3KABA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kabA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kabA02
2KGJA 4ODMA 5CQ2A 4LAXA 2DK7A 5HWCA 3RFWA 4IQ2A 2ZQVA 3NTPA 5DIUA 4DRJA 2YSGA 2M1IA 3O5FA 2PBCA 3UQAA 4G50A 2KXQA 3O5JA 2DMVA 5DITA 1YW5A 3EY6A 2XP6A 2LGOA 4DIPA 3JXVA 3KAIA 2RURA 3IKDA 1EG3A 1I5HW 2VCDA 1PBKA 2EZ5W 1L1PA 3JYJA 1ZCNA 1PINA 4DH0A 2FKEA 3IK8A 3LE4A 2KE0A 4ODLA 2UZ5A 2M2AA 4ODQA 5HT1A 4REXA 3FAPA 1D6OA 1FJDA 3M7NA 4LAYA 1J4RA 1KT0A 2M3OW 1A7XA 3KZ7A 4DRKA 4R0XA 2YSFA 1NMVA 3PRDA 1ROTA 4ODNA 2MLXA 4GGQA 5DIVA 1J6YA 1R9HA 5I98A 1FKFA 2XP4A 1J4HA 2N87A 3ODKA 1Q6IA 4O2TA 1F40A 1QPFA 3O5RA 4W9PA 2IF4A 4J4NA 5AHTA 3H9RB 5HW8A 4ODRA 2MPHA 2DK1A 3PRBA 2Q5AA 1NSGA 4TW7A 2DG4A 1N1AA 4ITZA 3LUOA 1FD9A 4DRPA 3UQIA 5B8IC 2L2SA 5HTGA 3I6CA 3O5IA 4JFLA 4G2PA 3NI6A 2XP5A 2YSIA 2D9FA 4GIVA 1F8AB 2L4JA 4JYSA 1KT1A 1FKSA 2M8JA 4ODPA 1FKBA 2JV4A 3UI5A 3PA7A 1NMWA 4DT4A 2LJ4A 4IQCA 1O6WA 4DRQA 2MF9A 3O5LA 4TW6A 2LPVA 1FKDA 2OFNA 2PV1A 5BXJA 4JFJA 2F2DA 2ZQSA 2RUQA 1QZ2A 4DRNA 2XP8A 1ZK6A 2AWGA 5HWBA 2ZR4A 5D75A 2DWVA 2JXWA 4ODKA 1M5YA 2M08A 4BF8A 2KFWA 2RSEA 4TX0A 2MLYA 3M85A 2JMFA 1EQ3A 3KAHA 4QT2A 5HUAA 5HW7A 4QIBA 3KCEA 2E45A 4W9QA 2LAJA 2F21A 3TDBA 1Q1CA 4LAVA 2PV2A 1JVWA 4U84A 1B6CA 3IHZA 4C02B 2JZVA 2RUDA 1P5QA 4DROA 3O5QA 1EG4A 2DG3A 4FAPA 1WR7A 4J4OA 1WMVA 3B7XA 3L4HA 3OOBA 1QPLA 4ODOA 4QT3A 2FAPA 3KACA 1Q6HA 3UI4A 2Y78A 3MDYB 2ZR5A 4W9OA 4LAWA 3TC5A 5HW6A 4U85A 3GPKA 2LKNA 2XP9A 2PV3A 2MNTA 2ITKA 1D7HA 1U79A 3CGMA 2KR7A 1ROUA 2ZAJA 1FKGA 4DRIA 3IKGA 3TCZA 4DRMA 4MGVA 2YSBA 1BKFA 2ZQTA 1FKLA 1TCOC 4IPXA 1JNSA 3KADA 2PPPA 1YATA 1W26A 3UI6A 1C9HA 2JX8A 5J6EA 3KABA 1Y0OA 2DJYA 2PPOA 4DZ2A 4E5RA 1TK7A 1FKHA 1BL4A 4TW8A 4TYOA 1HXVA 3VAWA 4JFIA 2RQSA 2RUCA 1FKTA 3KAFA 2PPNA 4U86A 3WH0A 4DRHA 3JYMA 1J4IA 3O5KA 4JFKA 1JMQA 4MSPA 2ZR6A 4JFMA 3O5DA 3KAGA 2MDIA 4NNRA 2XPAA 2XP7A 3O5MA 2M8IA 1D7JA 1FKKA 2KO7A 3O5GA 3O5OA 3UQBA 1K9RA 1K9QA 1FKJA 1JNTA 4N19A 1D7IA 1FAPA 3NRKA 1Q6UA 2XPBA 1FKRA 2KI3A 3UF8A 2XP3A 3O5EA 2MLZA 3CGNA 5GPGA 2RE3A 3CNGA 2YSHA 4TNSA 4DZ3A 1FKIA 5HKGA 2BA1A 2ZQUA 2F4EA 1EYMA 4FN2A 2DG9A 3O5PA 2VN1A 1T11A 2K8IA 3RGCA
chains in the Genus database with same CATH superfamily
2KGJA 3AQUA 4ODMA 5CQ2A 4WKAA 4LAXA 1RD6A 3BXWA 3CZ8A 2DK7A 5HWCA 3RFWA 4IQ2A 2ZQVA 3NTPA 5DIUA 4DRJA 3LKXA 5E62A 2YSGA 2M1IA 4URIA 3O5FA 2PBCA 4P8WA 3UQAA 4G50A 2A3AA 3B9EA 2KXQA 3O5JA 2DMVA 5DITA 1YW5A 1D2KA 1UR8A 2YBUA 3CH9A 3EY6A 2XP6A 1GPFA 1XHGA 2LGOA 4DIPA 3JXVA 1OGBA 4HARA 3KAIA 2G41A 1HKIA 2RURA 3IKDA 3ARUA 4Z2KA 1EG3A 1I5HW 4QZVB 3ARTA 1WAWA 2O9OA 2VCDA 3ARYA 1PBKA 2EZ5W 1L1PA 3JYJA 1ZCNA 3ARSA 1W9UA 3WD2A 1PINA 4DH0A 2FKEA 3IK8A 4ZPTR 3WL1A 4Z2GA 2DT2A 3LE4A 2KE0A 2AOSA 4ODLA 2UZ5A 2M2AA 4ODQA 2ETNA 5JH8A 5HT1A 2G8ZA 1ZB5A 4REXA 3FAPA 2WLZA 3WL0A 1D6OA 3W4RA 1FJDA 3QOKA 2DSZA 2DT3A 2YAJB 1WNOA 1ZBKA 3M7NA 4S3JA 2QRVA 4LAYA 1J4RA 1KT0A 2M3OW 1A7XA 3KZ7A 4DRKA 4R0XA 2YSFA 2ESCA 1NMVA 3PRDA 1ROTA 3FSBA 4ODNA 4MNLA 2MLXA 4MPKA 4GGQA 1H0GA 3ARRA 4WIWA 5DIVA 1J6YA 4KQZA 1LL4A 1R9HA 5I98A 3CHDA 1RP5A 1FKFA 2XP4A 4A0UA 1J4HA 4IT4A 2N87A 3ODKA 4WJXA 1Q6IA 1HJVA 4O2TA 1F40A 1QPFA 3O5RA 4W9PA 2IF4A 5E65A 4J4NA 3PRAA 5AHTA 2EULA 4MAVA 3H9RB 4KR0B 5HW8A 4ODRA 3FSCA 2B31A 2MPHA 2DK1A 3PRBA 2Q5AA 4Z2IA 1NSGA 4TW7A 4ZPVR 2DG4A 1N1AA 4AY1A 4ITZA 1FFQA 1EIBA 3BMBA 3LUOA 1FD9A 2YBTA 5DO2A 1LL6A 3G6MA 4DRPA 1LG1A 3UQIA 1TR8A 5B8IC 4IT6A 2L2SA 5HTGA 3I6CA 3O5IA 4JFLA 4G2PA 4R5EA 3RM4A 2QF8A 3MCBA 3FY1A 3NI6A 2XP5A 2PN0A 2YSIA 2D9FA 4NZCA 2IUZA 3OA5A 4GIVA 3ARXA 1F8AB 1W9PA 2L4JA 4JYSA 1KT1A 3GU0A 1FKSA 1EDQA 2M8JA 4ODPA 3EIPA 1FKBA 2Y8NB 1SYTA 2JV4A 3UI5A 5DF0A 3PA7A 1NMWA 4Z2HA 2WADA 4DT4A 2A3EA 2LJ4A 4IQCA 1O6WA 4A0TA 4DRQA 2MF9A 3O5LA 2WAEA 4TW6A 4UDMA 2LPVA 1FKDA 2OFNA 2PV1A 1W9VA 5BXJA 5DEZA 4Z2JA 3ALFA 4JFJA 2F2DA 1LJYA 2ZQSA 3AS0A 2A3CA 1HKMA 2RUQA 1QZ2A 4DRNA 2XP8A 1ZK6A 2AWGA 5HWBA 2ZR4A 5GPRA 5D75A 2DWVA 2JXWA 3RM8A 1E9LA 4HBOA 4ODKA 1M5YA 2M08A 4BF8A 3AS1A 1WB0A 1ITXA 2KFWA 4GLXA 1FLCA 2RSEA 4TX0A 1NWUA 1W1PA 2MLYA 3M85A 2JMFA 1EQ3A 3KAHA 4QT2A 5HUAA 5HW7A 4QIBA 4ML4A 3KCEA 2E45A 3MQGA 4W9QA 2DSVA 2OWOA 2LAJA 2F21A 3TDBA 1GUVA 1LQ0A 3FXYA 1Q1CA 1HJXA 4LAVA 3MCBB 1TFVA 2PV2A 1HKKA 3LKXB 1E6PA 2DT0A 1JVWA 4Z2LA 5U47A 1XRVA 4NSBA 3B9DA 4U84A 1B6CA 1NWRA 3G6LA 4L72B 3CHCA 3B8SA 2DT1A 3IHZA 4C02B 2JZVA 4LGXA 2RUDA 1E44A 3RGCA 1HKJA 1P5QA 4ZPWR 3CHFA 4DROA 3O5QA 1EG4A 4MTVA 2DG3A 4FAPA 3WIJA 1WR7A 4J4OA 4PTMA 1HJWA 1ZU8A 4DWSA 1WMVA 1OWQA 1O6IA 1JCHB 3B7XA 4DWSC 3WQVA 3L4HA 3OOBA 1QPLA 1LG2A 3B9AA 4ODOA 4HBEA 2FAPA 4QT3A 3KACA 1X6LA 1IX5A 1E6RA 1Q6HA 3UI4A 2Y78A 1GRJA 3MDYB 2ZR5A 4W9OA 4LAWA 3TC5A 4MNMA 5HW6A 4XAKA 1GOIA 1VF8A 4U85A 3GPKA 5E64A 1H0IA 1X6NA 3ARVA 3FS8A 2PI6A 1LL7A 2LKNA 1JNDA 2XP9A 2PV3A 2MNTA 2ITKA 3WD3A 1D7HA 1W1YA 1U79A 1W1TA 3CGMA 2KR7A 1NWTA 1ROUA 2ZAJA 2WLYA 1FKGA 1NH6A 4S3KA 4DRIA 3IKGA 3TCZA 4DRMA 1EHNA 1OGGA 4WKFA 1ZBCA 4WK9A 3WKZA 4MGVA 1KFWA 2YSBA 1BKFA 1K9TA 2ZQTA 1FKLA 1TCOC 4IPXA 4P8UA 1JNSA 3KADA 2PPPA 1NWSA 1YATA 1CTNA 1W26A 3UI6A 1C9HA 2JX8A 5J6EA 1UR9A 1ZL1A 3KABA 1Y0OA 5GQBA 4DWSD 2DJYA 1W1VA 2PPOA 4DZ2A 2FDMA 4E5RA 3ARZA 4MNKA 4L3NA 1TK7A 2B5UB 4Q22A 1FKHA 1FFRA 1BL4A 3AS3A 3WQWA 4TW8A 4TYOA 4WKHA 2OLHA 1HXVA 3VAWA 2DSWA 4DWSB 4JFIA 2RQSA 2RUCA 1JNEA 1FKTA 3KAFA 2PPNA 3ARPA 4U86A 3WH0A 4DRHA 3JYMA 1J4IA 3RMEA 3O5KA 4JFKA 1JMQA 4MSPA 2ZR6A 2P4VA 2DPEA 1E15A 4P8XA 4JFMA 3WD0A 3O5DA 3KAGA 2MDIA 4P8VA 4NNRA 5E5WA 2XPAA 2XP7A 3WD1A 5E66A 3CHEA 3O5MA 1E6ZA 2M8IA 1D7JA 1FKKA 1ZBVA 2KO7A 3O5GA 3O5OA 3AROA 3UQBA 1K9RA 1K9QA 1FKJA 5HBFA 1JNTA 4N19A 1D7IA 1FAPA 3NRKA 2DSUA 1Q6UA 2XPBA 1FKRA 3ALGA 2KI3A 4MNJA 4W5UA 3UF8A 2XP3A 3ARQA 1E6NA 3O5EA 2MLZA 1SR0A 3CGNA 3PR9A 5GPGA 3AS2A 2A3BA 2RE3A 2F23A 2WM0A 3CNGA 2WK2A 2YSHA 4TNSA 3WD4A 4DZ3A 1FKIA 5HKGA 3RM9A 2BA1A 2ZQUA 1ZBWA 2F4EA 1EYMA 3GTYX 3PQHA 4FN2A 2DG9A 3ARWA 4ZS6A 4Q7NA 3O5PA 2VN1A 1T11A 2K8IA 3MQHA 2O92A
chains in the Genus database with same CATH topology
2KGJA 3AQUA 4ODMA 5CQ2A 4WKAA 4LAXA 1RD6A 3BXWA 3CZ8A 2DK7A 5HWCA 3RFWA 4IQ2A 2ZQVA 3NTPA 5DIUA 4DRJA 3LKXA 5E62A 2YSGA 2M1IA 4URIA 3O5FA 2PBCA 4P8WA 3UQAA 4G50A 2A3AA 3B9EA 2KXQA 3O5JA 2DMVA 5DITA 1YW5A 1D2KA 1UR8A 2YBUA 3CH9A 3EY6A 2XP6A 1GPFA 1XHGA 2LGOA 4DIPA 3JXVA 1OGBA 4HARA 3KAIA 2G41A 1HKIA 2RURA 3IKDA 3ARUA 4Z2KA 1EG3A 1I5HW 4QZVB 3ARTA 1WAWA 2O9OA 2VCDA 3ARYA 1PBKA 2EZ5W 1L1PA 3JYJA 1ZCNA 3ARSA 1W9UA 3WD2A 1PINA 4DH0A 2FKEA 3IK8A 4ZPTR 3WL1A 4Z2GA 2DT2A 3LE4A 2KE0A 2AOSA 4ODLA 2UZ5A 2M2AA 4ODQA 5JH8A 5HT1A 2G8ZA 1ZB5A 4REXA 3FAPA 2WLZA 3WL0A 1D6OA 3W4RA 1FJDA 3QOKA 2DSZA 2DT3A 2YAJB 1WNOA 1ZBKA 3M7NA 4S3JA 2QRVA 4LAYA 1J4RA 1KT0A 2M3OW 1A7XA 3KZ7A 4DRKA 4R0XA 2YSFA 2ESCA 1NMVA 3PRDA 1ROTA 3FSBA 4ODNA 4MNLA 2MLXA 4MPKA 4GGQA 1H0GA 3ARRA 4WIWA 5DIVA 1J6YA 4KQZA 1LL4A 1R9HA 5I98A 3CHDA 1RP5A 1FKFA 2XP4A 4A0UA 1J4HA 4IT4A 2N87A 3ODKA 4WJXA 1Q6IA 1HJVA 4O2TA 1F40A 1QPFA 3O5RA 4W9PA 2IF4A 5E65A 4J4NA 3PRAA 5AHTA 4MAVA 3H9RB 4KR0B 5HW8A 4ODRA 3FSCA 2B31A 2MPHA 2DK1A 3PRBA 2Q5AA 4Z2IA 1NSGA 4TW7A 4ZPVR 2DG4A 1N1AA 4AY1A 4ITZA 1FFQA 1EIBA 3LUOA 1FD9A 2YBTA 5DO2A 1LL6A 3G6MA 4DRPA 1LG1A 3UQIA 1TR8A 5B8IC 4IT6A 2L2SA 5HTGA 3I6CA 3O5IA 4JFLA 4G2PA 4R5EA 3RM4A 2QF8A 3MCBA 3FY1A 3NI6A 2XP5A 2YSIA 2D9FA 4NZCA 2IUZA 3OA5A 4GIVA 3ARXA 1F8AB 1W9PA 2L4JA 4JYSA 1KT1A 1FKSA 1EDQA 2M8JA 4ODPA 1FKBA 2Y8NB 1SYTA 2JV4A 3UI5A 5DF0A 3PA7A 1NMWA 4Z2HA 2WADA 4DT4A 2A3EA 2LJ4A 4IQCA 1O6WA 4A0TA 4DRQA 2MF9A 3O5LA 2WAEA 4TW6A 2LPVA 1FKDA 2OFNA 2PV1A 1W9VA 5BXJA 5DEZA 4Z2JA 3ALFA 4JFJA 2F2DA 1LJYA 2ZQSA 3AS0A 2A3CA 1HKMA 2RUQA 1QZ2A 4DRNA 2XP8A 1ZK6A 2AWGA 5HWBA 2ZR4A 5GPRA 5D75A 2DWVA 2JXWA 3RM8A 1E9LA 4HBOA 4ODKA 1M5YA 2M08A 4BF8A 3AS1A 1WB0A 1ITXA 2KFWA 4GLXA 1FLCA 2RSEA 4TX0A 1NWUA 1W1PA 2MLYA 3M85A 2JMFA 1EQ3A 3KAHA 4QT2A 5HUAA 5HW7A 4QIBA 4ML4A 3KCEA 2E45A 3MQGA 4W9QA 2DSVA 2OWOA 2LAJA 2F21A 3TDBA 1GUVA 1LQ0A 3FXYA 1Q1CA 1HJXA 4LAVA 3MCBB 1TFVA 2PV2A 1HKKA 3LKXB 1E6PA 2DT0A 1JVWA 4Z2LA 5U47A 1XRVA 4NSBA 3B9DA 4U84A 1B6CA 1NWRA 3G6LA 4L72B 3CHCA 3B8SA 2DT1A 3IHZA 4C02B 2JZVA 4LGXA 2RUDA 3RGCA 1HKJA 1P5QA 4ZPWR 3CHFA 4DROA 3O5QA 1EG4A 4MTVA 2DG3A 4FAPA 3WIJA 1WR7A 4J4OA 4PTMA 1HJWA 1ZU8A 4DWSA 1WMVA 1OWQA 1O6IA 3B7XA 4DWSC 3WQVA 3L4HA 3OOBA 1QPLA 1LG2A 3B9AA 4ODOA 4HBEA 2FAPA 4QT3A 3KACA 1X6LA 1IX5A 1E6RA 1Q6HA 3UI4A 2Y78A 3MDYB 2ZR5A 4W9OA 4LAWA 3TC5A 4MNMA 5HW6A 4XAKA 1GOIA 1VF8A 4U85A 3GPKA 5E64A 1H0IA 1X6NA 3ARVA 3FS8A 2PI6A 1LL7A 2LKNA 1JNDA 2XP9A 2PV3A 2MNTA 2ITKA 3WD3A 1D7HA 1W1YA 1U79A 1W1TA 3CGMA 2KR7A 1NWTA 1ROUA 2ZAJA 2WLYA 1FKGA 1NH6A 4S3KA 4DRIA 3IKGA 3TCZA 4DRMA 1EHNA 1OGGA 4WKFA 1ZBCA 4WK9A 3WKZA 4MGVA 1KFWA 2YSBA 1BKFA 1K9TA 2ZQTA 1FKLA 1TCOC 4IPXA 4P8UA 1JNSA 3KADA 2PPPA 1NWSA 1YATA 1CTNA 1W26A 3UI6A 1C9HA 2JX8A 5J6EA 1UR9A 1ZL1A 3KABA 1Y0OA 5GQBA 4DWSD 2DJYA 1W1VA 2PPOA 4DZ2A 2FDMA 4E5RA 3ARZA 4MNKA 4L3NA 1TK7A 4Q22A 1FKHA 1FFRA 1BL4A 3AS3A 3WQWA 4TW8A 4TYOA 4WKHA 2OLHA 1HXVA 3VAWA 2DSWA 4DWSB 4JFIA 2RQSA 2RUCA 1JNEA 1FKTA 3KAFA 2PPNA 3ARPA 4U86A 3WH0A 4DRHA 3JYMA 1J4IA 3RMEA 3O5KA 4JFKA 1JMQA 4MSPA 2ZR6A 2DPEA 1E15A 4P8XA 4JFMA 3WD0A 3O5DA 3KAGA 2MDIA 4P8VA 4NNRA 5E5WA 2XPAA 2XP7A 3WD1A 5E66A 3CHEA 3O5MA 1E6ZA 2M8IA 1D7JA 1FKKA 1ZBVA 2KO7A 3O5GA 3O5OA 3AROA 3UQBA 1K9RA 1K9QA 1FKJA 5HBFA 1JNTA 4N19A 1D7IA 1FAPA 3NRKA 2DSUA 1Q6UA 2XPBA 1FKRA 3ALGA 2KI3A 4MNJA 4W5UA 3UF8A 2XP3A 3ARQA 1E6NA 3O5EA 2MLZA 1SR0A 3CGNA 3PR9A 5GPGA 3AS2A 2A3BA 2RE3A 2WM0A 3CNGA 2WK2A 2YSHA 4TNSA 3WD4A 4DZ3A 1FKIA 5HKGA 3RM9A 2BA1A 2ZQUA 1ZBWA 2F4EA 1EYMA 3PQHA 4FN2A 2DG9A 3ARWA 4ZS6A 4Q7NA 3O5PA 2VN1A 1T11A 2K8IA 3MQHA 2O92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGJ A;  4ODM A;  5CQ2 A;  4LAX A;  2DK7 A;  5HWC A;  3RFW A;  4IQ2 A;  2ZQV A;  3NTP A;  5DIU A;  4DRJ A;  2YSG A;  2M1I A;  3O5F A;  2PBC A;  3UQA A;  4G50 A;  2KXQ A;  3O5J A;  2DMV A;  5DIT A;  1YW5 A;  3EY6 A;  2XP6 A;  2LGO A;  4DIP A;  3JXV A;  3KAI A;  2RUR A;  3IKD A;  1EG3 A;  1I5H W;  2VCD A;  1PBK A;  2EZ5 W;  1L1P A;  3JYJ A;  1ZCN A;  1PIN A;  4DH0 A;  2FKE A;  3IK8 A;  3LE4 A;  2KE0 A;  4ODL A;  2UZ5 A;  2M2A A;  4ODQ A;  5HT1 A;  4REX A;  3FAP A;  1D6O A;  1FJD A;  3M7N A;  4LAY A;  1J4R A;  1KT0 A;  2M3O W;  1A7X A;  3KZ7 A;  4DRK A;  4R0X A;  2YSF A;  1NMV A;  3PRD A;  1ROT A;  4ODN A;  2MLX A;  4GGQ A;  5DIV A;  1J6Y A;  1R9H A;  5I98 A;  1FKF A;  2XP4 A;  1J4H A;  2N87 A;  3ODK A;  1Q6I A;  4O2T A;  1F40 A;  1QPF A;  3O5R A;  4W9P A;  2IF4 A;  4J4N A;  5AHT A;  3H9R B;  5HW8 A;  4ODR A;  2MPH A;  2DK1 A;  3PRB A;  2Q5A A;  1NSG A;  4TW7 A;  2DG4 A;  1N1A A;  4ITZ A;  3LUO A;  1FD9 A;  4DRP A;  3UQI A;  5B8I C;  2L2S A;  5HTG A;  3I6C A;  3O5I A;  4JFL A;  4G2P A;  3NI6 A;  2XP5 A;  2YSI A;  2D9F A;  4GIV A;  1F8A B;  2L4J A;  4JYS A;  1KT1 A;  1FKS A;  2M8J A;  4ODP A;  1FKB A;  2JV4 A;  3UI5 A;  3PA7 A;  1NMW A;  4DT4 A;  2LJ4 A;  4IQC A;  1O6W A;  4DRQ A;  2MF9 A;  3O5L A;  4TW6 A;  2LPV A;  1FKD A;  2OFN A;  2PV1 A;  5BXJ A;  4JFJ A;  2F2D A;  2ZQS A;  2RUQ A;  1QZ2 A;  4DRN A;  2XP8 A;  1ZK6 A;  2AWG A;  5HWB A;  2ZR4 A;  5D75 A;  2DWV A;  2JXW A;  4ODK A;  1M5Y A;  2M08 A;  4BF8 A;  2KFW A;  2RSE A;  4TX0 A;  2MLY A;  3M85 A;  2JMF A;  1EQ3 A;  3KAH A;  4QT2 A;  5HUA A;  5HW7 A;  4QIB A;  3KCE A;  2E45 A;  4W9Q A;  2LAJ A;  2F21 A;  3TDB A;  1Q1C A;  4LAV A;  2PV2 A;  1JVW A;  4U84 A;  1B6C A;  3IHZ A;  4C02 B;  2JZV A;  2RUD A;  1P5Q A;  4DRO A;  3O5Q A;  1EG4 A;  2DG3 A;  4FAP A;  1WR7 A;  4J4O A;  1WMV A;  3B7X A;  3L4H A;  3OOB A;  1QPL A;  4ODO A;  4QT3 A;  2FAP A;  3KAC A;  1Q6H A;  3UI4 A;  2Y78 A;  3MDY B;  2ZR5 A;  4W9O A;  4LAW A;  3TC5 A;  5HW6 A;  4U85 A;  3GPK A;  2LKN A;  2XP9 A;  2PV3 A;  2MNT A;  2ITK A;  1D7H A;  1U79 A;  3CGM A;  2KR7 A;  1ROU A;  2ZAJ A;  1FKG A;  4DRI A;  3IKG A;  3TCZ A;  4DRM A;  4MGV A;  2YSB A;  1BKF A;  2ZQT A;  1FKL A;  1TCO C;  4IPX A;  1JNS A;  3KAD A;  2PPP A;  1YAT A;  1W26 A;  3UI6 A;  1C9H A;  2JX8 A;  5J6E A;  3KAB A;  1Y0O A;  2DJY A;  2PPO A;  4DZ2 A;  4E5R A;  1TK7 A;  1FKH A;  1BL4 A;  4TW8 A;  4TYO A;  1HXV A;  3VAW A;  4JFI A;  2RQS A;  2RUC A;  1FKT A;  3KAF A;  2PPN A;  4U86 A;  3WH0 A;  4DRH A;  3JYM A;  1J4I A;  3O5K A;  4JFK A;  1JMQ A;  4MSP A;  2ZR6 A;  4JFM A;  3O5D A;  3KAG A;  2MDI A;  4NNR A;  2XPA A;  2XP7 A;  3O5M A;  2M8I A;  1D7J A;  1FKK A;  2KO7 A;  3O5G A;  3O5O A;  3UQB A;  1K9R A;  1K9Q A;  1FKJ A;  1JNT A;  4N19 A;  1D7I A;  1FAP A;  3NRK A;  1Q6U A;  2XPB A;  1FKR A;  2KI3 A;  3UF8 A;  2XP3 A;  3O5E A;  2MLZ A;  3CGN A;  5GPG A;  2RE3 A;  3CNG A;  2YSH A;  4TNS A;  4DZ3 A;  1FKI A;  5HKG A;  2BA1 A;  2ZQU A;  2F4E A;  1EYM A;  4FN2 A;  2DG9 A;  3O5P A;  2VN1 A;  1T11 A;  2K8I A;  3RGC A; 
#chains in the Genus database with same CATH topology
 2KGJ A;  3AQU A;  4ODM A;  5CQ2 A;  4WKA A;  4LAX A;  1RD6 A;  3BXW A;  3CZ8 A;  2DK7 A;  5HWC A;  3RFW A;  4IQ2 A;  2ZQV A;  3NTP A;  5DIU A;  4DRJ A;  3LKX A;  5E62 A;  2YSG A;  2M1I A;  4URI A;  3O5F A;  2PBC A;  4P8W A;  3UQA A;  4G50 A;  2A3A A;  3B9E A;  2KXQ A;  3O5J A;  2DMV A;  5DIT A;  1YW5 A;  1D2K A;  1UR8 A;  2YBU A;  3CH9 A;  3EY6 A;  2XP6 A;  1GPF A;  1XHG A;  2LGO A;  4DIP A;  3JXV A;  1OGB A;  4HAR A;  3KAI A;  2G41 A;  1HKI A;  2RUR A;  3IKD A;  3ARU A;  4Z2K A;  1EG3 A;  1I5H W;  4QZV B;  3ART A;  1WAW A;  2O9O A;  2VCD A;  3ARY A;  1PBK A;  2EZ5 W;  1L1P A;  3JYJ A;  1ZCN A;  3ARS A;  1W9U A;  3WD2 A;  1PIN A;  4DH0 A;  2FKE A;  3IK8 A;  4ZPT R;  3WL1 A;  4Z2G A;  2DT2 A;  3LE4 A;  2KE0 A;  2AOS A;  4ODL A;  2UZ5 A;  2M2A A;  4ODQ A;  2ETN A;  5JH8 A;  5HT1 A;  2G8Z A;  1ZB5 A;  4REX A;  3FAP A;  2WLZ A;  3WL0 A;  1D6O A;  3W4R A;  1FJD A;  3QOK A;  2DSZ A;  2DT3 A;  2YAJ B;  1WNO A;  1ZBK A;  3M7N A;  4S3J A;  2QRV A;  4LAY A;  1J4R A;  1KT0 A;  2M3O W;  1A7X A;  3KZ7 A;  4DRK A;  4R0X A;  2YSF A;  2ESC A;  1NMV A;  3PRD A;  1ROT A;  3FSB A;  4ODN A;  4MNL A;  2MLX A;  4MPK A;  4GGQ A;  1H0G A;  3ARR A;  4WIW A;  5DIV A;  1J6Y A;  4KQZ A;  1LL4 A;  1R9H A;  5I98 A;  3CHD A;  1RP5 A;  1FKF A;  2XP4 A;  4A0U A;  1J4H A;  4IT4 A;  2N87 A;  3ODK A;  4WJX A;  1Q6I A;  1HJV A;  4O2T A;  1F40 A;  1QPF A;  3O5R A;  4W9P A;  2IF4 A;  5E65 A;  4J4N A;  3PRA A;  5AHT A;  2EUL A;  4MAV A;  3H9R B;  4KR0 B;  5HW8 A;  4ODR A;  3FSC A;  2B31 A;  2MPH A;  2DK1 A;  3PRB A;  2Q5A A;  4Z2I A;  1NSG A;  4TW7 A;  4ZPV R;  2DG4 A;  1N1A A;  4AY1 A;  4ITZ A;  1FFQ A;  1EIB A;  3BMB A;  3LUO A;  1FD9 A;  2YBT A;  5DO2 A;  1LL6 A;  3G6M A;  4DRP A;  1LG1 A;  3UQI A;  1TR8 A;  5B8I C;  4IT6 A;  2L2S A;  5HTG A;  3I6C A;  3O5I A;  4JFL A;  4G2P A;  4R5E A;  3RM4 A;  2QF8 A;  3MCB A;  3FY1 A;  3NI6 A;  2XP5 A;  2PN0 A;  2YSI A;  2D9F A;  4NZC A;  2IUZ A;  3OA5 A;  4GIV A;  3ARX A;  1F8A B;  1W9P A;  2L4J A;  4JYS A;  1KT1 A;  3GU0 A;  1FKS A;  1EDQ A;  2M8J A;  4ODP A;  3EIP A;  1FKB A;  2Y8N B;  1SYT A;  2JV4 A;  3UI5 A;  5DF0 A;  3PA7 A;  1NMW A;  4Z2H A;  2WAD A;  4DT4 A;  2A3E A;  2LJ4 A;  4IQC A;  1O6W A;  4A0T A;  4DRQ A;  2MF9 A;  3O5L A;  2WAE A;  4TW6 A;  4UDM A;  2LPV A;  1FKD A;  2OFN A;  2PV1 A;  1W9V A;  5BXJ A;  5DEZ A;  4Z2J A;  3ALF A;  4JFJ A;  2F2D A;  1LJY A;  2ZQS A;  3AS0 A;  2A3C A;  1HKM A;  2RUQ A;  1QZ2 A;  4DRN A;  2XP8 A;  1ZK6 A;  2AWG A;  5HWB A;  2ZR4 A;  5GPR A;  5D75 A;  2DWV A;  2JXW A;  3RM8 A;  1E9L A;  4HBO A;  4ODK A;  1M5Y A;  2M08 A;  4BF8 A;  3AS1 A;  1WB0 A;  1ITX A;  2KFW A;  4GLX A;  1FLC A;  2RSE A;  4TX0 A;  1NWU A;  1W1P A;  2MLY A;  3M85 A;  2JMF A;  1EQ3 A;  3KAH A;  4QT2 A;  5HUA A;  5HW7 A;  4QIB A;  4ML4 A;  3KCE A;  2E45 A;  3MQG A;  4W9Q A;  2DSV A;  2OWO A;  2LAJ A;  2F21 A;  3TDB A;  1GUV A;  1LQ0 A;  3FXY A;  1Q1C A;  1HJX A;  4LAV A;  3MCB B;  1TFV A;  2PV2 A;  1HKK A;  3LKX B;  1E6P A;  2DT0 A;  1JVW A;  4Z2L A;  5U47 A;  1XRV A;  4NSB A;  3B9D A;  4U84 A;  1B6C A;  1NWR A;  3G6L A;  4L72 B;  3CHC A;  3B8S A;  2DT1 A;  3IHZ A;  4C02 B;  2JZV A;  4LGX A;  2RUD A;  1E44 A;  3RGC A;  1HKJ A;  1P5Q A;  4ZPW R;  3CHF A;  4DRO A;  3O5Q A;  1EG4 A;  4MTV A;  2DG3 A;  4FAP A;  3WIJ A;  1WR7 A;  4J4O A;  4PTM A;  1HJW A;  1ZU8 A;  4DWS A;  1WMV A;  1OWQ A;  1O6I A;  1JCH B;  3B7X A;  4DWS C;  3WQV A;  3L4H A;  3OOB A;  1QPL A;  1LG2 A;  3B9A A;  4ODO A;  4HBE A;  2FAP A;  4QT3 A;  3KAC A;  1X6L A;  1IX5 A;  1E6R A;  1Q6H A;  3UI4 A;  2Y78 A;  1GRJ A;  3MDY B;  2ZR5 A;  4W9O A;  4LAW A;  3TC5 A;  4MNM A;  5HW6 A;  4XAK A;  1GOI A;  1VF8 A;  4U85 A;  3GPK A;  5E64 A;  1H0I A;  1X6N A;  3ARV A;  3FS8 A;  2PI6 A;  1LL7 A;  2LKN A;  1JND A;  2XP9 A;  2PV3 A;  2MNT A;  2ITK A;  3WD3 A;  1D7H A;  1W1Y A;  1U79 A;  1W1T A;  3CGM A;  2KR7 A;  1NWT A;  1ROU A;  2ZAJ A;  2WLY A;  1FKG A;  1NH6 A;  4S3K A;  4DRI A;  3IKG A;  3TCZ A;  4DRM A;  1EHN A;  1OGG A;  4WKF A;  1ZBC A;  4WK9 A;  3WKZ A;  4MGV A;  1KFW A;  2YSB A;  1BKF A;  1K9T A;  2ZQT A;  1FKL A;  1TCO C;  4IPX A;  4P8U A;  1JNS A;  3KAD A;  2PPP A;  1NWS A;  1YAT A;  1CTN A;  1W26 A;  3UI6 A;  1C9H A;  2JX8 A;  5J6E A;  1UR9 A;  1ZL1 A;  3KAB A;  1Y0O A;  5GQB A;  4DWS D;  2DJY A;  1W1V A;  2PPO A;  4DZ2 A;  2FDM A;  4E5R A;  3ARZ A;  4MNK A;  4L3N A;  1TK7 A;  2B5U B;  4Q22 A;  1FKH A;  1FFR A;  1BL4 A;  3AS3 A;  3WQW A;  4TW8 A;  4TYO A;  4WKH A;  2OLH A;  1HXV A;  3VAW A;  2DSW A;  4DWS B;  4JFI A;  2RQS A;  2RUC A;  1JNE A;  1FKT A;  3KAF A;  2PPN A;  3ARP A;  4U86 A;  3WH0 A;  4DRH A;  3JYM A;  1J4I A;  3RME A;  3O5K A;  4JFK A;  1JMQ A;  4MSP A;  2ZR6 A;  2P4V A;  2DPE A;  1E15 A;  4P8X A;  4JFM A;  3WD0 A;  3O5D A;  3KAG A;  2MDI A;  4P8V A;  4NNR A;  5E5W A;  2XPA A;  2XP7 A;  3WD1 A;  5E66 A;  3CHE A;  3O5M A;  1E6Z A;  2M8I A;  1D7J A;  1FKK A;  1ZBV A;  2KO7 A;  3O5G A;  3O5O A;  3ARO A;  3UQB A;  1K9R A;  1K9Q A;  1FKJ A;  5HBF A;  1JNT A;  4N19 A;  1D7I A;  1FAP A;  3NRK A;  2DSU A;  1Q6U A;  2XPB A;  1FKR A;  3ALG A;  2KI3 A;  4MNJ A;  4W5U A;  3UF8 A;  2XP3 A;  3ARQ A;  1E6N A;  3O5E A;  2MLZ A;  1SR0 A;  3CGN A;  3PR9 A;  5GPG A;  3AS2 A;  2A3B A;  2RE3 A;  2F23 A;  2WM0 A;  3CNG A;  2WK2 A;  2YSH A;  4TNS A;  3WD4 A;  4DZ3 A;  1FKI A;  5HKG A;  3RM9 A;  2BA1 A;  2ZQU A;  1ZBW A;  2F4E A;  1EYM A;  3GTY X;  3PQH A;  4FN2 A;  2DG9 A;  3ARW A;  4ZS6 A;  4Q7N A;  3O5P A;  2VN1 A;  1T11 A;  2K8I A;  3MQH A;  2O92 A; 
#chains in the Genus database with same CATH homology
 2KGJ A;  3AQU A;  4ODM A;  5CQ2 A;  4WKA A;  4LAX A;  1RD6 A;  3BXW A;  3CZ8 A;  2DK7 A;  5HWC A;  3RFW A;  4IQ2 A;  2ZQV A;  3NTP A;  5DIU A;  4DRJ A;  3LKX A;  5E62 A;  2YSG A;  2M1I A;  4URI A;  3O5F A;  2PBC A;  4P8W A;  3UQA A;  4G50 A;  2A3A A;  3B9E A;  2KXQ A;  3O5J A;  2DMV A;  5DIT A;  1YW5 A;  1D2K A;  1UR8 A;  2YBU A;  3CH9 A;  3EY6 A;  2XP6 A;  1GPF A;  1XHG A;  2LGO A;  4DIP A;  3JXV A;  1OGB A;  4HAR A;  3KAI A;  2G41 A;  1HKI A;  2RUR A;  3IKD A;  3ARU A;  4Z2K A;  1EG3 A;  1I5H W;  4QZV B;  3ART A;  1WAW A;  2O9O A;  2VCD A;  3ARY A;  1PBK A;  2EZ5 W;  1L1P A;  3JYJ A;  1ZCN A;  3ARS A;  1W9U A;  3WD2 A;  1PIN A;  4DH0 A;  2FKE A;  3IK8 A;  4ZPT R;  3WL1 A;  4Z2G A;  2DT2 A;  3LE4 A;  2KE0 A;  2AOS A;  4ODL A;  2UZ5 A;  2M2A A;  4ODQ A;  5JH8 A;  5HT1 A;  2G8Z A;  1ZB5 A;  4REX A;  3FAP A;  2WLZ A;  3WL0 A;  1D6O A;  3W4R A;  1FJD A;  3QOK A;  2DSZ A;  2DT3 A;  2YAJ B;  1WNO A;  1ZBK A;  3M7N A;  4S3J A;  2QRV A;  4LAY A;  1J4R A;  1KT0 A;  2M3O W;  1A7X A;  3KZ7 A;  4DRK A;  4R0X A;  2YSF A;  2ESC A;  1NMV A;  3PRD A;  1ROT A;  3FSB A;  4ODN A;  4MNL A;  2MLX A;  4MPK A;  4GGQ A;  1H0G A;  3ARR A;  4WIW A;  5DIV A;  1J6Y A;  4KQZ A;  1LL4 A;  1R9H A;  5I98 A;  3CHD A;  1RP5 A;  1FKF A;  2XP4 A;  4A0U A;  1J4H A;  4IT4 A;  2N87 A;  3ODK A;  4WJX A;  1Q6I A;  1HJV A;  4O2T A;  1F40 A;  1QPF A;  3O5R A;  4W9P A;  2IF4 A;  5E65 A;  4J4N A;  3PRA A;  5AHT A;  4MAV A;  3H9R B;  4KR0 B;  5HW8 A;  4ODR A;  3FSC A;  2B31 A;  2MPH A;  2DK1 A;  3PRB A;  2Q5A A;  4Z2I A;  1NSG A;  4TW7 A;  4ZPV R;  2DG4 A;  1N1A A;  4AY1 A;  4ITZ A;  1FFQ A;  1EIB A;  3LUO A;  1FD9 A;  2YBT A;  5DO2 A;  1LL6 A;  3G6M A;  4DRP A;  1LG1 A;  3UQI A;  1TR8 A;  5B8I C;  4IT6 A;  2L2S A;  5HTG A;  3I6C A;  3O5I A;  4JFL A;  4G2P A;  4R5E A;  3RM4 A;  2QF8 A;  3MCB A;  3FY1 A;  3NI6 A;  2XP5 A;  2YSI A;  2D9F A;  4NZC A;  2IUZ A;  3OA5 A;  4GIV A;  3ARX A;  1F8A B;  1W9P A;  2L4J A;  4JYS A;  1KT1 A;  1FKS A;  1EDQ A;  2M8J A;  4ODP A;  1FKB A;  2Y8N B;  1SYT A;  2JV4 A;  3UI5 A;  5DF0 A;  3PA7 A;  1NMW A;  4Z2H A;  2WAD A;  4DT4 A;  2A3E A;  2LJ4 A;  4IQC A;  1O6W A;  4A0T A;  4DRQ A;  2MF9 A;  3O5L A;  2WAE A;  4TW6 A;  2LPV A;  1FKD A;  2OFN A;  2PV1 A;  1W9V A;  5BXJ A;  5DEZ A;  4Z2J A;  3ALF A;  4JFJ A;  2F2D A;  1LJY A;  2ZQS A;  3AS0 A;  2A3C A;  1HKM A;  2RUQ A;  1QZ2 A;  4DRN A;  2XP8 A;  1ZK6 A;  2AWG A;  5HWB A;  2ZR4 A;  5GPR A;  5D75 A;  2DWV A;  2JXW A;  3RM8 A;  1E9L A;  4HBO A;  4ODK A;  1M5Y A;  2M08 A;  4BF8 A;  3AS1 A;  1WB0 A;  1ITX A;  2KFW A;  4GLX A;  1FLC A;  2RSE A;  4TX0 A;  1NWU A;  1W1P A;  2MLY A;  3M85 A;  2JMF A;  1EQ3 A;  3KAH A;  4QT2 A;  5HUA A;  5HW7 A;  4QIB A;  4ML4 A;  3KCE A;  2E45 A;  3MQG A;  4W9Q A;  2DSV A;  2OWO A;  2LAJ A;  2F21 A;  3TDB A;  1GUV A;  1LQ0 A;  3FXY A;  1Q1C A;  1HJX A;  4LAV A;  3MCB B;  1TFV A;  2PV2 A;  1HKK A;  3LKX B;  1E6P A;  2DT0 A;  1JVW A;  4Z2L A;  5U47 A;  1XRV A;  4NSB A;  3B9D A;  4U84 A;  1B6C A;  1NWR A;  3G6L A;  4L72 B;  3CHC A;  3B8S A;  2DT1 A;  3IHZ A;  4C02 B;  2JZV A;  4LGX A;  2RUD A;  3RGC A;  1HKJ A;  1P5Q A;  4ZPW R;  3CHF A;  4DRO A;  3O5Q A;  1EG4 A;  4MTV A;  2DG3 A;  4FAP A;  3WIJ A;  1WR7 A;  4J4O A;  4PTM A;  1HJW A;  1ZU8 A;  4DWS A;  1WMV A;  1OWQ A;  1O6I A;  3B7X A;  4DWS C;  3WQV A;  3L4H A;  3OOB A;  1QPL A;  1LG2 A;  3B9A A;  4ODO A;  4HBE A;  2FAP A;  4QT3 A;  3KAC A;  1X6L A;  1IX5 A;  1E6R A;  1Q6H A;  3UI4 A;  2Y78 A;  3MDY B;  2ZR5 A;  4W9O A;  4LAW A;  3TC5 A;  4MNM A;  5HW6 A;  4XAK A;  1GOI A;  1VF8 A;  4U85 A;  3GPK A;  5E64 A;  1H0I A;  1X6N A;  3ARV A;  3FS8 A;  2PI6 A;  1LL7 A;  2LKN A;  1JND A;  2XP9 A;  2PV3 A;  2MNT A;  2ITK A;  3WD3 A;  1D7H A;  1W1Y A;  1U79 A;  1W1T A;  3CGM A;  2KR7 A;  1NWT A;  1ROU A;  2ZAJ A;  2WLY A;  1FKG A;  1NH6 A;  4S3K A;  4DRI A;  3IKG A;  3TCZ A;  4DRM A;  1EHN A;  1OGG A;  4WKF A;  1ZBC A;  4WK9 A;  3WKZ A;  4MGV A;  1KFW A;  2YSB A;  1BKF A;  1K9T A;  2ZQT A;  1FKL A;  1TCO C;  4IPX A;  4P8U A;  1JNS A;  3KAD A;  2PPP A;  1NWS A;  1YAT A;  1CTN A;  1W26 A;  3UI6 A;  1C9H A;  2JX8 A;  5J6E A;  1UR9 A;  1ZL1 A;  3KAB A;  1Y0O A;  5GQB A;  4DWS D;  2DJY A;  1W1V A;  2PPO A;  4DZ2 A;  2FDM A;  4E5R A;  3ARZ A;  4MNK A;  4L3N A;  1TK7 A;  4Q22 A;  1FKH A;  1FFR A;  1BL4 A;  3AS3 A;  3WQW A;  4TW8 A;  4TYO A;  4WKH A;  2OLH A;  1HXV A;  3VAW A;  2DSW A;  4DWS B;  4JFI A;  2RQS A;  2RUC A;  1JNE A;  1FKT A;  3KAF A;  2PPN A;  3ARP A;  4U86 A;  3WH0 A;  4DRH A;  3JYM A;  1J4I A;  3RME A;  3O5K A;  4JFK A;  1JMQ A;  4MSP A;  2ZR6 A;  2DPE A;  1E15 A;  4P8X A;  4JFM A;  3WD0 A;  3O5D A;  3KAG A;  2MDI A;  4P8V A;  4NNR A;  5E5W A;  2XPA A;  2XP7 A;  3WD1 A;  5E66 A;  3CHE A;  3O5M A;  1E6Z A;  2M8I A;  1D7J A;  1FKK A;  1ZBV A;  2KO7 A;  3O5G A;  3O5O A;  3ARO A;  3UQB A;  1K9R A;  1K9Q A;  1FKJ A;  5HBF A;  1JNT A;  4N19 A;  1D7I A;  1FAP A;  3NRK A;  2DSU A;  1Q6U A;  2XPB A;  1FKR A;  3ALG A;  2KI3 A;  4MNJ A;  4W5U A;  3UF8 A;  2XP3 A;  3ARQ A;  1E6N A;  3O5E A;  2MLZ A;  1SR0 A;  3CGN A;  3PR9 A;  5GPG A;  3AS2 A;  2A3B A;  2RE3 A;  2WM0 A;  3CNG A;  2WK2 A;  2YSH A;  4TNS A;  3WD4 A;  4DZ3 A;  1FKI A;  5HKG A;  3RM9 A;  2BA1 A;  2ZQU A;  1ZBW A;  2F4E A;  1EYM A;  3PQH A;  4FN2 A;  2DG9 A;  3ARW A;  4ZS6 A;  4Q7N A;  3O5P A;  2VN1 A;  1T11 A;  2K8I A;  3MQH A;  2O92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...