3K9WA

Crystal structure of phosphopantetheine adenylyltransferase from burkholderia pseudomallei with hydrolyzed 3'-dephospho coenzyme a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
163
structure length
163
Chain Sequence
b'GSMVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFFSLEERLKIANEVLGHYPNVKVMGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Structures of phosphopantetheine adenylyltransferase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 62
structure length 163
sequence length 163
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3k9wA00
2DXIA 3PRHA 1KP2A 4H3SA 4YP7A 4GRIA 4MWEA 4DDMA 5K0TA 3SYTA 4ZT3A 1O5TA 4MUJA 1Q15A 3FG9A 3G5AA 1EXDA 4CDMA 3LE8A 1I6MA 3GUZA 2A1TR 1JZSA 4MW2A 5HUHA 2AKEA 2CUZA 4P2BA 3FETA 3P0IA 5BNZA 4MWBA 4X0EA 4Q16A 5EKDA 1GZUA 3UOWA 3TZLA 4I6EA 4MW4A 2VTBB 1XJQA 1U7XA 4F4HA 4ARCA 2X1LA 1QRUA 4MVYA 1KKUA 3ZJUA 4NAHA 2CV2A 4KPUA 3AFHA 4JFAA 4PY2A 3X1MA 1K97A 3TZEA 1TFUA 1J1ZA 1VBKA 2V0CA 2O8VA 4MUIA 3ND6A 3VGJA 2IP1A 4MLPA 1UFVA 1EFPA 3CLSD 4EG1A 1H3EA 4DE5A 1A8HA 3A4IA 3UC5A 4MVCA 1NUPA 1KP3A 1H3FA 1VBMA 3D6UA 5LM3A 2R5WA 2CYCA 1JGTA 2A88A 2YWCA 1S4MA 4YBRA 4CT0A 4DJAA 4OUDA 4Q93A 2ZUEA 1GPMA 1F7VA 1JHDA 3TQOA 3Q12A 1LI5A 1U7DA 1WXHA 3RFFA 1N1DA 1EFVA 3G6KA 1KAQA 3FY4A 5JBNA 3U1VA 4R2LA 1N2GA 4MUKA 3Q4GA 3ZJVA 1F4LA 3RK0A 1YI8A 3COZA 4KKVA 1IFXA 1KQOA 1J20A 1O97C 2X1MA 3MLBA 2QUHA 1GTRA 1U0BB 1JZQA 2A1UB 1U3DA 3OTWA 1KH2A 1LW7A 4F3RA 1MOPA 2QUIA 3Q10A 5TGTA 2D5BA 3IVGA 5HG0A 2RD2A 1T6YA 1TYDE 4EG3A 1JMVA 1OWLA 3COVA 4MVWA 1PG0A 1WQ3A 3TS1A 2D54A 5TEVA 4HPWA 2QTRA 2GKSA 1G8HA 4UZFA 4JXXA 5LLTA 3INNA 1GN8A 4OJMX 2CT8A 3IVXA 3NBAA 2CV0A 3KT0A 1H1TA 4MUEA 3MLAA 3FH0A 1O95D 1R6TA 1OWMA 2EL7A 2WQ6A 1N2HA 2E18A 4WSOA 3C8ZA 4KR9A 2BTEA 3KT3A 3ND5A 5DASA 2D13A 1LI7A 2PG3A 1N2JA 2DR2A 1O94C 4MUNA 1YULA 1CT9A 3KT6A 1WQ4A 4MQ6A 3I05A 1WOYA 5DK4A 1WXIA 3IUBA 3SP1A 1NUQA 2Z08A 3MUEA 4ZT4A 1PFVA 5KWVA 1WXGA 4PBSA 1N78A 3CLTD 2ZUFA 2A86A 3VU8A 1NUTA 1O97D 1TYBE 3LCJA 1NI5A 3SZ3A 1QU3A 4EG5A 4EG7A 5FO1A 1MBZA 4HK4A 1SURA 1EUYA 2JAXA 2J5BA 1J1UA 1F7UA 3TQIA 5IHXA 1B6TA 1HYBA 1YIDA 1WKBA 1KAMA 3L92A 1IVSA 1TQ8A 5TEWA 2E89A 2A84A 3X1KA 4DDHA 1IH8A 3ILVA 1MAUA 3ZUGA 1K4KA 2QTMA 4ZCTA 4XFJA 1D2RA 1JEEA 1MRZA 4I6GA 2PIDA 3K9WA 4MWCA 4MW0A 2QJTA 3CLRC 2YY5A 1J09A 1I2DA 4L2IA 4NAUA 3ZXIA 2I1LA 1O95C 1R6XA 2CYBA 3VRHA 2AZXA 1QNFA 1G59A 1O96A 1JECA 1O94D 1ZH0A 1NURA 1QTQA 3FDXA 3SEZA 1N77A 4KR7A 3AG5A 4ZT5A 1KQPA 1O0BA 1GTSA 1MB9A 2QUJA 3AL0C 1O6BA 2A1TS 3DPIA 4K0RA 2A7XA 1Q11A 2PZBA 3IODA 1X6VA 1F9AA 2AG6A 1T6XA 3D6VA 3CLTC 1T6ZA 2BYTA 3ISJA 3HV0A 2CV1A 2WSIA 2V0GA 3AKZA 1OWPA 3F3MA 1PFWA 3RJZA 1YUMA 3DLAA 1T9GS 2YXNA 4NZPA 4U63A 2E0IA 1NSYA 4QBTA 5F23A 5H7XA 4DLPA 4A91A 3KFLA 4DDKA 1IRXA 3CLUD 1P7PA 4ND6A 5KCMA 3QTTA 5H16A 3SEQA 1ZJWA 4YP6A 1QRSA 3H9BA 4QRDA 4MWDA 3CLRD 4JXZA 2PFSA 3IUEA 1RQGA 5FNZA 1M8KA 4ZT7A 3FI0A 2QTNA 3N8HA 1TYAE 3COYA 4FZJA 4YP5A 1R6UA 1Q77A 2VXOA 4ZCPA 2DERA 1GAXA 2EJCA 4OUDB 1VLHA 1OD6A 4G5FA 3ND7A 4CQNA 1EFVB 2GOYA 4NATA 3TNJA 2PZ8A 5K0SA 1KR2A 3NV7A 2VTBA 2DETA 3A2KA 1M83A 4K03A 5DEOA 3RHSA 1Q19A 1K4MA 2HMAA 4ZT6A 4PBRA 2Z09A 2DUMA 1EUQA 1PFUA 1MAWA 4I6JA 3G59A 4UZEA 1XNGA 3CVXA 4MW9A 1K92A 3M5WA 4R0NA 3QTBA 3ELBA 1PFYA 3S3TA 3P0HA 3IVCA 1KQNA 3RK1A 4QREA 3N9IA 4J75A 2GM3A 2X3FA 4AS1A 2DPLA 2RE8A 1JIJA 1FYDA 5LFAA 3PNYA 1JIKA 1N2IA 1OBHA 3SDBA 2Z3VA 1J21A 3IMEA 3DO8A 3L93A 4ZCRA 3MXTA 4XFDA 2CYAA 3N2YA 1EE1A 2QUKA 3HZRA 4G6ZA 3IOCA 4JZYA 3CLUC 3IH5A 4KR6A 3HFJA 1ZH6A 2E21A 1NZJA 2WQ7A 3P52A 1COZA 1DNPA 1M8JA 3RBAA 3PNVA 3FWKA 3A05A 1BS2A 3GLVA 3MMXA 2X0KA 5IJXA 2H2AA 4G5YA 3BL5A 5J59A 5DB4A 1OBCA 1QQTA 1V47A 1QJCA 4MW6A 4S1OA 1G8GA 2A1UA 2CFOA 3HGMA 2DLCX 1PG2A 1IQ0A 2NZ2A 1O0CA 4DNXA 4MVXA 2J09A 1VBNA 3IDFA 1IHOA 3N05A 1T9GR 4ZT2A 1MC1A 1M1ZA 2HGZA 1IQRA 2A4MA 4ZCQA 1ZUNA 4BWVA 3E27A 2IELA 3K32A 2QJFA 1XNJA 4TS1A 1N2BA 4EG8A 3HL4A 2NSYA 4MULA 4AQ7A 1GLNA 3FIUA 2JANA 3PNBA 4MW7A 1N75A 3UK2A 2OQ2A 1WJGA 3AG6A 4NX2A 3CVUA 2PXHA 3PXUA 2CSXA 2JA2A 4E1AA 2ZP1A 1XNHA 1YUNA 1M8FA 3SZGA 5AHWA 1NUSA 3CVVA 3FNRA 2H29A 3X1JA 3A04A 3ZJTA 1I6LA 3AIIA 1ILEA 2HZ7A 3H97A 1OWOA 4KPUB 1JILA 3FOCA 2J07A 4MUGA 1J70A 3IOBA 5FO0A 4RUKA 2PZAA 2DEUA 4U8HA 3QE4A 3FHJA 4PBTA 4HJXA 4NDAA 3NBKA 1EFPB 4EG6A 4ARIA 1QU2A 4L2IB 1WY5A 4HJRA 4MW5A 5J5AA 4EFKA 2O5RA 1WXEA 2QJOA 1G8FA 5HUJA 1N2OA 1JEDA 1U3CA 1I6KA 3UMVA 4EGAA 4YMIA 1O96B 1TEZA 2J08A 1NYLA 3GMIA 3JXEA 1IQUA 3UY4A 3CVWA 1TYCA 3HMQA 4EG4A 3KT8A 3OP1A 4MW1A 4ZCSA 1EJ2A 1MJHA 5J58A 1JIIA 1X8XA 3ZXSA 3ZGZA 1FFYA 3COWA 3CR8A 5TS2A 1N2EA 2B7LA 3DV2A 3CVYA 1KORA 1QRTA 2YWBA 1M8GA 2XRZA 1NP7A 4U7JA 4MUHA 4J76A 1YIAA 2WB2A 2IJGX 4CDNA 1WZ2A 2J4DA 1KH3A 2C5SA 3IMCA 4ND7A 3CLSC 3IOEA 1Y42X 4EF6A 1OWNA 4XSVA 3ZIUA 4WNYA 1ULHA 1N3LA 1WXFA 3H99A 3P0JA 4GU5A 4MAFA 2XRYA 4MUFA 5KHAA 3LOQA 4JYZA 4RPIA 1NUUA 3H05A 4R2MA 1V8FA 2G36A 1M8PA 1MB2A 2TS1A 3IMGA 1H3NA 1KH1A 1VL2A 3H9CA 3CA8A 2OV4A
chains in the Genus database with same CATH superfamily
2XWQA 3B9BA 1WMSA 4YXWA 3UV7A 1A9OA 1NVMB 2BDUA 2YC2C 1F4PA 4AF6A 4B80A 5DBGA 4F84A 3WKCA 3KYBA 1W96A 4KMSA 3L7YA 4QGSA 5LQAA 1QKKA 4X61A 3JAKA 1DV2A 1NKVA 4QRHA 1A77A 4YMGA 3QGMA 1K6EA 1SKQA 4NP6A 4RL6A 3DBOB 4D4MA 1LRKA 2OWEA 4ITVA 5SYMA 2JLVA 1HZJA 2F2TA 5FV4A 1OGIA 2BGRA 2JJ1D 4ZRDA 5SZHB 2JDID 5ALZA 5BNZA 4UUBA 3U37A 2HIAA 4UNPA 4L4YA 5KREA 3IMFA 4IQFA 4DLWA 4PXAA 3PZBA 3ZEAA 5B7PA 2NADA 2TECE 3A4YA 1XIVA 4KZKA 4Y7CA 1QHXA 2W93A 3WGGA 5MFZA 4OBBA 2ZETA 4U7DA 1SUAA 2MYUA 2BUBA 4Q4CA 3LUAA 1I1OA 3EC7A 5E9QA 1LF5A 3OIUA 1X2EA 2HMUA 1XLUA 3W5IA 2JRLA 2O2XA 4L51A 1VBKA 3MUOA 4EKYA 2I2WA 5ILOA 5DVZA 2VP9A 2W6ZA 2YWXA 2O19A 3PDWA 2ZS8A 1Z3IX 1Q7EA 1N7IA 3VKUA 1L5SA 1QHHB 1H3EA 5M7EA 2QIPA 1RZRA 1ZG3A 3I09A 4QTUB 2Q1XA 3AJ9A 4EF5A 1TM5E 3ESXA 4XXHA 3O91A 4JQOA 1KP3A 1DLIA 1IM8A 5DZSA 2HQBA 2IYQA 5IMBA 5A7GA 3TTYA 1NX6A 1Z47A 3D0RA 4DBLE 8ABPA 5K20A 3RI3A 3ZH2A 2NUPA 4U5XA 4ME6A 3WLLA 1UFQA 2R7KA 5C1DA 2PYZA 1NQ5A 3ZWMA 4E5MA 3I6QA 4TLLB 3O6VA 4YBRA 3JZMA 2DPGA 2VPTA 4LRWA 2HUPA 4HOYA 3IAXA 5MDHA 4ER6A 1GPMA 1ZIYA 1Q1GA 4G1CA 5EQTA 4CV0A 2QG4A 3A4VA 4DT1B 2G09A 2XMDA 5ER6A 5CB8A 3FCAA 1DAPA 1KAQA 2HQ1A 2C3MA 2H1WA 4BZWA 6AT1A 5F12A 3CRZA 3TLBA 1JHXA 3IQDB 3FFBA 1WIWA 1KDPA 2QRPA 4G1VA 1Z8DA 3CGGA 4JY7A 2I55A 2FWIA 1MHPA 3NBXX 1X1QA 2ON6A 4K6OA 4MKZA 4BC0A 3C7TA 3KQSA 1C8LA 2GJAA 1T6BY 3DMFA 4QPDA 3R3JA 4WLVA 3G89A 3F6PA 1TKCA 3GDGA 3L9XA 3IDQA 1ZIPA 3OPNA 2GBIA 2O7NA 4B2LA 2AN5A 3BUSA 3IR5A 4FE7A 4L0CA 1C30A 2QUIA 3GN1A 4N8SA 2G77B 4WDQA 3VDQA 5FBVB 4NMXB 4IFEA 1E2GA 2QR3A 3NS7A 2RD2A 4UNNA 3PUXA 3M83A 1KY4A 4X5OA 2X76A 1S8FA 1JKJA 1PG0A 3EZ6A 3DULA 4RAOA 1WQ3A 4FK8A 1ZC3A 3K0EA 4IUYA 4UOQA 2BEWB 3LK6A 3DL2A 3LXXA 4IDEA 1AIPA 5HE9A 4HPWA 1XAGA 4IHQA 4EABA 3H84A 4JFRA 1ABEA 4U9HS 4X20B 4PXSA 3HY4A 1JQLB 2Y0BA 3NKFA 4KVAA 4G07A 5DHSA 4UEOA 5FOVA 3RQSA 3V2UA 4BO3A 5IT9A 1V9CA 2BR4A 5IAAA 5BYJA 5IJ9B 1RKBA 4CE6A 1P8JA 2B99A 2V45A 4TRNA 3BMNB 3ZU4A 4OVKA 1PW7A 3W4JA 1FK8A 5SICE 4HQNA 3WNVA 1J0CA 3EUFA 5CBPB 5LQUA 3NASA 1VL0A 4RTQA 2EL7A 1EGHA 2LIVA 3FB1A 3Q0IA 4PYRA 3RS8A 1SRQA 2OECA 2WPDA 2XITA 3VYUB 3DT9A 1GWNA 1PR3A 3FPJA 3HCCA 4L5BA 1VPDA 1MVNA 1BVYF 3QVOA 3AESA 3GZNB 4TLAA 3RYIA 4RH0A 2YXBA 3BE5A 1EX9A 1XRPA 2XB6A 3PFFA 3CPJB 1H6CA 1D04A 2ZJ6A 1V0JA 4TN1A 1WOYA 4JODA 1DRJA 4M1EA 2CNKA 4G8CA 5CJJA 3UGKA 3ORYA 1L5VA 1G3UA 1Z7GA 2B8EA 2I2XB 3REFA 3TLEA 2Z08A 1PFVA 1I4LD 3QV2A 3TB6A 3AUTA 2AX4A 2A2ZA 3L1HA 3K8YA 4LX8A 1F1JA 3UMSA 4EX6A 1SXJA 4RSHA 4O33A 3BQ9A 4MR7B 3ZTTA 1VSTA 4AF8A 4LRYA 5KNLA 2PUDA 4KN8A 2FZ5A 3R6WA 4NZYA 1P1JA 3JQAD 1M2KA 4GQIA 1GCAA 1DBRA 5GIPE 3MTAA 2WUFA 3BRWD 2YV1A 4EY7A 3OZXA 3PF9A 1DC3A 3RKSA 4Y3UA 1YQDA 3U2QA 1CHDA 5ARCA 3E9DA 4LYFA 3THRA 3V33A 5KU7A 1Z83A 1DBIA 1ZPDA 2O3SA 3EGDA 1N34B 1YCGA 3A6HA 5CDHA 4QULA 2AEMA 2NXNA 2P6MA 3W34A 4V0LA 4AY4A 3RAJA 1PS9A 2J4CA 3G0OA 1NQUA 2QWXA 3G2JA 5IAEA 3OZSA 4EUSA 4LKRA 1BDIA 4OL9A 1RKVA 1KPHA 4EI7A 3OPMA 3AR5A 3HRIA 1LBIA 4NH4A 2NU9B 3VDNB 3LGAA 3GFRA 1NQOA 3AX6A 1RHRA 3SQXA 2GKOA 4FP9A 3ETDA 3BMOB 4JP5A 1WF6A 1ZUIA 2A9QA 4AT1A 1ZMXA 3NAZA 3H04A 4E5DA 4CN8A 5AW3A 5EJEA 2FSIA 2COKA 2WQ7A 2QBYA 4FWBA 3GO4A 4YJFB 2VLBA 2R66A 2C8VA 2ZTLA 3KFXA 2V7BA 2NT3A 1KF0A 3HVUA 4RAQA 3EEYA 3ZDBA 1LI4A 3OZGA 4UDYX 3WLTA 3AF2A 3GQBB 3DE6X 3GIWA 2LXNA 3JQ6A 4UASA 4FC7A 2Q3BA 4YB8A 1N4DA 2P1DA 3K0CA 1Y1PA 2PPVA 5ESXA 1U3GA 2J45A 1UK6A 4KQXA 3ADBA 3V7WA 2WIBA 4GOJA 3FDXA 1TK9A 5GZ6A 5KYYB 1M2EA 2C7OA 4PSAA 1ZJ6A 2FPIA 3FGNA 1N77A 1ZD3A 1NJ8A 3C3CA 4KR7A 1GT6A 4C20A 4ENUA 1UJCA 3CUUA 3FOZA 4MV7A 3K73O 3H4IA 4O5OA 3BMQB 5JSKA 1NR1A 4BLWA 3WICA 4CLOA 2PN1A 3KV3O 1G3QA 4GEKA 1JFFA 4PFQA 1UANA 3OPYA 1UUFA 2NVWA 3IQXA 1K8QA 4ZVOA 3RSFA 2N1MA 3D6NB 1KVUA 1VKRA 1N6PA 2VNAA 4C4XA 4PR0A 1T6ZA 1XA3A 3BDIA 1DC4A 2WNSA 1YONA 4Q4DA 1BX0A 2OO5C 2EJTA 5TMDA 3ICVA 3LXUX 3HUUA 5CFOA 5BQXA 2AA3A 1YB7A 2H4JA 2X9QA 4MIOA 3DMDA 5FA6A 1I3MA 2EZ4A 1E1CB 4MICA 3S2YA 3DTVA 3KSZO 2WAXA 3QFRA 4TT3D 4BB6A 3CUYA 4D8XA 1XELA 3K4HA 3QIVA 3MWYW 2H3HA 3L1KA 3EQ9A 2AZ4A 5DBFA 3ZU2A 4OKSA 3ON5A 4Q1EA 3LYLA 1RWWA 4R8VA 4Y0AA 4ITUA 4EA8A 5L4NA 1Z68A 1V16B 3W2HA 1XXLA 3QLTA 1IC6A 1NW3A 1XEXA 1XMIA 2ZRAA 2VP4A 2F90A 3DV0A 3KB2A 3OKFA 3KK0A 3PGLA 1USWA 5TSDA 2HCJB 5LD2C 4GL2A 3P0EA 2PXCA 4M7OA 4RGQA 3GRUA 4A0SA 1X74A 2IYOA 2IUEA 1AN9A 1TT5B 3RODA 3D43A 3UMJA 4JLJA 4COOA 5AK5A 3KQQA 1IL0A 1VG9B 1E6MA 4Y2VA 1M8KA 1F51E 4BV3A 3OIYA 1TZCA 4OFBA 2QTNA 1CR6A 1Q0PA 4TXLA 1JXQA 5JNWA 1PGJA 2C7QA 4BGDA 8MHTA 5D3MB 2BFEA 2VF7A 1GQFA 3BIXA 2V1XA 1L0BA 5DNEA 1R5OA 3F73A 1L7BA 4MWSA 3ZKWB 3PS9A 5D1NA 5DM60 4LF6B 3QMMA 4C0BA 2RG7A 1OD6A 3BJIC 4CF6A 3LCUA 3RAGA 3WLAA 4G0NA 5I9MA 3T3HA 2GEVA 2JH8A 1XAJA 4W7SA 4JLAA 3A1DA 3O95A 4I8XA 2VYQA 5C7OO 1T1SA 1XZ8A 3DT8A 4MEBA 1RS0A 4WK2B 1UXGA 4PINA 4X6UA 3TNJA 4AZTA 2LW7A 3ZV7A 3HEBA 4BATA 2KE5A 3DDCA 3VC2A 4LJ4A 4K9KA 3WK5A 2QM3A 4P3YA 1XO1A 2VJPA 4LFAB 3NOVA 2I54A 1XLWA 2AEFA 3QU4A 4KQFA 4UZEA 1LSUA 3IMKA 2NVUB 4HH1A 3T7KA 3W5HA 2EBHX 1KC1A 2L69A 3Q7EA 5DP1A 5HM6A 5JVDB 4P81A 3A9WA 4E14A 2BGJA 2OFXA 4Y7DA 2CNDA 3GOQA 1J7KA 1LY1A 2ZANA 4IEEA 3V2HA 1MOSA 3CF0A 3GLGB 3GAFA 3N9IA 1LD3A 1A82A 4LJYA 4FYJA 2HK9A 3EUAA 3N8GA 3OU7A 3BZUA 4FNOA 2NXJA 2X3FA 3SE7A 2RHMA 3BCUA 4QWWA 4PLFA 3DKRA 1UEJA 4RWZA 1E6EA 4HMQA 4XD7A 3UAXA 1RJFA 4G85A 2EATA 5CM8B 4EVIA 3DPSA 3HACA 5KQGA 1Z7EA 1U7OA 3D3KA 2RIPA 1PZHA 5DXFA 2C57A 2GBFA 3SDBA 1ZK0A 3B12A 3H11A 1BMFD 2YIJA 5DTQA 1IBMB 4FGUA 4BB0A 4L6CA 1YT5A 1LDGA 4G0XA 4I5GA 3WLMA 4MV5A 1GGMA 3N2YA 1MH1A 1B0PA 4G6ZA 4WFKA 2DSNA 4XYBA 2Y2VA 2JI7A 1OI3A 2ECFA 1YI1A 1FFGA 1TTQB 1ZH6A 1WD5A 5DTJA 1EG2A 2ZJ3A 2CLOB 3ZDFA 5SY6A 4AYTA 1BW9B 2J5QA 3FDZA 3HN6A 1W88A 4H08A 3W8DA 1YB5A 4Q9LA 2G76A 3WLQA 3VX4A 2HX1A 5JT1A 2XMSA 3M4JA 4QBFA 2WRZA 5BMVF 2IF0A 5K2OA 1LTKA 4UULA 1WBJB 3CR3C 3O84A 1NU6A 3MCVA 4NCJA 5EQDA 3S68A 1PKXA 3LYAA 5DB4A 1BAPA 2UZ0A 4Y6OA 4CIAA 2W71A 3F6BX 1DEXA 2ZIWB 3W2FA 3SYMA 1G2IA 2NSLA 2QYOA 2O0LA 2X3YA 2ZU0C 3F2VA 4MINA 2FPLA 4NDNE 5EP3A 3VTZA 3H9JA 4FIDA 1HFKA 2OQRA 2CXRA 2Q6TA 1I7PA 4RVUA 4N48A 5K3BA 2FR0A 3RVJA 1VLZA 4U39A 2CK3D 3D5TA 4HXGA 4DZRA 4O4LF 1M1ZA 2G5TA 1SUEA 4UBKA 5K3SA 3T34A 4BMXA 3FYSA 1DX4A 4UCWA 3DO5A 3ZU3A 1CTQA 4WUVA 2QRLA 5AI5A 1CW2B 4Y18A 2YN4A 4JB3A 4RA6B 3OBIA 2NOAA 4DUGA 6NULA 3KP1A 1E2LA 1RQPA 3HGTA 3BWYA 4WZ6A 4Z2YA 2OZKA 5IP5A 1ADCA 1FMJA 3DQZA 2AW3A 3TIVA 3ZW9A 3D4NA 4JA2A 2P2LA 2OORC 4UVHA 2JZNA 1VCOA 3L8CA 3MHPA 3SK0A 4R16A 2VYNA 3AHJA 1ZDMA 4NC9A 5FAXA 5JFOA 4R51A 3WYNA 4Y1EA 3VNQA 4BWGA 3D0QA 2P6PA 1WULS 3K9FC 3QA9A 4WN9A 3AERB 3KETA 2DKOA 4LJLA 3AR2A 4PO9A 3RRBA 2Q6OA 2G1JA 1BOFA 3ID6C 5EE5B 3FNRA 1NPTO 2AZTA 4U7PB 2XT9A 3TFQA 5F4ZA 2A9OA 3LPAA 4O2AA 2NYRA 4L4UA 1V45E 1ZIOA 1U8AA 3ES9A 3DWEX 5FYQA 1BD3A 3L43A 2AK3A 3ORRA 4C4AA 4EQ6A 2FN3A 2R751 2WTNA 5F98A 1AVTA 1O08A 3UK7A 1E4VA 1S3SA 1UPUA 1PF7E 2PWBA 2R6AA 2Y92A 3KXKA 3L18A 3NBKA 1EFPB 1CE8A 1A2QA 1GZ3A 2BEUB 1M6WA 4LXTA 5JJIA 4HJRA 1QOQB 1JDBB 4HDNA 4MW5A 3TFWA 3ZD9A 3PKZA 4WESA 1DTWB 4BO4A 1QP7A 1CUHA 1NBOA 3WWOA 4UHEA 1SN7A 2FJPA 3UMVA 3QLJA 3VR6A 1A72A 3OLCX 4G2TA 4UAJA 3V8NA 4OYHA 4ZCLA 4EY3A 3K70B 1F12A 3HYNA 1V1MB 2W58A 4H0FA 1XZKA 1KIFA 2BKVA 4WT7A 4ZXPA 2F9FA 1WAMA 1IQUA 3EWAA 4JB0A 4L76A 4A0GA 1D07A 1LLUA 4Z4CA 1HG1A 1W73A 2QP3A 1R6VA 4EENA 2ZYGA 3I2IA 2YC4C 4GYYA 4AURA 3W8RA 4ZI5A 4MPJA 1Z18A 5KDOA 4LMPA 2JIZD 3HJGA 2W11A 1VIMA 2C98A 4RH1A 3RIXA 3F6EX 3BFJA 2X15A 3F7TA 3TXAA 3ZGVA 4KXXA 4B45A 3Q41A 4LV6A 4ZYZA 3UTDA 2XRZA 1CRZA 4QFBA 2IJGX 3M8KA 1PP4A 2HHCA 4K05A 2O57A 5A5GA 1QP8A 2VH1A 1Y6RA 5K4HA 2QD5A 1Q0LA 3M6FA 5ALTA 4UTPA 2AI3A 2MWMA 4QEZA 1FNBA 1R5JA 4X44A 4AP9A 4BVKA 1H5UA 2BFOA 2AHOA 2X2OA 4XLZA 4BNXA 1QDLB 1OWNA 1PFGA 1WW3A 2UV8A 2ASVA 3LL4A 1D3AA 3PTZA 3VJLA 4MHTA 3NDBB 1EFUA 2FPOA 3ZQ4A 4BVFA 1IDN1 3PIDA 3G2QA 4TTJA 3AM3A 3DDOA 3TL2A 4DMGA 1AGPA 3VPDA 5CB6A 3KLNA 3MINB 2IK8A 2Q1SA 1C1YA 1Q2XA 2F7SA 2FTKE 2X1HA 3GX1A 4GW3A 4MUFA 4OHWA 1YCHA 3WB9A 2HBQA 3WP0A 3AF5A 5JI2E 1RPNA 2XMBA 4PZPA 3KTAA 1G21E 4YQZA 5KDLA 3MQ4A 5LYJA 2GILA 4DAOA 4EFLA 1A8QA 2G8NA 3K6KA 1JQJC 1R3DA 3ELUA 2AX3A 4TKUA 4LDNA 2RHRA 4N76A 3N87A 2FPUA 4QAQA 1U1CA 1OH6A 3LDFA 4JGIA 3IMGA 1DEAA 4BN4A 4HS4A 4MCIA 1U0HC 5GV8A 1LB1B 4ZGBA 1NL3A 2ODNA 4P4NA 1QQAA 2FSHA 2J3DA 5B7GA 3IDAA 4Q1CA 1IZ9A 4H3SA 1S0UA 4YP7A 3AY0A 3R4CA 1QYIA 2JFHA 4X6XA 4XX0A 1WPXA 5AOBA 2DPXA 3B82A 3EDOA 2I0FA 1M74A 5ULLA 5LLSA 2Y67A 2YFQA 3GCZA 3HY3A 3GEPA 2HO4A 1TQ6A 2YRFA 2JNWA 2WHPA 5K6TA 2AKEA 4DY4A 1OLSB 3B5IA 3A6GA 1LDYA 1K27A 2RGAA 4PX2A 5FUXA 2IIBA 2BSAA 4YP0A 3UBTA 1EVJA 2QSJA 1J5XA 1NUAA 4J0EA 3O74A 4MWOA 4RHTA 4TL8A 3VPAA 5A3JA 1BVHA 3UB4A 5LR6A 3KSMA 4AMYA 1NQAO 2IX3A 4WKNA 3WLOA 3EFOB 4KO4S 1A9RA 2WHYA 4MDFA 1T6NA 1L7VC 4AU1A 3L0DA 3GFTA 3LW7A 5EJ5A 2WMYA 2WD7B 3DEJA 3S2ZA 3TRIA 1TFUA 3BTVA 2QPTA 2E1PA 2OY0A 3D8HA 4MUIA 4C89A 3LT2A 2APJA 1B1AA 2P35A 3ESQA 1O0SA 1M2OB 4UTNA 1M2HA 3AP1A 2C5HA 3ZUPA 1GU1A 2FV8A 3V4SA 4WW0A 4FMPA 2XDYA 5I9LA 3SF0A 3PFCA 2GWHA 1H3FA 5I51A 1CEXA 4MYDA 5FB3A 1Y81A 4LNUB 3W6UA 1FYFA 3AHFA 4GGOA 4RJTA 3ZOZA 5I7UA 1PJQA 1TIKA 1Z5VA 1VKHA 1E1QA 2Q9CA 3R75A 1Z22A 2AH5A 1C3LA 1QLWA 5SYNA 4Q93A 3QXJA 1VKZA 2AQHA 1N0UA 1MOZA 1E8NA 2NZYA 2FVXA 1DEHA 4X1KA 3ZLBA 5A9SA 4LAFA 5BSVA 5G4KA 1AXRA 1HSOA 4ON9A 3TQQA 3ZJ4A 4ZQFA 4R1NA 1GG8A 3DEAA 4K6CA 4XJVA 4ALMA 4MUKA 1L8LA 2BGNA 4DN6A 1GJRA 1V5EA 3R6LA 4YJ2A 1UEXC 4QQNA 4CKCB 1N5KA 1WABA 1SXQA 4M9UA 3WXBA 1P1RA 3ESYA 2X19A 1BMQA 3H2KA 1Z38A 3RU3A 3JWJA 5COQA 2HU2A 4ER5A 4EB3A 1COWD 3NEAA 5BVGA 1OV6A 2QV7A 4DR1B 3FRHA 5TGTA 2QNRA 1NN1A 3UPUA 1GPNA 1VPWA 2B37A 2J9FB 3QG5A 4XQ9A 1CQJA 2ZDQA 4RCYA 2NWQA 1DO2A 2GI4A 4TS3A 5KSWB 1RIIA 1BTOA 1YA8A 4B3MB 1W0JD 3A1EA 3RGWS 3W5DA 1AX9A 1BCSB 2C78A 4LNHA 4REOA 2FW7A 3LD9A 2B6HA 1I7LA 3RYFB 4M21A 2LP4Y 1C2TA 2XF2A 3G9QA 3PVCA 4RVFA 4X54A 3SAJA 4BQSA 1X19A 3QEKA 4P7FA 5DRYA 2CZCA 3A36A 4IDDA 5BVHA 3K6SA 2HWUA 5BNTA 4GPAA 1R0LA 1HX7A 1Q1NA 3JD0A 4X41A 5G0SA 4YRZA 1A7UA 3L7JA 4NQRA 2G9ZA 2VYVD 2EKLA 4R3WA 2FLVA 2QRZA 2WJIA 3HXQA 1WMBA 3PQ3A 3RC8A 4G1MB 2Y4NA 4HNQA 4Q03A 4DMLA 1JUDA 3P96A 4DNPA 2W2MA 4MTLA 1E1MA 5ALKA 1P0FA 2R4UA 3PE4A 2UKDA 1WXWA 5ILGA 2ANBA 2ODWA 4HLNA 3LBYA 4RETA 3Q11A 4Z49A 4YDQA 1LNQA 1OZ0A 3MELA 1URPA 4TUYB 2PMBA 4MKHA 5DWVA 2A5LA 4UHHA 5BWOA 3W9UA 4AZ3B 1NUHA 5AESA 4J8PA 5AVJA 3NDRA 5KMGB 4Y2UA 1MW9X 1YZLA 2OHVA 5TB5A 1JEYB 2PE5A 3D54D 2NUBA 2AQKA 2D8MA 2VJMA 4LHWA 4Q9DA 5DLEA 5HZGA 2RK3A 4FD2A 1SZJG 1HDZA 1GNQA 1Z2DA 1UOQA 2EYUA 4N3CA 2ZUFA 2CC2A 4C22A 1CETA 2MDTA 3VU8A 3THYB 4FI3C 3EDQA 2ORVA 4BO7A 2YHIB 2XADA 3G0IA 3VI3B 2ZYHA 4WCDA 3G6WA 1B6GA 3JQAB 4JOSA 1DKPA 3LCJA 5AKEA 4E5YA 4HT3B 2ZBUA 4QYXA 1GKYA 4AVYA 1RXVA 2HI0A 4MAAA 2QL9A 2RCYA 4AC9A 5J4VA 1X7DA 2AF4C 2OKGA 1QCZA 1B6TA 3F74A 1YIDA 4R83A 3ZN2A 4R2WA 2AN3A 3B8HA 4C0SA 3UT6A 5A6SA 3GPDG 4B4OA 3WLRA 4FZ3A 2HNKA 2ZBGA 3LDAA 5DHTA 2J3IA 1C9YA 1IN6A 3KEOA 1RWXA 1L1RA 1RBQA 1EHIA 4FEEA 1TQ8A 4OXXA 3ZCSA 3OLXA 4MRSA 5EJGA 1ZM9A 1EP1B 4J29A 1HK7A 1JHQA 3EPJA 3J7AC 2F1RA 4DDHA 2ZSFA 5HPYB 2XOKA 1WSDA 4HUQB 4N7JA 1Y5RA 3LO5A 3MJEA 2Z5VA 2WOOA 1VMIA 2C2ZA 4KACA 2BKAA 1QKIA 2GZHA 1A88A 2PL9A 2VUSA 2COUA 2X5KO 2QI9F 4RC9A 1LEHA 2I99A 4HDAA 3BA6A 4WASA 4BGUA 1RVV1 2YY5A 4ECAA 2WKQA 5J2UB 4UAVA 1U0SY 2I33A 4TROA 2I78A 3BH0A 1IHXA 2QTGA 2I1LA 1O95C 3DR5A 2XUPA 1UKVY 3C2QA 3FBGA 3JR7A 1UCFA 4JWTA 2VJYA 4KN9S 4MHOA 4PONA 3PD7A 4QX6A 2JAHA 5PGMA 5SY9A 3UJNA 1N2CE 1O96A 1O94D 4DPKA 4EL5A 2XUZA 2I6UA 1NURA 2CXUA 5CJPA 4TZ0A 3GRYA 3PFBA 3KB6A 4X00A 3K05A 4DREA 3F46A 2ETVA 5A5VA 3I4LA 1RAIA 1Z6PA 5FEMA 4D0GA 4ZT5A 4LXGA 1A8PA 3A1TA 1FZTA 1VMDA 3SJZA 3CSSA 3S27A 1Y4ZA 2WUVA 4XGNA 1OX4B 1X7ZA 1ELOA 4M8LA 1CVLA 1NM5C 1Y3FE 1VA4A 1G7RA 4X7BA 2XUJA 3OHPA 4IHKA 3RROA 3T6KA 1KI1A 3SOZA 2EX0A 4ZVQA 1U0TA 2P4UA 1GNTA 2QN3A 1KJQA 3PD0A 1ZGCA 4M8NE 2FFHA 1GQRA 4X8OA 1F1BA 4S2UA 4OB7A 4WKBA 1T9KA 3S7ZA 3MSCA 1GPH1 1EE2A 3DDNA 3I9JA 1MVOA 1RABA 2EZ8A 4MV3A 1U0EA 2DR0A 4CLEA 4QVIA 3L1VA 4X94A 3C8DA 5A5FA 5KJCA 1YV9A 2GM9A 1YR2A 2EC5A 3FAZA 4FCVA 4OHYA 1CZOA 1KK2A 1YZUA 3BFVA 2OKCA 5C32A 3NHPA 4YQYA 2H4XA 1EDZA 2YUTA 3HCNA 3HKCB 4M1WA 4MQ4A 2O5VA 3MTQA 4AN1A 4HDRB 2P9CA 5HBRA 1IRXA 3LC0A 3LUFA 3HVHA 4K6MA 3TLXA 4B3BA 3QEJA 3UMYA 1YBFA 1IWPB 3O4FA 4DCPA 2XMZA 1VP3A 1D1QA 1KMMA 1Q17A 5U4QA 1YZYA 1GUYA 2OYRA 4CT5A 2E4WA 5LSAA 3ZIDA 1X38A 3HCFA 4BTLA 1J07A 1TJPB 2JFZA 1F6WA 2NTVA 1U65A 2EVWX 4JVMA 4BVHA 1G66A 2VJCA 2NO7A 1P9RA 3HYLA 3UWSA 1P4SA 1XMQB 4IICA 2M6RA 5AXDA 4DMCA 1Z4JA 5JCJD 1DQYA 2WKPA 3DKIA 1T36A 2BZ0A 4G5HA 1IPHA 5JD5A 3AHEA 2RKWA 3L7CA 2CJYA 3NHMA 4JLVA 3L1UA 3SNHA 1T9CA 3BRQA 3LBIA 4L07A 2YR0A 1I2BA 1UJ5A 1UWLA 4H7DA 5BWMA 3OUTA 4FQ7A 2IYPA 4QLAA 4L0DA 3IUJA 4Y2YA 1P17A 2Y0CA 2MMCA 2GOYA 3ER9A 1VFNA 4R7TA 3L7BA 4GMKA 3P2KA 2O5EA 5CR9A 2FWAA 1ATIA 3E9RA 3WMGA 1Z0ZA 2VBIA 2ANCA 5JBQA 1JR2A 4AX4A 1CZNA 4NJEA 1JXMA 1IZ0A 3CVXA 1M1YE 2W70A 2BC9A 3O8LA 4LBVA 4LMAA 4N9QA 2R8XA 4RK6A 2OV2A 4EHAA 2C9DA 3RADC 1C7IA 1EFRA 3CRQA 3C7KA 1NBME 5H80A 2WG1A 1MEOA 1RWPA 2E3JA 2B3DA 2Z57A 4IYJA 2HU8A 4BX8A 1JKFA 4DQVA 1FSGA 5CIYA 3FROA 2XPCA 3LI2A 3L40A 1XVVA 2YWRA 2BELA 4TYPA 3ZV6A 1MC5A 2ZYAA 1IXYA 4BCBA 2XD4A 1T9DA 4G23A 5CX1B 2QD3A 2C96A 1GPYA 2AXPA 4IIJB 5H68A 3GEGA 3DO8A 1E6CA 3HDVA 4DR4B 4KWHA 3ILSA 1FUKA 5DGTA 4Z0NA 3I5MA 5LQRA 1ZM4A 2HMSA 4JYBA 1N2SA 3HFJA 3OICA 3PGVA 1P44A 1YOVB 3NLLA 1A7JA 1KEEB 3DV9A 2H8GA 2XUQA 2QVXX 4DR3B 1G21A 3EIHA 3ZDXB 1EQAA 1GLGA 1OYOA 3LUHA 3QU5A 4X90A 3R0ZA 4LDAA 5AHRA 4EEXA 1RC8A 2O8EA 5KBYA 3DF9A 3IQZA 4G8DA 1DG3A 5AKLA 3NORA 3ZNNA 2IF2A 1K7SN 4TYNA 1EK0A 4AL4A 1K0UA 3N0RA 3WMFA 4KXFB 1GR0A 4GO1A 5CAEA 4DFDA 5CIWA 1NASA 1QC5B 1EG7A 2Q5FA 1E58A 1A4XA 1I2ZA 3L82B 3NX4A 1Y7IA 4OB6A 1CUEA 3ESRA 4FHEA 4E03A 3QE0A 1D8AA 1LU9A 3WOHA 2XCSB 4OYRA 3LPLA 4QFDA 3I58A 2HGZA 2VIIA 3PNOA 1NXVA 1P7VA 1MIHA 1RPAA 1EJ0A 3RNOA 3C6YA 5COAA 3K32A 1HV8A 1VL6A 4ENPA 4WLFA 2W6IA 1ODJA 3AFIA 1KOFA 3ESCA 3DPUA 1BRMA 1H23A 1HE1C 2D7CA 3P1JA 3C6KA 1E63A 1OILA 3A11A 3R23A 1FQWA 1XPJA 2QLLA 2XSZA 3C1OA 4C4TA 4DQXA 4R3UC 3ZIAA 4F3KA 1B73A 1GAWA 2PMCA 2QLTA 2FCRA 3FPAA 1DAHA 1N8KA 2MR6A 4M0EA 1DJNA 5EXEA 5B12A 2PKQP 4LRSB 3CUVA 3GEDA 3FPSA 5IUNC 5B58C 1SG0A 1ISRA 2DE0X 2X4IA 5I9SA 3G23A 1JDPA 5TJ9A 2OXCA 3TOSA 1L5RA 4UVDA 2ZTHA 3P2YA 3QNUA 1JQ3A 1SCQA 2DJ5A 4LZAA 1V8DA 4N7MA 4Q3EA 4WOPA 2MR5A 5EZYA 3ADPA 1VJ0A 2H9IA 4X65B 1JILA 5AIAA 4BFZA 3QVTA 4DXAA 2FW9A 3B9RA 4CG0A 1EYZA 4GI2A 3PB3A 2IYFA 4RZUA 2BIFA 2JJ8A 2QE7D 3OIGA 3V7UA 1RWBA 2Q27A 2VP5A 3N3AC 3HUDA 1RI5A 3L06A 3GFGA 3QLVC 2MYNA 1MAVA 4GP7A 2QJOA 1Z45A 4I1VA 1ODKA 4PSUA 4D8UA 1KJIA 4RFLA 4W5JA 2R8YA 5JE8A 1YTUA 3EFHA 2I3BA 1GTL1 3UKOA 2DECA 4PLHA 4JN6B 1RYNA 4GNKA 3ZLTA 1KI6B 1MB0A 5IVKA 3L04A 1U94A 3JRXA 5D7NA 4DWOA 4W5NA 1H5QA 3UXEA 3DP9A 5JTTA 2VXBA 4JEUA 1XZLA 1WA5A 5HF8A 2ZREA 3V4ZA 1Z8FA 3KSUA 2QUAA 4MRVA 1NPDA 2CXXA 3OSUA 4CV2A 4E5VA 3OP1A 2AYXA 5IPFA 4ZCSA 2HFJA 1CZHA 3DAOA 1U8YA 2IEYA 3ZGZA 2J6BA 4CQMA 2ZTMA 2WTUA 5FPQA 3EDRA 1JV2B 4AWXA 4B6OA 1QRTA 4ZZIA 4L50A 1NXOA 1MAAA 3OM8A 4RDCA 3IHLA 1YZNA 2ID9A 1V6SA 3MA0A 4BNMA 2QS9A 4L3VA 4CM4A 3F9IA 3UYKA 1IEWA 1CFZA 4YYEA 4EK9A 3H42B 2VT7A 2FVYA 3TUJC 4A6PA 4ZEMA 3TLAA 1C0EA 2DBZA 1EDEA 3HPRA 4TXNA 1B00A 1Y1RA 1PK7A 1RE0A 5K99A 4NKRA 3GJZA 2PX6A 4FE4A 2Z3WA 5JAHA 4NR0A 4C4PA 1MNAA 2Z8XA 3F9RA 3Q98A 4DABA 5CD9A 4KYIB 5CFLA 2WZCA 4U3JB 4V0ME 3K16A 4LNAA 3LJKA 2VRCA 2YOFA 2WSSA 1S02A 1GQOA 2JGAA 1PEAA 3P9NA 3R3ZA 4LGVA 4R2MA 3JVVA 2I2FA 5JJCA 2GUWA 2WJZB 5KKCA 1X8JA 4KFSA 3V1KA 1ES9A 2ERCA 3GUYA 2D2XA 1E2PA 3OCVA 4QJ5A 2PA3A 3DMRA 3RV3A 4DC9A 4DUPA 2WTBA 5ED4A 4XLLA 1SVKA 3SBEA 3U4QA 3PJDA 1R6BX 1NW4A 4B75A 3DXZA 1VFPA 1QVWA 2NQ2C 1GYPA 3FCOA 4AKEA 1UWVA 1T8TA 4BLTA 4QJ4A 2V03A 4NTZA 3KQLA 4OBEA 4HAWA 5L6LB 3IO5A 1EWVA 5FWXB 4RHFA 3ROGA 1E7WA 3RTDA 4FHGA 2FJ0A 2R6DA 3MRVA 3TZCA 1J2TA 1IVNA 2HSZA 3EA0A 3VZPA 5FD8A 3GPIA 4TVOA 3DBLB 5D7BA 2QROA 3RVPA 3WLFA 4S05A 4ZO6A 2F9LA 2YX1A 2ZRHA 3I0NA 4S0XA 2YJ3A 3F3SA 4KQEA 4NULA 1XJQA 1YH3A 1Y8RB 2F1KA 3RWBA 2ID7A 1TQ2A 2O2GA 2OAP1 1U2DC 5IYZF 2LPMA 4AYXA 2SKDA 3GZ4A 1ZY2A 4FNMA 2P41A 4F4UA 1E2IA 2O8VA 3NWEA 4UM7A 1H2BA 3VGJA 4PPNA 5DM4A 3ENVA 4M99A 3W90A 4YCDA 4BJ1A 4BNWA 5ICMA 1AB5A 1OPXA 2BFFA 2GX6A 4B48A 4E6EA 5FFMA 1OXBB 4J1TA 3H1AA 1SBIA 4PAMA 1EVIA 3WNBA 5JSHA 3PT9A 2VDJA 1FYVA 1US8B 4NS1A 4DVJA 1T4GA 1F5SA 2XYRA 2R1VB 3EG9A 2E6KA 1MRSA 1QQ6A 1A1VA 1GSAA 1QIJA 4E0BA 1GPKA 2L42A 5CDFE 1JGTA 3EBLA 4G25A 5GMOA 2W9XA 3I8XA 4QDUA 4FJ2A 5EUCA 3AVXA 1AQLA 3SLGA 1XL1A 1YQUA 1XYYA 4ALLA 2BJHA 2BGGA 1SB8A 3WZ2A 1P2TA 5A5EA 4PLPA 1WXHA 4ZAXA 3EDCA 3UQZA 3T35A 4I4CA 3B1KA 1N2CA 3PCXA 1I3LA 4X7RA 2VI5A 5KNBA 1UJ6A 4M36A 4XE5A 3VI4B 2IHZA 3PR1A 3CF2A 4GLFA 4J0DA 4WHMA 5THQA 2W83A 3HBLA 3ZQ6A 1VXOA 3AJ8A 3JQBA 1UKYA 1UJMA 1YL7A 2IT1A 4WOBA 2FR8C 1TMYA 4CR8A 3FGOA 2JIMA 4DQKA 2JGDA 2ZUSA 4CMKA 3H1FA 3H5TA 2HFKA 3VDXA 3RRYA 2QLFA 2CNWA 4ZV9A 5L3QA 4DS3A 2BUAA 4FN4A 3C97A 3IUYA 4B2YA 5GADl 2WE7A 1S9HA 4LBYA 3WOVA 4RHUA 1Q3TA 3D3QA 4W5HA 4DIMA 1QYXA 4ETWA 3UNXA 5HOEA 4QPPA 3C6BA 2GYUA 4REQA 3WDLA 5ALMA 1WTCA 4AP6A 4RY8A 1JX6A 1ZS9A 4CTJA 3H17A 1JIQA 2YW9A 1S3FA 3K1YA 2YJNA 4PV7A 4CL0A 2XKKA 4ZPJA 4E1BA 3GF4A 1QYCA 1UAYA 4PX3A 3RVDA 3S8MA 3MBKA 4KR3A 3DZKA 3R76A 4Z86A 5EEHA 4U02A 4DQ0A 3KPWA 2ZTUA 2OA0A 4C3OB 2FQYA 2NSJA 1UMKA 4P38A 2WV7A 1YDGA 5DYIA 1CFJA 3ANNA 2O8FB 1B0AA 4NH0A 5BV2P 3MIIA 3FTPA 4KR9A 4YP9A 3KT3A 3KYIB 3DW1X 1QFYA 1ML3A 3R0IA 4R1QA 3AUJB 4Y2RA 3RSGA 3TR6A 1IN1A 4F5YA 3DBHB 4LF4B 2PLFA 3LAWA 4C03A 1O4VA 2J7PA 3OUZA 5KTRA 4U00A 2GN4A 2ZAYA 3MYRA 4OQEA 4HO1X 4AP5A 4F7DA 4B6RA 1FDWA 2DFKB 2R8BA 3C4VA 3SXJA 4HH3C 3ANSA 3GCDA 3KVOA 3UHAA 3ZS8A 1HSZA 2OBLA 4V1CB 4E11A 1E62A 1NMEA 4H1VA 3SP1A 2W0SA 4URZR 1JF8A 4DUZB 5BRNA 1JPUA 3KQWA 1BHSA 4HDMA 4URHA 4EDHA 2VT2A 4PZ0A 2GCNA 4GUAA 3AUAA 4BZQA 3THOA 2IZOA 5HKLA 4BNUA 5AJHA 2G0NA 3OIFA 5FORA 2ZRPA 1Q0QA 5DYNA 3SZ3A 5TMBA 1WB5A 2CCKA 4JBLA 1SD1A 4Y1FA 2CE2X 4H60A 4M1QA 5C80A 1UOEA 2JAXA 2VZEA 1L6IA 3C3WA 5IHXA 4RIGA 5DCYA 3P9KA 1M1YA 4JASB 2GUGA 2IYSA 5H5JA 1K68A 4BFLA 1Z0FA 3GJYA 2O4UX 2JVIA 1W49A 4EF4A 4LQ4A 1LWOA 1NBMA 3ADKA 5GQSA 1IVSA 1X92A 2JFVA 3G1UA 3L84A 3NAQA 2VDMB 4M0CA 4IRXA 3NM5A 4B8YA 1WBBA 1C3XA 3EZLA 3PR2B 1CEEA 4IKPA 2XB2A 4UHJA 4ZVLA 3FFWA 1XTUA 2OFPA 1M5UA 1VB5A 4FDVA 4YAEA 3GFSA 4MTCA 2I29A 2QDKA 3K35A 2GHTA 3EIOA 1YCDA 3R3SA 3U44B 3KELA 4EGSA 4HDCA 3OIWA 1TO1E 3BK1A 2PIDA 1P4RA 3I01A 4ZI2A 4IWNA 4WAUA 1P5FA 4DLBA 3DFUA 1LLFA 1HC7A 2OK7A 4P5EA 3RG2A 1TJ3A 1BA3A 1I7NA 2HUNA 2QLMA 2VPQA 2WYUA 1SOMA 1HYGA 2ENWA 3QVWA 3UK6A 3WNQA 4BNDB 1Z12A 3DLCA 5IKEA 3RYCB 3SJBA 1I01A 1MG0A 5J5VA 3TLGA 1CLUA 1SELA 2IHBA 2FN9A 4B09A 2IPOA 5DBOA 2DY1A 1H5NA 3FF4A 4U2EA 5H82A 2ZRIA 2X9VA 3AG5A 3KU4A 5AJYA 5FHQA 3N7AA 2JHAA 2KMLA 3WA6A 1U1FA 2IS6A 3G2NA 1E77A 4KOAA 4WZBE 4BFVA 3VO1A 3NIDB 3T1YB 4OLAA 4AUMA 3K9LA 4PX9A 5B1HA 3EXHA 4PG5A 1QBKC 1AE1A 3LPCA 3N5KA 3TMAA 3ZU6A 1GRVA 1SU7A 1DAMA 4KDRA 5IDXA 3AKCA 2YWJA 4WXPA 5E6SB 4RXTA 3RJ5A 1QVZA 2ID8A 3NQ41 2TMGA 1HYQA 1TVCA 2X9LA 2Y1LA 3CRVA 1RCFA 3NTRA 4NHEA 4QBKA 3WSTA 4CLRA 2BI8A 1L5FA 5IC6A 1OROA 4FGLA 1FX0B 2ZXUA 2H2IA 2A1IA 2D7JA 3AEQB 1RRPA 4RYDA 2FZ4A 3OT5A 5LBIA 4OI0A 3BMCB 1AN0A 3L4BC 5T6MA 2BWJA 1BCRB 1L4YA 5H83A 5LJLA 1GG5A 4EPYA 3O73A 1IG0A 1VPVA 3DJYA 3DOCA 5H3HA 3IPXA 5BSGA 2EP5A 3KYCA 3AWIA 1Y48E 4N3BA 2VXYA 4KBFA 4PPYA 3EXEB 1VLVA 4LYJA 2F3UA 5BURA 3VSEA 1KO5A 5EL0A 1D2EA 1OAOC 1TQHA 2PUGA 1MLDA 5E4JA 1KE2A 4EMUA 1ESMA 1KAHA 2AJLI 2VHTA 1SCAA 4Q7LA 3SEQA 1FPMA 1ZM2A 3IIEA 1ZJWA 3L4SO 2IEIA 2ZUTA 1P7CA 4LXYA 4H4EA 4ND2A 4C7KA 2D0PB 3ZWCA 5GZ1A 4KRGA 2IL1A 4BO5A 4CKWB 5FNVF 2GEKA 1FA9A 1QP0A 3ZWNA 3NETA 4C9BA 3BXFA 3PUWA 3EGVA 4Y6QA 1DADA 3A3NA 1YUBA 1E18A 1N5JA 3C8HA 2QZJA 4J6FA 1J06A 1RVDA 5BMVB 9LDTA 3BWVA 1NW5A 2GESA 2I76A 5B58T 3OFND 3KSDO 2EZ9A 1XQ1A 3MFYA 4E5SA 2BI4A 2REQA 1TMKA 1HEIA 2VP2A 3VR4H 1DDOA 4I46A 2SKEA 4HQ6A 4MQBA 5G1NA 1QLJA 1OJLA 4RK1A 5DCLA 3MPOA 5EXSA 4NATA 1MB4A 2EBWA 3NBQA 4JR1A 5HFAA 2DTEA 4NBKA 1SCJA 4NJOA 5HF6A 5NLLA 4TVKA 3OH8A 4O4LB 5G02A 5DEIA 3RJMA 3VDRA 3WMRA 4TYMA 5E7QA 1NX9A 2Z09A 1G5IA 4CMIB 3EGOA 3BS4A 5DE3A 3WNDA 4P2GA 4WERA 4RTMA 4I08A 1YA4A 1UPTA 3HI6A 3PXXA 2QKYA 1CUUA 2XT0A 3TW8A 1RAEA 4C2BA 2M2IA 3HDHA 1TADA 2NTJA 4ND3A 4P36A 4RLSA 3U3DA 2QTLA 4YIHA 3MQ2A 5LMZA 5EIBD 1U4SA 4Y2GA 3VHQA 2B83A 2H1OA 2A0KA 2ECOA 2IU4A 2LGJA 4AS1A 3PPWA 4RKFA 3AGPA 3MWDA 4FFPA 2DHQA 3KYDA 1D4OA 1U9CA 2O8DA 3HO8A 3GNSA 5LFAA 3EW9A 4HGNA 3FYUC 4PTYA 4D9FA 5JXHA 2IEAA 2FUKA 3NHUA 4GM0A 1OBHA 4UARA 5E7MA 3K20A 4EMTA 1T3ZA 4NICA 1YAHA 1CR2A 1ORIA 3CX8A 3I1JA 3MXTA 4H7EA 1GDTA 5KQSA 1Q1ZA 3MYYA 2IWRA 4LFBB 4YV1A 3C4QA 2C1XA 4KAJA 3NKLA 4Q4HA 1T26A 2QHXA 3COSA 4V0MA 3SYKA 3V9AA 2IUSA 4MKXA 4UE2A 3G9XA 1U9IC 4WK0B 4Q47A 1COZA 2W2KA 4TXMA 4XRRA 1DJLA 1M8JA 1USGA 1JR4A 1W1IA 2IITA 3F5FA 2ALJA 3HJHA 4GP9A 3VPFA 2WYIA 3R7WB 2J3LA 2W6QA 9ABPA 1Q0SA 2EX4A 4NYJQ 2H2AA 2ZSDA 3E1SA 3JASA 2B8TA 3K2BA 5T4FA 3K70C 1VBFA 2GEUA 2HA2A 3L8FA 3VVBA 1QQTA 1TZBA 1VCMA 1Z5NA 3OCUA 2OILA 3KFVA 3CXRA 1VZ3A 3C5CA 4F9FA 1GTVA 1M33A 5ICCA 5BQOA 1W36C 4UEQA 5CM2Z 3L8HA 5H4GA 1I30A 2YY6A 3DBVO 2PX3A 3UJ8A 3L6EA 4BGEA 1DKNA 3L8ZA 5L7WA 2V4UA 1GRRA 4MVJM 1R8JA 1C1XA 3ZE0B 3OHSX 5KPDA 4D43A 2HJVA 1IQRA 2CMDA 2UZIR 3VSBA 4MWGA 2A4MA 3IA7A 3ZE7A 4IIBA 4ALJA 3IJRA 4YXWD 4MR8A 3PEYA 3D6TB 1RCTE 1PZFA 2Z1NA 1NVVQ 2FG5A 3KZNA 3LCVB 1JPNA 3RUIA 821PA 2B2NA 1JSRA 2KQUA 2R6HA 4FFBA 4ONEA 3ENNA 4HY3A 1GQQA 1UBRS 1NE2A 3C3DA 5AHOA 3I6ZA 3UF0A 4CF3A 3QPWA 4MW7A 6ABPA 4K9RA 4CF4A 3OURA 4AQDA 4I1IA 3IV9A 1CUFA 1PFQA 1THZA 1NXXA 3NVMB 1G3RA 1P60A 3LX5A 3V80A 4DGSA 1JHVA 1II0A 4DR5B 1M8FA 3CZRA 3DBRB 5F5XA 5KQRA 5KKAA 3Q8LA 1OLUA 4EHHA 3WX0A 1QZXA 2VUIB 3OQVA 2ET6A 3N8NA 4LC1A 1Y7PA 4DWVA 4GSYA 3B1VA 3AOEA 1KS9A 2F1OA 2NTNA 1EMDA 2Q5IA 3RS5A 4AUEA 3FOCA 3DVAB 4QKQA 4R8MA 2IBSA 4Q0MA 3B53X 2J07A 3Q3EA 4F04A 1XLTC 4GF5A 2WU4A 3K9QO 5CDFA 2OYCA 4W5RA 2XNHA 4A8JB 1ZHFA 3EUEA 1GZDA 3CWQA 2X5JO 3OE4A 1RZRD 3S8EA 3QI7A 1M72A 2NVBA 2O5RA 1RQXA 1YVUA 3AR8A 1SCIA 1MR3F 4LGCA 4O2BA 1S2OA 4P3PA 1HYEA 3VAZA 4F0JA 2B21A 3FYHA 1ZW6A 5A3SA 1KE1A 3EXFB 3GEBA 4KB5A 3SQNA 2PJRA 2IXTA 3ESAA 5E2AA 3AU8A 1SQGA 4MDHA 3WDKA 3EIEA 2O0JA 3FIJA 3SYNA 3JX9A 3R5FA 4M53A 1DC7A 3ZYZA 5LYJF 1YNSA 2PX8A 2WYOA 1XV5A 1WUYA 4M8IA 3G0DA 3OZ7A 4M3NA 4B2IA 3L07A 1G64A 4EJ6A 3WRXA 4M6WB 2GVDC 5C7YA 1QB8A 5A0FA 4J0JA 3PHIA 1QO9A 1Z4LA 2Y0DA 2Y1DA 2B1IA 2O2IA 4L8VA 2B7LA 1IONA 3DV2A 4JBGA 4E3WA 4WI1A 2O14A 3TH5A 2WUWE 2LIPA 2EFYA 3IP6A 4V0KA 4YCMA 1I32A 4IDCA 2B25A 4P32A 1V39A 4C3ZA 4AKIA 3AEZA 1U2PA 4NYIR 2V7PA 2FPPB 4I3FA 3I04M 3MAJA 1X7XB 3A2NA 3QYJA 4YHBA 2HD4A 1V37A 3BVPA 1XZPA 4B85A 3N58A 3NDJA 1W0KA 4XSVA 1FP4B 4IXDA 4M98A 1IHUA 4MVJG 3S40A 4F8YA 3OQHA 4PXYA 1I4WA 3PBKA 5A6VA 5HNKA 5AI0A 1WW2A 2CCJA 3HZOA 3QNWA 5BOVA 3T7TA 2AUTA 3BG5A 1W0CA 3PC2A 2GLXA 2EWMA 4OX9B 1JIVA 2REOA 1NE7A 2CVOA 2JGIA 3UO8B 3NWPA 4R1UA 4GT1A 4ZI7A 4R6XA 2Y6VA 1V96A 1KH1A 4G9BA 5E6RB 1XU7A 4B3IA 4BRUA 4KP7A 3ICEA 1P62B 3OECA 4JCCA 1NW6A 4OFWA 1PJSA 2CW5A 2HDWA 4QU8A 2EG5A 1NONA 3T7JA 1GCIA 2GPYA 1T4MA 1HUQA 2AC7A 4G37A 2X6RA 3SQDA 4B5KA 4ENSA 3K5HA 4JLUA 1QF6A 5AW6A 3GUZA 1KFJB 2A57A 1IUNA 2RGRA 2XB9A 1EWTA 3CLHA 4KPYA 5DWDA 1ZONA 3H0EA 5KTKA 2DKFA 3ESBA 3DUFB 3FETA 4EM6A 1LRLA 1T5OA 2H00A 2XTNA 1T4BA 2DQZA 3PQDA 3KQNA 1TU3A 1IBLB 2FJUA 3E7XA 2PO5A 4KE8A 4M0LA 5EWJB 5AUQA 3UH1A 2VTBB 4WNAB 4YT8A 5DCWA 4LDPA 4FLMA 4RPKA 1WCIA 4OP3A 1NMQA 4GLLA 4F86A 5I9BA 1JDZA 1LC0A 2NP6A 1VIDA 1H9CA 2LD4A 4JI1B 2BHNA 1RXWA 1V7CA 2DHEA 3E70C 4KRXA 3PITA 4HSEA 5IMSA 2P3QA 3BHJA 4YJ2F 2Q3JA 2XKAA 1JDSA 2QENA 4WDRA 3FOFC 2ROQA 4BMSA 4H6VA 5I7HA 5JR3A 5BV8A 5AW5A 1X1BA 1QMPA 2AV6A 1VM6A 3R40A 5LLDA 3RDPA 1UT6A 2PRSA 1LK0A 2RCNA 5CA0A 1YAJA 1PN3A 2J0UA 4QYIB 5ITZA 1GXSB 2IS2A 1JMKC 2R5WA 4TLMB 4TV8A 3B1FA 2CYCA 1HMYA 3BL6A 1F9EA 1XU9A 3BE6A 3HHPA 2G7ZA 1E2UA 1B7GO 1GUZA 2A88A 2NO0A 2VYFA 2EW1A 2WAYA 1PDVA 2OGZA 4FU0A 4OQMA 1YRLA 1J6UA 4YO7A 2Q7OE 4CMBA 2QZSA 1E20A 3D3WA 5JCOC 3HYRA 1HI9A 2RKOA 3G5TA 3IRUA 4TV9F 3WYDA 4ZK2A 1KSGA 5AW1A 1L7NA 2OCIA 4V02A 5JNTA 2PX2A 1WHSB 4BLPA 1XCMA 3HQ4O 4RY9A 1JVNA 3BD9A 3BL8A 1BFKA 3TYXA 2RJ3A 3RYHB 5TLSA 2V9CA 2R1TB 4ZC1A 3QEOA 1U3VA 3VJKA 4KNVA 3CF6R 1YS6A 1IATA 2AT1A 1K1EA 1NNLA 3PFHA 3GOHA 4C5CA 3E3OA 1FVHA 4R05A 1DIAA 1T4CA 2JB9A 4FGJA 3QU7A 4WZBA 2X1MA 1ULAA 3OU6A 3FOBA 2HA5A 1V9SA 1EVYA 3DHYA 2Q49A 3HBAA 4AZWA 4OCZA 2BCJQ 1CQZA 3VR0A 1TM3E 1C0PA 3Q10A 3UZUA 1KHTA 3I5AA 5LMNB 1WW8A 5HG0A 5TT0A 5KOJA 5IG2A 5CNJA 2VHWA 4KAAA 4J4TA 1UINA 3IB6A 1W8DA 2ATIA 4BRWA 1I24A 2PLWA 4MRRA 4EJMA 2DQ4A 1JLRA 4OHUA 3TTXA 3C43A 3NBFA 3AHHA 2HCFA 2JD0A 4MUXA 5GJCA 3T5BA 1J22A 3ETEA 1C7FA 1J2EA 1P3Y1 3LP8A 1BYIA 4ZYTA 2YVQA 1CC1S 3KM0A 4E09A 1PQYA 3TRHA 2O8BA 1ISSA 1X70A 4RKWA 3OT1B 1EP3B 3OE1A 4LWOA 2OFFA 5G0VA 1VA5A 3U26A 3PFGA 3MD9A 1GTJ1 3SVZA 3P94A 2P9EA 2QGNA 3JZAA 3DTVD 4AF7A 3H2ZA 1HTBA 2CL6X 2VSQA 3GJ0A 3ND5A 4UVIA 2R48A 3D8RA 4MVJI 4LJ5A 4QARA 4RF4A 5E38A 2OCDA 4NG5A 4QHYA 1WUJS 5IANA 1G8PA 2ZYVX 1T0JB 1YZQA 2BT4A 3VO2A 1XRSB 2J87A 3RS3A 1E89A 1EBBA 1YRQA 3WLSA 1CDEA 3I05A 2CJWA 4QVKA 1GTMA 4R9RA 4RD6A 4CWAA 3UAGA 3MW8A 4DNQA 3QFHA 2ONYA 3IUBA 1JFTA 5EHIA 3SIRA 2QXUA 2YZMA 1HRDA 5BO5A 1FU4A 3A9UA 3CKKA 3GA7A 4MR9B 3QUCA 1AUQA 3SX4A 3NAGA 4EX7A 5AVYA 1ZI9A 2CF6A 1OTYA 4GP6A 2A86A 2DULA 4CU2A 4NI5A 4UATA 3GCXA 2O8CA 2BM1A 4DBVO 3DCYA 4FB4A 1JQBA 1UM9B 2Q7XA 2HRRA 3EYAA 4I8IA 4N82A 3IAUA 2BFDB 2ZI3A 2WPNA 4J90A 4KXLA 4HK4A 4P54A 1S4QA 1M6EX 4GQBA 3U7GA 2O54A 2Q62A 1FJHA 1SEPA 4ZA2A 4FR5A 4H35A 4E15A 2ZM5A 2WV9A 1NJFA 2OB1A 5JSZA 3CY6A 1CJUC 3IXMA 1TYEB 3NPMA 3D5EA 4XWOA 3JRWA 1YZHA 5AKIA 1G60A 3U7RA 4EYQA 2C4TA 4TMVA 3TM5A 5ADHA 2X9NA 1A9QA 3IEPA 4X71A 2ISSD 5AXCA 2BE9A 4PO8A 1DKUA 2XGSA 3D8SA 3RYTC 4CM5A 4DLNA 5CA1A 4BWFB 1AF4A 2JCGA 3QWHA 4BHTA 3A7EA 2HSDA 3KJZA 4TM8A 2HA7A 2HIGA 4MP6A 2NZXA 4I6GA 4BTVA 3K9WA 3G0HA 2KI5A 1VHTA 1W59A 2P2DA 2FK7A 2FSVC 3PP8A 1ZVVA 1ORRA 1T5TA 1XCOA 2YNMA 3QUAA 1ZINA 3U62A 1XFDA 3QKWA 4XYLA 1N1GA 2F48A 3O9ZA 3OLVA 4IOLA 3WLKX 3I9OA 4M1YA 3MTGA 2RGGA 6Q21A 1ETUA 1XCLA 3O3CA 1KPGA 2FGJA 4FKBA 4R2KA 4R31A 2R84A 4F2DA 4PYQA 2ZXEA 3DDZX 4HEQA 3TX6A 5KHLB 3BKXA 1RC1A 4FUQA 4FYKA 1W46A 4R2IA 4Q7QA 1DELA 4HMOA 5KSOA 1NJSA 4TM7A 1YCFA 5KNCD 1DEKA 1XL0A 2EDAA 1MB9A 1ZMOA 1EA5A 1H4QA 4I7EA 4HN2A 4IZ6A 1TCVA 5FBKA 4QM7A 3RKRA 3DB2A 5JDCA 3VYVA 4I9NA 3Q1KA 4IINA 4K0RA 3Q3IA 4ZTUB 1Z7YA 4F96A 3SVTA 4XYEA 1F9AA 2WJYA 5EMLA 1HBJA 3B20A 4TMTA 5CFQA 2C4WA 1MC8A 2G9RA 3FYDA 1JKXA 3ISJA 4RADA 4Q1BA 1CSEE 4KIJA 4MHSA 3LDGA 4JI4B 1K5GA 1KQ3A 1F2UB 3K9CA 5I8ZA 5LP6A 2AC2A 2GTHA 4WIAA 2JBHA 4KLAA 3FKJA 2FRVA 4HBGA 2QQGA 3LFTA 2VJAA 3NC1C 1MEJA 2PY6A 1YFJA 3F8TA 3G0GA 4DM7A 3RU2A 3DZFA 1HLPA 1JB1A 2JGNA 4HGQA 5DJ5A 1LZKA 2P4HX 2PZKA 1E99A 1NTOA 1YGYA 2AFHE 2O3RA 2QVLA 2ZWMA 3HE3A 3RVNA 2C3OA 3Q2IA 2Q5EA 2Y99A 1P1BA 1SXPA 2GCOA 2NXEA 3PDCA 3EPRA 1JNXX 4D44A 3QUTA 2E37A 3U56A 5H16A 2BZGA 1LLCA 2ZG6A 3GGGA 5AUPB 3UGTA 3WWEA 1P9NA 1SRRA 1K89A 2M98A 1AA9A 1NKSA 2Y9PB 3ITKA 4JJEA 4RJIA 3QE9Y 3FWYA 4YV0A 1BHJA 5FPSA 4EELA 2P40A 4Y9UA 5KZMB 4YMVA 3V8QA 2UYHA 4BXOB 1JT2A 5CNIA 4WKPA 3R7DA 1PQWA 5DU2A 2ZCUA 3M5CA 3RQIA 2PWAA 1UQRA 2C5LA 3F90A 2X2FA 3BERA 4PYLA 2FEPA 1YB6A 3GFQA 1HDCA 1U7HA 4XH9B 5B36A 1X86B 5H70A 3DZHA 1MX5A 2N42A 4IILA 5F3RA 2DBQA 4ZMRA 4MV9A 1EWQA 1KFEB 2HA6A 2R00C 1EPUA 1PWYE 3IIJA 3K1AB 2QEQA 2P3SA 1AZWA 2HPAA 2WT4A 4ND8A 4Y0VA 2GT1A 1VPTA 3QQ5A 1MZVA 4TLBA 5EFOA 2YWGA 5IJWA 1TEVA 1QQ7A 1A1SA 4FT2A 3KD3A 4J0FA 4LVOA 1U9ZA 4UW9A 1R18A 1M10A 4QUIA 4EA7A 4EJSB 4OH1A 1TPYA 3OX4A 4YROA 2W90A 3D7LA 3WGMA 3L41A 1QE5A 4FE3A 1JG6A 4G0ZA 1UJ4A 4GBED 4DSUA 2W6MA 3MK31 4J75A 1BXKA 2IH4A 3V3TA 2C3UA 1LX7A 2GAJA 1UF9A 4ZVKA 2ZE6A 1I7SB 2RE8A 4WCFB 2QQFA 3EPPA 1PO7A 3HBJA 2D5CA 3HFSA 1Y1TA 4G81A 1E2DA 4NBSA 4KGDA 2OXRA 4XGIA 4HATA 2Q3LA 2IHKA 4ZCRA 3G02A 3R5HA 4LG1A 1DTSA 5DP2A 2YJ4A 1NW8A 3FKQA 4S1VA 1M0EA 1BWPA 5LU9A 4IOJA 1PJZA 1YC5A 3ENQA 2E21A 1FXWF 2WILA 1ZUWA 5F9FA 1YDHA 5T3UA 1JAXA 1SC1A 2F1HA 3LQ1A 1XKXA 3GJ5A 1EZ1A 1VHDA 3T38A 1PNTA 1CZLA 2IYAA 1CJTC 1WEKA 3AFGA 1A27A 3DVRX 3RE1A 2OZVA 1T0BA 3Q3VA 1JHUA 2NO6A 1KO8A 4JKYA 2J9RA 3U49A 2AZDA 4NZNA 3HB9A 1OAKA 3LM8A 2JF0A 1G20E 3OJFA 4ZVUA 3INTA 1MQAA 4P31A 3R7BA 3NTVA 3TNDA 1BEEA 2ZTVA 5YASA 1Z6QA 2ZCJA 3O8OB 1G2QA 1YE8A 2FZVA 1IG3A 3AI7A 3TZ6A 3A6KA 1JLMA 5C53B 4DTIA 3HA3A 4HAOA 2A4KA 2H1VA 4UDXX 4LRQA 4ZAWA 2HF7A 2IELA 3MF4A 4ZOEA 1QTIA 4KAFA 3R5JA 4NCIA 1Z5UA 4R5MA 3C1AA 3OZAA 5F7OA 1BD4A 4OV6B 2EV9A 5GJBA 3W6NA 3PEWA 1S2GA 4RTRA 4Z3OA 3IILA 3NVKI 4O3MA 5HVNA 3ICQB 1DP4A 2HGSA 3B38A 2W2TA 1CP3A 2I6TA 2SCUB 2ZITA 3T99A 2OL4A 2WFLA 1F2DA 5AI9A 4B34A 2P0YA 1ZOPA 3IQHX 3AKZA 2ZP1A 1KDVA 3TRKA 1OX6A 2FPGA 2OCPA 3QF4B 4AMVA 5HP4A 1RRMA 2PK3A 3ROKA 2A5FA 2PMEA 2GLTA 3T9CA 4D0SA 1TA9A 5DHFA 3FDIA 1NLYA 1N8SA 4KAXA 3QOWA 2IV2X 1I6LA 3G1TA 4UXIA 2QTWB 5AO9A 3UW3A 3W6ZA 1ILEA 2HZ7A 4WXHA 1QM5A 1OWOA 1YB2A 1JH8A 2IQIA 1W85A 3KLMX 2VTVA 3NHRA 4RORA 3QKTA 4YREA 4R8LA 4WMLA 5JISA 5DYTA 4M2LA 3NYRA 1MO2A 4FDLA 4JUBA 5BYBA 5A4FS 1QWSA 4MGYR 1PUIA 3TSYA 1U2TA 1HFEL 4Y8VA 3EH2A 1XR3A 2WSBA 4HB3A 2FMKA 2D2VA 3LDHA 4XTCS 3DVLA 2QU8A 3STVA 4DA0A 4EFKA 1AQYA 3IESA 4FZ5A 2J6CA 1Z25A 3LV8A 1G8FA 3GEEA 2YS7A 2Z56A 4ZAGA 3AVTA 1C9MA 4R69A 5EOVA 3RLFA 5BRAA 4L22A 1XKLA 5EKXA 4CZ2A 5K1ZA 1YRBA 2AGVA 3EVNA 3L0CA 1CY7A 4G0MA 4Q7EA 4D56A 4X1OA 5A2QA 1DLJA 3M3HA 3NO4A 4EG4A 1I3CA 4RTPA 3OQMA 4C4SA 1FLAA 3BE8A 1SPXA 5AM3A 4DV5B 1ESNA 1KAOA 3ROFA 3T7RA 4CMGA 5KSPA 2QNBA 3OI7A 1EUDA 2C5FA 2JLBA 1ONSA 3D1JA 3HR8A 3CR8A 1Z0IA 1N2EA 4P4TA 1PU2A 1UOPA 1YI0A 1YNOA 2WAAA 5IYZB 4BPBA 4DLZA 4BKOA 4E22A 4MUHA 3JQGB 1E2HA 1CDOA 1ZI6A 3DDUA 1NF9A 2CEKA 2IOFK 4P53A 2QSZA 3TKAA 4UMEA 3UJHA 1BDMA 1H85A 5K0LA 3D8BA 2V7XA 5DGHA 3ADCA 3MS4A 2YBDA 4KXNA 2EKQA 4ZP1A 3B51X 3T06B 2V7VA 4XTRA 2YHSA 2EKBA 4F06A 4BMDA 1NGSA 3R24A 4XVHA 5HKKD 3GLIE 2F43B 1CRQA 2ZUCA 3HJAA 1ZN9A 4E32A 1GFSA 1EM8A 3WK8A 4B7UA 3ONDA 1JDUA 1Y6ZA 2CLSA 3L3BA 4RPIA 1RHQA 4ZO7A 3V8RA 4EKDA 2IUFA 3U1BA 3QPBA 4F4IA 4X1YA 2XMQA 1H0KA 1VLJA 2Y0EA 4N3GA 2HB6A 3V8EA 2C3PA 1EM6A 1J97A 1MJGM 2C2OA 2HWKA 4UMVA 2H4HA 5AHKA 2UZ1A 4KPFC 4PLGA 2IE0A 3RRJA 3FUXA 1Y7TA 1V3TA 3HTXA 3SN6A 3CA8A 3INRA 4IWXA 4RA9B 2KM1A 3I6IA 1AB6A 3DTTA 2ZBDA 2HV9A 4RF5A 1OYVA 1YBAA 2BAGA 3DMGA 5GJWC 4ZYYA 3NNSA 1MW8X 1KP2A 2H63A 1WE2A 3M9XA 3DYBA 3L6OO 3UK0A 1Y3HA 4ZT3A 4CHTA 3ZCTA 5TQ0B 3R1IA 1NVAA 1T2CA 1AQUA 1NLFA 1W2WB 1KK1A 3C3YA 3LE8A 4IYRA 3ENWA 1ONBA 1JZSA 1MDBA 3NT5A 3MRSA 3OCWA 3TEJA 1WCV1 3UN1A 1D09A 2ZT6A 4YRTA 3KYJB 1OBOA 4BZPA 1D6SA 2AQIA 3RUHA 3I45A 2O3UA 2RHDA 2UAGA 1WF3A 1YFZA 1NVTA 2J48A 5JH7A 2H06A 3H3FA 5NULA 1YRAA 2GTPA 4X91A 5EGSA 2B36A 1BVRA 4YCLA 3R9WA 2W6JA 1F8UA 2YXEA 4Y0NA 3O8QA 2FW8A 4CR6A 3AF1A 3NH6A 3OEED 3KXPA 1JP7A 2DPHA 1MPXA 5HCIA 5K9ZA 3T1VA 4FS8A 1M6VB 4D9NA 4G0UA 1RADA 1BJKA 1U7TA 2A0UA 3KC2A 2W6CX 3AYXB 4BKPA 2ODPA 4Q15A 3EMDA 3ULKA 1CEQA 2M32A 3EVTA 1AO3A 1VGQA 4PFJA 4QUGA 2OD7A 3AT1A 4B2PA 1U0NA 1SZDA 1KGDA 3SMQA 4R8SA 1OB5A 2VQFB 3WADA 1XZHA 4YLEA 4JI6B 4YP1A 3L4KA 4LJSA 2ZWPA 1KK0A 1YF3A 4R41A 2G1AA 4I1OA 2F3RA 3K94A 3UAYA 3X1XA 2FSPA 3U60B 4JJKA 1XD9A 2B3TA 1PGPA 1DIGA 1EUCA 3KXDA 4X92A 1CVRA 1V6CA 4OJKA 2XZLA 4LVUA 4H3HB 4OUDA 1GA1A 1MZPA 5CEJA 1CY2A 2C97A 4V3CA 2ZUEA 5SZJA 5HTKA 2Y9MB 2OBYA 2IDZA 3C39A 1JHDA 2Q5OA 4TMWA 5HRUA 4Z4HA 1F7VA 4BRZA 4F3NA 4E31A 3I0MA 3KVNA 1EFVA 3G6KA 4IIGA 4DW8A 3NIWA 4MGZR 4AJ2A 3B5EA 3ROPA 3PGXA 2AW5A 1G5TA 1YMQA 2OSBA 4XQ0A 3C5HA 4NEQA 1JEAA 1C9KA 2OCBA 3NEJA 4C4YA 1ZRHA 4MPPA 2AQ8A 3AY3A 4LY3A 3HCOA 4YRJA 1G7SA 3UAWA 2MU1A 3HS3A 5BW6B 5LQDA 2H92A 4C06A 2IIQA 2BKLA 4AJEA 3ZQJA 4AYWA 4E2WA 1GTRA 3JV7A 4H27A 2PSEA 2A1UB 1R4NA 2P8JA 3G2HA 2OCAA 3IE0A 5CYPA 4YR9A 4KH1A 5AVUA 1YR7A 1YQWA 5C2JB 4UUMA 2QMQA 5DH9A 1MB3A 2BFMA 1L7EA 1N3BA 4OP2A 2JLWA 4G67A 3BJEA 4I4TF 3I62A 3VR1A 5JNSA 1RXSA 1CS4C 2FP4B 1LPPA 1UZLA 3NH9A 2E4XA 3O0TA 4F92B 4RY2A 1Q57A 3DEKA 2DLNA 5BSFA 5IXSA 2HJHA 2YZ2A 1QG2A 3VDMA 1SHJA 4BLQA 4A82A 1B8UA 3AJAA 3CFYA 5SYAA 1MFPA 5DGXA 3TD6A 2OHJA 3SHQA 1OHHD 4RZXA 1ZYUA 3NBAA 3A58B 3KHSA 3HVKA 3U7EB 4CM8A 1E3SA 3C8MA 3DR3A 1M2VB 1KY2A 1TKAA 1OWMA 3UFXA 4GI1A 3U5TA 4C7OB 3IX7A 4CPDA 4YXFA 4ZMBA 5JAIA 4E5PA 4K8RB 4O4JA 3AYZB 3TAUA 1XTIA 5F2KA 5BNFA 1N57A 3WL5A 3I3OA 1EU1A 1WEHA 1O94C 4NBNA 3PFKA 3O4JA 1PLLA 2BGLA 2WF6A 1A4RA 1K7YA 4KV9A 3QVLA 5CFNA 4DCGA 4OJNA 1YZKA 1G8MA 4P8RA 4CLXA 2CWDA 3CMCO 4ZOBA 2VFAA 1DVRA 1NUQA 1GVHA 4FI3F 3MUEA 3WQRA 3GGPA 4ZT4A 3G13A 5KYGA 3H5IA 1OH8A 3I2KA 1YZFA 4MLDA 3GLTA 2VSYA 2GRJA 3C15C 1X7HA 5CLLA 3UQYS 3SHVA 1TK3A 1Y82A 2F8LA 1G55A 2CLCX 1MENA 3PQ6A 5EIWA 1KOJA 1TF2A 4FJ0A 5FTNA 1RLTA 3TUZC 1IZZA 2P9ZA 1NP3A 5DM0A 2IBTA 4NCXA 4JQSA 2WHRA 3PHHA 4WKGA 5EMHA 4EG5A 4PGMA 5ALQA 3M3PA 4Z5XA 1ZESA 3M1IA 1O57A 4LECA 2HOQA 5CBKA 1WB6A 1XMPA 1R74A 4LHYA 3NJ8A 3HMKA 2X9GA 1O2DA 4GC9A 4WRRA 3AUKA 1WQ1R 5CHYA 3OWXA 4NRDA 2BFBA 2OO3A 1P5RA 4DCJA 3DA8A 3VQTA 4F3YA 3PXDA 4JNKA 3QY0A 1ZOIA 4GVXA 3B6IA 1RZ3A 2JJ2A 5ITSA 3KE8A 2JK1A 4KWIA 5TEWA 2HYIC 1EIWA 3FUWA 5FL3A 5TX7A 2VHCA 3VKFA 3LUJA 1LDNA 4I5EA 2D3WA 2E7ZA 3DHEA 3G8DA 3X2FA 5CW2A 1K4KA 4GSKA 1M0SA 2Y6UA 3ASZA 1R15A 3EF0A 3HJNA 4HB2A 4K9QA 3A2LA 1EFDN 3U17A 2A9RA 3DLTA 3I2YX 3NHAA 3EBOA 5EP4A 4IQ0A 4HNGA 1XRQA 4AS3A 4F1WA 1EFRD 2IXFA 4YMHA 2W5UA 5BSEA 5GPBA 4DMUB 1X7YB 2R47A 2ZS9A 2FWMX 3DE4X 3C6ZA 4BP3A 3VX3A 3Q7PA 2YYZA 4NAUA 5FNVB 1FFAA 4HEHA 2XBLA 4IJWA 4MI3A 4MS1A 1UL1X 4RLFA 1R6XA 3CLKA 2ECPA 3LUCA 4U6NA 2R6CA 4RD1A 5EXXA 3OQOA 2C4NA 4PFSA 4ZQGA 4URFA 4GX1A 3U3OA 2IYEA 1NBIA 2DTXA 3FPHA 3ANXA 2N9UA 4RM2A 4R81A 3ZW8A 4J03A 4IP0A 1I5EA 1Y1KE 5A06A 3GHYA 4KQGA 3NW9A 3ETLA 3OCYA 2K6GA 2WU3A 2GD1O 4XCVA 5LQNA 2A1TS 1E9RA 1OXKB 2EGUA 2I1WA 1OASA 2BFAA 5JPCA 5FV7A 2XHZA 1FFXB 2XLBA 2WTXA 1D9XA 1G20A 3T1OA 2PRIA 4C0LA 1XWIA 3HP7A 1OC4A 4JSTA 5GINE 4CU5A 2CUTA 2IU3A 4TWZA 3ZXXA 5J40A 4BAUA 3S1SA 3U6BA 2QRHA 1BFDA 4MLCA 4TQGA 5BN4A 3MUFA 3DAYA 3HZZA 3RJZA 3DLAA 3OO1A 3LKVA 4QODA 3MAGA 1QP4A 1HDXA 4OK3A 3GA0A 2QK4A 4FQ8A 3DMHA 4H4DA 1QIKA 4ZGGA 5CYGA 6REQA 2BFPA 2TSYB 3IQEA 3UHOA 2E0IA 3ZCPA 1PQPA 4JI8B 1SBNE 1RYBA 4QVGA 2HRCA 5H7XA 4K6GA 5D8DA 3PDJA 3NT4A 2WJPA 4RDHA 4B43A 1HE2A 1P7PA 3UXYA 3KAKA 1UXKA 3STYA 4ZV4A 4C05A 2NU8B 1R50A 3K6RA 4QNRA 3SCZA 2Q2VA 5HMLA 3FMPB 2CNLA 3OQNA 1NYQA 2G4VA 3B7GA 4KLZA 4C6RA 1LRJA 1KHHA 5AK6A 1QYWA 2V5AA 4UXJA 1WUHS 1XZDA 3ZIAD 3E5NA 1B0ZA 1KEWA 4JJ8A 1C2YA 1L5MA 2HHJA 3VAYA 1H2HA 2BP7A 3LRTA 1O4WA 2DFLA 2CZQA 1XZCA 2JI9A 4MQFB 2YWDA 1X1EA 2WIDA 4NESA 4WN9B 1KDOA 3Q3HA 4ESVA 2EJCA 1ESCA 2P4EA 3IALA 1USVA 1CKEA 2HDHA 3THXB 1D0VA 2JAUA 4TTAA 2JFPA 3OWHA 3U09A 4HX9A 3L7DA 3V1TC 1JQEA 1SKAA 4GYJA 3T5PA 2ZI4A 1E3TA 1QE0A 4BMVA 4ZREA 1YDMA 3VM6A 2WOJA 2XDQB 1XRMA 4ZXFA 3PL1A 4FHCA 3CCFA 3ZI4A 2VDQB 4FSXA 1RM3A 2JEOA 1M7GA 1M83A 4RGYA 4GOOD 4KK4A 2Q8PA 4ZT6A 1B15A 1YQEA 3NXKA 4IKOA 4QGAA 3UEOA 1CE8B 1D5WA 1MAWA 2G6BA 3NYIA 1A5BB 3OE7A 4TLEA 3TLZA 1SOUA 5LC1A 5JXWA 3THWA 1MP0A 3PQ8A 4HDKB 5DV9A 4YPFA 4GWLA 5EKSA 2B8WA 2OLEA 3IYLW 4FYXA 2B4RO 1DL5A 1HFWA 5FCDA 4QT0A 3B6MA 1KMQA 2VN8A 1WLYA 5KTTA 1V48A 3RK1A 4J0HA 3LQFA 4K2AA 1P4GA 4D4GA 4D46A 3ZY3A 1SCUB 4OKIA 2YYYA 2EJWA 4DCNA 1EBFA 2DPLA 4IIHA 3C70A 1SY7A 1EVZA 2ZTSA 3F5MA 2V9ZA 4YRDA 2BEVA 2YV2A 2P8SA 1MX1A 3KRTA 4K86A 5T8KA 4QL3A 4CQMD 2VYCA 3CF4A 3FA2A 5L9AA 3SZOA 4V1CI 1J21A 3T4EA 1CX9B 2HSEA 1YBHA 1PHPA 3X2SA 1RJDA 4ZVTA 1DE0A 5KINB 2CMKA 3GLIA 2XUGA 4P4SA 2VOJA 3IOCA 3MLEA 2QVZX 3IH5A 4IGEA 1FNSA 3UENA