3K9WA

Crystal structure of phosphopantetheine adenylyltransferase from burkholderia pseudomallei with hydrolyzed 3'-dephospho coenzyme a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
163
structure length
163
Chain Sequence
GSMVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFFSLEERLKIANEVLGHYPNVKVMGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of phosphopantetheine adenylyltransferase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
total genus 62
structure length 163
sequence length 163
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3k9wA00
4R0NA 4FZJA 4KR7A 3LCJA 3LE8A 4MUFA 3AL0C 3L92A 2A1TR 1Y42X 2O5RA 3Q4GA 3ZXIA 1QU2A 3RFFA 1T6ZA 1M8FA 3A4IA 1N2HA 1OWNA 1N78A 4EG6A 5TEVA 3IOBA 4JYZA 3AKZA 4ARCA 4BWVA 3H9BA 2X1LA 1MC1A 1PFVA 3AG6A 2IP1A 3MUEA 2QUKA 3AG5A 5IHXA 2D13A 1MJHA 2A88A 1M1ZA 2WQ6A 1YULA 1O97C 1J21A 2C5SA 4JFAA 4MQ6A 1IVSA 1M8KA 3GUZA 1KH2A 1JMVA 3PNBA 3KFLA 4EF6A 1OWPA 1TYCA 2YY5A 3Q12A 4CDNA 1VBKA 3A04A 4Q93A 1JZSA 4MUEA 4MVYA 4A91A 3FIUA 3CVUA 1OWMA 1U3DA 2PZ8A 1WXEA 3GMIA 1KAMA 1M8GA 4P2BA 5AHWA 2DETA 1R6UA 1N1DA 1T6XA 1H3NA 2H29A 3PNVA 4KKVA 5TS2A 3FG9A 2CV2A 2QJFA 3COWA 3I05A 1M8JA 3CLTC 1KP3A 3HGMA 1NUTA 3HFJA 4CDMA 1IQRA 3IH5A 1NSYA 3FI0A 3IUBA 4KR9A 1X8XA 1N2GA 2ZUFA 4NATA 3ZXSA 1NUPA 4MUGA 3IVGA 3CLTD 1ZUNA 4PBTA 1EFVA 4ZT4A 4U8HA 3HV0A 1K92A 4YBRA 3IUEA 1GTSA 1I6KA 4GRIA 1EJ2A 4NAHA 4NZPA 1OD6A 4MW7A 1H3FA 1N77A 3PRHA 1J1UA 1N2OA 1O96B 1U7DA 4ND7A 3SZ3A 1ILEA 3K32A 3C8ZA 3SZGA 3CLSD 1NURA 2CYAA 3IODA 4MLPA 2HMAA 4CT0A 1TYBE 3IDFA 1EXDA 1MBZA 4U63A 4OJMX 1IFXA 1IHOA 3P0IA 4EFKA 2A1UA 1VBNA 2CSXA 3CA8A 1P7PA 2E89A 4MVXA 5KHAA 1WXGA 1G8FA 3OP1A 3OTWA 1V47A 2AG6A 1KKUA 4UZFA 4ZT3A 4AS1A 3KT3A 3UK2A 1F4LA 4L2IB 1MB9A 2PXHA 1S4MA 5KCMA 1A8HA 4ARIA 3NBAA 4KR6A 5H7XA 5J5AA 1NP7A 3P0HA 1PG2A 3DV2A 2OV4A 5LLTA 1SURA 3CLSC 4CQNA 1WQ4A 3INNA 2NSYA 1I2DA 3TZLA 3BL5A 5LM3A 1GAXA 1M8PA 4RUKA 1QRSA 3UY4A 1JEEA 2DR2A 1GLNA 1QQTA 1N3LA 3X1MA 4ZT6A 2O8VA 5K0SA 1QNFA 1MRZA 2A86A 1K4KA 4S1OA 2TS1A 1UFVA 1J20A 1ZH6A 2J07A 3UMVA 1GTRA 4QREA 1WXFA 2VXOA 4MUIA 1LI5A 4MUKA 1N2EA 1T9GS 3H97A 5BNZA 2NZ2A 4QRDA 1F7UA 3IVXA 5J58A 4JZYA 1EFPB 1O94C 5LFAA 1K4MA 1K97A 1H1TA 4I6EA 4YP6A 1U3CA 2J09A 2V0GA 1NZJA 3N05A 1MOPA 3IMGA 1BS2A 1VL2A 1OBCA 3H05A 1XJQA 1VBMA 4K0RA 1MB2A 3N8HA 1N75A 4J75A 4XFDA 5DB4A 3H99A 4F4HA 1NYLA 3SEQA 2QUHA 1NUQA 3P0JA 4ZCTA 3KT8A 3ZGZA 4PBRA 1GZUA 1EFVB 3HMQA 4MW5A 4ND6A 1KP2A 2I1LA 4ZT2A 5FO1A 2BTEA 3M5WA 4EGAA 1LI7A 1PG0A 2QJOA 1U7XA 2HZ7A 3ZJTA 1JGTA 2CYBA 2X1MA 2PZBA 4MWDA 4I6GA 4XFJA 4OUDB 2H2AA 1N2BA 1GPMA 2A84A 5TEWA 3IOCA 2CT8A 3GLVA 1WKBA 1O94D 1F7VA 1N2IA 3ZJUA 5TGTA 2DUMA 1J1ZA 3G59A 4MW6A 4U7JA 2DEUA 3IMEA 3S3TA 1XNHA 1QRUA 2B7LA 1R6XA 2R5WA 1TFUA 2JA2A 1NI5A 3LOQA 4NAUA 2GOYA 2G36A 1TQ8A 3UC5A 2AKEA 4H3SA 2QUJA 1KR2A 2A1UB 3DLAA 2YXNA 1YIAA 1G8GA 2DLCX 2WB2A 4RPIA 3SYTA 4MUHA 3IVCA 1OWLA 3MXTA 3U1VA 1IH8A 4MVCA 3G5AA 5HUJA 4MW9A 1JZQA 3NV7A 1KQOA 3F3MA 3HL4A 1MAUA 3DO8A 3CR8A 3FETA 3K9WA 2D5BA 5KWVA 3A05A 1PFYA 1Q19A 1JILA 5FNZA 3CLUD 4E1AA 5HG0A 5DEOA 3H9CA 3QTBA 2CUZA 4J76A 1F9AA 1M83A 1LW7A 3FNRA 3QTTA 1KQNA 1D2RA 2E21A 3RHSA 3AIIA 3SP1A 4ZCPA 4DLPA 1OWOA 1PFUA 4DNXA 3RK1A 2Z08A 1CT9A 3CVVA 1T9GR 2WQ7A 1QJCA 1FYDA 1IRXA 3ND6A 3P52A 4ZT5A 2RD2A 4OUDA 3ZUGA 1WJGA 2QJTA 2CYCA 2ZP1A 3AFHA 4PY2A 3TZEA 1ZJWA 2D54A 1EE1A 4DDKA 3IMCA 3L93A 1NUSA 3TS1A 1JIKA 3PNYA 3FH0A 2A1TS 1Q11A 3KT0A 3G6KA 2J5BA 4K03A 2Z3VA 4NX2A 2CV0A 1KH3A 2CV1A 3DPIA 3SDBA 2ZUEA 1TYAE 2XRYA 4MAFA 3CLUC 1VLHA 1U0BB 4DE5A 4EG5A 3N2YA 3D6VA 4XSVA 4MW1A 4AQ7A 3E27A 3MLAA 4YP5A 1G59A 2X0KA 3FHJA 4MULA 1O95C 4HK4A 1OBHA 2A7XA 1WOYA 4WSOA 3KT6A 4NDAA 4I6JA 4TS1A 2DERA 2E18A 1JIJA 2AZXA 3CVYA 5HUHA 3COVA 2BYTA 1I6MA 1X6VA 4Q16A 4F3RA 1R6TA 3CVXA 3RK0A 3COZA 1KAQA 4MW0A 4EG1A 3TNJA 1ZH0A 1O0CA 1Q77A 4EG7A 5H16A 3ND7A 4EG3A 3RJZA 1EUYA 4HJXA 1YUMA 4JXZA 4HPWA 4KPUA 1J70A 1GN8A 2QTRA 3JXEA 4ZCSA 1O95D 1WY5A 2PZAA 4ZT7A 3HZRA 1XNGA 4MWBA 3VGJA 3CLRC 2QTMA 3NBKA 5IJXA 1COZA 1YI8A 2E0IA 2V0CA 2QTNA 4ZCQA 1J09A 3UOWA 1TYDE 1KQPA 1EFPA 4JXXA 1O0BA 1Q15A 2X3FA 1TEZA 2IELA 3COYA 1PFWA 4EG4A 1WXIA 5F23A 1O5TA 4MWCA 1JIIA 2PFSA 4HJRA 2RE8A 2JANA 3ISJA 3CVWA 1B6TA 1IQ0A 1I6LA 1KH1A 5FO0A 3D6UA 3FY4A 2DPLA 1YUNA 3PXUA 2HGZA 1DNPA 2GM3A 3ZJVA 2VTBB 1V8FA 3TQIA 2WSIA 3RBAA 2QUIA 1MAWA 2PIDA 1O96A 4DJAA 2CFOA 5JBNA 3ELBA 1O6BA 4GU5A 4DDMA 3ND5A 2J08A 3Q10A 1KORA 1WZ2A 1N2JA 2A4MA 3CLRD 2VTBA 4G6ZA 3SEZA 1FFYA 4EG8A 4QBTA 2GKSA 2YWBA 4KPUB 3VU8A 1IQUA 3IOEA 4DDHA 3X1KA 1RQGA 2J4DA 2DXIA 4MW4A 5EKDA 4MVWA 2OQ2A 4MUNA 4UZEA 1JEDA 3MLBA 3X1JA 2JAXA 3FWKA 3ZIUA 2IJGX 1WXHA 1ULHA 3MMXA 1WQ3A 4PBSA 4WNYA 1T6YA 3FDXA 4ZCRA 2YWCA 4R2MA 3N9IA 3ILVA 5K0TA 4YP7A 1NUUA 1HYBA 1XNJA 1JECA 5DK4A 1QTQA 4MW2A 1JHDA 2EL7A 4YMIA 3A2KA 4G5YA 4MWEA 5DASA 3QE4A 1G8HA 4X0EA 1QU3A 3VRHA 1O97D 3TQOA 2XRZA 1QRTA 1YIDA 2PG3A 2Z09A 1H3EA 5J59A 4G5FA 1EUQA 4R2LA 3FOCA 4L2IA 2EJCA 4MUJA
chains in the Genus database with same CATH superfamily
1QXSA 4P4UA 3WGNA 1MB4A 4OGGA 2EKZA 5AW6A 2A1TR 1PWEA 1MJ5A 3BWBA 1O89A 4BVBA 3PICA 4AQYB 4S1VA 4TTPA 3D7NA 4MVJA 4EJ0A 3HCDA 5JNTA 1M2FA 1NZDA 2B20A 4RAOA 4AN4A 5TEVA 3RS8A 3BXPA 3FIJA 2G63A 1L5SA 1PL8A 4KFTA 4DREA 4L9AA 2O5VA 2PLNA 5CDSA 3MWDA 4AW9A 8ATCA 4QUBA 4U0JA 5CA1A 2IBMA 3ROXA 2RAFA 1KO5A 4CDGA 5ALQA 1PNVA 4LF6B 1GUAA 2SCUB 3S0JA 3V2UA 1E5TA 2XMPA 5HA5A 4AKGA 1IVSA 2H5EA 3ITNA 2GJ4A 1YMUA 2FR8C 3PFFA 5A7HA 3OHMA 4REOA 3BKXA 3EEYA 4P7FA 3RRBA 2UVQA 2JK1A 3OPYB 4PCUA 5TX7A 2IV3A 3SZMA 4X71A 5HIJA 1SN7A 5IZ4A 1YQEA 1PX2A 1B1AA 5EZYB 1VBKA 3RS7A 4D9IA 1JZSA 1KYIA 4H4CA 3REGA 4EJMA 2PD6A 2ZJ8A 1N7JA 4NYMR 1XZJA 2H31A 1Z29A 4XM0A 4DIFA 1PD1A 2CVPA 2P68A 1F2TA 4KWCA 2A0KA 2A78A 4I1UA 4IMJB 4O4JB 4OF4A 4O4LB 4HDKB 3STTA 1QE5A 1P75A 1P9WA 3E58A 3IBYA 4UDXX 1X3LA 3EXAA 3SAJA 3ZGXA 3GJTA 1WW3A 2B1QA 2GK7A 4NMWA 4NABA 3MGBA 4L7QA 4M7PA 4YDSA 3ZE6A 1C41A 1E8MA 1GUFA 2MSNA 3UXMA 3PIIA 4UUQA 5DN6A 3KXKA 3WSVA 2PFKA 2AXNA 3S5UA 1M8JA 4UTXA 1WSWA 2D2EA 4G5RA 1NJSA 4JOQA 5CLGA 5AHOA 5JAHA 3L7AA 2ZIZA 5CHYA 1YNSA 4MS3A 3VV3A 4BLRA 4RTOA 2D5AA 1TA4A 1G0OA 1O54A 2WI8A 3MAGA 3QLTA 1RYHA 1ICIA 3K92A 2PKEA 3NBMA 2AXEA 5ALDA 5H0IA 5CX4A 1SZJG 3TI7A 4CMIA 4MWTA 1UWCA 3LVRE 3TLCA 3K8ZA 3W1VA 4GP9A 1A9XB 2FG6C 1SOVA 1S6YA 2OORA 1V43A 3JVUA 5K0JA 1QX4A 1XTBA 2BKXA 3IUEA 3DLCA 3PDIA 3IKMB 1Z4IA 4MQUA 3DV9A 1A9QA 3UPDA 2QVLA 1C9JA 4MW7A 2I6XA 3B8HA 2WDZA 2EQ5A 3PRHA 1H6AA 3OZVA 5C31A 1JE1A 2JGDB 1GZ7A 4RTPA 1N5KA 5LZ5A 3GMSA 4ZK2A 4Y6RA 5T4EA 2POQX 4ZODA 1UAYA 3OICA 3W3AH 1YHNA 3QE3A 2V8BA 1NBAA 1QO0D 1W0KA 2XLCA 3DCNA 3EGVA 2CXPA 2JC3A 3LO8A 2MDTA 1VPTA 4KNWA 1BH2A 1DADA 2XDWA 4IXWA 3BUSA 2NO5A 1RFGE 4F4CA 1C9EA 5KNDH 1IUOA 3ZHXA 3A2NA 1CHNA 4WNIA 1K7EB 2V6MA 2DT8A 3GRCA 4YJHB 1RVV1 3KQQA 1GIAA 2FW9A 2PL5A 1S2LA 5JS6A 1P7WA 1XTZA 2YXLA 2C2WA 1DKOA 3TCNA 2V9PA 4FB4A 3FJOA 4GQIA 2B9VA 4TTIA 5LNK1 1FDSA 4BNMA 1JVSA 1VYVA 9MHTA 2BFNA 3NBAA 4I1PA 1PNTA 2UUCB 2HK6A 5BSMA 1HK7A 4RL4A 1HNXB 2C1ZA 5EKTA 5EQTA 1DRJA 3OLVA 1N8SA 3NUGA 4HNTA 5FUMA 3T7EA 2HLDA 1WQ4A 1FFAA 1DTSA 3CEHA 4H1TA 4BKOA 5EUCA 2ID8A 4A0RA 4BFWA 5JO0A 3DV0A 4DCSA 2W4IA 4XQEA 4JLUA 1GAXA 2JNWA 5EJEA 3DWGA 2Q1YA 4AZSA 3DB1A 1KPGA 5H8WA 3FNQA 1Z4NA 1Z3IX 1QV7A 1GFIA 1S96A 2DWUA 2OOKA 3E23A 3EGWA 2QN6A 3KLNA 3BMOA 1YZ3A 1U2EA 3I3SR 2VH2A 3TPZA 3A4MA 3H19A 4WA7A 3UMRA 3QF4A 2PMKA 5F7ZA 1SCNE 2EEPA 6GPBA 3U61B 1P73A 3Q87B 3LXXA 5BNFA 4NOKA 1INLA 1YHYA 2H57A 4JJAA 1S1CA 3KPYA 4G2NA 3ROPA 3AKEA 3WGUA 2WNIA 3EDOA 4EAAA 4ZQFA 3EW7A 2G4LA 3LF1A 1C2TA 4F5EA 4V0SA 1YRLA 2EBUA 1A3CA 3H97A 4U02A 3TIFA 4CKZA 1A97A 3NALA 5HM6A 1CFZA 1D2EA 1RWOA 5KYNA 5J2UB 3WO0A 4RPJA 4EFDA 2GEVA 3ROMA 1NXVA 3K0HA 2LKCA 5I3ZA 1H0RA 2IHBA 4I6EA 3CEJA 2Y0DA 3R77A 4ENRA 3P4XA 1B2LA 5JNWA 1IK4A 1UMDB 2QTGA 2QTAA 5FJIA 3I1YA 2GCGA 3GRAA 3UIEA 3DLIA 1RD4A 1RWXA 2QZ9A 1BS2A 2Q07A 1JXAA 4TRMA 1XQYA 1ZD1A 2OBFA 2F1HA 4X7MA 5IG2A 2PMWB 1V16B 2QUHA 1XOIA 3R74A 2JD0A 1SY7A 5A4FS 2RCYA 5TPZD 4CG0A 1UBKS 3VU9A 3C1AA 1ATZA 1UXOA 2IDZA 3KK0A 2XR1A 4OQPA 5DJ5A 5KREA 4UBLA 3KOZA 1LA2A 4AYXA 1DUSA 1LDBA 5TQ0A 1SBNE 4PYOA 1U7XA 2BFFB 5HS6A 3RSZA 1EP9A 4FQ7A 3OE7D 1R37A 3VJKA 5IK2D 1NDUA 3PEYA 4JLKA 1XZDA 3EXHA 4TLEA 4QDUA 1RM0A 4UVDA 3T0IA 3OOEA 3OJWA 4JJ6A 2QX7A 1WUKS 2INGX 3QXCA 4EO7A 4ZAXA 1OT5A 1GPWB 1K63A 4G97A 3RB8A 3NYRA 5DHPA 2IWRA 5IDXA 5I7AA 4DQDA 4B9EA 5LUAA 2HJRA 1EX9A 5LZ4A 3LLSA 3C39A 4CFZA 3OAAD 4NRDA 2CDBA 5IVHA 2J9RA 3AXSA 3GLVA 4I66A 4NJOA 2HUPA 4NENB 5E6SB 2QXYA 3W2TA 5J4YA 5DTRA 3O4VA 3KQWA 4HI0E 3TEMA 4CM8A 3AFNA 4Q7LA 3V8QA 1G4UR 1MDFA 1N33B 4C6RA 3B85A 1OXMA 1RPTA 1VHDA 2AMJA 2EDCA 2P5UA 4RSRA 1NT2A 3G68A 2DSTA 3NC1C 3IT1A 4P3YA 3LVBA 2VIIA 2JAUA 4WKPA 4LISA 5F73A 2WF6A 3TSCA 1EK1A 3PSAA 2G9NA 2R48A 2WIAA 2CXQA 1Z4MA 2Q4BA 4RORA 3W7BA 2GTIA 4DJ5X 4QVIA 3BFXA 3L7OA 2YXNA 3EQ6A 4FEAA 3I2IA 5HE9A 3DAYA 1QHGA 1LQ2A 1RC1A 2Q1SA 1OFGA 3R5HA 2XWBF 1G8YA 4KE8A 4O08A 4ZOLA 2IL1A 3ZXYA 2X8BA 3PFHA 1QRAA 4KPGA 1IHPA 1JHQA 1E6UA 4GR9A 4QOHA 2AUMA 3G2PA 2V59A 1KHTA 2FMIA 4JD5A 4LX8A 4C0LA 1YS6A 4PQEA 3O9MA 2G76A 2YTZA 4CWAA 3WGIA 3DXZA 1J8DA 3NV7A 4LAFA 3RPEA 3W1WA 2O54A 3OTIA 4HUQB 4LXIA 1WE2A 1AQJA 2VATA 4WW0A 4JUBA 2RSLA 5KYUA 1I1HA 3R7NA 1DB3A 3E3LA 1UKZA 3AL3A 3OEHD 4Y0VA 1NX9A 4ZYTA 2FX3A 1TZCA 5M29A 2HMWA 1TJYA 3KYDA 4AUEA 5LJIA 3BGSA 3DPSA 4O02B 1I4EB 1PV1A 2IF2A 2PWZA 2R87A 4EHHA 3ECCA 3LU1A 3QBDA 3AY7A 4B32A 5FLXA 5ALJA 2XEDA 1ILWA 4B80A 3DZCA 1JMKC 3HBLA 3PA8A 3Q7QA 4ESEA 3EH1A 3HPRA 5FWXA 5DWVA 3E2IA 3LT1A 1A69A 2W0SA 4WXMA 2R2GA 1P4SA 2E21A 3AUAA 4LXHA 1NM5A 4NZZA 4RENA 5CDTA 1O2DA 1U1DA 4OQEA 1ND6A 2CLOB 1K9SA 2JFNA 2R8OA 3RFVA 4QFBA 3R3HA 4U2BA 3SBOA 4D81A 4EB0A 4Z0TA 1ULBA 1F1BA 4MB2A 1P3JA 5KKAA 4URUR 3GJ6A 4LNUA 4DRYA 1G2IA 4GPTA 5LZ2A 4DB4A 2HA2A 2HFKA 2ZP1A 3AF1A 2HYIC 1AUOA 2OCYC 5EJGA 3E18A 4M55A 3CZMA 2JCVA 4JLPA 4OI2A 1Y5NA 5A3SA 1AHIA 3ZHSA 5KTRA 1G2OA 1R18A 3L93A 1UJCA 3CH6A 2B5OA 1U4NA 3O6VA 1M72A 4L9WA 1MX1A 3ABRB 4J29A 4XSGA 5D84A 2VYVD 3GPLA 1HL7A 1ISSA 2B83A 4LYHA 4IRMA 2H65A 4NX2A 2VTBA 1VE1A 4BQSA 4LOIA 1YMVA 2IU3A 5BQ5A 4W1RA 5B3JC 5LQAA 4R9VA 4XR9A 4R1NA 2ZJ6A 2PX6A 1XDSA 4GI3A 2OBMA 3SSOA 2G06A 1XD2B 2G70A 2ISQA 2Z9DA 4INPA 4MAFA 4QUJA 3WA7A 3ZLJA 5AKJA 2UVPB 2W2PA 4UEOA 3NHRA 3R3YA 4TKZA 5AWFC 5JCOA 1MG0A 3PZRA 2G9ZA 4BCCA 2FUCA 1FXSA 3WOVA 4M8KA 4S05A 5TSDA 3RK4A 3FMPB 4HK4A 1Z7WA 4P5EA 4JGBA 4MVJH 1XRNA 4OJNA 3RJ9A 3MW8A 3A1CA 5COQA 3ZLBA 2I8CA 2IEDA 3CH4B 3DE2X 3ZCVA 5JROA 4DQUA 7AT1A 3KB8A 1W9HA 1R6TA 2PJDA 2EKBA 3O74A 4QU5A 5AJYA 2R6AA 1VCNA 1ZESA 2CDAA 2UVPA 3BJZA 3IR7A 4X95A 5AHKA 3RUHA 4WZBE 4N9QA 4IINA 4DLKA 2AHRA 2REQB 1JN0A 4I14A 5JZMA 3S2SA 4HZIA 4UQOA 2WJ4A 2R0QC 4KQEA 6REQB 1YVRA 4HPWA 3BZBA 4QYXA 4AJ1A 3U4QB 3TJZA 2PX5A 3PXXA 4FPXA 3LFHA 1PV2A 4IS2A 3WDKA 4Q4LA 1OE0A 1E9RA 3I9KA 4PPQA 3UO8B 4TM7A 1C1DB 3H2HA 1TEXA 1BOOA 4NY1A 4EA7A 1QDUA 4LXYA 3QBEA 3SU8A 3ESQA 3NASA 3QU4A 2WJAA 5FIUA 4IF6A 3N75A 4WOCA 5KTMA 5FOXA 2IELA 3TZKA 4DA4A 4GRAA 2UDPA 3CBGA 2IUFA 2X1VA 4KZKA 5K3DA 1YJ5A 4C7OB 1MC8A 4BNKA 4PLTA 3I64A 5KX5A 1GAQA 3DNPA 2C5LA 2H1CA 2YFYA 3V6LA 1SOAA 1YJ8A 1OGYA 4GC5A 2UXBB 4A2PA 4P3NA 3UUEA 1W5EA 3D6UA 3LVFO 2OKGA 3L18A 4KDEA 1W46A 1XI2A 3WTBA 3JD2A 1Z63A 3A1UA 1VTKA 3M3DA 4RZQA 3ZWCA 3PZBA 4CG1A 3GVPA 1JHVA 3B9RA 4XIIA 1L8AA 4WKGA 4MVJF 1R4MA 3L82B 1CHDA 3MYRA 4RL6A 3VUFA 2QG9A 4AWXA 1IJFA 1U1FA 1VCHA 2OV1A 1JXMA 2EF1A 4XYGA 3RUIA 5BXQC 1QYIA 4N3BA 4WAUA 2YY6A 2K4MA 3QE9Y 4F3CA 3KELA 4H7IA 2N46A 4P5PA 4W7IA 4S0ZA 4HATA 1DRKA 1A7JA 1EUZA 2OZKA 1PJ2A 3U2QA 2DLDA 1HZZC 4A92A 1OUMA 3AHFA 4BLOA 5BVHB 4DR4B 4POAA 1SQFA 3BJMA 4TTAA 4FM9A 2XI4A 1HTWA 2R7NA 3HH8A 2WHQA 3PYMA 2BELA 2E4ZA 1DOHA 1E6CA 1L4LA 1QS0A 1X8JA 2VEOA 1T8YA 2HBYA 1I4LD 3ESRA 2GBCA 3F4BA 3E53A 4UVHA 4UZSA 1N8TA 4GGMX 3RC7A 4DQVA 4DM7A 1T0PA 3GLSA 1LTKA 3LHSA 5D7NA 3RSGA 3UT5B 5EP2A 4D44A 4E5UA 4F1KA 4D3ZA 1HQKA 1XEAA 2CLFB 5FOSA 4YAUA 4GMHA 4KHPB 2D1YA 4C2UA 1KR5A 1A4RA 2VO1A 3ZIUA 2QLBA 2CFSA 1FP7A 1PJZA 4YQYA 2LGJA 3KDAA 5AK3A 3H8JA 2Q3LA 4K6GA 2DYKA 3TQSA 4N0MA 3F5SA 4D0NA 3DOOA 3W6OA 1JX6A 3M34A 4FGWA 3OWHA 5KOYA 4KQFA 3WLOA 1JMYA 3BMNA 2QQEA 3H1AA 4MIEA 2ZYSA 1EFAA 1MTOA 3Q8WA 3M89A 2VJMB 5HK9A 1PVVA 1Z0DA 3N2LA 4WJZA 5THQA 3KB2A 5DASA 3QE4A 3EVGA 4MV4A 2G88A 3PL1A 4FX5A 1ZD2P 4U7FA 4EPVA 3PSHA 5TQ2B 2PG3A 3CZCA 5KYGA 4OLJA 2EP5A 1YR6A 2QN1A 4HN9A 1P4GA 2W37A 3KAPA 1R5BA 4I8XA 4J0GA 4NJEB 4NYMQ 1I94B 3KEFA 4U2DA 3RSCA 4HH0A 5D86A 2B21A 2PUAA 4GIBA 1KYYA 1X1AA 4RH0A 3D02A 4R9RA 2IH5A 2BKLA 1ULZA 4JLAA 1JSCA 4MX8A 1NTRA 2FF5A 1Q0UA 4JSYA 4NCJA 2RH8A 2AX3A 3X44A 2QW8A 5C46F 2C5FA 2FWBA 3PNLA 4WZBA 4DBLE 2UYCA 5B3KA 1MRSA 3DBIA 1BEEA 3H7AA 4CLEA 2HJVA 5KU1A 2CHFA 1R15A 3BICA 3JALB 2BGLA 4QECA 4NLLA 2PWBA 1VE6A 1XA4A 3GLIA 4EPWA 1Q0LA 1CIPA 4LHWA 3GFFA 2OCAA 5KJ1A 1Z5PA 3QA9A 2Q50A 4O4HF 3Q3CA 2J0QA 2JLYA 2QUKA 1QWSA 2UYOA 2VJLA 4TUYF 4QGFA 4JLJA 1K9VF 1QIFA 2H9AA 3RU3A 5JFOA 5KWSA 1YT5A 3IVRA 1GCUA 4PS0A 3ZGYA 1SC6A 1QG4A 3IPAA 3Q9SA 4MR9B 2MWMA 5DM70 4MNTA 3WGTA 3OEYA 1ADFA 3EUFA 3WMXA 4YRLA 2WIGA 5IDYA 3VVLA 1Q1AA 1R12A 5H3CA 2J5RA 4CKCA 2HADA 2XCUA 2GBLA 2ZS9A 5LNK6 2HA7A 2XCLA 2VQFB 1E9FA 3AP1A 3RAPR 2FPKA 4PFQA 3P20A 4Q4HB 4L9RA 4JEMA 1YSCA 2E55A 5B53A 3QPBA 4DL9A 1EFKA 4RF3A 4MJLA 4ZDKA 2C9OA 2Q3CA 1YDEA 5HDQA 1R6UA 3DLPX 4DSUA 2IYQA 1L5WA 3AY3A 1JDBB 3PNVA 4WXPA 5LC1A 5CFLA 3NJ4A 2VJKA 3ELYA 5JCOC 2EEZA 4DIEA 3LTNC 2CXTA 2FE4A 5IS2A 4CZ2A 1WOMA 1Z75A 3JYOA 5E7JA 1EX7A 3V97A 4LDAA 8GPBA 3LQ1A 3TTUA 3O9VA 2GN9A 1KQ3A 3H2IA 2FFJA 5A4AA 4RC9A 4EYSA 1YBAA 3O83A 4NXNB 1WB4A 1C81A 1K6MA 3EIWA 2X1HA 4MV1A 2JIRA 2ZWAA 2OYRA 1XKXA 3GK3A 3V32A 4P4LA 1NI4A 4BFTA 3THOA 7REQA 1O5IA 1TUGA 4E3WA 1RVDA 4WTOA 4G5XA 1RDFA 4J16C 4U8HA 3KAQA 5EJMA 4TVSA 1GNVA 4Q6BA 1F4PA 4OQYA 3UHOA 4C20A 4ZN6A 2WE8A 2NZVG 2JGJA 1J1UA 1W0JD 1QGUB 4YUVA 2GZMA 3IQZA 2QI9C 1UT5A 1U6KA 3DC2A 1RMTA 1U8ZA 1VMAA 1DAOA 3K32A 2J31A 4KMMA 4DMUB 1I2AA 3JZMA 3NHZA 4HY3A 4N6NA 2R6JA 2I4TA 1LLCA 1YB7A 4ARAA 2JZOA 4RJIA 1C0EA 4N82A 3B1XA 3RT1A 2Q6KA 3PQFA 2H4FA 2M1ZA 4AP5A 3NV9A 2CLEB 2V8OA 3C3YA 4PAWA 5MN5A 1QVZA 3L0IB 1D3AA 3TQQA 4RKEA 2EVWX 5A2GA 1P33A 1YZVA 1RLUA 1C7RA 4OFXA 1MAHA 3QJGA 2I6GA 3VU0A 2P30A 2Z2JA 4W6ZA 3ZDRA 3ZZTA 4BLQA 4CKBA 2VRWA 3JATA 4ZALA 3PCRB 4BNWA 3QGMA 3COJA 1P7PA 3GUUA 3LQRA 3GNLA 4HDSA 3NTOA 3I9FA 4JBLA 1OXKB 4BJ3A 4ZHQF 3Q8LA 2C42A 2V98A 3EWNA 2AG6A 2IU6A 5IDVA 1N34B 2XUHA 2B4QA 3BB1A 3M33A 2ATIA 3M6XA 2IRWA 4WXRA 4MS3B 2FTKE 3NDIA 5KCMA 3EDCA 4Q01A 4LXQA 3ZDZB 1HF3A 5IXYA 2CE2X 4QHSA 2C2HA 3KKPA 5A3QA 5D2CA 5CM8B 1KZHA 2VP6A 1UK8A 1F1JA 3PDCA 1BQ3A 2XADA 1SURA 1RI2A 2J1LA 3GEIA 3OMXA 3GJ8A 3L5KA 4JP5A 1DU4A 3JZIA 1HZJA 5E6UB 4ZOAA 3GP5A 4E5KA 5EQDA 4DHWA 2OFPA 3HUEA 4GSKA 4QE3A 3JRNA 4X3OA 4XYMA 1GLNA 1EHIA 1TEHA 2ZRKA 2PX2A 2XDQA 1Z06A 2QPAA 4XLZA 4GZ5A 5CEFA 5ADWA 4D3DA 5F1OA 4OHRA 5THKA 1NZFA 1XCPA 3MQFA 1YJXA 2C3MA 2I2CA 3AINA 2VWHA 4QTZA 4ZT6A 6CHYA 3HFSA 1PVDA 5BNWA 3O03A 3HYTA 4OMCA 5FBRB 4NCAA 1LH0A 3U31A 3U4CA 1DJMA 1Q3HA 1WR8A 2IXAA 3W6PA 1CRQA 3PGXA 1FVFA 5HX7A 3SJ7A 5HZMA 3ZHQA 4XUCA 1D0VA 1IY9A 3D3JA 1OLUB 2B0JA 2IPNA 3G7SA 3KEOA 3VYSB 2IUUA 4F86A 4DCMA 1HE3A 2O1EA 3A37A 3F6SA 2QV0A 2GT1A 3BWVA 4E51A 4EX7A 3MWDB 1ES9A 2Q8QA 4HN4B 3GLGA 2WC1A 1PLKA 1NJFA 1RYZA 1BXGA 3GAZA 2RHJA 3D2CA 3HMKA 3K0FB 4RHYA 4TQGA 1K4MA 1UC9A 3CCBA 4XWAA 5D85A 3V8VA 5AVRA 1KRXA 5ALFA 3MELA 4GUAA 2PUHA 1P4RA 1FSZA 3GJRA 3VKHA 2BM1A 4BZPA 1KEEB 1NAIA 3DZIA 1OLOA 4L07A 1D4AA 2NUTA 3RS4A 5ERXA 1KARA 5K6AA 4M0UA 1GQQA 2FWMX 5CIQA 1XJQA 5AUOB 1CUJA 4OBWA 3ZU6A 1KJNA 4OB7A 2IYNA 3CNOA 2RHRA 1NR7A 1MZPA 3NXSA 3OZXA 3DBLB 4A3SA 5L45A 1JDJA 3IP3A 1PIWA 2AFHE 3TOZA 1AGNA 2O3JA 4CEJA 4LNHA 4I1OA 2Q1TA 2GXUA 3RVJA 5KJCA 5DI9A 4BC1A 3WFJA 1L4UA 1C7QA 2FUEA 1J4AA 4QIHA 3T1VA 3TDNA 4P31A 3I4FA 4XI9A 2YMMA 4KVAA 2FWNA 3TZHA 3V7YA 1T2DA 3OE5A 5AI4A 4K0KB 1ZJZA 2QTWB 2YWJA 1HTBA 5DZSA 3BCRA 1KFKB 1TVCA 5JMWA 1HNZB 1V37A 4DYHA 1TUBA 3MPOA 4DLZA 2ZSBA 5GQSA 3L41A 4TT3A 3Q1LA 2UZAA 3C5HA 4QU8A 2DUWA 2XKAA 4C05A 5EJ9A 2ZM6B 4AJEA 4IIJA 5HKAA 3LJKA 1QAOA 4NJMA 4DXDA 4B76A 4HB4A 3TNFA 6REQA 3FVWA 1VGRA 1LVGA 1SKUA 3FZYA 5AOVA 3ZJUA 3AHGA 3OQIA 1Z4OA 1XD2A 4LZNA 1XRQA 3D6AA 3T99A 1W73A 4QC2A 1T10A 4JB0A 3H16A 4FGUA 2XITA 3AFOA 3DFFA 4LCEA 1NI5A 2WJWA 4OYHA 4R51A 4RULA 1JH9A 1BVUA 1GPDG 2Q46A 3L0DA 1PX0A 2Q3FA 4NBKA 1UZAA 1SBZA 2ZJ4A 2O0HA 2QVBA 2CF5A 3OQOA 3P9SA 2CK3D 2IHVA 5EEGA 2GZ1A 5HSGA 4A8JB 3U0VA 3O8BA 3EFEA 1FS5A 4H6XA 2D6FA 2O8EA 1EDZA 3VNRA 5A5DA 2QN2A 2W90A 2VP3A 2XA2A 4QNNA 4CUKA 2X3UA 5JSHA 1UK7A 2XMBA 5ECWA 4M36A 3D3EA 2PZLA 3W5CA 3JYHA 3K9GA 4ZYYA 3WKEA 2VQEB 2ONCA 3AJAA 4HWTA 4YV0A 5IMSA 4R6WA 4CEIB 5IC4A 5BUSA 2CLDX 2HX1A 3BRWD 4B40A 5C7YA 5AHRA 3LNCA 4ND8A 2Y6UA 2IPMA 1FF9A 4O4JF 4QEKA 2JCBA 3ZZUA 1WPRA 4M1OA 4ISCA 5DM60 4WOBA 1IZ9A 1J99A 1PCXA 2R751 1M0WA 3JAKB 2FF7A 2QQ0A 3UJHA 3ZBUA 3PUYA 3DYIA 3QTTA 4UNIA 5I9NA 4ED9A 1GAEO 3KETA 3HU2A 3KKQA 1PJRA 1BDIA 3P9QA 2YJ5A 3CUEF 3GZ4A 2AG1A 3AIIA 2OB2A 1XQ9A 1OLXA 1JKJA 1CT9A 5MHTA 3E82A 1SXPA 5EWLB 5H68A 3BAZA 4ZV7A 2XQKA 4XZ3A 4CN9A 5HQ3B 3QEKA 1R0YA 1WJGA 3LWBA 3AVQA 2CFIA 3RROA 3I4LA 1C14A 3A26A 3RBVA 3B1ZA 5CTJA 1X1RA 3FPBA 4EGFA 3LW8A 3IMCA 2VQ6A 2BFFA 1NUSA 2XOEA 1EP3B 1E79A 4KN5A 2JEYA 5AVVA 1KRWA 4QXPA 2D3TA 1W0CA 3L8DA 1ZOOA 1QFYA 2H0RA 2KWIA 1R74A 2DH6A 3EY9A 5T6BA 3W5VA 4DQLA 3PD0A 3N0TA 4N5LA 3I4CA 4E15A 2AVDA 3CFYA 3AEYA 3SJBA 3GOHA 2ZUEA 4TKMA 1F2UB 1B26A 1NDQA 2D5CA 1E4EA 2WSLA 1NKSA 2XMGA 4RDIA 3FGNA 3VPXA 4C78A 1GU1A 4GDFA 3DUFA 5EWMB 2WOOA 1X1DA 4Z1OA 1P5RA 2PJRA 3HE3A 1BD4A 1P6UA 4LJ7A 4KR0A 3GPCA 4C3UA 3GP8A 4RIEA 3W05A 3MLEA 5IVIA 2ES4A 1CUAA 2WD7A 2X0KA 3O2NA 4KC0A 4EHDA 3FHJA 4DS3A 4KQXA 3OJFA 3CRNA 3M3PA 4HXEB 2WAMA 3A31A 4MTCA 5AJTA 3UMCA 3WLPA 1UODA 2QWXA 1GGFA 2VYQA 2JB9A 3OCCA 3VFDA 3T7IA 1A8UA 2IQIA 4X8MA 3SIRA 3WNCA 1TUIA 1Y48E 2X14A 2Y9MB 4DHEA 1Z2PX 3SG0A 4Q00A 4IP0A 2JFWA 3MTDA 1J8YF 3Q6IA 1FDWA 2XT9A 1NONA 4V2IA 4EB6B 1TZKA 1CP2A 2YWDA 4H31A 2KLHA 4CN8A 2QVXX 1ISIA 1W19A 2NPOA 4YX9A 1N3YA 5K4GA 1XAHA 2QTRA 1D9ZA 1CY8A 4HGPA 4QSMA 3VO1A 2FA9A 2ZYRA 2ZRCA 1N0IA 1VKHA 3TE7A 4MQEB 3VNBA 4R3WA 4KJXA 4P0QB 5TLSA 4RE6A 3AV3A 1IC6A 4C4YA 4JENA 1JHYA 2OZVA 2XRMA 3JQAD 3KSUA 2X9NA 4ND1A 3OHPA 3N0WA 2OHGA 1KEVA 4WINA 1T9ZA 1DWOA 2ILTA 3D0OA 3PUWA 1D6SA 4IYJA 3STUA 5ICMA 1T4CB 3AVOA 1O0BA 1IHDA 3TL2A 3IPXA 4LZZA 3KBOA 1Z2EA 4WOPA 3OTOB 1TAUA 4WZAB 3WP1B 1Z4LA 2YJZA 1RLJA 2HUNA 1RP7A 1AS3A 2FEKA 4D0SA 3C6YA 1T9KA 1WKVA 2PYIA 2P2YA 4D4IA 1XZPA 2IYVA 5F1KA 4RGYA 1B73A 2ST1A 1ZHHA 4HYYA 3BRSA 1GT6A 1BFUA 3QKRB 1AQIA 3DULA 3PU6A 3OF3A 1H05A 2ICAA 3Q2IA 1ZUD1 5IULC 5F52A 4RJ2A 1VCIA 5LBTA 1SEPA 1CS0A 1NQOA 3LGAA 1GZ3A 4MKHA 4XASA 4ZVOA 3SBEA 5BV0A 5KUTA 2WABA 1GGEA 4JASB 4PGHA 1Y0BA 3W9BA 3L1IA 4R6XA 5F3DA 2XAUA 3N0RA 1U2QA 3PYLA 1MAVA 2A0XA 1VG0B 4GLFA 2HJGA 2QV7A 2XMRA 3EVBA 3LUJA 1DXOA 1Z0IA 4OB6A 4Y2UA 1WU7A 4GUDA 1DX6A 4AICA 2AOTB 2WM2A 4MCJA 2RC5A 5FBKA 3UHPA 4D3SA 3I28A 3AM4A 4EY8A 4URVR 5J2UF 3UA3A 3B1VA 3CGGA 4OATA 3VR4A 2HTFA 3SS7X 2GD0A 3EQ2A 4G4JA 2GKSA 4M7WA 1ETHA 2VDWA 3TOXA 3D2LA 2W6JD 1T5LA 1HPLA 4DDHA 2WYUA 3OZRA 4JX9A 1GXSA 1CQZA 1KZ4A 1WVIA 4FXPA 1H2EA 1KETA 3OQ6A 5EWJB 2OPHA 3SIWA 4D6XA 4RK7A 5BYKA 2I29A 2NWQA 4O2BF 3EMDA 1M75A 5CT8A 4CDRA 1TM7E 3V8EA 5CFOA 1Z17A 3ZI0A 1V39A 1JR2A 4MMYB 4IR7A 5GAJA 4NECA 1NAHA 4HAUA 2IU4A 2XUJA 3JQBA 5H82A 5HFAA 1R0WA 3WNZA 3WTCA 5KHOC 1OXSC 2DAPA 4HG2A 2RAVA 3N8KA 5DSZA 4R84A 2QNIA 2TMKA 2LWIA 2QK4A 4QGSA 2GFIA 2IXTA 2P6MA 2W2MA 4M0PA 1Y9JA 2IDJA 4P22A 4QNMA 4QYIA 3WKBA 4Z4QA 3FKJA 4K40A 1XZGA 1H65A 1ZIDA 2QLJA 3B6MA 1T1GA 2N1BA 1VPVA 3A1NA 3BVPA 3F8SA 3IDOA 5DM0A 3TW4A 1ZNZA 5EKUA 3NUZA 3PD1A 3WZMA 2G9VA 2E7ZA 4E5VA 1E8DA 4MWEA 4MI6A 1NW3A 4MQ5A 1SXJA 1GKKA 1JQAA 4O4LA 1QVAA 3WIOA 3D8NA 1DXYA 1M2WA 1VMDA 1U1GA 1Z2NX 3AF6A 3O0DA 3D1VA 4RLFA 5MFPA 1THGA 5J4LA 3CJRA 3E5MA 5F2OA 4G5FA 5IJAA 1EUQA 3GVCA 1ZLYA 1GDHA 2XWQA 1E2GA 4GR4A 1P8JA 4R2LA 3W9UA 2L42A 3TX2A 3KM0A 3MA0A 4C6SA 2JW5A 2Q1WA 4FZJA 3U44A 3THWA 3QVTA 1LC0A 2DT5A 3A8TA 3MHPA 2FV8A 4LRYA 3OMWA 3OO1A 3C3KA 4HS4A 3LYLA 2QB5A 2I3DA 1RTKA 4KACA 3FSGA 4YRGA 3LUPA 1EU1A 4CE6A 1R16A 2DU8A 4LI0A 3WRXA 2PXCA 4TT3D 3SSAA 5BV2P 2XT0A 2I7CA 4RPCA 4K9DA 4TUYB 1J0CA 1YE5A 4PSUA 1E6LA 3SWWA 1CNMA 5AKLA 2QTBA 3O1HB 1PJBA 3RTEA 1L6IA 5KHLB 4QDOA 1DJLA 4R98A 5EIAA 2D5IA 3D7MA 1I32A 3LPAA 1NW5A 5DH9A 1QU3A 3PC2A 5E95A 2PSEA 2NYRA 1M1ZA 4HSGA 1PNRA 5ED0A 1YULA 3I45A 4JFAA 4EENA 4EEKA 2QJWA 2BF7A 1CUEA 4N18A 4QPJC 4U4AA 3VU1A 2YBDA 5K5EA 1N32B 1IEXA 4M76B 3KFLA 2Q3BA 3OT1A 2WWYA 1I2ZA 1PR0A 2KBFA 2R00A 3CT4A 3TRHA 3ONFA 4HYEA 5E4JA 3WG9A 5F4BA 2RGCA 4TPKA 4MUEA 5FORA 4MYCA 5TDHA 3CMCO 3QNWA 3RLFA 1JFVA 1TMGE 1XEXB 3JQRA 4E6PA 1JHMA 3RVLA 4EABA 4TQUS 3BHIA 3A28A 3IUMA 1RJDA 2AN9A 2BJVA 4V0LA 4BQRA 3FZEA 4CV3A 3PHIA 2R8RA 3GJZA 4KKVA 4AKEA 1WSAA 2BFCB 4N54A 3D4PA 3P97A 4OU5A 2PWAA 5IU6A 1SPBS 1BE1A 2OCXA 1G7RA 2OORC 2PT6A 1ZRHA 3C24A 3OX1A 4MV6A 4QA9A 1ZUIA 4W5HA 1S2DA 3AVWA 2ANBA 4XIGS 4BVFA 1RMYA 2BI7A 3REOA 4X1IB 5JG7A 5KX5B 1X9GA 3G49A 5BWLA 1BX3A 2HXGA 3QFSA 1QP8A 2A58A 3D6NB 4Q6WA 3EZXA 2GJKA 3BIFA 3TXXA 4AJIA 1U5BA 5SZJA 4XCXA 2CJWB 4ZOCA 2QRHA 1SVLA 1U11A 4F0JA 5IT5A 3IBGA 5KSYA 4ZT4A 3U7FB 1BWSA 1ZPDA 4IJUA 4QXAA 1K92A 2I71A 3THWB 3VNUA 3OHSX 1DEOA 3CX8A 2V7VA 2WU3A 3TGPA 2OZLA 2FRVA 4HPXB 1WA5A 1MJFA 1JS1X 1NGSA 2P62A 2Q5EA 3HB9A 5INTA 4IIYA 1D2AA 1FNBA 4AAYA 5G02A 6PFKA 1EWRA 3ZX4A 2A35A 4FOTA 3HVUA 1VYHA 1GR0A 1KMHB 5JZSA 1EVYA 3CW8X 1OAKA 2DUNA 2DX7A 4ZAGA 2XW6A 3BGDA 5K99A 3QXXA 1YFLA 3R3ZA 4HADA 3OVMA 3IDFA 2WKPA 5BQ3A 5JC1A 4M1MA 4G1EB 5BOSB 2CFRA 1TTPB 5K51A 4ITRC 3D0QA 1BZYA 1D7OA 2ZJYA 3ACCA 4IBOA 3ZDXB 1QB7A 1CUCA 1L2TA 1M7HA 3BD9A 5EIXA 1OXUA 2BHNA 2BL4A 1C0LA 2VYCA 4BAUA 4CMHA 2JH3A 4RQTA 4OHPA 4B85A 3L6CA 5DOZA 1WPQA 4J0JA 5AUQA 4GBGA 1AC5A 1V35A 3GUHA 4I8IA 5IN5A 3VC1A 4UUMA 2CXXA 2CJYA 4XM2A 4EK9A 1AS0A 3KCQA 3LX6A 3Q40A 1TVMA 4JYPA 3ZIDA 4EMTA 4ACAA 2FDCA 5JH7B 2YICA 1S2IA 4GOKA 1SU6A 2DKNA 2C88A 5HXAA 1FJXA 1ARZA 1GSIA 3RKSA 3WLMA 1T34A 4JP2A 3OQBA 5TPWB 4L27A 1FP6A 2C8VA 2JRCA 2IHYA 4GZMA 4BQQA 1NFQA 2I54A 5CT6A 3ORQA 5IT0A 1I2DA 5JH7F 5M3BA 4W5QA 2JCSA 3BL5A 4JU9A 5BO5A 5HDBB 2Z04A 3HKBB 2A1IA 3AFMA 3HSKA 5DWQA 2HL6A 2QORA 3NGXA 1EBBA 3TQTA 3IFSA 4LJLA 3IT0A 5A0FA 2NX2A 1YC5A 5D8DA 5IM5A 5BMOA 4GMFA 4HTAA 1T2NA 3NM4A 1U0LA 3W0LB 1SH7A 3DF7A 2HHHB 1HYGA 3TBHA 1NR1A 1DEXA 3I04A 1LSJA 2XB9A 3AQ4A 3KNZA 1ECCA 4NQZA 4CUZA 1UFVA 1JG3A 5FLEX 4ASUA 5BSGA 2PT9A 5EMMA 1DTEA 3H42B 1HXHA 2CZCA 1L7PA 5DN9A 5FCDA 2F59A 2CUKA 5CFRA 2Z8YM 1H0HA 2BBWA 1N2EA 3FNBA 1QORA 1S3FA 1TT7A 2MSLA 2OXFA 3H5RA 4I81A 1L5HA 3GJYA 5LMUB 2IWHA 1DMSA 4JOBA 3RS5A 1TW3A 2PU7A 4G5SA 4JZYA 4F6RA 1TCCA 1EG2A 4GI1A 4KXFB 3E1GA 2Q49A 4N7MA 4QUAA 1PEAA 4TL9A 4Z2YA 1UJ5A 3UMMA 4GL2A 4CMJA 2YFKA 3JRXA 4TMZA 3T3DA 3V80A 3A1VA 3H5OA 4WZAE 3SLGA 1I14A 5IRCD 5CT4A 1HA3A 4RHTA 4ZZIA 5KYKA 4A1FA 1PP4A 1FIUA 5AM4A 1YV9A 1I0ZA 1RWWA 4KVGA 4E22A 1VBMA 1YCHA 5REQB 5TVKA 4DIKA 1N75A 1HOTA 4D8YA 2AZ4A 3EXEA 2F43A 1M9NA 3QKRA 4P83A 1K8YB 2IZ5A 4Z9FA 3SKVA 4CM4B 4F4HA 3UAZA 1XEFA 2PUJA 3EZ2A 3JZAA 1Y4AE 4GPBA 4WWHA 4URFA 3AIOA 4DLYA 4HUQA 3ROQA 3DOCA 3PGMA 2Q21A 3GL9A 1V3QE 4WEQA 1W5FA 2I9PA 3CRVA 1W2WB 4MUBA 2I1LA 5TGDA 2KJQA 2UV8A 4YCSA 4HWOA 3KFVA 1LI7A 3E3OA 2WMNB 1BGXT 1EJ0A 2ZYAA 1P6XA 4YJFA 4NKRA 2XDQB 5CLLA 1KAOA 3T12A 1FXWF 3DVSX 1JGTA 2X8WA 1JB9A 1P1KA 2FUNB 5IKPA 2KE5A 5DLQC 2PZBA 1WTCA 3UJNA 2XBUA 1GL7A 5LD2C 1EXWA 2ADOA 3AKDA 4HB3A 3HG7A 4OI0A 4KWIA 4CKXA 2XGSA 4IIBA 4OMFG 3GHHA 2DWOA 3UOWA 4DIBA 1ZJYA 1KFJB 3T9CA 3IQEA 3GR6A 4M0LA 5L40A 2VAWA 3RTAA 4IG4A 3TPCA 3LDHA 1QYDA 5I51A 4AMBA 2C00A 1BMDA 1G6OA 1K7SN 1UPFA 4UEQA 4P7KA 3KJIA 4JT9A 4BGEA 1EFCA 1OROA 1G3RA 2NZYA 1KZYC 2DHQA 3CKLA 2AN1A 3NHBA 1AUPA 3GFSA 1CERA 3WKDA 3K71B 3FBWA 3MJSA 5DBHX 1BWRA 5JQGF 2AKEA 1LX7A 1GTL1 2A1UB 2HNKA 4HMPA 4AG3A 4D9MA 5M04A 3JTMA 1WB6A 1YIAA 4BNVA 2R4QA 5DHAA 1FSGA 1XZIA 5EIHA 2X3YA 3KZNA 3NT4A 3OY2A 3U4IA 4GMXA 4TXLA 4XJSA 2EZ8A 3U26A 3WFZA 3QU7A 4W4TA 2OA0A 2ZATA 3IVCA 1OWLA 1RMQA 1YI0A 2XXJA 2ZVJA 1R0KA 3D8BA 3PPXA 1WEKA 3U1VA 2WRZA 2FPWA 1NU6A 5DEIA 3G5AA 3AHDA 5A4KA 1RPJA 4QG7A 3BQMB 1XB2A 1C4XA 4ZVSA 4O2RA 1ORDA 2GZ3A 4MB6A 4B44A 4CQLA 4MRVA 3WS7A 3HVHA 5BVGA 3L9XA 4U7TB 3NNSA 4ZQCB 2IBTA 3V8BA 2CEKA 3IOMA 5HOQA 3MGGA 2YS7A 1J5PA 4DKXA 5JD5A 1CJVC 2O3SA 3GROA 1M6VB 3LPMA 3PUJA 1G41A 1GCIA 1BEZA 4E31A 1HETA 2IY8A 4L08A 4HPJB 4DFDA 3HDTA 5DN6D 2VCEA 4MS4B 2AOTA 4OQDA 4V0NA 2ZKLA 2A8YA 2OO3A 4YGXB 3DTVD 3AX6A 3H04A 1MEJA 2RBEA 5GJVC 2BR3A 1SCUA 3B6ZA 1GQOA 4L28A 4UATA 2O2GA 4BFSA 4QGBA 2BFEB 3OKFA 4EP1A 4ARZB 1RJFA 4N65A 2GEKA 3FD8A 3B2EA 1N92A 1SHZA 1TJNA 3D64A 3G0DA 4FBGA 2KQUA 4IILA 4YRRA 3RK1A 1EBFA 2LVBA 3D7SA 1K3UB 4M7OA 1G5RA 1Z83A 3U16A 2J9GA 3NIFB 5GPBA 4IQ4A 3H9UA 4YC7A 5K8JB 2IUSA 3AHJA 3QI7A 4LE0A 5A9TA 3ITDA 5BWOA 3AFHA 3G5TA 4QX6A 2DPGA 5H9VA 4GHWA 3NXKA 4DDUA 4L6CA 3R3JA 4B48A 4ZPXA 3M2TA 3BXEA 2EFEB 2HREA 4PRYA 4EJSC 3UB4A 1MXHA 1RRGA 1XX6A 1JIKA 2WT9A 4K9SA 4QHTA 5BQPA 2A1TS 5FNVF 2AKYA 5MGBA 1ONPA 1E1NA 1VLJA 2G0TA 3G6KA 4BEJA 3NAGA 1G291 2GRUA 1A4UA 1GGKA 4RPLA 4S2EA 3WWDA 5KPDA 3O3CA 4DY6A 2VBIA 1OH5A 5EPEA 1VPEA 1FVHA 3SOZA 1UPXA 3OLCX 3FYUB 3VR2D 1NJ2A 4WD3A 3GLRA 2Q8PA 1KGSA 1W52X 5EIFA 2X15A 1MW8X 2O59A 2YX1A 1J2YA 2ZTLA 4GM4A 4RVSA 4ABYA 4IVRA 5HK8A 1AZWA 4CMEA 1JUDA 1DHTA 1F38A 2E4WA 3FR7A 3U7JA 1R0XA 1EFRD 1XMSA 4K6HA 1PE0A 5SZKB 3ZQ6A 2AGVA 5L3QB 1DKRA 2B82A 2ZIXA 3TMYA 4YP5A 2ZKIA 5KOJB 3CPJB 2OP1A 4Y8VA 3C45A 2CVFA 2QVGA 1E2KA 2AN4A 3SLKA 3R24A 2R96A 1YFKA 3TLZA 2OYSA 3PQ4A 5DCYA 3O7WA 1XTIA 3WWEA 3ZY6A 1PG5A 1RM3A 1XJWA 1J39A 2KHZA 4I6JA 2EP7A 4ER6A 3OA2A 1IMJA 2W70A 3RAGA 5ANRB 1JIJA 3WYGA 2OXTA 3WQRA 3L4JA 3A7EA 1KI3A 4RJKA 3DDZX 3REQB 2A9KA 1Z33A 1ZC3A 4H08A 3M81A 4AXXA 4IL5A 2B5WA 1XO1A 2PRSA 3F71A 5AJUA 1O0CA 1ZK2A 2GUWA 4KIGA 5DTIA 2DKOA 3EOAI 4Q37A 3RJZA 1C3VA 2ECPA 1RI3A 4XRGA 5B1EA 1AHPA 1ISPA 4OX9B 1IEWA 5DYWA 5I6DA 2PHZA 2C2XA 3OZBA 4FGSA 2Z6QA 1OV4A 2J67A 3O1IC 4BRSA 4TSFA 3HZRA 1P5ZB 3RVSA 1IN6A 3M9XA 4LWQA 4BNHA 1X7XA 4M4SA 2IU0A 2V0CA 4O4LF 4TM8A 3NWOA 3WK5A 2WUWE 5DW3A 1YA6A 3LC0A 2H16A 4XDGA 2EHDA 3DEYX 1SVIA 1JFLA 2FN7A 3NQ41 2NYVA 3UAWA 4CQMA 1J2UA 3O8CA 1Q17A 1U9CA 3OIFA 5KQPA 2ORED 3OEWA 4P81A 3IHWA 4PC2A 1U4OA 1XMPA 4Y6QA 3TE6A 2QP3A 2XSZD 1X0XA 1A5ZA 3EIXA 5BSRA 4JC5A 1JV2B 4IHQA 1UP7A 1NW7A 5EPOA 4E2WA 4EI2A 5FTMA 3RUAA 7YASA 1P29A 4KPFC 1PDVA 4G26A 1UH5A 4LDQA 5LA6F 3RRMA 1F48A 4OOFA 5AKXA 2HRDA 2DPLA 4YASA 1N4AA 4A0QA 3GLFE 1G5FA 3SC2B 3TKLA 4JVMA 4LMRA 1OX4A 4OHXA 5KQRA 1ZM9A 3ITEA 1B8NA 4GX1A 3TQIA 5I3CA 5KJEA 5K0GA 1PT7A 1RE1A 1DAHA 2B7CA 4H4DA 4M0MA 1SBTA 4NCXA 4X8OA 3ZD8A 3EVAA 3H1BA 4D8UA 3KSRA 3JQFC 3QH4A 3EXG1 3X43A 1XAIA 3DYBA 2WSBA 3PXBA 4ERXA 5K45A 2HIGA 2Z6UA 1U1EA 4OFWA 3ADOA 2UYHA 3RCBA 3MJRA 2EZTA 1FPMA 2PXAA 1DS6A 4PAGA 5IP5A 4CPDA 4CIWA 3A0RB 3DHNA 1D4ZA 4IQGA 1UDRA 4R0VA 1H2ZA 1USWA 1DFGA 1XSEA 3P9CA 3R7WA 1BROA 4A0GA 2YASA 4V38A 3OZTA 3CEMA 3TRKA 3I6ZA 1BQEA 4Z53A 2VG8A 2G0NA 1W49A 3S2ZA 4RHXA 3F7MA 4ZVMA 2H11A 4O1MA 4H18A 3AK4A 5CCEA 3BTVA 3K8OE 4PR0A 4YALA 1EK5A 2Q0SA 1LF5A 1UBMS 4MUNA 4UZEA 3SX4A 5DBIA 5BNIA 5JIBA 2I7DA 1XVLA 3DJFA 2PSSA 3G9TA 1EFUA 4IO1A 2WICA 1K8QA 2FFAA 1WXHA 3B36A 2REBA 1TF7A 1V5IA 2VL7A 1QANA 4N5HX 4S1NA 4EHAA 1Q7CA 2GKGA 3FZNA 3S7TA 4Q9AA 1VIYA 4R2MA 4ODIA 4C3OB 3LT0A 1V0JA 1QH1B 4UNPA 2RMKA 3M0EA 3MQ2A 4C0BA 3HL0A 5DCUA 1RAFA 3AI1A 3DF9A 4G5YA 4IHKA 2Y1OA 1J8FA 1E5LA 1G98A 1JYEA 2AG5A 2PRYA 2V7BA 2WTXA 3BAFA 3QPUA 2C29D 2DPYA 1BU5A 1ZHFA 5A3VA 5JJKA 1YJCA 3VZCA 1H3EA 3KYDB 1SUBA 2QN8A 5KTSA 1WV0A 4KN9S 2XUGA 1KZ7B 3FOCA 3JQ7B 4XGRA 4WPGA 1S8OA 1VRWA 3KHSA 4QO7A 4KHZA 5LJLA 3A1EA 2BTQA 2GVZC 2R47A 5KB3A 3VPFA 2IYLD 1JLSA 1V5GA 2VPQA 3MNFA 4K2HA 4XH9B 1M2HA 2NZJA 3BE5A 1IJBA 3BBPA 3WAKA 7ABPA 3SZRA 3U4HA 1AKMA 1DQRA 4EYEA 4KVZA 1T1IA 4QYMA 1G21A 4ECEA 4R0MA 5FUWA 3N0XA 1BHO1 3KQMA 2FSPA 4BP1A 1K88A 3VR3D 2GZ2A 5COBA 3UJBA 2J46A 1Z5GA 2M2IA 3LMKA 4MDHA 1NBMD 1Q83A 2QL5A 3L5OA 3L8MA 3MIIA 5ERYA 1RHRA 1Z5OA 4UAGA 2QUZA 4R1OA 1KJ9A 1M6NA 2NO6A 1PGNA 3PDWA 3K5IA 3MMNA 3WHIA 1YAHA 1G21B 1NV8A 2A5LA 3DO6A 3MMZA 3ER9A 4R8KA 1M8KA 2HMVA 4KP7A 5J43A 4ON9A 1NN0A 5ES3A 4S12A 3TUJC 1KS9A 3I62A 1UJNA 5TPZA 4MJ7A 4GBED 4YT8A 2KS6A 5KNCA 3RSQA 2ZS8A 1QM5A 3UT6A 4DIMA 2BLNA 2YN0A 4CDNA 1K8XB 2IE8A 3JQ8B 5DPMA 2UUBB 4PTLA 2G72A 4W1PA 4EHIA 3MJHA 3EUWA 3MJEA 2FKNA 4Q48A 1F8YA 4ZDJA 3ST7A 3H9EO 1QF9A 4LV8B 2QAGC 2J4CA 3K0FA 3A6PC 3VNVA 3H2YA 3QV1A 3W78A 1VECA 4HH1A 3E9ZA 1QH8B 4MV0A 4DV3B 1N1DA 4LNUB 1L4NA 1D2MA 4HDSB 5PNTA 1QH1A 1VSVA 3X3HA 4EW2A 4B3SB 3HBMA 4DLRA 2H0QA 1D7AA 2GA9A 2P3QA 3PXEA 4X5OA 1EMDA 2HU2A 4TTSA 8LDHA 3K35A 1FLVA 2QSYA 3B7PA 3DOHA 3FCUB 1P9LA 3MWLA 4F6CA 1NSYA 2OWEA 4IDNA 3P9YA 1PUJA 3PENA 4H60A 4JUCA 2ZR8A 1J07A 1SUFA 2Q5OA 3FYSA 1TLLA 3L7IA 3F6PA 1C7EA 1NUPA 1V48A 2HMSA 2VF7A 4R3UC 4WADA 1IONA 2DFVA 4MKFA 4WHMA 4YBRA 4D41A 1DFIA 4EO4A 4MKZA 1DC8A 1R1DA 2Z9BA 4P7GA 3AUUA 3RW9A 3ZD6A 3H7IA 5JHHB 2ZG6A 3HJNA 2WILA 1N2OA 4KXUA 5FT9A 5K8VA 3V9PA 2K7ZA 3QVUA 3O75A 3F96A 4AF8A 4NXMB 1TQ2A 3R3SA 5D00A 3CNQS 2XUKA 4JN6B 3KOXA 1CJKC 3QYPA 4V2UA 3GLTA 4MB0A 2WFMA 4GD3Q 1OLUA 3L7JA 3PWZA 4BDTA 4C21A 3ADKA 5TIIA 1QLHA 2WSMA 1FTYA 3FSRA 5ILQA 5CB4B 4UM9B 1Z08A 3GNTA 2A1UA 1OBFO 1PJAA 2DWQA 2HWKA 2FWAA 4EYKA 2E89A 4DLXA 5ENZA 5KHAA 5HHTA 1NXXA 3LWZA 2F55A 2Z2YA 2QENA 2BGRA 1U8FO 4PCVA 5FPQA 5EVCA 3U09A 1Y1RA 1GXSB 3QUTA 4ND4A 1NNLA 3FPJA 1NMXA 4UHDA 4WNAB 1DVRA 1WZCA 4Q19A 3V48A 4F11A 4AP9A 2YZ2A 3CUUA 1WDKA 4FTWA 3RANA 1IBMB 2PUTA 1F0PA 1XD8A 1XN4A 2BMFA 2I1QA 2Y27A 2VHYA 3P0HA 3KAJA 3RBXA 4OX9Y 4JA2A 3PEFA 4HX2A 5GADl 5FL3A 3OPQA 3AZPA 4MPRA 4LC1A 2Y1LA 3G17A 3QU2A 4JR2A 4YWHA 4A0SA 4DANA 1HNWB 3H5TA 2FSSA 2J33A 5E2BA 4KGDA 2F67A 1QQTA 3H2JA 1SK9A 4HQNA 1VE9A 2CVQA 5JPCA 1ZA1A 2OZPA 4AMZA 4IF4A 1H4VB 2CNBA 3C1UA 1F3OA 4HAZA 4JIMA 2OMKA 3BK2A 5AJHA 3WSWA 3BXGA 1W5BA 1E8NA 1RC0A 2WTAA 3H2KA 4W7SA 1JQ3A 2XE7A 1F60A 1WCWA 3JALA 3K1TA 3X1DA 3K53A 2C0CA 1WDTA 3DT6A 1NV9A 4M1QA 3TRFA 4ENPA 4QDTA 2ZBEA 5JNUA 4IUDS 2NXNA 2AFIA 2FQYA 3AJDA 3Q0IA 1A8SA 3MD0A 3EVCA 1PBNA 1M10A 2EX4A 2YXPX 2EGUA 4GOLD 1KEKA 1TX4B 3H0KA 5EZYA 3W2IA 3LP5A 3WRWA 3WRYC 5KEIA 1FMJA 4HVCA 2IYFA 1ZSYA 4MWSA 1V8PA 1DRVA 1H0SA 2QTFA 3DKIA 4MHTA 4JAVC 2F3TA 4KSYA 5EJAA 1JSLA 1QFXA 1EGAA 1Z18A 2MMGA 3G9UA 1K97A 1RKQA 2CLCX 4IOKA 4LE2A 4PYQA 4KX3A 3T6KA 1CRPA 4JY7A 2QT9A 4C7JA 5P8WA 1GNSA 1J0DA 1MQ8B 4CKEB 3WMGA 1X2BA 2YWXA 4NOLA 3HUTA 3TLJA 1IM5A 2NYAA 2IC5A 3N7AA 1MOPA 1G20A 4B3DA 2X6RA 4CMBA 3I0NA 3UV3A 4FCWA 5DYIA 1SVSA 2PGNA 1JR3A 4AUKA 4A15A 3OKAA 2XUAA 3N8HA 4J75A 2OFWA 2CXHA 3PXAA 1VJ1A 2IS1A 3E9MA 1SWVA 2UUOA 4HZUB 2PSDA 3K9FC 1U0NA 5EGNA 5J2UA 1OHHD 3KT8A 1Q44A 1DAEA 4MINA 2ATXA 1I3KA 1R0BA 3Q8KA 1NVAA 4OCZA 1CR4A 1XZKA 3SSNA 1PT9A 4ITVA 3ZR4B 4OA8A 4ZD6A 1K7FB 1KQGA 2P9JA 1W29A 4NE7A 4LYAA 2PEYA 4WESB 1S4QA 3ZHCA 2WINI 3CPHA 2V65A 5I7OA 1JHAA 1RHQA 1SCQA 4HZUA 4GYJA 4KZPA 2NQTA 2Z95A 1GZ5A 4K87A 1UXJA 2VZLA 1C4WA 3AI7A 3VR4H 4JJIA 4IJKA 2BRUA 1JAZA 1R50A 5FWYA 4ETIA 2WIDA 1E3EA 4EHNA 3I04M 4EDFA 4JQOA 2QY6A 4TOIA 5CDFA 5IKMA 3WRVA 1W4AA 3FWZA 4URWR 8OHMA 3VH2A 1I36A 4CI0B 1JFFB 2P3LA 4U5QA 1F7VA 4NJEA 1EHYA 1ULTA 4OM8A 4LA4A 1ZAKA 3MOIA 2YJ6A 2X8AA 3ESYA 3RVOA 4DV6B 1DAMA 2J0SA 2GCNA 3H0CA 4HNQA 1ECFA 3TSWA 3TXYA 4IXMA 3P8ZA 1I6WA 4Q3KA 5JYBA 1QP7A 3HM2A 2C92A 4YMLA 1XTTA 2BJHA 3DTVA 3GIWA 1SKMA 2F90A 4FHFA 1OC4A 5GJWC 3D6TB 1MQAA 3I1FA 4CETA 3WK9A 5AOBA 2Z1MA 3WFIA 3TH5A 3FYUC 3EGCA 2VNSA 4BY9E 1EIWA 5K3CA 2A6PA 1BDMA 2DLCX 2PGIA 4UVIA 4QJ3A 3JS5A 4ALKA 1DV2A 5KCZA 4BNXA 3LK6A 4FGKA 2B69A 2OHXA 2WOJA 3W9YA 1CY1A 1UMBA 4IIUA 5KSZA 1U3UA 3E9DA 3MXTA 4WQMA 3FKSA 3WKCA 2P5TB 2QS9A 2FMTA 3VI4B 4Y1GA 2G09A 2AL7A 2WD8A 2Z5FA 2ET6A 1PSZA 1CNFA 1GUDA 2YXBA 1ZZGA 2OLJA 4ICIA 1UIMA 2FSVA 3OQVA 5DNCA 3WNQA 4Z54A 4UDNA 5AM0A 2V97A 3ROFA 4FD2A 5BOVA 2QGNA 1DKMA 1U0FA 5JSKA 3EUAA 3VHLB 1ZR2A 1NPYA 5BUZA 3THXB 2ZDQA 2Z30A 5LQNA 1C1XB 5I8WA 1HLGA 1FSPA 4ID9A 5IEBA 3OQJA 3CH7A 4J76A 2Q5LA 3LCMA 4NBNA 4J7XA 1CF9A 1RIFA 3VU3A 2OO7A 2Y1CA 3QF7A 2CBGA 4R8LA 2BUCA 4X91A 1EWQA 3HACA 4FYWA 5IC5A 5JCXA 3KKZA 5C51B 1XZLA 4E14A 1JQ5A 1KI8A 2P3SA 4UXIA 1QFJA 3RHSA 5IFLA 5AKZA 1F0YA 5TY0A 4EQ6A 4YJ2B 1MO3A 4W5JA 2Q5IA 3QG1A 1HI9A 2N75A 2ZJAA 3L7LA 3O93A 5D5HA 1UBOS 3DG9A 3TAXA 3LHFA 3TOSA 5LB2A 2WSSA 1JAHA 1P0QA 1UP6A 4IH4A 4KO4S 2GZDA 3RYTC 4QAQA 1X7WA 4OUDA 1BN6A 3KG2A 1JE0A 5FI0B 5FLYA 1ZM2A 5KAMA 1UM9A 1N2CB 1VL0A 3T7KA 3FOFC 1TGVA 4Z4EA 3DZDA 2H3HA 4P93A 4TMKA 3PF8A 3IPRA 4KQJA 4YJFB 4B4UA 4DV2B 4J3NA 2QRMA 4H7DA 2BMDA 2J9FA 3GGGA 4ZXFA 1LJ8A 4RV9A 4JI0B 1AQYA 4S1PA 1L3BA 1Q7TA 4GEKA 3ZH9B 2CV0A 3OPYA 5J2TA 3M1AA 4N0QA 1I3OA 4FMPA 1TMKA 1J56A 2XRYA 3NT5A 3QKIA 4EYGA 2AVNA 2QU8A 2F3SA 2P9ZA 3NKLA 1QGDA 3TSYA 3FNFA 4F6RB 1DEKA 1LDYA 2R8BA 4RTJA 1IY0A 3IP8A 1DLIA 2VTVA 2AQIA 2PJZA 1I24A 3JWGA 1MO6A 2V6GA 2R8ZA 1G59A 2R7AA 4J0HA 5JYEA 4WFJA 3MILA 3HCNA 2A7XA 1K5GA 2B92A 4U9HS 5IF9A 3ZX5A 5J47A 4I55F 3H6HA 3TDMA 3RFCA 4DBZA 1EDBA 2AN5A 1XFDA 2O2JA 2VDOB 1GLGA 5JAUA 2JVKA 3NHSA 1ULSA 1U65A 3EXIA 1U2ZA 3F5MA 4HS9A 1X6VA 4FI3C 4DMGA 4F3RA 4ZU6X 1F8UA 1WSBA 1RQNA 4J7AA 3JATB 3G9QA 3M1IA 4HDQB 3ZHTA 5JAPA 2AKAB 2XQJA 3WLKX 4G0UA 3VHXB 1XJCA 2OGZA 3AVUA 1T91A 3GUYA 4HGQA 3BF8A 2G17A 3NATA 3Q5DA 4ER3A 3DE0X 3OJXA 4RBNA 4BN4A 1EUYA 3KQLA 5EIWA 1LLQA 3I2YX 5LP1A 4MRSA 1JNXX 1XE3A 4KPUA 4KN8A 4ZCSA 2PZAA 4QEZA 3GVIA 1T3ZA 2CKMA 1NA5A 1E2EA 3PRKE 3ZW9A 2IS6A 1YI8A 2KW5A 2W4QA 2FP3A 4ML3A 3ZVMA 4OHYA 3RUCA 1N7HA 5K3EA 4RD6A 4ZCQA 4FZRA 4KH1A 1J09A 3RF6A 2BEWB 2WT4A 3IGFA 2QQGA 2PWYA 3ICCA 2BBSA 3EPRA 4DWJA 2ZZNA 4M9ZA 3IBSA 1JG1A 1NVXQ 3DHYA 5B3LA 3LUCA 1YZFA 3KXLA 4OYLA 3D6MA 3F97A 2YQZA 4KTVE 4G5OA 1U8EA 4QJIA 1EFLA 3I9JA 1OTHA 3ET5A 3IT2A 1L7MA 3Q3EA 2OILA 3ANYB 1TCAA 4FWTA 2HDWA 4BMVA 1QAMA 1T5DX 3K72B 3R6GA 4JJGA 4Y67A 3ZPXA 1B6TA 2A94A 2HM7A 4FSDA 3DDSA 3IERA 4JBWA 2YZMA 2AOVA 3IPLA 3PX3A 1NW4A 2ZAGA 3KLMX 4JROA 4PZUA 5JZ9A 5HKOA 3DO5A 2PS0A 4DJDC 3VISA 3LFTA 3OT4A 3EEQA 2R6FA 4YT4A 5CA0B 1VPLA 3ZWAA 1PYOA 3RBAA 4LG1A 2LIPA 4ATNA 4BKQA 4QDZA 1KOJA 4HT3B 4UHCA 5I48A 4LHSA 3MMPA 4J1TC 2P4SA 1GEEA 4U39A 3GQBB 1DDIA 4Q4JA 4XGNA 2HPZA 3ELBA 4Q1DA 5GOTA 5GWXA 1IBLB 3A6ZA 3FLEA 4JJ7A 3HYRA 1D5WA 1CR0A 2R1TA 3H4TA 4JX8A 4OLBA 4JDUA 4JT4A 1N2JA 1U0EA 3EEBA 2HWYA 4J94A 3TECE 1ENYA 4O33A 3UYKA 3FTEA 1N1EA 5AW2A 2DP4E 4BZZA 1PBTA 3IO5A 3IOEA 4RWEA 2VQSA 4JGGA 4GOXA 3VR0A 4AIIA 3T38A 3VZDA 1LFDB 4EVSA 2ECFA 1I30A 1PJTA 1R6BX 1T8UA 1JH8A 1KAEA 4EMUA 3NBUA 4K1XA 1QYXA 4A6PA 4A8TA 2FOXA 1UDWA 3VA7A 1N8KA 4XIFA 4I50B 5LLSA 4QFCA 3AVYA 2CUNA 4V0MA 2O2IA 4PZAA 4R83A 1TDJA 3L0ZA 1ECPA 2ZLBA 3PKIA 4Z0PA 2ENWA 5ADHA 2BFEA 1XWFA 1Y1SA 4N47A 4QDXA 4HDRB 1QE3A 4E70A 2GQ0A 3LQQA 3DV0B 3UJPA 3IV7A 3D8TA 4YP7A 1FVOA 3BZUA 1II8A 2C2KA 2IUYA 3MSCA 5IARA 3ZOKA 4MVJP 1ZD3A 4G9BA 1JHDA 4KUEA 3DE1X 3EAQA 4L5AA 2FPLA 1TZMA 4K81B 4DCTA 1OXXK 4JYCA 1GDTA 2NP6A 5C4MA 5HM8A 3H3XA 5EIBC 1EJ6A 2O7VA 3KR0A 4WFQA 1P2BA 3DEFA 3TQOA 3VBEA 4CF7A 2QIOA 4ZO8A 3GFBA 2ETXA 3IYLW 3T35A 2QTZA 4Z9AA 1IPFA 4O2BA 2ROQA 4B45A 4F97A 4JI8B 1NMYA 4B73A 2N1MA 1T8WA 1X7XB 2ARKA 2JH9A 4KLCA 4MUJA 4AKTA 4BXOA 3X1XA 3ZUPA 5AK5A 3R7AA 1I7PA 4IGFA 5EP3A 3AL0C 3LVQE 2HWUA 2IHUA 1M8FA 4AIRA 5I7SA 1TKCA 2RC6A 2XTNA 3ZE1B 1NJ6A 3DVRX 5HW0A 2GVNA 4OXNA 2REOA 1C3OB 1CZNA 4EL0A 3EMKA 3L1VA 4V02A 2GM4A 2Y0CA 2VUUA 4YA6A 3WDSA 3KQVA 4G1CA 1TQDA 1KRHA 2JGKA 4V24A 4NYIQ 3WWOA 3OKCA 3AG6A 3LYHA 3MUEA 3A3KA 2D13A 5FJJA 1ID1A 3BA1A 4LRQA 3QLJA 1I1OA 2Z5LA 2QGZA 3Q5EA 4GS5A 4O4IA 4MQ6A 3T9BA 2H1WA 1LLUA 4WJKB 1KH2A 1JMVA 3PNBA 4DCGA 3OM8A 2IA5A 2XKBA 4HNHA 3T1HB 4LMPA 1E98A 4LY9A 2PBRA 3G1WA 1SC4A 2I66A 3FSGD 4JCCA 3L07A 2YUTA 2Z2KA 7MDHA 3TN7A 1AQ6A 3SSMA 1XJ0A 3WB2A 2C2YA 4JBIA 5KOHA 1ONOA 1XMXA 2ZIGA 3C98A 1H5QA 3KUXA 4BUJA 3NTVA 3S2YA 3T1OA 3QPCA 3WQQA 2PZ8A 4L51A 4QNRA 4DYDA 2GPYA 2HSWA 3BXOA 4KR3A 5AI5A 4IHJF 1Q14A 2NOAA 2WUVA 5ALIA 3UEOA 2XOXA 4G09A 5IBCA 4GOND 1H42A 3BFJA 4DBVO 5U1PA 4HDOB 3HYCA 4PLYA 4B31A 4WOKA 1QJ4A 2FRDC 3FG9A 1Y6FA 4UOQA 1GFZA 1TECE 4JLMA 3ENZA 1ID8A 1MAAA 1A7UA 2G5GX 2QRPA 1ZNYA 1FUIA 2TMDA 4IHJB 1TMYA 3K1ZA 5CLHA 3HN7A 3NX4A 5TS3A 5AFSA 1H9BA 4NCIA 1O08A 3EXEB 4CM5A 2FK7A 3CWCA 1BKDR 1S02A 4K9RA 4MVJM 4JJEA 3D8RA 4HQLA 1XLTC 3ND8A 1Z6GA 2FE1A 3FTPA 5CFZA 1C5KA 4UU1A 1DIAA 4O29A 5FTWA 1CUGA 2NU8A 4YAOA 4KK4A 1ZIOA 4F5ZA 2FPMA 3HABA 2BRUC 1NNSA 1XMVA 1ANKA 2VHQA 5IF3A 2PUFA 4NEQA 4WOJA 4K6FA 1BQ4A 2VQ3A 2JAHA 3A10A 2P9GA 4P32A 1UXHA 1ECGA 3H11A 4I08A 2CYAA 1V4VA 3D1JA 4IGKA 3RC2A 5C7OO 4ZEMA 4G67A 2HMAA 3A06A 2OECA 3HI4A 3O8QB 2F3RA 4YJ3F 3BMCB 4BNNA 5BN3B 1ELOA 5H3HA 2IEIA 1WP4A 1WSDA 2MMCA 4OP3A 4N8DA 3Q7IA 2G9UA 4X6XA 4QICA 5G0TA 2Y2VA 3TX6A 2AFIE 3U9TA 1ZZEA 3T5MA 3LC1O 1ZOIA 1Q0ZA 1KKLA 1EFHA 1L8OA 3H6GA 4GPIB 4NV3A 1XXHA 2PGDA 1UQTA 2G71A 3OIUA 1KJZA 1Y9AA 4ZVRA 4D74A 2GLXA 5C5EA 2ZJ7A 3DEHA 5FEMA 3HKBA 2X42A 4RYDA 2WAYA 4ARIA 1WEHA 4DDTA 3BM5A 1JKIA 3D3QA 3S1LA 4LDNA 4RZUA 1Q7EA 3GWGA 3OOHA 1Z5NA 4Q7QA 3CUWA 3CLSC 4F8YA 2XNDD 1ZEJA 1UEXC 2EOAA 3JD0A 4UUNA 5L4NA 2RHCA 4IDDA 3BQNB 1FTQA 5KYWA 2JEZA 2QX9A 4YI3A 3TF5A 5HKKD 2SECE 2QOEA 2D8AA 4LF5B 3Q3HA 4L4ZA 3PJRA 3DM5A 5A9RA 1T2UA 1Y7LA 2CLMB 1Q1NA 2F6RA 4K9OA 4H17A 4GRDA 2VWGA 3M5DA 2OAP1 1YS7A 2QE7D 3GV0A 3TRJA 4HWGA 3WLFA 5KC8A 3GDFA 2CLKB 3GPBA 3DFIA 5JMTA 1N3LA 1PTJA 2PUVA 1QCDA 5JD3A 1QWOA 3Q0TA 3EXIB 2X86A 2OWDA 1J5EB 3CVJA 4RK1A 1VFPA 4PG4A 1GYQA 2WTEA 4DGSA 1E4YA 5CK5A 4FFWA 4J7CA 3HZZA 3VPGA 4FR0A 4FFBB 5EYPA 3T5BA 2BC9A 4BQIA 1SEVA 1T9HA 1J25A 1E3JA 1Z4QA 2Z3ZA 4F5DA 2ZWMA 1SULA 3AR9A 2XECA 5AOAA 2XHZA 5IBQA 4DCUA 1MO2A 2ZIAA 2B4AA 3WDMA 4AZVA 2PUDA 3QEJA 3V00A 1ORWA 3AT1A 3EG5A 1NIPA 5JOQA 5BN5B 1E7MA 1R4NB 4AZ3B 4BMYA 2VH5R 3FOZA 4XQCA 3GFGA 3KX2A 3PDIB 3GFOA 3RC8A 1OYYA 3MEQA 4P4NA 3E0QA 4FFPA 4MYUA 4PV7A 3RRYA 4MV3A 4JMLA 3TO5A 5FWXB 3QK7A 2XMQA 3N05A 5JC8A 5BWNA 2RGDA 3FVTA 5DRYA 1B76A 3NIDB 1RXEA 1MB2A 2J6BA 2OBBA 4JLBA 2H8GA 3L8GA 5CAEB 1UMKA 1DPGA 1ML4A 3I39X 2V7QD 2FKAA 2Z8ZA 3AXTA 3R1IA 4FOSA 4NESA 4V0QA 2ALJA 4FE7A 3UG7A 1FOEB 4QVKA 3AETB 4ZCTA 1JA9A 1TA0A 1VKJA 3MRTA 4OIMA 1NYRA 2YJ3A 4R01A 1RYBA 1PTJC 1CY7A 4L5IA 4MQLA 1GZUA 2XVAA 3HMQA 1KP2A 1JSZA 2O2HA 1U8AA 2GEBA 3BXZA 3M5WA 1Z0ZA 4ZU3A 4RIHA 3HXPA 3ILSA 1HYEA 3K96A 1V8OA 1QUEA 4KQGA 4JUDX 2EFHB 2AUNA 2FZWA 2O23A 2VJQA 3NOXA 1A2OA 4J3JA 4AURA 5I7FA 1JEYA 2QM8A 2GJ9A 2P2NA 4EMBA 2W11A 5E6UA 2Z1DA 5BYAA 4W1QA 2VUIB 2JCYA 4Q3NA 1O57A 4GPAA 1QHXA 3D4BA 1W4LA 1IAVA 2YDYA 5AI9A 5GONA 2WM9B 2ODNA 2CF6A 4X93A 3LK7A 2RI6A 3I2GA 3SS9X 1O94D 5AW8A 4CEHB 3V1LA 2GGSA 3SQXA 1D0SA 3RHFA 2DTEA 2BP7A 3TQFA 3ZWQA 1A7KA 2I2FA 2PJUA 1R5JA 2XVMA 5DBOA 5A1TA 2YJGA 2SCUA 2EATA 3S4YA 5L4SA 1H9CA 3C3PA 3EC7A 3JQ9C 4YDRA 4PFKA 1FFXB 4XUDA 2DBRA 3VR1A 1KZGB 1B3BA 2AEFA 1L4YA 1UKEA 2JA2A 3PA6A 4NAUA 2I4NA 4OQLA 5F78A 4YIHA 2QRGA 2DULA 2Y92A 3K09C 3VJMA 3W77A 4ALNA 1DIGA 4OV6B 3PLAE 1KR2A 1WLYA 3NDBB 5HGXA 3OFKA 4WA8A 3FCCA 3FUWA 1WCIB 1M6YA 2FR0A 1CB0A 1SUCA 3LW7A 4WFIA 5DBFA 5E2AA 1U3TA 1RC8A 2R2AA 3HKCA 1ZISA 3HZOA 2VH1A 5EFZA 1I3CA 4G1FA 4MUHA 4YAGA 4OQQA 4YMVA 5CG1A 4RZIA 1YL5A 4PFSA 1T4GA 2ZROA 3QLUA 3HS3A 5HUJA 3NVMB 3LUDA 4GGOA 1Y80A 3JD3A 3L7KA 1AMOA 2NT3A 4L22A 4A10A 1YACA 4UTVA 5JQGA 2ZBDA 1P62B 2ATCA 3HWSA 3FETA 4DDVA 3K9WA 1JI3A 1FW8A 1M2KA 3A05A 1E2UA 1KY4A 4FUTA 1A1SA 1V7CA 3CLUD 4E1AA 2QX6A 2AQKA 4LS3A 4Q39A 5NULA 1OIWA 3TNYA 5KOJA 3DW3X 5LXTA 3FLAA 4V39A 3R23A 4H2DA 4MDEA 3H5IA 4QHYA 4WKOA 5FFNA 5F9HA 1TZJA 4IZOA 3RRNA 1DG9A 1QDLB 2J3MA 2YIDA 2PGLA 4LV6A 3T41A 2NXCA 4H7PA 3TJMA 1Q6YA 5HYVA 1YDMA 2D4AA 3LECA 3RYCB 3OCWA 4BO2A 1K75A 4C0SA 3RV3A 3C6BA 3K2BA 4BP3A 2ZI4A 1IEQA 4DLPA 1A8QA 1Z0KA 2GBGA 5F3RA 3JQAB 1AY0A 1T43A 1JRLA 2C77A 2Z08A 3CURA 4UHEA 5AO9A 4AZ0B 5K3SA 2F62A 4E08A 2DWCA 1U0GA 3WLLA 2PUWA 3QEOA 4JU8A 3HRHA 4OHOA 1DBPA 3ORRA 4XPIB 3RR2A 3TZQA 2ZI3A 4YMGA 2J3LA 2N9UA 2QW1A 3F9RA 4CTKA 4YRSA 2GWRA 1YOBA 1PL6A 5EINA 3STYA 4CKWB 3U7IA 3I73A 4L1KA 2RB4A 5AK0A 2FWJA 4V03A 5BN4A 1SUPA 4DNOA 1JJIA 4D1YA 3O8OB 2H5LA 2QR3A 4JBXA 4QQRA 5FTKA 3KJXA 3TL6A 5DLYA 5LA6B 1US8A 1UOQA 1EPUA 3HYLA 2BGTA 3K5PA 1RKXA 2QMZA 3S27A 3SYRA 3UF0A 4Y2JA 4Z8YA 2CV1A 4AF6A 3K2IA 4DOMA 2YMQA 4TZKA 5IUNC 5DNDA 3GEGA 4LKOA 5E9JA 1NYTA 1JA1A 1X8LA 1ZI8A 4JJFA 4YQEA 3G88A 2F8TA 3W2GA 3U9SA 4EGSA 2P6PA 1LPBB 3PRJA 4R4JA 1A0OA 3A9TA 2XD9A 3REQA 1CETA 1G8PA 5E2IA 1OPRA 3MLAA 1J2TA 2CHGA 5GVRA 2WWHA 3BMQA 1WMSA 3CQ9A 3CIOA 3IOYA 4P3PA 2X0DA 1U8UA