3K9WA

Crystal structure of phosphopantetheine adenylyltransferase from burkholderia pseudomallei with hydrolyzed 3'-dephospho coenzyme a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
163
structure length
163
Chain Sequence
GSMVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFFSLEERLKIANEVLGHYPNVKVMGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of phosphopantetheine adenylyltransferase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
total genus 62
structure length 163
sequence length 163
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3k9wA00
1JEEA 3TQOA 4L2IA 3G5AA 1JEDA 1OWMA 4YP7A 2OQ2A 3IUEA 1OWOA 3CVUA 3SEQA 4TS1A 4HJXA 1MAWA 3DPIA 1G8FA 1I6KA 4MWEA 2AZXA 3PNVA 4YP5A 2HMAA 1VBNA 4MW2A 3KT0A 2G36A 4G5FA 1GZUA 3D6UA 3AIIA 3RHSA 3ILVA 3SP1A 1JZQA 4MVWA 3FOCA 4DNXA 2YY5A 2WQ6A 2A1UA 1N2GA 3CLSC 4KPUB 3CLTD 3ND5A 1JZSA 5LFAA 1T6ZA 3TQIA 1JIJA 1OD6A 3A05A 5FO1A 2DLCX 1JMVA 1M8FA 1WZ2A 2CV0A 1MB9A 4MUFA 2A86A 1N2HA 4KR9A 1JIIA 1O96A 2CYAA 2J4DA 1J1ZA 1M8KA 1TYDE 1T9GR 1V47A 2J08A 1Q19A 2PZAA 4MAFA 3Q10A 1IFXA 1MC1A 2HGZA 1LI7A 1GPMA 5FO0A 1G8HA 3MLAA 4RUKA 4YP6A 2E0IA 3CLUD 2O8VA 2PIDA 3A2KA 1I6MA 4QREA 4EGAA 1O6BA 1HYBA 2H2AA 2X1MA 3KT3A 3K9WA 3NBKA 1EFPA 1N3LA 2VTBB 4Q16A 2YWCA 1TQ8A 1QRTA 2CSXA 3X1JA 1QRSA 5H7XA 1N2JA 3FIUA 3Q4GA 2PFSA 1KQOA 1EFVB 1YI8A 4UZFA 3ZUGA 3H9CA 1PFUA 3OP1A 2Z08A 4NATA 4ZCSA 1XJQA 4H3SA 4EFKA 2VTBA 2JAXA 1U0BB 1GTSA 1J21A 1MAUA 4U7JA 5TEVA 3KFLA 1EJ2A 4WNYA 1T9GS 5FNZA 3U1VA 3K32A 1COZA 1J1UA 1J09A 4RPIA 1LI5A 1TYAE 4NDAA 1KKUA 5J59A 3INNA 4ZCPA 2D54A 2CUZA 3FH0A 3G59A 4JYZA 3KT6A 3P0IA 4MVYA 4R0NA 3RJZA 2QUJA 1KORA 1KAQA 5JBNA 1JIKA 1XNHA 1MOPA 3AKZA 3G6KA 3DV2A 4MWCA 2O5RA 2QJFA 4ND7A 3RBAA 2IJGX 3LE8A 5DK4A 3QTBA 1MBZA 1F7VA 1O94D 1D2RA 1NI5A 2ZUFA 1NYLA 2PXHA 2ZP1A 2BTEA 1OBHA 2X0KA 4XSVA 1EUQA 2R5WA 1U3CA 3IMCA 2CYBA 2J5BA 1WQ3A 3HZRA 1EE1A 3P0HA 3IH5A 3QTTA 1QRUA 5AHWA 1PFYA 4I6JA 2PG3A 1O0CA 5DEOA 1VL2A 1WXIA 3FWKA 2VXOA 3N8HA 4G5YA 2QJTA 3FY4A 1ZUNA 1WXHA 1FYDA 2E89A 4FZJA 4GU5A 2QUIA 2EL7A 4ZT5A 4YBRA 4I6GA 1YUNA 1TYBE 4MW7A 1VBMA 2AG6A 3ZJUA 3LCJA 2A4MA 4DDHA 3VU8A 3HL4A 2CV1A 4MW6A 2Z09A 1N2IA 4Q93A 3IDFA 4QBTA 4DLPA 1S4MA 3ZJTA 3ZGZA 1NUUA 4XFJA 2I1LA 3CLSD 1KH3A 3F3MA 3ND6A 2QUHA 1J70A 4J76A 2RE8A 1VBKA 3CVXA 2A7XA 3HFJA 2DETA 4K03A 1F9AA 5DB4A 2BYTA 3IVXA 4WSOA 3AG5A 3Q12A 1U7DA 2CV2A 3CA8A 1JILA 5K0TA 4MW0A 1P7PA 3ELBA 4DE5A 4KKVA 3L93A 1B6TA 1H3EA 2DEUA 3ND7A 4GRIA 4JXXA 1X6VA 1M8JA 4I6EA 3ZIUA 1NP7A 4CT0A 2XRZA 4CQNA 4R2LA 1RQGA 1EUYA 4DJAA 1GLNA 3H05A 2QTRA 4MW1A 1U7XA 1M8PA 1O0BA 4JXZA 4ZT2A 1KQNA 1ZJWA 3VRHA 1ZH6A 4YMIA 5KWVA 1NUTA 1O96B 3N05A 3GUZA 3IOBA 4AS1A 3COZA 3HGMA 5LM3A 4CDNA 1GN8A 2PZBA 1DNPA 4MW9A 3BL5A 4BWVA 1IH8A 4MQ6A 3FG9A 4JZYA 3S3TA 3MMXA 5H16A 3HMQA 3VGJA 4NX2A 1G59A 2CT8A 2A1TR 1JECA 1YIDA 2DUMA 2EJCA 3GLVA 3TNJA 1H3NA 2DR2A 3DLAA 4PBSA 3CVWA 4EG1A 1YUMA 2CFOA 4R2MA 3FI0A 3DO8A 3IVCA 3MLBA 3KT8A 3HV0A 1ULHA 4ZCQA 4DDKA 2WB2A 1KQPA 1NUQA 1N2OA 4EG7A 1N77A 1R6UA 1WQ4A 1XNJA 2WSIA 1KAMA 4F4HA 2QJOA 5IHXA 1F4LA 4KPUA 3UY4A 5EKDA 4MW5A 1GTRA 4MUGA 3PNYA 2QTMA 1O94C 4P2BA 1IRXA 1OWPA 1QU2A 3GMIA 3C8ZA 3ZXIA 5K0SA 1PFVA 1I6LA 1OBCA 4OJMX 1YIAA 1ZH0A 2V0GA 1M1ZA 3TZEA 4U63A 1WJGA 3H9BA 1KH1A 1OWLA 1QJCA 4DDMA 3IUBA 3RK0A 4ND6A 3P52A 1TYCA 3P0JA 1QQTA 1TEZA 2DPLA 1BS2A 2TS1A 2J07A 3PRHA 3X1MA 1O97C 3CLTC 3I05A 4MUHA 1I2DA 3IVGA 4S1OA 1KH2A 1IQ0A 1J20A 1K92A 1Q77A 5J5AA 4PBRA 4ZT7A 4G6ZA 1KP3A 2ZUEA 2D5BA 3CLUC 4MUKA 4ZCTA 2NSYA 3IMGA 4ZT6A 4ZT3A 3N2YA 4MUEA 4EG6A 1FFYA 4EG3A 1N2BA 3TS1A 1Y42X 2QUKA 3IODA 2X1LA 1JGTA 1XNGA 5HUJA 2QTNA 3UMVA 3FNRA 4L2IB 4MULA 1KP2A 3LOQA 4ZCRA 1JHDA 3MXTA 4ARIA 1Q11A 2D13A 1N75A 3IMEA 1WXFA 1ILEA 4NZPA 3M5WA 5TS2A 1V8FA 4MUNA 4AQ7A 2AKEA 2C5SA 3CVYA 1NURA 4JFAA 3ZXSA 1R6XA 1MJHA 3RFFA 2NZ2A 4U8HA 3ZJVA 1PG2A 1IVSA 4KR6A 1NZJA 1LW7A 2JANA 1T6XA 1O95C 4OUDB 1H3FA 3CLRD 1IQUA 1M83A 3E27A 1M8GA 5IJXA 3AG6A 1SURA 2GOYA 1WXGA 1Q15A 3AFHA 1MB2A 2OV4A 1O97D 1N2EA 3IOEA 2WQ7A 4UZEA 1GAXA 1QTQA 1UFVA 4HPWA 4MUJA 1EFVA 4MWDA 1A8HA 4OUDA 3SDBA 1IHOA 1EFPB 4EG8A 5TGTA 2E21A 3NBAA 4HJRA 1R6TA 2A84A 2J09A 4NAHA 2DERA 4MW4A 3MUEA 1N78A 2A88A 2YXNA 1WKBA 3COYA 3SEZA 3FHJA 3PXUA 1T6YA 4ARCA 4MVCA 1K97A 5DASA 2IP1A 3CVVA 4MVXA 4KR7A 5TEWA 2DXIA 3A4IA 1K4MA 1PG0A 5KHAA 1NUPA 2HZ7A 2JA2A 4E1AA 2Z3VA 2B7LA 1PFWA 4XFDA 2PZ8A 5LLTA 4EF6A 3A04A 5KCMA 3COVA 4QRDA 1WXEA 3COWA 3OTWA 4EG4A 5HG0A 3JXEA 4NAUA 3CLRC 1WOYA 3D6VA 4MLPA 3QE4A 1WY5A 3UC5A 1F7UA 4PBTA 1G8GA 4MWBA 4CDMA 1EXDA 4K0RA 3NV7A 5BNZA 4MUIA 3FDXA 3SZ3A 5J58A 3N9IA 1U3DA 2IELA 3H97A 2CYCA 2V0CA 3ISJA 2A1TS 3IOCA 1NUSA 4ZT4A 1QNFA 1H1TA 1IQRA 4A91A 4HK4A 3TZLA 2GKSA 3H99A 3AL0C 1QU3A 4F3RA 1KR2A 1NSYA 4PY2A 3UK2A 1MRZA 1CT9A 1K4KA 1O5TA 4EG5A 3SYTA 2H29A 1O95D 2RD2A 3PNBA 3SZGA 1X8XA 1N1DA 2E18A 1VLHA 3CR8A 2X3FA 2A1UB 4X0EA 3UOWA 3L92A 3RK1A 5HUHA 2GM3A 1YULA 4J75A 2YWBA 5F23A 2XRYA 1TFUA 3FETA 1OWNA 3X1KA
chains in the Genus database with same CATH superfamily
1HDCA 3ILYA 1JEEA 2PKQO 1SA0A 3MTBA 4P7GA 4QEDA 3OZSA 1UKAA 1WCXA 1SCUB 3FPEA 3MIZA 5SYNA 2I2WA 2P9CA 4UNIA 3IC5A 2HXSA 2IOFA 2OQ2A 4FNOA 1XLWA 3ROKA 4JZKA 2ZSFA 3E0XA 4JUFA 3OQOA 5CM9C 3L40A 2XBUA 2C2GA 4U2EA 4RJTA 2BGNA 1YZFA 3AJ8A 3G0IA 1IDN1 2OM2A 1ZOSA 1N32B 3OOSA 5BR7A 5EPOA 4PXAA 3DPIA 3ROEA 1JH9A 1SC9A 1G8FA 1W5AA 2PWPA 3OX2A 3PNVA 3BB3A 3O8QB 5KYNA 1E1QD 3T7SA 8MHTA 1K89A 1Y5LA 3MCWA 4XEUA 3DLCA 1AKUA 4CCYB 1N5KA 3PUZA 3P9IA 4OQLA 2EDCA 4LMRA 1BD4A 4EENA 5TVGA 1M6VB 1LY1A 2A1UA 2P3SA 4A5SA 4D4JA 2WSSA 3LCUA 5E95A 3CUUA 3NUGA 4H7FA 3QU9A 3KKQA 1ZK1A 1JIJA 2O8FB 2ZUBA 3GUVA 1PYGA 4ITRC 1YKSA 1VMIA 5E6RB 3TQRA 4FT2A 3P96A 4ER0A 2GCGA 3C1AA 2FSSA 4XA8A 5JROA 5EKXA 2NT3A 5AKXA 2E5LB 3IT0A 3H65A 3OQPA 3P5BA 1Z73A 2CJPA 1DDIA 1VKNA 1MB9A 4YAWA 3WV5A 1ZNWA 4GKAA 2B7BA 5ESXA 4MRMB 4ZVSA 2Z98A 2B78A 1BC5A 2CYAA 3DDUA 4A2PA 1QCZA 4AMVA 5KTNA 2AFHA 4WXYB 3K70B 2QN7A 3IQXA 2DUWA 1U5AA 1ZGHA 1CHDA 2A3NA 2YXLA 3PFGA 3QQ5A 1PW7A 1T6BY 1YB4A 3KPYA 2OCXA 4DN6A 5ADHA 4NG4A 4D74A 2QGNA 2EZ4A 1QG6A 3ZLJA 1UJ4A 3LAWA 4U9IS 3CLUD 3ZD7A 2O8VA 5I3ZA 1J8VA 1QS0B 2EW2A 2DFKB 1V41E 3GJSA 2VJCA 4TL7A 5MF6A 2QW0X 4J3FA 2FPKA 4RZHA 4WCDA 3L49A 1GJRA 1YBVA 1J8YF 4NP6A 5DWDA 1PL0A 5HBGA 1KI6B 3PC8C 3SSOA 2Q3HA 3EHEA 3VYRB 5KYVA 4AKGA 3RCBA 4HDNB 3J7AC 4OQPA 4NNOA 3QBTA 2JCXA 1B0AA 1XVVA 2DX7A 4PLVA 4QOHA 4KTTE 4Y7CA 1WP9A 2D4AA 5FB3A 3ETJA 5REQA 2G9NA 6AT1A 2EFEB 2RCYA 4RV4A 2JJYA 4KQMA 1P1CA 1ZUD1 4PX9A 1ZN7A 3HCAA 4J07A 3D02A 1W36D 3OF5A 7MDHA 1HO3A 3OSZA 3PA8A 4B6JA 4JJFA 4YFYA 3MB5A 3MW8A 3K6SB 2ILTA 2PGIA 3CG4A 3PKJA 4PLWA 4NCBA 4RHCA 7REQB 2YVUA 4FJ2A 2A7QA 2VPYA 1J22A 2GFIA 2J3IA 2NV2B 2YMLA 1BROA 2BKVA 4RMIA 4BP1A 4XWYA 4W9MC 1FFHA 1WU8A 4IR7A 3DE2X 1TYAE 1B16A 1MB3A 3PGMA 2B4YA 1KKUA 4NZZA 5EJ7A 2JLUA 1ZONA 2QP4A 4I55F 4JBYA 5DO9A 4YNBA 3IAS1 4ZC8A 1SCIA 5EE1A 2I99A 3WB1A 4D0SA 1UK8A 3WKAA 3JWJA 1L7OA 1AGRA 1A5ZA 3FNBA 2C2MA 1RRPA 1Z13A 3F6CA 3HLYA 4YROA 5JQWA 6ADHA 1A1SA 1N2ZA 1L5HA 221PA 4M21A 1IZYA 2OUKA 3QTBA 1Y7LA 2X19A 2ZLBA 1ZUNB 1T3HA 1FFGA 1ORWA 3NKVA 4JJEA 4BAUA 1P2SA 4LVNA 3GLFB 3WE7A 4RZQA 1Z34A 2Y1EA 4LBYA 3HUDA 1E0JA 4MQUA 1AY0A 3SIPA 3F96A 4G5XA 2X0KA 2QXYA 5GM2A 4ENWA 4UNSA 4LZOA 1BQEA 5FFMA 3UUEA 4A82A 3T5PA 1VG9B 5D3KA 2PRSA 3M34A 2UVDA 4G5QA 5F21A 1VGRA 2VDQB 1GQ2A 1CR6A 3V2UA 3FPFA 1GV1A 4QYWA 4RELA 5A4MS 5AHWA 1C8LA 1PFYA 4R05A 1W4CA 4DUPA 1MQAA 4FDUA 1M0SA 2BGMA 3GFOA 4KW7A 5DEOA 3LD9A 1IHPA 3CF4A 3A1WA 2QMYA 3WG9A 4Q4HB 2GERA 2P62A 5FJJA 5MN4A 1SC1A 4JXJA 3FKSA 4TUYB 4UHJA 1B0ZA 1R9JA 3C3WA 5B1EA 2ZR0A 1Z7BA 4IGIA 1DWOA 4NK4A 4J7XA 5AUOB 3T5GA 4I81A 1CVIA 4BGUA 3P9CA 3RJ5A 2QX8A 5LXTB 2R2GA 2BGWA 2IHUA 4V1CA 3KKZA 3HZOA 3KKNA 3L2OB 4MV6A 4WINA 4EPVA 2PJZA 3EA0A 3VU8A 1WA5A 3LW7A 1IBLB 5JC1A 4Q93A 1KERA 3KZ1E 4HDCA 4DLPA 3J80A 2XMZA 2OXIA 1JKXA 4M8IA 4EHDA 3ZGZA 3I58A 2F48A 3B51X 4CM5A 4XFJA 2DBQA 1JG7A 2FMKA 3DEZA 5D85A 1P2UA 1USWA 3ZZNA 4MV1A 1IN7A 2AYYA 3SPXA 3HFJA 3WA7A 1X80B 1A72A 5IBQA 2GLXA 2ZSEA 3K0AB 1QV7A 1TM4E 2VYQA 1RQ2A 3T7KA 3IDZA 5DYNA 3MJ4A 1VDMA 2CCJA 4BPBA 2ZWIA 3AB8A 3T35A 1FCJA 2Q7OE 4OP2A 2FUG1 1Y1TA 1AUXA 2VYFA 3H86A 2EBFX 5FWAA 4BBJA 5K8IA 1ZJYA 4DV0B 3IUSA 1CUXA 1X1TA 5J4HA 3OF2A 2YQ5A 3OPYB 1LFDB 4IIXA 1U0JA 4GPBA 4C05A 1GRCA 2C9OA 5I9MA 1P1IA 2ZB8A 2ZRQA 2NV6A 3D2CA 1X14A 3QEMA 4TMXA 3H1GA 3S2UA 3A28A 4CIVA 1GCGA 3OT1A 1TZJA 4C4AA 1GTJ1 2B4TO 2VEDA 5CG1A 2P9QA 3PSHA 5A5GA 2IH5A 4PZEA 5SZHB 2UXBB 4KR3A 2RHCA 4G1CA 1TIKA 5FP0A 1EUYA 3RT9A 2WYIA 3RKRA 1GA4A 5K0EA 1ISJA 4IRUB 1RHKA 1E77A 2OWDA 3KALA 4WK6A 2FQYA 3AFNA 4OHUA 3UOAB 1M8PA 5B5SA 4TZ6A 2CLIB 2GSWA 2MSLA 3QVUA 2YS6A 1L4UA 3OUTA 5LMNB 1IMJA 1Q20A 2HD4A 4JT4A 1Q91A 4RLSA 5C1PA 1DG9A 3LYAA 4FQ8A 2AX3A 3IAM6 3HKDB 1QIMA 4E5YA 3H83A 2IYXA 1VP3A 3OIDA 2G1KA 2IZ5A 3HCFA 3WLLA 2X4IA 3WYDA 2JLQA 1NBOA 2GNPA 3F90A 1I33A 2ODNA 2BUBA 1OC4A 1T3TA 3NOVA 3NWPA 4P83A 2H06A 4UUOA 1VJ1A 4GZ6A 1NQTA 4CYMA 5LQDA 3OQVA 4HB2A 4O33A 4QIHA 1IIRA 4LRQA 2PYIA 3D2BA 3TNJA 4FPXA 3CC8A 2A9RA 1H3NA 1N8KA 4OB7A 1TAHA 3H3FA 4JN6B 4P93A 1Z5UA 1OFVA 4RM2A 2CFOA 5HTOA 3EVDA 2CBXA 2MYNA 4HGZA 4DUGA 1X7XB 1NOIA 2H5EA 1FY2A 3TBFA 3QNMA 1N5DA 3K94A 1WDMA 3Q7SA 5HEKA 1C7FA 1EM8A 4LE2A 1ETHA 1WDLA 1W4RA 3R44A 1W85B 3HKBA 1LGYA 4Q4JA 3VBCA 4Q15A 4D80A 2J5XA 4DZTA 4EY3A 4RIIA 4HNSA 1PUJA 2WSYB 3I1IA 1A8QA 2QZZA 3WL7A 1NE7A 2QNBA 1LLUA 1MX1A 3UAOA 3LUBA 1W49A 1BDHA 3SSAA 2V4MA 4OYYA 1SUFA 4UTNA 5IT9A 1T5SA 2OGZA 4W5QA 4N7BA 2DP4E 3AP2A 2WQZA 4OB6A 1E2BA 1F60A 4HNAB 1GOTA 3T7IA 2GBLC 3C6MA 1BXZA 3ZDXB 5A9RA 5LZ9A 2XCSB 2IU0A 5JW6A 2IF2A 2A9JA 1XL1A 3MTIA 4BQPA 1V9SA 1GQYA 4KRXA 3ZBPA 2QYSA 2VG8A 1D4ZA 1FUYB 3FYHA 3SK0A 5FA8A 1JU9A 4W8OA 2PKCA 3GP8A 5FA5A 1IHUA 5ALUA 3QYAA 1HE2A 3AHGA 1Z8NA 4M9RA 3F8SA 3EMKA 4FZ5A 4MICA 2FRVA 1CQJA 3U37A 5JD5A 3ANSA 4QECA 5IW8A 1USKA 4EX6A 1UIMA 4XR9A 3REGA 4U7GA 5EZYB 1YCGA 1NN1A 4PSCA 2D0PB 3ABOB 4CODB 4HF7A 2A0UA 4EFDA 1QO0A 1KH2A 3QXHA 2IKQA 1QYDA 1VKZA 1UJ6A 3Q3VA 2AVDA 4O4HF 4YTEA 5A0FA 5K1ZA 1KHHA 4BMNA 4BO2A 5B4UA 3O8RA 1A27A 1ZI6A 4MXDA 1COWD 2XIQA 4QGBA 3X1WA 4ZP1A 3C6ZA 2QTCA 3H2IA 4KNWA 3VV3A 2C54A 1XCGB 4EOGA 5K3FB 4FYYA 1Y48E 2WSSD 5I7SA 1QKJA 1Z6GA 2OCLA 4YRFA 2P65A 4DAEA 5DBOA 4HQRA 5E6UB 4GR4A 1YU6A 3OU2A 2BONA 2GPBA 4DA6A 1QWSA 3I6BA 3DBRA 1PIWA 4RHYA 4U9HS 1Z0JA 3T3EA 1U0NA 3O2SB 3AZOA 1XD2B 4M83A 3DAYA 4CV3A 4E5VA 2ERCA 3TL6A 3ZW8A 4OXYA 4ZCRA 3ADOA 1G38A 4ARIA 1W75A 4H7DA 3S2GA 4NZMA 4PLHA 3UJ8A 2H1IA 3UIEA 1ILEA 2Y76A 8LDHA 1CRWG 1HFEL 3TB6A 4D42A 2BI8A 2FZWA 4Z9XA 3VMFA 5ENDA 3INTA 4QUDA 1EB9A 1EHYA 3L7AA 5C81A 3A27A 1EG7A 3NWEA 4OA5A 2J9XB 2PZFA 2WSBA 4G8JA 4CGYA 5LVAA 1RHQA 2O8EB 3IVRA 1T0IA 1ZMOA 1SJ9A 3AF3A 4P7BA 4W1RA 2CXPA 4XGNA 1CKEA 3TLKA 2R6ZA 4TRNA 1Y8QA 1W85A 3HKBB 3AFHA 3AYXB 1WKCA 3QKSB 4R69A 3IOEA 3X43A 2QIPA 4C6RA 3OIFA 4Q3LA 1CBUA 3SBXA 4ZK6A 1E7RA 2WIKA 3RIHA 3ER8A 1EFVA 2Q8NA 1JSRA 1ORIA 2BE9A 3OPXA 3WHKA 1H2BA 1ZIXA 1GILA 2GS9A 4CF4A 4ESEA 4HQ6A 4AJ4A 4C0JA 1RIFA 2JGMA 3ZWBA 2HMUA 3CTMA 2FPIA 5FOXA 1BE1A 4AZVA 4D3DA 2GI4A 2A0XA 4UD6A 2FR8C 2HU7A 1G0NA 4OXKA 5F9FA 2F4NA 2O2IA 2XQFA 1LS6A 5DASA 3N5KA 3D54D 3PVCA 3U7HB 1N6IA 3N3AC 2H00A 1EQ2A 3KXPA 5AW9A 1QGED 1ORVA 3I04M 4DM4A 2JGIA 3H5IA 4L3WA 4CM8B 3EPKA 2HZ7A 4RK4A 2QL7A 4D8TA 3I8OA 3WAKA 1NI4A 1HSOA 2HXYA 5G3ZA 3IP9A 1OX4B 1MG5A 3QMVA 1D2AA 4LJ5A 2YJ6A 4NBLA 4OHOA 4Q7JB 3UMCA 3MWEA 1C0EA 2F7SA 3COWA 5IBRA 3OTWA 3BSSA 1HQCA 2GJKA 1TA4A 1C8BA 1JW9B 3T7AA 1NRJB 5EVCA 5ITWA 4J4TA 4R84A 4TLCA 4YDSA 1WOYA 2O0KA 5DGIA 5K8VA 3AC0A 1QC5A 2RGNC 1KJJA 2FWAA 3QE4A 3UB3A 3CO0S 5KTSA 2BFBA 2XTZA 4QQRA 5T3YA 2YH2A 4DRXA 4HAOA 4CUKA 1IG0A 3ZDZB 2E4WA 1L5FA 2X40A 1MG0A 2W2KA 2VBGA 2I7XA 2E4XA 1IY2A 4JVLA 4KPFC 4JIMA 5SZIA 1LRKA 4R41A 3KVNA 3P9ZA 3H97A 4IIHA 1QYXA 1Y4ZA 1B3RA 3IURA 3LQFA 5D5QA 5HX7A 2VPQA 3NTRA 1GDTA 4FWTA 1A2OA 1OQAA 2M32A 1QNFA 5DTIA 4ZANA 4N5DA 3EFOA 1R00A 1QIEA 4MS4A 4HGRA 1YJBA 2QI9C 3NAQA 3QPAA 3W2TA 1KNQA 4EHNA 5AVVA 3F0TA 5CVDA 1AD2A 1UMKA 1NSYA 2FEOA 5KYYB 2WMNB 3IBSA 1F5NA 4HGOA 2HJWA 2PMCA 2YJNA 4G9BA 3VR0A 3NT5A 1ICIA 2KBEA 1G16A 2PIAA 2HYIC 5A2GA 4Z4FA 1SFRA 4GL4A 1CERA 4UOQA 2EHDA 3RB8A 2RB5A 4L4XA 3WK6A 3I0NA 2QL6A 3PPWA 2RONA 3MMPA 4G8CA 3A1TA 1UOQA 1G8PA 3ZCXA 1E9RA 1TM7E 2WT9A 2C5FA 2YX1A 4B6RA 3USCS 3HYLA 4MPTA 4H1WA 1RNLA 4ZVKA 2ZTUA 4BEBA 4GPTA 4L8FA 2FB9A 3GRKA 1H05A 3G02A 3FWNA 1YR7A 1LDYA 4U2GA 1GLGA 1XGKA 3NHMA 4IOJA 1GTZA 1BXGB 3T3HA 1BOFA 1V9LA 5H8WA 3E9RA 2BI4A 1MV8A 1SR8A 1THGA 4QGSA 2Z0MA 4IYRA 4RAOA 2ADMA 3VR2D 4P0PB 3WGTA 3Q3EA 1BXRA 4XJSA 2V8BA 1JHVA 2PBFA 2H52A 1TYZA 3OZDA 3PXAA 2QN8A 3CBGA 3QVSA 4RKQA 2GZ2A 1EWYA 4RQTA 1RC1A 3L8CA 5AQEA 1KXZA 3FNIA 3PL1A 3KQKA 2W4IA 4Q03A 2YFKA 2IRWA 4RYDA 1E59A 4FONA 2FPRA 5DM4A 5JRDS 5CVTA 3HE3A 3D6UA 3U13A 2JAQA 3JR7A 2PRZA 2QAIA 5A9SB 2BTOA 2R97A 3LO5A 4PYOA 4IWXA 3ROXA 3FVWA 1I4TD 4GWGA 2OLEA 4ATNA 1OH8A 1WZUA 3IDOA 1SOUA 1OPRA 5A05A 1KJNA 1CIJA 1L5SA 1O5OA 2I55A 2ZJYA 3KCQA 2P8JA 3KU1A 1Q22A 3MGGA 4W5WA 4OXQA 2F55A 3BMNA 2QYOA 2B5VA 2RGNA 2E3JA 3QUQA 5TT0A 1C29B 3FDJA 3SC2B 4KQWA 3ESRA 1ES9A 1HNWB 2ZEJA 2GLTA 3VVLA 4QT0A 5AKJA 1IY9A 4BATA 1G21E 1P7YA 3PHLA 1XWFA 4B4OA 4A6EA 1Z82A 3JYHA 4N3AA 1HYQA 4LHSA 1JIIA 3HVIA 1M2VA 5ALIA 1D07A 1FTQA 1PNTA 3BWBA 4ZV4A 1PEDA 4H0CA 4INJA 3HBNA 3PHHA 2J08A 3HY6A 5CEJA 2OMKA 1HOTA 2QT0A 2FSGA 2FNAA 1NWHA 3EZNA 3LYLA 4OKSA 5EAIA 5A5VA 1E9VA 1L5WA 2ZAYA 1G8HA 3GFFA 2OEPA 2QTVA 5CLIA 1U7TA 5CM2Z 5FPPA 1JPVA 5FJIA 2IYEA 4QATA 4AJ2A 4DJTA 1EG2A 4HX2A 4JQZA 3U2QA 2H08A 3II6X 3GCGA 1DC8A 4OBWA 2IGTA 1YHZA 1UFOA 3DGFC 4Z3DA 5A6SA 3DEYX 5KQRA 4ALLA 1GT6A 3GA7A 3FR7A 5CAEA 2E87A 4KWEA 5KWEA 2GN2A 1BOOA 3C3CA 4K5QA 5NLLA 2YWCA 1TA0A 1OLSB 3L7JA 2CSXA 1ADGA 3DH0A 3KPVA 1Z47A 1PJZA 4KXMA 4PPQA 4A1FA 4F11A 1K88A 1G64A 2W8ZA 3BRWD 3G2KA 4Z4IA 4BMDA 1PLKA 1YV9A 2HSDA 3OQJA 1CX9B 2PVSA 1KA9H 2Z08A 1C7QA 1XRLA 2GHQA 1CYDA 1IOVA 3ZEIA 2Y2UA 1HPLA 4PSKA 3ZHCA 3TFOA 2KM1A 3EIEA 1NMEA 1CFZA 3LLMA 3VPGA 1WMFA 5IUKC 5AVQA 1RLMA 3KFLA 1X9IA 3L07A 1SOAA 4N6OA 3B9QA 2OFPA 3ZCSA 2XCIA 5ED0A 2H5JA 1COZA 1KJYA 1T3SA 2BZGA 2AJCA 1J09A 2CLFB 3F74A 3IXQA 4FFMA 5EERA 5HFNA 4C88A 4ZK2A 2FY8A 1FMJA 3RUFA 4LC1A 3TIXB 4X65B 1ZIPA 2GXSA 2YMPA 2PPLA 3PK0A 1JTVA 4WI1A 3WLTA 4L5YA 5K0LA 2O7SA 3IYLW 2Q1XA 2X7XA 3ZW9A 4B1FA 4MVYA 4EB8A 4OHRA 4A0RA 4K9OA 5I7RA 1GZDA 1U9CA 3K53A 4TYMA 3X2SA 5BXYA 1U99A 3DZBA 1P4RA 1QM5A 3ENVA 3O2NA 3WQQA 1OLSA 3JZMA 5HFJA 1RJFA 4MRMA 3COSA 1TC1A 5CFRA 1DAMA 4FUTA 2C96A 1R4NB 2WIBA 3E5NA 3KVVA 2POQX 4L51A 1CDZA 4MJ3A 2TMYA 3PEEA 3OFSA 4FSDA 4WH0A 3IEKA 1K6MA 1NI5A 2PQ6A 1UT8A 3LS2A 4HN2A 1D3AA 1F8GA 3GGPA 1RWWA 2R62A 3TTWA 3UXHA 1IM5A 2W42A 1QZ3A 4QJBA 1H66A 2Q2NA 4IICA 3WYGA 3NHBA 2KLHA 1QHXA 1RLTA 2OGSA 1EE2A 2VDJA 4KTVE 3BSYA 3U3JA 3Q8MA 1WUYA 4G4JA 1GGJA 3V3KA 3K30A 1Z2EA 2B8TA 3QFHA 4CI9A 3KELA 4UBMA 5J2TB 3NV9A 4BECA 1YDHA 3PXGA 3I5UA 1GG2A 1TJPB 1LTHR 1P4AA 5YASA 3ZR4B 5EWMB 3NIGB 2PG3A 2V6MA 1WLSA 3OWXA 1YS2X 4WJZA 4PZDA 2XGGA 1EU1A 3QEJA 4ZARA 2XCRB 2E4UA 4ICIA 4NC9A 2I2AA 4C5AA 1OZGA 2IVFA 5JXGA 2O8BB 3CX3A 4PHGA 3CUKA 3AWDA 4Y6SA 5HGJA 1D6JA 1PR9A 4LOLA 3SR4A 3NDBB 1M0WA 1PI3A 4MO9A 2IS2A 3UUGA 2CUTA 5TSDA 1HRKA 1G8SA 4E1VA 2C7GA 2X7JA 4Q9DA 2I4RA 1FDUA 2WDPA 3JD1A 4IDBA 3PDIA 1VLQA 3DOOA 3NHLA 3HL4A 3OKCA 1XMVA 1LD3A 1Z2AA 2C1XA 4ZV7A 3CRNA 2CHQA 3IQFA 5I8WA 4DSOA 5JSKA 4LVCA 3OT5A 3DDSA 2YINC 3G82C 4PGAA 1GYQA 2YRWA 1B00A 4FFBB 4IKPA 2WHRA 2O3QA 4URZR 1JG1A 2I3GA 4I8DA 1UPTA 2A30A 4HAYA 3BORA 1XFAA 1E1RA 4WN9B 2X0RA 1JHQA 2Q4TA 2OG2A 1UWLA 2R5FA 3GI1A 3AR9A 4M7RA 1QR2A 2RHLA 4CHGA 4CETA 4KFCA 4GI3A 4EHAA 2O20A 4BB5A 2OZPA 2UYYA 4WSOA 2SKCA 1WL8A 3UHPA 3C39A 3B1ZA 3L0YA 1QOPB 4MGIR 3CA8A 2AKYA 1ULSA 2PMDA 3FVVA 1VIAA 3GEHA 1C14A 1A5AB 1P7PA 2I1WA 4QYSA 2GEBA 3LU1A 1Y1SA 5FWDA 5LLSA 2AJ8A 1KI9A 3C74A 4DE5A 3SJZA 4ENQA 1WV1A 1TJNA 1WMAA 4F84A 2GEVA 1VPTA 1DAFA 2ATEA 3WGGA 1EI9A 1F3LA 4KQGA 5FL7D 4XB1A 2IWRA 1RRCA 3PGVA 5FNVF 1NJ1A 2VAXA 2VDKB 2XGOA 3WBBA 5JCPA 3R9WA 1MJ5A 4QT4A 2AIRA 1S3IA 3C3PA 3KXIA 1UUFA 2PQMA 1W52X 3HJTA 2PD6A 1USGA 4O2BF 2XRZA 4IXTA 3ZDYB 4KQ6A 4E13A 1YA4A 4OMCA 1F8YA 4PPFA 2RIPA 2HGSA 1KO7A 1NW4A 4KP7A 3F78A 2Q1SA 2WNIA 2ZSAA 3EJWA 2G4VA 1U2RA 3HEBA 4WL0A 4RFSB 1HFJA 1O6CA 1KQNA 1QANA 4ZVOA 1FLDA 3ZS9A 4QHSA 4BIIA 2OV6A 3FDIA 1AK2A 4YUVA 5TDHA 5FFFA 1K75A 2X2EA 3PLNA 1AB5A 2G71A 3EXIB 1GN8A 3TK1A 4OJNA 1PEKE 2OHIA 1ZR2A 3JATA 4S12A 4Q3AA 5BW5A 3T1TA 1NN0A 1BRTA 2DHEA 3BFXA 3RFVA 1O6ZA 1U0GA 4PRLA 3RE1A 4F6LA 3UT6A 4EJFA 1RM4A 4I36A 5JYBA 4D81A 5JATA 3L6RA 1ZD1A 2YWRA 1C30B 4HLDA 2IZ1A 3AF1A 4EPXA 1VRWA 4BMPB 1QQ7A 4DR7B 1YJCA 1Z37A 2WJIA 3T61A 1W581 4K88A 1Z3IX 1ZI8A 5EFOA 3HK2A 3NXSA 4WCFC 2I3AA 3PFHA 1EGAA 2R4UA 3USES 1BN7A 4H17A 1JLRA 2K7ZA 4H35A 4HXYA 4KLZA 1VCMA 4HWTA 1SBZA 4ME6A 5AHRA 3RV4A 3H3JA 1FPQA 2C9ZA 3BULA 4II2A 1VKOA 3AHEA 4PX5A 2O8FA 3DBLB 4F7DA 3WXMA 1VQ1A 3CF2A 1R8SA 2GO1A 3FI0A 3BWEA 1RBZA 2HADA 1W1WA 4MZDA 1O58A 1CQIB 2JAPA 3IVCA 4EEXA 3AF5A 3RSLA 2JI7A 4C01A 1CJSA 1Y9AA 2WKWA 3C1OA 4G25A 3ONEA 2YZ7A 2G70A 4FXPA 1DI0A 3W3AH 3UGTA 3N76A 3ZQUA 4BX8A 3J7TA 4HLQB 3UAYA 4JVSB 3ZWXA 4DDKA 2OV3A 3PJFA 4NH0A 1O57A 5BN4A 4BNDA 2HIMA 3I2YX 5IANA 3QOWA 3MBOA 1DKQA 2AQ8A 4XUGB 1BEUB 3GEBA 1ST2A 1WQ4A 5D3QA 3FGPA 3BD8A 5KYGA 1T0JB 3I34X 1NBME 4ZN6A 3C85A 5A7HA 3K5HA 3ZQJA 2QUAA 2JBAB 1BKDR 4UHFA 4DNPA 5BUZA 1ZX1A 2QX4A 1GPLA 1DE0A 3STTA 2H1RA 3GMIA 1TAQA 3EIWA 4URHA 1J0EA 2I4MA 3ZS8A 2RAPA 4Z7NB 3MEQA 5LQSA 4DWVA 3LLCA 5CPBA 1ORHA 3FYUC 1QLJA 1U4SA 3NBMA 4LV6A 2FW8A 4U63A 3T7TA 5B2EA 1ESEA 2QRJA 5AKIA 1CS0A 4DEXA 1R0KA 3WIBA 5IS2A 3A3KA 2WHQA 4J1TA 3HB5X 4B7UA 1K3UB 3D3NA 5K3AA 2P68A 3BF7A 4O4JB 5C3MA 2AFIA 4Q7LA 3CXUA 4GMDA 1KAEA 1XK6A 1BS2A 1HYHA 3JQQA 3HBFA 3DDCA 2V96A 3SY8A 3WYBA 4MUHA 3TM5A 1X3LA 4B9AA 3GX1A 3RSCA 1NASA 3EEYA 4HDNA 4IIJB 5HIMA 3S0JA 5EJ8A 1Q77A 1T6NA 2G76A 4OBEA 5SICE 1DXOA 1K3TA 1RYFA 4XYEA 1EPUA 3ESDA 4HWOA 5TF4A 2REQB 3WGYA 1KP3A 2BUAA 1TTQB 2BEJA 3HRIA 3IMGA 2YYSA 4N5NA 4MUEA 4U0KA 1GPH1 3K9BA 4G41A 1R0WA 4AY2A 4IIGA 1FFYA 3BSWA 3AEUB 4KIUA 1P0MA 4XSHA 5JSZB 3H9JA 1J25A 1I0IA 1N0VC 2EIXA 3AKCA 3AUYA 3PX2A 2P9FA 4FIDA 3V8PA 3IAEA 2HPHA 4X5OA 3U7GA 3H1TA 1AZTA 1R0ZA 3ZHZA 1ZXBA 3UAVA 4PLYA 5DBIA 1GL7A 4MV8A 4RTOA 1FZTA 2BUCA 1V37A 3DPSA 1PR2A 2RH5A 3LNCA 4DVJA 1W96A 5JARA 5CJJA 3PUXA 4OI1A 1HDZA 4R1TA 1D03A 3D6JA 4DCPA 3KJQA 4LXGA 3WWOA 4LC0A 4IDAA 3M3HA 3PE3A 1V8FA 2HHJA 3G7UA 3QH4A 4EHIA 5ICCA 3W6ZA 2EZUA 2RG1A 4G5SA 4QDJA 2GBLA 3EK2A 4X1YA 3TD6A 1ZFNA 1M6HA 2CKDA 5ALKA 5JDCC 1NHWA 4JELA 1T8SA 1AGNA 1E2UA 4WKCA 4CQMD 3F49S 4RCYA 5K05A 1P9NA 1BVHA 4J2HA 4XCXA 1SC6A 1EK5A 3DTYA 4FW9A 3CT6A 1Z83A 3HRHA 3K9LA 4NKRA 4RWZA 4U3JA 5T3UA 2FEAA 3ZCUA 3GQBA 5EJ2A 3RVNA 4YV2A 2XZTA 1W8DA 3IQGX 2AOUB 3NHFA 4HDSA 5K2OA 1XEWY 1W46A 3NEAA 5EHXA 4UUAA 2XNJA 1AX9A 1E2LA 1Z17A 5H3HA 1ZD9A 4GPAA 4UZEA 4LOKA 1F2UA 2GEUA 2G5CA 5E7QA 3D31A 4MLDA 2JFOA 3IIKA 4RLHA 3GGGA 3SDBA 5B1DA 2ACVA 4FHFA 4FN5A 2NZVG 3LPDA 4FGSA 5AW3A 1J7KA 5TGTA 3NBAA 2ORYA 1NIPA 4HJRA 5MFZA 1W25A 4FFBA 1RI5A 3OPNA 2GYVA 3ERCA 2H6EA 2PR2A 3EOBI 4Z6KA 2HRBA 4NJMA 2DQ4A 3NANA 3UJHA 4BB6A 4MWZA 4C4PA 5L7WA 4S2EA 4DA0A 1W19A 3VUEA 4Q3KA 1SZDA 1HL3A 2WE7A 2WT8A 4HAWA 4C7VA 2WJPA 1EGHA 1K8ZB 2VFAA 1L1FA 4CKXA 4F2WA 1D1PA 3DLHA 2CZQA 4PANA 4TTPA 3OSUA 2WSLA 3E8XA 4P2GA 5D3MB 1TGYA 4EVSA 4ER3A 2D5IA 3GJQA 3GFQA 1PP4A 4UW9A 4L4ZA 4E1AA 2PSSA 1UOOA 1O2DA 5HZHA 5HR5A 3BH6A 2ZVJA 3GPLA 3SGLA 1D04A 1J8MF 1FDIA 1PDOA 3GFGA 3ADBA 2JLVA 3K73O 1I24A 3NJRA 1M6EX 5FUXA 3GRRA 1EFRA 1ECGA 1UKEA 3BXZA 1JJFA 1GZVA 2ALJA 1QB8A 1YACA 3OBIA 4RJKA 3ETNA 1Q44A 1YAHA 4EUFA 3PFCA 4Q47A 3JALA 3LOPA 1G8AA 3CONA 4DBVO 3WS7A 3BF8A 5EGNA 3QGMA 4L5JA 3RARA 3SJ7A 5CDSA 2FLKA 1MX9A 2LWIA 2VP6A 2LE0A 2YASA 4B7CA 3QF7A 1V39A 4D1YA 5B7NA 4K0RA 4C0AC 4BGVA 4C6HA 3INRA 1LDMA 4UEWA 4M7WA 5E9WA 1U9IA 2ZRKA 5J58A 3MS2A 3S8YA 3TW0A 1EEXB 1YKGA 5COAA 2IV7A 4Y2TA 4ESHA 1WKVA 4MEJA 5FA6A 3N74A 1XTRA 5E3IA 4RZUA 2WVGA 5DPMA 4P9NA 3V00A 2OHGA 1XAGA 1VHDA 3HPQA 5HRAA 4ZGBA 2P9EA 2V45A 3ZPXA 2MYPA 4ZD6A 1DIGA 1ODLA 3RUHA 4AN1A 1L7BA 5A4JA 3UK2A 1SH7A 2GXAA 1JFFB 2J7KA 3OEED 4IYJA 3WBFA 1NNSA 1M2HA 1JKIA 2Q5CA 5LMUB 3VH2A 3HCRA 1ZBDA 1VKRA 2IHTA 1RYZA 5DHTA 3GA5A 1S7GA 2R79A 1MQ9A 3C5HA 2MMCA 3ZGLA 3DAPA 3PDHA 3UV3A 2P90A 4POOA 3MOSA 3IAXA 3GBPA 1Y33E 3THWB 1LBEA 2BFAA 5ELLA 3R7WB 1C9MA 3HYNA 4HDKA 3RFUA 3N7TA 3NHUA 3O92A 5HS4A 3WP0A 4LRSB 4FYIA 3I6MA 4BO8A 4WE3A 2ZBPA 1TRKA 3HA7A 1PD0A 2GN6A 2W2PA 3DLIA 1D6SA 3IEXA 3GJ0A 4FDLA 3WGHA 4BQQA 3H1FA 4LMAA 1HYGA 1OLOA 4QDUA 1JEDA 2C4MA 3GLUA 3P0RA 1TLLA 4FC6A 4Q37A 4TV8B 5ALMA 1AHHA 3ZLUA 3ZZUA 3E9DA 4Z7OB 1BVUA 1RBMA 1XSEA 2IIPA 5LUBA 1QGOA 2R48A 3UT5A 4DLTA 1GAEO 2Q41A 1U7OA 1EVKA 3SEQA 3TLGA 1BMTA 1Y9JA 2H0AA 3DE6X 3OVMA 1L6IA 4WNAA 1QE3A 2GD2A 1S01A 1XV5A 1L7NA 1RAAA 4NENA 1A9QA 2RHGB 1XP5A 4BFTA 2FFHA 5JSUA 3AY6A 2BJVA 4YP5A 4Q12A 3KD2A 2BKXA 3G8DA 1PHRA 3WGVA 1V5WA 2QTBA 2XQVA 3QE9Y 3Q9UA 1YZGA 4KH1A 2YV1A 2YIJA 4H1VA 1WZIA 4JXKA 3ZU3A 5D86A 4A8TA 2Y0EA 2PSHA 3AR4A 3R24A 4RIFA 3SNKA 3TCNA 4BVEA 3R5KA 4OMFG 3PC6A 4BBZA 4FHZA 2OV2A 4KU4A 3VYWA 1VIYA 3JZAA 1FNNA 1Y81A 4A7PA 1SOVA 2PMWB 3ZOKA 3GLIA 1MAHA 1RHUA 5EJMA 1FRZA 1UJMA 3O8OB 4JWTA 1GGNA 1L7XA 5HF9A 1XMJA 3WKBA 2Q3LA 3KEQA 3G2MA 1E9BA 3T99A 1T2EA 1N2HA 1JJ7A 1T8TA 2G67A 2EW8A 3EXFB 3VPFA 3VR6A 1YZYA 3RVLA 3GEEA 3BT7A 4XASA 2CMFA 1UZUA 1V1MA 1Z6TA 3TLGB 1Q19A 1CP2A 2WM2A 4LJRA 1CZRA 1BE0A 4B76A 1C0PA 3NTXA 3PL5A 4QBIA 2OORA 2F64A 1DADA 3MLAA 3BCRA 1V4VA 3FLEA 3T9AA 1SXHA 4NU5A 3AKDA 2XQJA 3IQZA 1T3ZA 1JR2A 2C4TA 1SKYB 3KU4A 4GP7A 3QX3A 1ONNA 1PZFA 4QYXA 4WZBA 4AZWA 2H65A 5HKKA 1HYBA 2HI0A 3BIWA 3PQDA 3TLBA 2NACA 3DE0X 5EUQB 5C5EA 3OCCA 1QGAA 4Q16A 3R76A 1TO2E 4RTKA 3ZWAA 1NKVA 1TUGA 1WPRA 4Q24A 2XHZA 1Z0IA 1RKUA 3ITEA 3EIXA 4PS0A 2EARA 3LUAA 2Z5VA 3R23A 1T3GA 3AHJA 3I2IA 4FGUA 3G9UA 1DC5A 4YAKA 1NLMA 3TIVA 2LUOA 2FMIA 4M0CA 3VU9B 3B3AA 1ZZGA 3CNBA 3WMXA 3CR7A 3ZWDA 1YE3A 4P5DA 1TO6A 3UJBA 4YUAA 1YB2A 1OGIA 1GKKA 1EJ2A 3OQHA 1X80A 3LHIA 5THXA 3AVVA 2ZIVB 1CUBA 2MTBA 4OOFA 5JXIA 3PNSA 2P69A 1U80A 3FBTA 4PO8A 1C9YA 2NO6A 2P40A 4Q1EA 3KR1A 1DAIA 1XFDA 2DR0A 1ZH2A 1JSZA 3OLWA 4H9GA 5CURA 5EZ5A 1KK2A 5IP5A 3INNA 3KXLA 4EL0A 3U44B 5GJBA 3RREA 5KKAA 1EAYA 1T1EA 5PNTA 4ZXPA 2H4HA 1ZCBA 4TQ9A 1VPEA 4PM4A 1KORA 2OCAA 4ZHQF 5FTLA 4TYYA 3AKZA 3G6KA 4KXYA 3U7QA 1KEKA 3TQQA 2XNDD 3G2QA 4TSFA 4DT1A 3OHSX 2X8JA 3DFKA 1EDZA 1NNI1 1ISIA 1J56A 1KO8A 1NN3A 2YTZA 3CH4B 1ODJA 3ED1A 4LJ4A 5DK4A 1N4AA 4Q4HA 5HM6A 4ZOQI 1M2NA 3DFIA 3K0CA 2O8EA 1X94A 4WY5A 1P4SA 1ZGCA 4Y6GB 3EA5A 4WKGA 1JEQA 2EC5A 4WXRA 2F3UA 2NPOA 4RTMA 4KFUA 5DP1A 2O19A 2JI4A 3AO0B 2ZAIA 4YMUA 1KKMA 1MW8X 4BY9E 5C1OA 1PAUA 1XKLA 3ZLTA 3PQ7A 2G9RA 1YZKA 2P9BA 1X1DA 1ZM7A 1G8YA 4HUQB 1AQ6A 4MQMA 2J5RA 3KUUA 5MN5A 1T4MA 2BSQA 1L7AA 3EGXA 1JJVA 2QPOA 4ECAA 3SLRA 1SBCA 2CVQA 3DB2A 5JCOA 1P2BA 3IAAA 5TJ9A 1M9NA 3IALA 4C04A 4JHLA 1U2TA 1UC8A 2JASA 5LP6B 3QUAA 3GK3A 1BE8A 3HGTA 3HV2A 3ZX5A 5DNWA 4FEEA 3PQ6A 1VBMA 2AG6A 4CR8A 1FFWA 4U7WA 1PK8A 2HDWA 1E1CB 4R7TA 4UBKA 1LVHA 3OEHA 2XXAB 3E8SA 4LGVA 1D5CA 3G6WA 3LK6A 4C2AA 2ZRBA 4Z8XA 3CNNA 4HDRB 3UJDA 2QAGA 4EB6A 1GDHA 3WQSB 4RVDA 2JLAA 5JWRA 4ZHQB 2ZSDA 2WJAA 3STWA 2WF6A 4ACBA 4KOEC 4G56A 1ZCAA 3SBOA 3I01A 4Q6BA 4EZEA 3PIDA 3IJ5A 2W5UA 1WDWB 3AG5A 3KUCA 3LDHA 2JHGA 1U7DA 3FHLA 2H59A 4FYWA 3F7NA 3A06A 1L4YA 3QI7A 2LDBA 4ZVUA 4H1UA 2G1PA 1C9EA 3D8TA 3CQ9A 4YJHA 3C3EA 4UPVA 5GZ6A 3RV3A 4KKVA 3DZGA 3PPVA 3LZCA 4HH0A 1Y6GA 3LLSA 2FR0A 3IEPA 1Q14A 4LS3A 4PNPA 4IUYA 4GRIA 2H4ZA 3L4EA 5DSZA 1DGQA 3LQ2A 1N1GA 3EZFA 3SDZA 3UCXA 3ZV5A 3U56A 2VHTA 1G9SA 3HJUA 3I42A 5G4LA 1A2QA 3VC1A 1ZIOA 4MAMA 4NBRA 4NDZA 1MTOA 4UU0A 4XPIA 1A9SA 1ECJA 5AKKA 3DDZX 2BJWA 1ADJA 1RWXA 1PV4A 3LIPA 4R7ZA 2QL9A 1B8VA 4UMEA 5K0JA 1GFWA 4MW1A 2N42A 3GRVA 4ZWNA 5EIHA 4DPKA 5JZBA 3NC4A 3QG5A 5U4QA 1NF9A 1YJXA 1DFIA 1HORA 1ZRMA 2L0XA 1JS1X 3QJGA 4AJNA 3WMEA 1HZZC 4JBXA 4AX4A 4RXTA 3CZQA 4AS1A 2GNAA 2P5YA 1QFYA 3AX6A 3P2YA 1NX9A 4RGBA 2FZKA 2CK3A 1PT6A 2PZBA 4GO1A 3JV7A 2KW5A 1A9XA 1DUVG 1NR7A 2CD7A 2WJJA 4KE8A 2XXJA 3I92A 3DEAA 3VHLB 1WOMA 3OZRA 2O2ZA 1XD8A 4DKXA 5JSQA 5KDDA 2IS1A 1UBCA 3CF6R 2ID4A 1PWYE 1P0IA 2C3UA 1BWQA 4IBOA 4JC4A 5DHAA 4YCMA 1CUZA 3O4IA 2GKGA 4RK6A 3ZK8A 3QPCA 4GYJA 3NTUA 1JQ5A 3DZDA 4FSHA 4BKUA 4FR5A 5JAIA 1P9OA 2IE8A 3H8VA 3A9RA 5ICFA 4NJEB 5TQ0B 1PT5A 2IQ5A 3H1EA 1SZJG 4K9LA 3WFIA 2H4JA 4JL8A 4LNUB 4ZQGA 3D3KA 4B2YA 2ZUWA 3ELDA 4J94A 4D0RA 4DMLA 1UC4B 4QOSA 4RKWA 4YJ2B 7REQA 4AT1A 2OXTA 5U4XA 4NCHA 4D9BA 1XRQA 2B20A 1TM2A 1Q1GA 1S2OA 4OOEA 1HSZA 1FP7A 2XUHA 5U1PA 2B5OA 3B20A 4CFZA 4DSNA 1IBKB 5JI2E 3O26A 3V4VB 4YJ3B 4X64B 2V4UA 3EG5A 5FI0B 1BSVA 3O1LA 5EQTA 4NBUA 1PS0A 1WY7A 4DL9A 1RXIA 3EUFA 1UBOS 3SCZA 4F9TA 3LRPA 1E1NA 5EMKA 3BMNB 3PT5A 2O4CA 4XEHA 5AOVA 3L9WA 2PH3A 4PPGA 4RACA 1FSFA 1I01A 1VE3A 3ESQA 4TZTA 4D4HA 1R18A 1R6UA 4LDQA 1MFZA 2VHCA 2WSIA 4JUAA 1SKAA 3HJAA 2Y1GA 3PA6A 2QJOA 4OP3A 4UVEA 4Q3EA 3WOHA 4DLBA 3K0SA 4W8GA 5F7ZA 1QH1A 3OTOB 1SXJB 1XEFA 4CUJA 5CB4F 2REOA 5CFQA 2YN4A 2ZZMA 4R9NA 3U44A 1YVEI 4HRXA 2HB6A 3C4QA 2I78A 3GUHA 2ZIXB 1ENOA 1NLZA 4KC0A 3TEMA 3EWSA 2BWJA 4OHCA 3CX6A 3SX2A 1PWZA 1R7RA 3UJ7A 4FFPA 4OGFA 2R25B 4DCGA 1SHLA 4YONB 2X2FA 3CX7A 1O1YA 4IH1A 4AUEA 4A23A 2QMHA 4JLNA 1IM8A 1XCBA 4UC0A 1T1SA 3TQCA 4UUBA 2RMKA 1SVUA 1WPQA 3P0JA 5FTMA 1EJ6A 3C98A 3EWAA 1OU4A 1SB9A 2APJA 4TN1A 4ARZB 3Q6MA 4IUBS 3ZG6A 3WRYC 2HREA 1NBMA 5HSGA 1MF7A 3EVAA 3PP8A 3RVJA 3L8DA 3OPMA 2YQZA 1AOXA 1LBHA 1T8PA 1GPYA 1XZKA 2ZYIA 2QHXA 1HMPA 1DU4A 4G6ZA 3PRJA 3T3IA 5F9HA 2NSYA 5F5XA 2PLAA 3UWDA 3FSGA 2AN5A 1ENPA 3DVQX 5EMLA 2OC9A 5FIUA 5CTJA 3RYIA 1IL0A 1JRLA 2AT1A 2IEDA 1KMHA 2VDRB 3DJFA 4NZNA 1FP4A 1VP9A 1IXRC 4LXHA 2H3HA 4PSAA 3FKQA 1JAXA 1MX3A 1KY4A 3P9QA 4YRZA 2XGSA 3PGA1 3HKEA 2W8BA 4HFNA 4ITUA 3O2QB 3OURA 4UXHA 3VR3A 4Q1BA 2EX1A 1G17A 4C4ZA 2R7NA 2H11A 4U8GA 1ORTA 3TXYA 5BQFA 1WXFA 5IZCC 5JOQA 3ZK9A 2GMWA 1R64A 4UM9B 1X92A 2A1IA 1GQOA 2IY8A 4Q4DA 1DHRA 3WWYA 1JSLA 1YTUA 5JQGF 1YONA 1B41A 3DKRA 1M1NA 1ZVJA 2PS3A 2R4QA 3M6LA 2W6JD 3M6VA 4LJAA 4NOJA 5KJEA 3VR6H 5KNCH 4KR6A 4P31A 3IS3A 5KJCA 3HXQA 2QOEA 3H5TA 3TDNA 2JAUA 2NOAA 4P98A 3IXMA 1PTJA 5C7IO 1H3FA 1YS9A 2IUYA 3JZIA 3NKLA 3PITA 1R15A 2ZPTX 3PC7A 2V7QD 1RM3A 1L7MA 5P21A 4D46A 1K5HA 1XR3A 1KEUA 2GOYA 4UBOA 2DFTA 3RIEA 1XMQB 4PQRA 2G8NA 4R3NA 4YAFA 2OYRA 2QQ5A 4D8WA 1KBQA 3IL2A 2ZUEA 4KSYA 4U2DA 2O2XA 2VXCA 4MMZB 4HWSA 5L3RA 1A8HA 1O9GA 1OX4A 1WLYA 1OBOA 3P9NA 3RJ9A 3GD5A 1C3OB 4EI8A 3LTNC 2AX4A 1SXJE 3E58A 1IZ0A 1IDOA 2FMUA 3O4HA 5LZ7A 4NAHA 1HLDA 3W9UA 4ED9A 3UH0A 1AQIA 4AZ3A 1G21B 1E1KA 1U2GC 5A3VA 2B98A 2QTAA 3D59A 2WTXA 3E22A 3WO0A 1TUBA 2YVLA 4GZ5A 4TKUB 4PQYA 3SQLA 1V4NA 3B38A 3TKAA 3QELB 3PSAA 4BMZA 4EP1A 4Z3KA 2XA1A 3H2YA 2VRBA 2CNNA 2QRKA 4BU1A 1XB2A 5CYGA 3U4MA 2I4NA 3OY7A 3CN7A 3N70A 4Y8VA 2B4QA 3V46A 1B8NA 1P31A 1DAEA 4C3UA 1KVTA 5M7EA 3JQ9C 3NHRA 5B4TA 1TJYA 2ABWA 3HA5A 3COVA 4RZIA 3ML1A 4X1OA 4EF6A 5DWQA 2GA9A 5I9LA 3C5CA 4IS3A 2VPIA 4MS4B 4HEQA 2O5EA 1EVJA 2VKTA 3LTEA 4AKTA 3EIFA 5JCJD 3CJRA 5K8UA 3KUDA 3H2BA 3M6AA 3VKHA 4MVJP 3ANYB 2Q3CA 3KR2A 3D6VA 3J81A 4LMBA 5FT9A 2IS4A 3LOUA 3SQDA 1L3CA 3RSSA 1PJAA 3GN1A 1OLUB 1TJ4A 1E3MA 3VAAA 4I4TA 4YR7A 3KDAA 3TR0A 4ZZ0A 2VAPA 1AA9A 2BCJQ 2F3RA 1FQOA 5L7YA 3ZV7A 1SVLA 4LHVA 1QONA 4E03A 1E5QA 1XU9A 4RQAA 3ZEAA 5I7UA 1NUSA 2I2XB 3EVEA 4ZT4A 4HQKA 1H1TA 1XYGA 2HK7A 3CNHA 1RVDA 3RQSA 2AMVA 1L4MA 1CNFA 3QXCA 1H8HA 3SF0A 3SJCA 4HDSB 1NR5A 2O0LA 3DM9B 4EABA 1V95A 1WPXA 4QGFA 4DG8A 4MRPA 4DLVA 2IEYA 1G60A 1T4CA 4F2DA 4RKEA 4EG5A 2VHUA 1N5JA 4UULA 1YS7A 2AN9A 2ZE8A 2WUEA 1QORA 3O91A 1Z5PA 2GDJA 3N2LA 2OCKA 3KUXA 3AESB 4DMFA 1YO6A 1LTQA 4KGDA 4WEOA 4AZ0A 1JVBA 4MGKR 5AM4A 1W4ZA 4MQ5A 1Q0ZA 3IIMA 3HO6A 2Q5JA 4YV0A 4BMVA 1AURA 3CXRA 5BNZA 1ECLA 3KB2A 3UXEA 4BNXA 5IBCA 5EIBD 2AJTA 3D8UA 4IKEA 4B4WA 5LP6F 1T25A 4I1OA 5JS1A 3ZHSA 1ATIA 1E99A 2OHJA 2WTAA 4YV1A 4QPNA 2PYZA 3CRZA 1UK9A 4HADA 4B3TB 5JR3A 4K26A 3NTLA 3R5JA 4AI6A 3RI3A 4G0ZA 2BDTA 4NK5A 4MIOA 4B82A 3B78A 3AERA 1FLVA 1J90A 2PCLA 4LNAA 2PGLA 4B3BA 4DCNA 3K9FC 4G09A 2XYRA 1ABFA 2VBCA 1K7EB 1DTSA 1QXSA 4P4LA 4D79A 2AZXA 3FGZA 5F2KA 3GGDA 4JU9A 5E38A 2WYUA 1QIGA 2HL6A 3IQIX 4X93A 3ZHXA 3AQ4A 4FCCA 3UK1A 3G89A 4CL0A 5B7GA 1X9HA 5AD1A 4MVWA 1A9OA 4TV8F 2CLOB 2MSKA 2WYOA 2Z9BA 1M34E 2WQ6A 5JDCA 2D0DA 3FYCA 2FJUA 1IUOA 3W6PA 3RU2A 4RA6B 2G4LA 3EIQA 1DBRA 1P0FA 5LKRA 1WHSA 4QSHA 1LJ8A 5ILGA 1EK2A 4ZQEA 5E9JA 1MIOA 2AFHB 3A05A 3SDSA 2HCTA 4IVNA 3DD5A 2NP6A 3ONDA 5IARA 2I1QA 3Q7PA 3QMPA 2R8RA 4IX1A 4CJXA 5KU1A 4IHAA 4A8HA 1M2WA 5LUAA 4CDRA 2CV0A 1R9NA 1AS3A 5F52A 4PCVA 3ZNOA 2ADFA 4HX5A 4WK0B 4Z4HA 3WQRA 3EASA 4WQMA 2IT1A 1Z7WA 1FK8A 1QX3A 2P2YA 2YRFA 4XLZA 4ZO6A 4A0FA 1FYEA 5AOAA 3L4SO 3FOBA 1Q7BA 4X1KA 3GNSA 1Z6YA 1SXJD 3QLUC 2Y3IA 4QREA 3BRSA 5AI5A 4EGAA 4E11A 1N1MA 1BCSB 5ALFA 1JUDA 2D2FA 5LDGA 4DY4A 1BD3A 1NIJA 1VHLA 1VLVA 3CM0A 3CW2A 3WZMA 4O0LA 3T4EA 2O0JA 2FPIB 3VYSB 5BWLA 1VJGA 3QVMA 3GLGB 1CUDA 4PYKA 3UT5B 4LHXA 2ODTX 4JYAB 2PTHA 3EY4A 4D3XA 4QOFA 4X7BA 2XMRA 3BWYA 3M7IA 3IAS6 3OP1A 5C9ZA 3OFKA 4TT3D 1FXWA 2AUTA 4XOIA 4N6GA 4DWJA 2PH5A 4XSGA 1NJ8A 2XZPA 2Y93A 4WDQA 2WF7A 5JSFA 2PUFA 1NOKA 3H5AA 5GVSA 1AKNA 5DHFA 4YP1A 3V32A 3SKVA 4B80A 1VIMA 1YHYA 2W93A 3L04A 4NWIA 4Z2YA 3TSWA 4H27A 4MQEA 4ODIA 4QWWA 3QQPA 3K32A 1GU1A 3CIFA 4N3BA 1I3KA 1G2QA 3F5MA 3PXDA 3MRTA 3HSSA 1L4LA 1JNYA 2Z57A 3MG9A 3Q72A 5J59A 1RC8A 2CMDA 5EMJA 4UFPA 2GK7A 4NJMB 1N9GB 1Z6PA 3R3XA 1I36A 2C9MA 2Z5FA 2FPLA 1QAMA 2G5PA 1P1JA 4CLEA 1GAJA 3CIOA 1KKLA 3NYRA 4E5PA 1R5JA 1XEAA 1EHIA 2PFKA 2O5RA 5GONA 2ZR7A 4QD3A 1GQRA 1T4DA 3TM4A 3K0AA 3FVQA 2WF8A 4X3PA 5BORA 1PV2A 4DXDA 4MHTA 1PTJC 1GGHA 3OCJA 1M6VA 3PD7A 3Q87B 3OJ0A 2I65A 4JITA 2RI0A 3RODA 2RHDA 3LDFA 1ZM9A 5H4HA 4BTEA 1QIKA 4N3NA 1QBGA 1BFDA 3GUCA 3P9KA 4PF1A 1NVFA 2GZ1A 4M60A 3S27A 4PU0A 3P2KA 1G20B 5EJEA 4LXIA 3F67A 2BEVA 2I7TA 2L42A 3NS7A 2BSAA 2B37A 4JUIA 4D9EA 3NBZC 2FFQA 5KJFA 1IATA 1JJIA 3V7WA 5CT4A 2PUJA 4M9UA 3T9CA 1B1CA 3ISTA 4DQLA 1U1GA 4ZTUB 1M2GA 4G5YA 2X15A 3V1YA 4NMWA 2HPVA 3ZV3A 4UTZA 1DAPA 3BGSA 1U98A 2Q3DA 3S44A 5CFLA 4AUMA 1IK4A 5BRNA 4IF6A 3ICPA 1F38A 1FUKA 3NGMA 2J0UB 2PX4A 5BN1A 5HIAA 3FCYA 3NQ41 3IA7A 4OAOA 1YBFA 3GZTB 4QFCA 3Q5DA 1JEYA 2Z3ZA 4LZWA 2R3SA 4K9MA 3K7EA 4LY9A 4F4UA 3NH6A 3AI3A 1REQB 3AFOA 2C4HA 1VCIA 2W9XA 1BGVA 3MJCA 4AG3A 1WD7A 3M3DA 2R6CA 4BDTA 3WLMA 3WYCA 1G5RA 1F17A 2MSWA 1IEWA 3E9CA 3BS4A 4YLEA 3N0TA 4UU1A 5CT5A 1SVNA 3FE2A 4MVJG 3KWMA 4CF7A 3HCWA 5CVVA 4WECA 7GPBA 2VO1A 3AZQA 5DXAA 2FEKA 1M2JA 4RTPA 1ISPA 3L77A 4RH3A 2OK8A 1B6SA 3I8XA 3K9HA 3A0UA 1HQYE 1NLFA 2CHGA 4DMKA 2AXEA 4G85A 1IZ9A 3TTXA 2QUBA 1L5LA 4Y1RB 5KSYA 3G9XA 1I10A 2XMQA 2ZWOA 1UBEA 2XSZD 3ET4A 3H3XA 5AVJA 5HE9A 3MD9A 3LLVA 1C3EA 5I45A 3OZTA 1HE4A 1BA3A 2R8PA 1ULAA 2YC4C 1P18A 5I8PA 5KNBH 2ZSIA 1B6TA 1V1RB 2ZBGA 4CPDA 3ANMA 1P44A 2OGUA 1JWLA 4B48A 1P2VA 3M4YA 3RSZA 1WBBA 3N0WA 1NU6A 4EB6B 3KOMA 1PZEA 3ASZA 2AEEA 3AUUA 2IP4A 3EZXA 4MLZA 4MS3A 4O2AB 2NTEA 4E5DA 2VT7A 2D1FA 1K1EA 1RQGA 3F98A 4HG2A 4B3IA 3B2EA 2BZ1A 1C1DB 2QTRA 3G5MA 1AS2A 1UK7A 1YQXA 2QB5A 1BX3A 4X85A 4B33A 5JAMA 2GHRA 4R5HA 2B8NA 4HD8A 1FFSA 1NBWB 4AN4A 4AP5A 4LQCA 4AW9A 3AKYA 2BKLA 5D87A 2WD7B 3ZBTA 2HU5A 4QX6A 3I32A 3QE3A 2HJRA 3QVLA 4YRJA 2AK2A 1GSIA 4DRZA 3HGMA 3RWMB 5FTJA 2R7KA 3V2HA 1TAUA 1FFCA 1FSZA 4PVDA 3W90A 2HHHB 4MW9A 4ND8B 4QSMA 2VWGA 5JCJA 2G09A 1YOVB 3LI2A 3SVZA 5CBPA 4FR2A 1ZL2A 1WTAA 2OZLB 3MMXA 4KQXA 1ZC3A 1U8YA 1MOQA 3VKUA 5DIZA 5HKKD 4N5IX 4DIFA 4F8EA 1IMOA 4LFBB 4L02A 2X9QA 2EL9A 1QIHA 3NWOA 4NYJQ 5AI6A 2Y1OA 3LUDA 4XIIA 2FRXA 2VF8A 1VIDA 4JJGA 1IOZA 4RIEA 1SCKA 3PWSA 4DLKA 1QHHA 4PBSA 2QRUA 5T8KA 3TL3A 1BN6A 3WLJA 2G82A 1K0FA 4R2MA 2GN4A 2OLKA 3W8NA 2IX9A 1XRPA 3LFHA 4UBNA 4CMIB 1L1RA 4L5AA 4ZEOA 5JHGB 2X86A 4GLFA 3FOAA 4J9UE 3RS2A 1SC4A 1Q92A 4EAAA 3SXUA 4XYGA 1KOGA 3AVUA 5KPJA 2AC7A 1JYEA 4I3FA 4II7A 4I4LA 4Q4JB 5EESA 2JK0A 3T41A 4F06A 1A7JA 4XWKA 1EDEA 2QMZA 1KQPA 4FWBA 2JK1A 3FR8A 3SMQA 2C2BA 3ZGVA 3TQHA 4Y9UA 1P75A 2P2GA 4EF4A 5KHOC 1BCSA 2A33A 2P3LA 2FN4A 4ES6A 3EXEA 4E21A 4GMKA 3DA8A 4IQ8A 5JZVA 2FMTA 4MDYA 3B1JA 1C1HA 3EOAI 2R86A 4O5OA 1OWPA 2NG1A 1QU2A 1N6OA 1SU6A 8ADHA 3GOQA 4IZ6A 4IP0A 2PT5A 1HI9A 4AS2A 2VXBA 4CDGA 2CFRA 2FN3A 1ECBA 4AJ9A 4KDRA 4DTIA 3MGAA 1FB5A 1OFUX 1Q7TA 4JLWA 1DZ3A 2GEJA 4P4NA 4L07A 5BW6B 2P4UA 2V0NA 3RJZA 3WKEA 3IQWA 1F51E 2Q6KA 4BNUA 1QQTA 4JLKA 3X1MA 5BURA 3PGLA 4XD7D 3VSCA 1R5NA 4LEIA 5EZQA 1I2DA 3KTFA 4RF4A 1T1RA 4KSCA 4RA9A 3EDYA 1GTG1 2XB8A 4EELA 3RBZA 3Q15C 4BXOB 2DAPA 3GCXA 4XJTA 3EDMA 2LDXA 2ZKIA 4ZT7A 2A5FA 3WX0A 3AVYA 1C3VA 3QFFA 3T7JA 3LT4A 2D2XA 3TEJA 2G7ZA 2ZATA 3N2YA 4KLAA 3ZE0B 2EX4A 4EG3A 1I3LA 1EQUA 1XU7A 1U9JA 2B9EA 3JQ6A 3R7FA 1Y42X 3ON5A 4ZI3A 4JBGA 4YCNA 3AP3A 3T94A 4H6XA 4LW8A 4W6QA 2DUJA 4G4SO 3BXXA 2R87A 3VJRA 3C8HA 4WXEA 2QORA 4EO7A 2AOUA 2B5WA 4TMWA 3EGVA 1W88A 3Q40A 4P08A 3I01M 2JIOA 3JS5A 2A14A 4HGQA 2DHQA 3GP3A 4JA2A 4PLGA 3ZCRA 5KKNB 1SHUX 1TQ2A 2PVPA 3MJFA 3GLHB 4L08A 1NVTA 3DZCA 1Z2DA 4IPTA 2CDAA 5J43A 3M5WA 4C07A 1GFSA 2BEUA 3MVEA 2PWYA 1C4WA 1HZJA 2BBTA 4AQ7A 4BNJA 4HUTA 2Z2IA 4FEAA 1P2GA 1RQPA 2GASA 3NAZA 4NECA 2OHFA 3T38A 1ZD8A 1AG9A 2ES4A 3PXCX 4X41A 5ALYA 3ZXSA 2NZ2A 3AM4A 3I37X 4Z5XA 4A1OA 4AFNA 1F1BA 4RU1A 1QCYA 2AD1A 5JWOA 4W5HA 1FS5A 2QM3A 2I2CA 4WZZA 5H68A 1P19A 1CEQA 1NBIA 5CT6A 1VE9A 2QVZX 2GRAA 3ISVA 4FX5A 4ND2A 4CHTA 2Y71A 4F60A 2WQ7A 1V96A 1VJTA 3AOEC 4JR1A 3O4JA 4CFSA 4RJLA 2D5LA 2QE7A 5G40A 1VM6A 1XZEA 1YL7A 1RP1A 2JFXA 2YL2A 1UBRS 1V5EA 3ITKA 3O8LA 1OJLA 5TPWA 1J6UA 5K8TA 3QPUA 4N5HX 3KJGA 1L6RA 2EP5A 2R1ZA 2JGAA 3NM5A 1WKBA 4RHUA 4WD3A 1JHUA 1JFRA 3L0IB 4EEKA 2IBTA 5GOTA 4BASA 2DC1A 4U2FA 4JQYA 3UUFA 4ZI7F 4WCFA 1T29A 4MVXA 5TEWA 3UAGA 4GM1A 2PYDA 1GEEA 1LXCA 2YUIA 3A4IA 5A5EA 4M9ZA 5BVHA 4DT1B 4MDEA 3K1AA 4GT1A 4HSGA 2QX7A 2VP0A 4IXWA 5EIWA 2X4LA 1L4GA 1S89A 4HX9A 1LVUA 4AMUA 4EEZA 5IC4A 1Z0DA 3UA4A 3M1IA 3LFTA 4FCWA 4C21A 1L8QA 2JIMA 5I47A 2CJXA 1XA4A 4KL8S 4GVLA 1E2MA 1FX0B 1RZVA 3AJEA 4P53A 5BR1A 2NN3C 2GZDA 3NIBA 3R6WA 3MOIA 4XTCS 3FMGA 2VNHA 3K0KA 1EUCB 2VDWA 3O4GA 2VQEB 3UAXA 3R4VA 3M6XA 1NR1A 4KIFA 1G3MA 4PQEA 2RSLA 1C1DA 1MHTA 3WHIA 1IRIA 1GWNA 2UZ3A 2YJTD 4G0PA 4CCWA 3WNBA 5BV8A 2Q4RA 1LDBA 1KZYC 2I7CA 2Q1TA 2ZSBA 4NJEA 3WLFA 1XUOA 3SZ3A 1U8TA 3U48A 1XLTA 3B70A 3HWWA 2FG7C 3N9IA 1RYYA 1U3GA 3M9WA 1V3TA 4GHWA 3B89A 3AI2A 1F4PA 2D0IA 3CZAA 3H13A 5I4KA 1RJEA 2XDYA 5DBGA 3W5HA 1Q6YA 3QVGB 3AUAA 6LDHA 3JQBC 3E4CA 1J2YA 3GCWA 1VYHA 1WWKA 2CWWA 4P3YA 5J1TB 4P81A 3VZSA 2O2DA 4CMAA 3IKVA 2CF5A 3TNDA 3K72B 3NJ4A 4OKNA 4AYXA 5K0FA 2M1ZA 4JC8A 2FJPA 2YBDA 4DREA 2QV7A 2BEWA 5A4DA 5L95A 5HUHA 5BVHB 2R8ZA 4L73A 3KVRA 3T4XA 2HEGA 1FUIA 5KVSA 3PJRA 3BB4A 1TFUA 4AU1A 1GSAA 1UZLA 1JSXA 2I67A 2ODAA 3DMPA 4QQ8A 5GV7A 2GGSA 1UBGA 3L8HA 4DDUA 5AJWA 2PX3A 3WNQA 3PE6A 4EMSA 1G4HA 2WR8A 4JB2A 1JEQB 1FSGA 3I2GA 5K4HA 3D6MA 1EX7A 4CLXA 1GPDG 3WWZA 2VP5A 2J7PD 4EYQA 4XD7A 3NT4A 2VC2B 1HA3A 5IULC 1ZNZA 3HPRA 3TIFA 3VTZA 3PQ4A 1Q0HA 3GO4A 5C7YA 2O2SA 4C0WA 5C8DA 1NG1A 2BE7A 4LHZA 2J4FA 4E6PA 1CY1A 2OHOA 2WHEA 3QV1A 4C5BA 1RE0A 1VBNA 4LNUA 1S8OA 3HNOA 1XMSA 4WOJA 2ZU6A 3R5SA 3DQPA 1LNQA 2RGXA 1Q0PA 4N1AA 4R6WA 3LBNA 4L0MA 3U17A 1RKVA 2NSJA 4EUKA 4I9NA 3ZVRA 2K2QB 4I50B 4FTWA 4DLYA 4KN6A 4KPUB 1W8IA 4ZO8A 3AFMA 3JCZA 4NV3A 4YECA 3CH6A 5JDIC 1QQ5A 4TXLA 3BH0A 4F8YA 3O6VA 4ZEVA 2Z2KA 1PR6A 3GR6A 1H5QA 4DPMA 4G5RA 1ZMBA 3DL2A 1OAAA 5JASA 3CVJA 4X95A 2JGNA 1ZMRA 4QG7A 1MRSA 1O54A 1YHNA 1CE8A 2C8VA 2Y9MB 3I12A 3P2EA 4O2BB 4OEHA 4CV1A 4DCJA 5HZGA 4QHTA 1BJKA 4F2HA 1D1SA 2A86A 2PLFA 2WIDA 1N8SA 3RS4A 1FRVA 3JWIA 1TUIA 1ZJ5A 3OX3A 4G1VA 4JT9A 1Y3DE 2PNJA 5KQLA 3TOZA 1G9TA 5KYKA 3BHNA 2W6PA 3MELA 5JVDB 2GVZC 1FNCA 2PBZA 5CDTA 3A9SA 3HCCA 3H5VA 1TF5A 5H59A 4K9KA 4BE4A 1RXVA 2C1EA 4I5IA 1DINA 5GZ3A 3KFXA 2JVJA 2WIFA 3IT2A 2W71A 4J0JA 4D6PA 3F2VA 4QC2A 1X38A 5KSWB 1Z12A 1MB4A 4X8LA 2AMFA 5HRCA 2BFEA 4UATA 2XDAA 4L8YA 1E2JA 4IHKA 2AZMA 4WASA 4L5BA 1DXYA 4QOJA 2V5UA 5AM1A 2NO7A 1EWTA 1DC3A 2VBIA 5EE0A 4A0SA 1VBFA 5KIAA 3FGOA 1GSOA 1JAIA 1Y3BE 2E48A 2QJWA 1HF3A 3TEFA 2ATCA 4V3BA 3CCFA 1ABEA 3PRYA 2IYLD 2XI4A 5EWJB 4W7SA 4F86A 3SI7A 2R6AA 2VSYA 4ARVA 1J0DA 4BV9A 1VMKA 1Z25A 4HWPA 5F78A 3WGNA 5K03A 4FEGA 4F3KA 4Q3CA 1CF2O 3ROQA 4GAEA 2D8AA 4FYHA 5CFNA 1CS0B 2ZYAA 1U0BB 4QVIA 4EGCB 1MAUA 3HDVA 1I32A 4ZXFA 5J9FA 1Q16A 1K9VF 1YF3A 1W7AA 2Y27A 4TVSA 1OH7A 1JA9A 1BMFD 3D4IA 3ZZ0A 1RJ9A 4D92A 4ENVA 5I7OA 3FWZA 2KLBA 3FMVA 3UOGA 1BIFA 4DFDA 1I5OA 4CIAA 2IE0A 3GMSA 1AQNA 3QNWA 2FF5A 1JBQA 1R4NA 2YVKA 4ZCPA 4Z0TA 3TLEA 2ECKA 1QGUB 1RTKA 2WTEA 3FPAA 1N2CB 2JI9A 2EEZA 4D6XA 1T1GA 2E7ZA 2Z8YM 1DIOB 3WHPA 3C8DA 3GBSA 4IXDA 3DV2A 3L0OA 1IXKA 1N2SA 4COKA 2AR0A 4EKIA 4KVZA 2AA3A 4U6QA 5CG2A 5JVDF 2WAAA 1KGSA 2ZCVA 1KZGB 3TR6A 1V1JA 1X9GA 1VA4A 4XVUA 4HDQB 5AVZA 2C92A 2ZKLA 2IDKA 3F4LA 5C4IA 2VDMB 4BNGA 4QRIA 1E4EB 3HJCA 5B1YA 3HB1A 5FEUA 4ZAFA 1M1YA 1OXXK 1ZKDA 1T5DX 4HAZA 4HYEA 4IDCA 3AHFA 3FDZB 3AEQB 4YQYA 4G3XA 4AVYA 4CT5A 5KDLA 5JEEA 1WXXA 4IIDA 3LM8A 4N7MA 1GPBA 4AS3A 4LF7B 1Q7GA 3JAKB 1GFIA 3EQZA 4OQDA 2X8WA 3ZXUB 1MA3A 1XTKA 2BL4A 1E20A 3TZCA 3KG2A 5AVTA 1XPRA 3GAZA 5J63A 1PSZA 1A95A 3KZKA 5BSTA 1PT9A 1EFTA 5BOSA 2D62A 2OHVA 3JWEA 4YLGA 3JWPA 1EP3B 2PWZA 5B36A 4QXQA 5KAPA 5ADUS 1RAEA 1UBHS 1ZJJA 2OR3A 1NYQA 3CNLA 3OM9A 3MQ2A 1T9BA 2X4GA 1WSWA 4R83A 3VKFA 3PQFA 1T8YA 1YUNA 3E7FA 4W9RA 1MPXA 3ET5A 5TGZA 2I6QA 5WRFA 4UOEA 5IWCA 2Q5HA 4D82A 3BTOA 4P3XA 1OPXA 2IVZA 2Q4EA 1IY0A 2ZJ1A 3FAKA 5EOVA 2GZ3A 4HFJA 1T9CA 3UMYA 4ZVLA 5EMMA 4YRKA 3ZTWA 1FMLA 3BQ9A 4P4UA 4KDCA 1S4MA 2OO5C 5CW2A 5EA2A 3EULA 3PZRA 1QH8A 3ICQB 1JG3A 4JUCA 2FKAA 1SNYA 4DZZA 3CJQA 4J76A 2HQBA 4LOAA 4KVFA 2D1RA 2FVXA 2A7XA 3GAAA 1UQUA 4J49A 1AQYA 1TAGA 3QX8A 4Y6PA 2JD0A 3WK7A 5KBYA 3H4IA 1JDSA 1XVTA 4D4MA 2BYTA 3K8YA 4P4TA 4CEJA 4J4HA 3RS7A 1IB0A 1YK0A 1Q3HA 4ZZ3A 4L50A 4QUKA 2PMBA 4Q1CA 3OJCA 1Y7PA 3C3XA 1QO0D 3GQVA 4KLNA 4RE6A 4RZ3A 1OROA 1YE5A 5AOBA 2KYRA 4MYUA 5LOVF 1Z68A 1JHOA 3T8YA 2XA2A 4BAZA 3DGEC 3R3UA 3AK4A 3QW2A 2CDBA 1CUEA 3EEIA 4Y3UA 3S2SA 4Y98A 1JTEA 1I2AA 1M8JA 1OI4A 2ATVA 1FXSA 2LIPA 3G0GA 4FILA 2YOFA 5AP9A 4MJLA 3U62A 2BM1A 2GZAA 4L16A 5DYWA 3H05A 1BMFA 1HDXA 1SGWA 3TFWA 1J24A 3CZ5A 4K2AA 1SUSA 3PHIA 3TSAA 4XRRA 2Q1UA 3ZHVA 1BHO1 1L4KA 2RI1A 2RHOA 5CLLA 4REQA 5T5QA 2ZETA 4R1PA 4Z0HO 1XDWA 1XNRB 1VE1A 5T67A 3ZCQA 3E3NA 1K68A 3AKEA 3DDOA 1PE0A 4GSKA 3RVQA 3UJCA 5BT8A 3RU9A 2QLJA 4BNZA 2JLXA 2V1UA 3NHAA 3C48A 1Y1QA 3K09C 4ZRNA 2X5NA 1JA1A 2JRCA 4A73A 2GCEA 3ZYCA 2ZTMA 2QLLA 3OC0A 2P78A 4FDTA 4IM7A 5D7BA 1I3NA 2AW5A 3K0EA 4J3NA 3ASVA 2PMFA 2X2OA 1BS9A 1J5EB 5GM1A 1UDCA 2HQ1A 1YXMA 3AL2A 3BMXA 4BNVA 3K20A 2P2LA 1E6WA 1OYVA 5AUPB 4P5EA 4I5EA 4DQVA 5DOVA 1KAOA 2EP8A 2GD6A 4I0WB 3DLAA 3R7SA 3TIIA 3TRDA 4BKQA 2DTXA 3CVWA 4FM9A 3WA6A 3MINB 5KOYA 3OJOA 3OZGA 2FPSA 2O57A 2PSFA 3VO9A 1EVZA 3CLKA 1TIBA 4CTOA 1XU4A 3QPDA 4QBHA 4E5UA 3KBOA 3NI2A 2ESRA 1K7XB 3MCVA 5AFSA 4X20A 5IAOA 2Q6VA 2RJ3A 4EITA 4ZCQA 1HETA 4URUR 1LBQA 4PIPA 2QD3A 1Q6ZA 1LBTA 2IF0A 2PX6A 1U6KA 3IDAA 4R9UC 3F7OA 5TPZD 1PBTA 2XUJA 1SO8A 1XQXA 3MWJA 3DEKA 3PNLA 4KEAA 2ZUTA 1J2JA 3NR2A 5IABA 2WNSA 3N3BC 1UM8A 4GBED 1DBSA 3HWRA 5IM4A 4DR5B 4I3GA 3STUA 1GTRA 1G1AA 2WVJA 3NRBA 4RTQA 2ZAMA 3ZHQA 3JQRA 4KGVA 2NXEA 2E5FA 5JQGA 1Q1EA 1T8RA 4OJMX 4OJYA 1E0KA 2O52A 1I8TA 4PSVA 4KR2A 3NKFA 4RZXA 3EH1A 1QKIA 3EDCA 5LSAA 3U60B 1JEYB 3DONA 2VF7A 4KXLA 3V4LA 3OQMA 3WIVA 3PHCA 4UHEA 5EJ4A 1IE3A 1P0CA 1Z9BA 1JE0A 3LX5A 2XNKA 4J6EA 5AKYA 3S99A 1JR6A 1QYIA 2R751 1BDMA 1M34A 3K16A 3P52A 4BOYA 1VPVA 1SWWA 2QD4A 5BNTA 2VDVE 4QO8A 2CNWA 1L5KA 2DPLA 4TZ0A 1Z07A 3IUNA 3C45A 2FWBA 4LSWA 3BB1A 3OHPA 3CLTC 1AXRA 2IYFA 3EVZA 1LQUA 4HXFB 4QJIA 1AKQA 4CT0A 3SZUA 1X7WA 3DL0A 4NLLA 2HIGA 2ZIUB 1J7JA 3FCUB 3LDAA 2ETXA 1QPBA 3B7WA 4QOEA 2HBYA 2ZDQA 2IXGA 5CNKA 1AK1A 2XOEA 2Y67A 4WACA 5HOQA 1ADBA 3HCNA 1A8IA 2PMEA 4OQXA 3LSYA 4I55B 1D2CA 1KF0A 4WOPA 1RKQA 1NVEA 5K5EA 3M5CA 4RXUA 5CXSA 4F4IA 4G23A 1GNTA 2F1JA 3H9GA 1UOEA 1II9A 2P7IA 2Q21A 3NHPA 2EQBA 4J7CA 1QYRA 2B0JA 3JQFA 4MDHA 3LT2A 5I8ZA 1XNGA 2IYTA 5AOCA 4HQNA 3RDPA 1V5IA 2QVLA 3F71A 1JB1A 2QE6A 3IBGA 3NP9A 4KE9A 4RPJA 3UQYS 1LDNA 1QRDA 2W2TA 1EZZA 3MJHA 1DKLA 3D0OA 3P9XA 4YWHA 2V54A 4PO3X 4C08A 2CF6A 5LNK6 1DJOA 2VHVA 1KYIA 3CT4A 2OKGA 4NBTA 3AY7A 4XIGS 5DM70 4AJOA 1KSHA 2GM5A 3L02A 4Y2VA 2FFJA 3ZHOA 1CLEA 1TMGE 4B8YA 4YP9A 3DOCA 3JQ8B 4RVHA 3DXYA 1DBPA 4RZSA 3JAKA 4IIYA 1LV8A 1CTQA 1L5QA 2IV2X 2CDRA 3H9QA 3U4QA 1Y89A 3HJFA 4GBMA 3UM9A 3CVYA 3CV3A 1LX6A 1A7AA 1X0XA 1JT9A 4WOBA