3KABA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kabA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kabA02
1J4HA 3O5MA 3UQBA 1R9HA 4G50A 4TW8A 2VN1A 4W9QA 3KAGA 3ODKA 2YSGA 2F2DA 2FAPA 1FKLA 4ODNA 4DRHA 5BXJA 3WH0A 2KE0A 1JNSA 1PBKA 4ODMA 2ITKA 2F4EA 1QPFA 1FKIA 2ZAJA 2LJ4A 2AWGA 2XP9A 1J4RA 4DIPA 3O5KA 1FKKA 1W26A 4DRIA 1D7HA 2YSBA 2M1IA 1EQ3A 3O5DA 1FKJA 3JYMA 3NI6A 4TX0A 5GPGA 4DH0A 4DT4A 4FN2A 1FKHA 3CNGA 2JMFA 4ODRA 5HWCA 1FKRA 1Q6UA 3IHZA 2KO7A 3TC5A 2JZVA 1O6WA 1WR7A 1EG3A 1JNTA 2MNTA 4IQ2A 3UQIA 2K8IA 2Q5AA 3M85A 4G2PA 1JMQA 4DRPA 2MLXA 2RQSA 2XPAA 3IK8A 2ZQVA 1YATA 4DRNA 1BKFA 2LAJA 5DIVA 4W9OA 2RE3A 1Q6HA 5I98A 2XP8A 2RUQA 2ZQTA 5B8IC 2PPNA 2YSHA 2KR7A 2UZ5A 3EY6A 4JFMA 1FKSA 2IF4A 3O5EA 2MPHA 2YSIA 2MF9A 3TCZA 3O5IA 4JFIA 3B7XA 4TNSA 4REXA 1BL4A 1U79A 4R0XA 2DMVA 2L4JA 4U84A 2KGJA 2OFNA 3CGMA 1T11A 2JX8A 3PRDA 4QT2A 1N1AA 1P5QA 3PRBA 2PV2A 4GIVA 2E45A 1F8AB 2KXQA 3KZ7A 4U86A 2DK1A 1K9QA 3UI6A 3O5RA 1NMWA 2XPBA 2KFWA 2DJYA 2M08A 3O5QA 4ODPA 5HW8A 3KABA 3NRKA 3KAIA 2D9FA 4ODOA 1FJDA 5HT1A 1EYMA 4NNRA 1QPLA 4JFJA 4LAYA 3NTPA 1M5YA 2XP5A 1FKTA 3IKDA 4DRJA 4DZ3A 4GGQA 1EG4A 2LGOA 3PA7A 3KAFA 4DRKA 1FD9A 2JV4A 2ZR6A 4O2TA 2MDIA 2DWVA 2PPPA 1FKGA 2PV3A 4LAWA 2VCDA 3KAHA 5DIUA 2M2AA 2XP7A 1FKBA 5HW7A 2MLZA 4LAXA 5HUAA 1I5HW 4TYOA 4FAPA 2F21A 1QZ2A 1NMVA 3JYJA 3O5GA 2ZR5A 2YSFA 2PBCA 2LKNA 2L2SA 2ZR4A 4ODKA 2RSEA 3CGNA 1TCOC 2M3OW 2LPVA 4MSPA 1YW5A 4JYSA 2ZQSA 3LE4A 5HW6A 2BA1A 2FKEA 1D7IA 3UQAA 3KCEA 4E5RA 1ROTA 5D75A 3I6CA 1Q6IA 3IKGA 4ODQA 5HWBA 1Q1CA 2XP6A 4IQCA 4N19A 5J6EA 5CQ2A 1PINA 1C9HA 1J4IA 4DROA 2RUCA 4JFLA 3MDYB 4ODLA 4QIBA 2DK7A 3UI4A 4J4OA 2M8JA 1KT1A 2DG3A 4BF8A 3KACA 3TDBA 5DITA 1FKFA 1KT0A 2PV1A 2Y78A 5AHTA 3UF8A 2RUDA 4TW6A 1D6OA 1K9RA 2RURA 2XP4A 3O5PA 4LAVA 2XP3A 2DG9A 2PPOA 3LUOA 3RFWA 4QT3A 5HTGA 2DG4A 1J6YA 4IPXA 3H9RB 4DZ2A 2EZ5W 1JVWA 3O5OA 4C02B 4JFKA 4MGVA 1ROUA 5HKGA 3GPKA 1FKDA 1TK7A 2ZQUA 1FAPA 3O5JA 3UI5A 4DRQA 1F40A 1ZK6A 1B6CA 1A7XA 1WMVA 1ZCNA 3O5LA 1L1PA 4U85A 3VAWA 3O5FA 4DRMA 3M7NA 3JXVA 2M8IA 1Y0OA 4TW7A 2KI3A 4ITZA 1HXVA 1NSGA 3L4HA 4J4NA 3RGCA 3OOBA 4W9PA 3KADA 3FAPA 2MLYA 2N87A 1D7JA 2JXWA
chains in the Genus database with same CATH superfamily
1J4HA 3O5MA 1E44A 2VN1A 3ARXA 4MNKA 4AY1A 2YSGA 1ZU8A 4HARA 2FAPA 3WH0A 1LQ0A 3ARQA 2KE0A 4ZPWR 4ODMA 2ITKA 4NZCA 1FKKA 1W26A 2YSBA 2M1IA 1EQ3A 1FKJA 3NI6A 1CTNA 1HKKA 4DH0A 5HBFA 3PRAA 1FKRA 3UQIA 1O6WA 2K8IA 3M85A 4MNMA 5E62A 2MLXA 3IK8A 2G41A 1BKFA 4UDMA 2RUQA 2ZQTA 2AOSA 2WLZA 1FKSA 1WNOA 2IF4A 3VAWA 2YSIA 4JFIA 4KR0B 2L4JA 2KGJA 1T11A 3PRDA 4MTVA 3PRBA 2E45A 3AS3A 4Z2KA 1K9QA 3AS1A 3ARZA 3UI6A 3O5RA 1FLCA 2KFWA 2M08A 4XAKA 3NRKA 1D2KA 1HJXA 4JFJA 4LAYA 3NTPA 4DRJA 1ZB5A 2PN0A 4GGQA 4DWSC 4A0TA 2ZR6A 5DEZA 1FKGA 2VCDA 2XP7A 4Q22A 2YAJB 1LL4A 3WD0A 2DT1A 5GQBA 1O6IA 1QZ2A 3FS8A 3CHCA 3RM8A 2LPVA 3LE4A 3GTYX 2YBTA 4P8UA 4E5RA 4ZPVR 5HWBA 1NWRA 5J6EA 1PINA 1ZBKA 2RUCA 4ODLA 1ITXA 4QIBA 2DK7A 3WL0A 4J4OA 2M8JA 1KT1A 2DG3A 4WKAA 5DITA 1FKFA 1E6PA 1E6RA 2PV1A 5AHTA 4TW6A 3O5PA 4LAVA 2XP3A 1UR9A 4R5EA 1NWTA 5U47A 3H9RB 1JVWA 4DWSB 1ROUA 1TK7A 3CH9A 3UI5A 4DRQA 1A7XA 1WMVA 1LG2A 4U85A 2DPEA 3O5FA 3LKXA 3M7NA 3JXVA 1Y0OA 4DWSD 5E66A 4J4NA 2N87A 1D7JA 2EULA 1XRVA 4TW8A 2A3CA 1E6NA 4ZPTR 1LG1A 3KAGA 2DT0A 4HBOA 2F2DA 4ODNA 1FKLA 4DRHA 1TR8A 4Z2JA 4IT4A 2AWGA 4DRIA 1W1TA 3FXYA 4TX0A 5GPGA 2YBUA 4FN2A 3CNGA 3LKXB 3MQGA 1Q6UA 2KO7A 4IQ2A 2WK2A 1W1VA 3ARWA 1LJYA 2DT2A 1JMQA 1EHNA 2ZQVA 2LAJA 5I98A 2RE3A 1HJWA 5B8IC 2PPNA 1WB0A 2KR7A 4WK9A 1RP5A 2MF9A 3TCZA 3B7XA 4REXA 1U79A 3G6MA 2OFNA 4QT2A 3W4RA 2PV2A 3KZ7A 4U86A 1LL7A 1EDQA 1ZBWA 1GRJA 3BXWA 3KABA 3MQHA 3B9AA 3KAIA 3CZ8A 4ODOA 1HKMA 1EYMA 1QPLA 4P8XA 2XP5A 3IKDA 1EG4A 3KAFA 1FD9A 5DF0A 4Z2IA 2MDIA 2F23A 1ZBVA 4NSBA 1FKBA 4L72B 4TYOA 3ARTA 4ML4A 4PTMA 1NWSA 2PBCA 2YSFA 1WAWA 2LKNA 4S3JA 3CGNA 4MSPA 2ZQSA 4KQZA 3KCEA 1OWQA 1Q6IA 2WM0A 4IQCA 5CQ2A 1C9HA 1H0GA 1KT0A 2RUDA 2RURA 3RFWA 3WD4A 2DG9A 3LUOA 5HTGA 4QT3A 2DG4A 2QF8A 1J6YA 2OWOA 4DWSA 4DZ2A 2EZ5W 4C02B 1IX5A 3WD1A 3GPKA 2ZQUA 1F40A 3O5LA 2ETNA 4DRMA 3ALGA 1SR0A 1NSGA 3OOBA 4W9PA 3KADA 3FAPA 2JXWA 2B5UB 4G50A 1E6ZA 3ARPA 3WQVA 2DSUA 4L3NA 5BXJA 1NWUA 1ZL1A 1JNSA 3B9DA 5GPRA 1QPFA 1FKIA 1JNDA 2XP9A 4DIPA 3O5KA 1D7HA 3JYMA 4DT4A 1FKHA 2OLHA 3PA7A 3IHZA 1SYTA 1GUVA 1EG3A 1JNTA 2Y8NB 2MNTA 2Q5AA 4DRPA 4DRNA 1H0IA 2XPAA 2RQSA 1YATA 1W9PA 5DIVA 1Q6HA 2FDMA 1HKJA 3B8SA 2YSHA 1OGGA 2UZ5A 3EY6A 4JFMA 1E15A 4GLXA 1BL4A 2O92A 4U84A 4S3KA 2B31A 2A3EA 1N1AA 5E5WA 1P5QA 4Z2GA 1F8AB 2KXQA 2DK1A 2G8ZA 3CHEA 2DJYA 3O5QA 3RM4A 5HW8A 2D9FA 3MCBA 4NNRA 4DZ3A 1FKTA 2WADA 4DRKA 4O2TA 3ALFA 2DWVA 2PPPA 2ESCA 5DIUA 3KAHA 5HW7A 5E64A 2M2AA 2MLZA 4LAXA 3BMBA 4ZS6A 1I5HW 5HUAA 3O5GA 2ZR5A 3AS0A 2QRVA 1TCOC 4JYSA 1W1PA 5HW6A 3MCBB 3GU0A 1ROTA 4Z2HA 2XP6A 4N19A 3QOKA 3UI4A 2DSWA 4BF8A 3TDBA 1D6OA 1K9RA 1FFQA 2XP4A 1E9LA 2IUZA 2PPOA 5DO2A 4MAVA 3ARSA 4W5UA 3O5OA 4JFKA 3FY1A 1FKDA 1GPFA 1FAPA 1B6CA 1ZCNA 1NH6A 1L1PA 4WKHA 2KI3A 4ITZA 1HXVA 3RGCA 3RMEA 3UQBA 1R9HA 5E65A 2A3AA 3FSBA 4W9QA 3ODKA 1FFRA 3WKZA 3EIPA 1KFWA 1PBKA 2F4EA 2LJ4A 2ZAJA 1J4RA 4MPKA 2WAEA 2DT3A 3O5DA 1LL6A 1W9UA 3FSCA 3WD2A 3ARYA 5HWCA 2JMFA 4ODRA 3TC5A 1EIBA 2JZVA 1WR7A 4G2PA 4WJXA 1X6LA 4W9OA 2XP8A 4Q7NA 3O5EA 3O5IA 4TNSA 2MPHA 1GOIA 4R0XA 2DMVA 3WD3A 3CGMA 2PI6A 2JX8A 3AROA 4GIVA 1NMWA 1K9TA 2XPBA 1TFVA 4ODPA 3PQHA 4URIA 1FJDA 4Z2LA 5HT1A 2O9OA 1M5YA 2LGOA 4P8VA 2JV4A 1OGBA 1JNEA 1W9VA 3CHFA 2PV3A 4LAWA 1UR8A 4HBEA 2A3BA 3AQUA 4FAPA 2F21A 1NMVA 3JYJA 2P4VA 1XHGA 4WKFA 2L2SA 2ZR4A 1HKIA 2RSEA 4ODKA 1VF8A 2M3OW 2DSZA 1YW5A 1ZBCA 4MNLA 2BA1A 4P8WA 5JH8A 2FKEA 1D7IA 3UQAA 3AS2A 3ARRA 5D75A 1HJVA 3B9EA 3I6CA 3IKGA 3ARUA 4ODQA 1Q1CA 3WL1A 4DROA 1J4IA 4JFLA 3MDYB 1W1YA 1RD6A 3KACA 4IT6A 3UF8A 2Y78A 3WQWA 3PR9A 3RM9A 4A0UA 1X6NA 4IPXA 2DSVA 4LGXA 3ARVA 4MGVA 4WIWA 5HKGA 3CHDA 3O5JA 1ZK6A 1JCHB 3G6LA 2WLYA 4TW7A 2M8IA 3WIJA 3OA5A 4QZVB 3L4HA 4MNJA 2MLYA
chains in the Genus database with same CATH topology
1J4HA 3O5MA 2VN1A 3ARXA 4MNKA 4AY1A 2YSGA 1ZU8A 4HARA 2FAPA 3WH0A 1LQ0A 3ARQA 2KE0A 4ZPWR 4ODMA 2ITKA 4NZCA 1FKKA 1W26A 2YSBA 2M1IA 1EQ3A 1FKJA 3NI6A 1CTNA 1HKKA 4DH0A 5HBFA 3PRAA 1FKRA 3UQIA 1O6WA 2K8IA 3M85A 4MNMA 5E62A 2MLXA 3IK8A 2G41A 1BKFA 2RUQA 2ZQTA 2AOSA 2WLZA 1FKSA 1WNOA 2IF4A 3VAWA 2YSIA 4JFIA 4KR0B 2L4JA 2KGJA 1T11A 3PRDA 4MTVA 3PRBA 2E45A 3AS3A 4Z2KA 1K9QA 3AS1A 3ARZA 3UI6A 3O5RA 1FLCA 2KFWA 2M08A 4XAKA 3NRKA 1D2KA 1HJXA 4JFJA 4LAYA 3NTPA 4DRJA 1ZB5A 4GGQA 4DWSC 4A0TA 2ZR6A 5DEZA 1FKGA 2VCDA 2XP7A 4Q22A 2YAJB 1LL4A 3WD0A 2DT1A 5GQBA 1O6IA 1QZ2A 3FS8A 3CHCA 3RM8A 2LPVA 3LE4A 2YBTA 4P8UA 4E5RA 4ZPVR 5HWBA 1NWRA 5J6EA 1PINA 1ZBKA 2RUCA 4ODLA 1ITXA 4QIBA 2DK7A 3WL0A 4J4OA 2M8JA 1KT1A 2DG3A 4WKAA 5DITA 1FKFA 1E6PA 1E6RA 2PV1A 5AHTA 4TW6A 3O5PA 4LAVA 2XP3A 1UR9A 4R5EA 1NWTA 5U47A 3H9RB 1JVWA 4DWSB 1ROUA 1TK7A 3CH9A 3UI5A 4DRQA 1A7XA 1WMVA 1LG2A 4U85A 2DPEA 3O5FA 3LKXA 3M7NA 3JXVA 1Y0OA 4DWSD 5E66A 4J4NA 2N87A 1D7JA 1XRVA 4TW8A 2A3CA 1E6NA 4ZPTR 1LG1A 3KAGA 2DT0A 4HBOA 2F2DA 4ODNA 1FKLA 4DRHA 1TR8A 4Z2JA 4IT4A 2AWGA 4DRIA 1W1TA 3FXYA 4TX0A 5GPGA 2YBUA 4FN2A 3CNGA 3LKXB 3MQGA 1Q6UA 2KO7A 4IQ2A 2WK2A 1W1VA 3ARWA 1LJYA 2DT2A 1JMQA 1EHNA 2ZQVA 2LAJA 5I98A 2RE3A 1HJWA 5B8IC 2PPNA 1WB0A 2KR7A 4WK9A 1RP5A 2MF9A 3TCZA 3B7XA 4REXA 1U79A 3G6MA 2OFNA 4QT2A 3W4RA 2PV2A 3KZ7A 4U86A 1LL7A 1EDQA 1ZBWA 3BXWA 3KABA 3MQHA 3B9AA 3KAIA 3CZ8A 4ODOA 1HKMA 1EYMA 1QPLA 4P8XA 2XP5A 3IKDA 1EG4A 3KAFA 1FD9A 5DF0A 4Z2IA 2MDIA 1ZBVA 4NSBA 1FKBA 4L72B 4TYOA 3ARTA 4ML4A 4PTMA 1NWSA 2PBCA 2YSFA 1WAWA 2LKNA 4S3JA 3CGNA 4MSPA 2ZQSA 4KQZA 3KCEA 1OWQA 1Q6IA 2WM0A 4IQCA 5CQ2A 1C9HA 1H0GA 1KT0A 2RUDA 2RURA 3RFWA 3WD4A 2DG9A 3LUOA 5HTGA 4QT3A 2DG4A 2QF8A 1J6YA 2OWOA 4DWSA 4DZ2A 2EZ5W 4C02B 1IX5A 3WD1A 3GPKA 2ZQUA 1F40A 3O5LA 4DRMA 3ALGA 1SR0A 1NSGA 3OOBA 4W9PA 3KADA 3FAPA 2JXWA 4G50A 1E6ZA 3ARPA 3WQVA 2DSUA 4L3NA 5BXJA 1NWUA 1ZL1A 1JNSA 3B9DA 5GPRA 1QPFA 1FKIA 1JNDA 2XP9A 4DIPA 3O5KA 1D7HA 3JYMA 4DT4A 1FKHA 2OLHA 3PA7A 3IHZA 1SYTA 1GUVA 1EG3A 1JNTA 2Y8NB 2MNTA 2Q5AA 4DRPA 4DRNA 1H0IA 2XPAA 2RQSA 1YATA 1W9PA 5DIVA 1Q6HA 2FDMA 1HKJA 3B8SA 2YSHA 1OGGA 2UZ5A 3EY6A 4JFMA 1E15A 4GLXA 1BL4A 2O92A 4U84A 4S3KA 2B31A 2A3EA 1N1AA 5E5WA 1P5QA 4Z2GA 1F8AB 2KXQA 2DK1A 2G8ZA 3CHEA 2DJYA 3O5QA 3RM4A 5HW8A 2D9FA 3MCBA 4NNRA 4DZ3A 1FKTA 2WADA 4DRKA 4O2TA 3ALFA 2DWVA 2PPPA 2ESCA 5DIUA 3KAHA 5HW7A 5E64A 2M2AA 2MLZA 4LAXA 4ZS6A 5HUAA 1I5HW 3O5GA 2ZR5A 3AS0A 2QRVA 1TCOC 4JYSA 1W1PA 5HW6A 3MCBB 1ROTA 4Z2HA 2XP6A 4N19A 3QOKA 3UI4A 2DSWA 4BF8A 3TDBA 1D6OA 1K9RA 1FFQA 2XP4A 1E9LA 2IUZA 2PPOA 5DO2A 4MAVA 3ARSA 4W5UA 3O5OA 4JFKA 3FY1A 1FKDA 1GPFA 1FAPA 1B6CA 1ZCNA 1NH6A 1L1PA 4WKHA 2KI3A 4ITZA 1HXVA 3RGCA 3RMEA 3UQBA 1R9HA 5E65A 2A3AA 3FSBA 4W9QA 3ODKA 1FFRA 3WKZA 1KFWA 1PBKA 2F4EA 2LJ4A 2ZAJA 1J4RA 4MPKA 2WAEA 2DT3A 3O5DA 1LL6A 1W9UA 3FSCA 3WD2A 3ARYA 5HWCA 2JMFA 4ODRA 3TC5A 1EIBA 2JZVA 1WR7A 4G2PA 4WJXA 1X6LA 4W9OA 2XP8A 4Q7NA 3O5EA 3O5IA 4TNSA 2MPHA 1GOIA 4R0XA 2DMVA 3WD3A 3CGMA 2PI6A 2JX8A 3AROA 4GIVA 1NMWA 1K9TA 2XPBA 1TFVA 4ODPA 3PQHA 4URIA 1FJDA 4Z2LA 5HT1A 2O9OA 1M5YA 2LGOA 4P8VA 2JV4A 1OGBA 1JNEA 1W9VA 3CHFA 2PV3A 4LAWA 1UR8A 4HBEA 2A3BA 3AQUA 4FAPA 2F21A 1NMVA 3JYJA 1XHGA 4WKFA 2L2SA 2ZR4A 1HKIA 2RSEA 4ODKA 1VF8A 2M3OW 2DSZA 1YW5A 1ZBCA 4MNLA 2BA1A 4P8WA 5JH8A 2FKEA 1D7IA 3UQAA 3AS2A 3ARRA 5D75A 1HJVA 3B9EA 3I6CA 3IKGA 3ARUA 4ODQA 1Q1CA 3WL1A 4DROA 1J4IA 4JFLA 3MDYB 1W1YA 1RD6A 3KACA 4IT6A 3UF8A 2Y78A 3WQWA 3PR9A 3RM9A 4A0UA 1X6NA 4IPXA 2DSVA 4LGXA 3ARVA 4MGVA 4WIWA 5HKGA 3CHDA 3O5JA 1ZK6A 3G6LA 2WLYA 4TW7A 2M8IA 3WIJA 3OA5A 4QZVB 3L4HA 4MNJA 2MLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J4H A;  3O5M A;  3UQB A;  1R9H A;  4G50 A;  4TW8 A;  2VN1 A;  4W9Q A;  3KAG A;  3ODK A;  2YSG A;  2F2D A;  2FAP A;  1FKL A;  4ODN A;  4DRH A;  5BXJ A;  3WH0 A;  2KE0 A;  1JNS A;  1PBK A;  4ODM A;  2ITK A;  2F4E A;  1QPF A;  1FKI A;  2ZAJ A;  2LJ4 A;  2AWG A;  2XP9 A;  1J4R A;  4DIP A;  3O5K A;  1FKK A;  1W26 A;  4DRI A;  1D7H A;  2YSB A;  2M1I A;  1EQ3 A;  3O5D A;  1FKJ A;  3JYM A;  3NI6 A;  4TX0 A;  5GPG A;  4DH0 A;  4DT4 A;  4FN2 A;  1FKH A;  3CNG A;  2JMF A;  4ODR A;  5HWC A;  1FKR A;  1Q6U A;  3IHZ A;  2KO7 A;  3TC5 A;  2JZV A;  1O6W A;  1WR7 A;  1EG3 A;  1JNT A;  2MNT A;  4IQ2 A;  3UQI A;  2K8I A;  2Q5A A;  3M85 A;  4G2P A;  1JMQ A;  4DRP A;  2MLX A;  2RQS A;  2XPA A;  3IK8 A;  2ZQV A;  1YAT A;  4DRN A;  1BKF A;  2LAJ A;  5DIV A;  4W9O A;  2RE3 A;  1Q6H A;  5I98 A;  2XP8 A;  2RUQ A;  2ZQT A;  5B8I C;  2PPN A;  2YSH A;  2KR7 A;  2UZ5 A;  3EY6 A;  4JFM A;  1FKS A;  2IF4 A;  3O5E A;  2MPH A;  2YSI A;  2MF9 A;  3TCZ A;  3O5I A;  4JFI A;  3B7X A;  4TNS A;  4REX A;  1BL4 A;  1U79 A;  4R0X A;  2DMV A;  2L4J A;  4U84 A;  2KGJ A;  2OFN A;  3CGM A;  1T11 A;  2JX8 A;  3PRD A;  4QT2 A;  1N1A A;  1P5Q A;  3PRB A;  2PV2 A;  4GIV A;  2E45 A;  1F8A B;  2KXQ A;  3KZ7 A;  4U86 A;  2DK1 A;  1K9Q A;  3UI6 A;  3O5R A;  1NMW A;  2XPB A;  2KFW A;  2DJY A;  2M08 A;  3O5Q A;  4ODP A;  5HW8 A;  3KAB A;  3NRK A;  3KAI A;  2D9F A;  4ODO A;  1FJD A;  5HT1 A;  1EYM A;  4NNR A;  1QPL A;  4JFJ A;  4LAY A;  3NTP A;  1M5Y A;  2XP5 A;  1FKT A;  3IKD A;  4DRJ A;  4DZ3 A;  4GGQ A;  1EG4 A;  2LGO A;  3PA7 A;  3KAF A;  4DRK A;  1FD9 A;  2JV4 A;  2ZR6 A;  4O2T A;  2MDI A;  2DWV A;  2PPP A;  1FKG A;  2PV3 A;  4LAW A;  2VCD A;  3KAH A;  5DIU A;  2M2A A;  2XP7 A;  1FKB A;  5HW7 A;  2MLZ A;  4LAX A;  5HUA A;  1I5H W;  4TYO A;  4FAP A;  2F21 A;  1QZ2 A;  1NMV A;  3JYJ A;  3O5G A;  2ZR5 A;  2YSF A;  2PBC A;  2LKN A;  2L2S A;  2ZR4 A;  4ODK A;  2RSE A;  3CGN A;  1TCO C;  2M3O W;  2LPV A;  4MSP A;  1YW5 A;  4JYS A;  2ZQS A;  3LE4 A;  5HW6 A;  2BA1 A;  2FKE A;  1D7I A;  3UQA A;  3KCE A;  4E5R A;  1ROT A;  5D75 A;  3I6C A;  1Q6I A;  3IKG A;  4ODQ A;  5HWB A;  1Q1C A;  2XP6 A;  4IQC A;  4N19 A;  5J6E A;  5CQ2 A;  1PIN A;  1C9H A;  1J4I A;  4DRO A;  2RUC A;  4JFL A;  3MDY B;  4ODL A;  4QIB A;  2DK7 A;  3UI4 A;  4J4O A;  2M8J A;  1KT1 A;  2DG3 A;  4BF8 A;  3KAC A;  3TDB A;  5DIT A;  1FKF A;  1KT0 A;  2PV1 A;  2Y78 A;  5AHT A;  3UF8 A;  2RUD A;  4TW6 A;  1D6O A;  1K9R A;  2RUR A;  2XP4 A;  3O5P A;  4LAV A;  2XP3 A;  2DG9 A;  2PPO A;  3LUO A;  3RFW A;  4QT3 A;  5HTG A;  2DG4 A;  1J6Y A;  4IPX A;  3H9R B;  4DZ2 A;  2EZ5 W;  1JVW A;  3O5O A;  4C02 B;  4JFK A;  4MGV A;  1ROU A;  5HKG A;  3GPK A;  1FKD A;  1TK7 A;  2ZQU A;  1FAP A;  3O5J A;  3UI5 A;  4DRQ A;  1F40 A;  1ZK6 A;  1B6C A;  1A7X A;  1WMV A;  1ZCN A;  3O5L A;  1L1P A;  4U85 A;  3VAW A;  3O5F A;  4DRM A;  3M7N A;  3JXV A;  2M8I A;  1Y0O A;  4TW7 A;  2KI3 A;  4ITZ A;  1HXV A;  1NSG A;  3L4H A;  4J4N A;  3RGC A;  3OOB A;  4W9P A;  3KAD A;  3FAP A;  2MLY A;  2N87 A;  1D7J A;  2JXW A; 
#chains in the Genus database with same CATH topology
 1J4H A;  3O5M A;  1E44 A;  2VN1 A;  3ARX A;  4MNK A;  4AY1 A;  2YSG A;  1ZU8 A;  4HAR A;  2FAP A;  3WH0 A;  1LQ0 A;  3ARQ A;  2KE0 A;  4ZPW R;  4ODM A;  2ITK A;  4NZC A;  1FKK A;  1W26 A;  2YSB A;  2M1I A;  1EQ3 A;  1FKJ A;  3NI6 A;  1CTN A;  1HKK A;  4DH0 A;  5HBF A;  3PRA A;  1FKR A;  3UQI A;  1O6W A;  2K8I A;  3M85 A;  4MNM A;  5E62 A;  2MLX A;  3IK8 A;  2G41 A;  1BKF A;  4UDM A;  2RUQ A;  2ZQT A;  2AOS A;  2WLZ A;  1FKS A;  1WNO A;  2IF4 A;  3VAW A;  2YSI A;  4JFI A;  4KR0 B;  2L4J A;  2KGJ A;  1T11 A;  3PRD A;  4MTV A;  3PRB A;  2E45 A;  3AS3 A;  4Z2K A;  1K9Q A;  3AS1 A;  3ARZ A;  3UI6 A;  3O5R A;  1FLC A;  2KFW A;  2M08 A;  4XAK A;  3NRK A;  1D2K A;  1HJX A;  4JFJ A;  4LAY A;  3NTP A;  4DRJ A;  1ZB5 A;  2PN0 A;  4GGQ A;  4DWS C;  4A0T A;  2ZR6 A;  5DEZ A;  1FKG A;  2VCD A;  2XP7 A;  4Q22 A;  2YAJ B;  1LL4 A;  3WD0 A;  2DT1 A;  5GQB A;  1O6I A;  1QZ2 A;  3FS8 A;  3CHC A;  3RM8 A;  2LPV A;  3LE4 A;  3GTY X;  2YBT A;  4P8U A;  4E5R A;  4ZPV R;  5HWB A;  1NWR A;  5J6E A;  1PIN A;  1ZBK A;  2RUC A;  4ODL A;  1ITX A;  4QIB A;  2DK7 A;  3WL0 A;  4J4O A;  2M8J A;  1KT1 A;  2DG3 A;  4WKA A;  5DIT A;  1FKF A;  1E6P A;  1E6R A;  2PV1 A;  5AHT A;  4TW6 A;  3O5P A;  4LAV A;  2XP3 A;  1UR9 A;  4R5E A;  1NWT A;  5U47 A;  3H9R B;  1JVW A;  4DWS B;  1ROU A;  1TK7 A;  3CH9 A;  3UI5 A;  4DRQ A;  1A7X A;  1WMV A;  1LG2 A;  4U85 A;  2DPE A;  3O5F A;  3LKX A;  3M7N A;  3JXV A;  1Y0O A;  4DWS D;  5E66 A;  4J4N A;  2N87 A;  1D7J A;  2EUL A;  1XRV A;  4TW8 A;  2A3C A;  1E6N A;  4ZPT R;  1LG1 A;  3KAG A;  2DT0 A;  4HBO A;  2F2D A;  4ODN A;  1FKL A;  4DRH A;  1TR8 A;  4Z2J A;  4IT4 A;  2AWG A;  4DRI A;  1W1T A;  3FXY A;  4TX0 A;  5GPG A;  2YBU A;  4FN2 A;  3CNG A;  3LKX B;  3MQG A;  1Q6U A;  2KO7 A;  4IQ2 A;  2WK2 A;  1W1V A;  3ARW A;  1LJY A;  2DT2 A;  1JMQ A;  1EHN A;  2ZQV A;  2LAJ A;  5I98 A;  2RE3 A;  1HJW A;  5B8I C;  2PPN A;  1WB0 A;  2KR7 A;  4WK9 A;  1RP5 A;  2MF9 A;  3TCZ A;  3B7X A;  4REX A;  1U79 A;  3G6M A;  2OFN A;  4QT2 A;  3W4R A;  2PV2 A;  3KZ7 A;  4U86 A;  1LL7 A;  1EDQ A;  1ZBW A;  1GRJ A;  3BXW A;  3KAB A;  3MQH A;  3B9A A;  3KAI A;  3CZ8 A;  4ODO A;  1HKM A;  1EYM A;  1QPL A;  4P8X A;  2XP5 A;  3IKD A;  1EG4 A;  3KAF A;  1FD9 A;  5DF0 A;  4Z2I A;  2MDI A;  2F23 A;  1ZBV A;  4NSB A;  1FKB A;  4L72 B;  4TYO A;  3ART A;  4ML4 A;  4PTM A;  1NWS A;  2PBC A;  2YSF A;  1WAW A;  2LKN A;  4S3J A;  3CGN A;  4MSP A;  2ZQS A;  4KQZ A;  3KCE A;  1OWQ A;  1Q6I A;  2WM0 A;  4IQC A;  5CQ2 A;  1C9H A;  1H0G A;  1KT0 A;  2RUD A;  2RUR A;  3RFW A;  3WD4 A;  2DG9 A;  3LUO A;  5HTG A;  4QT3 A;  2DG4 A;  2QF8 A;  1J6Y A;  2OWO A;  4DWS A;  4DZ2 A;  2EZ5 W;  4C02 B;  1IX5 A;  3WD1 A;  3GPK A;  2ZQU A;  1F40 A;  3O5L A;  2ETN A;  4DRM A;  3ALG A;  1SR0 A;  1NSG A;  3OOB A;  4W9P A;  3KAD A;  3FAP A;  2JXW A;  2B5U B;  4G50 A;  1E6Z A;  3ARP A;  3WQV A;  2DSU A;  4L3N A;  5BXJ A;  1NWU A;  1ZL1 A;  1JNS A;  3B9D A;  5GPR A;  1QPF A;  1FKI A;  1JND A;  2XP9 A;  4DIP A;  3O5K A;  1D7H A;  3JYM A;  4DT4 A;  1FKH A;  2OLH A;  3PA7 A;  3IHZ A;  1SYT A;  1GUV A;  1EG3 A;  1JNT A;  2Y8N B;  2MNT A;  2Q5A A;  4DRP A;  4DRN A;  1H0I A;  2XPA A;  2RQS A;  1YAT A;  1W9P A;  5DIV A;  1Q6H A;  2FDM A;  1HKJ A;  3B8S A;  2YSH A;  1OGG A;  2UZ5 A;  3EY6 A;  4JFM A;  1E15 A;  4GLX A;  1BL4 A;  2O92 A;  4U84 A;  4S3K A;  2B31 A;  2A3E A;  1N1A A;  5E5W A;  1P5Q A;  4Z2G A;  1F8A B;  2KXQ A;  2DK1 A;  2G8Z A;  3CHE A;  2DJY A;  3O5Q A;  3RM4 A;  5HW8 A;  2D9F A;  3MCB A;  4NNR A;  4DZ3 A;  1FKT A;  2WAD A;  4DRK A;  4O2T A;  3ALF A;  2DWV A;  2PPP A;  2ESC A;  5DIU A;  3KAH A;  5HW7 A;  5E64 A;  2M2A A;  2MLZ A;  4LAX A;  3BMB A;  4ZS6 A;  1I5H W;  5HUA A;  3O5G A;  2ZR5 A;  3AS0 A;  2QRV A;  1TCO C;  4JYS A;  1W1P A;  5HW6 A;  3MCB B;  3GU0 A;  1ROT A;  4Z2H A;  2XP6 A;  4N19 A;  3QOK A;  3UI4 A;  2DSW A;  4BF8 A;  3TDB A;  1D6O A;  1K9R A;  1FFQ A;  2XP4 A;  1E9L A;  2IUZ A;  2PPO A;  5DO2 A;  4MAV A;  3ARS A;  4W5U A;  3O5O A;  4JFK A;  3FY1 A;  1FKD A;  1GPF A;  1FAP A;  1B6C A;  1ZCN A;  1NH6 A;  1L1P A;  4WKH A;  2KI3 A;  4ITZ A;  1HXV A;  3RGC A;  3RME A;  3UQB A;  1R9H A;  5E65 A;  2A3A A;  3FSB A;  4W9Q A;  3ODK A;  1FFR A;  3WKZ A;  3EIP A;  1KFW A;  1PBK A;  2F4E A;  2LJ4 A;  2ZAJ A;  1J4R A;  4MPK A;  2WAE A;  2DT3 A;  3O5D A;  1LL6 A;  1W9U A;  3FSC A;  3WD2 A;  3ARY A;  5HWC A;  2JMF A;  4ODR A;  3TC5 A;  1EIB A;  2JZV A;  1WR7 A;  4G2P A;  4WJX A;  1X6L A;  4W9O A;  2XP8 A;  4Q7N A;  3O5E A;  3O5I A;  4TNS A;  2MPH A;  1GOI A;  4R0X A;  2DMV A;  3WD3 A;  3CGM A;  2PI6 A;  2JX8 A;  3ARO A;  4GIV A;  1NMW A;  1K9T A;  2XPB A;  1TFV A;  4ODP A;  3PQH A;  4URI A;  1FJD A;  4Z2L A;  5HT1 A;  2O9O A;  1M5Y A;  2LGO A;  4P8V A;  2JV4 A;  1OGB A;  1JNE A;  1W9V A;  3CHF A;  2PV3 A;  4LAW A;  1UR8 A;  4HBE A;  2A3B A;  3AQU A;  4FAP A;  2F21 A;  1NMV A;  3JYJ A;  2P4V A;  1XHG A;  4WKF A;  2L2S A;  2ZR4 A;  1HKI A;  2RSE A;  4ODK A;  1VF8 A;  2M3O W;  2DSZ A;  1YW5 A;  1ZBC A;  4MNL A;  2BA1 A;  4P8W A;  5JH8 A;  2FKE A;  1D7I A;  3UQA A;  3AS2 A;  3ARR A;  5D75 A;  1HJV A;  3B9E A;  3I6C A;  3IKG A;  3ARU A;  4ODQ A;  1Q1C A;  3WL1 A;  4DRO A;  1J4I A;  4JFL A;  3MDY B;  1W1Y A;  1RD6 A;  3KAC A;  4IT6 A;  3UF8 A;  2Y78 A;  3WQW A;  3PR9 A;  3RM9 A;  4A0U A;  1X6N A;  4IPX A;  2DSV A;  4LGX A;  3ARV A;  4MGV A;  4WIW A;  5HKG A;  3CHD A;  3O5J A;  1ZK6 A;  1JCH B;  3G6L A;  2WLY A;  4TW7 A;  2M8I A;  3WIJ A;  3OA5 A;  4QZV B;  3L4H A;  4MNJ A;  2MLY A; 
#chains in the Genus database with same CATH homology
 1J4H A;  3O5M A;  2VN1 A;  3ARX A;  4MNK A;  4AY1 A;  2YSG A;  1ZU8 A;  4HAR A;  2FAP A;  3WH0 A;  1LQ0 A;  3ARQ A;  2KE0 A;  4ZPW R;  4ODM A;  2ITK A;  4NZC A;  1FKK A;  1W26 A;  2YSB A;  2M1I A;  1EQ3 A;  1FKJ A;  3NI6 A;  1CTN A;  1HKK A;  4DH0 A;  5HBF A;  3PRA A;  1FKR A;  3UQI A;  1O6W A;  2K8I A;  3M85 A;  4MNM A;  5E62 A;  2MLX A;  3IK8 A;  2G41 A;  1BKF A;  2RUQ A;  2ZQT A;  2AOS A;  2WLZ A;  1FKS A;  1WNO A;  2IF4 A;  3VAW A;  2YSI A;  4JFI A;  4KR0 B;  2L4J A;  2KGJ A;  1T11 A;  3PRD A;  4MTV A;  3PRB A;  2E45 A;  3AS3 A;  4Z2K A;  1K9Q A;  3AS1 A;  3ARZ A;  3UI6 A;  3O5R A;  1FLC A;  2KFW A;  2M08 A;  4XAK A;  3NRK A;  1D2K A;  1HJX A;  4JFJ A;  4LAY A;  3NTP A;  4DRJ A;  1ZB5 A;  4GGQ A;  4DWS C;  4A0T A;  2ZR6 A;  5DEZ A;  1FKG A;  2VCD A;  2XP7 A;  4Q22 A;  2YAJ B;  1LL4 A;  3WD0 A;  2DT1 A;  5GQB A;  1O6I A;  1QZ2 A;  3FS8 A;  3CHC A;  3RM8 A;  2LPV A;  3LE4 A;  2YBT A;  4P8U A;  4E5R A;  4ZPV R;  5HWB A;  1NWR A;  5J6E A;  1PIN A;  1ZBK A;  2RUC A;  4ODL A;  1ITX A;  4QIB A;  2DK7 A;  3WL0 A;  4J4O A;  2M8J A;  1KT1 A;  2DG3 A;  4WKA A;  5DIT A;  1FKF A;  1E6P A;  1E6R A;  2PV1 A;  5AHT A;  4TW6 A;  3O5P A;  4LAV A;  2XP3 A;  1UR9 A;  4R5E A;  1NWT A;  5U47 A;  3H9R B;  1JVW A;  4DWS B;  1ROU A;  1TK7 A;  3CH9 A;  3UI5 A;  4DRQ A;  1A7X A;  1WMV A;  1LG2 A;  4U85 A;  2DPE A;  3O5F A;  3LKX A;  3M7N A;  3JXV A;  1Y0O A;  4DWS D;  5E66 A;  4J4N A;  2N87 A;  1D7J A;  1XRV A;  4TW8 A;  2A3C A;  1E6N A;  4ZPT R;  1LG1 A;  3KAG A;  2DT0 A;  4HBO A;  2F2D A;  4ODN A;  1FKL A;  4DRH A;  1TR8 A;  4Z2J A;  4IT4 A;  2AWG A;  4DRI A;  1W1T A;  3FXY A;  4TX0 A;  5GPG A;  2YBU A;  4FN2 A;  3CNG A;  3LKX B;  3MQG A;  1Q6U A;  2KO7 A;  4IQ2 A;  2WK2 A;  1W1V A;  3ARW A;  1LJY A;  2DT2 A;  1JMQ A;  1EHN A;  2ZQV A;  2LAJ A;  5I98 A;  2RE3 A;  1HJW A;  5B8I C;  2PPN A;  1WB0 A;  2KR7 A;  4WK9 A;  1RP5 A;  2MF9 A;  3TCZ A;  3B7X A;  4REX A;  1U79 A;  3G6M A;  2OFN A;  4QT2 A;  3W4R A;  2PV2 A;  3KZ7 A;  4U86 A;  1LL7 A;  1EDQ A;  1ZBW A;  3BXW A;  3KAB A;  3MQH A;  3B9A A;  3KAI A;  3CZ8 A;  4ODO A;  1HKM A;  1EYM A;  1QPL A;  4P8X A;  2XP5 A;  3IKD A;  1EG4 A;  3KAF A;  1FD9 A;  5DF0 A;  4Z2I A;  2MDI A;  1ZBV A;  4NSB A;  1FKB A;  4L72 B;  4TYO A;  3ART A;  4ML4 A;  4PTM A;  1NWS A;  2PBC A;  2YSF A;  1WAW A;  2LKN A;  4S3J A;  3CGN A;  4MSP A;  2ZQS A;  4KQZ A;  3KCE A;  1OWQ A;  1Q6I A;  2WM0 A;  4IQC A;  5CQ2 A;  1C9H A;  1H0G A;  1KT0 A;  2RUD A;  2RUR A;  3RFW A;  3WD4 A;  2DG9 A;  3LUO A;  5HTG A;  4QT3 A;  2DG4 A;  2QF8 A;  1J6Y A;  2OWO A;  4DWS A;  4DZ2 A;  2EZ5 W;  4C02 B;  1IX5 A;  3WD1 A;  3GPK A;  2ZQU A;  1F40 A;  3O5L A;  4DRM A;  3ALG A;  1SR0 A;  1NSG A;  3OOB A;  4W9P A;  3KAD A;  3FAP A;  2JXW A;  4G50 A;  1E6Z A;  3ARP A;  3WQV A;  2DSU A;  4L3N A;  5BXJ A;  1NWU A;  1ZL1 A;  1JNS A;  3B9D A;  5GPR A;  1QPF A;  1FKI A;  1JND A;  2XP9 A;  4DIP A;  3O5K A;  1D7H A;  3JYM A;  4DT4 A;  1FKH A;  2OLH A;  3PA7 A;  3IHZ A;  1SYT A;  1GUV A;  1EG3 A;  1JNT A;  2Y8N B;  2MNT A;  2Q5A A;  4DRP A;  4DRN A;  1H0I A;  2XPA A;  2RQS A;  1YAT A;  1W9P A;  5DIV A;  1Q6H A;  2FDM A;  1HKJ A;  3B8S A;  2YSH A;  1OGG A;  2UZ5 A;  3EY6 A;  4JFM A;  1E15 A;  4GLX A;  1BL4 A;  2O92 A;  4U84 A;  4S3K A;  2B31 A;  2A3E A;  1N1A A;  5E5W A;  1P5Q A;  4Z2G A;  1F8A B;  2KXQ A;  2DK1 A;  2G8Z A;  3CHE A;  2DJY A;  3O5Q A;  3RM4 A;  5HW8 A;  2D9F A;  3MCB A;  4NNR A;  4DZ3 A;  1FKT A;  2WAD A;  4DRK A;  4O2T A;  3ALF A;  2DWV A;  2PPP A;  2ESC A;  5DIU A;  3KAH A;  5HW7 A;  5E64 A;  2M2A A;  2MLZ A;  4LAX A;  4ZS6 A;  5HUA A;  1I5H W;  3O5G A;  2ZR5 A;  3AS0 A;  2QRV A;  1TCO C;  4JYS A;  1W1P A;  5HW6 A;  3MCB B;  1ROT A;  4Z2H A;  2XP6 A;  4N19 A;  3QOK A;  3UI4 A;  2DSW A;  4BF8 A;  3TDB A;  1D6O A;  1K9R A;  1FFQ A;  2XP4 A;  1E9L A;  2IUZ A;  2PPO A;  5DO2 A;  4MAV A;  3ARS A;  4W5U A;  3O5O A;  4JFK A;  3FY1 A;  1FKD A;  1GPF A;  1FAP A;  1B6C A;  1ZCN A;  1NH6 A;  1L1P A;  4WKH A;  2KI3 A;  4ITZ A;  1HXV A;  3RGC A;  3RME A;  3UQB A;  1R9H A;  5E65 A;  2A3A A;  3FSB A;  4W9Q A;  3ODK A;  1FFR A;  3WKZ A;  1KFW A;  1PBK A;  2F4E A;  2LJ4 A;  2ZAJ A;  1J4R A;  4MPK A;  2WAE A;  2DT3 A;  3O5D A;  1LL6 A;  1W9U A;  3FSC A;  3WD2 A;  3ARY A;  5HWC A;  2JMF A;  4ODR A;  3TC5 A;  1EIB A;  2JZV A;  1WR7 A;  4G2P A;  4WJX A;  1X6L A;  4W9O A;  2XP8 A;  4Q7N A;  3O5E A;  3O5I A;  4TNS A;  2MPH A;  1GOI A;  4R0X A;  2DMV A;  3WD3 A;  3CGM A;  2PI6 A;  2JX8 A;  3ARO A;  4GIV A;  1NMW A;  1K9T A;  2XPB A;  1TFV A;  4ODP A;  3PQH A;  4URI A;  1FJD A;  4Z2L A;  5HT1 A;  2O9O A;  1M5Y A;  2LGO A;  4P8V A;  2JV4 A;  1OGB A;  1JNE A;  1W9V A;  3CHF A;  2PV3 A;  4LAW A;  1UR8 A;  4HBE A;  2A3B A;  3AQU A;  4FAP A;  2F21 A;  1NMV A;  3JYJ A;  1XHG A;  4WKF A;  2L2S A;  2ZR4 A;  1HKI A;  2RSE A;  4ODK A;  1VF8 A;  2M3O W;  2DSZ A;  1YW5 A;  1ZBC A;  4MNL A;  2BA1 A;  4P8W A;  5JH8 A;  2FKE A;  1D7I A;  3UQA A;  3AS2 A;  3ARR A;  5D75 A;  1HJV A;  3B9E A;  3I6C A;  3IKG A;  3ARU A;  4ODQ A;  1Q1C A;  3WL1 A;  4DRO A;  1J4I A;  4JFL A;  3MDY B;  1W1Y A;  1RD6 A;  3KAC A;  4IT6 A;  3UF8 A;  2Y78 A;  3WQW A;  3PR9 A;  3RM9 A;  4A0U A;  1X6N A;  4IPX A;  2DSV A;  4LGX A;  3ARV A;  4MGV A;  4WIW A;  5HKG A;  3CHD A;  3O5J A;  1ZK6 A;  3G6L A;  2WLY A;  4TW7 A;  2M8I A;  3WIJ A;  3OA5 A;  4QZV B;  3L4H A;  4MNJ A;  2MLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...