3K9TA

Crystal structure of putative peptidase (np_348812.1) from clostridium acetobutylicum at 2.37 a resolution
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
435
structure length
422
Chain Sequence
GMEEINKYIQNSSETGGEIYNLIEELFPICRSITGNGVRKTMDIIRKHIPLEIHEVKSGTKVFDWTVPKEWNIKDAYVRNSKGEKVIDFKENNLHVMSYSVPVHKTMTLDELKPYLHTIPGNKDRIPYLTSYYKENWGFSLTQNKFDELCDDDYEVVIDSSLEDGSLTYGEYYIRGELEEEILLTTYTCHPSMCNDNLSGVALITFIAKALSKLKTKYSYRFLFAPETIGSITWLSRNEDKLKNIKMGLVATCVGDAGIKNYKRTKFGDAEIDKIVEKVLMHCGSEYYVADFFPWGSDERQFSSPGINLSVGSLMRSCYGFDGYHTSADNLCYMNKDGLADSYKTYLEVIYTIENNRTYLNLNPKCEPQLGKRGDEFAMFWVLNMSDGKNSLLDIAYKSGMEFRRIKYAADALYRVELLKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative peptidase (NP_348812.1) from CLOSTRIDIUM ACETOBUTYLICUM at 2.37 A resolution
rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase
molecule keywords putative peptidase
total genus 139
structure length 422
sequence length 435
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09940 DUF2172 Domain of unknown function (DUF2172)
A PF16221 HTH_47 winged helix-turn-helix
A PF16254 DUF4910 Domain of unknown function (DUF4910)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k9tA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3k9tA01
3.50.30.90 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3k9tA02
2FMYA 2F2EA 3BZ6A 5ICGA 4JQFA 1XMBA 1Z7UA 2MBFA 4UIBA 2HTSA 3D68A 1O57A 1B9NA 2D45A 4DUKA 3P9CA 3HSRA 2C6YA 4E70A 4HLYA 3MZHA 3WABA 5J6XA 2FVGA 4G6QA 5HLHA 1HKSA 3S9LA 3P9IA 2J5OA 4PGHA 1K79A 2ESNA 3PB6X 3HYIA 2J9AA 3GX4X 4OIRF 3CJNA 3J7AO 4CYDA 2AS5F 4IRIA 3MFKA 4EJTA 2C1CA 1XSVA 4M71A 4EWTA 2XAQA 2IMOA 4A38A 1I6XA 2DEAA 3REOA 4ASNA 1RNLA 3CTAA 1WI9A 1PP7U 4P9UA 3FMCA 3F8CA 1YQAA 2RFHA 2PEXA 1LDJA 2V9VA 4KIFA 4BHBA 1H8LA 3LAJA 1P6RA 2F8HA 5DS0A 4OOIA 2DQRA 5JR3A 4HDUA 3F8MA 6CPAA 3BI0A 3L2NA 3QAHA 1F1ZA 5K5QA 3FVLA 5LRKA 4HYEA 3L00A 1PDNC 5A2QK 2M30A 2PG4A 5JI6A 1K78A 1I27A 2DU9A 2IT0A 2R3SA 3BP8A 2HFHA 2WC2A 1KYWA 3OOPA 1ZRCA 3TO7A 4HF0A 3O2PE 3COAC 3WC5A 4IXAA 2BE5F 5DUKA 5FD5A 2VOPA 5HLIA 3B3TA 2ZNZA 1WQ2A 3RPUA 2AFWA 4IHTA 1LEAA 4UVAA 4WK8F 3M8EA 1TTYA 1BPNA 4YU9A 1U6GA 3QNVA 1TQMA 2VL1A 4UHTA 1UHWA 5LHHA 4EJWA 2AXLA 2V1UA 4NGSA 2VXZA 1UCRA 3DLJA 4KNYA 1O3SA 3M1EA 2PMUA 1B1BA 2EFNA 2CTCA 1H9GA 1WKMA 5IT9Z 1AMPA 4L0YB 3BHXA 2Q2EA 4R7MA 1EV7A 2HKXA 1ZG9A 1XGNA 3NH8A 1IXSB 2EK9A 2PJAA 1XD7A 2V1DA 5ELYA 2GAUA 4IJAA 5D5WB 3PB4X 3LA2A 1R58A 3VOEA 1BIBA 3L2CA 3KZYA 4AVPA 1IW7F 1BM9A 3CPAA 2BGCA 4ZY0A 3H8GA 2ISZA 3ISZA 3DPLC 1ZLHA 1CP6A 4O23A 1KWMA 2XAHA 2P8TA 4KN7X 4WX9A 3VATA 4F8ZA 4PGGA 4OC5A 5HOOA 1TNSA 2DBBA 4NGMA 1V4RA 5H20A 1J2XA 4ESFA 2ZEEA 1YO5C 3KR5A 5ILSA 2CF4A 2XUBA 1LDDA 3JW4A 2W57A 2Q4ZA 2GXGA 1U5TB 3MQ0A 4P45A 2O61A 5LYIA 4UV8A 3LQRA 1ZREA 3SI0A 1CBXA 1T2KA 2HKOA 2Q0OA 5DD4A 3DEUA 2EK8A 2GIVA 4M9SA 3FXRA 3GFJA 3V7RA 2G7UA 3HIFA 1PP8F 2ZOGA 3Q9VA 4U0VA 3DXJF 4WXDA 4Y17A 1BJAA 4MHGA 3B02A 1S6LA 3W6JB 3N5FA 1J9IA 3PB7X 3F8FA 3QP5A 5LHIA 1OR7A 3V7CA 2IJLA 1AOYA 2XIGA 2V8HA 3E6BA 5LLQA 5K8NA 1E17A 4M6YA 5D5XB 4A2UA 1D8KA 4RGSA 5LBQA 4HX7A 3I4PA 1CPXA 3MAJA 4L0ZB 1TQIA 2DTRA 3KEOA 1G3TA 4FWUA 3GEZA 4MEXF 5BPDA 3F3XA 1UB9A 1SMYF 4YIFA 1LAPA 4HV5A 4S04A 2ZBKA 5E18F 3HSEA 4BYYA 4MHNA 1D5VA 4KT5C 4MNUA 5BOXA 4RGRA 4R79A 2HEOA 4A0YA 4DJLA 1H0MA 2HYFA 1P4AA 3RJPA 4Q47A 1SFEA 4Y15A 3WGGA 3NA6A 5ICFA 2O53A 2QQAA 1J7KA 4IVNA 4ZY1A 1FBUA 3KLOA 4G7HF 1Z6RA 1UHMA 4NFRA 4NGTA 2QUFA 1TW2A 4D0PA 3I0TA 3FF3A 1SAXA 2A3SA 4A6EA 1QGPA 4NHJA 1ARMA 3HOTA 2KJCA 3GYHX 3C7JA 1ODDA 3MZYA 1ULYA 1ZN2A 1USTA 1FSHA 2E1CA 1REPC 4HA8A 1LFWA 1MZBA 1KQ9A 1B6AA 2VODA 2OA4A 3U1DA 2BOAA 1MJAA 4M9ZA 1ZLIA 2DW4A 2QLZA 2DI3A 2ABZA 3ML6A 1XDSA 2QVPA 5LRGA 4JYWA 4FX4A 5L3GA 2BO9A 3NEUA 2FEZA 2XEJA 2C6GA 1L3LA 2Y75A 2K7LA 4R8FA 1CGPA 2Q51A 2HOEA 5LGNA 2QBYB 1O3RA 2YSRA 4YFXF 5AONA 4OIWA 1JGSA 3D7FA 3I58A 4EQQA 4TNUA 5J8CA 1P4WA 5HVQC 4H2KA 4MMOA 4KMFA 2GLFA 4O6JA 4WF2A 1YSJA 3S9MA 1Z6TA 3IWFA 4EM2A 2W84A 2V1XA 2ZJ2A 3H8EA 4WWCA 4AXVA 1P92A 3JSOA 3CUOA 3LWUA 2E7XA 1BLLE 8CPAA 4IHSA 4I7HA 1W5SA 1F9NA 5LYLA 3HSFA 2D2WA 1ZAOA 2PJ1A 5K1YA 5JVTA 2E1NA 2P5VA 2NNNA 1D3YA 1IGBA 3TX8A 3LWFA 3EETA 4LG0A 2LF8A 5KK1A 1CX8A 2P7CB 4DNCA 2STWA 2FXAA 1U2WA 1F2OA 1GHCA 2MC3A 3FECA 3SXYA 2FA5A 3VARA 1TW3A 2QENA 2MLKA 5I4MA 1VGYA 4M73A 3KCCA 3M9AA 4OIOF 1S7AA 2RC4A 3E6DA 2ZKZA 1HKTA 5E20A 4UEFA 4JZ0A 1U78A 1FY7A 2EB7A 4DYOA 3E5QA 3RYRA 2IQ6A 2PIZA 2IP2A 1SMTA 2ZEMA 4LK1F 3RTRA 1Y0UA 4ZH4F 1R1UA 2PMHA 5AIPA 4JK1X 2P6TA 5LRRA 4ETSA 1TNTA 5DUIA 4EGYA 4L18B 1QPMA 1RIOH 1ZG3A 1E2XA 4CGZA 3TDZC 4KN4X 4FT8A 4NGQA 1ZYRF 5D5UB 4PZJA 2CFXA 5L3EA 1LANA 1U5TA 1LCPA 3AAFA 2C6CA 4UEEA 3NH5A 3PBBA 2ZOFA 1EH6A 4K2EA 3TGNA 2QBYA 4CZZA 2AFUA 1R1TA 3QOPA 2L01A 1XGSA 4GYIA 2ZEOA 1YW7A 3J81K 4EV0A 3JSPA 2HS5A 2XAJA 1FNOA 1T6SA 3SJFA 2IA1A 2A6EF 4B8XA 2AFSA 1Y0RA 2PJBA 4WJBA 4QWQA 4LB6B 1RUNA 2I3CA 3IKTA 3SQNA 2PN6A 2O0YA 1Z5RA 5D8LB 2EV5A 4MTEA 4HF1A 1KGSA 1J59A 4G7OF 5CVIA 2HWVA 4G8XA 3TO6A 1KU9A 3FX6A 1HW5A 2TDXA 4M74A 4XLPF 2WZNA 3MCZA 3VEPA 3KR4A 5JM6A 4UNOA 5HS7A 3BJOA 3FX3A 3R4KA 1RUOA 5K8OA 2G7HA 4R1HA 2MH9A 1LJ9A 3PB8X 2DT5A 1Z2LA 4LK0F 5FGMA 3D7DA 1ZARA 2LNBA 2F5FA 1Z05A 3T5XA 4KYWA 3F22A 1XN7A 5KVRA 1XB4A 4HW0A 2VT3A 2PFBA 5FLXK 4UVBA 2XRNA 1SD4A 1KYZA 3CT9A 4HF2A 4GGGA 4P9FA 1D8JA 2EFOA 3V4GA 4P4EA 1JE8A 3EYIA 5HVHA 3K2ZA 3KETA 1OMIA 4P4JA 1YFHA 3I64A 5HDGA 3LAPA 2HB6A 1SD7A 4ZZLA 3WTYC 2VT2A 1BI0A 2FF4A 1HDUA 3L09A 2AFXA 3K0LA 4MCPA 2MA3A 2PBIA 2FBIA 2NSMA 5D8KB 2FE3A 2RKHA 4EVIA 4P55A 1FBSA 4NQWA 4CPAA 3ZMVA 4P44A 2E7WA 4NJRA 5LHGA 2HC9A 2GREA 3LFKA 1EH7A 1ELLP 2RQPA 3SZPA 3IFEA 4WXHA 4BXUA 2PJPA 2VBYA 2XVCA 3J80K 1HQCA 3DPTA 2F5EA 3KP5A 1IXCA 1DDNA 1STZA 3NRVA 3LMSA 2P6SA 2FRHA 3RYPA 3G73A 4X3RA 2CO5A 2UWMA 2A61A 2EWBA 2KJBA 1YW8A 2HTJA 1EH8A 4EJOA 5L3FA 4RB0A 4CDGA 3RKXA 4YFKF 3ZN0A 2H27A 1IZ1A 3GLXA 1TF8A 1IXRC 4I01A 2PJ2A 1W5TA 3WU0A 2DK8A 4MCSA 3F6OA 4G1PA 3PQKA 3GF2A 1HKQA 4YWYA 4A5NA 3GFIA 5HDNA 1GXPA 4N0BA 1LAMA 3MN8A 4FX0A 3ZQ7A 3BI1A 4CICA 5HLGA 3N4MA 2CGPA 2LDUA 1BI1A 1J5YA 2ZMEB 3J80Z 4PXBA 1JXSA 3FWEA 2CW0F 2KIFA 3EQLF 4M6XA 4G94A 1AWCA 3N97A 2O3FA 1YS6A 1CP7A 4IK2A 3DQVC 2K4BA 3V38A 1XMAA 2M87A 3K1PA 1PCAA 3T0YA 4NJQA 2MD5A 3SI2A 5DCMB 5FO5A 2L54A 5E8IA 1YW4A 4P4BA 1G3WA 2CSOA 4XRFA 3KHXA 4Q4ZF 3GWZA 4NGNA 2EK5A 1WWXA 5ILUA 2FOKA 2LKPA 3PFOA 3ECHA 3QU3A 1FX7A 2MH2A 3TDUC 3ULQB 4DQ2A 4P10A 2JPCA 2RNJA 3MEXA 4LMYA 2EV0A 4PDKA 2VBXA 1TKFA 5L3DA 1ZRDA 2OD5A 4PQAA 4U0WA 3HTSB 4AWXB 3CLOA 4ESJA 3IRRA 4OIQF 1Y0YA 5ICEA 3O3KA 1Z9CA 3HRSA 4H0EA 4KIGA 1XGOA 2A6HF 1R23A 3TKYA 1R1VA 2ZEFA 1G3YA 2FBKA 2NRAC 3BXMA 4Z2YA 4ZZDA 3GO5A 3T8TA 1Y7EA 5FB2A 3R0JA 1O7LA 3S9NA 3DFGA 2D1HA 2OU2A 2RGVA 4OC3A 1ONVA 3F8NA 3H3UA 5DEQA 2ZMEA 1ZRFA 1GYTA 3KP7A 4HLXA 5CVRA 4ESBA 3DV8A 3M7GA 4B09A 4I98B 3WE3A 4IHMA 1SFXA 5FFXA 2EFPA 1HSJA 4OC0A 5D5VB 3KASA 2A69F 2H6BA 1F2PA 2POKA 2CYYA 5K5OA 3J81Z 2P5KA 2ZXJA 3EUHA 5HDKA 2B0LA 3CPXA 4IRGA 2Z5UA 4EGZA 3GFMA 3KP3A 5CVJA 2DPDA 1IN8A 1R36A 5D8NA 1MKMA 2L3DA 3HUVA 2W85A 5LYFA 2OR4A 3PFEA 2NNYA 3PBEA 1RI7A 2Z9OA 2VC1A 1V3FA 4HX8A 3PFIA 2ZEHA 1UWYA 1TF9A 2KRFA 1T39A 1GXQA 4OC1A 3G3ZA 2ESHA 3DP7A 4RGUA 2BV6A 2DAOA 2ANPA 5EEHA 1NSAA 2XEGA 1TXRA 4IRHA 4YG2F 4EM0B 4UIAA 4G7ZF 4M9XA 2OOTA 1SFUA 1ON2A 2L4MA 4LG0B 4L5JA 2QQBA 2IW5A 1YIOA 4PXCA 5E17F 4X8IA 1ARLA 2YPRA 2ZELA 3KQXA 3GZ5A 2DK5A 4ON0A 2CQKA 4Q48A 1X3UA 3SJGA 4P5OA 2YX4A 3P7NA 3VB2A 2XAGA 5E1WA 4Y13A 4U88A 4PPZA 2RDPA 4OMYA 4IPAA 1WRJA 4EMEA 3FEDA 4RAZA 6PAXA 4ENNA 4RB3C 1WSUA 3E3VA 2XEIA 5LRJA 2K86A 1FP2A 4EJVA 2F7VA 3TC8A 1BAVA 3WU1B 3PEIA 3GB0A 1R5GA 3HHGA 3F72A 1OYWA 4I09A 1YW6A 2PJ7A 4UEZA 4BHPA 2BYVE 3ZMTA 3GUXA 4MQ9F 3GUDA 2IA2A 4JBAA 3CDHA 2XGXA 1FZPB 1FNNA 2FSWA 1G6NA 1RZ4A 3V8KA 1XCBA 4L9NA 5ED4A 1PYTB 2ISYA 1U5TC 1T0FA 4HQEA 4CXFA 3K9TA 5CLSA 1IN4A 3FF5A 1M4LA 3I71A 3F6VA 4F9VA 2JZYA 2FQ3A 4GYGA 3K1NA 1JHHA 1AYEA 3FHZA 5LEJA 5FFZA 2H09A 4RAYA 3KHZA 3RI4A 4N9HA 4PXEA 2EWNA 5HS8A 5EEGA 4G9YA 4OC4A 4A39A 4ZYEA 3NFZA 1S29A 3SZTA 2PLYA 1IF1A 3JRUA 1W4MA 3I59A 5FLXZ 3FXQA 2M8EA 3SFZA 4P6YA 4B6ZA 1KQ8A 1SD5A 1R7JA 3JTGA 4P96A 3WTUC 3R61A 4P4FA 1R22A 3SI1A 4ENMA 1FT9A 1K6OA 1FPQA 5DV5A 2IJZA 1W7PB 2CWEA 3FEEA 2PJ4A 2X0LA 2XHKA 3KP2A 2KKOA 1MGTA 2VBZA 1R43A 1LOKA 4MCRA 1CG2A 4MQVA 4YFNF 4MGRA 4R76A 2CIJA 2UXXA 3GXOA 1TLHB 2ZEGA 4ZI6A 1FT7A 3LSTA 1QQ9A 5F6FA 3BROA 2UZKA 2J5PA 4UF4A 1FYMA 2OZ6A 4U0YA 4GM5A 3HRUA 3SHFA 5E1ZB 2RB7A 3QP6A 1Z91A 1QO0D 4A0XA 3E6MA 3BJ6A 4FHTA 3E97A 5J1QA 1QBJA 2STTA 1G3SA 3D67A 4EMSA 2PI0A 3IL2A 3KLNA 1XFOA 5LYDA 2GA2A 1CF7A 4P4IA 3DF8A 5BS6A 3ZMSA 1IUYA 4XLNF 3HLPA 3ZMUA 2ZCWA 2F5DA 2VONA 1DP7P 3KE2A 5JFRA 1HBXG 1P2FA 3RBUA 2A07F 2PCUA 3BJAA 4KUMA 2NS0A 1XJOA 4A6DA 3B3CA 1YMEA 3I53A 5LRSA 3QPHA 3EDPA 3D66A 5F64A 2OQRA 3I5UA 2DO7A 1YTYA 2Z3YA 5TRDA 2NAZA 5D6FA 3ABTA 2KIUA 1QMUA 2HGCA 2OAZA 3DKWA 1S3JA 4O3MA 3L7WA 4ZYDA 2DPUA 2K27A 4GCVA 4KMUX 3BDDA 1R5HA 2ADUA 4U7BA 1LVAA 1ZGAA 2RVCA 2JPBA 4O5VA 2XAFA 2PJ5A 3IIBA 4GXOA 5ERIA 3GW2A 5BQTA 3KFWX 1QNTA 3M8FA 4G6DA 4MTDA 3H8FA 3H3ZA 3FZVA 5H6RA 4AIKA 5JGFA 2M5WA 4CHUA 1YS7A 3P9KA 1QZYA 2PE3A 4ZX8A 1HXDA 3KZWA 2YR2A 3E5UA 1ZH5A 4OINF 2O8XA 4MCQA 1C0WA 4S05A 2AFOA 4A94A 1BC8C 4FAIA 3R60A 4ONWA 1BI2A 5LGUA 2EJRA 3Q9SA 4HX4A 4ZYQA 4CO8A 2GA1A 2JRTA 1XRYA 2BCOA 2K02A 3IRQA 4ENJA 4L5IA 2Y48A 3NH4A 1EE3P 5D4SA 3WC6A 4R8HA 2HQNA 1KU2A 1S7OA 1IAWA 2O6GE 1FP1D 4YIIA 4F9UA 1J75A 3T1BA 3K69A 4L9TA 4OU0A 4HOBA 2GLJA 1USSA 4PXDA 1ZLKA 1TKHA 3IKVA 3R0AA 2JTVA 5JHUA 1DE4C 1JHFA 4OC2A 4I0AA 1OPCA 1YYVA 2W24A 5CVVA 5HS9A 4KA4A 2PJ3A 1DPRA 1ZG8A 2DFIA 3F21A 2QJ8A 2NYXA 2YX7A 3F8BA 5D4RA 2P5LC 1ZLJA 3FM3A 4A37A 5A2QZ 3V8LA 3C1DA 1KU3A 3KL9A 2RV8A 1ZHFA 4WWVA 3WG9A 3WODF 1HW1A 1QQIA 2BBYA 1R3NA 1TKJA 3B3SA 4L9JA 2X4HA 4MHZA 2C6PA 4K3NA 4RB1A 3DGVA 3B7IA 4XSZF 1O3QA 3D5LA 3WTSC 4HQMA 5CJ9A 3FXUA 1I5ZA 1UFMA 3V7ZA 2QWWA 1XCVA 3CUQB 2GU2A 5IB9A 5DD8A 1DTDA 1W7PD 4RGXA 5J8FA 3ROUA 1W7PA 2L02A 4KDPA 1MJBA 3C3WA 4Q5SF 1B59A 2HR3A 2Q43A 3TQNA 2QZ8A 4BH9A 2ZFWA 3ZP5A 2FBHA 3QU6A 4HBLA 3I59B 4IAVA 3T8WA 4OMEA 3PRTA 2O03A 1K7AA 4LLNA 3NQOA 3MWMA 2NYQA 2QYVA 1FBQA 4BD9A 4MRIA 2EFQA 1YLOA 1XSDA 2FMLA 3CO7C 4TV7A 5DYMA 2LSOA 2XKOA 5ICCA 1FWZA 2G9DA 4KSIA 3GFLA 1TQPA 1MDMB 2ELHA 4A5MA 3CO6C 2OBPA 2Z33A 1FYLA 1FOKA 2XEFA 4WCGA 3Q5FA 3I1UA 2VE9A 5D6EA 3WTXC 2PJ0A 2V79A 3E5XA 3HRTA 4RS8A 3BY6A 1KU7A 2ZO4A 3RDIA 2JEWA 2V8GA 3OV8A 1P4XA 1KA8A 3CDXA 3K2KA 3WGIA 2AFMA 1Z1DA 2EFWA 3WGHA 2H6CA 5HVGA 5CPAA 3L9FA 1BPMA 2F5CA 2IVMA 3S2WA 4XSXF 3D7GA 3SJXA 3TO9A 3T8RA 2D1VA 3ZMZA 3KP6A 4Z65A 1LQ1A 1XBUA 4BHCA 1MDMA 2WV0A 4WXCA 5H6QA 3KI9A 2O4HA 4I2OA 3WE2A 4QLCU 2ZENA 3EYYA 1MJ9A 3E6CC 3V8JA 5AIQA 4LLLA 3LA3A 5E8GA 4GO1A 2K4JA 1IN6A 3ERED 2JBKA 2G9WA 3ELKA 2GXBA 2LF7A 3HOSA 5K5RA 3K1MA 1Z8LA 2M45A 4MXUA 3D4UA 3JTHA 3O6BB 1U8RA 2PJ8A 1HEEA 5HXDA 2A5YB 4XBFA 4A0ZA 2UXNA 2HZTA 1F5TA 5L3BA 2Z99A 4P4DA 1Q7LA 4KICA 2PRQA 3HHHA 4N9IA 1J0RA 3TOBA 5LEKA 1SD6A 4OKOA 4EM1A 5DCMA 3IJ3A 1FYKA 2DQLA 2QVOA 5TJJA 2ZNYA 3WTWC 1OBRA 1IRFA 1BC7C 3B3WA 2A68F 2RN7A 3BPXA 3ABUA 3ZN1A 2ZEDA 3GLJA 2DLLA 2Y0MA 1CPSA 2EA2A 1ON1A 2OZUA 2JSCA 4OIDA 1Q1HA 2ZEPA 2GWRA 1IN5A 3WTTC 2YU3A 1YG2A 4M72A 3LA7A 1H9TA 3V7SA 2M1BA 3U2RA 4BNCA 4BAYA 4OP4A 4R6TA 2PVVA 3H92A 2PIYA 2QQ9A 1T98A 1HSTA 2WWYA 4ZX9A 1F57A 2VE8A 1A04A 3IHUA 4HV6A 3WTZA 3GZ6A 3PB9X 2COMA 1CF7B 3JAMZ 5CYVA 1OKRA 4LQGA 4FUUA 1BIAA 3FMQA 1FSEA 2FU4A 2P4WA 4UUVA 4EJUA 2P7VB 5K8MA 2CG4A 4LGWA 2V8VA 4RB2C 1O7FA 3RIRA 3F23A 5HVFA 3W6KB 2VN2A 2JT1A 2EA4A 2CTBA 1XSXA 3BPVA 3BOQA 1FC3A 1FLIA 3RZAA 3WC7A 2HDCA 3FM5A 4ZYHA 1QZZA 2PJ9A 1XMKA 2WTEA 5E1XA 4HDVA 3C18A 2BEOA 1BI3A 2QM3A 5FD6A 5CVUA 1ZG1A 2HQRA 3FJUA 3JAMK 1LB2A 1IRGA 3KGQA 1I1GA 3IWZA 3ZMDA 2XV4S 4U7DA 3FMRA 3ISPA 3FMSA 1ZG7A 1S8NA 4L9VA 4BQAA 1IN7A 1VIXA 1U3EM 3HRMA 5THWA 4LD5A 2H94A 2XROA 4LB5A 1NHAA 1B9MA 2L4AA 3RPQA 1HW2A 5BMZA 4I02A 5F1RA 5IT3A 7CPAA 3HTUA 3MRUA 5L3CA 2WYRA 1ZGJA 1ELMP 2VOOA 3B35A 3HUGA 3B3VA 4HAMA 1YLFA 5DCFA 3I54A 1OYYA 4A12A 3SJEA 3FH4A 1MD0A 2V77A 3QRFF 2ACJA 3VFZA 3RAMA 2IPQX 3D7HA 1HDQA 4TWEA 3U9GA 1DPUA 4NGPA 3WTVC 4AIJA 1YW9A 5D29A 4OIPF 2AFZA 4LLGF 4ENKA 3ISXA 2R7FA 2V8DA 2IRFG 2JBJA 2VC0A 3CUQC 3PQJA 2V6CA 3QPTA 4LJZF 1F4KA 4MHPA 1TBXA 4ZY2A 2GQQA 1VHEA 4HZFA 2OQGA 1ZG5A 5JH9A 3KQZA 2FNPA 4ZYGA 2W25A 3VH9A 3IC7A 1XDUA 1DUXC 4FBEA 3GVAA 4OMZA 2Q8KA 3TOAA 3KP4A 2R7DA 4AIHA 5CBMA 1KQ0A 2PQ8A 2XASA 3WT4A 3IWWA 2PJ6A 3IEHA 1B4AA 4X2TA 1G4DA 3D0SA 4IF4A 2PJCA 3RKWA 5BPIA 1LEBA 1LDKB 4F7ZA 5LGTA 1BN5A 1O3TA 1VHOA 4AD9A 3KZZA 4NGRA 1GVJA 2EV6A 3RKYA 4MHYA 2PVWA 1IY7A 3IC1A 1K78B 3B73A 1I1SA 2XKPA 5ILVA 1PUEE 2VBWA 3ZPLA 1L0OC 1JQGA 3BWGA 3CUQA 4RUHA 2IA0A 1XGMA 1BBYA 1R00A 4UV9A 4KFCA 5IT9K 4Q7AA 4W9YA 3ECOA 3LQQA 5F09A 1T38A 4EFDA 3IO1A 4NB5A 2ETHA 2HYGD 3R6SA 5K8PA 4I0BA 2MLGA 4UXNA 3KEQA 1OYIA 5DDGA 3B2YA 2GZWA 1RTQA 1BOAA 3VODA 4LFUA 2FNAA 2QYOA 1VTNC 2KIMA 4MEYF 4PCQA 1LNWA 4KIBA 4UVCA
chains in the Genus database with same CATH superfamily
4IL6C 2FMYA 2J8RA 3R9FA 3CCYA 2F2EA 2IXSA 3BZ6A 2GXAA 2HNHA 5ICGA 4JQFA 1XMBA 3C2BA 1Z7UA 2WPWA 4FQGA 4BEHA 2MBFA 4G12A 3E7LA 4UIBA 3HG9A 2HTSA 3D68A 4A3MJ 4I76A 1O57A 3PNVA 1B9NA 3KYCB 2XRLA 1T0FC 2D45A 4DUKA 1IUFA 3HSRA 3P9CA 1YIJI 2C6YA 1PVEA 1LVKA 1B8IB 3NE8A 4KS9A 4BMHA 3K4KA 1VI4A 4E70A 1R5ID 3HBLA 4HLYA 3MZHA 4PJ0C 1YR0A 5AG7A 5F47A 3WABA 5J6XA 2FVGA 4G6QA 5HLHA 3LODA 3I9V2 4AU7A 1SQHA 1HKSA 3S9LA 1YITI 2Y9ZA 3L1PA 2L0KA 1Z3YA 3BT9A 3P9IA 4PSWA 5K7ZA 1JGGA 3ZJ0A 2YU9J 4Y7NJ 4V2GA 2J5OA 4EATA 4PGHA 1K79A 2ESNA 3QYBA 3PB6X 3HYIA 4YFJA 3S3OA 2R7TA 1BO4A 3GX4X 2J9AA 1VQ5I 1V55H 2EVNA 4OIRF 3JRBA 4XL9A 3GMEA 1E3OC 3CJNA 3D5RC 1QPIA 3J7AO 4CYDA 3BG7A 4J00A 1JT0A 2AS5F 4IRIA 4XPDC 2QKLB 3MFKA 4EJTA 2DFFA 2C1CA 1XSVA 3G1OA 4ZC3A 4M71A 1S3ZA 2BUEA 4EWTA 4ONUA 2XAQA 2IMOA 3W6SA 1I6XA 2GBYA 4A38A 2DEAA 3REOA 4ASNA 5C88A 1M1DA 2A4NA 4MFDA 2YGWA 5F08A 4BY7J 1RNLA 3CTAA 1WI9A 4B3XA 1PP7U 1P0HA 4P9UA 3VYUB 4F0YA 1WH7A 2LMDA 3FMCA 3F8CA 5AGEA 1YQAA 2HI6A 2RFHA 2PEXA 2EUIA 1LDJA 2V9VA 3WC5A 4C8CA 2W00A 3BTJA 4KIFA 4BHBA 1VI0A 1P6RA 2BW3B 4C9YA 3LAJA 4OOIA 2DQRA 5JR3A 2E19A 2BHZA 3CF5F 4HDUA 4A3IJ 4JP0A 3F8MA 6CPAA 3BI0A 3L2NA 3FBIB 3QAHA 1F1ZA 4M3FA 5K5QA 3FVLA 2DDBA 1E3PA 4A69C 1BA5A 4C7HA 5LRKA 1K6YA 4HYEA 3L00A 2PC1A 4IHWA 1PDNC 5A2QK 2M30A 2VZYA 2PG4A 5JI6A 1K78A 3W3CA 2PJRB 2MABA 1R49A 1I27A 3BC8A 2DU9A 1K61A 2V6EA 5F0FA 1I12A 2GP4A 2IT0A 2R3SA 3BP8A 3OWCA 1T33A 2COBA 2HFHA 1TWHJ 1VQOI 2LRDA 1KYWA 2WC2A 2FOWA 3OOPA 2ZJQF 2OH1A 1Y9KA 4KOUA 3ZR8X 1ZRCA 3TO7A 4HF0A 3O2PE 3P2FA 1B72B 1MBJA 3COAC 4IXAA 1E3HA 2BE5F 5DUKA 3IAS2 5FD5A 5HLIA 3OYNA 2VOPA 5C44J 2ZNZA 1WQ2A 4OAZA 2R7XA 4B5PA 3RPUA 3QYEA 3HGGA 4IHTA 1LEAA 2Y69H 2R7VA 2AFWA 4UVAA 4WK8F 3SDGA 3M8EA 5IYBJ 1TTYA 1BPNA 4YU9A 5B5EC 4LUAA 2AJ6A 2R5ZB 4B11A 1U6GA 1JUPA 3OYMA 3QNVA 1TQMA 2KLOA 3AG1H 4UHTA 2NVXJ 2VL1A 1UHWA 3EUAA 5LHHA 1T08B 4NF1A 3TFYA 3S1MJ 4EJWA 2AXLA 2YNCC 2V1UA 2HV2A 4MIMA 4NGSA 2VXZA 3QQAA 1UCRA 1QU3A 3DLJA 1J3LA 1X3ZB 4KNYA 3AG2H 4F3QA 3M1EA 2PMUA 1O3SA 4CCKA 1B1BA 2EFNA 2K5CA 1BW5A 1H9GA 2CTCA 1ZRSA 2KFDA 4COGA 1WKMA 5IT9Z 1IJWC 1WJEA 3PNTA 3FXTA 2WB1A 1AMPA 4L0YB 3BHXA 2Q2EA 3ZQQA 4R7MA 1MH3A 4NBQA 1EV7A 2HKXA 1G2HA 2EIJH 1ZG9A 1XGNA 4C86A 2IAIA 3NH8A 1IXSB 2EK9A 1I3QJ 3GTJJ 4UFXA 2PJAA 1XD7A 2V1DA 5ELYA 4B13A 3QOEA 2EILH 1TZLA 2GAUA 4A31A 4IJAA 3K7AJ 5D5WB 1PU9A 3PB4X 2FM4A 3ONQA 1PUAA 3LA2A 1R58A 3VOEA 1BIBA 3KX2A 1EZAA 3L2CA 2WY7Q 3KZYA 4AVPA 1IW7F 2KL4A 1BM9A 3CPAA 9ANTA 2BGCA 4ZY0A 2DA4A 1RR7A 3H8GA 1M6VB 2ISZA 3ISZA 3DPLC 1YVKA 2ICWG 1YRNB 1ZLHA 1CP6A 4O23A 1KWMA 4FE7A 2XAHA 2P8TA 4KN7X 4WX9A 4HNVA 1LE8A 3VATA 4F8ZA 4JX5A 4PGGA 2CFOA 2Q1ZB 2XF5A 3RZOJ 4OC5A 5HOOA 5C82A 3K4NA 1TNSA 2DBBA 4NGMA 1V4RA 2LREA 5H20A 3CC7I 3HJEA 1J2XA 2TCTA 1UJ8A 4ESFA 2VL8A 2YNEA 2ZEEA 1YO5C 3C2HA 4XR6A 2KIQA 4FD5A 4NSQA 3H0DA 4I99C 4QPOA 3KR5A 4IQJA 1X1DA 3HC7A 5ILSA 2CF4A 3K4IA 2XUBA 4BY1J 1LDDA 1YVOA 3JW4A 2W57A 2Q4ZA 3EUKL 2GXGA 1U5TB 2NS7A 4V2FA 3MQ0A 3MKYB 3M07A 4C85A 4P45A 4INJA 4RBOA 2O61A 4FTHA 5LYIA 4UV8A 3LQRA 2C27A 4F0XA 4CRYB 2R7HA 1ZREA 5K8MA 4KISA 2ZXHA 3SI0A 1CBXA 1T2KA 1DQUA 2HKOA 2Q0OA 4CRZB 5DD4A 1SANA 3DEUA 4C3HJ 3CCQI 1RPWA 5HMNA 2EK8A 2GIVA 5IX3A 4M9SA 4PUSA 3FXRA 3GFJA 3V7RA 4E8OA 2G7UA 3HIFA 2JVGA 1PP8F 1EF4A 1GUUA 2V9PA 3S2HJ 2ZOGA 1BR4A 3Q9VA 3KIOA 3DXJF 4U0VA 4WXDA 4Y17A 3MKZA 4F93B 4C8PA 2L9VA 1VQ6I 3L2QA 1S7NA 1BJAA 1D0XA 3I3GA 3TEDA 4MHGA 3ZOBA 3OIQA 3BQYA 3B02A 4Y49C 2MYSA 1S6LA 3W6JB 3N5FA 4UWJA 1J9IA 3PB7X 1FEXA 3F8FA 3QP5A 4B43A 5LHIA 1JJ6C 1OR7A 2XDVA 2RREA 3V7CA 5LFAA 3NWSA 2IJLA 1AOYA 2PX9A 3PZJA 2XIGA 2V8HA 4M85A 3E6BA 4RA2A 3TP3A 5LLQA 5K8NA 1CS0B 1E17A 4M6YA 2VZZA 5D5XB 5G20A 2K9QA 1D8KA 4A2UA 4D7NA 4RGSA 2R7SA 5LBQA 4R57A 4HX7A 3I4PA 4RM3A 4B1RA 1OCTC 1CPXA 3MAJA 4L0ZB 1TQIA 2DTRA 3KEOA 1G3TA 5B3SH 4FWUA 3GEZA 1X3WB 3M8JA 2TRTA 3F9KA 3D5SC 4MEXF 2K85A 5BPDA 2HVRA 1OQYA 3F3XA 3QAYA 1UB9A 1IGNA 1SMYF 1JKOC 4YIFA 3ZCOA 1LAPA 4HV5A 4S04A 4BE0A 4OWRB 2ZBKA 5E18F 3HSEA 1SVMA 4BYYA 2PSWA 4MHNA 3WHBA 1D5VA 4KT5C 4ZDLA 2XC7A 3BTLA 1Y1VJ 1N77A 4MNUA 5BOXA 1RO5A 1AHDP 2ZW5A 4RGRA 3N05A 1S7KA 2BSWA 4R79A 1MBKA 2HEOA 2HOSA 4KUAA 4A0YA 4DJLA 1MBEA 4FD6A 1H0MA 3K4MA 2HYFA 1P4AA 2VKDA 4MFLA 2DT6A 3RJPA 4CYNA 5JQ4A 1XTAA 4Q47A 1SFEA 4Y15A 1Q2DA 4KLWA 2B4DB 1X1BA 3BJ7A 1AKHA 4JD6A 3WGGA 5H2FC 1XEBA 3NA6A 2JSPA 5ICFA 4F92B 2O53A 2QQAA 1SFKA 1J7KA 1D1AA 2BVMA 4IVNA 2B58A 4ZY1A 1FBUA 3P2HA 2Z3NA 2BY3A 1Y8QB 3KLOA 5E3OA 4G7HF 1Z6RA 3OYIA 4E7IA 2AE6A 1UHMA 2R7QA 4NFRA 4R87A 4NGTA 4HRIA 1WWZA 1W36D 1WGXA 3B8GA 2QUFA 2KP6A 1TW2A 2L7MP 1V5FA 4D0PA 5GAEJ 3VSLA 2LY9A 4PJJA 2L7KA 3I0TA 3FF3A 1SAXA 2A3SA 2XGEA 1QGPA 4A6EA 3C2GA 1Z21A 4BBRJ 3AL0C 4NHJA 3VWEA 4M8DA 4CYCA 1CM0A 1POGA 3IV5A 1ARMA 3HOTA 2KJCA 3S1RJ 2ECCA 2R1IA 3X2QH 4Z6YA 5EJCA 1MH4A 2HXOA 3GYHX 4L89A 2CY2A 1V54H 4PV6A 3C7JA 1ODDA 3MZYA 2HZDA 1ULYA 1ZN2A 2KPMA 5EYRA 1USTA 1FSHA 2E1CA 3CDLA 3A0HC 5CPRB 1REPC 4HA8A 2VJ4A 1MZBA 1MNEA 1KQ9A 1B6AA 3TMOA 1LFWA 4HNUA 2VODA 2ZW6A 1CE8B 2YJTA 2OA4A 3U1DA 2BOAA 4H4KC 4AIDA 2DIKA 1AKHB 1MJAA 4M9ZA 4BUPA 5J4VA 1ZLIA 3MVPA 1U0JA 2DW4A 2QLZA 1VQKI 2DI3A 1V0CA 4A3GJ 3ML6A 2ABZA 2KCWA 1XDSA 3LMMA 2QVPA 4MFJA 5LRGA 4JYWA 4AUXA 4FX4A 5L3GA 2BO9A 3NEUA 2FEZA 2XEJA 2C6GA 1L3LA 2FIWA 5EZGA 3DDDA 2Y75A 2K7LA 4R8FA 1CGPA 2Q51A 1X58A 2HOEA 3I55I 5LGNA 2QBYB 1O3RA 1Z77A 1MBFA 1FOXA 3HOWJ 4IF5A 4KOVA 1M44A 3RZDJ 2YSRA 4YFXF 5AONA 1KONA 1LPQA 3E0KA 1WJ5A 4OIWA 1JGSA 5DS0A 1OCZH 5M5YJ 3ZQFA 3D7FA 3I58A 4E7LA 4D9JA 5IOYA 5DTDA 4EQQA 4TNUA 3CJTB 3GIUA 5J8CA 1E0EA 1P4WA 1V5GA 1Z0XA 5HVQC 4H2KA 4MMOA 4D5FA 2OV7A 4KMFA 4O6JA 2GLFA 4HKFA 4A2ZA 4WF2A 1YSJA 3S9MA 1Z6TA 3IWFA 2B9SA 5FRMA 4EM2A 2W84A 3BR2A 3FIWA 2V1XA 4IOAF 2ZJ2A 2GFQA 3H8EA 1BOBA 3G6EI 4AYBN 4HG2A 2GLOA 5FVJA 4WWCA 4AXVA 1P92A 3JSOA 2OTLI 3CUOA 2P6EA 3LWUA 3Q3SA 2E7XA 5KCMA 1BLLE 8CPAA 2P6GA 3LSMA 2BXZA 1A36A 4IHSA 4I7HA 1W5SA 3P5JA 1F9NA 2IS4A 5LYLA 1KC7A 2LC2A 3HOUJ 1YOVB 3HSFA 2D2WA 1ZAOA 2PJ1A 5K1YA 4BJ6C 5JVTA 1NH3A 2E1NA 2P5VA 3DTIA 2UV1A 2EINH 5FLMJ 2NNNA 1D3YA 5M5WJ 1JTYA 1YI2I 3HOZJ 1IGBA 2D4PA 2D4OA 3OSGA 3LWFA 3TX8A 2A05A 3EETA 2LF8A 4LG0A 3I74A 4F6AA 2VB6A 5KK1A 1CX8A 2BY0A 3LSJA 4DNCA 5IP9J 3DBRB 2FXAA 3IH4A 2P7CB 3SYTA 2STWA 4X6AJ 2R93J 1EKEA 3S16J 1U2WA 1F2OA 4UFWA 1GHCA 2MC3A 2VJIA 3FECA 3RSNA 3SXYA 2FA5A 4V19K 1D1CA 3VARA 1TW3A 3DNSA 2QENA 4FE4A 2MLKA 4M3DA 5I4MA 1VGYA 3RNZA 4M73A 1OFCX 3KCCA 1H8AC 1IB1E 3M9AA 1YX5A 2Z3OA 4MFKA 4OIOF 1N25A 1S7AA 3HB9A 4OAYA 2RC4A 3E6DA 2ZKZA 2L9SA 1GV5A 1MBGA 2Y31A 1IG7A 2RQQA 1HKTA 2GOXB 2Y0SN 5FJ8J 1HF0A 5E20A 4UEFA 2L2OA 4JZ0A 2ID3A 5K7FA 3FKIJ 4B12A 1U78A 2M34A 1FY7A 2EB7A 4QIWN 3JRCA 1IOFA 1IYKA 3MMYB 4DYOA 3E5QA 1P7IA 3RYRA 2IQ6A 4C2YA 2PIZA 2IP2A 1GGOA 1SMTA 1D5YA 2ZEMA 1BR1A 4LK1F 3RTRA 2AUNA 1Y0UA 3M3YJ 4ZH4F 1R1UA 2PMHA 1T8IA 4PK2A 1P7JA 4BXXJ 5AIPA 5I0CA 4JK1X 2DN0A 2E2HJ 2QGUA 2D0OA 2P6TA 5HLTA 5LRRA 4ETSA 2GOMA 4B5PB 2VJ5A 2M9HA 5TISC 3S2DJ 1WJFA 4MJ8A 4XONA 4HNXB 1TNTA 5DUIA 2GIZA 4EGYA 4RLFA 1QSOA 4Q36A 4L18B 1QPMA 3BQZA 3QYFA 5IV0A 4BINA 4ANJA 1RIOH 3CC2I 1ZG3A 2DCEA 1U9OA 3Q0WA 3G23A 1E2XA 2IGKA 4CGZA 1VFCA 3TDZC 4LIVA 3BLYA 2KDOA 3I4MJ 4BACA 5HH1A 4KN4X 4FT8A 2OC6A 3TW6A 4UUSB 1Z4EA 3F8KA 4M6GA 2P81A 2QEXI 4JWPA 4NGQA 5F46A 5KTCA 1ZYRF 2E1OA 5D5UB 5EEAA 2WBMA 2YNDA 3QB8A 4PZJA 2CFXA 5L3EA 1LANA 4II3A 1U5TA 3CESA 5G1ZA 1LCPA 3AAFA 2C6CA 1TP4A 2V26A 3ABLH 1X19A 4UB8C 3NH5A 4LX9A 4UEEA 3PBBA 2ZOFA 2R5YA 1EH6A 4K2EA 1L0CA 3TGNA 2QBYA 4CZZA 1IICA 4L8AA 2AFUA 1R1TA 4C9VA 1Z8TA 2X1DA 3QOPA 2L01A 1XGSA 4GYIA 2I10A 3K70D 3HKZA 1YW7A 1DP3A 2ZEOA 4A3KJ 3J81K 4LIUA 3TLYA 1MBHA 3EY5A 4EV0A 3JSPA 5JVLA 2HS5A 4YRVA 4EVYA 2XAJA 3IH2A 4E6KG 2R0QC 1FNOA 1QHHD 1T6SA 2YUSA 3HEFA 1FOWA 3SJFA 1NTCA 2HYJA 3D3SA 2IA1A 2A6EF 4B8XA 4KSFA 2AFSA 5FKMA 4BE2A 1Y0RA 2PJBA 2REFA 1R57A 4WJBA 4QWQA 4YRHA 1ZR4A 4LB6B 1RUNA 4BQNA 4J3GA 2B4BA 2I3CA 3IKTA 3SQNA 2PN6A 2O0YA 3MKLA 2KRHA 3DEWA 1Z5RA 5D8LB 3I6SA 2D0PA 2A5WA 2EV5A 4MTEA 4HF1A 2HI3A 1KGSA 3SJMA 3IWGA 1J59A 3SEQA 4B44A 4G7OF 3A4CA 5CVIA 2HWVA 2FL4A 3OR2C 4JVOA 3JRIA 2MFZA 4G8XA 3TO6A 1QZEA 2CMPA 1KU9A 3FX6A 2QIRA 4BKXA 1HW5A 1I50J 2TDXA 2E71A 1BW6A 4M74A 1VQLI 1DU0A 2DMUA 4XLPF 2WZNA 3MCZA 3VEPA 3KR4A 5JM6A 1RC9A 4UNOA 5HS7A 2Q7SA 3DKYA 3BJOA 3IAM2 2CW7A 3RKQA 3FX3A 3R4KA 1I39A 1RUOA 5K8OA 2G7HA 2ZC2A 4R1HA 2MH9A 1LJ9A 4UFVA 2IS6A 2QSGX 3PB8X 2DT5A 2AUMA 3KKWA 1Z2LA 5EZHA 2F4IA 3CQZJ 5GP9A 1WJBA 3FDYA 3L2RA 4W1UA 4LK0F 2F4OB 3J7ZI 2DJNA 5FGMA 4XQFA 3BJ8A 3D7DA 1ZARA 3TYXA 4Y33A 2LNBA 2F5FA 3S8PA 1Z05A 2LR8A 3T5XA 4KYWA 2E35A 3IH3A 1TWCJ 1H89C 3F22A 2MP0A 1XN7A 5KVRA 2M0MA 2FJ1A 2W1OA 1R9TJ 1XB4A 4HW0A 5LD2C 4C9AA 2VT3A 3DPUA 5EF6A 2ELJA 2PFBA 5TGTA 3GTMJ 3PGPA 5FLXK 4UVBA 4MY3A 1KUXA 4OLLA 2XRNA 1SD4A 1KYZA 3VDXA 3CT9A 4HF2A 4GGGA 2DPTA 4P9FA 1D8JA 4XRSA 5FLVA 2EFOA 3V4GA 4J01A 2M4KA 4P4EA 2F5VA 1JE8A 4UUSA 3EYIA 5HVHA 3K2ZA 3KETA 1OMIA 4P4JA 1YFHA 3I64A 1KZHA 5HDGA 3LAPA 2HB6A 1SD7A 3TLGB 4ZZLA 3WTYC 3D2MA 2XPVA 1J09A 2VT2A 1BI0A 2X85A 3H5NA 2FF4A 2VXKA 2L5QA 1HDUA 2R7ZJ 3L09A 1HDDC 2AFXA 2VQYA 2LK2A 3CXPA 4UCNA 4AVAA 3H9GA 3CD6I 3K0LA 4MCPA 5B66C 3FXJA 1MK4A 2MA3A 5GAHJ 2PBIA 2FBIA 5F04A 2EZLA 1N71A 2NSMA 1GHEA 5D8KB 2FE3A 2HQAA 1K83J 3CXQA 2RKHA 4Y4RA 4P55A 4EVIA 1FBSA 4NQWA 2XF7A 4XMYA 3ZMVA 4CPAA 1YX3A 4P44A 2E7WA 4NJRA 5LHGA 1GVDA 3Q0VA 2HC9A 3R1KA 3ASNH 2GREA 5F1JA 3LFKA 5EG0B 4ZJZA 1EH7A 1ELLP 2RQPA 3TTHA 3SZPA 3IFEA 5G21A 2LG4A 4WXHA 4BXUA 5IPAA 2PJPA 4A3EJ 2VBYA 2XVCA 3AG4H 3TLCA 2EZHA 3J80K 4IEJA 1HQCA 3PNYA 4MY0A 3DPTA 3JRAA 2F5EA 4E0AA 3KP5A 2X1EA 1IXCA 1DDNA 1STZA 3DTKA 3NRVA 5GCNA 3LMSA 3WG7H 2BZTA 1FTTA 2P6SA 2FRHA 3RYPA 3G73A 4X3RA 2CO5A 2UWMA 2A61A 2EWBA 2KJBA 1YW8A 2HTJA 3OYLA 1Q5XA 2JA8J 1EH8A 1QVUA 2CUZA 4EJOA 5L3FA 5EGOB 1A31A 1ETWA 4RB0A 4CDGA 2PCNA 5IP6A 3RKXA 2KZVA 4NC8A 2EQRA 5F0CA 4GDFA 3S1QJ 1GT0C 3A01B 4YFKF 3ZN0A 1NSLA 2H27A 3AFHA 1IZ1A 2X6XA 3T07A 4IQ4A 1YK3A 2CQXA 5G22A 1XF1A 1X2NA 3GLXA 1TF8A 1TWFJ 4MFZA 1IXRC 2FCKA 4I01A 3MZ8A 3CCLI 2ZW4A 3NOJA 4N4NB 2DYRH 1NE9A 1DU6A 4RMNA 2PJ2A 1W5TA 3BCBA 3WU0A 2DK8A 4MCSA 3F6OA 3L2UA 3A02A 2CUEA 1ZR2A 4G1PA 4NUBA 3PQKA 3GF2A 1HKQA 1B87A 4YWYA 4A5NA 4F55A 3GFIA 5HDNA 4RS2A 4KSAA 5DWNA 1JUMA 1V5EA 5AG5A 4A3LJ 1HCRA 1GXPA 4N0BA 1LAMA 3MN8A 4FX0A 4J19A 3ZQ7A 1D0YA 4CYCB 3H9QA 5AG6A 3BI1A 4CICA 1FIPA 5HLGA 3N4MA 2LDUA 1BI1A 3OYHA 1J5YA 2CGPA 3GTLJ 1X12A 2HUZA 2ZMEB 3J80Z 2OB0A 4LQ6A 1JXSA 4PXBA 3SXOA 3FWEA 3KYLA 4M3GA 2CW0F 3BG9A 1OCCH 3OL3A 2KIFA 3EQLF 1FJLA 1EJ9A 4CGLA 4HPQA 4M6XA 4G94A 1AWCA 3N97A 2O3FA 1YS6A 2AHQA 3G8WA 4A33A 3W6XA 4CAWA 1MNMC 4XK4A 4OADA 1CP7A 4IK2A 2FXFA 3DQVC 2K4BA 3PO3J 3V38A 4IOCF 1XMAA 2VPRA 2M87A 3K1PA 1PCAA 3T0YA 2IGNA 4E4HA 4CYQA 3GJZA 3VTAA 4NJQA 2VQCA 2BY1A 2MD5A 3SI2A 5DCMB 5FO5A 3D2PA 3G3SA 3FBNB 2L54A 3GTKJ 3DTEA 2CH0A 5E8IA 1YW4A 4P4BA 4XLEA 1G3WA 2QF7A 2CSOA 4XRFA 3KHXA 1S7EA 4XNHB 2Z1DA 2HQYA 3UKGA 3LACA 2L7ZA 2NVYJ 2VQGA 4Q4ZF 5CNPA 3GWZA 4NGNA 2BHYA 2EK5A 4X1EA 1WWXA 5ILUA 4DGWB 2FOKA 2LKPA 3BR0A 3PFOA 2B3UA 1V6CA 3R9GA 2O5RA 3ECHA 3QU3A 3S15J 1FX7A 1TT5B 4XICA 2MH2A 3TDUC 3ULQB 3S14J 1JDEA 4MI4A 2KZGA 3CCEI 1HDPA 4DQ2A 5HODA 4P10A 2JPCA 1CJWA 3TCVA 2RNJA 3MEXA 5EMIA 2ZMEC 4MBUA 4LMYA 1GDTA 4CZCA 1XC5A 2X0SA 2EV0A 4PDKA 2VBXA 1TKFA 3Q0UA 5L3DA 1ZRDA 2OD5A 1MMSA 4PQAA 4U0WA 2E28A 3HTSB 1JWQA 4AWXB 5J1YA 1XIXA 3U1BA 3CLOA 3BG5A 2YS9A 3CLQA 4ESJA 3IRRA 4OIQF 4A3DJ 1Y0YA 1Y56A 5ICEA 4HNWB 2Z11A 1XF8A 2CNMA 1X1CA 3PIPF 3O3KA 4YIRX 1OISA 1Z9CA 3HRSA 4H0EA 4KIGA 1PUFB 3EZAA 3TLEA 2HQ5A 5C3EJ 3PL8A 2FUG2 4BJTA 2DF5A 3K10A 4E5SA 1XGOA 2A6HF 1R23A 3TKYA 1R1VA 2ZEFA 2VKVA 3PM1A 4XOTA 2VASA 4C8AA 2I5UA 2UUZA 3CP2A 4YN3A 1G3YA 3KPHA 2FBKA 1UZCA 4YEJA 2V7FA 5K7HA 2NRAC 4A93J 5E79C 3BXMA 1Y9WA 3PFYA 2W7NA 1A6QA 2JA7J 4G6TB 1DGWY 4Z2YA 4ZZDA 1S9HA 3GO5A 3T8TA 4DYRA 2IGMA 5FB2A 1Y7EA 3R0JA 4CGMA 1O7LA 3S9NA 3DFGA 2D1HA 3I9SA 5C4JJ 2OU2A 4B4CA 3DLAA 2RGVA 2PRBA 3OYCA 3RCOA 4OC3A 1ONVA 4KT6A 1OZPA 4EEFG 3CP8A 3F8NA 3H3UA 2CNTA 3G1LA 3UNGC 4C9RA 2JN6A 5DEQA 1QHGA 3D8PA 3LSKA 1X1AA 3OMYA 5FKKA 2ZMEA 4C68A 1ZRFA 3FK7A 1GYTA 3KP7A 4HLXA 2EZCA 1IC8A 3BLNA 5CVRA 2F48A 4ESBA 3DV8A 2HVQA 2LD5A 1VBGA 3BTCA 2CV1A 3M7GA 4B09A 5IB0A 3IWEA 2Y2ZA 3CF2A 4I98B 3WE3A 2Y30A 2G0EA 1G8XA 4A30A 4IHMA 3GYAA 1I21A 1SFXA 5FFXA 3H5ZA 2EFPA 2DYSH 2VKEA 2IS1A 3GTOJ 2Z16A 1HSJA 4BE1A 1J4JA 4OC0A 5D5VB 3KASA 2A69F 2H6BA 1F2PA 2POKA 2CYYA 5K5OA 2B3VA 2X1CA 2R92J 4XN0A 2P5KA 2ZXJA 3EUHA 3J81Z 3BZCA 2B0LA 5HDKA 3QPLA 3CPXA 4IRGA 3HOYJ 2BXYA 3JR9A 3DU5A 1A35A 5A28A 2BL1A 2Z5UA 4EGZA 3GFMA 4CGNA 3EO4A 3KP3A 4C30A 4GXHA 5CVJA 1IN8A 1R36A 2DPDA 5D8NA 1MKMA 4OAEA 2L3DA 1VZ0A 2W85A 3HUVA 2OR4A 5LYFA 3PFEA 1UMQA 2QQ8A 3FRMA 2ZXWH 2NNYA 3PBEA 1RI7A 5F27A 4C8UA 2Z9OA 3FNCA 2VC1A 1V3FA 4E2AA 4HX8A 3PFIA 3ZQIA 1DIKA 2VIXA 2ZEHA 1UWYA 1TF9A 2KRFA 1T39A 1GXQA 4E7KA 3G3ZA 2OZGA 4OC1A 4NCZA 2ESHA 4CDJA 4A3CJ 3LD2A 2Y9YA 3DP7A 2BV6A 3JCUC 4RGUA 2DAOA 3O8GA 5IYDJ 2FSRA 4H89A 2ANPA 1ETOA 5EEHA 1NSAA 2XEGA 1TXRA 4IRHA 5E3MA 4YG2F 4E7ZA 4EM0B 4UIAA 1JI8A 4G7ZF 4M9XA 2OOTA 2KHMA 1SFUA 1JDBC 4JX4A 4N4OB 1MNDA 1ON2A 2L4MA 4LG0B 4L5JA 4A95A 2QQBA 2IW5A 3SR3A 2E5ZA 4C7IA 2LBFA 1YIOA 4DYCA 4PXCA 5E17F 2R5ZA 4X8IA 1ARLA 2YPRA 4NQWB 3FKJA 4MHDA 4Y3OA 2ZELA 3KQXA 3FB3A 3GZ5A 2DK5A 3OIPA 4ON0A 2CQKA 4FCYA 4Q48A 4AVZA 1M4IA 2Q4YA 4HNTA 1JKQC 3CCSI 4CAFA 1X3UA 3SJGA 1Y0NA 2WAQN 3H9JA 4D5CA 1F43A 4P5OA 2YX4A 2XF6A 2O28A 3P7NA 1R4NB 4C8TA 3VB2A 2ZSHB 2XAGA 5E1WA 4Y13A 4U88A 4PPZA 1NXJA 2RDPA 3DBLB 4OMYA 4IPAA 2LBFB 1WRJA 2CUJA 4XOPA 4EMEA 2WSAA 2IBDA 5BWAB 3SEZA 3OYDA 3FEDA 1H8LA 4QC6A 3C26A 2DOAA 1JT6A 2XPUA 4RAZA 6PAXA 3CCRI 4ENNA 2FS5A 4RB3C 1WSUA 4C2ZA 4CDKA 2WADA 3E3VA 4C8FA 2XEIA 3OYEA 1LFUP 5LRJA 2K86A 4E7JA 4KVOE 1FP2A 4EJVA 2F7VA 3JRGA 4UA3A 3TC8A 4R3LA 1BAVA 1MIJA 2FX0A 2NVQJ 1WCMJ 3A1YA 3F0CA 3U1KA 2VI6A 3WU2C 3WU1B 4D1QA 4ZTFA 4CCLA 4CCMA 3GB0A 3PEIA 2VQLA 1ERDA 1R5GA 3JREA 3HHGA 2KDZA 5FKOA 3F72A 3DWLE 1OYWA 3R95A 4IIXA 2OLSA 4ITVA 4I09A 1FTZA 1VBHA 1YW6A 2PJ7A 5FKLA 2X9DA 4UEZA 2VXDA 3PIOF 2JK3A 4BHPA 2BYVE 3ZMTA 3GUXA 4MQ9F 3GUDA 2IA2A 4JBAA 1PJRA 3CDHA 4ORFA 1HLVA 1CQTA 2XGXA 1FZPB 1FNNA 1LRZA 2FSWA 1G6NA 1RZ4A 3V8KA 1XCBA 1I3AA 3LFUA 4L9NA 5ED4A 1PYTB 4KZTA 2ISYA 1U5TC 3M1CA 1T0FA 2GE3A 4HSTA 4KOYA 2JA2A 4HQEA 3ICUA 4CXFA 4C3JJ 2PMZN 1JJ8C 3K9TA 4CS0B 1ZKGA 5CLSA 1IN4A 4F52A 3OY9A 3FF5A 1M4LA 3CCJI 3I71A 1GV2A 3F6VA 1AUGA 4F9VA 4NNJA 2JZYA 2FQ3A 2NOJB 4GYGA 4BDYA 4C2UA 3FBUA 1AA7A 3K1NA 3VSKA 3DR8A 1JHHA 1AYEA 1ZL0A 3FHZA 1LFBA 2DTZA 2LY2A 5LEJA 5FFZA 3FHNA 2FIAA 2H09A 3G1MA 1A5JA 4B48A 2LVSA 4RAYA 5JVGF 4CZ1A 3IGRA 3GY9A 2IGOA 3RI4A 3GKRA 4N9HA 3KHZA 4PXEA 2EWNA 5HS8A 4HSRA 1BR2A 2OJED 2I8DA 3K6GA 3HOXJ 5EEGA 4G9YA 1JKPC 4OC4A 3V42A 4A39A 5FD8A 4ZYEA 3NFZA 1S29A 3SZTA 2JDDA 4J0NA 2PLYA 1OCOH 4I6ZA 1IF1A 3JRUA 4MFPA 1W4MA 2XAUA 3I59A 5FLXZ 3QWLA 3FXQA 4C9UA 2CJJA 3SHPA 4JOMA 3S32A 3S93A 1VQ7I 2V9KA 4XLFA 2M8EA 3SFZA 4P6YA 2Z3MA 4JLYA 1KQ8A 1MW7A 1SD5A 1R7JA 4B6ZA 2L7FP 4EYSA 3JTGA 3RQ4A 4RM2A 4P96A 3WTUC 3BR3A 3R61A 2QSHX 1IU8A 4DZJA 4P4FA 2ZXIA 4AG7A 1R22A 2ATRA 1A2ZA 3SI1A 3VWDA 1X1PA 2CQ7A 4ENMA 2F8HA 2M4GA 1FT9A 3FISA 1K6OA 4CCNA 3ZRGA 1FPQA 2J8MA 3OSFA 3A01A 5DV5A 2IJZA 4KVXA 3CZXA 4II2A 3H3VK 5J1UA 1W7PB 2CWEA 2DXIA 3FEEA 2GANA 2PJ4A 1C3OB 2X0LA 2XHKA 3KP2A 4MJXA 2KKOA 2VUMJ 2NMTA 3I3LA 2XSJC 4A32A 5JLXA 1MGTA 4QSHA 2VBZA 2E60A 1R43A 3KZIC 3S3MA 3A03A 1LOKA 4MCRA 1CG2A 3HKZN 4MQVA 4YFNF 2EZBA 4MGRA 1P9QC 4R76A 3N7ZA 2HU9A 2CIJA 2UXXA 3GXOA 3S17J 2LFBA 1TLHB 2WY8Q 2ZEGA 4ZI6A 1FT7A 1TC3C 3FIXA 1T95A 1WVRA 3LSTA 1IIDA 1QQ9A 3BR6A 3BROA 4XKBA 5F6FA 4XKWA 2UZKA 5DM6F 2J5PA 2DPSA 2F4MB 2NXNB 1FYMA 4UF4A 2HWGA 3DKXA 4XPDB 2OZ6A 4U0YA 1F36A 4GM5A 3HRUA 1W0UA 4JXRA 3SHFA 2NVTJ 5E1ZB 3OS1A 1VQMI 2RB7A 5M3FJ 3QP6A 2MW8A 2XPWA 1Z91A 2F6CA 1QO0D 2VLAA 4A0XA 1VQ8I 4QPQA 3BCAA 3E6MA 3BJ6A 4FHTA 3E97A 5J1QA 5CQGA 3SDBA 1QBJA 2STTA 3ESWB 1G3SA 2P6FA 4JJXA 3D67A 4EMSA 2PI0A 3IL2A 2HPMA 4DJAA 5HNHA 3KLNA 3M4OJ 2X6WA 2CRGA 3AL0B 1XFOA 4UBRA 5LYDA 2GA2A 4CAEA 3CCUI 1CF7A 3CDIA 5FRNA 3DF8A 1YGHA 4P4IA 3HM5A 1KUYA 1YLEA 3TBIA 1QRYA 3GZNB 4QBJA 5BS6A 3ZMSA 1IUYA 4XLNF 3HLPA 3H4QA 3ZMUA 2ZCWA 2F5DA 1S7LA 2VONA 1DP7P 4M6VA 2LLKA 4BQOA 3KE2A 4ZBGA 5JFRA 4ABZA 1P2FA 1HBXG 4AYBA 1B8IA 3RBUA 5IYCJ 3LSIA 1IOIA 2A07F 3OS0A 4NC7A 2ODFA 1XG1A 2DODA 2PCUA 3BJAA 3W91A 4KUMA 2NS0A 4UUTA 1XJOA 4KOTA 3LSGA 5EGOA 4A6DA 3B3CA 3T90A 1YMEA 3I53A 3ZQHA 4DBQA 5LRSA 3QPHA 2O8KA 3EDPA 3D66A 5F64A 1SC7A 2OQRA 1U8BA 2DFHA 1YJNI 4XPKA 3S6FA 3I5UA 1W5CC 5C4XJ 2DO7A 2A6TA 4NEXA 4PFPA 1YTYA 2Z3YA 5TRDA 2NAZA 5D6FA 4TJVA 3ABTA 2KIUA 1QMUA 2HGCA 2OAZA 2M7BA 1ETKA 2L9NA 3DKWA 1S3JA 4ZYDA 3L7WA 4O3MA 4XRSG 2DPUA 2K27A 1VQ9I 4AG9A 4GCVA 4CGPA 1BJZA 3B3TA 4KMUX 3BDDA 4RAFA 1OLTA 1YRNA 1R5HA 2GM4A 3EZBA 2ADUA 4U7BA 1LVAA 1ZGAA 2RVCA 2JPBA 4O5VA 2XAFA 2PJ5A 4AVCA 2DA3A 4UY8I 1EZBA 3IIBA 2Z3LA 3TLZA 2DA5A 5GPCA 4GXOA 5ERIA 2AO9A 3CMMA 4NXYA 3GW2A 5BQTA 3KFWX 5BNGA 2HOAA 3CCVI 1QSMA 1ITYA 1B72A 3VPRA 2K3FA 3VWBA 1QNTA 3M8FA 1XMTA 4G6DA 3EFAA 4DIQA 3ERMA 4MTDA 3H8FA 3H3ZA 3FZVA 5H6RA 1D1BA 4AIKA 3IUOA 4BDZA 2XGCA 3IP4B 4MO7A 5JGFA 4XPLA 2H8RA 1NBWA 3W2AA 5F1YA 2FE7A 2M5WA 1YE9A 1YS7A 4CHUA 3P9KA 4W97A 1QZYA 2PE3A 4C9EA 1YJWI 4CA0A 4M6HA 5F49A 4ZX8A 1MMDA 1HXDA 3K4CA 3KZWA 2YR2A 1WHUA 1Z4RA 3E5UA 1ZH5A 4OINF 2KMUA 2O8XA 4MCQA 1VQNI 4UCPA 4MI1A 1C0WA 3K4LA 4S05A 2AFOA 4A94A 2LKSA 1VQ4I 2W48A 4A3FJ 1BC8C 4FAIA 1C30B 3RPUD 3JRHA 1WH5A 3R60A 3EC4A 4ONWA 1BI2A 2EJRA 5LGUA 3Q9SA 4HX4A 4ZYQA 3HPGA 1APLC 4CO8A 2GA1A 2JRTA 1Z7LA 3I56I 1XRYA 2BCOA 3LSHA 4Q38A 2E1MB 2K02A 3IRQA 3PUBA 5JLWA 3E1SA 2VQHA 2M3AA 4ENJA 1UFHA 4L5IA 3ZZIA 2Y48A 1MMNA 3NH4A 1EE3P 1UHSA 5D4SA 3WC6A 2PJRA 2DA6A 2G0BA 4ZGYB 4CCJA 5GADJ 4HNYB 1R61A 4ZTJA 4R8HA 3LNQA 1SVLA 3EIFA 3JRFA 4C3IJ 2HQNA 1KU2A 1S7OA 1IAWA 2O6GE 2O9LA 1FP1D 4YIIA 3PUFA 1MMAA 2Y0SA 4F9UA 1J75A 2WPXA 3T1BA 3I4NJ 1S5KA 3JUWA 2N8GA 2EPFA 3K69A 3NAUA 4HOBA 4L9TA 4OU0A 1USSA 2GLJA 3OL4A 4PXDA 1ZLKA 1TKHA 2CUFA 3IKVA 5GPAA 2QKMB 2JTVA 3R0AA 2B7EA 5JHUA 1DE4C 1JHFA 3F5BA 3QPSA 1Q2YA 3S6KA 4CO9A 4OC2A 3RQIA 4I0AA 2YJVA 3FXLA 1OPCA 2HOTA 1YYVA 3H35A 2AQFA 2W24A 5CVVA 5HS9A 2OTJI 4KA4A 2PJ3A 3DSBA 2KQRA 4U9ZA 4QVTA 4M3SA 2E2IJ 1DPRA 2LY1A 1ZG8A 3ABMH 1Z9UA 2WA0A 2DFIA 3GLLA 3F21A 2K5TA 2QJ8A 2NYXA 2YX7A 3F8BA 5D4RA 2P5LC 5J47A 1ZLJA 4DYQA 2LKXA 1D0ZA 1IV8A 5KTAA 4GFBA 1SEUA 3TP0A 3FM3A 4KOXA 4A37A 4B10A 5A2QZ 4K30A 3H5RA 3V8LA 3C1DA 5DS9A 3J7AY 1KU3A 2OPTA 4LITA 1N75A 3GTPJ 1Y7RA 3KL9A 2RV8A 4CSWA 4Y49B 1ZHFA 2R5YB 4WWVA 3WG9A 3WODF 1HW1A 2R8VA 4CAXA 1ACIA 1QQIA 2BBYA 2WV1A 1R3NA 1TKJA 1X4PA 1BL0A 3WR7A 2O7OA 3B3SA 4L9JA 2G3TA 2X4HA 3UY5A 4AVBA 5E3LA 5A27A 4MHZA 2FQ4A 2JUCA 5CKTA 1LUJB 4X5KA 3TLAA 3BR1A 4XLAA 2C6PA 4K3NA 4RB1A 3SFIA 3DGVA 3B7IA 2E5NA 4XSZF 1O3QA 3D5LA 3WTSC 4HQMA 5EBVA 5CJ9A 4II9A 2K9LA 3UR3C 4BL0B 4KVME 1Q1VA 4CYOA 3FXUA 1T36B 1I5ZA 1UFMA 3V7ZA 1P4NA 2K40A 2QWWA 3TE4A 5FROA 1XCVA 2FT0A 3MD2A 3FXMA 3W6VA 1RRJA 3ASOH 2JRMA 3CUQB 3RO0A 2GU2A 1G59A 5IB9A 5DD8A 4KUBA 1DTDA 2X6YA 1W7PD 4RGXA 5J8FA 4IX7A 3ROUA 1W7PA 2DA2A 2L02A 3H0GJ 3LSPA 5ISVA 2CV0A 3HL2A 4KDPA 2IS2A 3QODA 1Z8XA 3PO2J 2CXAA 1MJBA 4H6ZA 2JLMA 3C3WA 4CUGA 4Q5SF 2Z10A 4YELA 1B59A 3H36A 3HOVJ 3CJQB 2ID6A 2HR3A 4PJLA 2Q43A 3TQNA 1ZO0A 2QZ8A 4BH9A 4H6UA 5JPHA 2VI7A 4RN7A 2ZJPF 2HXIA 2ZFWA 3IU1A 3ZP5A 3ZXSA 2JQ7A 2B5GA 5KAFC 3R9EA 5E96A 2FBHA 2CU7A 3QU6A 4HBLA 3I59B 1W0TA 4IAVA 3K4JA 3T8WA 4PK4A 4OMEA 3PRTA 2O03A 3TL4X 1OCRH 1K7AA 4LLNA 4PSXA 3EZEA 3NQOA 1FMWA 4M3BA 3MWMA 2R7WA 2RAEA 1ETYA 1FOYA 2NYQA 2QYVA 1FBQA 3PP9A 4MRIA 4BD9A 2FD5A 2EFQA 3MN2A 1YLOA 1A9XB 2KT0A 2LP0A 1XSDA 2Z3PA 1FIAA 4IUSA 2FMLA 2J8NA 1WPKA 1WK4A 3CO7C 4TV7A 2K9MA 2X6OA 2LSOA 2XKOA 5DYMA 5ICCA 2EIMH 1FWZA 4IHXA 2R4GA 2WAEA 2G9DA 3H1CA 3JRDA 2E2JJ 2WB1N 4KSIA 3GFLA 1TQPA 4FD4A 1IDYA 3R96A 3DU6A 2ELHA 5GTIC 3OYFA 1TWAJ 1MDMB 2QECA 4A5MA 3CO6C 5IOZA 3B6AA 5J40A 2JA6J 3S6GA 4CH7A 4R9MA 3PSFA 3OYAA 3A2KA 2JEVA 1WZ2A 2Q7BA 3S1NJ 3T9YA 2OBPA 4ZYAA 2Z33A 1FYLA 2HROA 2JUGA 1FOKA 4WCGA 2XEFA 3Q5FA 3I1UA 4XNFA 2VE9A 5D6EA 3WTXC 3NARA 2PJ0A 2P0WA 1RR8C 2KISA 2V79A 3E5XA 3HRTA 4RS8A 1Y1WJ 4D7MA 3BY6A 1YX0A 4CGOA 1XPXA 1KU7A 2ZO4A 4QTRA 3RDIA 1Y9ZA 1XE4A 2JEWA 2V8GA 1WJCA 2DOFA 4E7HA 3OV8A 2DFEA 1SVOA 2CQQA 3A0BC 1P4XA 1KA8A 3CDXA 3K2KA 4B5OA 2JMWA 3WGIA 1U6MA 2Z0ZA 4PK3A 2AFMA 1LFPA 1Z1DA 4F91B 2CS3A 2EFWA 1X10A 3OOUA 4BGDA 1O4XA 4NC6A 4RLQA 5J1RA 3GCMA 3WGHA 2H6CA 2ARHA 5HVGA 5CPAA 3L9FA 2MD0A 1BPMA 2F5CA 2IVMA 4ZDPA 2K9NA 3S2WA 4XSXF 3CXSA 3D7GA 1Y6IA 3TO9A 3T8RA 3SJXA 4COBA 2ECBA 3O8HA 2D1VA 1K4SA 3ZMZA 4A3JJ 1TL8A 2B0AA 3KP6A 4FASD 4Z65A 5F9MA 4FETA 1LQ1A 1QSTA 4BBHA 4XKVA 3V8IA 2X48A 2WUUA 1XBUA 4BHCA 1BXRB 1MDMA 2WV0A 1SFOJ 4WXCA 5H6QA 3KI9A 2M2EA 1RESA 4S0HB 4I2OA 1R6RA 3WE2A 2O4HA 2Q0YA 2MC4A 4PFOA 2DMNA 3HDDA 4QLCU 2ZENA 3EYYA 3K4BA 1MJ9A 3E6CC 4KLVA 3V8JA 2NVUB 4DW6A 5AIQA 3JVNA 4LLLA 2LOOA 2JA5J 2QMLA 3LA3A 1UELB 5E8GA 5K99A 1Z67A 4GO1A 4JX6A 2K4JA 1IN6A 1TT0A 3ERED 2JBKA 2G9WA 3ELKA 4LG3A 2GXBA 4JYKA 2HVSA 2X51A 3K9UA 2LF7A 4XNHC 3HOSA 1M4GA 2DMTA 4RDUA 2D5VA 4XORA 1IO2A 3K1MA 5K5RA 2M45A 2MGQA 3HUGB 3ZQLA 3BTIA 1NK2P 1Z8LA 3JTHA 3D4UA 3O6BB 1U8RA 2EO8A 2PR8A 4C99A 4U87A 3K70C 2PJ8A 1HEEA 4I49A 2JJ7A 1VHSA 4R3KA 4UCMA 2A5YB 5HXDA 2H1KA 4XBFA 5EDNA 5AG4A 4A0ZA 2UXNA 2ZSIB 4BBSJ 2HZTA 4NDLA 2VJJA 4IO9F 1F5TA 1MSFC 5L3BA 5E3NA 2Z99A 4UB6C 4P4DA 2IEKA 4DOZA 1Q7LA 1IRXA 4BXFA 1XOVA 1ZQ3P 4KICA 3HGYA 3HHHA 2PRQA 4N9IA 1J0RA 3TOBA 1ORKA 5LEKA 4XRMA 1YHQI 1SD6A 3CMYA 4OKOA 4EM1A 4C84A 5DCMA 3IJ3A 4M6IA 1FYKA 2DQLA 4X0GA 1MSEC 2M7AA 3VYSB 3IU2A 2QVOA 5TJJA 2ZNYA 3OYBA 3WTWC 1OBRA 1RXTA 1IRFA 3GTQJ 1BC7C 4C2MJ 3KYDB 1IV6A 5KNLA 3B3WA 2A68F 2RN7A 3BG6A 1YQEA 1YREA 4KORA 2OZHA 2W4SA 3BPXA 1HA8A 4QB9A 3ABUA 3ZN1A 2ZEDA 3GLJA 4JXQA 4XLCA 2DLLA 4MFQA 2Y0MA 3G2BA 1CPSA 1XMXA 2ME6A 2EA2A 1ON1A 1ON0A 2OZUA 3DBHB 2JSCA 4ZDOA 2EZIA 2VBQA 3A9LA 2MSYA 2IL4A 4OIDA 1ETXA 1Q1HA 1EA3A 2GWRA 1IN5A 2ZEPA 2LH9A 3WTTC 4AM3A 3SZGA 3DR6A 2YU3A 2LTPA 1YG2A 1YJ9I 3H5AA 4M72A 4BEHB 2C5QA 4DBRA 1X2MA 3LA7A 1H9TA 3V7SA 2M1BA 3U2RA 4BAYA 2PMZA 3MKWB 3L2WA 4BNCA 1A6IA 4OP4A 4CAVA 2R7RA 1NK3P 4R6TA 1LKXA 2PVVA 2DDAA 3H92A 2PIYA 2QQ9A 2B5GB 3KRVA 4Y52J 3PSIA 1T98A 1VF9A 1HSTA 1WJDA 2WWYA 4ZX9A 3W2WA 1F57A 5DWMA 3TT2A 1T56A 3EUHC 2VE8A 1A04A 2LYCA 2V4JC 2B4DA 3FYNA 3IHUA 1LE8B 2DA1A 4HV6A 3WTZA 5KTDA 3GZ6A 3VYTB 2KRCA 3U21A 3FXOA 2DXQA 1UG2A 3PB9X 5KAIC 2COMA 2OUMA 3OIOA 1CF7B 3JAMZ 5CYVA 1OKRA 2ME0A 4LQGA 2PR1A 4FUUA 4GRIA 1K4TA 4RI1A 1BIAA 3KEYA 3FMQA 1FSEA 1S7FA 2FU4A 2P4WA 3OWTA 3TW7A 4UUVA 4KJZA 1SAUA 1IRZA 5M5XJ 4EJUA 3AKZA 1W36C 2P7VB 2L9RA 2CG4A 4LGWA 4MLOA 4PJNA 2DJIA 4XN3A 4RB2C 1RKTA 1O7FA 2V8VA 4FD7A 1ZGWA 3RIRA 3OS2A 3F23A 5HVFA 3CMEI 2DMPA 4E7SA 3W6KB 5KHDA 3BZKA 3BG3A 2VN2A 2JT1A 2EA4A 2CTBA 5B1BH 1XSXA 3BPVA 3BOQA 1FC3A 1FLIA 3RZAA 2G3AA 3WC7A 1NMTA 2HDCA 1S60A 1R4MB 4U5YA 1RETA 2R7OA 3FM5A 5H84A 2R7UA 4ZYHA 4BQQA 1QZZA 4IKFA 1W1WE 3OR1C 2PJ9A 1ETVA 1XMKA 1PUFA 2WTEA 5E1XA 2ZXVA 4HDVA 3C18A 2M0CA 3F0AA 2JWTA 2BEOA 2WAFA 3OYKA 2Q04A 1BI3A 3FXKA 2VEZA 4KNGE 3B6CA 2QM3A 2X7BA 3DEEA 5FD6A 3GTGJ 4E94A 3D1NI 3SXNA 5CVUA 1ZG1A 2HQRA 1KZFA 1ZELA 4XIDA 2EZAA 4FISA 1S72I 3FJUA 2XB5A 3EPZA 4IIYA 3JAMK 1MMGA 1LB2A 1ZK8A 5J4YA 1IRGA 3KGQA 1ZTRA 3CC4I 1I1GA 3IWZA 1VKCA 3ZMDA 2REEA 4U9YA 2XV4S 3VYRB 4U7DA 2ZW7A 2HDDA 3FMRA 3ISPA 3G71I 4YGOA 3FMSA 1ZG7A 3S3NA 1S8NA 4L9VA 1B6BA 3BR5A 5GAGJ 2VPLA 4BQAA 1IN7A 1VIXA 5JHFA 1U3EM 2AQEA 1R71A 3HRMA 5THWA 4LD5A 2H94A 2XROA 2JDCA 4LB5A 1NHAA 1B9MA 2V1NA 1FMVA 2L4AA 3RPQA 1HW2A 2XB0X 3DCFA 5BMZA 4I02A 3G4SI 2DMQA 1HOMA 5F1RA 5IT3A 7CPAA 3HTUA 4B47A 5L3CA 2WYRA 3MRUA 4UWIA 1WVMA 2R82A 1ZGJA 1ELMP 2VOOA 2W82A 3EXNA 1XX5A 3B35A 3CMAI 1WFXA 3HUGA 1K4JA 3ZGKA 3B3VA 4HAMA 1YLFA 2E1MC 2OF7A 3I54A 5DCFA 3E0JB 2AXTC 1OYYA 1M4DA 1IYLA 5H86A 2RNGA 4A12A 3T5MA 2H8WA 2Q2EB 3SJEA 1KEEB 2EBIA 1MD0A 2V77A 3FH4A 4C2XA 3QRFF 4C2TA 2ACJA 3VFZA 3RAMA 2IPQX 2M8GX 3JTKA 3D7HA 1HDQA 1TWGJ 5IY5H 2EH3A 4TWEA 3S6HA 3U9GA 1KBLA 1DPUA 3ZQGA 1U9NA 1PYVA 2BEIA 3CZ6A 2CQNA 3WTVC 1UAAA 4HPSA 4NGPA 4AIJA 2MG4A 1KUVA 1YW9A 4BS9A 5D29A 1VQPI 3W2VA 2ZJRF 4OIPF 2AFZA 4LLGF 2XSDC 2HDWA 4ENKA 1N78A 4M3EA 3CJRB 4L5EA 1AU7A 2Z2SB 5EC4A 3DLLF 4IHYA 3ISXA 2R7FA 2V8DA 1Y39A 2IRFG 2JBJA 4HEA2 2VC0A 3CUQC 3NWTA 3PQJA 2F5IA 2EZKA 2V6CA 1Q2CA 2B63J 1ETQA 3QPTA 3RYOA 4LJZF 4LOCA 5M3MJ 1F4KA 4MHPA 1TBXA 4ZY2A 3HPHA 1ENHA 1M1EB 1JTXA 2GQQA 4XM3A 4XLHA 1VHEA 4IZZA 1OR7C 4HZFA 4XKCA 2OQGA 1ZG5A 2Z3KA 5JH9A 5J3LA 3KQZA 2DOEA 2DT7B 2FNPA 4MFEA 2Q44A 1X4OA 2BOLA 4ZYGA 2K9SA 2W25A 4BJ5C 2EIKH 1NG6A 4KOWA 3VH9A 2OCCH 3WHCA 4AB7A 3IC7A 1XDUA 1DUXC 4FBEA 3ZQCA 3GVAA 2BVLA 5IR2A 4OMZA 2Q8KA 3TOAA 2I00A 3KP4A 1VNDA 2R7DA 4AIHA 5B1AH 5CBMA 3FK6A 1OCPA 1Z8WA 1KQ0A 2NS8A 2H1LA 2PQ8A 2XASA 3OYGA 3WT4A 2BW3A 2WAQA 1HC8A 3LL7A 1Y8RB 2QSFX 3IWWA 2XGDA 1QA6A 1Z3XA 1WJAA 2PJ6A 3IEHA 1B4AA 2EBJA 1RKWA 1G4DA 4X2TA 1XS9A 5IP7J 3NE7A 3D0SA 3T0TA 4IF4A 2PJCA 3RKWA 3AG3H 5BPIA 1LEBA 4BU2A 1LDKB 4F7ZA 3LOCA 2HPIA 5LGTA 1BN5A 1I1DA 3CCMI 1O3TA 1VHOA 2BY2A 4AD9A 3KZZA 5EG0A 4NGRA 1GVJA 2PDOA 2ZFUA 5F5XA 5F48A 2EV6A 2QA4I 1ZYMA 5HNFA 3RKYA 1IDZA 4MHYA 3LSRA 2PVWA 1IY7A 3IC1A 1K78B 2QCOA 3B73A 2ZPAA 1I1SA 2NOGA 4AC0A 2XKPA 5ILVA 1PUEE 2VBWA 4IHVA 2ELKA 3ZPLA 1I6HJ 1L0OC 3MGDA 1JQGA 4PJMA 2E34A 3BWGA 3CUQA 4B3AA 3GBGA 1H88C 2JVHA 4RUHA 2IA0A 4MXUA 5DM7F 4B14A 1XGMA 4CCOA 1QVTA 1BBYA 1R00A 2Q4VA 4UV9A 4KITB 3K2AA 4KFCA 3T05A 3TLGA 2OCEA 5IT9K 4Q7AA 4W9YA 1NG7A 3ECOA 3L2VA 3HXLA 2CNSA 3ABKH 3LQQA 4GS4A 5JYBA 4RAGA 2R98A 5F09A 1T38A 2H5MA 4EFDA 3IO1A 4P1WA 4KOSA 3PJRA 1JKRC 4NB5A 2ETHA 2HYGD 3R6SA 1DGRM 5K8PA 1OJLA 2K3PA 4I0BA 1TIQA 2MLGA 4UXNA 3KEQA 1OYIA 2ZB9A 4H1HA 1WI3A 3HZJA 1S5LC 5DDGA 3C8OA 4DZPA 1JUSA 3B2YA 5F0HA 4TJXA 2GZWA 5GTHC 1RTQA 1BOAA 2E36A 3VODA 2CV2A 1QSRA 3J7YJ 2I79A 4LFUA 5CQEA 2FNAA 2QYOA 1VTNC 2YNCA 1UG0A 2KIMA 4MEYF 4PCQA 1LNWA 4CYPA 2DA7A 3TLBA 2VKHA 3OYJA 4KIBA 5FKNA 4QUSA 4A3BJ 2CW8A 4UVCA 1QSNA 1GLNA
chains in the Genus database with same CATH topology
2FMYA 2F2EA 3BZ6A 5ICGA 4JQFA 1XMBA 1Z7UA 2MBFA 4UIBA 2HTSA 3D68A 1O57A 1B9NA 2D45A 4DUKA 3P9CA 3HSRA 2C6YA 4E70A 4HLYA 3MZHA 3WABA 5J6XA 2FVGA 4G6QA 5HLHA 1HKSA 3S9LA 3P9IA 2J5OA 4PGHA 1K79A 2ESNA 3PB6X 3HYIA 2J9AA 3GX4X 4OIRF 3CJNA 3J7AO 4CYDA 2AS5F 4IRIA 3MFKA 4EJTA 2C1CA 1XSVA 4M71A 4EWTA 2XAQA 2IMOA 4A38A 1I6XA 2DEAA 3REOA 4ASNA 1RNLA 3CTAA 1WI9A 1PP7U 4P9UA 3FMCA 3F8CA 1YQAA 2RFHA 2PEXA 1LDJA 2V9VA 4C8CA 4KIFA 4BHBA 1H8LA 3LAJA 1P6RA 2F8HA 5DS0A 4OOIA 2DQRA 5JR3A 4HDUA 3F8MA 6CPAA 3BI0A 3L2NA 3QAHA 1F1ZA 5K5QA 3FVLA 5LRKA 4HYEA 3L00A 1PDNC 5A2QK 2M30A 2PG4A 5JI6A 1K78A 1I27A 2GP4A 2DU9A 2IT0A 2R3SA 3BP8A 2HFHA 2WC2A 1KYWA 3OOPA 1ZRCA 3TO7A 4HF0A 3O2PE 3COAC 3WC5A 4IXAA 2BE5F 5DUKA 5FD5A 2VOPA 5HLIA 3B3TA 2ZNZA 1WQ2A 3RPUA 2AFWA 4IHTA 1LEAA 4UVAA 4WK8F 3M8EA 1TTYA 1BPNA 4YU9A 1U6GA 3QNVA 1TQMA 2VL1A 4UHTA 1UHWA 5LHHA 4EJWA 2AXLA 2V1UA 4NGSA 2VXZA 1UCRA 3DLJA 4KNYA 1O3SA 3M1EA 2PMUA 1B1BA 2EFNA 2CTCA 1H9GA 1WKMA 5IT9Z 1AMPA 4L0YB 3BHXA 2Q2EA 4R7MA 1EV7A 2HKXA 1ZG9A 1XGNA 3NH8A 1IXSB 2EK9A 2PJAA 1XD7A 2V1DA 5ELYA 2GAUA 4IJAA 5D5WB 3PB4X 3LA2A 1R58A 3VOEA 1BIBA 3L2CA 3KZYA 4AVPA 1IW7F 1BM9A 3CPAA 2BGCA 4ZY0A 3H8GA 2ISZA 3ISZA 3DPLC 1ZLHA 1CP6A 4O23A 1KWMA 2XAHA 2P8TA 4KN7X 4WX9A 3VATA 4F8ZA 4PGGA 4OC5A 5HOOA 1TNSA 2DBBA 4NGMA 1V4RA 5H20A 1J2XA 4ESFA 2ZEEA 1YO5C 3KR5A 5ILSA 2CF4A 2XUBA 1LDDA 3JW4A 2W57A 2Q4ZA 2GXGA 1U5TB 3MQ0A 4C85A 4P45A 2O61A 5LYIA 4UV8A 3LQRA 1ZREA 3SI0A 1CBXA 1T2KA 2HKOA 2Q0OA 5DD4A 3DEUA 2EK8A 2GIVA 4M9SA 3FXRA 3GFJA 3V7RA 2G7UA 3HIFA 1PP8F 2ZOGA 3Q9VA 4U0VA 3DXJF 4WXDA 4Y17A 4C8PA 1BJAA 4MHGA 3B02A 1S6LA 3W6JB 3N5FA 1J9IA 3PB7X 3F8FA 3QP5A 5LHIA 1OR7A 3V7CA 2IJLA 1AOYA 2XIGA 2V8HA 3E6BA 5LLQA 5K8NA 1E17A 4M6YA 5D5XB 4A2UA 1D8KA 4RGSA 5LBQA 4HX7A 3I4PA 1CPXA 3MAJA 4L0ZB 1TQIA 2DTRA 3KEOA 1G3TA 4FWUA 3GEZA 4MEXF 5BPDA 3F3XA 1UB9A 1SMYF 4YIFA 1LAPA 4HV5A 4S04A 2ZBKA 5E18F 3HSEA 4BYYA 4MHNA 1D5VA 4KT5C 4MNUA 5BOXA 4RGRA 4R79A 2HEOA 4A0YA 4DJLA 1H0MA 2HYFA 1P4AA 3RJPA 4Q47A 1SFEA 4Y15A 3WGGA 3NA6A 5ICFA 2O53A 2QQAA 1J7KA 4IVNA 4ZY1A 1FBUA 3KLOA 4G7HF 1Z6RA 1UHMA 4NFRA 4NGTA 2QUFA 1TW2A 4D0PA 3I0TA 3FF3A 1SAXA 2A3SA 4A6EA