3KABA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kabA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kabA02
3UQBA 1K9QA 1PBKA 2M2AA 1EQ3A 4U85A 2LAJA 3IHZA 3KZ7A 5HT1A 3M85A 2EZ5W 2M8IA 2Q5AA 3VAWA 3NTPA 1M5YA 4JFJA 1FJDA 1BL4A 1Q6HA 3PRDA 4ODPA 3TCZA 4DRHA 4ODMA 1FKSA 1FKHA 2JV4A 1FKIA 3CGMA 2YSFA 3L4HA 3KADA 2BA1A 3KABA 4JFLA 2F2DA 4DZ3A 2M1IA 3M7NA 4E5RA 2XP7A 3O5FA 1R9HA 3O5JA 4DRKA 4ODNA 2RUDA 2XP6A 3JYMA 3O5QA 2KFWA 3O5IA 3IKGA 1D7JA 1ROTA 4DH0A 5CQ2A 4G50A 1L1PA 2ZR5A 3UI6A 3RGCA 3CNGA 3TC5A 3O5GA 5HTGA 5HKGA 1A7XA 1F8AB 1FKLA 2RE3A 1WR7A 1QPFA 2FKEA 5DIVA 2Y78A 3KACA 4TYOA 2N87A 3LE4A 2YSHA 3O5EA 3IK8A 1J4HA 4G2PA 3LUOA 4LAYA 4TW8A 4MGVA 2PBCA 2KI3A 2ZQTA 2ZAJA 2DG9A 2XP9A 1YATA 2AWGA 2KGJA 1FKKA 2DG3A 1FKTA 4JYSA 4R0XA 5DIUA 1FKRA 1PINA 1U79A 1D7HA 1JNSA 3NRKA 3O5RA 1ZK6A 4DRMA 1QZ2A 4DRJA 2MLYA 1FAPA 4C02B 5HW6A 3B7XA 1TCOC 4ODRA 3KAIA 1FKGA 1Q1CA 3O5DA 1EYMA 3KAGA 4LAWA 1JNTA 2VN1A 1FD9A 3JYJA 1HXVA 3KCEA 2PPOA 4DRQA 4TW6A 5HWCA 3O5KA 4TNSA 3O5OA 3UQAA 3UF8A 5B8IC 2RURA 2ZQSA 1ROUA 4W9QA 1O6WA 2ITKA 2RUCA 1K9RA 5DITA 3JXVA 3O5MA 3TDBA 4J4NA 2DJYA 1P5QA 3WH0A 2MDIA 2PV3A 4TX0A 4ODQA 2ZR6A 1D7IA 4IQ2A 2K8IA 3RFWA 4IPXA 2XP3A 4QT2A 4TW7A 5AHTA 1T11A 2PV1A 3EY6A 1BKFA 4DRIA 2XPAA 1EG4A 4JFKA 2MNTA 5I98A 3FAPA 1J6YA 2KO7A 4GIVA 2KR7A 2MLXA 1FKBA 4NNRA 4O2TA 1QPLA 5D75A 1JMQA 5BXJA 5GPGA 4LAVA 3PA7A 1Y0OA 4ODKA 2KXQA 4DZ2A 3KAHA 2ZQVA 2MLZA 3UI4A 2YSIA 5HW8A 3I6CA 2IF4A 2RSEA 1JVWA 1WMVA 2XP4A 4MSPA 2L4JA 2D9FA 3ODKA 1NSGA 2LGOA 3MDYB 5HUAA 4DIPA 4DROA 3H9RB 3OOBA 4GGQA 4U86A 1J4RA 2PPNA 4W9PA 1NMWA 2JZVA 4ODLA 1ZCNA 2KE0A 2VCDA 3CGNA 2M8JA 2XP8A 1KT1A 2M3OW 1J4IA 3PRBA 1I5HW 1Q6UA 3NI6A 4BF8A 4J4OA 4DRPA 2JMFA 2PPPA 2YSBA 5J6EA 2F4EA 2MPHA 3UQIA 2JXWA 2FAPA 2E45A 2DMVA 1N1AA 3UI5A 2ZQUA 4QT3A 2XP5A 5HWBA 4U84A 3IKDA 1FKFA 3O5LA 4JFIA 2ZR4A 1F40A 4FN2A 2MF9A 4ITZA 4QIBA 1EG3A 3KAFA 1FKDA 2L2SA 4DRNA 5HW7A 1NMVA 1C9HA 2M08A 2JX8A 2DG4A 1YW5A 3O5PA 4W9OA 1B6CA 1D6OA 2RQSA 2OFNA 2XPBA 1TK7A 1FKJA 4N19A 2F21A 2PV2A 2YSGA 4LAXA 4FAPA 2DWVA 4IQCA 3GPKA 4ODOA 1KT0A 2RUQA 2LKNA 4REXA 2LJ4A 2DK1A 4DT4A 2UZ5A 1Q6IA 2LPVA 2DK7A 4JFMA 1W26A
chains in the Genus database with same CATH superfamily
4MNKA 3UQBA 3B9DA 1K9QA 1LG2A 1OWQA 2WAEA 1D2KA 1PBKA 2M2AA 1E9LA 4HARA 1EQ3A 4U85A 2LAJA 3FSCA 3IHZA 2OLHA 3KZ7A 5HT1A 3MCBA 1HKIA 1E6RA 3M85A 2EZ5W 2M8IA 1HJVA 2Q5AA 4IT4A 1W1PA 2DSZA 3NTPA 1M5YA 3VAWA 1E15A 4JFJA 1H0IA 1FJDA 1BL4A 1Q6HA 3PRDA 1SR0A 4ODPA 3TCZA 1NWSA 2ETNA 3AQUA 4DRHA 4ODMA 3AS0A 1GUVA 1FKSA 1HKMA 1FKHA 2JV4A 1FKIA 4WKHA 2EULA 5U47A 4MNMA 3CGMA 4Q22A 2YSFA 4DWSA 1ITXA 3L4HA 3KADA 2BA1A 3KABA 3WL1A 4JFLA 4P8WA 2F2DA 3ARPA 2WM0A 4DZ3A 3AS1A 2M1IA 3M7NA 1X6LA 4ZPVR 4E5RA 2XP7A 3O5FA 2P4VA 1R9HA 4ZPWR 1RP5A 1NWRA 3O5JA 4DRKA 4ODNA 2RUDA 2XP6A 3RM4A 3JYMA 3O5QA 1GPFA 2KFWA 3O5IA 2IUZA 2DT1A 3ARUA 2DSVA 3IKGA 1D7JA 4AY1A 1ROTA 4DH0A 5CQ2A 4G50A 1L1PA 2ZR5A 3UI6A 3RGCA 3CNGA 3TC5A 2DSUA 4KR0B 1FFRA 2DPEA 3O5GA 5HTGA 5HKGA 3QOKA 1A7XA 1F8AB 1FKLA 2RE3A 1WR7A 1LG1A 1QPFA 2FKEA 1NWTA 5DIVA 2Y78A 4QZVB 3ARYA 3KACA 2A3EA 2F23A 4TYOA 2DT3A 5E64A 5E62A 2N87A 4DWSD 3LE4A 1ZBVA 2DSWA 2YSHA 4HBEA 3O5EA 2DT0A 3IK8A 1J4HA 4NZCA 1EHNA 4G2PA 2WK2A 3LUOA 4LAYA 4TW8A 4MGVA 3ARWA 2PBCA 4DWSC 1IX5A 3LKXB 4L72B 2KI3A 2ZQTA 3AROA 3ALFA 1ZB5A 2ZAJA 3CHEA 2DG9A 3WD2A 1ZU8A 2XP9A 2OWOA 2WADA 4WK9A 1HKKA 2FDMA 1FFQA 1CTNA 1YATA 4Z2JA 2AWGA 3G6LA 1WAWA 2KGJA 1FKKA 2DG3A 3GTYX 1LL4A 2O92A 1FKTA 4JYSA 4R0XA 2B31A 5DIUA 2A3CA 1FKRA 1PINA 1U79A 1D7HA 3B9AA 1JNSA 1X6NA 3NRKA 3O5RA 1ZK6A 4DRMA 3CHFA 1QZ2A 2QRVA 1GOIA 4W5UA 4DRJA 1W1VA 2MLYA 1FAPA 4C02B 4MPKA 5HW6A 3B7XA 1TCOC 4P8VA 4ODRA 2WLYA 3KAIA 1FKGA 4Z2IA 1Q1CA 3O5DA 1EYMA 3KAGA 2PI6A 4LAWA 1SYTA 1JNTA 1RD6A 2VN1A 1FD9A 3JYJA 1HXVA 3KCEA 3MQGA 2PPOA 4DRQA 3RM9A 4TW6A 5HWCA 3O5KA 4TNSA 1E44A 1LL6A 3O5OA 3UQAA 3UF8A 5B8IC 3FXYA 3WD1A 1H0GA 2RURA 2ZQSA 3ARTA 1ROUA 4W9QA 1O6WA 2ITKA 2RUCA 1K9RA 5DITA 3JXVA 3O5MA 3TDBA 4J4NA 3MCBB 2DJYA 1P5QA 3WH0A 4WKFA 4WIWA 2MDIA 2PV3A 4TX0A 2DT2A 1EDQA 5E5WA 3WQVA 4ODQA 2ZR6A 1FLCA 1E6ZA 1D7IA 4IQ2A 2K8IA 3RFWA 2A3AA 2XP3A 4IPXA 4QT2A 3AS2A 4TW7A 5AHTA 3WD3A 4URIA 4DWSB 1T11A 2PV1A 3EY6A 1HJWA 1BKFA 4DRIA 3CH9A 2XPAA 1EG4A 3ARXA 4JFKA 4KQZA 1TR8A 2QF8A 4HBOA 4R5EA 2MNTA 1OGGA 5DEZA 5I98A 3FAPA 1J6YA 2KO7A 4GIVA 2KR7A 4A0TA 2MLXA 2O9OA 1FKBA 4NNRA 4O2TA 1QPLA 3GU0A 2B5UB 5D75A 1JMQA 5BXJA 4LGXA 5GPGA 4LAVA 4S3KA 3PA7A 4Z2HA 5GPRA 3W4RA 1Y0OA 1NWUA 1ZL1A 2ESCA 4XAKA 4ODKA 2KXQA 1XRVA 1K9TA 4DZ2A 3KAHA 4WKAA 2ZQVA 2MLZA 1ZBCA 3UI4A 2YSIA 5HW8A 3I6CA 1W1TA 2Y8NB 1JNDA 2IF4A 2RSEA 5JH8A 2G41A 1E6NA 1JVWA 1WMVA 5E66A 4P8UA 2XP4A 3FS8A 4MSPA 2L4JA 2D9FA 3WD4A 3ODKA 1NSGA 2LGOA 3MDYB 5HUAA 1LL7A 4DIPA 4ML4A 4DROA 3H9RB 1W9VA 3OOBA 1E6PA 4GGQA 2PN0A 4L3NA 3BMBA 4U86A 4ZS6A 4PTMA 3WIJA 1J4RA 1NH6A 2PPNA 4W9PA 3ARQA 1ZBKA 3ARZA 4Q7NA 1NMWA 3B9EA 2JZVA 3EIPA 4ODLA 1ZCNA 3ARRA 3FY1A 2YBUA 2KE0A 1W9UA 1JCHB 2VCDA 4Z2LA 3CGNA 2M8JA 2XP8A 1KT1A 2M3OW 1J4IA 3PRBA 1I5HW 1Q6UA 3NI6A 4BF8A 4J4OA 2YBTA 1HKJA 3RMEA 4DRPA 2JMFA 3WKZA 2PPPA 2YSBA 5J6EA 2F4EA 2MPHA 3UQIA 2JXWA 5DO2A 4IT6A 2FAPA 2E45A 1LJYA 2DMVA 1N1AA 3MQHA 1O6IA 3UI5A 2ZQUA 2YAJB 4QT3A 1ZBWA 2XP5A 5HWBA 4U84A 3IKDA 1FKFA 3O5LA 1W1YA 4WJXA 4JFIA 2ZR4A 4ZPTR 1OGBA 3WQWA 1F40A 4FN2A 3ALGA 1UR9A 2MF9A 3ARVA 4ITZA 4QIBA 1EG3A 3KAFA 1FKDA 4GLXA 4UDMA 4Z2GA 2L2SA 4DRNA 5HW7A 1NMVA 5E65A 1C9HA 3CZ8A 1GRJA 3OA5A 3CHCA 2AOSA 1TFVA 3LKXA 4Z2KA 2M08A 1WB0A 3ARSA 2JX8A 2DG4A 1YW5A 3O5PA 4W9OA 4MTVA 1B6CA 3PQHA 3CHDA 1D6OA 1W9PA 2RQSA 3PR9A 2OFNA 3PRAA 1VF8A 2XPBA 1TK7A 1WNOA 4A0UA 1FKJA 1JNEA 4N19A 1EIBA 3WD0A 2F21A 2PV2A 2YSGA 4LAXA 3FSBA 4NSBA 4MNLA 1UR8A 5DF0A 3BXWA 5GQBA 5HBFA 1XHGA 1HJXA 3WL0A 4FAPA 2DWVA 3G6MA 4IQCA 3GPKA 4ODOA 1KT0A 2RUQA 4MAVA 3AS3A 2WLZA 2A3BA 2LKNA 4REXA 2LJ4A 2DK1A 4DT4A 3RM8A 4MNJA 2G8ZA 3B8SA 2UZ5A 1Q6IA 2LPVA 2DK7A 1LQ0A 4P8XA 4JFMA 1W26A 4S3JA 1KFWA
chains in the Genus database with same CATH topology
4MNKA 3UQBA 3B9DA 1K9QA 1LG2A 1OWQA 2WAEA 1D2KA 1PBKA 2M2AA 1E9LA 4HARA 1EQ3A 4U85A 2LAJA 3FSCA 3IHZA 2OLHA 3KZ7A 5HT1A 3MCBA 1HKIA 1E6RA 3M85A 2EZ5W 2M8IA 1HJVA 2Q5AA 4IT4A 1W1PA 2DSZA 3NTPA 1M5YA 3VAWA 1E15A 4JFJA 1H0IA 1FJDA 1BL4A 1Q6HA 3PRDA 1SR0A 4ODPA 3TCZA 1NWSA 3AQUA 4DRHA 4ODMA 3AS0A 1GUVA 1FKSA 1HKMA 1FKHA 2JV4A 1FKIA 4WKHA 5U47A 4MNMA 3CGMA 4Q22A 2YSFA 4DWSA 1ITXA 3L4HA 3KADA 2BA1A 3KABA 3WL1A 4JFLA 4P8WA 2F2DA 3ARPA 2WM0A 4DZ3A 3AS1A 2M1IA 3M7NA 1X6LA 4ZPVR 4E5RA 2XP7A 3O5FA 1R9HA 4ZPWR 1RP5A 1NWRA 3O5JA 4DRKA 4ODNA 2RUDA 2XP6A 3RM4A 3JYMA 3O5QA 1GPFA 2KFWA 3O5IA 2IUZA 2DT1A 3ARUA 2DSVA 3IKGA 1D7JA 4AY1A 1ROTA 4DH0A 5CQ2A 4G50A 1L1PA 2ZR5A 3UI6A 3RGCA 3CNGA 3TC5A 2DSUA 4KR0B 1FFRA 2DPEA 3O5GA 5HTGA 5HKGA 3QOKA 1A7XA 1F8AB 1FKLA 2RE3A 1WR7A 1LG1A 1QPFA 2FKEA 1NWTA 5DIVA 2Y78A 4QZVB 3ARYA 3KACA 2A3EA 4TYOA 2DT3A 5E64A 5E62A 2N87A 4DWSD 3LE4A 1ZBVA 2DSWA 2YSHA 4HBEA 3O5EA 2DT0A 3IK8A 1J4HA 4NZCA 1EHNA 4G2PA 2WK2A 3LUOA 4LAYA 4TW8A 4MGVA 3ARWA 2PBCA 4DWSC 1IX5A 3LKXB 4L72B 2KI3A 2ZQTA 3AROA 3ALFA 1ZB5A 2ZAJA 3CHEA 2DG9A 3WD2A 1ZU8A 2XP9A 2OWOA 2WADA 4WK9A 1HKKA 2FDMA 1FFQA 1CTNA 1YATA 4Z2JA 2AWGA 3G6LA 1WAWA 2KGJA 1FKKA 2DG3A 1LL4A 2O92A 1FKTA 4JYSA 4R0XA 2B31A 5DIUA 2A3CA 1FKRA 1PINA 1U79A 1D7HA 3B9AA 1JNSA 1X6NA 3NRKA 3O5RA 1ZK6A 4DRMA 3CHFA 1QZ2A 2QRVA 1GOIA 4W5UA 4DRJA 1W1VA 2MLYA 1FAPA 4C02B 4MPKA 5HW6A 3B7XA 1TCOC 4P8VA 4ODRA 2WLYA 3KAIA 1FKGA 4Z2IA 1Q1CA 3O5DA 1EYMA 3KAGA 2PI6A 4LAWA 1SYTA 1JNTA 1RD6A 2VN1A 1FD9A 3JYJA 1HXVA 3KCEA 3MQGA 2PPOA 4DRQA 3RM9A 4TW6A 5HWCA 3O5KA 4TNSA 1LL6A 3O5OA 3UQAA 3UF8A 5B8IC 3FXYA 3WD1A 1H0GA 2RURA 2ZQSA 3ARTA 1ROUA 4W9QA 1O6WA 2ITKA 2RUCA 1K9RA 5DITA 3JXVA 3O5MA 3TDBA 4J4NA 3MCBB 2DJYA 1P5QA 3WH0A 4WKFA 4WIWA 2MDIA 2PV3A 4TX0A 2DT2A 1EDQA 5E5WA 3WQVA 4ODQA 2ZR6A 1FLCA 1E6ZA 1D7IA 4IQ2A 2K8IA 3RFWA 2A3AA 2XP3A 4IPXA 4QT2A 3AS2A 4TW7A 5AHTA 3WD3A 4URIA 4DWSB 1T11A 2PV1A 3EY6A 1HJWA 1BKFA 4DRIA 3CH9A 2XPAA 1EG4A 3ARXA 4JFKA 4KQZA 1TR8A 2QF8A 4HBOA 4R5EA 2MNTA 1OGGA 5DEZA 5I98A 3FAPA 1J6YA 2KO7A 4GIVA 2KR7A 4A0TA 2MLXA 2O9OA 1FKBA 4NNRA 4O2TA 1QPLA 5D75A 1JMQA 5BXJA 4LGXA 5GPGA 4LAVA 4S3KA 3PA7A 4Z2HA 5GPRA 3W4RA 1Y0OA 1NWUA 1ZL1A 2ESCA 4XAKA 4ODKA 2KXQA 1XRVA 1K9TA 4DZ2A 3KAHA 4WKAA 2ZQVA 2MLZA 1ZBCA 3UI4A 2YSIA 5HW8A 3I6CA 1W1TA 2Y8NB 1JNDA 2IF4A 2RSEA 5JH8A 2G41A 1E6NA 1JVWA 1WMVA 5E66A 4P8UA 2XP4A 3FS8A 4MSPA 2L4JA 2D9FA 3WD4A 3ODKA 1NSGA 2LGOA 3MDYB 5HUAA 1LL7A 4DIPA 4ML4A 4DROA 3H9RB 1W9VA 3OOBA 1E6PA 4GGQA 4L3NA 4U86A 4ZS6A 4PTMA 3WIJA 1J4RA 1NH6A 2PPNA 4W9PA 3ARQA 1ZBKA 3ARZA 4Q7NA 1NMWA 3B9EA 2JZVA 4ODLA 1ZCNA 3ARRA 3FY1A 2YBUA 2KE0A 1W9UA 2VCDA 4Z2LA 3CGNA 2M8JA 2XP8A 1KT1A 2M3OW 1J4IA 3PRBA 1I5HW 1Q6UA 3NI6A 4BF8A 4J4OA 2YBTA 1HKJA 3RMEA 4DRPA 2JMFA 3WKZA 2PPPA 2YSBA 5J6EA 2F4EA 2MPHA 3UQIA 2JXWA 5DO2A 4IT6A 2FAPA 2E45A 1LJYA 2DMVA 1N1AA 3MQHA 1O6IA 3UI5A 2ZQUA 2YAJB 4QT3A 1ZBWA 2XP5A 5HWBA 4U84A 3IKDA 1FKFA 3O5LA 1W1YA 4WJXA 4JFIA 2ZR4A 4ZPTR 1OGBA 3WQWA 1F40A 4FN2A 3ALGA 1UR9A 2MF9A 3ARVA 4ITZA 4QIBA 1EG3A 3KAFA 1FKDA 4GLXA 4Z2GA 2L2SA 4DRNA 5HW7A 1NMVA 5E65A 1C9HA 3CZ8A 3OA5A 3CHCA 2AOSA 1TFVA 3LKXA 4Z2KA 2M08A 1WB0A 3ARSA 2JX8A 2DG4A 1YW5A 3O5PA 4W9OA 4MTVA 1B6CA 3PQHA 3CHDA 1D6OA 1W9PA 2RQSA 3PR9A 2OFNA 3PRAA 1VF8A 2XPBA 1TK7A 1WNOA 4A0UA 1FKJA 1JNEA 4N19A 1EIBA 3WD0A 2F21A 2PV2A 2YSGA 4LAXA 3FSBA 4NSBA 4MNLA 1UR8A 5DF0A 3BXWA 5GQBA 5HBFA 1XHGA 1HJXA 3WL0A 4FAPA 2DWVA 3G6MA 4IQCA 3GPKA 4ODOA 1KT0A 2RUQA 4MAVA 3AS3A 2WLZA 2A3BA 2LKNA 4REXA 2LJ4A 2DK1A 4DT4A 3RM8A 4MNJA 2G8ZA 3B8SA 2UZ5A 1Q6IA 2LPVA 2DK7A 1LQ0A 4P8XA 4JFMA 1W26A 4S3JA 1KFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQB A;  1K9Q A;  1PBK A;  2M2A A;  1EQ3 A;  4U85 A;  2LAJ A;  3IHZ A;  3KZ7 A;  5HT1 A;  3M85 A;  2EZ5 W;  2M8I A;  2Q5A A;  3VAW A;  3NTP A;  1M5Y A;  4JFJ A;  1FJD A;  1BL4 A;  1Q6H A;  3PRD A;  4ODP A;  3TCZ A;  4DRH A;  4ODM A;  1FKS A;  1FKH A;  2JV4 A;  1FKI A;  3CGM A;  2YSF A;  3L4H A;  3KAD A;  2BA1 A;  3KAB A;  4JFL A;  2F2D A;  4DZ3 A;  2M1I A;  3M7N A;  4E5R A;  2XP7 A;  3O5F A;  1R9H A;  3O5J A;  4DRK A;  4ODN A;  2RUD A;  2XP6 A;  3JYM A;  3O5Q A;  2KFW A;  3O5I A;  3IKG A;  1D7J A;  1ROT A;  4DH0 A;  5CQ2 A;  4G50 A;  1L1P A;  2ZR5 A;  3UI6 A;  3RGC A;  3CNG A;  3TC5 A;  3O5G A;  5HTG A;  5HKG A;  1A7X A;  1F8A B;  1FKL A;  2RE3 A;  1WR7 A;  1QPF A;  2FKE A;  5DIV A;  2Y78 A;  3KAC A;  4TYO A;  2N87 A;  3LE4 A;  2YSH A;  3O5E A;  3IK8 A;  1J4H A;  4G2P A;  3LUO A;  4LAY A;  4TW8 A;  4MGV A;  2PBC A;  2KI3 A;  2ZQT A;  2ZAJ A;  2DG9 A;  2XP9 A;  1YAT A;  2AWG A;  2KGJ A;  1FKK A;  2DG3 A;  1FKT A;  4JYS A;  4R0X A;  5DIU A;  1FKR A;  1PIN A;  1U79 A;  1D7H A;  1JNS A;  3NRK A;  3O5R A;  1ZK6 A;  4DRM A;  1QZ2 A;  4DRJ A;  2MLY A;  1FAP A;  4C02 B;  5HW6 A;  3B7X A;  1TCO C;  4ODR A;  3KAI A;  1FKG A;  1Q1C A;  3O5D A;  1EYM A;  3KAG A;  4LAW A;  1JNT A;  2VN1 A;  1FD9 A;  3JYJ A;  1HXV A;  3KCE A;  2PPO A;  4DRQ A;  4TW6 A;  5HWC A;  3O5K A;  4TNS A;  3O5O A;  3UQA A;  3UF8 A;  5B8I C;  2RUR A;  2ZQS A;  1ROU A;  4W9Q A;  1O6W A;  2ITK A;  2RUC A;  1K9R A;  5DIT A;  3JXV A;  3O5M A;  3TDB A;  4J4N A;  2DJY A;  1P5Q A;  3WH0 A;  2MDI A;  2PV3 A;  4TX0 A;  4ODQ A;  2ZR6 A;  1D7I A;  4IQ2 A;  2K8I A;  3RFW A;  4IPX A;  2XP3 A;  4QT2 A;  4TW7 A;  5AHT A;  1T11 A;  2PV1 A;  3EY6 A;  1BKF A;  4DRI A;  2XPA A;  1EG4 A;  4JFK A;  2MNT A;  5I98 A;  3FAP A;  1J6Y A;  2KO7 A;  4GIV A;  2KR7 A;  2MLX A;  1FKB A;  4NNR A;  4O2T A;  1QPL A;  5D75 A;  1JMQ A;  5BXJ A;  5GPG A;  4LAV A;  3PA7 A;  1Y0O A;  4ODK A;  2KXQ A;  4DZ2 A;  3KAH A;  2ZQV A;  2MLZ A;  3UI4 A;  2YSI A;  5HW8 A;  3I6C A;  2IF4 A;  2RSE A;  1JVW A;  1WMV A;  2XP4 A;  4MSP A;  2L4J A;  2D9F A;  3ODK A;  1NSG A;  2LGO A;  3MDY B;  5HUA A;  4DIP A;  4DRO A;  3H9R B;  3OOB A;  4GGQ A;  4U86 A;  1J4R A;  2PPN A;  4W9P A;  1NMW A;  2JZV A;  4ODL A;  1ZCN A;  2KE0 A;  2VCD A;  3CGN A;  2M8J A;  2XP8 A;  1KT1 A;  2M3O W;  1J4I A;  3PRB A;  1I5H W;  1Q6U A;  3NI6 A;  4BF8 A;  4J4O A;  4DRP A;  2JMF A;  2PPP A;  2YSB A;  5J6E A;  2F4E A;  2MPH A;  3UQI A;  2JXW A;  2FAP A;  2E45 A;  2DMV A;  1N1A A;  3UI5 A;  2ZQU A;  4QT3 A;  2XP5 A;  5HWB A;  4U84 A;  3IKD A;  1FKF A;  3O5L A;  4JFI A;  2ZR4 A;  1F40 A;  4FN2 A;  2MF9 A;  4ITZ A;  4QIB A;  1EG3 A;  3KAF A;  1FKD A;  2L2S A;  4DRN A;  5HW7 A;  1NMV A;  1C9H A;  2M08 A;  2JX8 A;  2DG4 A;  1YW5 A;  3O5P A;  4W9O A;  1B6C A;  1D6O A;  2RQS A;  2OFN A;  2XPB A;  1TK7 A;  1FKJ A;  4N19 A;  2F21 A;  2PV2 A;  2YSG A;  4LAX A;  4FAP A;  2DWV A;  4IQC A;  3GPK A;  4ODO A;  1KT0 A;  2RUQ A;  2LKN A;  4REX A;  2LJ4 A;  2DK1 A;  4DT4 A;  2UZ5 A;  1Q6I A;  2LPV A;  2DK7 A;  4JFM A;  1W26 A; 
#chains in the Genus database with same CATH topology
 4MNK A;  3UQB A;  3B9D A;  1K9Q A;  1LG2 A;  1OWQ A;  2WAE A;  1D2K A;  1PBK A;  2M2A A;  1E9L A;  4HAR A;  1EQ3 A;  4U85 A;  2LAJ A;  3FSC A;  3IHZ A;  2OLH A;  3KZ7 A;  5HT1 A;  3MCB A;  1HKI A;  1E6R A;  3M85 A;  2EZ5 W;  2M8I A;  1HJV A;  2Q5A A;  4IT4 A;  1W1P A;  2DSZ A;  3NTP A;  1M5Y A;  3VAW A;  1E15 A;  4JFJ A;  1H0I A;  1FJD A;  1BL4 A;  1Q6H A;  3PRD A;  1SR0 A;  4ODP A;  3TCZ A;  1NWS A;  2ETN A;  3AQU A;  4DRH A;  4ODM A;  3AS0 A;  1GUV A;  1FKS A;  1HKM A;  1FKH A;  2JV4 A;  1FKI A;  4WKH A;  2EUL A;  5U47 A;  4MNM A;  3CGM A;  4Q22 A;  2YSF A;  4DWS A;  1ITX A;  3L4H A;  3KAD A;  2BA1 A;  3KAB A;  3WL1 A;  4JFL A;  4P8W A;  2F2D A;  3ARP A;  2WM0 A;  4DZ3 A;  3AS1 A;  2M1I A;  3M7N A;  1X6L A;  4ZPV R;  4E5R A;  2XP7 A;  3O5F A;  2P4V A;  1R9H A;  4ZPW R;  1RP5 A;  1NWR A;  3O5J A;  4DRK A;  4ODN A;  2RUD A;  2XP6 A;  3RM4 A;  3JYM A;  3O5Q A;  1GPF A;  2KFW A;  3O5I A;  2IUZ A;  2DT1 A;  3ARU A;  2DSV A;  3IKG A;  1D7J A;  4AY1 A;  1ROT A;  4DH0 A;  5CQ2 A;  4G50 A;  1L1P A;  2ZR5 A;  3UI6 A;  3RGC A;  3CNG A;  3TC5 A;  2DSU A;  4KR0 B;  1FFR A;  2DPE A;  3O5G A;  5HTG A;  5HKG A;  3QOK A;  1A7X A;  1F8A B;  1FKL A;  2RE3 A;  1WR7 A;  1LG1 A;  1QPF A;  2FKE A;  1NWT A;  5DIV A;  2Y78 A;  4QZV B;  3ARY A;  3KAC A;  2A3E A;  2F23 A;  4TYO A;  2DT3 A;  5E64 A;  5E62 A;  2N87 A;  4DWS D;  3LE4 A;  1ZBV A;  2DSW A;  2YSH A;  4HBE A;  3O5E A;  2DT0 A;  3IK8 A;  1J4H A;  4NZC A;  1EHN A;  4G2P A;  2WK2 A;  3LUO A;  4LAY A;  4TW8 A;  4MGV A;  3ARW A;  2PBC A;  4DWS C;  1IX5 A;  3LKX B;  4L72 B;  2KI3 A;  2ZQT A;  3ARO A;  3ALF A;  1ZB5 A;  2ZAJ A;  3CHE A;  2DG9 A;  3WD2 A;  1ZU8 A;  2XP9 A;  2OWO A;  2WAD A;  4WK9 A;  1HKK A;  2FDM A;  1FFQ A;  1CTN A;  1YAT A;  4Z2J A;  2AWG A;  3G6L A;  1WAW A;  2KGJ A;  1FKK A;  2DG3 A;  3GTY X;  1LL4 A;  2O92 A;  1FKT A;  4JYS A;  4R0X A;  2B31 A;  5DIU A;  2A3C A;  1FKR A;  1PIN A;  1U79 A;  1D7H A;  3B9A A;  1JNS A;  1X6N A;  3NRK A;  3O5R A;  1ZK6 A;  4DRM A;  3CHF A;  1QZ2 A;  2QRV A;  1GOI A;  4W5U A;  4DRJ A;  1W1V A;  2MLY A;  1FAP A;  4C02 B;  4MPK A;  5HW6 A;  3B7X A;  1TCO C;  4P8V A;  4ODR A;  2WLY A;  3KAI A;  1FKG A;  4Z2I A;  1Q1C A;  3O5D A;  1EYM A;  3KAG A;  2PI6 A;  4LAW A;  1SYT A;  1JNT A;  1RD6 A;  2VN1 A;  1FD9 A;  3JYJ A;  1HXV A;  3KCE A;  3MQG A;  2PPO A;  4DRQ A;  3RM9 A;  4TW6 A;  5HWC A;  3O5K A;  4TNS A;  1E44 A;  1LL6 A;  3O5O A;  3UQA A;  3UF8 A;  5B8I C;  3FXY A;  3WD1 A;  1H0G A;  2RUR A;  2ZQS A;  3ART A;  1ROU A;  4W9Q A;  1O6W A;  2ITK A;  2RUC A;  1K9R A;  5DIT A;  3JXV A;  3O5M A;  3TDB A;  4J4N A;  3MCB B;  2DJY A;  1P5Q A;  3WH0 A;  4WKF A;  4WIW A;  2MDI A;  2PV3 A;  4TX0 A;  2DT2 A;  1EDQ A;  5E5W A;  3WQV A;  4ODQ A;  2ZR6 A;  1FLC A;  1E6Z A;  1D7I A;  4IQ2 A;  2K8I A;  3RFW A;  2A3A A;  2XP3 A;  4IPX A;  4QT2 A;  3AS2 A;  4TW7 A;  5AHT A;  3WD3 A;  4URI A;  4DWS B;  1T11 A;  2PV1 A;  3EY6 A;  1HJW A;  1BKF A;  4DRI A;  3CH9 A;  2XPA A;  1EG4 A;  3ARX A;  4JFK A;  4KQZ A;  1TR8 A;  2QF8 A;  4HBO A;  4R5E A;  2MNT A;  1OGG A;  5DEZ A;  5I98 A;  3FAP A;  1J6Y A;  2KO7 A;  4GIV A;  2KR7 A;  4A0T A;  2MLX A;  2O9O A;  1FKB A;  4NNR A;  4O2T A;  1QPL A;  3GU0 A;  2B5U B;  5D75 A;  1JMQ A;  5BXJ A;  4LGX A;  5GPG A;  4LAV A;  4S3K A;  3PA7 A;  4Z2H A;  5GPR A;  3W4R A;  1Y0O A;  1NWU A;  1ZL1 A;  2ESC A;  4XAK A;  4ODK A;  2KXQ A;  1XRV A;  1K9T A;  4DZ2 A;  3KAH A;  4WKA A;  2ZQV A;  2MLZ A;  1ZBC A;  3UI4 A;  2YSI A;  5HW8 A;  3I6C A;  1W1T A;  2Y8N B;  1JND A;  2IF4 A;  2RSE A;  5JH8 A;  2G41 A;  1E6N A;  1JVW A;  1WMV A;  5E66 A;  4P8U A;  2XP4 A;  3FS8 A;  4MSP A;  2L4J A;  2D9F A;  3WD4 A;  3ODK A;  1NSG A;  2LGO A;  3MDY B;  5HUA A;  1LL7 A;  4DIP A;  4ML4 A;  4DRO A;  3H9R B;  1W9V A;  3OOB A;  1E6P A;  4GGQ A;  2PN0 A;  4L3N A;  3BMB A;  4U86 A;  4ZS6 A;  4PTM A;  3WIJ A;  1J4R A;  1NH6 A;  2PPN A;  4W9P A;  3ARQ A;  1ZBK A;  3ARZ A;  4Q7N A;  1NMW A;  3B9E A;  2JZV A;  3EIP A;  4ODL A;  1ZCN A;  3ARR A;  3FY1 A;  2YBU A;  2KE0 A;  1W9U A;  1JCH B;  2VCD A;  4Z2L A;  3CGN A;  2M8J A;  2XP8 A;  1KT1 A;  2M3O W;  1J4I A;  3PRB A;  1I5H W;  1Q6U A;  3NI6 A;  4BF8 A;  4J4O A;  2YBT A;  1HKJ A;  3RME A;  4DRP A;  2JMF A;  3WKZ A;  2PPP A;  2YSB A;  5J6E A;  2F4E A;  2MPH A;  3UQI A;  2JXW A;  5DO2 A;  4IT6 A;  2FAP A;  2E45 A;  1LJY A;  2DMV A;  1N1A A;  3MQH A;  1O6I A;  3UI5 A;  2ZQU A;  2YAJ B;  4QT3 A;  1ZBW A;  2XP5 A;  5HWB A;  4U84 A;  3IKD A;  1FKF A;  3O5L A;  1W1Y A;  4WJX A;  4JFI A;  2ZR4 A;  4ZPT R;  1OGB A;  3WQW A;  1F40 A;  4FN2 A;  3ALG A;  1UR9 A;  2MF9 A;  3ARV A;  4ITZ A;  4QIB A;  1EG3 A;  3KAF A;  1FKD A;  4GLX A;  4UDM A;  4Z2G A;  2L2S A;  4DRN A;  5HW7 A;  1NMV A;  5E65 A;  1C9H A;  3CZ8 A;  1GRJ A;  3OA5 A;  3CHC A;  2AOS A;  1TFV A;  3LKX A;  4Z2K A;  2M08 A;  1WB0 A;  3ARS A;  2JX8 A;  2DG4 A;  1YW5 A;  3O5P A;  4W9O A;  4MTV A;  1B6C A;  3PQH A;  3CHD A;  1D6O A;  1W9P A;  2RQS A;  3PR9 A;  2OFN A;  3PRA A;  1VF8 A;  2XPB A;  1TK7 A;  1WNO A;  4A0U A;  1FKJ A;  1JNE A;  4N19 A;  1EIB A;  3WD0 A;  2F21 A;  2PV2 A;  2YSG A;  4LAX A;  3FSB A;  4NSB A;  4MNL A;  1UR8 A;  5DF0 A;  3BXW A;  5GQB A;  5HBF A;  1XHG A;  1HJX A;  3WL0 A;  4FAP A;  2DWV A;  3G6M A;  4IQC A;  3GPK A;  4ODO A;  1KT0 A;  2RUQ A;  4MAV A;  3AS3 A;  2WLZ A;  2A3B A;  2LKN A;  4REX A;  2LJ4 A;  2DK1 A;  4DT4 A;  3RM8 A;  4MNJ A;  2G8Z A;  3B8S A;  2UZ5 A;  1Q6I A;  2LPV A;  2DK7 A;  1LQ0 A;  4P8X A;  4JFM A;  1W26 A;  4S3J A;  1KFW A; 
#chains in the Genus database with same CATH homology
 4MNK A;  3UQB A;  3B9D A;  1K9Q A;  1LG2 A;  1OWQ A;  2WAE A;  1D2K A;  1PBK A;  2M2A A;  1E9L A;  4HAR A;  1EQ3 A;  4U85 A;  2LAJ A;  3FSC A;  3IHZ A;  2OLH A;  3KZ7 A;  5HT1 A;  3MCB A;  1HKI A;  1E6R A;  3M85 A;  2EZ5 W;  2M8I A;  1HJV A;  2Q5A A;  4IT4 A;  1W1P A;  2DSZ A;  3NTP A;  1M5Y A;  3VAW A;  1E15 A;  4JFJ A;  1H0I A;  1FJD A;  1BL4 A;  1Q6H A;  3PRD A;  1SR0 A;  4ODP A;  3TCZ A;  1NWS A;  3AQU A;  4DRH A;  4ODM A;  3AS0 A;  1GUV A;  1FKS A;  1HKM A;  1FKH A;  2JV4 A;  1FKI A;  4WKH A;  5U47 A;  4MNM A;  3CGM A;  4Q22 A;  2YSF A;  4DWS A;  1ITX A;  3L4H A;  3KAD A;  2BA1 A;  3KAB A;  3WL1 A;  4JFL A;  4P8W A;  2F2D A;  3ARP A;  2WM0 A;  4DZ3 A;  3AS1 A;  2M1I A;  3M7N A;  1X6L A;  4ZPV R;  4E5R A;  2XP7 A;  3O5F A;  1R9H A;  4ZPW R;  1RP5 A;  1NWR A;  3O5J A;  4DRK A;  4ODN A;  2RUD A;  2XP6 A;  3RM4 A;  3JYM A;  3O5Q A;  1GPF A;  2KFW A;  3O5I A;  2IUZ A;  2DT1 A;  3ARU A;  2DSV A;  3IKG A;  1D7J A;  4AY1 A;  1ROT A;  4DH0 A;  5CQ2 A;  4G50 A;  1L1P A;  2ZR5 A;  3UI6 A;  3RGC A;  3CNG A;  3TC5 A;  2DSU A;  4KR0 B;  1FFR A;  2DPE A;  3O5G A;  5HTG A;  5HKG A;  3QOK A;  1A7X A;  1F8A B;  1FKL A;  2RE3 A;  1WR7 A;  1LG1 A;  1QPF A;  2FKE A;  1NWT A;  5DIV A;  2Y78 A;  4QZV B;  3ARY A;  3KAC A;  2A3E A;  4TYO A;  2DT3 A;  5E64 A;  5E62 A;  2N87 A;  4DWS D;  3LE4 A;  1ZBV A;  2DSW A;  2YSH A;  4HBE A;  3O5E A;  2DT0 A;  3IK8 A;  1J4H A;  4NZC A;  1EHN A;  4G2P A;  2WK2 A;  3LUO A;  4LAY A;  4TW8 A;  4MGV A;  3ARW A;  2PBC A;  4DWS C;  1IX5 A;  3LKX B;  4L72 B;  2KI3 A;  2ZQT A;  3ARO A;  3ALF A;  1ZB5 A;  2ZAJ A;  3CHE A;  2DG9 A;  3WD2 A;  1ZU8 A;  2XP9 A;  2OWO A;  2WAD A;  4WK9 A;  1HKK A;  2FDM A;  1FFQ A;  1CTN A;  1YAT A;  4Z2J A;  2AWG A;  3G6L A;  1WAW A;  2KGJ A;  1FKK A;  2DG3 A;  1LL4 A;  2O92 A;  1FKT A;  4JYS A;  4R0X A;  2B31 A;  5DIU A;  2A3C A;  1FKR A;  1PIN A;  1U79 A;  1D7H A;  3B9A A;  1JNS A;  1X6N A;  3NRK A;  3O5R A;  1ZK6 A;  4DRM A;  3CHF A;  1QZ2 A;  2QRV A;  1GOI A;  4W5U A;  4DRJ A;  1W1V A;  2MLY A;  1FAP A;  4C02 B;  4MPK A;  5HW6 A;  3B7X A;  1TCO C;  4P8V A;  4ODR A;  2WLY A;  3KAI A;  1FKG A;  4Z2I A;  1Q1C A;  3O5D A;  1EYM A;  3KAG A;  2PI6 A;  4LAW A;  1SYT A;  1JNT A;  1RD6 A;  2VN1 A;  1FD9 A;  3JYJ A;  1HXV A;  3KCE A;  3MQG A;  2PPO A;  4DRQ A;  3RM9 A;  4TW6 A;  5HWC A;  3O5K A;  4TNS A;  1LL6 A;  3O5O A;  3UQA A;  3UF8 A;  5B8I C;  3FXY A;  3WD1 A;  1H0G A;  2RUR A;  2ZQS A;  3ART A;  1ROU A;  4W9Q A;  1O6W A;  2ITK A;  2RUC A;  1K9R A;  5DIT A;  3JXV A;  3O5M A;  3TDB A;  4J4N A;  3MCB B;  2DJY A;  1P5Q A;  3WH0 A;  4WKF A;  4WIW A;  2MDI A;  2PV3 A;  4TX0 A;  2DT2 A;  1EDQ A;  5E5W A;  3WQV A;  4ODQ A;  2ZR6 A;  1FLC A;  1E6Z A;  1D7I A;  4IQ2 A;  2K8I A;  3RFW A;  2A3A A;  2XP3 A;  4IPX A;  4QT2 A;  3AS2 A;  4TW7 A;  5AHT A;  3WD3 A;  4URI A;  4DWS B;  1T11 A;  2PV1 A;  3EY6 A;  1HJW A;  1BKF A;  4DRI A;  3CH9 A;  2XPA A;  1EG4 A;  3ARX A;  4JFK A;  4KQZ A;  1TR8 A;  2QF8 A;  4HBO A;  4R5E A;  2MNT A;  1OGG A;  5DEZ A;  5I98 A;  3FAP A;  1J6Y A;  2KO7 A;  4GIV A;  2KR7 A;  4A0T A;  2MLX A;  2O9O A;  1FKB A;  4NNR A;  4O2T A;  1QPL A;  5D75 A;  1JMQ A;  5BXJ A;  4LGX A;  5GPG A;  4LAV A;  4S3K A;  3PA7 A;  4Z2H A;  5GPR A;  3W4R A;  1Y0O A;  1NWU A;  1ZL1 A;  2ESC A;  4XAK A;  4ODK A;  2KXQ A;  1XRV A;  1K9T A;  4DZ2 A;  3KAH A;  4WKA A;  2ZQV A;  2MLZ A;  1ZBC A;  3UI4 A;  2YSI A;  5HW8 A;  3I6C A;  1W1T A;  2Y8N B;  1JND A;  2IF4 A;  2RSE A;  5JH8 A;  2G41 A;  1E6N A;  1JVW A;  1WMV A;  5E66 A;  4P8U A;  2XP4 A;  3FS8 A;  4MSP A;  2L4J A;  2D9F A;  3WD4 A;  3ODK A;  1NSG A;  2LGO A;  3MDY B;  5HUA A;  1LL7 A;  4DIP A;  4ML4 A;  4DRO A;  3H9R B;  1W9V A;  3OOB A;  1E6P A;  4GGQ A;  4L3N A;  4U86 A;  4ZS6 A;  4PTM A;  3WIJ A;  1J4R A;  1NH6 A;  2PPN A;  4W9P A;  3ARQ A;  1ZBK A;  3ARZ A;  4Q7N A;  1NMW A;  3B9E A;  2JZV A;  4ODL A;  1ZCN A;  3ARR A;  3FY1 A;  2YBU A;  2KE0 A;  1W9U A;  2VCD A;  4Z2L A;  3CGN A;  2M8J A;  2XP8 A;  1KT1 A;  2M3O W;  1J4I A;  3PRB A;  1I5H W;  1Q6U A;  3NI6 A;  4BF8 A;  4J4O A;  2YBT A;  1HKJ A;  3RME A;  4DRP A;  2JMF A;  3WKZ A;  2PPP A;  2YSB A;  5J6E A;  2F4E A;  2MPH A;  3UQI A;  2JXW A;  5DO2 A;  4IT6 A;  2FAP A;  2E45 A;  1LJY A;  2DMV A;  1N1A A;  3MQH A;  1O6I A;  3UI5 A;  2ZQU A;  2YAJ B;  4QT3 A;  1ZBW A;  2XP5 A;  5HWB A;  4U84 A;  3IKD A;  1FKF A;  3O5L A;  1W1Y A;  4WJX A;  4JFI A;  2ZR4 A;  4ZPT R;  1OGB A;  3WQW A;  1F40 A;  4FN2 A;  3ALG A;  1UR9 A;  2MF9 A;  3ARV A;  4ITZ A;  4QIB A;  1EG3 A;  3KAF A;  1FKD A;  4GLX A;  4Z2G A;  2L2S A;  4DRN A;  5HW7 A;  1NMV A;  5E65 A;  1C9H A;  3CZ8 A;  3OA5 A;  3CHC A;  2AOS A;  1TFV A;  3LKX A;  4Z2K A;  2M08 A;  1WB0 A;  3ARS A;  2JX8 A;  2DG4 A;  1YW5 A;  3O5P A;  4W9O A;  4MTV A;  1B6C A;  3PQH A;  3CHD A;  1D6O A;  1W9P A;  2RQS A;  3PR9 A;  2OFN A;  3PRA A;  1VF8 A;  2XPB A;  1TK7 A;  1WNO A;  4A0U A;  1FKJ A;  1JNE A;  4N19 A;  1EIB A;  3WD0 A;  2F21 A;  2PV2 A;  2YSG A;  4LAX A;  3FSB A;  4NSB A;  4MNL A;  1UR8 A;  5DF0 A;  3BXW A;  5GQB A;  5HBF A;  1XHG A;  1HJX A;  3WL0 A;  4FAP A;  2DWV A;  3G6M A;  4IQC A;  3GPK A;  4ODO A;  1KT0 A;  2RUQ A;  4MAV A;  3AS3 A;  2WLZ A;  2A3B A;  2LKN A;  4REX A;  2LJ4 A;  2DK1 A;  4DT4 A;  3RM8 A;  4MNJ A;  2G8Z A;  3B8S A;  2UZ5 A;  1Q6I A;  2LPV A;  2DK7 A;  1LQ0 A;  4P8X A;  4JFM A;  1W26 A;  4S3J A;  1KFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...