3KADA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMAKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 44
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kadA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kadA02
3LE4A 4DZ3A 4JFMA 2ZR5A 2M2AA 4ODPA 2LPVA 4R0XA 1BL4A 5HWCA 2D9FA 1YATA 1Y0OA 4ODOA 1FJDA 5HT1A 2RURA 2PV3A 4BF8A 2XP3A 4U84A 3O5KA 2MDIA 2KR7A 4JYSA 4LAYA 2ZQSA 2Q5AA 2M8IA 3CGMA 1FKDA 3UQBA 2KFWA 2N87A 1D6OA 3O5QA 2XP8A 1JVWA 3M85A 5DITA 3NI6A 3O5RA 4N19A 3KAGA 2JMFA 3O5FA 3OOBA 3KAHA 4G2PA 3O5OA 2PV1A 3O5GA 2XP6A 5I98A 4C02B 2XP5A 2XPBA 4MSPA 4TW8A 4G50A 1FKFA 2RQSA 3GPKA 2E45A 4J4NA 1FKHA 1J6YA 5CQ2A 2RUDA 2M1IA 4DROA 5J6EA 4J4OA 2PPOA 1FKJA 5HWBA 2EZ5W 2MLYA 2BA1A 4LAWA 5AHTA 2ITKA 3KCEA 1FAPA 4ODQA 3UI6A 2DG9A 4W9PA 1WMVA 2DJYA 2OFNA 1HXVA 2JV4A 1JMQA 2ZAJA 1EG4A 3O5DA 2YSGA 2XP4A 3PA7A 2VCDA 2RUCA 4TW7A 2LGOA 2YSIA 3TCZA 1U79A 1FKGA 1Q6HA 3O5MA 1FD9A 3KAFA 2ZQUA 3O5EA 2ZR6A 4DZ2A 2XP7A 2MPHA 2DMVA 4QIBA 1Q1CA 5B8IC 2RE3A 1ROUA 5HW8A 5DIUA 5HUAA 2PV2A 1K9RA 2ZQTA 1EQ3A 1I5HW 2F21A 4REXA 1EYMA 1FKKA 4TX0A 1KT1A 1A7XA 3CGNA 1J4RA 4W9QA 5BXJA 3IHZA 4JFLA 3UQIA 2IF4A 1B6CA 4DT4A 4TW6A 2DK1A 2DK7A 1D7JA 1PINA 2RUQA 4DRIA 2L4JA 3CNGA 4LAVA 3ODKA 3L4HA 4MGVA 2JX8A 1YW5A 2LAJA 1FKRA 1R9HA 2MNTA 2K8IA 1ZCNA 2F4EA 3UI4A 3VAWA 3PRBA 2DG3A 4ODLA 4ODKA 4E5RA 4GIVA 4DIPA 2PPPA 2ZR4A 3I6CA 3PRDA 2FKEA 2JZVA 1QZ2A 2M08A 5HW7A 3IK8A 2YSFA 4NNRA 1NMWA 1F40A 4U86A 2MLZA 4U85A 2LKNA 3RFWA 1N1AA 4DRPA 4DH0A 4O2TA 2YSBA 5DIVA 1L1PA 2KI3A 1WR7A 1FKBA 2L2SA 2KXQA 1Q6UA 3B7XA 3M7NA 4JFIA 1EG3A 5HKGA 1JNSA 3UQAA 4ODMA 3IKGA 1FKLA 1NSGA 1QPLA 3KZ7A 2LJ4A 4DRKA 4ITZA 3FAPA 4DRMA 4IQCA 2DWVA 4W9OA 3UI5A 1FKIA 3JYMA 1Q6IA 5HTGA 3H9RB 3KACA 2F2DA 3EY6A 3O5IA 4TNSA 2KE0A 2RSEA 4ODRA 5GPGA 2YSHA 4IQ2A 2ZQVA 1JNTA 5D75A 1M5YA 1C9HA 3UF8A 1F8AB 4JFKA 4GGQA 1TCOC 1K9QA 2FAPA 2KGJA 2AWGA 1TK7A 1D7HA 4DRQA 5HW6A 4DRJA 2MF9A 3KABA 2PPNA 4TYOA 2M8JA 1QPFA 4DRNA 2M3OW 3NRKA 1KT0A 1ZK6A 4FN2A 3NTPA 3JXVA 4QT3A 1FKSA 1ROTA 3TDBA 3KADA 4IPXA 1P5QA 4LAXA 1BKFA 2KO7A 2JXWA 1FKTA 1O6WA 1NMVA 2UZ5A 2MLXA 2VN1A 2XPAA 3MDYB 2Y78A 2DG4A 3O5JA 2PBCA 1J4HA 3O5LA 4ODNA 1W26A 3LUOA 4DRHA 2XP9A 1J4IA 3RGCA 1D7IA 3WH0A 3JYJA 3IKDA 3KAIA 1T11A 4FAPA 1PBKA 4JFJA 4QT2A 3O5PA 3TC5A
chains in the Genus database with same CATH superfamily
4PTMA 3LKXA 3LE4A 4DZ3A 3RM9A 3RMEA 4JFMA 2DT1A 4LGXA 2PI6A 2ZR5A 2M2AA 4ZPVR 4IT4A 4ODPA 2LPVA 1EDQA 4R0XA 1BL4A 5HWCA 2D9FA 2EULA 1D2KA 1YATA 3ARVA 4MNKA 3FY1A 1Y0OA 4W5UA 4ODOA 1FJDA 5HT1A 3BXWA 2RURA 2PV3A 2WK2A 1JNDA 3WL0A 4L3NA 4BF8A 4Z2HA 2XP3A 4U84A 3O5KA 4WKAA 5GPRA 4MTVA 4Z2IA 1ZBKA 2MDIA 2KR7A 4JYSA 4LAYA 2ZQSA 4URIA 2Q5AA 1GUVA 3CHCA 2M8IA 3CGMA 1FKDA 3UQBA 5DO2A 2KFWA 1RP5A 2N87A 3WD4A 1D6OA 5DEZA 3O5QA 2XP8A 1JVWA 1XRVA 3LKXB 4ZPTR 2OLHA 3M85A 5DITA 3ARUA 1LL7A 3AS2A 3NI6A 5E66A 3O5RA 4L72B 4N19A 2YAJB 1WNOA 3KAGA 2JMFA 3O5FA 3OOBA 3FS8A 1NWSA 3KAHA 4HBEA 4HARA 3WL1A 4G2PA 3O5OA 2PV1A 2YBTA 1HKKA 3O5GA 2O92A 2XP6A 1E15A 4ZPWR 5I98A 4C02B 4DWSB 2XP5A 2XPBA 4MSPA 1W9PA 4TW8A 4S3JA 1H0IA 1FKFA 2RQSA 4G50A 1OGGA 3GPKA 4MNLA 2E45A 4UDMA 4J4NA 1TR8A 1JNEA 4P8XA 3ARSA 1FKHA 4MPKA 1J6YA 1FFRA 5CQ2A 2RUDA 1LJYA 3BMBA 2M1IA 4DROA 5J6EA 3CHEA 3CHDA 4J4OA 2PPOA 1FKJA 3B9AA 3WD3A 1XHGA 5HWBA 2EZ5W 1GPFA 2MLYA 2BA1A 1HJVA 4LAWA 5AHTA 2ITKA 3KCEA 1FAPA 4ODQA 3UI6A 1NWUA 1HKMA 2DG9A 4W9PA 1X6NA 1WMVA 3WQVA 2DJYA 2OFNA 1HXVA 1LQ0A 2JV4A 3ALGA 1JMQA 2ZAJA 1EG4A 3O5DA 2YSGA 2XP4A 3ARYA 3PA7A 2VCDA 1ZB5A 2RUCA 3CZ8A 4TW7A 2LGOA 2YSIA 1X6LA 3TCZA 1ZBVA 1U79A 1FKGA 1E6PA 1Q6HA 3O5MA 1FD9A 2YBUA 3ALFA 3B9DA 4QZVB 3KAFA 2ZQUA 1GRJA 1ZBCA 3O5EA 2ZR6A 4DZ2A 3AROA 1E6ZA 2XP7A 4MNJA 3ARZA 2MPHA 2DMVA 4QIBA 1Q1CA 3AS3A 1HKIA 5B8IC 2RE3A 1ROUA 5HW8A 5DIUA 5HUAA 1WB0A 2PV2A 1EHNA 3ARRA 1HJWA 1K9RA 2WLYA 2ZQTA 1KFWA 1EQ3A 1I5HW 2F21A 3PRAA 4REXA 1EYMA 1FKKA 4TX0A 1SR0A 1ZL1A 3MQHA 1NWRA 1KT1A 1HJXA 1UR8A 4ZS6A 1A7XA 1NH6A 3CGNA 2P4VA 3RM4A 4DWSC 4NZCA 2DSUA 1J4RA 4W9QA 5BXJA 2A3BA 3IHZA 4JFLA 3UQIA 2IF4A 1B6CA 4DT4A 4TW6A 2DK1A 2DK7A 2PN0A 4Z2KA 1W1PA 1D7JA 1UR9A 1PINA 2RUQA 5DF0A 1W1YA 4DRIA 4Z2LA 2L4JA 3MQGA 3CNGA 4LAVA 3ODKA 4A0TA 3L4HA 4MGVA 4P8UA 2DPEA 3WIJA 2JX8A 1YW5A 5E5WA 2LAJA 1FKRA 1R9HA 2MNTA 1VF8A 2K8IA 1ZCNA 2DSVA 1SYTA 2F4EA 5E64A 2DT0A 3GTYX 3UI4A 3VAWA 3PRBA 2DG3A 2B5UB 4ODLA 4ODKA 4E5RA 4GIVA 3PR9A 4DIPA 1W1VA 2QRVA 2A3CA 2DSZA 1RD6A 2PPPA 3AS1A 2Y8NB 2ZR4A 3I6CA 3PRDA 2FKEA 4Z2GA 2JZVA 5U47A 1ZBWA 1QZ2A 2M08A 4WK9A 2OWOA 5HW7A 2QF8A 3IK8A 2YSFA 3QOKA 4KQZA 4NNRA 1FFQA 3W4RA 1ZU8A 3ARXA 3G6MA 1NMWA 1F40A 4U86A 2MLZA 2WADA 2A3EA 4U85A 2LKNA 1E44A 3RFWA 1N1AA 2F23A 4DRPA 4WKHA 4DH0A 4O2TA 4MAVA 4WJXA 1EIBA 2YSBA 5DIVA 1L1PA 2KI3A 1WR7A 3ARTA 1JCHB 4GLXA 1FKBA 2L2SA 4AY1A 2KXQA 2O9OA 1Q6UA 3B7XA 3M7NA 2FDMA 4JFIA 1EG3A 4Q7NA 5HKGA 1JNSA 2G41A 3UQAA 4ODMA 4P8VA 2WM0A 5E65A 4MNMA 3IKGA 3ARQA 3B8SA 1FKLA 2WLZA 1NSGA 4DWSD 1FLCA 1QPLA 1E9LA 1TFVA 3KZ7A 1E6NA 2LJ4A 4ITZA 3OA5A 4DRKA 3FAPA 4DRMA 3AQUA 5JH8A 4IQCA 2DWVA 4W9OA 3ARPA 2DSWA 3UI5A 1FKIA 1K9TA 3JYMA 3CHFA 1Q6IA 5HTGA 4P8WA 3H9RB 1LG1A 3KACA 1IX5A 3MCBA 1OWQA 2F2DA 1LL6A 3EY6A 3O5IA 4DWSA 4TNSA 1O6IA 2KE0A 2RSEA 3PQHA 4ODRA 3ARWA 3CH9A 2DT3A 5GPGA 3AS0A 2YSHA 3GU0A 4IQ2A 3G6LA 2ZQVA 3WD0A 1JNTA 5D75A 1M5YA 1C9HA 3UF8A 4HBOA 1F8AB 4JFKA 4GGQA 1TCOC 1K9QA 2FAPA 2KGJA 2AWGA 1CTNA 1TK7A 1D7HA 4WKFA 4DRQA 1OGBA 2ESCA 4Q22A 5HW6A 3FSBA 3FXYA 4DRJA 3B9EA 1E6RA 2MF9A 3KABA 2PPNA 4KR0B 4Z2JA 3WD2A 4TYOA 2M8JA 1QPFA 4DRNA 3MCBB 2M3OW 3NRKA 1KT0A 1ZK6A 4FN2A 3NTPA 4NSBA 3JXVA 3RM8A 4QT3A 1FKSA 1ROTA 3TDBA 3KADA 4IPXA 1P5QA 4LAXA 4XAKA 2B31A 1BKFA 4S3KA 2KO7A 2JXWA 1FKTA 1NMVA 1O6WA 4ML4A 2UZ5A 2DT2A 2MLXA 2VN1A 3EIPA 2XPAA 1HKJA 1H0GA 2A3AA 4R5EA 3MDYB 2Y78A 1W1TA 2DG4A 3O5JA 2PBCA 1J4HA 4IT6A 3O5LA 1LL4A 4ODNA 1GOIA 1W26A 2IUZA 3LUOA 5E62A 4DRHA 2XP9A 1J4IA 2WAEA 3FSCA 3RGCA 3WKZA 1D7IA 2AOSA 1W9VA 2G8ZA 1WAWA 5GQBA 1ITXA 3WH0A 3JYJA 3WD1A 1W9UA 3IKDA 3KAIA 4WIWA 1T11A 2ETNA 4FAPA 5HBFA 3WQWA 1LG2A 1PBKA 1NWTA 4JFJA 4QT2A 4A0UA 3O5PA 3TC5A
chains in the Genus database with same CATH topology
4PTMA 3LKXA 3LE4A 4DZ3A 3RM9A 3RMEA 4JFMA 2DT1A 4LGXA 2PI6A 2ZR5A 2M2AA 4ZPVR 4IT4A 4ODPA 2LPVA 1EDQA 4R0XA 1BL4A 5HWCA 2D9FA 3ARVA 1D2KA 1YATA 4MNKA 3FY1A 1Y0OA 4W5UA 4ODOA 1FJDA 5HT1A 3BXWA 2RURA 2PV3A 2WK2A 1JNDA 3WL0A 4L3NA 4BF8A 4Z2HA 2XP3A 4U84A 3O5KA 4WKAA 5GPRA 4MTVA 4Z2IA 1ZBKA 2MDIA 2KR7A 4JYSA 4LAYA 2ZQSA 4URIA 2Q5AA 1GUVA 3CHCA 2M8IA 3CGMA 1FKDA 3UQBA 5DO2A 2KFWA 1RP5A 2N87A 3WD4A 1D6OA 5DEZA 3O5QA 2XP8A 1JVWA 1XRVA 3LKXB 4ZPTR 2OLHA 3M85A 5DITA 3ARUA 1LL7A 3AS2A 3NI6A 5E66A 3O5RA 4L72B 4N19A 2YAJB 1WNOA 3KAGA 2JMFA 3O5FA 3OOBA 3FS8A 1NWSA 3KAHA 4HBEA 4HARA 3WL1A 4G2PA 3O5OA 2PV1A 2YBTA 1HKKA 3O5GA 2O92A 2XP6A 1E15A 4ZPWR 5I98A 4C02B 4DWSB 2XP5A 2XPBA 4MSPA 1W9PA 4TW8A 4S3JA 1H0IA 1FKFA 2RQSA 4G50A 1OGGA 3GPKA 4MNLA 2E45A 4J4NA 1TR8A 1JNEA 4P8XA 3ARSA 1FKHA 4MPKA 1J6YA 1FFRA 5CQ2A 2RUDA 1LJYA 2M1IA 4DROA 5J6EA 3CHEA 3CHDA 4J4OA 2PPOA 1FKJA 3B9AA 3WD3A 1XHGA 5HWBA 2EZ5W 1GPFA 2MLYA 2BA1A 1HJVA 4LAWA 5AHTA 2ITKA 3KCEA 1FAPA 4ODQA 3UI6A 1NWUA 1HKMA 2DG9A 4W9PA 1X6NA 1WMVA 3WQVA 2DJYA 2OFNA 1HXVA 1LQ0A 2JV4A 3ALGA 1JMQA 2ZAJA 1EG4A 3O5DA 2YSGA 2XP4A 3ARYA 3PA7A 2VCDA 1ZB5A 2RUCA 3CZ8A 4TW7A 2LGOA 2YSIA 1X6LA 3TCZA 1ZBVA 1U79A 1FKGA 1E6PA 1Q6HA 3O5MA 1FD9A 2YBUA 3ALFA 3B9DA 4QZVB 3KAFA 2ZQUA 1ZBCA 3O5EA 2ZR6A 4DZ2A 3AROA 1E6ZA 2XP7A 4MNJA 3ARZA 2MPHA 2DMVA 4QIBA 1Q1CA 3AS3A 1HKIA 5B8IC 2RE3A 1ROUA 5HW8A 5DIUA 5HUAA 1WB0A 2PV2A 1EHNA 3ARRA 1HJWA 1K9RA 2WLYA 2ZQTA 1KFWA 1EQ3A 1I5HW 2F21A 3PRAA 4REXA 1EYMA 1FKKA 4TX0A 1SR0A 1ZL1A 3MQHA 1NWRA 1KT1A 1HJXA 1UR8A 4ZS6A 1A7XA 1NH6A 3CGNA 3RM4A 4DWSC 4NZCA 2DSUA 1J4RA 4W9QA 5BXJA 2A3BA 3IHZA 4JFLA 3UQIA 2IF4A 1B6CA 4DT4A 4TW6A 2DK1A 2DK7A 4Z2KA 1W1PA 1D7JA 1UR9A 1PINA 2RUQA 5DF0A 1W1YA 4DRIA 4Z2LA 2L4JA 3MQGA 3CNGA 4LAVA 3ODKA 4A0TA 3L4HA 4MGVA 4P8UA 2DPEA 3WIJA 2JX8A 1YW5A 5E5WA 2LAJA 1FKRA 1R9HA 2MNTA 1VF8A 2K8IA 1ZCNA 2DSVA 1SYTA 2F4EA 5E64A 2DT0A 3UI4A 3VAWA 3PRBA 2DG3A 4ODLA 4ODKA 4E5RA 4GIVA 3PR9A 4DIPA 1W1VA 2QRVA 2A3CA 2DSZA 1RD6A 2PPPA 3AS1A 2Y8NB 2ZR4A 3I6CA 3PRDA 2FKEA 4Z2GA 2JZVA 5U47A 1ZBWA 1QZ2A 2M08A 4WK9A 2OWOA 5HW7A 2QF8A 3IK8A 2YSFA 3QOKA 4KQZA 4NNRA 1FFQA 3W4RA 1ZU8A 3ARXA 3G6MA 1NMWA 1F40A 4U86A 2MLZA 2WADA 2A3EA 4U85A 2LKNA 3RFWA 1N1AA 4DRPA 4WKHA 4DH0A 4O2TA 4MAVA 4WJXA 1EIBA 2YSBA 5DIVA 1L1PA 2KI3A 1WR7A 3ARTA 4GLXA 1FKBA 2L2SA 4AY1A 2KXQA 2O9OA 1Q6UA 3B7XA 3M7NA 2FDMA 4JFIA 1EG3A 4Q7NA 5HKGA 1JNSA 2G41A 3UQAA 4ODMA 4P8VA 2WM0A 5E65A 4MNMA 3IKGA 3ARQA 3B8SA 1FKLA 2WLZA 1NSGA 4DWSD 1FLCA 1QPLA 1E9LA 1TFVA 3KZ7A 1E6NA 2LJ4A 4ITZA 3OA5A 4DRKA 3FAPA 4DRMA 3AQUA 5JH8A 4IQCA 2DWVA 4W9OA 3ARPA 2DSWA 3UI5A 1FKIA 1K9TA 3JYMA 3CHFA 1Q6IA 5HTGA 4P8WA 3H9RB 1LG1A 3KACA 1IX5A 3MCBA 1OWQA 2F2DA 1LL6A 3EY6A 3O5IA 4DWSA 4TNSA 1O6IA 2KE0A 2RSEA 3PQHA 4ODRA 3ARWA 3CH9A 2DT3A 5GPGA 3AS0A 2YSHA 4IQ2A 3G6LA 2ZQVA 3WD0A 1JNTA 5D75A 1M5YA 1C9HA 3UF8A 4HBOA 1F8AB 4JFKA 4GGQA 1TCOC 1K9QA 2FAPA 2KGJA 2AWGA 1CTNA 1TK7A 1D7HA 4WKFA 4DRQA 1OGBA 2ESCA 4Q22A 5HW6A 3FSBA 3FXYA 4DRJA 3B9EA 1E6RA 2MF9A 3KABA 2PPNA 4KR0B 4Z2JA 3WD2A 4TYOA 2M8JA 1QPFA 4DRNA 3MCBB 2M3OW 3NRKA 1KT0A 1ZK6A 4FN2A 3NTPA 4NSBA 3JXVA 3RM8A 4QT3A 1FKSA 1ROTA 3TDBA 3KADA 4IPXA 1P5QA 4LAXA 4XAKA 2B31A 1BKFA 4S3KA 2KO7A 2JXWA 1FKTA 1NMVA 1O6WA 4ML4A 2UZ5A 2DT2A 2MLXA 2VN1A 2XPAA 1HKJA 1H0GA 2A3AA 4R5EA 3MDYB 2Y78A 1W1TA 2DG4A 3O5JA 2PBCA 1J4HA 4IT6A 3O5LA 1LL4A 4ODNA 1GOIA 1W26A 2IUZA 3LUOA 5E62A 4DRHA 2XP9A 1J4IA 2WAEA 3FSCA 3RGCA 3WKZA 1D7IA 2AOSA 1W9VA 2G8ZA 1WAWA 5GQBA 1ITXA 3WH0A 3JYJA 3WD1A 1W9UA 3IKDA 3KAIA 4WIWA 1T11A 4FAPA 5HBFA 3WQWA 1LG2A 1PBKA 1NWTA 4JFJA 4QT2A 4A0UA 3O5PA 3TC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LE4 A;  4DZ3 A;  4JFM A;  2ZR5 A;  2M2A A;  4ODP A;  2LPV A;  4R0X A;  1BL4 A;  5HWC A;  2D9F A;  1YAT A;  1Y0O A;  4ODO A;  1FJD A;  5HT1 A;  2RUR A;  2PV3 A;  4BF8 A;  2XP3 A;  4U84 A;  3O5K A;  2MDI A;  2KR7 A;  4JYS A;  4LAY A;  2ZQS A;  2Q5A A;  2M8I A;  3CGM A;  1FKD A;  3UQB A;  2KFW A;  2N87 A;  1D6O A;  3O5Q A;  2XP8 A;  1JVW A;  3M85 A;  5DIT A;  3NI6 A;  3O5R A;  4N19 A;  3KAG A;  2JMF A;  3O5F A;  3OOB A;  3KAH A;  4G2P A;  3O5O A;  2PV1 A;  3O5G A;  2XP6 A;  5I98 A;  4C02 B;  2XP5 A;  2XPB A;  4MSP A;  4TW8 A;  4G50 A;  1FKF A;  2RQS A;  3GPK A;  2E45 A;  4J4N A;  1FKH A;  1J6Y A;  5CQ2 A;  2RUD A;  2M1I A;  4DRO A;  5J6E A;  4J4O A;  2PPO A;  1FKJ A;  5HWB A;  2EZ5 W;  2MLY A;  2BA1 A;  4LAW A;  5AHT A;  2ITK A;  3KCE A;  1FAP A;  4ODQ A;  3UI6 A;  2DG9 A;  4W9P A;  1WMV A;  2DJY A;  2OFN A;  1HXV A;  2JV4 A;  1JMQ A;  2ZAJ A;  1EG4 A;  3O5D A;  2YSG A;  2XP4 A;  3PA7 A;  2VCD A;  2RUC A;  4TW7 A;  2LGO A;  2YSI A;  3TCZ A;  1U79 A;  1FKG A;  1Q6H A;  3O5M A;  1FD9 A;  3KAF A;  2ZQU A;  3O5E A;  2ZR6 A;  4DZ2 A;  2XP7 A;  2MPH A;  2DMV A;  4QIB A;  1Q1C A;  5B8I C;  2RE3 A;  1ROU A;  5HW8 A;  5DIU A;  5HUA A;  2PV2 A;  1K9R A;  2ZQT A;  1EQ3 A;  1I5H W;  2F21 A;  4REX A;  1EYM A;  1FKK A;  4TX0 A;  1KT1 A;  1A7X A;  3CGN A;  1J4R A;  4W9Q A;  5BXJ A;  3IHZ A;  4JFL A;  3UQI A;  2IF4 A;  1B6C A;  4DT4 A;  4TW6 A;  2DK1 A;  2DK7 A;  1D7J A;  1PIN A;  2RUQ A;  4DRI A;  2L4J A;  3CNG A;  4LAV A;  3ODK A;  3L4H A;  4MGV A;  2JX8 A;  1YW5 A;  2LAJ A;  1FKR A;  1R9H A;  2MNT A;  2K8I A;  1ZCN A;  2F4E A;  3UI4 A;  3VAW A;  3PRB A;  2DG3 A;  4ODL A;  4ODK A;  4E5R A;  4GIV A;  4DIP A;  2PPP A;  2ZR4 A;  3I6C A;  3PRD A;  2FKE A;  2JZV A;  1QZ2 A;  2M08 A;  5HW7 A;  3IK8 A;  2YSF A;  4NNR A;  1NMW A;  1F40 A;  4U86 A;  2MLZ A;  4U85 A;  2LKN A;  3RFW A;  1N1A A;  4DRP A;  4DH0 A;  4O2T A;  2YSB A;  5DIV A;  1L1P A;  2KI3 A;  1WR7 A;  1FKB A;  2L2S A;  2KXQ A;  1Q6U A;  3B7X A;  3M7N A;  4JFI A;  1EG3 A;  5HKG A;  1JNS A;  3UQA A;  4ODM A;  3IKG A;  1FKL A;  1NSG A;  1QPL A;  3KZ7 A;  2LJ4 A;  4DRK A;  4ITZ A;  3FAP A;  4DRM A;  4IQC A;  2DWV A;  4W9O A;  3UI5 A;  1FKI A;  3JYM A;  1Q6I A;  5HTG A;  3H9R B;  3KAC A;  2F2D A;  3EY6 A;  3O5I A;  4TNS A;  2KE0 A;  2RSE A;  4ODR A;  5GPG A;  2YSH A;  4IQ2 A;  2ZQV A;  1JNT A;  5D75 A;  1M5Y A;  1C9H A;  3UF8 A;  1F8A B;  4JFK A;  4GGQ A;  1TCO C;  1K9Q A;  2FAP A;  2KGJ A;  2AWG A;  1TK7 A;  1D7H A;  4DRQ A;  5HW6 A;  4DRJ A;  2MF9 A;  3KAB A;  2PPN A;  4TYO A;  2M8J A;  1QPF A;  4DRN A;  2M3O W;  3NRK A;  1KT0 A;  1ZK6 A;  4FN2 A;  3NTP A;  3JXV A;  4QT3 A;  1FKS A;  1ROT A;  3TDB A;  3KAD A;  4IPX A;  1P5Q A;  4LAX A;  1BKF A;  2KO7 A;  2JXW A;  1FKT A;  1O6W A;  1NMV A;  2UZ5 A;  2MLX A;  2VN1 A;  2XPA A;  3MDY B;  2Y78 A;  2DG4 A;  3O5J A;  2PBC A;  1J4H A;  3O5L A;  4ODN A;  1W26 A;  3LUO A;  4DRH A;  2XP9 A;  1J4I A;  3RGC A;  1D7I A;  3WH0 A;  3JYJ A;  3IKD A;  3KAI A;  1T11 A;  4FAP A;  1PBK A;  4JFJ A;  4QT2 A;  3O5P A;  3TC5 A; 
#chains in the Genus database with same CATH topology
 4PTM A;  3LKX A;  3LE4 A;  4DZ3 A;  3RM9 A;  3RME A;  4JFM A;  2DT1 A;  4LGX A;  2PI6 A;  2ZR5 A;  2M2A A;  4ZPV R;  4IT4 A;  4ODP A;  2LPV A;  1EDQ A;  4R0X A;  1BL4 A;  5HWC A;  2D9F A;  2EUL A;  1D2K A;  1YAT A;  3ARV A;  4MNK A;  3FY1 A;  1Y0O A;  4W5U A;  4ODO A;  1FJD A;  5HT1 A;  3BXW A;  2RUR A;  2PV3 A;  2WK2 A;  1JND A;  3WL0 A;  4L3N A;  4BF8 A;  4Z2H A;  2XP3 A;  4U84 A;  3O5K A;  4WKA A;  5GPR A;  4MTV A;  4Z2I A;  1ZBK A;  2MDI A;  2KR7 A;  4JYS A;  4LAY A;  2ZQS A;  4URI A;  2Q5A A;  1GUV A;  3CHC A;  2M8I A;  3CGM A;  1FKD A;  3UQB A;  5DO2 A;  2KFW A;  1RP5 A;  2N87 A;  3WD4 A;  1D6O A;  5DEZ A;  3O5Q A;  2XP8 A;  1JVW A;  1XRV A;  3LKX B;  4ZPT R;  2OLH A;  3M85 A;  5DIT A;  3ARU A;  1LL7 A;  3AS2 A;  3NI6 A;  5E66 A;  3O5R A;  4L72 B;  4N19 A;  2YAJ B;  1WNO A;  3KAG A;  2JMF A;  3O5F A;  3OOB A;  3FS8 A;  1NWS A;  3KAH A;  4HBE A;  4HAR A;  3WL1 A;  4G2P A;  3O5O A;  2PV1 A;  2YBT A;  1HKK A;  3O5G A;  2O92 A;  2XP6 A;  1E15 A;  4ZPW R;  5I98 A;  4C02 B;  4DWS B;  2XP5 A;  2XPB A;  4MSP A;  1W9P A;  4TW8 A;  4S3J A;  1H0I A;  1FKF A;  2RQS A;  4G50 A;  1OGG A;  3GPK A;  4MNL A;  2E45 A;  4UDM A;  4J4N A;  1TR8 A;  1JNE A;  4P8X A;  3ARS A;  1FKH A;  4MPK A;  1J6Y A;  1FFR A;  5CQ2 A;  2RUD A;  1LJY A;  3BMB A;  2M1I A;  4DRO A;  5J6E A;  3CHE A;  3CHD A;  4J4O A;  2PPO A;  1FKJ A;  3B9A A;  3WD3 A;  1XHG A;  5HWB A;  2EZ5 W;  1GPF A;  2MLY A;  2BA1 A;  1HJV A;  4LAW A;  5AHT A;  2ITK A;  3KCE A;  1FAP A;  4ODQ A;  3UI6 A;  1NWU A;  1HKM A;  2DG9 A;  4W9P A;  1X6N A;  1WMV A;  3WQV A;  2DJY A;  2OFN A;  1HXV A;  1LQ0 A;  2JV4 A;  3ALG A;  1JMQ A;  2ZAJ A;  1EG4 A;  3O5D A;  2YSG A;  2XP4 A;  3ARY A;  3PA7 A;  2VCD A;  1ZB5 A;  2RUC A;  3CZ8 A;  4TW7 A;  2LGO A;  2YSI A;  1X6L A;  3TCZ A;  1ZBV A;  1U79 A;  1FKG A;  1E6P A;  1Q6H A;  3O5M A;  1FD9 A;  2YBU A;  3ALF A;  3B9D A;  4QZV B;  3KAF A;  2ZQU A;  1GRJ A;  1ZBC A;  3O5E A;  2ZR6 A;  4DZ2 A;  3ARO A;  1E6Z A;  2XP7 A;  4MNJ A;  3ARZ A;  2MPH A;  2DMV A;  4QIB A;  1Q1C A;  3AS3 A;  1HKI A;  5B8I C;  2RE3 A;  1ROU A;  5HW8 A;  5DIU A;  5HUA A;  1WB0 A;  2PV2 A;  1EHN A;  3ARR A;  1HJW A;  1K9R A;  2WLY A;  2ZQT A;  1KFW A;  1EQ3 A;  1I5H W;  2F21 A;  3PRA A;  4REX A;  1EYM A;  1FKK A;  4TX0 A;  1SR0 A;  1ZL1 A;  3MQH A;  1NWR A;  1KT1 A;  1HJX A;  1UR8 A;  4ZS6 A;  1A7X A;  1NH6 A;  3CGN A;  2P4V A;  3RM4 A;  4DWS C;  4NZC A;  2DSU A;  1J4R A;  4W9Q A;  5BXJ A;  2A3B A;  3IHZ A;  4JFL A;  3UQI A;  2IF4 A;  1B6C A;  4DT4 A;  4TW6 A;  2DK1 A;  2DK7 A;  2PN0 A;  4Z2K A;  1W1P A;  1D7J A;  1UR9 A;  1PIN A;  2RUQ A;  5DF0 A;  1W1Y A;  4DRI A;  4Z2L A;  2L4J A;  3MQG A;  3CNG A;  4LAV A;  3ODK A;  4A0T A;  3L4H A;  4MGV A;  4P8U A;  2DPE A;  3WIJ A;  2JX8 A;  1YW5 A;  5E5W A;  2LAJ A;  1FKR A;  1R9H A;  2MNT A;  1VF8 A;  2K8I A;  1ZCN A;  2DSV A;  1SYT A;  2F4E A;  5E64 A;  2DT0 A;  3GTY X;  3UI4 A;  3VAW A;  3PRB A;  2DG3 A;  2B5U B;  4ODL A;  4ODK A;  4E5R A;  4GIV A;  3PR9 A;  4DIP A;  1W1V A;  2QRV A;  2A3C A;  2DSZ A;  1RD6 A;  2PPP A;  3AS1 A;  2Y8N B;  2ZR4 A;  3I6C A;  3PRD A;  2FKE A;  4Z2G A;  2JZV A;  5U47 A;  1ZBW A;  1QZ2 A;  2M08 A;  4WK9 A;  2OWO A;  5HW7 A;  2QF8 A;  3IK8 A;  2YSF A;  3QOK A;  4KQZ A;  4NNR A;  1FFQ A;  3W4R A;  1ZU8 A;  3ARX A;  3G6M A;  1NMW A;  1F40 A;  4U86 A;  2MLZ A;  2WAD A;  2A3E A;  4U85 A;  2LKN A;  1E44 A;  3RFW A;  1N1A A;  2F23 A;  4DRP A;  4WKH A;  4DH0 A;  4O2T A;  4MAV A;  4WJX A;  1EIB A;  2YSB A;  5DIV A;  1L1P A;  2KI3 A;  1WR7 A;  3ART A;  1JCH B;  4GLX A;  1FKB A;  2L2S A;  4AY1 A;  2KXQ A;  2O9O A;  1Q6U A;  3B7X A;  3M7N A;  2FDM A;  4JFI A;  1EG3 A;  4Q7N A;  5HKG A;  1JNS A;  2G41 A;  3UQA A;  4ODM A;  4P8V A;  2WM0 A;  5E65 A;  4MNM A;  3IKG A;  3ARQ A;  3B8S A;  1FKL A;  2WLZ A;  1NSG A;  4DWS D;  1FLC A;  1QPL A;  1E9L A;  1TFV A;  3KZ7 A;  1E6N A;  2LJ4 A;  4ITZ A;  3OA5 A;  4DRK A;  3FAP A;  4DRM A;  3AQU A;  5JH8 A;  4IQC A;  2DWV A;  4W9O A;  3ARP A;  2DSW A;  3UI5 A;  1FKI A;  1K9T A;  3JYM A;  3CHF A;  1Q6I A;  5HTG A;  4P8W A;  3H9R B;  1LG1 A;  3KAC A;  1IX5 A;  3MCB A;  1OWQ A;  2F2D A;  1LL6 A;  3EY6 A;  3O5I A;  4DWS A;  4TNS A;  1O6I A;  2KE0 A;  2RSE A;  3PQH A;  4ODR A;  3ARW A;  3CH9 A;  2DT3 A;  5GPG A;  3AS0 A;  2YSH A;  3GU0 A;  4IQ2 A;  3G6L A;  2ZQV A;  3WD0 A;  1JNT A;  5D75 A;  1M5Y A;  1C9H A;  3UF8 A;  4HBO A;  1F8A B;  4JFK A;  4GGQ A;  1TCO C;  1K9Q A;  2FAP A;  2KGJ A;  2AWG A;  1CTN A;  1TK7 A;  1D7H A;  4WKF A;  4DRQ A;  1OGB A;  2ESC A;  4Q22 A;  5HW6 A;  3FSB A;  3FXY A;  4DRJ A;  3B9E A;  1E6R A;  2MF9 A;  3KAB A;  2PPN A;  4KR0 B;  4Z2J A;  3WD2 A;  4TYO A;  2M8J A;  1QPF A;  4DRN A;  3MCB B;  2M3O W;  3NRK A;  1KT0 A;  1ZK6 A;  4FN2 A;  3NTP A;  4NSB A;  3JXV A;  3RM8 A;  4QT3 A;  1FKS A;  1ROT A;  3TDB A;  3KAD A;  4IPX A;  1P5Q A;  4LAX A;  4XAK A;  2B31 A;  1BKF A;  4S3K A;  2KO7 A;  2JXW A;  1FKT A;  1NMV A;  1O6W A;  4ML4 A;  2UZ5 A;  2DT2 A;  2MLX A;  2VN1 A;  3EIP A;  2XPA A;  1HKJ A;  1H0G A;  2A3A A;  4R5E A;  3MDY B;  2Y78 A;  1W1T A;  2DG4 A;  3O5J A;  2PBC A;  1J4H A;  4IT6 A;  3O5L A;  1LL4 A;  4ODN A;  1GOI A;  1W26 A;  2IUZ A;  3LUO A;  5E62 A;  4DRH A;  2XP9 A;  1J4I A;  2WAE A;  3FSC A;  3RGC A;  3WKZ A;  1D7I A;  2AOS A;  1W9V A;  2G8Z A;  1WAW A;  5GQB A;  1ITX A;  3WH0 A;  3JYJ A;  3WD1 A;  1W9U A;  3IKD A;  3KAI A;  4WIW A;  1T11 A;  2ETN A;  4FAP A;  5HBF A;  3WQW A;  1LG2 A;  1PBK A;  1NWT A;  4JFJ A;  4QT2 A;  4A0U A;  3O5P A;  3TC5 A; 
#chains in the Genus database with same CATH homology
 4PTM A;  3LKX A;  3LE4 A;  4DZ3 A;  3RM9 A;  3RME A;  4JFM A;  2DT1 A;  4LGX A;  2PI6 A;  2ZR5 A;  2M2A A;  4ZPV R;  4IT4 A;  4ODP A;  2LPV A;  1EDQ A;  4R0X A;  1BL4 A;  5HWC A;  2D9F A;  3ARV A;  1D2K A;  1YAT A;  4MNK A;  3FY1 A;  1Y0O A;  4W5U A;  4ODO A;  1FJD A;  5HT1 A;  3BXW A;  2RUR A;  2PV3 A;  2WK2 A;  1JND A;  3WL0 A;  4L3N A;  4BF8 A;  4Z2H A;  2XP3 A;  4U84 A;  3O5K A;  4WKA A;  5GPR A;  4MTV A;  4Z2I A;  1ZBK A;  2MDI A;  2KR7 A;  4JYS A;  4LAY A;  2ZQS A;  4URI A;  2Q5A A;  1GUV A;  3CHC A;  2M8I A;  3CGM A;  1FKD A;  3UQB A;  5DO2 A;  2KFW A;  1RP5 A;  2N87 A;  3WD4 A;  1D6O A;  5DEZ A;  3O5Q A;  2XP8 A;  1JVW A;  1XRV A;  3LKX B;  4ZPT R;  2OLH A;  3M85 A;  5DIT A;  3ARU A;  1LL7 A;  3AS2 A;  3NI6 A;  5E66 A;  3O5R A;  4L72 B;  4N19 A;  2YAJ B;  1WNO A;  3KAG A;  2JMF A;  3O5F A;  3OOB A;  3FS8 A;  1NWS A;  3KAH A;  4HBE A;  4HAR A;  3WL1 A;  4G2P A;  3O5O A;  2PV1 A;  2YBT A;  1HKK A;  3O5G A;  2O92 A;  2XP6 A;  1E15 A;  4ZPW R;  5I98 A;  4C02 B;  4DWS B;  2XP5 A;  2XPB A;  4MSP A;  1W9P A;  4TW8 A;  4S3J A;  1H0I A;  1FKF A;  2RQS A;  4G50 A;  1OGG A;  3GPK A;  4MNL A;  2E45 A;  4J4N A;  1TR8 A;  1JNE A;  4P8X A;  3ARS A;  1FKH A;  4MPK A;  1J6Y A;  1FFR A;  5CQ2 A;  2RUD A;  1LJY A;  2M1I A;  4DRO A;  5J6E A;  3CHE A;  3CHD A;  4J4O A;  2PPO A;  1FKJ A;  3B9A A;  3WD3 A;  1XHG A;  5HWB A;  2EZ5 W;  1GPF A;  2MLY A;  2BA1 A;  1HJV A;  4LAW A;  5AHT A;  2ITK A;  3KCE A;  1FAP A;  4ODQ A;  3UI6 A;  1NWU A;  1HKM A;  2DG9 A;  4W9P A;  1X6N A;  1WMV A;  3WQV A;  2DJY A;  2OFN A;  1HXV A;  1LQ0 A;  2JV4 A;  3ALG A;  1JMQ A;  2ZAJ A;  1EG4 A;  3O5D A;  2YSG A;  2XP4 A;  3ARY A;  3PA7 A;  2VCD A;  1ZB5 A;  2RUC A;  3CZ8 A;  4TW7 A;  2LGO A;  2YSI A;  1X6L A;  3TCZ A;  1ZBV A;  1U79 A;  1FKG A;  1E6P A;  1Q6H A;  3O5M A;  1FD9 A;  2YBU A;  3ALF A;  3B9D A;  4QZV B;  3KAF A;  2ZQU A;  1ZBC A;  3O5E A;  2ZR6 A;  4DZ2 A;  3ARO A;  1E6Z A;  2XP7 A;  4MNJ A;  3ARZ A;  2MPH A;  2DMV A;  4QIB A;  1Q1C A;  3AS3 A;  1HKI A;  5B8I C;  2RE3 A;  1ROU A;  5HW8 A;  5DIU A;  5HUA A;  1WB0 A;  2PV2 A;  1EHN A;  3ARR A;  1HJW A;  1K9R A;  2WLY A;  2ZQT A;  1KFW A;  1EQ3 A;  1I5H W;  2F21 A;  3PRA A;  4REX A;  1EYM A;  1FKK A;  4TX0 A;  1SR0 A;  1ZL1 A;  3MQH A;  1NWR A;  1KT1 A;  1HJX A;  1UR8 A;  4ZS6 A;  1A7X A;  1NH6 A;  3CGN A;  3RM4 A;  4DWS C;  4NZC A;  2DSU A;  1J4R A;  4W9Q A;  5BXJ A;  2A3B A;  3IHZ A;  4JFL A;  3UQI A;  2IF4 A;  1B6C A;  4DT4 A;  4TW6 A;  2DK1 A;  2DK7 A;  4Z2K A;  1W1P A;  1D7J A;  1UR9 A;  1PIN A;  2RUQ A;  5DF0 A;  1W1Y A;  4DRI A;  4Z2L A;  2L4J A;  3MQG A;  3CNG A;  4LAV A;  3ODK A;  4A0T A;  3L4H A;  4MGV A;  4P8U A;  2DPE A;  3WIJ A;  2JX8 A;  1YW5 A;  5E5W A;  2LAJ A;  1FKR A;  1R9H A;  2MNT A;  1VF8 A;  2K8I A;  1ZCN A;  2DSV A;  1SYT A;  2F4E A;  5E64 A;  2DT0 A;  3UI4 A;  3VAW A;  3PRB A;  2DG3 A;  4ODL A;  4ODK A;  4E5R A;  4GIV A;  3PR9 A;  4DIP A;  1W1V A;  2QRV A;  2A3C A;  2DSZ A;  1RD6 A;  2PPP A;  3AS1 A;  2Y8N B;  2ZR4 A;  3I6C A;  3PRD A;  2FKE A;  4Z2G A;  2JZV A;  5U47 A;  1ZBW A;  1QZ2 A;  2M08 A;  4WK9 A;  2OWO A;  5HW7 A;  2QF8 A;  3IK8 A;  2YSF A;  3QOK A;  4KQZ A;  4NNR A;  1FFQ A;  3W4R A;  1ZU8 A;  3ARX A;  3G6M A;  1NMW A;  1F40 A;  4U86 A;  2MLZ A;  2WAD A;  2A3E A;  4U85 A;  2LKN A;  3RFW A;  1N1A A;  4DRP A;  4WKH A;  4DH0 A;  4O2T A;  4MAV A;  4WJX A;  1EIB A;  2YSB A;  5DIV A;  1L1P A;  2KI3 A;  1WR7 A;  3ART A;  4GLX A;  1FKB A;  2L2S A;  4AY1 A;  2KXQ A;  2O9O A;  1Q6U A;  3B7X A;  3M7N A;  2FDM A;  4JFI A;  1EG3 A;  4Q7N A;  5HKG A;  1JNS A;  2G41 A;  3UQA A;  4ODM A;  4P8V A;  2WM0 A;  5E65 A;  4MNM A;  3IKG A;  3ARQ A;  3B8S A;  1FKL A;  2WLZ A;  1NSG A;  4DWS D;  1FLC A;  1QPL A;  1E9L A;  1TFV A;  3KZ7 A;  1E6N A;  2LJ4 A;  4ITZ A;  3OA5 A;  4DRK A;  3FAP A;  4DRM A;  3AQU A;  5JH8 A;  4IQC A;  2DWV A;  4W9O A;  3ARP A;  2DSW A;  3UI5 A;  1FKI A;  1K9T A;  3JYM A;  3CHF A;  1Q6I A;  5HTG A;  4P8W A;  3H9R B;  1LG1 A;  3KAC A;  1IX5 A;  3MCB A;  1OWQ A;  2F2D A;  1LL6 A;  3EY6 A;  3O5I A;  4DWS A;  4TNS A;  1O6I A;  2KE0 A;  2RSE A;  3PQH A;  4ODR A;  3ARW A;  3CH9 A;  2DT3 A;  5GPG A;  3AS0 A;  2YSH A;  4IQ2 A;  3G6L A;  2ZQV A;  3WD0 A;  1JNT A;  5D75 A;  1M5Y A;  1C9H A;  3UF8 A;  4HBO A;  1F8A B;  4JFK A;  4GGQ A;  1TCO C;  1K9Q A;  2FAP A;  2KGJ A;  2AWG A;  1CTN A;  1TK7 A;  1D7H A;  4WKF A;  4DRQ A;  1OGB A;  2ESC A;  4Q22 A;  5HW6 A;  3FSB A;  3FXY A;  4DRJ A;  3B9E A;  1E6R A;  2MF9 A;  3KAB A;  2PPN A;  4KR0 B;  4Z2J A;  3WD2 A;  4TYO A;  2M8J A;  1QPF A;  4DRN A;  3MCB B;  2M3O W;  3NRK A;  1KT0 A;  1ZK6 A;  4FN2 A;  3NTP A;  4NSB A;  3JXV A;  3RM8 A;  4QT3 A;  1FKS A;  1ROT A;  3TDB A;  3KAD A;  4IPX A;  1P5Q A;  4LAX A;  4XAK A;  2B31 A;  1BKF A;  4S3K A;  2KO7 A;  2JXW A;  1FKT A;  1NMV A;  1O6W A;  4ML4 A;  2UZ5 A;  2DT2 A;  2MLX A;  2VN1 A;  2XPA A;  1HKJ A;  1H0G A;  2A3A A;  4R5E A;  3MDY B;  2Y78 A;  1W1T A;  2DG4 A;  3O5J A;  2PBC A;  1J4H A;  4IT6 A;  3O5L A;  1LL4 A;  4ODN A;  1GOI A;  1W26 A;  2IUZ A;  3LUO A;  5E62 A;  4DRH A;  2XP9 A;  1J4I A;  2WAE A;  3FSC A;  3RGC A;  3WKZ A;  1D7I A;  2AOS A;  1W9V A;  2G8Z A;  1WAW A;  5GQB A;  1ITX A;  3WH0 A;  3JYJ A;  3WD1 A;  1W9U A;  3IKD A;  3KAI A;  4WIW A;  1T11 A;  4FAP A;  5HBF A;  3WQW A;  1LG2 A;  1PBK A;  1NWT A;  4JFJ A;  4QT2 A;  4A0U A;  3O5P A;  3TC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...