3IIBA 1XCVA 5LYLA 3SZPA 1BBYA 2PIYA 1YYVA 4P4BA 4M9XA 2NYQA 2W84A 3L7WA 1R00A 3S9MA 5DCFA 4U0WA 3B3SA 3I1UA 1VHOA 2EK8A 4OIWA 4ENMA 1ELMP 1Y0YA 2ANPA 1P6RA 2WZNA 3I64A 5FFXA 3W6JB 3P9KA 2VOPA 5CPAA 1K78A 1XJOA 1TBXA 1ZHFA 5DUIA 3H8FA 1SMTA 2PJ8A 2HQRA 1TF9A 5H6RA 2BOAA 3F23A 3SJXA 4NGRA 1IRFA 3K1PA 4G8XA 1R23A 4M6YA 3DFGA 2ZOFA 3PBEA 2J5OA 1B1BA 4L9TA 3SJGA 3HOTA 3IJ3A 4EJWA 1ON1A 2H6CA 4A38A 4LMYA 1RUNA 3EETA 2E1NA 4E70A 4AXVA 3IHUA 3ZMTA 4OKOA 3L9FA 4KT5C 4XSXF 1JGSA 4Y17A 2P5VA 5L3BA 5L3GA 1ZRFA 5IB9A 1XFOA 3HSEA 4TV7A 4EGYA 4IRHA 1YSJA 2XAQA 2VBZA 4G94A 1QQIA 2ACJA 1DDNA 1F57A 1YW8A 3C7JA 2EV6A 4MEYF 1XMBA 2HB6A 3MZHA 4AD9A 5BMZA 3IFEA 3DEUA 1G4DA 2DPDA 3BJOA 1FBSA 3GWZA 1OKRA 1WVMA 1XSVA 2PRQA 4PXBA 3VEPA 3QP5A 2DQRA 4UUVA 3E5XA 3TDUC 5FD5A 2CSOA 2K86A 2GIVA 2CF4A 5LRSA 4R8FA 3D7DA 3LSTA 3F8NA 4EJUA 2C6CA 1XB4A 1MDMA 3WC6A 2R3SA 3FWEA 3IRQA 1U5TB 2HDCA 3KP2A 4A0ZA 1SD7A 3KHZA 3GFLA 3VH9A 3O6BB 4YU9A 2NRAC 5HS8A 3IO1A 2JBJA 1IN6A 4RB3C 1EV7A 1YS7A 2ABZA 5DYMA 3FF3A 2O4HA 2Y48A 4CO8A 3GX4X 1QZZA 1R1TA 5FO5A 3JTGA 3IWFA 2ISZA 2EFNA 3V8KA 4ONWA 5E1XA 3MN8A 4OINF 4AIHA 5DDGA 2KKOA 3VTAA 3NH4A 2D45A 5BPDA 1EH8A 1VIXA 3J80Z 1FYLA 2IRFG 3WGGA 4UV8A 3KP7A 1YIOA 2F8HA 1V6CA 2EA2A 4KSIA 1IN4A 1FT7A 2VXZA 1J59A 4CICA 5ILUA 1O7LA 2P8TA 3B02A 4EWTA 2V8DA 2PJPA 1QO0D 3O2PE 4LLGF 2YPRA 2EV0A 3CO6C