3K9WA

Crystal structure of phosphopantetheine adenylyltransferase from burkholderia pseudomallei with hydrolyzed 3'-dephospho coenzyme a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
163
structure length
163
Chain Sequence
GSMVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFFSLEERLKIANEVLGHYPNVKVMGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Structures of phosphopantetheine adenylyltransferase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 62
structure length 163
sequence length 163
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3k9wA00
3SZ3A 2GKSA 3A04A 3TQOA 1F7VA 4DDKA 2Z09A 3FY4A 3TZEA 1IQ0A 2DPLA 2E89A 1OWNA 3CLSD 3RK0A 2IJGX 4XSVA 4ZT3A 4MW2A 3FDXA 1ZH6A 4ZCQA 4MW0A 4ARIA 2DLCX 2X0KA 3IMCA 3QE4A 1WXHA 2CUZA 1J21A 4KR6A 4WNYA 3DO8A 4E1AA 5DEOA 1NI5A 1VLHA 5LLTA 2TS1A 4MWDA 1XJQA 2HMAA 3CLRC 1R6UA 2XRZA 1H3EA 2PIDA 1NUTA 1G8GA 4PY2A 3RFFA 1OD6A 1COZA 5KHAA 2AZXA 4L2IA 3ZXIA 2I1LA 2J5BA 1NP7A 1PFVA 2X3FA 3ZJUA 1NURA 3H9CA 3C8ZA 2RD2A 1EUQA 1FFYA 1O95D 5HG0A 1LI5A 1V8FA 3ELBA 1GTRA 1K92A 1ZH0A 3UOWA 3ZXSA 4MLPA 1WXEA 4NAHA 4KR9A 4RUKA 1I6KA 1EJ2A 3ND5A 1JHDA 4U63A 1MAWA 3ND6A 1WXFA 1EUYA 1JILA 4I6EA 4CDNA 3FIUA 3COVA 5KWVA 1B6TA 3FH0A 1K97A 2XRYA 1H3NA 2WB2A 4ZT5A 2QJTA 4NATA 3VGJA 1NUQA 3IMGA 1IH8A 3CLRD 1J1ZA 4GU5A 2EL7A 1KAMA 1NZJA 4PBSA 4JXXA 1ZUNA 1WOYA 1K4KA 1QTQA 1GZUA 1EFVB 3UMVA 1ZJWA 1VL2A 4MVXA 2D13A 3D6VA 2YWCA 3HL4A 4GRIA 4DNXA 3IUEA 4ND6A 4J75A 1U7XA 3CLSC 2H29A 2V0GA 4MW9A 4KPUB 1M8GA 3IOEA 1OBHA 2E21A 2DXIA 3KT8A 4Q16A 3SZGA 3PRHA 5FNZA 2NSYA 1O97C 3LE8A 3AFHA 4CQNA 3VU8A 1EXDA 1QQTA 2YWBA 3COWA 1LW7A 3ZUGA 2A1TS 1OBCA 1UFVA 1U3CA 4MWEA 1FYDA 1O94C 5F23A 5K0TA 1J1UA 1N2IA 4ZCPA 1KQNA 2DERA 3CR8A 1N3LA 1I6LA 1TYAE 3CA8A 2YXNA 2J07A 3COZA 3H05A 4ZT7A 2IP1A 2AKEA 1PFUA 1YULA 2CYAA 3Q10A 1T9GR 1QNFA 2JANA 4MW4A 3OTWA 5KCMA 1KORA 1G59A 3PNVA 1R6XA 1WZ2A 2QUJA 4EF6A 3DLAA 1QRUA 1GTSA 5FO1A 3IODA 4K03A 4EGAA 2Z3VA 1M83A 2QTRA 1IHOA 1MBZA 4R0NA 1I2DA 3GUZA 4JZYA 3MUEA 3PNBA 5LM3A 4XFJA 2VXOA 3KT3A 3TS1A 1M8PA 1O97D 3RK1A 4OJMX 4J76A 3X1KA 2QTMA 3AKZA 4DJAA 3Q12A 1D2RA 1QJCA 1N1DA 3N05A 2QUIA 3FHJA 1BS2A 3QTTA 4MUHA 4YP7A 1HYBA 1GAXA 1O94D 4EG6A 3UC5A 1Q19A 5K0SA 3HFJA 4CT0A 2DEUA 1OWOA 1QU3A 1MC1A 3A05A 3P0HA 4MULA 1U7DA 1EFVA 1XNGA 3MXTA 1JZSA 5HUJA 1U3DA 1G8HA 4X0EA 3IOCA 1NUPA 1O0CA 1WJGA 3PNYA 4MW7A 1H1TA 4ARCA 1M1ZA 1K4MA 3N9IA 1F7UA 1ULHA 2IELA 4MW1A 1TFUA 2PZBA 1Q15A 1M8KA 1Y42X 5TGTA 4H3SA 1YIDA 4MUKA 1DNPA 1WY5A 3K32A 4ZCTA 4KPUA 1OWMA 2QJFA 2A4MA 4ND7A 2X1LA 3CVXA 3A2KA 4MVYA 1JMVA 1V47A 3HGMA 1YUMA 3LOQA 1R6TA 1U0BB 1EFPB 3ZJTA 3TQIA 4YP6A 1TYCA 4MW6A 4MUJA 2CYCA 4MWBA 4MUIA 1XNJA 2PXHA 1TYBE 3BL5A 3F3MA 3OP1A 4OUDA 5J5AA 1O5TA 1KH2A 3A4IA 5IJXA 1IQUA 1WQ3A 3G59A 3P0JA 2J09A 3RHSA 1TQ8A 4ZT6A 2A7XA 1LI7A 2A86A 5H7XA 1A8HA 1JIJA 2BTEA 4NZPA 2CSXA 1JGTA 4MVCA 4QRDA 1KR2A 3AG6A 5DASA 1VBNA 4ZT4A 4A91A 4MVWA 3ILVA 4XFDA 3MLBA 4MUNA 3SEZA 4EG8A 3U1VA 1IQRA 3GLVA 1QRSA 4PBTA 4HPWA 1J20A 3CLUC 2HGZA 1EE1A 3TNJA 1O6BA 1OWPA 2X1MA 4P2BA 4JFAA 2QJOA 1N2BA 4MAFA 3G6KA 3AL0C 1KAQA 4MUGA 4AS1A 3IVGA 1PG2A 1NUSA 1F4LA 1QRTA 3NBAA 5BNZA 5IHXA 3P52A 5DB4A 2WSIA 2GOYA 3FNRA 4EG4A 1MRZA 4K0RA 3G5AA 3N8HA 3KT0A 5AHWA 3SYTA 4AQ7A 1T6YA 1T6XA 2A84A 3CLTC 4QREA 4NX2A 1N2EA 5EKDA 3RBAA 4YMIA 1NYLA 5FO0A 1T6ZA 1N2OA 3HV0A 1MAUA 1O96B 4F4HA 3DV2A 3CVUA 1F9AA 2JAXA 4HK4A 1H3FA 2A88A 4MUFA 3DPIA 1O0BA 3H97A 4S1OA 5J59A 1N2JA 2O8VA 3VRHA 2VTBB 1T9GS 1CT9A 1X8XA 2A1UB 3CVVA 2CV2A 1G8FA 1MB9A 3X1MA 2G36A 2PG3A 1QU2A 1JIIA 4EG5A 3P0IA 3D6UA 1M8JA 1JZQA 2WQ7A 1NSYA 2YY5A 1GLNA 3CLUD 4MW5A 4UZEA 3ZIUA 1PG0A 4NDAA 4NAUA 3SP1A 4F3RA 4MUEA 5TS2A 2J4DA 2R5WA 2CYBA 3GMIA 2DR2A 4YBRA 3NV7A 1SURA 1GPMA 1EFPA 3HZRA 3FI0A 2HZ7A 2CT8A 3IUBA 3NBKA 2AG6A 4TS1A 3HMQA 5JBNA 2DETA 1KH1A 1PFWA 2BYTA 3ISJA 1KH3A 2CV1A 1WXIA 3CLTD 1NUUA 2QUHA 5LFAA 3N2YA 3MLAA 2ZUEA 5J58A 2C5SA 4U8HA 3INNA 2PFSA 1KQPA 4DDHA 1WKBA 3ND7A 4Q93A 1JECA 1X6VA 3TZLA 4DE5A 1N78A 1MJHA 2PZAA 3FOCA 1YIAA 3MMXA 4WSOA 2QTNA 4FZJA 5H16A 2D5BA 4CDMA 2ZP1A 4BWVA 2E0IA 2QUKA 3K9WA 1N75A 3COYA 1WXGA 3QTBA 2PZ8A 3SDBA 2O5RA 4HJXA 4G6ZA 4DLPA 3ZGZA 1S4MA 3FG9A 3IVCA 1N77A 2NZ2A 4I6JA 4ZCSA 2CFOA 3H99A 4I6GA 1VBMA 1Q11A 2Z08A 3UK2A 3FWKA 2OQ2A 2RE8A 3PXUA 1VBKA 3KT6A 3H9BA 4EG7A 3IMEA 4R2LA 2E18A 1TYDE 3ZJVA 3IVXA 1KP2A 1J09A 2JA2A 4L2IB 1JIKA 1WQ4A 1ILEA 4ZCRA 1O96A 4KR7A 2DUMA 3Q4GA 3KFLA 2J08A 2B7LA 3AIIA 4PBRA 1XNHA 2VTBA 1GN8A 2A1UA 2CV0A 2H2AA 3L92A 4JYZA 4MWCA 2EJCA 1J70A 1IFXA 2OV4A 3X1JA 2GM3A 1P7PA 2D54A 1JEDA 5DK4A 2V0CA 5HUHA 3RJZA 4ZT2A 4R2MA 1RQGA 3L93A 4G5FA 1N2HA 4EG1A 4YP5A 4DDMA 1KKUA 3IDFA 4JXZA 1I6MA 4MQ6A 1PFYA 5TEVA 2A1TR 3S3TA 3M5WA 4EG3A 1JEEA 3SEQA 1N2GA 3UY4A 3CVWA 1YI8A 2WQ6A 1IVSA 1IRXA 3IOBA 1MB2A 4RPIA 3I05A 1Q77A 3LCJA 1YUNA 4OUDB 5TEWA 3FETA 1OWLA 2ZUFA 1KQOA 3IH5A 4UZFA 3E27A 1TEZA 1MOPA 3JXEA 1KP3A 3CVYA 4EFKA 4QBTA 4HJRA 3AG5A 4G5YA 1M8FA 1O95C 4U7JA 4KKVA
chains in the Genus database with same CATH superfamily
3Q7PA 2C8JA 4X3OA 1X7DA 4QG7A 1RKBA 5ALVA 1LDMA 2ZITA 2JZCA 4PZCA 5EWJA 2FN3A 4DDKA 1W5BA 1OWNA 1ZUIA 3OE4A 3VNRA 5BO5A 1YQUA 2R6GA 3DLIA 5CLGA 4E70A 4B81A 4BS9A 3BIFA 3QPCA 4CQJA 3D7KA 2JZNA 2Z5VA 1YJ8A 3OURA 1AKYA 1UJ2A 1WXHA 3NKVA 4MXDA 2F43B 4TMWA 4XLLA 1P5HA 4ALMA 3MINB 2BSQA 4JELA 1XIVA 1ML4A 1Z62A 4MQ4A 3BFPA 2H85A 2GN9A 5B7NA 5CMLA 1IM8A 3UQZA 1QE3A 3IPRA 4RQUA 3WQQA 2ZBFA 2FRDA 1Q0SA 3EULA 2QA5A 4PG6A 2C7BA 1LNZA 1PZNA 3DOUA 3HUDA 3TL3A 4BLPA 3HN2A 3IHKA 1SQ5A 2VJAA 4P38A 1H0HA 1F20A 4O4LF 4JFRA 4RA6B 5DBEX 1LXCA 3AUYA 4TQAA 1QQAA 1IBCA 4H9GA 4FDVA 2X9LA 1Z6PA 2J5BA 2ORYA 1QGUB 3HUUA 2Q6OA 4QTUB 1PLJA 3H1GA 4I3FA 1NVGA 3PYXA 4B7CA 4RTQA 1NW9B 3C8ZA 1ZRHA 3F98A 2ZK7A 3I9V6 4AJ4A 1RP7A 3Q5DA 4EMUA 5I4CA 4Q3OA 5E6SA 3VI3B 4ZOQI 3WKCA 3DTNA 4UBNA 5ALQA 1F6DA 2C3UA 2IWHA 4FSXA 3UOWA 4TRRA 2GWRA 4AJKA 4JK3A 1W88A 4Q9KA 4INJA 1C7ZA 1K0UA 4O3MA 3TRFA 1E0DA 4YV2A 4HNRA 5JOQA 1R6DA 4O4HF 1R4NB 4ZQBA 1JHDA 2QRGA 3ZU4A 4YUYA 4H6XA 5JS6A 2HCTA 2YRXA 1WCV1 2HQRA 3L0DA 3QXXA 4HB3A 3VU3A 1S2LA 2PA3A 4NNOA 2WJJA 2XAAA 3FH0A 3GF4A 2QIOA 2QPTA 2LXNA 3FWYA 4KX5A 5KJ6A 3QWIA 4BFLA 3O8RA 3OOYA 1R0BA 4W63A 4ZT5A 1XTZA 3FBTA 2QG4A 2WICA 2N3ZA 3MWKA 4BO6A 4EP1A 1QHGA 2AZ4A 4R6XA 1LPAB 4MEBA 3R3WA 3VR4D 4QOFA 1YRAA 3ASUA 3BWMA 3SYKA 1SBIA 2ZAYA 4DSNA 2J1LA 2BKEA 5C80A 3F6EX 4N5HX 5FD8A 2R0QC 4C01A 1UKCA 2JI6A 3OJFA 3OE7A 5EZYA 4BV8A 4KXNA 4E94A 2OILA 3F2IA 5ULLA 2VCHA 3VTAA 4KFRA 1GKIA 4JGIA 1HNNA 2R1TA 3VU1A 1BE8A 1T8RA 3AVYA 1E18A 4ARAA 1E2HA 4A2CA 3H5AA 5DTEA 1WHTA 2WU8A 1T3HA 3IP7A 1E5VA 4RFSA 1R5NA 3NTOA 5C4MA 2C4NA 1DMSA 2W6CX 1PBNA 4GBGA 3STTA 3U2QA 3VR2A 3MJDA 5IJ0A 2XVXA 3CLSC 2H29A 1H2XA 1SN7A 3KUKA 4J7AA 4MW9A 3C70A 1GRNA 2RGNC 5BSMA 3U3KA 3KQUA 4P0TA 1E63A 2FKAA 2OESA 4K2AA 5AD1A 3AUJB 3C3BA 4IWXA 4YJ3A 5CB4B 5BWNA 4A8PA 5HFJA 2WE7A 3C3DA 3PRHA 3QYAA 3HCFA 4X1OA 4Z0TA 4DJDC 1PT5A 1GQSA 4E5NA 2GPSA 1P4HA 3CJRA 3EC7A 3UTCA 1SWVA 1JMKC 5BV7A 2IIBA 2ISSD 3ER9A 4GLJA 4WXRA 4MVJE 2CD9A 5D3QA 3COPA 5DMHA 1M3SA 3HYCA 2ZIXA 3PQ2A 3K9BA 4MZDA 4EKGA 2BZ0A 3PFWO 4MRSA 3ZWDA 1IOLA 3D4PA 4L50A 3ZUGA 4Y3UA 1C30B 1HLPA 2WD9A 4TL6A 2DHDA 1HE5A 4J2OA 1N2IA 1ZVKA 2C1EA 3DO6A 4WV3A 5EZSA 3JYOA 4MUXA 4WEQA 5JQGF 4MVJP 1N9GA 5KWJA 1QK3A 3THOA 2XDWA 4ZK6A 2VQFB 3A4YA 4YK7A 4DUYB 2FJUA 5H68A 1PTKA 3GY0A 5JARA 5TPZD 5HW0A 4FONA 1B6SA 1M9NA 2LD4A 3CZ5A 4UTXA 4WZBB 1WCXA 1H2HA 2BISA 2P3OA 4TKVB 3TOCA 3PI6A 5K01A 2FQYA 1QIGA 5KNBD 2QUJA 1QZZA 4D6XA 1TM7E 3EG9B 5BXQC 2J3HA 3IODA 4GX1A 4L3VA 5AOCA 5H82A 3KG2A 3ZDBA 1M83A 2FEWB 2VYVD 3OFSA 2NV0A 2CKMA 3D3WA 2ODEA 5JJIA 1PZFA 1WEHA 2NM0A 2B5VA 1IUNA 1NXTA 4KRXA 4PPGA 3NT5A 3HK2A 2P2GA 4JLAA 1LDGA 4RTLA 3TS1A 1GJRA 3NDIA 1NVDA 3NQ41 1W76A 3CGWA 4O2AA 5HRAA 1D2RA 1W19A 1FRNA 1JHRA 2G83A 2QX8A 1G7CA 4ZMBA 3ZCPA 3EWSA 5TPWA 4ML3A 1T36A 1D5CA 1OLUA 1GR0A 4FQ7A 5H9VA 2QV7A 5BPHA 1OAOA 4KVFA 3GFGA 4CUJA 3GNSA 1QVVA 1TM4E 3STXA 1NV9A 4WK0B 1SC1A 4DUZB 3BH7A 2OZPA 3A3OA 3SWWA 1KFBB 3UK0A 3O2JA 4ZQEA 2IPOA 1COWA 3MXTA 2ACWA 3HUTA 1KMQA 4NEGA 1GT91 1Q5PA 1RI4A 2OXCA 3ESXA 2W9XA 5AOVA 2EVWX 1OQAA 3O74A 1H1TA 4K46A 1GQQA 1TGVA 3EGWA 2J5KA 4LJAA 3K71B 2LDXA 1T4GA 4JT9A 4NK5A 3TPZA 1DKOA 2IX9A 5IG2A 4V38A 1LQTA 1ZGHA 3SHQA 2W2LA 4W9RA 1MHTA 4G5SA 1C8KA 3C6MA 4MV9A 5IABA 4N18A 1E6LA 2P6OA 2FETA 3K2BA 4PYMA 5JO9A 3LA8A 3QU9A 1XAHA 4BNKA 4BB9A 3I2HA 1X9HA 3DVRX 5IBPA 2Q1SA 4OGWA 3BXEA 4U2DA 1ZGBA 3VJMA 3E9CA 3K72B 5FUYA 2CXUA 3ZEIA 3C6YA 3BICA 1BE1A 4H6WA 1OCEA 3CR7A 2BC9A 1WZUA 1TW3A 4TMXA 3LOPA 1EFPB 2HO4A 1IHYA 1QC5A 2I4MA 3EW7A 3MRSA 4QGFA 4RKFA 5LQSA 5T8KA 3COJA 2MSDB 2WUWE 4KH0A 1KRHA 4MUJA 1EINA 1FK8A 3UMJA 4WERA 3W5DA 4MWBA 1XZDA 1FU7A 1BN7A 3OP1A 1LZLA 2H9YA 2ZRCA 1Y4DE 4K05A 1DSSG 3NI2A 3HA2A 3OC6A 4YLGA 5DW3A 2VK8A 3ZKWA 1F1JA 4NJMB 3A1NA 5LQKA 2GBFA 3BBLA 2R6AA 1ABFA 2RB4A 1H1DA 1VI5A 4MRRA 1GXSB 1I0LA 1ZU4A 4FBGA 1E2LA 1HO3A 1OT5A 2V96A 1W4ZA 3FMPB 2XJ9A 1GNPA 3P26A 5THQA 1Y5RA 2VOEA 2O2IA 1QKIA 1IJKA 1JXOA 2FPSA 2A2ZA 4LI0A 2O2YA 2OHHA 3R3SA 4ND5A 5DNAA 1CZUA 5DV9A 1M2GA 1TAQA 3GCWA 1V5IA 3TLBA 5FWYA 4MOWA 3RYCB 1HG0A 4KACA 3LP6A 2PT5A 4LWZA 3ZZ1A 4MV1A 1JAXA 3DZKA 3L0PA 3WMEA 2BTEA 1L1QA 1Q17A 1SY7A 3NZEA 2REBA 3V8EA 4ZTUB 5EXTA 2M6LA 4C9BA 4QQKA 2ZI4A 2IZ6A 3FNEA 1XPOA 4RKEA 3QI2A 2WAXA 3L8YA 2DJ5A 3A2LA 3T41A 1MPTA 2F3PA 4QPCA 3ZQJA 5EHXA 5JSQA 3I2IA 2HU7A 5IKMA 3KBBA 1SBHA 3Q8WA 1NQTA 1R9GA 3ZCXA 3JPYA 4X00A 1ZNXA 2X6RA 3GV0A 4K86A 3AM4A 4LJLA 5K6RA 1L7QA 3EEIA 1QRTA 4GZ3A 4JJIA 3U7RA 3E6AA 4AJJA 1CVLA 2YWHA 3HCAA 1U8ZA 3MILA 1AKUA 2PMDA 2VP4A 3W9YA 1HBJA 4JYMA 1J5EB 1G8YA 1YH3A 4OTZA 2N46A 3ITKA 2GGSA 2WIAA 2GRJA 2ZUDA 3ET4A 2D1QA 3G9ZA 4HLUC 1AZSC 4EI8A 4MRMA 4ALJA 4DW8A 5JSFA 4HBZA 2HRRA 3EBLA 4FHDA 1AK2A 1NYLA 3ZIDA 2XZOA 2FPMA 1VE7A 4Q4AA 1P5JA 4C5AA 3P9QA 2Q5EA 5HRUA 3VH1A 1F9AA 1PG5A 5B5SA 1XJWA 5LMNB 3D8UA 2P1DA 1FRFS 4MWSA 3EEYA 4F97A 3S2IA 4WVFA 1LJLA 4KFUA 4CMIA 1F4VA 3ZLBA 5D51S 3NIBA 5IKPA 3TL6A 1RIFA 5JFOA 1V5EA 4FOPA 2DHRA 4A15A 3Q7QA 1WMBA 2AW3A 1X7WA 3CVOA 3QWBA 5DKFA 4GVXA 5D3KA 6NULA 3ENQA 1VKOA 3E3AA 5IZCA 2WJHA 2BHRA 2C04A 4F3RA 5J5CA 5IJZA 3U5ZB 4RWZA 4P3XA 3D7RA 3BWVA 1CNMA 1U0TA 1T1IA 3N2ZB 2I80A 3Q7SA 2JEZA 5F3WB 3HXTA 4YBRA 2OXTA 3D0RA 5EP2A 4GMXA 4UE3S 5IC4A 1KU0A 1EM8B 1ZD8A 3SI7A 1WUYA 1R66A 4PXAA 1PS9A 3SSOA 4C4ZA 2IS1A 4Q21A 1CNEA 3KS9A 3B5JA 1UEIA 2K7ZA 2VFAA 1GAQA 4F2DA 5A62A 2NUAA 2AG6A 2ZG6A 3HMQA 4P3KA 1GZ3A 4WKPA 4AWAA 2CV1A 4M1KA 3JQ8B 4IRUB 2XAUA 1K1EA 2C4VA 2O5VA 4GO1A 4QUDA 4GKKB 3OESA 5BPFA 1KI6B 2H54A 4WL0A 1ZEMA 3QV2A 4NBTA 3HDQA 5JV5A 5AVQA 1L5QA 1J99A 3DL2A 4AZ3B 1RQLA 5DF1A 2ZQ5A 4ZJUA 2WAAA 2IYFA 1MEEA 1AQIA 1X6VA 2ZUBA 4MB6A 4NE2A 4LNHA 3SVZA 5L8VA 4Z3OA 3AP2A 3DE1X 1NBEA 3FW1A 3G7NA 3P96A 1EWVA 1QMGA 4BLSA 5IF9A 5LDHA 1IC6A 5EHQA 3NWOA 1DKNA 1NE7A 1CS4C 5FJJA 2UUPA 5TPZA 4AMYA 1WXGA 3NPMA 3EEQA 4V0OA 4TT8A 3QE3A 2BI7A 3W7VA 2O05A 4HJXA 5CR9A 1YRHA 9ATCA 4GL2A 2JJMA 4E03A 4F86A 4G01B 5EMMA 1W2GA 1S4MA 3BZUA 2P0YA 1S8OA 4FSDA 1GGEA 4QNRA 3PC4A 3RSOA 3D2LA 1L5FA 4NKRA 4D81A 2C7PA 4QARA 4I6GA 3B20A 4YJFA 1BC5A 3KYCA 4IKEA 1N5KA 1CUBA 1ESZA 4WZAE 2BWJA 2IUSA 3JQ7B 3P0RA 4RTSA 1VCHA 2NQ8A 3FWKA 3UEOA 1NTRA 3QWFA 1UPUA 2FRDC 3AOEC 2R7LA 3KLPX 1V45E 3NATA 3SICE 1DRUA 3L6UA 4NMLA 3GLTA 2KLHA 2D4HA 4BWGA 1VBFA 1JKJB 2CF5A 3ZJVA 2C95A 3OQIB 4WGFA 4F1KA 2JK0A 1DBPA 2EF1A 2GPYA 3QOWA 1M2WA 7MDHA 4FKMA 3HKEB 3SYRA 4G1CA 1P9WA 2MSLA 2R00A 1KARA 2R2AA 4Q4DA 5LZ9A 4LWQA 4L5AA 3GZNA 3P9KA 2OYCA 3KKQA 3T3HA 3H42B 4PC3A 2XUIA 2CHVA 3OSZA 2B37A 5T4FA 2G63A 2A0FA 2AJ8A 4COOA 5IBQA 1OIWA 4J0FA 5J9FA 1PCXA 3NTXA 2ZYSA 1NRJB 2OV4A 3JARB 3K1AB 4G0OA 4HRYA 1HDCA 3T35A 2BDEA 2DHCA 5AM4A 5HZGA 1JEDA 2CF6A 2FEPA 3LI2A 2EEPA 2FGJA 4C0QC 1LRKA 1XL1A 4OFXA 1N92A 2PKXA 4KFSA 4AMZA 4CCYB 2I1VB 3BXHA 2NP7A 5EZ6B 4MQ6A 4CKBA 4B7ZA 2C07A 3PFHA 1W5TA 3PGKA 1ZJ5A 1P1BA 3NVMB 3AY3A 3QUSA 5DNWA 3BKWA 1K7FB 3GEPA 1OU4A 2W2OA 3DUFB 4M0LA 2OGTA 3DMRA 2IIPA 3GNQA 1BAPA 2ONJA 1VG9B 3HEMA 5FULA 1TM2A 4W7HA 5ICEA 5CT8A 1VPTA 4DDWA 5JJKA 1Q77A 3CNOA 5EG5A 3S2YA 4JGGA 4Z9YA 2IHZA 4HNTA 3MD0A 1RYFA 2WT4A 1BE0A 5IDQA 2XB2A 2J5RA 1A9XB 2YUTA 3M5DA 1VFNA 1F14A 1BYUA 1X1CA 2BMVA 4NZZA 3ICVA 5IVKA 2VF5X 2XMRA 1P6XA 1CLUA 2E4XA 3AX6A 2OHFA 4QBTA 3UFXA 1Z6XA 2VAWA 4L8YA 1LV7A 3IPYA 2E48A 3PFBA 4V02A 2C2XA 2EBHX 3W0LB 4ZPJA 4RULA 1D6SA 1E6EA 3UHFA 1UUFA 4NCKA 1OXXK 2Y1XA 2RHMA 3ETCA 3FY4A 3K9GA 4JEUA 4MAAA 4PU0A 4JI2B 1IQ0A 1K9SA 3E1SA 1HEIA 4Q0MA 4CMGA 3EPKA 4CTKA 4Z0HO 3W1VA 3FDXA 3AFNA 4MW0A 1Z8HA 4IXTA 4R8MA 2BP7B 3HHPA 5CYOA 5FPQA 4US1R 1DAGA 4IIHA 5KAMA 2MMGA 3Q7EA 1UXHA 2OFXA 1D1QA 1K68A 1XL0A 2QUZA 3K5IA 4WNAB 1XDWA 3GOHA 3IDZA 3WLFA 3E9EA 4ER3A 2B1QA 3AVOA 5K05A 2NUPA 1QFMA 1G41A 2J31A 2HMAA 1UEJA 4G81A 1Z7GA 4IHJB 3NRBA 4R2HA 5SICE 1N4AA 3TVTA 1P33A 5K8TA 2ZIAA 4FCVA 3BUSA 2XQVA 1UM9B 4KQXA 2AYXA 4N6OA 5FLKA 3D6MA 4QG3A 3RJ5A 1C9JA 1OBFO 4L2IA 4KMOA 4FDLA 5GTDA 4URFA 4ZVLA 1L7XA 2ONZA 3B13B 4HAZA 4H1TA 5L3RA 1XMIA 5IARA 1AXGA 2PT6A 2NAPA 4CVNA 4DUGD 1SKYE 1EFKA 3N2LA 1NW3A 4F8EA 5C7YA 2PSDA 2VPQA 1SD1A 4NU6A 2P9EA 1HNZB 3OPMA 1SO8A 4G8DA 3K5PA 4RY8A 4GBMA 4X71A 3ON5A 2HIAA 1DC6A 3NKFA 1E96A 3QPWA 2IXEA 1P29A 1U2SA 1W7AA 1E9DA 2R8XA 2VJLA 4BVEA 3E8MA 3F5QA 4U63A 1MAWA 1L5LA 4EPYA 3FIUA 2BGGA 3JD1A 4OHYA 5TS3A 4WDQA 3HQ4O 4ARSA 3IVRA 4AJEA 2HXGA 4FN4A 1ZI9A 3FR8A 1P1KA 4EVIA 1RPAA 3CNHA 3PHJA 1XEWX 4HQNA 5JAUA 2BFPA 4YO8A 4GI2A 1LVUA 4ZYUA 1YTLA 3B1VA 3NIWA 4RLHA 5G3ZA 2IUTA 1GAEO 1UDBA 4FHFA 1YL5A 2FLKA 1PF7E 4RSMA 1P74A 3O75A 1RYDA 4XW2A 5I8WA 2EYQA 2HRZA 1HFKA 1YK1A 4ETWA 1XMVA 3VC7A 3QUAA 5J4YA 3AI3A 3HZOA 4YV7A 3MMSA 1G5IA 2BEUB 2AXQA 2HTFA 4BLTA 3MS4A 3BRSA 1IBSA 2BMJA 5LJLA 2O2GA 3PHCA 3SFZA 3HS3A 5F4BA 3ROPA 4KX3A 2FXVA 1NVAA 3FGZA 1QPGA 3IUEA 3R9IA 1RZRA 5K3OA 1H9CA 1R4AA 2ZRMA 4WCDA 5HIMA 1QCDA 5LCXA 5M3BA 4DQXA 4B48A 4Z5XA 2V0GA 3JD2A 2H5JA 3LP5A 1ZBDA 4RD4A 4RJ2A 4ZOBA 2FPGB 2VDKB 4B3TB 1HA3A 2MU1A 5G0UA 4L4XA 5U4QA 1HORA 1FY2A 1M34E 1KDRA 1YZVA 3LIIA 2J9YB 2XGGA 5IVDA 3V7WA 4MR9A 4AB1A 3DL4A 2CVHA 1A9PA 4P84A 5T8KC 3KQKA 2DH5A 3DKRA 2CLIB 1O97C 1A1VA 4ZRMA 2NGRA 4ZRDA 3TCNA 1YDGA 2CVPA 1YMQA 2OLEA 2X77A 1D0IA 2XKAA 3O47A 5CHYA 2GEFA 5G3YA 3WHLA 5F2EA 2F17A 2IPNA 1QQTA 3FYUA 3HLKA 3O0DA 2YS6A 4U1RA 3U9TA 3K70D 4ID3A 1GPKA 3MQ2A 1SZJG 1E2FA 2ANBA 3FPEA 4C0BA 4DMKA 1JKMA 4GR5A 4PM4A 3DVAB 4ZJYA 1Z2OX 4BNGA 4ZCPA 5I5GA 3T3DA 3LY9A 3SX0A 4LNUB 3SR4A 1JEOA 1Q20A 1T0BA 4QT0A 3B52X 3TTXA 1JTFA 1N3LA 4OQQA 9GPBA 2CXRA 2FVXA 3KOYA 2J3KA 3P8ZA 5AESA 3TOSA 1HT1E 4IH9A 1WXWA 2WFLA 3HKDA 2RAFA 3MRXA 4KZKA 1IY2A 5AH0A 4MHTA 4IF6A 4MKIA 1SCQA 1YBHA 1L5ZA 4NMHA 1NMQA 1EBUA 1NULA 4OXQA 4DTCA 3U0BA 3OCYA 3AJRA 2VBIA 3OQHA 1U0OC 1G59A 3W5BA 2ZBQA 1QHEA 3GJ3A 2BE7A 3OZFA 5BN3B 3NRJA 4JQSA 3FUWA 2I33A 1GTSA 5H4GA 1NBAA 2GT1A 3AVPA 2YH2A 2CDAA 1V8OA 3GUZA 3QF7A 5I9SA 3PDCA 1U7PA 2DVMA 2JGIA 3EDMA 1Y1SA 1E0AA 2PJUA 3AJ9A 4IIGA 5DNDA 1VIMA 3HSSA 1CU1A 4G0MA 3OT1B 3LUKA 5DTJA 3D0OA 3FAKA 3FLMA 3ZQ6A 1N1DA 2D62A 1ZISA 3IQDB 4QEKA 4M0DA 5KNLA 1JV2B 3CCCA 3M81A 2O2HA 4NBUA 1HZJA 3EY4A 1O6FA 2ZJ7A 1EWKA 3HFJA 3K35A 2PY6A 4N40A 3P27A 2DQZA 1UKEA 3PKIA 4IIJF 3QJ5A 3WNBA 2XB9A 4MULA 5G4KB 3MHTA 5H80A 3MMPA 1UP7A 2ATEA 1JLRA 2PYDA 2WKQA 3TTUA 4D44A 2ZSUA 5JC8A 4NYJQ 1IXKA 2J5QA 3TQSA 4CV1A 1M5UA 3ABQB 4K8OA 1YDHA 1K4MA 3AFMA 2F00A 1BXRA 3EJWA 4FD2A 4PSDA 3HR4A 5AKIA 5A6SB 4BVJA 3H84A 2BBWA 5AKGA 1IIRA 4UQOA 1TC1A 3L46A 4BLRA 1DQZA 3GNLA 3HABA 1PLLA 3ZDQA 4D97A 3KTOA 2REQA 5IZCC 5HFAA 1ZK4A 2YIMA 4RACA 3SSMA 4BLVA 1SKAA 3CUEF 5JRJA 5KHOC 3CF0A 1RAEA 5KWSA 5AIBA 2I76A 2QL5A 3LT1A 2OC4A 3OLWA 4MVYA 3U1TA 3X1DA 4NBLA 4A6XA 3A2KA 4M4SA 5B30A 5C7IO 2XGSA 2OPBA 2CEAA 2D3WA 2WU4A 3DZBA 5DN6A 3FWNA 2WMNB 2H8GA 3CIFA 1RYNA 1MTOA 5B4UA 1W5AA 3HWWA 3QLVC 1FYFA 2AE2A 4XDGA 5EERA 2A0KA 3W77A 5LOVB 2AE1A 1GRVA 2UKDA 2WNSA 3C0KA 1IVYA 3H11B 3A3KA 3OY2A 1EGMB 2ORVA 4QHYA 4XR9A 5GM1A 4G0PA 4D9JA 3ETLA 4H1HA 4XWKA 3IP8A 1TYBE 1I2ZA 2OQIA 2A78A 3ASZA 1VB3A 5J5AA 2NVWA 3O8NA 1ZM3A 4JOSA 1PT7A 3BXZA 3G89A 1KQ3A 1L5YA 1U11A 3QX9A 3WGZA 3LRPA 821PA 4MS4B 5FLEX 4AD8A 4KSCA 2B7CA 2HNAA 3PXAA 4UW9A 2GKGA 2A0XA 4LRSB 1XRSB 4NZPA 4IIBA 4GPIB 4FLEA 1PP4A 2IDJA 1CUWA 3KKNA 1ECFA 4BJ5A 3GGDA 2CLKB 2PBLA 1W1UA 1OX4A 2C0PA 3REFA 3RAJA 2XZTA 5KI6A 5I45A 3KTAA 1H4SA 4CHGA 1QLWA 1HDYA 5AKKA 3DKVA 4J49A 4F7DA 1O5OA 4GX5A 4LJ7A 3ZTWA 2RGRA 3L02A 3VI4B 1NVXQ 3R6WA 5M34A 4HPWA 2Q3CA 4N5IX 5BYJA 3I6QA 3CF4A 3CEPB 4P80A 3ZXXA 4BO3A 2UXCB 4F6RA 4F38A 1BCRB 3CRNA 1YE8A 2AQKA 3KOZA 2R5NA 3JALB 3NPAA 4Y6LA 5F77A 1SRQA 2PL3A 1BDIA 4FXOA 2V3WA 1B15A 3OM0A 3E3MA 2PRIA 3FZYA 2BFCA 2Q8QA 5ALSA 2A35A 3W6ZA 4AS1A 2DCMA 3M4ZA 4M9UA 3N28A 1IXSB 3FNRA 1G55A 1HLGA 1IHPA 3O8QA 4XM0A 3AETA 4M53A 3I2JA 2GXUA 1HDXA 4N6NA 2DBYA 3SYTA 5C46F 1KO1A 4KB5A 3W5IA 1FPMA 1CXZA 3G2IA 4NX2A 2RFLA 1D2MA 4DWOA 4RJKA 4M87A 1T6ZA 4F4HA 4KH1A 3GLHA 3LIPA 1YE3A 2YMMA 5TIIA 2GTPA 3D9QX 1OLXB 4YY3B 1WPXA 4JI8B 5AK4A 1I7QB 5CCBA 1WKCA 1XVUA 4G1MB 4IFBA 2J67A 4KQMA 4NFHA 1NNLA 4CRWB 5DBHX 3CVVA 2R6R1 1GGJA 3T6KA 3UXHA 5P21A 1UKBA 4MPRA 4WOJA 4B5KA 4GM4A 2HIHA 1T1JA 1W0CA 4PGMA 5T4EA 5K0NA 1G21E 4FHGA 3ID6C 3UMBA 1D9XA 1AUVA 2RGWA 2NUTB 2A9OA 2ZJ0A 3N86A 4U2FA 2HSDA 1ULTA 3AINA 2M2IA 3HMKA 5A9SB 5KPJA 4NS4A 1S3GA 2QRJA 3OFND 5DHUA 1POXA 4RS4A 4UQLA 3VNSA 1RYEA 4G1UC 5A0TA 2XYQA 2AIRA 3DWFA 4X6LA 4G1FA 2Q3JA 1OR8A 3CR3C 3MOGA 4F2HA 1DAOA 1CUSA 2B4RO 2CXHA 2HZ7A 1ORRA 2JIBA 1YRYE 2TMKA 3JQPA 1M0TA 4HLQB 4I1RA 3S2ZA 3T9FA 4P7GA 1TKCA 5KDOA 5KYUB 3HCOA 3PHIA 1UR5A 2X8JB 2JD2A 3PC3A 3Q15C 2NACA 2DPHA 4B17A 4BN5A 4F4IA 2BYTA 1H2RS 3PJDA 4MGHA 5K3BA 2ZETA 4KN9S 2FVYA 3V1KA 5KSYA 3CTPA 1MC8A 1P81A 2G40A 2FK8A 4RELA 4YRPA 4E11A 5DXJA 2L2QA 3LUPA 3RC3A 2H18A 4QUJA 2JF0A 1U8UA 4JMLA 2HUNA 4G09A 1NZFA 5FRDA 2ALJA 2F4VB 4AKHA 3RT7A 2XOXA 1Z6QA 2E3JA 1FMLA 3ZK8A 5B55A 2ZWPA 1YA4A 5TRTA 3P32A 1LSOA 1U65A 3LY7A 2QTNA 6LDHA 4M9SA 5JCJA 3DWIA 3R7WB 1F2TB 2KYRA 2PH1A 3H5LA 5JSUA 2Q4RA 1Q7CA 4O1IA 1HDGO 2PZ8A 3E84A 1RRMA 2ATXA 3RAEC 5BSWA 1F06A 5HZMA 4BE4A 4U9HS 4AYTA 4E33A 1YL7A 1VPWA 1P62B 2FPUA 4S35A 2FHPA 1Q84A 2H8KA 4J2HA 4XWWA 4IDEA 1SVLA 3A3YA 4GXNA 1C3LA 3WIDA 1ZZGA 5AKEA 4ZCSA 1M2HA 3ZBUA 4ZN6A 1JQJC 2OCPA 3TPCA 5SZHB 1O58A 1QYIA 1LSUA 5JJCA 3MJHA 1JPNA 3EG5A 2OLJA 1MJNA 1BROA 1GSAA 2PZMA 1NXSA 2WVJA 4PYLA 1LRJA 1VBKA 3L41A 2ESRA 3G2QA 1I3MA 3KSZO 2F62A 3GUHA 1U7ZA 3I37X 4DDUA 4M7OA 3FHOA 2IHBA 1U0HC 1U3WA 4ZC1A 4Q9IA 4N76A 3EAFA 2C9BA 1I1NA 4D74A 4GVPA 1DXHA 3DMPA 3T1NA 1GIAA 1NP3A 3WX0A 1CUCA 1ZGAA 2CNDA 4FE3A 1JIKA 1Y6QA 4FS3A 4MV5A 4RK0A 2FEMA 3ZCRA 2X19A 4Z4QA 3IP1A 1QR2A 3MGBA 3LLUA 2H4YA 4TRJA 3DMGA 3Q4GA 4QJ4A 3KFLA 3TW8A 2WAOA 2QVXX 3O3OB 3VMFA 1EK0A 2GEKA 1FRQA 1O6GA 5BR4A 2H2AA 2BEVB 2VDVE 1P73A 2H0QA 2Y93A 4D9FA 3HA7A 3RSFA 2P3SA 3A10A 2HB6A 4ARUA 5K0CA 4V1CI 3KJXA 2FW9A 4F4JA 2AYZA 2J85A 3C3CA 1AG9A 1C5KA 4B2PA 2FA9A 4MTCA 4I4NA 2I65A 3A6JA 4HH3C 4LQDA 4FGWA 2GH1A 1FS4A 1BDJA 1NDUA 1A9TA 4OFZA 3VTKA 4BATA 5BSVA 1H93A 1CZNA 1XEXB 1WV0A 2E4YA 4LRXA 1OH7A 1X74A 1DQPA 2HTEA 3IDFA 4X7PA 3C3KA 5A2QA 4J9UE 4IZOA 4Q6BA 4HLDA 2P65A 3FZQA 1CR0A 5DX1A 2ROQA 3SHFA 1K27A 1F1BA 2QHXA 3AQIA 5F35A 2B98A 1I4EB 5EJ5A 2Y1WA 2XQFA 3F3KA 4OBEA 1Y6ZA 1NW4A 2K6GA 3R8FA 4D41A 4B31A 4O2LA 1PU2A 4FR2A 1P7WA 2NV6A 3FCAA 3WWOA 1XFDA 1IZZA 2I3BA 3LCJA 3RFUA 1Z4MA 2UUCB 1EZZA 4OO3A 1G38A 5AM2A 2YYSA 1WO8A 3FZNA 1KJZA 3PNOA 3UJNA 1A7JA 3VKGA 2WYOA 3FNIA 3RRNA 1GR1A 4L4RA 2HLPA 4LY9A 3QE9Y 1Y33E 3EIOA 3C97A 3L7CA 7REQA 4FFWA 1X70A 1LNQA 3PUJA 3N39C 1OYYA 4JIMA 4LYJA 4PTZA 4RMHA 4ZD6A 4ZWNA 1FBTA 5A6VA 5C5CA 4G5YA 1XTPA 2WG0A 1XMOB 4FS8A 4WD3A 2DE0X 3N8DA 4BKQA 3OCJA 3QF4A 3ADPA 1PFGA 5DCUA 4TMVA 5HM6A 1U2EA 1UAAA 3CINA 1CUYA 4C06A 2FHSA 1GPLA 3KE9A 3I5MA 4V1CB 4V0ME 4Z1OA 4E5KA 1O6ZA 2BCGY 4CL3A 2J3IA 1TVKB 3FYUC 4JD5A 3NASA 4HFJA 1Y8ZA 4AJIA 1DEOA 4EI2A 4PGGA 1N8TA 3K6RA 3VO9A 1W36C 3TG8A 5IF3A 3OE7D 3AM3A 3ORQA 2YXPX 1RQXA 2YL2A 2E4WA 1XJQA 5BMVA 1A9RA 5HRCA 5JEEA 2H59A 4BVLA 3DSRA 3JQQA 1E3DA 4LXXA 4W9NA 3U3MA 4PCLA 2I6GA 4JI1B 2PV7A 3REOA 2I29A 3KL4A 1G3QA 4Q3LA 4KUGA 5JS7A 2B4TO 4OBBA 4DCVA 3AERA 3EASA 5JS1A 1CULC 3GZ4A 4L7VA 1SQ6A 2YZMA 3ICEA 3C3YA 5CNJA 2AEJA 1BJRE 1WV1A 4AP9A 1XZBA 2FJPA 1N0HA 2GYVA 3IS3A 4JR1A 4XD7A 3WNQA 1JWLA 1WBDA 3N6XA 2MHCA 4W5QA 4IXNA 1BMQA 2PNJA 3Q3EA 3ACDA 3LRXA 4KGXA 2HU8A 5AW4A 3NJ4A 3L07A 5BVHB 4J6EA 4TPKA 4H18A 3ZD6A 1Z0KA 5JS8A 2ZJ2A 2V6GA 1C0PA 3C16C 2BOVA 1TOAA 1MZVA 2DX7A 5IAKA 3UJAA 1WXEA 1YCHA 3OO0A 2E4UA 1Q0PA 3QMVA 3LBIA 4N6GA 4TTAA 4FFDA 1L7AA 1WE2A 3EQ6A 2ZBEA 3L1KA 3WJ7A 4NONA 3B51X 3OJ0A 1CS0A 3D6FA 4KRYA 5G0WA 3TIFA 4BQQA 4L4ZA 1JILA 3C4JA 4Y2YA 5FTNA 5L7YA 1W0KD 3ROKA 1OC2A 3RUIA 5KWVA 3KSDO 3UPTA 1SG0A 2JHGA 4MS3A 2OUKA 3CX8A 1CJKC 2JLAA 2ZB3A 1M5TA 3MBOA 3ZYZA 3FDZA 1SUSA 5AP9A 5JZ9A 1AS2A 1BMTA 1FYVA 2WD7B 3A9CA 1CYDA 4OLJA 4JOQA 5CYFA 3V2GA 1N2SA 2ZI3A 1MVOA 4IQ0A 1MNQA 4RNDB 4OI2A 3IV6A 1J1ZA 1L9KA 4UMVA 4P4SB 3T1TA 3O8CA 3H18A 5LYJA 2IHKA 4RVCA 2FPOA 5IUJC 4NCBA 2BF4A 2E4VA 5ADUS 1R50A 3AOGA 4XRGA 3C6KA 4RF2A 3SXUB 1RFLA 2HMYB 2AX4A 2X0DA 2POQX 2YVQA 4ZU6X 2JCXA 1VXRA 4HQKA 2HD4A 4RD0A 3VZDA 2HX1A 4X90A 3FYSA 4AYWA 1JB9A 5ICFA 1WHSA 3BQ9A 1A9YA 2ZRQA 3ETHA 4CPDA 1W5SA 4L02A 5TQJA 3A1WA 1CDEA 2HWUA 4KPUB 1SQSA 2PLAA 3UJ9A 2GJ8A 2FAXA 1GLVA 2UYGA 4Q34A 1YZHA 2GK7A 3FTPA 2G1PA 1THTA 1XZAA 2A33A 4LSWA 2H1IA 4MJLA 4CIDA 2E21A 1ETUA 4KPYA 2Q6KA 3A1FA 5TQ2A 1EM8A 3V00A 4DCCA 2PCJA 1Q0RA 3S1SA 3BMCB 1EXMA 4AS2A 2CDCA 3ONDA 4D26A 3LE8A 5A4DA 1O1YA 4YB8A 1RBZA 3M49A 4DCPA 1K98A 3KOXA 1K5HA 2WWXA 3K0BA 2QMEA 2I5PO 2VR1A 1GU1A 3G2PA 3HJAA 4FFNA 3PJRA 1T5BA 2WWTA 2EIXA 4KR2A 4K2HA 5C9ZA 3A6ZA 4AJ9A 2XI4A 1FMFA 2H11A 2F3TA 3O2NA 3Q1KA 3ZGNA 4KI7A 3FCSB 4KREA 4KOAA 4OLAA 2OXEA 3LECA 3WLPA 4D25A 1W35A 1YMUA 1MX5A 1Q1ZA 1T2CA 1TUIA 2GEUA 3THYA 4IVQA 1JLHA 1U04A 4YRBA 3QOFA 1OJLA 1R5BA 2W2LD 4Q9LA 3UAXA 2HT1A 5F21A 4HGPA 3ROTA 1GUBA 4QU8A 4I55F 1RRCA 4X20A 1E4EA 2JFYA 2ID7A 3CSUA 2QAGA 4C0KA 3KV1A 3Q7TA 1S9HA 1Z25A 2IUEA 3FMIA 3OX3A 4Q7KA 4AJ1A 2HV9A 4LY6A 2XQJA 1Y9ZA 4DBZA 4F3NA 3NNDA 5E95A 2QJRA 3MJFA 1Y3FE 1Z4OA 1LFDB 2JJ8A 3PHBE 3KUCA 4JX8A 5BT8A 3KTDA 4GWGA 1IZ9A 4ND4A 1WRBA 5C32A 4CLRA 5LM3A 4FFVA 4XFJA 4RA9B 3Q3GE 4DG5A 3JYPA 1O97D 5CA1B 4OJMX 2XMBA 5AXAA 2QTMA 3AKZA 1U0EA 1NC3A 3D2BA 4EMSA 1JFTA 4BJ1A 3D0QA 3ZE7A 1Y1PA 1I9CA 2VYCA 4WTOA 2VF4X 2ECOA 3QTTA 4TVOA 4BRUA 5JI3E 1E3MA 2HC9A 3VDXA 3KXIA 2WWWA 4ZI7A 1N57A 1F0PA 3KL2A 4EG6A 3OTQA 4WQMA 3GPLA 3BM5A 5GJCA 5BP7A 3HKEA 5J40A 4YRNA 2WM9B 3NWPA 4RVOA 4LZPA 5K3SA 3P0HA 1R0YA 5EP1A 4DYHA 2R47A 3ZE6A 1ODFA 4YFVA 3KZMA 2WPDA 4HSGA 2VYQA 3GRYA 3OX1A 3JTEA 2AI2A 3I2GA 2LGJA 4HPJB 4PLHA 5BNZA 3EMBA 2J45A 3AB7A 3AZOA 1L3CA 2BKVA 4G25A 3M6IA 5C8YF 2PZBA 4TYWA 3ZWKA 4AULA 1KVSA 1ZX1A 2I2AA 5C3MA 1E1NA 3DM9B 1GZSA 4G37A 5CIQA 3IJPA 3RSZA 3WLIA 2D6FA 1OHHD 1HFWA 1BFKA 2ZVQX 4FDTA 4CKYA 3OWXA 4IICA 1KS2A 5KJCA 4FC6A 1E5DA 1R6BX 3CB4A 1R8SA 2E5WA 4BLWA 3OMLA 1IJBA 4LX8A 5IC6A 5L45A 4IVRA 3CRMA 2QTTA 3I53A 4FFBA 3ZWWA 2GESA 2F1JA 3ZDYB 1SCIA 3MGAA 4GPD1 4NYMQ 3ZC3A 1UQRA 5BORA 3LPAA 4X60A 3TXXA 2JGJA 1KI4A 2I66A 3NC4A 4WUVA 2FPPB 2QN3A 3HP4A 3K6SA 1ARZA 3Q9LA 1DJNA 1X7ZB 3B1KA 1BA2A 3B6IA 1K2WA 3N58A 3QMMA 5AKYA 4AO8A 1I33A 3C3PA 3KLBA 5JMWA 2AI1A 1M72A 4YRMA 2J9FB 1ZYUA 2YHSA 4HWTA 4YYZA 1E66A 3O4JA 2OZEA 3KUXA 2QV0A 1OYVA 1SXJB 1GUZA 1XRJA 3GWZA 4YCAA 4YREA 3RHSA 1H42A 1PJQA 1ZOPA 4JHXA 1KQGA 3FROA 2X4IA 3IL2A 1UC9A 1MJFA 1KZ9A 2GHRA 2QTZA 4MV8A 4PAQA 1XGKA 3SF8A 3W8EA 1B8UA 4JJZA 4QDKA 1ACJA 1XYVA 4C1BA 3MAJA 1VB5A 2QQGA 4BVBA 4G5HA 2RAUA 4FT4A 4HEA1 5HYVA 1C3XA 3KEOA 1DWQA 4WBNB 4N65A 1SCUA 4CF4A 3GB9A 3OX2A 1PGPA 4RQBA 4UD2A 2C20A 3G2JA 2IDZA 3SE7A 3YASA 4ER0A 1DAMA 3I1YA 2ZYHA 3G2LA 1KSHA 1ORHA 2IBMA 2VSNA 3ZWPA 1XD2A 2HGZA 1J0CA 5FUVA 1CQJB 1UDWA 3AKYA 4YHBA 3TAXA 1IU9A 3I9OA 3MD9A 2GKOA 1GTVA 3W3AH 4WPGA 2WOJA 3BSSA 4P7KA 3RROA 4JC8A 3NVAA 3F74A 2FYTA 1QUFA 1W96A 2XUPA 2VEDA 1L8QA 2V55B 3IAFA 1NUHA 1GD1O 1ZZEA 3W6OA 3RC7A 4AG6A 2A9KA 1W4BA 3MTAA 1TO6A 5D84A 4XYLA 4PSUA 1MD9A 2OFOA 4NCJA 1C3EA 1CEQA 4G9GA 5DB4A 2WSIA 4DM3A 3DD5A 3K5WA 3FB1A 3B78A 3W2FA 1AH2A 2QN6A 2VNHA 3VPDA 4D3SA 1QDEA 5I9IA 4PNZA 3DCIA 2GNAA 3FYCA 4M54A 1EGVB 2X0RA 3I73A 4NOKA 4RGQA 1T6YA 2VCEA 1BQ4A 3CLTC 1VKZA 1P4GA 2HJ9A 3DOFA 4FEEA 3JV7A 2BI4A 3SG0A 1DUSA 1VHJA 2X7JA 4H35A 1T2EA 4O6VA 4PHGA 1N2OA 4A8JB 1K66A 2O6LA 4C4TA 3DDOA 1WDMA 1NJGA 4ARZB 3U7GA 5AJHA 1YDMA 2VH1A 1Y8RB 3C87A 1H3FA 3CH6A 2IODA 1E3WA 1DAKA 1NAIA 3KOWA 4MEJA 5HXAA 4AKGA 1U94A 2AZTA 2X22A 2ZJOA 2CFSA 2HQ1A 3ZLJA 2NO9A 4HAUA 4MDHA 5C1DA 1ZR4A 2Z2XA 2HR1A 2TSYB 3X2FA 1DI0A 2BONA 1GLNA 1K7YA 5GZ6A 1II8B 2NU7A 4OSEA 4C20A 4JA2A 5DHRA 4KQIA 4EBBA 2C83A 1VCNA 4JUIA 4URWR 1DOAA 4LHSA 5IAGA 4Y2HA 1BFUA 1MDBA 4XB2A 4B43A 3W4JA 1SCJA 3CURA 5CVJA 2GLUA 3KJQA 1DG3A 4W1QA 4FYJA 2IHUA 1O4VA 3DTYA 3N2NA 4JVSB 2JIZD 4BX0A 1HEUA 2VDWA 3GGGA 2HHHB 1TQ2A 1MLDA 3EZFA 5GONA 1R1DA 1EK1A 2EBWA 1DDOA 5KYTA 3A1VA 2NZYA 5REQB 1RU3A 3MYYA 3VJRA 1WSWA 5AJYA 3RF7A 1OZHA 1V1RB 5AICA 1JJAA 1Z3IX 1W4CA 5JBNA 1NBOA 5DCWA 5FL3A 2SKDA 1R16A 2CNWA 2GXSA 2Z6QA 2CLLB 1YF3A 3AIMA 3TLYA 3BJEA 4QJIA 3N2YA 1HTWA 3VZRA 1VMDA 1AO3A 1FJ2A 5JNSA 2X2EA 1Q6ZA 3ZHQA 2J9XB 3L40A 1QNLA 4MQUA 1KFKB 3EARA 1D1TA 2HPAA 4U8HA 5DP2A 1VHDA 1N78A 3PGA1 3N7TA 2VP3A 4A0GA 1S4QA 2QSUA 1XFAA 2OBLA 3GPCA 4WSOA 1QE5A 1TGYA 3FSJX 3P2MA 3PQDA 4FK8A 2VUUA 4UOQA 3U60B 4CMAA 1FW6A 4QUHA 5F12A 1Q57A 1PEYA 4X92A 1XV5A 2IIVA 3H5WA 5HIKA 1YR9A 2CD7A 1FLAA 5LA6B 3NCHA 4BLQA 5DYTA 2PKQO 4JYCA 2VQSA 4IJ5A 4IIFA 3VV3A 1FL9A 5TMPA 2VHYA 3OMXA 4LSZA 2XODA 4YJ2B 1X14A 3AR3A 1UFKA 2GDJA 3OEED 4TN1A 2EYUA 1DOZA 2E5FA 4IQFA 5U4XA 4FMDF 5BR8B 5C35A 1C0LA 4Q1EA 4BX8A 3DVAA 3QG1A 4I4TB 4R31A 3NFRA 4G0WA 1QWOA 4Y6RA 1R88A 2VNSA 5U9CA 3OTGA 1RVV1 2EL9A 4I3GA 3FCCA 3MTEA 4W9NC 3AJEA 3HJFA 1U9YA 2O52A 3LUDA 1X7YB 2PK3A 4PS1A 4Q01A 4QOHA 5B4VA 4ZYTA 4QLAA 5MFPA 2O8FA 3DAPA 3VSCA 3RYHA 4NH4A 5C8VA 1XP8A 3B3AA 5JMOA 1CUVA 2C7RA 2WZCA 4DPKA 3WQSB 2BBTA 4IHJF 4RGBA 3HO1A 2VSFA 1PZGA 1WQ4A 3RU2A 2ZS9A 3T7SA 4QU0A 1R0RE 3N3AC 4FQ8A 3MPOA 4GNRA 4IIEA 2YZ7A 3HVJA 3HB4X 5HPYB 2Q9CA 1SOAA 2ZU6A 2QRNA 4IHQA 1D4AA 4HI0E 4J1TA 3V2HA 3GT4A 1Z75A 3W4IA 2BELA 2ZSBA 1NT2A 3L43A 3PA8A 4N1AA 3SQDA 5K8IA 4O8CA 1DEAA 1ZBQA 3TVDA 4N9WA 3QXHA 1IZ8A 4PN3A 5DWVA 3MBIA 4D9MA 4FILA 3E48A 3Q6NA 2ZQYA 2HRCA 1UJMA 2WM3A 2CJXA 1T0PA 2DFLA 4TV8B 4AJ2A 1FMCA 4QU9A 4EENA 7ABPA 2ODTX 2K7FA 1NR7A 2OVFA 1BGXT 2PZKA 2QTBA 4XVHA 5CBPA 1VE6A 2NNLD 2DSTA 3BDVA 1NI4A 4KWEA 3N07A 2M9MA 3RTAA 3EIWA 3NORA 5AI4A 1FPQA 2IPXA 3I1FA 3TNDA 1OH5A 2CN1A 3A6HA 3PITA 1HWYA 1MQAA 1QCYA 1T1EA 2B7BA 1Z2AA 2D1YA 2AX3A 4D9GA 1Y3HA 1DQNA 3ISVA 4OA8A 1MUUA 4DAOA 1ELOA 3ANSA 3FUTA 3GFTA 2XE4A 4JQZA 1IVSA 3FTDA 3AYXB 1ZY2A 2AJDA 3GRUA 1T9HA 4V0RA 2Y1OA 1OKKA 5DWDA 3RS2A 5CDHA 4PZUA 1Y34E 3OEHD 4C87A 1BD3A 3GLIB 2XCSB 2E49A 2VP9A 1RHKA 3EXIB 4CEJA 1Z6GA 3DV0A 3KPUA 3GA7A 1V3VA 2QMOA 3KV3O 2IUYA 3FETA 2IYWA 3TZHA 1NLUA 1KQOA 1JLMA 2F6RA 3PQ6A 4DLTA 2NSDA 4QGBA 3AKEA 3NXSA 3DL0A 3QBVA 4XUDA 1KVQA 1ZOSA 1I7SB 3WDSA 3LYUA 3CZAA 4M1WA 4FZ3A 4ILEA 1AGRA 2IYQA 2P5YA 4YACA 2XUFA 2Q6LA 4U2GA 3AP1A 1EK6A 4CLOA 4PC2A 3RK4A 3TQOA 5DX8A 4QC2A 4C04A 4LJ5A 4LSMA 1ZD3A 2W48A 2E89A 2OB2A 4BZWA 5BXYA 4EFLA 6REQB 4QDJA 2QPAA 4YYEA 1USKA 3KXLA 2IU4A 3KU1A 3I9NA 3UV6A 5DHFA 1WCIB 5TF4A 2P27A 1ESMA 3UFBA 2IE8A 3LCUA 3KX2A 1J21A 2Q4BA 3JR7A 4EB3A 1V9LA 3PEVA 4MCAA 1RXSA 2BTQB 1MQ8B 3F5SA 3E9NA 3IBTA 4INPA 3TE6A 1IOWA 1V6AA 3G9XA 5LLTA 1CJUC 1ZCFA 1IATA 4FJ0A 4MMZB 2AFHA 2I7DA 5EZYF 3E18A 3WJ2A 1PVDA 1RYMA 1WW8A 4IDNA 2OOSA 4D79A 2LR0A 1GG9A 2PX0A 1VL0A 3SLRA 5HVNA 1XWWA 3O73A 2QZ4A 1RZRD 5HTKA 1ZVMA 4E7PA 2SCUB 5LXTB 4QVKA 1XLUA 2GMWA 1TEXA 4PTYA 2QAGC 4HEA6 5F5XA 3CF4G 2DWUA 4AU1A 1EUQA 1S96A 4CLHA 3RB8A 1X13A 2CUTA 4HVCA 1XTRA 1LPNA 4PANA 2DLNA 3IAS1 4NU8X 4TV9A 4RTMA 2UVDA 1H9AA 1N5LA 2Q5LA 4O33A 3UHOA 3NIFB 3CCFA 3TOVA 1VIDA 2X9QA 5EJ2A 4CLDA 1ENOA 3OU2A 1G20B 3ZW9A 1OFUX 3LSYA 1VRVA 1KYWA 1VC2A 5EPUA 3P4YA 5EIBC 4DYDA 1RAHA 3ND6A 3DOIA 3JQAA 1KNXA 1EUYA 1XB2A 1D2GA 5ESDA 3WJAA 2B8WA 4CQLB 5JS2A 1UBRS 4Y18A 5FBRB 1ODLA 1IMOA 2H00A 3CX6A 3EISA 3CPSA 4G5QA 2HMUA 2VHXA 2I4IA 2QJTA 3IAHA 2NU9B 4EGJA 3HXPA 5LQMA 5KPDA 1L4LA 3FFWA 1UZMA 1PV4A 5K6TA 4QGHA 4RFVA 4ETIA 1A82A 3MJ4A 2X8WA 4BBAA 4CWAA 3RRXA 1NZJA 3WLOA 4FFMA 1GUAA 2WHQA 2O3UA 4UBJA 3RRZA 5JHGB 1KETA 1K4KA 1P1RA 2YZKA 5LD2B 3PTLA 3A6KA 2QNBA 1B26A 3IHLA 1ACLA 5KYNA 4MDYA 1KOFA 1QKKA 2GBIA 3WKEA 1K75A 1V39A 3G5LA 4LC9A 1PGOA 3W6NA 4C7BA 2D0OB 4BP1A 4HNQA 4MVJA 5EJGA 4TUYF 4DSAA 5IVPA 4M7PA 2GCEA 4PO9A 1J6UA 1UINA 2B83A 3OI7A 4O1HA 3K0SA 1XDGA 1Z0SA 5CH8A 2HDOA 3SLKA 4MK4A 1U9JA 3P2JA 1II9A 4YHHB 1XELA 2H2IA 3C8DA 3IOEA 4GR4A 4B8YA 2XZLA 3HL0A 4B82A 1XZEA 5FFFA 4EJ0A 3BSFA 4LYFA 4TWBA 3ZD7A 5KYWB 3KDAA 1N7HA 1TAGA 3LLVA 2EFDB 2GD2A 4EUEA 1HNWB 2TMDA 3FTCA 2Z43A 2ZW9A 1FFXB 4EYOA 1HL3A 1P45A 2C9YA 3X44A 2JLYA 3LWBA 1LJ8A 2ZFUA 4A0FA 1WD5A 5HNKA 4FGKA 5EVCA 4B3RB 1J90A 2P9HA 3ZWBA 2AG0A 4L57A 3THWB 5JXWA 4UVDA 1WMDA 2I9KA 4BN4A 2DERA 5KQMA 5LOVF 1ZFNA 1GG2A 2FEOA 3WG9A 2CGEA 2WSMA 1HSOA 5HQJA 4TVSA 2B0JA 2C4HA 5CYGA 4F06A 4MA0A 1SVNA 4D3DA 3BFJA 4P98A 1PFUA 2CYAA 2VJQA 10MHA 4G86A 2FMTA 3SHWA 2AKEA 1F2TA 5CW1A 3RTGA 5A0VA 4DDVA 1XEFA 2AGVA 1B8PA 4H59A 4DQVA 2ZRPA 3B1FA 1BZYA 4O2BA 1KWGA 3LQQA 3JZIA 5KQPA 4UU8A 3RRBA 3BVPA 3LDAA 3IC5A 1T29A 1X7XA 2AH5A 3D4OA 4L3OA 3O1JC 5BV2P 1V9SA 3HNPA 4HNHA 3ZGXA 4C22A 3LFUA 4UUNA 1Q91A 5HJ7A 4ZVMA 5JC1A 3FR7A 5DN6D 3KJZA 2RK3A 2Q45A 3EOAI 3VVMA 3IUNA 3JWPA 5K8UA 1FTNA 5FA5A 2VYFA 2IYUA 3E81A 3P9XA 4DPMA 1JHOA 3UHJA 2BH9A 1ZRMA 4E1BA 1T9ZA 4DIMA 2NXCA 3OH8A 3RLIA 2WIKA 4WFIA 3SR0A 3UWMA 5G1NA 2IHVA 4CTOA 1RLMA 1SEVA 1W1IA 4LV8B 1OGJA 4MYSA 1AKWA 1IM2A 4CT0A 5ELLA 1XI2A 4JSTA 1VJCA 4C89A 3SJAA 2KQUA 4ZQHA 1VJGA 2VNAA 3DDUA 3NYRA 3NNSA 4MB2A 2EZTA 2ISQA 2NUBA 4I1IA 2I2CA 3ZYCA 2WUVA 2NXEA 1T8TA 3IOCA 1ZMOA 3GJSA 1O0CA 5D85A 4TTQA 4ECAA 2WYWA 2ZRFA 3ZDDA 3RS8A 4O8ZA 2WTBA 3HI6A 2PDAA 4M0FA 4HMOA 1I9GA 2J7PA 2ZCUA 4D9BA 1PAUA 1M2VA 2QLNA 3H0EA 4F9TA 4UTVA 5FHQA 3DBRB 4XR4A 2WSSA 1RHUA 2QSYA 3F6BX 4I1OA 4KO2S 4UDOA 2JRLA 5T5QA 3TSOA 1ISRA 4QUKA 1JMVA 2ICAA 4S0XA 2PO7A 4TMTA 3CZ4A 3MW8A 2QB5A 4MQMA 3WL3A 1DKQA 2A5DA 2NO5A 4LNAA 4XZ3A 3BC1A 3VR0A 3JZAA 1QHSA 4EWLA 3VYVA 2AVDA 2WJAA 5ADWA 3M8KA 2ZVJA 4RGVA 4OEHA 3KETA 2C4MA 4MW6A 3KPYA 4DB4A 3EVNA 5IXYA 3LKZA 4FE7A 2QM3A 3R3UA 3QZUA 4MUAA 2Z4SA 2IV7A 3TUIC 3Q3JB 4ZV9A 3V1LA 4CW7A 4ZHQB 3ADDA 1UJ4A 3EXG2 4K3UA 1RBMA 3GGCA 2AF3C 3IE0A 4QFCA 1O94A 3WSWA 4CM7A 3QUCA 5FBKA 5JNUA 1CQIB 1OBOA 1ONBA 3STVA 2NTYC 1XRQA 1ZOIA 1JIJA 1OLSB 4MQEB 3DDHA 4Q5IA 3GX1A 1AUPA 5BQ5A 3S7TA 4B34A 1XYGA 1XC7A 1JDNA 1T4CA 1U0FA 3MG9A 2F55A 3K9CA 1RLUA 1XRPA 3LH5A 4QTZA 4R5MA 3TLEA 4XFDA 2W70A 4F4CA 1TKAA 2JS7A 2WF6A 3G68A 4GPBA 3A9SA 1T1SA 5DM2A 5DT2A 1LK5A 5AKLA 1YBVA 1TD9A 2VQDA 3FWPA 3OZRA 5ITZA 5JZOA 1NMYA 3M4NA 1XTBA 2YHUA 4R05A 2WB4A 5D3MA 3ZU6A 2CXQA 4DA8A 4OXKA 4QU5A 4GRAA 4WN9B 1EIZA 4R8LA 2QY6A 4ZRNA 2ETVA 2IXAA 2WG1A 3HKBA 2EF0A 3B60A 3IFSA 2Z2IA 3LPLA 5H59A 3VUFA 2HCRA 2QJWA 1CDDA 3T94A 2P4SA 4D8TA 2F3QA 4HGRA 1NQXA 2WG2A 2F67A 1PI3A 1G98A 1X2BA 1L5WA 4PHHA 2CL6X 2XGOA 3D43A 5DLDA 2YDYA 4BGEA 4P0QB 5J1SB 3DUWA 4MPJA 4EO7A 1N6KA 3D6TB 3KXPA 4E32A 2J9GA 1VI2A 1FE8A 2D5LA 2CFRA 3L4KA 1IOZA 4PNHA 2C8LA 5FCDA 5JNRA 3FIJA 2GK4A 2OHOA 3ROQA 3OLCX 1BKYA 3PLNA 3G23A 4G41A 4NP6A 5C5DA 5JCJD 5A5GA 4J1TC 4XD2A 2VLBA 1GFWA 4MUFA 9LDTA 2ZT5A 3A1CA 3DP9A 4M36A 5D01A 4RKQA 5ALXA 1CQWA 2IX3A 3PHGA 2O8VA 2TYSB 1IEXA 2PL5A 1A1SA 1CT9A 1OPRA 3FFBA 3IAS6 3EA0A 3OLZA 4FD3A 5DULA 2QXYA 2BCJQ 1E7SA 2ZI7A 3MPUA 4RVHA 4DSUA 2I91A 2F48A 2OAEA 4ENTA 4X9XA 4LBVA 1QVZA 2JAPA 2JLCA 4I8IA 2BH2A 3REQA 2UXDB 3A4VA 3UT6A 3H1PA 3ONNA 3WQRA 1Q21A 3UC9A 3NH6A 2JLSA 5H81A 1RWNA 4FUQA 3Q11A 1VPEA 4TYQA 3E9ZA 3TQHA 3M3DA 3T9EA 1YBFA 1Y4SA 3IXMA 2AD1A 1LBIA 1NR5A 4K6HA 3RVQA 1PUJA 3KO8A 3W2EA 1Q83A 5LP6A 3PS9A 4P4SA 2OBXA 1GNSA 4XIIA 5DPMA 3OLYA 2C2YA 4BWFB 1N5DA 2B1GA 2V5VA 5EMKA 3RE1A 3MVEA 3ICPA 4Y2SA 3GLGE 2JKYA 4DCNA 1Z22A 121PA 3LC2O 2EJTA 1WSBA 4DNQA 1WXIA 4GLFA 3CLTD 3GRAA 4RVNA 2RGAA 2XZDA 1C8VB 5E2BA 5FV7A 1TJPB 1EP2B 3C7DB 5ALTA 5BT9A 1UC5B 2NZVG 3AR6A 1RRFA 1NG1A 6GPBA 1BXGA 1SOMA 1WZEA 3Q3VA 3NIGB 4L0MA 4GPTA 2WYIA 4PZEA 2HMVA 2EFHB 4F46A 4HNVA 1HZZA 2W4MA 4B71A 5A4JA 1XPUA 4CKZA 4KQ6A 2IXDA 2QZPA 2WJ6A 3MMXA 1B6RA 2R7NA 4FZJA 3DXZA 3L5KA 4I99A 4L7QA 4A26A 5MN5A 3U4QB 2FZLA 2FUKA 2E0IA 3DMHA 5LP1A 3SOZA 3OLVA 4Z8YA 1KMHA 2HLDA 1V6CA 3QE2A 5B6IA 2O8EB 4EGFA 5KOJB 4HDMA 2ZYGA 1H94A 1M2OA 5LBUA 3V1YA 2EKPA 1YDFA 4BXOB 2V5AA 3JATA 4YR7A 4DLPA 4DIOA 3ZGZA 4XAQA 5JHHB 2ZBPA 4ZALA 3N7UA 3G0IA 4AUMA 4EW2A 4Q9NA 4OK3A 4NZYA 1NIPA 2BUAA 2NZ2A 3GN1A 1EGQA 1PT8A 4YDRA 1RI1A 4A82A 4BNFA 3U61B 4M8IA 1EA7A 5IYZF 1H05A 5T4HA 2NVUA 3V4VB 3QUTA 3PENA 3VYRB 3OLXA 1JEQB 4K1XA 5JD3A 2QSZA 4OQYA 4PYKA 2H1SA 4UVIA 3WHKA 1Q7RA 1SVSA 2FFQA 5FOXA 1CERA 2H4JA 2ZM5A 2GN1A 3DJFA 4OGFA 4QHSA 1R6AA 3ERCA 1T0UA 4M3NA 3IVXA 1TKBA 4IIVA 5AKJA 4JQOA 2F8MA 2FF7A 5HIAA 3AEUB 1A5SB 1J09A 1QE0A 2R4QA 4DIFA 5LUBA 3R8CA 4GH5A 4REQB 3WV5A 1KYYA 3PX3A 5LQRA 1EGHA 3Q6IA 1KK3A 4Q7QA 5CDYA 1EWYA 1PN3A 1VXOA 3MCWA 4QBIA 1LBTA 3U7FB 5H3CA 3Q72A 1JW9B 1L7RA 4AZ0B 3NWEA 2VP6A 4BNJA 3ROMA 5J2UB 2QL7A 1Z5WA 3FCUB 1GGNA 3FWZA 3TIIA 4YO7A 2ZAMA 3PE6A 5DCYA 1J70A 1IFXA 2Z9DA 4J7XA 5FAKA 1I7DA 1EIWA 1TL7C 1V7ZA 2W2KB 4WACA 1YHZA 4NFYA 5KX5B 9MHTA 3QKSB 3R7NA 1O08A 3CZMA 2V74B 4AUNA 1E8NA 3L7NA 2FPLA 3PKJA 1QAMA 3HJTA 4DABA 1RC8A 1ECPA 4ABYA 1RQGA 4CCSA 5I7VA 2J48A 1MVNA 1S5PA 2ENUA 1NW6A 1WZCA 3INGA 2JCVA 3OHMA 4Q4JA 4X45A 3ONEA 4KNWA 3O2QB 2B0CA 3OUUA 5CEJA 1SQ0A 3M5WA 1OH8A 5CB4F 3DR5A 1JQBA 1TM3E 4Q3CA 4XKJA 4HQ0A 2DULA 2WK1A 5IXSA 1T5IA 2J4CA 3CVWA 4JBLA 4C0XA 4XGKA 5KYXA 4PCVA 1NN3A 3HA5A 1I8TA 4V0KA 1O5IA 2OAP1 1T4DA 2EFGA 3HG7A 4ER6A 2DB3A 1TVCA 3RT1A 3JYQA 5LNK6 2PUBA 2ECFA 4XD7D 1JAIA 4GQIA 2XKKA 4ABTA 3WE7A 4KQ9A 2PUVA 3DAFA 1UBOS 3PHHA 3LM8A 4LYAA 3B9PA 4CLEA 2A3NA 1Q50A 3MQFA 4EM6A 3BGWA 1PHPA 5IMBA 5K7SA 2HJRA 3HBAA 3BPSA 5JSKA 3JASB 1HE1C 3QX8A 3I9KA 3WA6A 5AW5A 5AUQA 1DRKA 1WZNA 1DKPA 3AIOA 2VTVA 1M8FA 3NALA 3PUHA 3ROEA 2Q2WA 3RSCA 5KKNB 4X65B 1UWCA 2V7GA 3K30A 3U3DA 2NVOA 1RJWA 5EUCA 3GIWA 3V2UA 3MFQA 4ZEWA 2VZ9A 1K5PA 3LQ1A 3PPWA 4WMLA 1G9TA 3HFRA 3NVDA 8OHMA 4XM1A 1DELA 1D1PA 3KCNA 5EJIA 3UMFA 1EFRA 1WR8A 2Z6VA 3RC1A 5CLJA 3KQTA 1S3IA 4M46A 3U7QA 4UFOA 1NA5A 5JEDA 4BO5A 4CV3A 1WPGA 3B1WA 5GZ3A 1E89A 3S8YA 1YB2A 3QE4A 3MWFA 5BWBA 2BGLA 4KR6A 1D7AA 4YQFA 4R5HA 4ILKA 2ZSEA 4N5DA 4Y6QA 5BWOA 2JFNA 2JVJA 4M0MA 2HA5A 1MORA 3F5FA 3LV8A 3PFCA 1CWUA 2ZRHA 3CISA 3M7IA 5DBFA 1A2OA 1Z3CA 3LDFA 4QICA 2VUIB 1FSGA 3K8YA 2Q4EA 5AW1A 5BVGB 2FR1A 1G3UA 2HQBA 1FFEA 2BE9A 3UWOA 3ZVLA 4OMUA 1COZA 3QEAZ 4LOJA 2VRNA 3WK5A 3I01M 1RE0A 5E9QA 1OX6A 2PKRA 3BMOA 5KVSA 3LC0A 2KPOA 5J43A 4OQ4A 3QPVA 5HX7A 2H0AA 3OBIA 2GCNA 1YFJA 1FFYA 1QFZA 2DFKB 2EW1A 1J8DA 2ORIA 5HG0A 3CRW1 4LJKA 1BU5A 1CQJA 3W5CA 2ATVA 4I9HA 5EE3A 3OZTA 1NI3A 3JTMA 4XJTA 5DTQA 2PTHA 3RRJA 5GMOA 1I13A 1TU4A 2D7JA 3TBKA 3UXEA 4RORA 3O4FA 2O7NA 3GT7A 2WAMA 3L0YA 3Q3IA 3AR4A 1UC4B 2O9JA 1L4BA 2YJ4A 4K81B 5CURA 1BIFA 2FPIA 2G07A 3DDCA 3EQZA 1TCUA 3C45A 1O03A 3RWMB 4OH1A 4KR0A 5BYAA 2PT7A 2B1JA 5JATA 3CYFA 4DR6B 2JLQA 2EFCB 3GFQA 1X1EA 3L4BA 4ZZIA 1EGAA 1KMNA 5CA1F 3NEYA 4MS1A 4LJ8A 3BHJA 2XADA 1X7GA 4GU5A 1PLKA 5GM2A 2EL7A 1RXVA 2Z57A 1H66A 2CUNA 2DSNA 2FW6A 4I1YA 3HWX1 5DYWA 4Z49A 2QT0A 2OORA 5CITA 1UPFA 3K4QA 3OIGA 4GWLA 2BFAA 4NVRA 1C4OA 4IGEA 1IY1A 1XF1A 5KYYB 3KJIA 4JQCA 3EHDA 4CM6A 1YA8A 3D5QA 4ZVVA 3OT5A 2XNHA 3H3FA 4W5JA 5CM9C 3HL4A 5EY5B 3WLJA 4C4YA 4P7FA 3RVMA 4DQUA 2C31A 4XVUA 3IHWA 1MJGA 2PH3A 1LQUA 1N6PA 2QPLA 1II8A 4GX0A 2AOTB 4JR2A 3O26A 4R8SA 3BAFA 4DIUA 3BEOA 1TT5A 5AI9A 2WZBA 3KAPA 1A8QA 4KQJA 4BQNA 4ENWA 2GAAA 2X23A 5BN4A 5KOYA 4YALA 1JYEA 2DPGA 4Z3KA 5JD6A 3LK6A 1RD4A 1R0KA 3E9RA 5AO9A 1U28A 5GJVC 3BF8A 5IJ9A 2J3DA 1EH5A 1YL6A 3QFCA 2F8SA 4XWGA 2A58A 2Q28A 2YV5A 3ZWYA 1AV7A 4CI0B 3VOTA 2WJYA 2QRKA 1RWPA 3QEBZ 3EXHA 1CF9A 2QN7A 2QLTA 5JYEA 3M9XA 5ARDA 3IAXA 3F6YA 4FNAA 3NLLA 3STYA 4FHZA 2EP5A 1JPVA 1UBKS 2W37A 3F9IA 2XEDA 4NCNA 3OT4A 1UXJA 1XWFA 3PVZA 1UFVA 4N39A 5HF6A 1Y9AA 3O6VA 1O94C 4MWEA 1VDMA 4AWBA 1PYOA 5JSZB 3G0BA 2CCJA 3AF5A 2XDAA 1R5OA 4RYDA 2XBMA 3T7RA 1V3QE 3A4NA 3OZCA 4IDOA 4LJYA 1VCMA 2QVBA 3H05A 1P1FA 3NO4A 4Y1FA 2AS0A 3TLGB 3UMYA 5SZJA 1TA4A 2ZZNA 4EZBA 2ZGVA 1E1CB 1VE1A 1XA3A 2CY0A 2ZEJA 3PHLA 2WUEA 5CX1B 2I99A 3H2KA 3ZNQA 4Q1CA 3GHYA 3QK7A 3HYRA 1BWRA 1QBGA 3OTWA 1YB7A 2PQ2A 2XD9A 1E4YA 4JB8A 1PEDA 1H0KA 3D2AA 3DE2X 4MKRA 5K2OA 2BAGA 1ODJA 2YJNA 4Q12A 3RFTA 1EUDB 4ADSG 8MHTA 1U9ZA 1H8EA 4B47A 1LPSA 1JG7A 2LCIA 2J41A 5IM4A 4FYYA 2GFQA 1XVLA 1NBWB 4LZZA 3SIPA 1KDTA 2GPTA 2YFKA 3EC1A 4LYEA 2JGKA 5BQXA 1RABA 1ZSNA 2JAOA 1J2UA 2W8BA 4OHXA 3P2IA 4CKCA 1QIIA 4F4DA 1A4XA 2P41A 1CUHA 3MUEA 3F2VA 4P36A 3U4HA 4D8UA 3NFYA 4EHKA 2YVLA 4D92A 1L5OA 4OPMA 4FOSA 5A4KA 3T4EA 1LWNA 1Q74A 3LLSA 3EVDA 2XF8A 2YC2C 4BIMA 3FRIA 1RMTA 2QRHA 2P0EA 2ZJ3A 3IAAA 3DHEA 5K0ZA 1CLEA 2OB1A 2R6ZA 4XE5A 1F0YA 4RPCA 2B36A 1RDFA 1B8OA 3QLTA 4KP7A 1JQEA 2TECE 4LMRA 3CG0A 5KYKA 1B4DA 4OYRA 4P2GA 1KIAA 3CFYA 5CX4A 1J97A 16PKA 3CLHA 2QI9C 5DK6A 3TIVA 1KEWA 3A1UA 5I4BA 4LYDA 4E2YA 1R74A 2UUBB 3R9XB 2QG6A 2R44A 3GN2A 2NZJA 5A5FA 2PUEA 3AY6A 2YJ3A 3F6PA 1G8HA 5F9MA 5EWMA 1I51A 3BD7A 1YR8A 1DQRA 3W5HA 4X85A 4CLXA 3P7MA 1WL8A 3ZOZA 2PUJA 3DDSA 2NYAA 5FNVB 1IAVA 5MN6A 1G16A 2WTXA 3LUAA 1FNNA 4H3SA 4GD3Q 3EGIA 2ZIUB 3R77A 3UJ6A 4GYJA 2VSOA 5EJ7A 4QFMA 4CEIA 1RI3A 4HTFB 2BR3A 2BHNA 3RYFB 2SBTA 2XVAA 4PHCA 2B8TA 4WWHA 3WGJA 5IT4A 2HHAA 1Z17A 2I7VA 4W8HA 3GT0A 3G8CA 4GE0A 1V47A 1F2VA 1QRAA 1A8PA 1RWOA 3F1LA 1P2GA 5BR1A 3I83A 5ALIA 4CQMA 5JXGA 4EAQA 1PK8A 3RFCA 3HSKA 1THMA 1NKVA 4D2IA 3Q1LA 4LTMA 5J5VA 3KB2A 4YMVA 2GCIA 3TQIA 5J1TB 1WXDA 4LVCA 4JR0A 3VR6H 4RHCA 1K3FA 2RK4A 3L5OA 5CFRA 3RD5A 1IEWA 3BL5A 1FA9A 3F3MA 4BMZA 4L8VA 3AI2A 3OPNA 3TLCA 5L9AA 3NCTA 4KDFA 3A4IA 2HA3A 2R65A 4Z3DA 2ERCA 3KKZA 5LYYA 3A1DA 1E3JA 1C8BA 1UANA 3AZPA 4D3ZA 5AW9A 5DM70 5DMXA 4NCAA 1HZZC 1VLVA 1ADYA 3D8SA 3L4SO 3U6KA 1A8HA 1RCUA 4UE6A 4E46A 4WESA 3H1AA 3T8YA 5KHLB 2YKGA 2EV9A 3DCJA 1MO5A 2IRWA 3W7AA 3KQQA 3TR5A 2HUPA 4E2FA 4EB0A 4YC7A 1Y8AA 4OY3A 2PWPA 4OFWA 5KVCA 4EW3A 2IS6A 4EHJA 1YS1X 1PYDA 2HF7A 2D0IA 2UZ1B 1HLFA 2CVQA 4LHYA 4EB8A 1ZN2A 4EYEA 4U00A 1RM0A 4N3CA 5LPNA 3LU1A 2XHZA 3WVNA 2FWPA 4DREA 4KDRA 1FX1A 1OYWA 3NHPA 4YAOA 5DM1A 3AGQA 5E9JA 3OHSX 2XMDA 1L5HB 1HK7A 1Y8QA 1N0IA 1YS9A 2OVBA 1X80B 2VHWA 4LXYA 3LWZA 4Q02A 1EI9A 5JRZA 5C1IA 4DR1B 2X7XA 4J7UA 2QJOA 1J8MF 1U0LA 2QRQA 1QTNA 3GJ0A 4MI3A 5LA6F 2OG1A 2QRMA 3HI4A 2HSGA 3G6KA 4LZLA 4EF5A 3N74A 5LZ2A 3V46A 4WVLA 1APBA 3IVGA 1NUSA 1F4LA 1FDVA 1JDPA 3F90A 3H8JA 4YJ2F 2CNWD 2XA9A 3NAZA 3VSBA 2ACKA 4W7IA 3AZQA 3ZLVA 3OMWA 3WO0A 3KQHA 3E22B 4FNOA 1WSDA 2EOAA 4C7OB 1OI4A 4BNMA 4KQKA 2QZJA 4P08A 4WJKB 1RBYA 4I4TF 1V7QA 2VDMB 3KOUA 3BRCA 3THXA 1QJ4A 1VJDA 2A84A 5LXTA 3U49A 1NVMB 1FXUA 3FUUA 4YMIA 4MWGA 1YJXA 3ZV6A 5EE0A 2B5WA 4I5FA 1UXKA 2Q0SA 2QZZA 2BFEB 3IUSA 4K40A 4RVUA 2A88A 3WQHA 2JIQA 2BFFA 3KOOA 4JENA 2HWKA 4KIFA 5U1PA 3BK2A 4U2BA 1GN9A 1LTQA 2CV2A 1OTYA 1G8FA 4X93A 2P78A 4Q05A 1F51E 4ID9A 2CJWA 1M8JA 1JZQA 2DYKA 4GS5A 1KO7A 1HMYA 1VMAA 4EAAA 2QP9X 3T15A 3AKDA 3JWJA 4FZ5A 3TIGA 2Q99A 1KSGA 5B6JA 1J25A 4ZIRB 3N2GB 1V1JA 1VCIA 1Q1EA 1EVEA 1C9EA 2VZ8A 4WBXC 4RTOA 4Y1RB 1PSZA 1GPNA 3Q2KA 4HNUA 3EQ2A 2PUDA 3E8XA 4H31A 4BFVA 4TV8F 1YOBA 3HZRA 3K0AB 4LHZA 1H1LB 1U9IA 2X0IA 1WLSA 3BREA 3BIJA 3HB1A 5TQ0B 1K8YB 4Q15A 4E5YA 2PKCA 4JJFA 1NXQA 3KELA 1O3YA 4X24A 2H3HA 3J80A 1GTJ1 2DETA 2BGKA 5EIOA 1SM4A 4OQFA 3X1WA 5JXIA 1ZNQO 5TT0A 1C50A 4MP6A 4MVJG 4KUHA 1N8NA 5IKXA 3O1HB 3UWSA 2G4CA 1OGYA 1SCKA 4WXMA 4YAFA 5L3SB 1EB9A 2VJDA 1SXQA 5DFAA 3QHAA 3G02A 4JUFA 5FR1A 3W3ZB 1CY7A 4XGQA 1P80A 2FUEA 3U6BA 1NMZA 5IAJA 3F8TA 2W71A 1DXOA 4MA4A 3RO7A 4G4JA 3TOZA 4B44A 2JLWA 1HGXA 2PD4A 4XASA 1XTUA 2J0VA 5JIBA 4IJUA 1GCAA 2MSEB 2WIJA 4E5UA 1E1LA 1M2FA 3K9WA 4EJFA 4WGGA 1R10A 3PC2A 1Y98A 2VJBA 3PDWA 4EKEA 1GGHA 1T26A 1U8FO 2EZUA 1SUWA 2NTEA 5DLEA 2Y3IA 4R1UA 1MPXA 1P5ZB 5E9AA 3RKRA 4U3JB 4FPXA 4F5ZA 5JE8A 3D1LA 5JPIA 2EKBA 2JASA 2DTDA 2YYZA 3OKPA 3ZHTA 3USCS 5IHPA 4A5SA 3K6JA 1NQ5A 3IPAA 4DA7A 3GG2A 2BKUA 4YRTA 1SU6A 1SXJC 2FCAA 4QXQA 4UHCA 1XF9A 2IZZA 3O83A 2LWIA 3KZ1E 2R86A 2EXXA 3O03A 3KWFA 5B57C 3MAGA 4BO9A 4FFOA 4U0KA 3NP9A 5ICGA 5IU6A 1OKKD 3DTTA 2RGYA 3TGLA 2FMFA 2CBGA 1F5NA 1X1AA 3I8SA 2O48X 4BEJA