3KADA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMAKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 44
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kadA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kadA02
1W26A 2LKNA 5HW7A 1O6WA 2KGJA 3PA7A 2RUCA 3IKGA 4GIVA 2E45A 3CNGA 2KR7A 5HWBA 2MDIA 2YSHA 3UI6A 3M85A 2F4EA 2AWGA 1ROTA 1EYMA 4DH0A 4TW8A 4O2TA 2Y78A 4QIBA 2DG3A 3VAWA 2JV4A 4LAXA 3B7XA 4U84A 3O5GA 1FKRA 2YSFA 4ODRA 3UF8A 2DWVA 5BXJA 2MNTA 2ZR6A 1JMQA 3RFWA 1FKBA 3KCEA 4DRPA 3UI4A 1FKGA 2JX8A 1D7JA 1BKFA 2ZR5A 3L4HA 4DZ2A 1FD9A 2FKEA 3NTPA 2PV2A 4TYOA 4DROA 3IKDA 5CQ2A 2M8JA 3CGMA 2XPBA 1P5QA 4IQ2A 4NNRA 2MF9A 2KI3A 3WH0A 3TC5A 3KADA 2JXWA 3NI6A 2MLXA 2XPAA 1Y0OA 2JMFA 2ITKA 3JXVA 1T11A 1FKDA 2N87A 2DJYA 4ODKA 1YW5A 3KAHA 4JFMA 3PRDA 4IPXA 4E5RA 4LAVA 4MSPA 2ZQVA 2VCDA 1EQ3A 4JFIA 4DRKA 3UQIA 3KABA 1FAPA 4DRHA 1Q6HA 2XP7A 4DRMA 3IK8A 5HKGA 1J4HA 4QT3A 2PPOA 4DT4A 4W9OA 3FAPA 1TCOC 3UI5A 1JVWA 3JYMA 1N1AA 5HW8A 4JFLA 5HUAA 1FKJA 3UQAA 2FAPA 3O5OA 5B8IC 2XP5A 1EG3A 4DRNA 2L4JA 1M5YA 2BA1A 2ZAJA 3NRKA 1TK7A 3MDYB 1QPLA 4ODNA 4ODLA 1J6YA 1Q6UA 2ZQUA 1D7IA 3H9RB 2RURA 2XP4A 4ODMA 2KXQA 1I5HW 3LE4A 2LGOA 4JFJA 2M2AA 2OFNA 1WR7A 4G2PA 1D6OA 3EY6A 5DIVA 3TDBA 2Q5AA 1QZ2A 1PINA 2XP8A 2DMVA 3TCZA 1C9HA 3UQBA 2LPVA 2RUQA 4REXA 2ZQSA 1K9RA 1K9QA 1EG4A 1FKHA 4ITZA 2K8IA 1F40A 4TW6A 4IQCA 4ODOA 1JNTA 2UZ5A 2EZ5W 2D9FA 2PPPA 3KACA 2F21A 3GPKA 5HT1A 1FKTA 4DIPA 1FKIA 1ZK6A 3JYJA 3KAGA 1Q1CA 1J4IA 3RGCA 5I98A 5HTGA 2LAJA 5DITA 1PBKA 2JZVA 2PV3A 5DIUA 3O5IA 5HWCA 4DZ3A 4R0XA 4FAPA 1JNSA 2M08A 3KAFA 1J4RA 3O5FA 4W9PA 1FKSA 2PV1A 2IF4A 3KAIA 4BF8A 1B6CA 2XP9A 3CGNA 1KT1A 1R9HA 5AHTA 2DK7A 2MLZA 1D7HA 4QT2A 2PPNA 4J4NA 4JFKA 1ROUA 2KE0A 2RSEA 1F8AB 2M1IA 1L1PA 1FKKA 2XP6A 1WMVA 3I6CA 2RE3A 3M7NA 1QPFA 4N19A 1NMVA 5J6EA 2DG4A 3KZ7A 4C02B 2LJ4A 4DRIA 2RUDA 4DRJA 4TNSA 3O5RA 2MPHA 2M3OW 3O5JA 1Q6IA 4TW7A 1ZCNA 3O5DA 4ODPA 4LAWA 2DG9A 1FJDA 3O5QA 4LAYA 5HW6A 4ODQA 3O5MA 2M8IA 4JYSA 1YATA 1U79A 4U85A 3PRBA 1BL4A 3ODKA 2KO7A 1FKLA 5GPGA 3O5PA 2YSBA 2L2SA 3LUOA 3OOBA 2VN1A 1A7XA 4DRQA 4J4OA 1HXVA 2YSGA 3O5LA 2PBCA 4FN2A 1NMWA 1FKFA 2RQSA 1NSGA 3O5KA 2ZR4A 3IHZA 1KT0A 2XP3A 2DK1A 4MGVA 4U86A 2KFWA 2MLYA 4GGQA 2F2DA 5D75A 4TX0A 4W9QA 3O5EA 2YSIA 4G50A 2ZQTA
chains in the Genus database with same CATH superfamily
4ZPWR 1W26A 2P4VA 4MPKA 1LL6A 1FFQA 2LKNA 5HW7A 3GU0A 1O6WA 2KGJA 3PA7A 1HKMA 3B9DA 2RUCA 4Z2GA 3IKGA 1W9UA 3FSBA 4S3KA 1W1PA 4WK9A 1WB0A 1E6NA 3AS3A 4LGXA 4GIVA 1FFRA 2E45A 3CNGA 2KR7A 1E15A 1H0GA 1JNDA 5HWBA 2MDIA 4ZPTR 2DSZA 2YSHA 1LG2A 3UI6A 2YAJB 3PR9A 4Q22A 3M85A 2F4EA 2AWGA 1ROTA 1EYMA 4DH0A 4TW8A 4O2TA 4IT4A 2PI6A 4WKAA 2Y78A 4QIBA 2DG3A 4HBOA 1ZBKA 1JNEA 3RM4A 2WM0A 2A3BA 3VAWA 3RM8A 2JV4A 1D2KA 4LAXA 3B7XA 2O92A 1LJYA 4U84A 3O5GA 3WL0A 1FKRA 4S3JA 2YSFA 4ODRA 3UF8A 2DWVA 5BXJA 4MNLA 2A3AA 2MNTA 2O9OA 2WK2A 5DEZA 2ZR6A 1FLCA 1JMQA 3RFWA 2DSVA 3WD4A 1FKBA 1WNOA 1NH6A 1E6PA 1ITXA 4HARA 4WKFA 3KCEA 4DRPA 3UI4A 1FKGA 2JX8A 1D7JA 1BKFA 3MQHA 3AS1A 4Z2IA 4MNMA 1OGBA 2ZR5A 2DSUA 3L4HA 3WKZA 2AOSA 1FD9A 4XAKA 4DZ2A 4P8XA 2FKEA 3NTPA 2PV2A 4TYOA 3CHDA 5E62A 3ARQA 4DROA 4KR0B 3IKDA 5CQ2A 2M8JA 2XPBA 3CGMA 1P5QA 4IQ2A 5E66A 1EIBA 3FY1A 4NNRA 1RP5A 3MCBB 5GPRA 2MF9A 2KI3A 2DT0A 2G8ZA 3OA5A 3WH0A 3TC5A 1E44A 4PTMA 3KADA 4Z2HA 4DWSB 2JXWA 3NI6A 2MLXA 4R5EA 3CH9A 2XPAA 4Z2KA 2B5UB 1Y0OA 2JMFA 4L3NA 1W1VA 3CHFA 2WLYA 4P8WA 2ITKA 5HBFA 3JXVA 1HJWA 1T11A 3FSCA 1FKDA 1NWUA 2N87A 2DJYA 2OLHA 3WIJA 1LG1A 4ODKA 1YW5A 3KAHA 4JFMA 1XRVA 3PRDA 4IPXA 4E5RA 3WQWA 4LAVA 4MSPA 1O6IA 4Q7NA 3B9EA 5E64A 2FDMA 4UDMA 3ARUA 2ZQVA 2VCDA 3AQUA 3WD3A 1EQ3A 4JFIA 1KFWA 4W5UA 4NSBA 4DRKA 3UQIA 3KABA 4ML4A 1FAPA 4DRHA 1HKKA 3B9AA 1Q6HA 2XP7A 4DRMA 3IK8A 5HKGA 1GRJA 2QF8A 1J4HA 4QT3A 2PPOA 4DT4A 4W9OA 3FAPA 1TCOC 3ARWA 3CZ8A 3UI5A 1JVWA 3JYMA 5E65A 1N1AA 2WAEA 2YBTA 5HW8A 3ARYA 4JFLA 5HUAA 1FKJA 3ALFA 1HJVA 3UQAA 2FAPA 3O5OA 1ZBVA 1ZB5A 5B8IC 2XP5A 1EG3A 2L4JA 4DRNA 1W9PA 1M5YA 2BA1A 2ZAJA 4WIWA 3NRKA 4Z2LA 1TK7A 3MDYB 1QPLA 4ODNA 4MNJA 4ODLA 1J6YA 3WD0A 1Q6UA 2ZQUA 5E5WA 1D7IA 1ZL1A 1XHGA 3H9RB 2RURA 2XP4A 1NWTA 4ODMA 2KXQA 1I5HW 3LE4A 2LGOA 4JFJA 4WJXA 4A0UA 2M2AA 5GQBA 2OFNA 1WR7A 4G2PA 1D6OA 3EY6A 1H0IA 5DIVA 3TDBA 1GPFA 1E6ZA 2Q5AA 1QZ2A 1NWSA 1PINA 2XP8A 2DMVA 3TCZA 1RD6A 4WKHA 1C9HA 1WAWA 3UQBA 2LPVA 2RUQA 3ARVA 4HBEA 1UR8A 4REXA 2ZQSA 2WLZA 2F23A 3AS2A 1K9RA 1HKIA 1K9QA 1EG4A 2DT3A 2QRVA 1FKHA 2K8IA 4ITZA 5DO2A 4TW6A 4IQCA 1F40A 4ODOA 1JNTA 2UZ5A 2EZ5W 3WL1A 4DWSD 1OGGA 2D9FA 1SYTA 2PPPA 3KACA 1UR9A 2DSWA 2F21A 1GOIA 3GPKA 5HT1A 1FKTA 4NZCA 1CTNA 4AY1A 4DIPA 1FKIA 1LL7A 1ZK6A 3JYJA 3KAGA 1GUVA 3PRAA 1Q1CA 1IX5A 1J4IA 2IUZA 3RGCA 5I98A 5HTGA 1EHNA 2LAJA 5DF0A 3RM9A 5DITA 1PBKA 1K9TA 3ARSA 2JZVA 2YBUA 2PV3A 5DIUA 3O5IA 1LQ0A 5HWCA 4ZPVR 4DZ3A 2EULA 3GTYX 4R0XA 4FAPA 2ETNA 1JNSA 3LKXA 2M08A 3ARRA 3KAFA 1J4RA 3O5FA 4W9PA 3WD2A 1FKSA 1ZBCA 3QOKA 3MQGA 2ESCA 2G41A 2PV1A 2IF4A 3KAIA 4BF8A 1B6CA 2XP9A 1W9VA 3PQHA 3CGNA 1SR0A 4L72B 3WQVA 1KT1A 1R9HA 5AHTA 2DK7A 2MLZA 1D7HA 1X6NA 4MTVA 3ARZA 4QT2A 2PPNA 4J4NA 3LKXB 1ROUA 4JFKA 3FS8A 2KE0A 2RSEA 1F8AB 2M1IA 1L1PA 1FKKA 2XP6A 1WMVA 3I6CA 2RE3A 3M7NA 1QPFA 4N19A 1NMVA 5J6EA 2DG4A 3KZ7A 1JCHB 4C02B 2B31A 4URIA 2LJ4A 3AS0A 4DRIA 2RUDA 2DT2A 1VF8A 4DRJA 4TNSA 1HJXA 3O5RA 2MPHA 2M3OW 5U47A 2WADA 3O5JA 3CHEA 1Q6IA 4KQZA 4TW7A 1ZCNA 3O5DA 4ODPA 4LAWA 3AROA 1E6RA 2DG9A 4Z2JA 3ARTA 1W1YA 1FJDA 3O5QA 4LAYA 5HW6A 4ODQA 3ARPA 3O5MA 2M8IA 4JYSA 1YATA 4GLXA 1U79A 3W4RA 3FXYA 4U85A 4A0TA 3PRBA 2A3CA 1BL4A 1TR8A 4MAVA 1E9LA 3ODKA 1OWQA 2KO7A 1FKLA 5GPGA 1TFVA 3MCBA 3O5PA 2YSBA 2L2SA 3LUOA 3OOBA 1LL4A 2VN1A 2Y8NB 1A7XA 1X6LA 4IT6A 1ZU8A 4DRQA 3B8SA 4J4OA 1NWRA 3BMBA 1HXVA 2YSGA 3O5LA 2PBCA 2OWOA 4ZS6A 4FN2A 4DWSA 5JH8A 1NMWA 3ALGA 1W1TA 3EIPA 3G6LA 1FKFA 2DT1A 1EDQA 1ZBWA 4DWSC 2RQSA 1NSGA 4P8VA 2DPEA 3O5KA 2ZR4A 3RMEA 3IHZA 1KT0A 2XP3A 2DK1A 4MGVA 4U86A 2KFWA 1HKJA 2MLYA 4GGQA 4P8UA 3G6MA 2F2DA 3WD1A 3CHCA 3ARXA 5D75A 4TX0A 4W9QA 4MNKA 4QZVB 3BXWA 2YSIA 3O5EA 4G50A 2ZQTA 2PN0A 2A3EA
chains in the Genus database with same CATH topology
4ZPWR 1W26A 4MPKA 1LL6A 1FFQA 2LKNA 5HW7A 1O6WA 2KGJA 3PA7A 1HKMA 3B9DA 2RUCA 4Z2GA 3IKGA 1W9UA 3FSBA 4S3KA 1W1PA 4WK9A 1WB0A 1E6NA 3AS3A 4LGXA 4GIVA 1FFRA 2E45A 3CNGA 2KR7A 1E15A 1H0GA 1JNDA 5HWBA 2MDIA 4ZPTR 2DSZA 2YSHA 1LG2A 3UI6A 2YAJB 3PR9A 4Q22A 3M85A 2F4EA 2AWGA 1ROTA 1EYMA 4DH0A 4TW8A 4O2TA 4IT4A 2PI6A 4WKAA 2Y78A 4QIBA 2DG3A 4HBOA 1ZBKA 1JNEA 3RM4A 2WM0A 2A3BA 3VAWA 3RM8A 2JV4A 1D2KA 4LAXA 3B7XA 2O92A 1LJYA 4U84A 3O5GA 3WL0A 1FKRA 4S3JA 2YSFA 4ODRA 3UF8A 2DWVA 5BXJA 4MNLA 2A3AA 2MNTA 2O9OA 2WK2A 5DEZA 2ZR6A 1FLCA 1JMQA 3RFWA 2DSVA 3WD4A 1FKBA 1WNOA 1NH6A 1E6PA 1ITXA 4HARA 4WKFA 3KCEA 4DRPA 3UI4A 1FKGA 2JX8A 1D7JA 1BKFA 3MQHA 3AS1A 4Z2IA 4MNMA 1OGBA 2ZR5A 2DSUA 3L4HA 3WKZA 2AOSA 1FD9A 4XAKA 4DZ2A 4P8XA 2FKEA 3NTPA 2PV2A 4TYOA 3CHDA 5E62A 3ARQA 4DROA 4KR0B 3IKDA 5CQ2A 2M8JA 2XPBA 3CGMA 1P5QA 4IQ2A 5E66A 1EIBA 3FY1A 4NNRA 1RP5A 3MCBB 5GPRA 2MF9A 2KI3A 2DT0A 2G8ZA 3OA5A 3WH0A 3TC5A 4PTMA 3KADA 4Z2HA 4DWSB 2JXWA 3NI6A 2MLXA 4R5EA 3CH9A 2XPAA 4Z2KA 1Y0OA 2JMFA 4L3NA 1W1VA 3CHFA 2WLYA 4P8WA 2ITKA 5HBFA 3JXVA 1HJWA 1T11A 3FSCA 1FKDA 1NWUA 2N87A 2DJYA 2OLHA 3WIJA 1LG1A 4ODKA 1YW5A 3KAHA 4JFMA 1XRVA 3PRDA 4IPXA 4E5RA 3WQWA 4LAVA 4MSPA 1O6IA 4Q7NA 3B9EA 5E64A 2FDMA 3ARUA 2ZQVA 2VCDA 3AQUA 3WD3A 1EQ3A 4JFIA 1KFWA 4W5UA 4NSBA 4DRKA 3UQIA 3KABA 4ML4A 1FAPA 4DRHA 1HKKA 3B9AA 1Q6HA 2XP7A 4DRMA 3IK8A 5HKGA 2QF8A 1J4HA 4QT3A 2PPOA 4DT4A 4W9OA 3FAPA 1TCOC 3ARWA 3CZ8A 3UI5A 1JVWA 3JYMA 5E65A 1N1AA 2WAEA 2YBTA 5HW8A 3ARYA 4JFLA 5HUAA 1FKJA 3ALFA 1HJVA 3UQAA 2FAPA 3O5OA 1ZBVA 1ZB5A 5B8IC 2XP5A 1EG3A 2L4JA 4DRNA 1W9PA 1M5YA 2BA1A 2ZAJA 4WIWA 3NRKA 4Z2LA 1TK7A 3MDYB 1QPLA 4ODNA 4MNJA 4ODLA 1J6YA 3WD0A 1Q6UA 2ZQUA 5E5WA 1D7IA 1ZL1A 1XHGA 3H9RB 2RURA 2XP4A 1NWTA 4ODMA 2KXQA 1I5HW 3LE4A 2LGOA 4JFJA 4WJXA 4A0UA 2M2AA 5GQBA 2OFNA 1WR7A 4G2PA 1D6OA 3EY6A 1H0IA 5DIVA 3TDBA 1GPFA 1E6ZA 2Q5AA 1QZ2A 1NWSA 1PINA 2XP8A 2DMVA 3TCZA 1RD6A 4WKHA 1C9HA 1WAWA 3UQBA 2LPVA 2RUQA 3ARVA 4HBEA 1UR8A 4REXA 2ZQSA 2WLZA 3AS2A 1K9RA 1HKIA 1K9QA 1EG4A 2DT3A 2QRVA 1FKHA 2K8IA 4ITZA 5DO2A 4TW6A 4IQCA 1F40A 4ODOA 1JNTA 2UZ5A 2EZ5W 3WL1A 4DWSD 1OGGA 2D9FA 1SYTA 2PPPA 3KACA 1UR9A 2DSWA 2F21A 1GOIA 3GPKA 5HT1A 1FKTA 4NZCA 1CTNA 4AY1A 4DIPA 1FKIA 1LL7A 1ZK6A 3JYJA 3KAGA 1GUVA 3PRAA 1Q1CA 1IX5A 1J4IA 2IUZA 3RGCA 5I98A 5HTGA 1EHNA 2LAJA 5DF0A 3RM9A 5DITA 1PBKA 1K9TA 3ARSA 2JZVA 2YBUA 2PV3A 5DIUA 3O5IA 1LQ0A 5HWCA 4ZPVR 4DZ3A 4R0XA 4FAPA 1JNSA 3LKXA 2M08A 3ARRA 3KAFA 1J4RA 3O5FA 4W9PA 3WD2A 1FKSA 1ZBCA 3QOKA 3MQGA 2ESCA 2G41A 2PV1A 2IF4A 3KAIA 4BF8A 1B6CA 2XP9A 1W9VA 3PQHA 3CGNA 1SR0A 4L72B 3WQVA 1KT1A 1R9HA 5AHTA 2DK7A 2MLZA 1D7HA 1X6NA 4MTVA 3ARZA 4QT2A 2PPNA 4J4NA 3LKXB 1ROUA 4JFKA 3FS8A 2KE0A 2RSEA 1F8AB 2M1IA 1L1PA 1FKKA 2XP6A 1WMVA 3I6CA 2RE3A 3M7NA 1QPFA 4N19A 1NMVA 5J6EA 2DG4A 3KZ7A 4C02B 2B31A 4URIA 2LJ4A 3AS0A 4DRIA 2RUDA 2DT2A 1VF8A 4DRJA 4TNSA 1HJXA 3O5RA 2MPHA 2M3OW 5U47A 2WADA 3O5JA 3CHEA 1Q6IA 4KQZA 4TW7A 1ZCNA 3O5DA 4ODPA 4LAWA 3AROA 1E6RA 2DG9A 4Z2JA 3ARTA 1W1YA 1FJDA 3O5QA 4LAYA 5HW6A 4ODQA 3ARPA 3O5MA 2M8IA 4JYSA 1YATA 4GLXA 1U79A 3W4RA 3FXYA 4U85A 4A0TA 3PRBA 2A3CA 1BL4A 1TR8A 4MAVA 1E9LA 3ODKA 1OWQA 2KO7A 1FKLA 5GPGA 1TFVA 3MCBA 3O5PA 2YSBA 2L2SA 3LUOA 3OOBA 1LL4A 2VN1A 2Y8NB 1A7XA 1X6LA 4IT6A 1ZU8A 4DRQA 3B8SA 4J4OA 1NWRA 1HXVA 2YSGA 3O5LA 2PBCA 2OWOA 4ZS6A 4FN2A 4DWSA 5JH8A 1NMWA 3ALGA 1W1TA 3G6LA 1FKFA 2DT1A 1EDQA 1ZBWA 4DWSC 2RQSA 1NSGA 4P8VA 2DPEA 3O5KA 2ZR4A 3RMEA 3IHZA 1KT0A 2XP3A 2DK1A 4MGVA 4U86A 2KFWA 1HKJA 2MLYA 4GGQA 4P8UA 3G6MA 2F2DA 3WD1A 3CHCA 3ARXA 5D75A 4TX0A 4W9QA 4MNKA 4QZVB 3BXWA 2YSIA 3O5EA 4G50A 2ZQTA 2A3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W26 A;  2LKN A;  5HW7 A;  1O6W A;  2KGJ A;  3PA7 A;  2RUC A;  3IKG A;  4GIV A;  2E45 A;  3CNG A;  2KR7 A;  5HWB A;  2MDI A;  2YSH A;  3UI6 A;  3M85 A;  2F4E A;  2AWG A;  1ROT A;  1EYM A;  4DH0 A;  4TW8 A;  4O2T A;  2Y78 A;  4QIB A;  2DG3 A;  3VAW A;  2JV4 A;  4LAX A;  3B7X A;  4U84 A;  3O5G A;  1FKR A;  2YSF A;  4ODR A;  3UF8 A;  2DWV A;  5BXJ A;  2MNT A;  2ZR6 A;  1JMQ A;  3RFW A;  1FKB A;  3KCE A;  4DRP A;  3UI4 A;  1FKG A;  2JX8 A;  1D7J A;  1BKF A;  2ZR5 A;  3L4H A;  4DZ2 A;  1FD9 A;  2FKE A;  3NTP A;  2PV2 A;  4TYO A;  4DRO A;  3IKD A;  5CQ2 A;  2M8J A;  3CGM A;  2XPB A;  1P5Q A;  4IQ2 A;  4NNR A;  2MF9 A;  2KI3 A;  3WH0 A;  3TC5 A;  3KAD A;  2JXW A;  3NI6 A;  2MLX A;  2XPA A;  1Y0O A;  2JMF A;  2ITK A;  3JXV A;  1T11 A;  1FKD A;  2N87 A;  2DJY A;  4ODK A;  1YW5 A;  3KAH A;  4JFM A;  3PRD A;  4IPX A;  4E5R A;  4LAV A;  4MSP A;  2ZQV A;  2VCD A;  1EQ3 A;  4JFI A;  4DRK A;  3UQI A;  3KAB A;  1FAP A;  4DRH A;  1Q6H A;  2XP7 A;  4DRM A;  3IK8 A;  5HKG A;  1J4H A;  4QT3 A;  2PPO A;  4DT4 A;  4W9O A;  3FAP A;  1TCO C;  3UI5 A;  1JVW A;  3JYM A;  1N1A A;  5HW8 A;  4JFL A;  5HUA A;  1FKJ A;  3UQA A;  2FAP A;  3O5O A;  5B8I C;  2XP5 A;  1EG3 A;  4DRN A;  2L4J A;  1M5Y A;  2BA1 A;  2ZAJ A;  3NRK A;  1TK7 A;  3MDY B;  1QPL A;  4ODN A;  4ODL A;  1J6Y A;  1Q6U A;  2ZQU A;  1D7I A;  3H9R B;  2RUR A;  2XP4 A;  4ODM A;  2KXQ A;  1I5H W;  3LE4 A;  2LGO A;  4JFJ A;  2M2A A;  2OFN A;  1WR7 A;  4G2P A;  1D6O A;  3EY6 A;  5DIV A;  3TDB A;  2Q5A A;  1QZ2 A;  1PIN A;  2XP8 A;  2DMV A;  3TCZ A;  1C9H A;  3UQB A;  2LPV A;  2RUQ A;  4REX A;  2ZQS A;  1K9R A;  1K9Q A;  1EG4 A;  1FKH A;  4ITZ A;  2K8I A;  1F40 A;  4TW6 A;  4IQC A;  4ODO A;  1JNT A;  2UZ5 A;  2EZ5 W;  2D9F A;  2PPP A;  3KAC A;  2F21 A;  3GPK A;  5HT1 A;  1FKT A;  4DIP A;  1FKI A;  1ZK6 A;  3JYJ A;  3KAG A;  1Q1C A;  1J4I A;  3RGC A;  5I98 A;  5HTG A;  2LAJ A;  5DIT A;  1PBK A;  2JZV A;  2PV3 A;  5DIU A;  3O5I A;  5HWC A;  4DZ3 A;  4R0X A;  4FAP A;  1JNS A;  2M08 A;  3KAF A;  1J4R A;  3O5F A;  4W9P A;  1FKS A;  2PV1 A;  2IF4 A;  3KAI A;  4BF8 A;  1B6C A;  2XP9 A;  3CGN A;  1KT1 A;  1R9H A;  5AHT A;  2DK7 A;  2MLZ A;  1D7H A;  4QT2 A;  2PPN A;  4J4N A;  4JFK A;  1ROU A;  2KE0 A;  2RSE A;  1F8A B;  2M1I A;  1L1P A;  1FKK A;  2XP6 A;  1WMV A;  3I6C A;  2RE3 A;  3M7N A;  1QPF A;  4N19 A;  1NMV A;  5J6E A;  2DG4 A;  3KZ7 A;  4C02 B;  2LJ4 A;  4DRI A;  2RUD A;  4DRJ A;  4TNS A;  3O5R A;  2MPH A;  2M3O W;  3O5J A;  1Q6I A;  4TW7 A;  1ZCN A;  3O5D A;  4ODP A;  4LAW A;  2DG9 A;  1FJD A;  3O5Q A;  4LAY A;  5HW6 A;  4ODQ A;  3O5M A;  2M8I A;  4JYS A;  1YAT A;  1U79 A;  4U85 A;  3PRB A;  1BL4 A;  3ODK A;  2KO7 A;  1FKL A;  5GPG A;  3O5P A;  2YSB A;  2L2S A;  3LUO A;  3OOB A;  2VN1 A;  1A7X A;  4DRQ A;  4J4O A;  1HXV A;  2YSG A;  3O5L A;  2PBC A;  4FN2 A;  1NMW A;  1FKF A;  2RQS A;  1NSG A;  3O5K A;  2ZR4 A;  3IHZ A;  1KT0 A;  2XP3 A;  2DK1 A;  4MGV A;  4U86 A;  2KFW A;  2MLY A;  4GGQ A;  2F2D A;  5D75 A;  4TX0 A;  4W9Q A;  3O5E A;  2YSI A;  4G50 A;  2ZQT A; 
#chains in the Genus database with same CATH topology
 4ZPW R;  1W26 A;  2P4V A;  4MPK A;  1LL6 A;  1FFQ A;  2LKN A;  5HW7 A;  3GU0 A;  1O6W A;  2KGJ A;  3PA7 A;  1HKM A;  3B9D A;  2RUC A;  4Z2G A;  3IKG A;  1W9U A;  3FSB A;  4S3K A;  1W1P A;  4WK9 A;  1WB0 A;  1E6N A;  3AS3 A;  4LGX A;  4GIV A;  1FFR A;  2E45 A;  3CNG A;  2KR7 A;  1E15 A;  1H0G A;  1JND A;  5HWB A;  2MDI A;  4ZPT R;  2DSZ A;  2YSH A;  1LG2 A;  3UI6 A;  2YAJ B;  3PR9 A;  4Q22 A;  3M85 A;  2F4E A;  2AWG A;  1ROT A;  1EYM A;  4DH0 A;  4TW8 A;  4O2T A;  4IT4 A;  2PI6 A;  4WKA A;  2Y78 A;  4QIB A;  2DG3 A;  4HBO A;  1ZBK A;  1JNE A;  3RM4 A;  2WM0 A;  2A3B A;  3VAW A;  3RM8 A;  2JV4 A;  1D2K A;  4LAX A;  3B7X A;  2O92 A;  1LJY A;  4U84 A;  3O5G A;  3WL0 A;  1FKR A;  4S3J A;  2YSF A;  4ODR A;  3UF8 A;  2DWV A;  5BXJ A;  4MNL A;  2A3A A;  2MNT A;  2O9O A;  2WK2 A;  5DEZ A;  2ZR6 A;  1FLC A;  1JMQ A;  3RFW A;  2DSV A;  3WD4 A;  1FKB A;  1WNO A;  1NH6 A;  1E6P A;  1ITX A;  4HAR A;  4WKF A;  3KCE A;  4DRP A;  3UI4 A;  1FKG A;  2JX8 A;  1D7J A;  1BKF A;  3MQH A;  3AS1 A;  4Z2I A;  4MNM A;  1OGB A;  2ZR5 A;  2DSU A;  3L4H A;  3WKZ A;  2AOS A;  1FD9 A;  4XAK A;  4DZ2 A;  4P8X A;  2FKE A;  3NTP A;  2PV2 A;  4TYO A;  3CHD A;  5E62 A;  3ARQ A;  4DRO A;  4KR0 B;  3IKD A;  5CQ2 A;  2M8J A;  2XPB A;  3CGM A;  1P5Q A;  4IQ2 A;  5E66 A;  1EIB A;  3FY1 A;  4NNR A;  1RP5 A;  3MCB B;  5GPR A;  2MF9 A;  2KI3 A;  2DT0 A;  2G8Z A;  3OA5 A;  3WH0 A;  3TC5 A;  1E44 A;  4PTM A;  3KAD A;  4Z2H A;  4DWS B;  2JXW A;  3NI6 A;  2MLX A;  4R5E A;  3CH9 A;  2XPA A;  4Z2K A;  2B5U B;  1Y0O A;  2JMF A;  4L3N A;  1W1V A;  3CHF A;  2WLY A;  4P8W A;  2ITK A;  5HBF A;  3JXV A;  1HJW A;  1T11 A;  3FSC A;  1FKD A;  1NWU A;  2N87 A;  2DJY A;  2OLH A;  3WIJ A;  1LG1 A;  4ODK A;  1YW5 A;  3KAH A;  4JFM A;  1XRV A;  3PRD A;  4IPX A;  4E5R A;  3WQW A;  4LAV A;  4MSP A;  1O6I A;  4Q7N A;  3B9E A;  5E64 A;  2FDM A;  4UDM A;  3ARU A;  2ZQV A;  2VCD A;  3AQU A;  3WD3 A;  1EQ3 A;  4JFI A;  1KFW A;  4W5U A;  4NSB A;  4DRK A;  3UQI A;  3KAB A;  4ML4 A;  1FAP A;  4DRH A;  1HKK A;  3B9A A;  1Q6H A;  2XP7 A;  4DRM A;  3IK8 A;  5HKG A;  1GRJ A;  2QF8 A;  1J4H A;  4QT3 A;  2PPO A;  4DT4 A;  4W9O A;  3FAP A;  1TCO C;  3ARW A;  3CZ8 A;  3UI5 A;  1JVW A;  3JYM A;  5E65 A;  1N1A A;  2WAE A;  2YBT A;  5HW8 A;  3ARY A;  4JFL A;  5HUA A;  1FKJ A;  3ALF A;  1HJV A;  3UQA A;  2FAP A;  3O5O A;  1ZBV A;  1ZB5 A;  5B8I C;  2XP5 A;  1EG3 A;  2L4J A;  4DRN A;  1W9P A;  1M5Y A;  2BA1 A;  2ZAJ A;  4WIW A;  3NRK A;  4Z2L A;  1TK7 A;  3MDY B;  1QPL A;  4ODN A;  4MNJ A;  4ODL A;  1J6Y A;  3WD0 A;  1Q6U A;  2ZQU A;  5E5W A;  1D7I A;  1ZL1 A;  1XHG A;  3H9R B;  2RUR A;  2XP4 A;  1NWT A;  4ODM A;  2KXQ A;  1I5H W;  3LE4 A;  2LGO A;  4JFJ A;  4WJX A;  4A0U A;  2M2A A;  5GQB A;  2OFN A;  1WR7 A;  4G2P A;  1D6O A;  3EY6 A;  1H0I A;  5DIV A;  3TDB A;  1GPF A;  1E6Z A;  2Q5A A;  1QZ2 A;  1NWS A;  1PIN A;  2XP8 A;  2DMV A;  3TCZ A;  1RD6 A;  4WKH A;  1C9H A;  1WAW A;  3UQB A;  2LPV A;  2RUQ A;  3ARV A;  4HBE A;  1UR8 A;  4REX A;  2ZQS A;  2WLZ A;  2F23 A;  3AS2 A;  1K9R A;  1HKI A;  1K9Q A;  1EG4 A;  2DT3 A;  2QRV A;  1FKH A;  2K8I A;  4ITZ A;  5DO2 A;  4TW6 A;  4IQC A;  1F40 A;  4ODO A;  1JNT A;  2UZ5 A;  2EZ5 W;  3WL1 A;  4DWS D;  1OGG A;  2D9F A;  1SYT A;  2PPP A;  3KAC A;  1UR9 A;  2DSW A;  2F21 A;  1GOI A;  3GPK A;  5HT1 A;  1FKT A;  4NZC A;  1CTN A;  4AY1 A;  4DIP A;  1FKI A;  1LL7 A;  1ZK6 A;  3JYJ A;  3KAG A;  1GUV A;  3PRA A;  1Q1C A;  1IX5 A;  1J4I A;  2IUZ A;  3RGC A;  5I98 A;  5HTG A;  1EHN A;  2LAJ A;  5DF0 A;  3RM9 A;  5DIT A;  1PBK A;  1K9T A;  3ARS A;  2JZV A;  2YBU A;  2PV3 A;  5DIU A;  3O5I A;  1LQ0 A;  5HWC A;  4ZPV R;  4DZ3 A;  2EUL A;  3GTY X;  4R0X A;  4FAP A;  2ETN A;  1JNS A;  3LKX A;  2M08 A;  3ARR A;  3KAF A;  1J4R A;  3O5F A;  4W9P A;  3WD2 A;  1FKS A;  1ZBC A;  3QOK A;  3MQG A;  2ESC A;  2G41 A;  2PV1 A;  2IF4 A;  3KAI A;  4BF8 A;  1B6C A;  2XP9 A;  1W9V A;  3PQH A;  3CGN A;  1SR0 A;  4L72 B;  3WQV A;  1KT1 A;  1R9H A;  5AHT A;  2DK7 A;  2MLZ A;  1D7H A;  1X6N A;  4MTV A;  3ARZ A;  4QT2 A;  2PPN A;  4J4N A;  3LKX B;  1ROU A;  4JFK A;  3FS8 A;  2KE0 A;  2RSE A;  1F8A B;  2M1I A;  1L1P A;  1FKK A;  2XP6 A;  1WMV A;  3I6C A;  2RE3 A;  3M7N A;  1QPF A;  4N19 A;  1NMV A;  5J6E A;  2DG4 A;  3KZ7 A;  1JCH B;  4C02 B;  2B31 A;  4URI A;  2LJ4 A;  3AS0 A;  4DRI A;  2RUD A;  2DT2 A;  1VF8 A;  4DRJ A;  4TNS A;  1HJX A;  3O5R A;  2MPH A;  2M3O W;  5U47 A;  2WAD A;  3O5J A;  3CHE A;  1Q6I A;  4KQZ A;  4TW7 A;  1ZCN A;  3O5D A;  4ODP A;  4LAW A;  3ARO A;  1E6R A;  2DG9 A;  4Z2J A;  3ART A;  1W1Y A;  1FJD A;  3O5Q A;  4LAY A;  5HW6 A;  4ODQ A;  3ARP A;  3O5M A;  2M8I A;  4JYS A;  1YAT A;  4GLX A;  1U79 A;  3W4R A;  3FXY A;  4U85 A;  4A0T A;  3PRB A;  2A3C A;  1BL4 A;  1TR8 A;  4MAV A;  1E9L A;  3ODK A;  1OWQ A;  2KO7 A;  1FKL A;  5GPG A;  1TFV A;  3MCB A;  3O5P A;  2YSB A;  2L2S A;  3LUO A;  3OOB A;  1LL4 A;  2VN1 A;  2Y8N B;  1A7X A;  1X6L A;  4IT6 A;  1ZU8 A;  4DRQ A;  3B8S A;  4J4O A;  1NWR A;  3BMB A;  1HXV A;  2YSG A;  3O5L A;  2PBC A;  2OWO A;  4ZS6 A;  4FN2 A;  4DWS A;  5JH8 A;  1NMW A;  3ALG A;  1W1T A;  3EIP A;  3G6L A;  1FKF A;  2DT1 A;  1EDQ A;  1ZBW A;  4DWS C;  2RQS A;  1NSG A;  4P8V A;  2DPE A;  3O5K A;  2ZR4 A;  3RME A;  3IHZ A;  1KT0 A;  2XP3 A;  2DK1 A;  4MGV A;  4U86 A;  2KFW A;  1HKJ A;  2MLY A;  4GGQ A;  4P8U A;  3G6M A;  2F2D A;  3WD1 A;  3CHC A;  3ARX A;  5D75 A;  4TX0 A;  4W9Q A;  4MNK A;  4QZV B;  3BXW A;  2YSI A;  3O5E A;  4G50 A;  2ZQT A;  2PN0 A;  2A3E A; 
#chains in the Genus database with same CATH homology
 4ZPW R;  1W26 A;  4MPK A;  1LL6 A;  1FFQ A;  2LKN A;  5HW7 A;  1O6W A;  2KGJ A;  3PA7 A;  1HKM A;  3B9D A;  2RUC A;  4Z2G A;  3IKG A;  1W9U A;  3FSB A;  4S3K A;  1W1P A;  4WK9 A;  1WB0 A;  1E6N A;  3AS3 A;  4LGX A;  4GIV A;  1FFR A;  2E45 A;  3CNG A;  2KR7 A;  1E15 A;  1H0G A;  1JND A;  5HWB A;  2MDI A;  4ZPT R;  2DSZ A;  2YSH A;  1LG2 A;  3UI6 A;  2YAJ B;  3PR9 A;  4Q22 A;  3M85 A;  2F4E A;  2AWG A;  1ROT A;  1EYM A;  4DH0 A;  4TW8 A;  4O2T A;  4IT4 A;  2PI6 A;  4WKA A;  2Y78 A;  4QIB A;  2DG3 A;  4HBO A;  1ZBK A;  1JNE A;  3RM4 A;  2WM0 A;  2A3B A;  3VAW A;  3RM8 A;  2JV4 A;  1D2K A;  4LAX A;  3B7X A;  2O92 A;  1LJY A;  4U84 A;  3O5G A;  3WL0 A;  1FKR A;  4S3J A;  2YSF A;  4ODR A;  3UF8 A;  2DWV A;  5BXJ A;  4MNL A;  2A3A A;  2MNT A;  2O9O A;  2WK2 A;  5DEZ A;  2ZR6 A;  1FLC A;  1JMQ A;  3RFW A;  2DSV A;  3WD4 A;  1FKB A;  1WNO A;  1NH6 A;  1E6P A;  1ITX A;  4HAR A;  4WKF A;  3KCE A;  4DRP A;  3UI4 A;  1FKG A;  2JX8 A;  1D7J A;  1BKF A;  3MQH A;  3AS1 A;  4Z2I A;  4MNM A;  1OGB A;  2ZR5 A;  2DSU A;  3L4H A;  3WKZ A;  2AOS A;  1FD9 A;  4XAK A;  4DZ2 A;  4P8X A;  2FKE A;  3NTP A;  2PV2 A;  4TYO A;  3CHD A;  5E62 A;  3ARQ A;  4DRO A;  4KR0 B;  3IKD A;  5CQ2 A;  2M8J A;  2XPB A;  3CGM A;  1P5Q A;  4IQ2 A;  5E66 A;  1EIB A;  3FY1 A;  4NNR A;  1RP5 A;  3MCB B;  5GPR A;  2MF9 A;  2KI3 A;  2DT0 A;  2G8Z A;  3OA5 A;  3WH0 A;  3TC5 A;  4PTM A;  3KAD A;  4Z2H A;  4DWS B;  2JXW A;  3NI6 A;  2MLX A;  4R5E A;  3CH9 A;  2XPA A;  4Z2K A;  1Y0O A;  2JMF A;  4L3N A;  1W1V A;  3CHF A;  2WLY A;  4P8W A;  2ITK A;  5HBF A;  3JXV A;  1HJW A;  1T11 A;  3FSC A;  1FKD A;  1NWU A;  2N87 A;  2DJY A;  2OLH A;  3WIJ A;  1LG1 A;  4ODK A;  1YW5 A;  3KAH A;  4JFM A;  1XRV A;  3PRD A;  4IPX A;  4E5R A;  3WQW A;  4LAV A;  4MSP A;  1O6I A;  4Q7N A;  3B9E A;  5E64 A;  2FDM A;  3ARU A;  2ZQV A;  2VCD A;  3AQU A;  3WD3 A;  1EQ3 A;  4JFI A;  1KFW A;  4W5U A;  4NSB A;  4DRK A;  3UQI A;  3KAB A;  4ML4 A;  1FAP A;  4DRH A;  1HKK A;  3B9A A;  1Q6H A;  2XP7 A;  4DRM A;  3IK8 A;  5HKG A;  2QF8 A;  1J4H A;  4QT3 A;  2PPO A;  4DT4 A;  4W9O A;  3FAP A;  1TCO C;  3ARW A;  3CZ8 A;  3UI5 A;  1JVW A;  3JYM A;  5E65 A;  1N1A A;  2WAE A;  2YBT A;  5HW8 A;  3ARY A;  4JFL A;  5HUA A;  1FKJ A;  3ALF A;  1HJV A;  3UQA A;  2FAP A;  3O5O A;  1ZBV A;  1ZB5 A;  5B8I C;  2XP5 A;  1EG3 A;  2L4J A;  4DRN A;  1W9P A;  1M5Y A;  2BA1 A;  2ZAJ A;  4WIW A;  3NRK A;  4Z2L A;  1TK7 A;  3MDY B;  1QPL A;  4ODN A;  4MNJ A;  4ODL A;  1J6Y A;  3WD0 A;  1Q6U A;  2ZQU A;  5E5W A;  1D7I A;  1ZL1 A;  1XHG A;  3H9R B;  2RUR A;  2XP4 A;  1NWT A;  4ODM A;  2KXQ A;  1I5H W;  3LE4 A;  2LGO A;  4JFJ A;  4WJX A;  4A0U A;  2M2A A;  5GQB A;  2OFN A;  1WR7 A;  4G2P A;  1D6O A;  3EY6 A;  1H0I A;  5DIV A;  3TDB A;  1GPF A;  1E6Z A;  2Q5A A;  1QZ2 A;  1NWS A;  1PIN A;  2XP8 A;  2DMV A;  3TCZ A;  1RD6 A;  4WKH A;  1C9H A;  1WAW A;  3UQB A;  2LPV A;  2RUQ A;  3ARV A;  4HBE A;  1UR8 A;  4REX A;  2ZQS A;  2WLZ A;  3AS2 A;  1K9R A;  1HKI A;  1K9Q A;  1EG4 A;  2DT3 A;  2QRV A;  1FKH A;  2K8I A;  4ITZ A;  5DO2 A;  4TW6 A;  4IQC A;  1F40 A;  4ODO A;  1JNT A;  2UZ5 A;  2EZ5 W;  3WL1 A;  4DWS D;  1OGG A;  2D9F A;  1SYT A;  2PPP A;  3KAC A;  1UR9 A;  2DSW A;  2F21 A;  1GOI A;  3GPK A;  5HT1 A;  1FKT A;  4NZC A;  1CTN A;  4AY1 A;  4DIP A;  1FKI A;  1LL7 A;  1ZK6 A;  3JYJ A;  3KAG A;  1GUV A;  3PRA A;  1Q1C A;  1IX5 A;  1J4I A;  2IUZ A;  3RGC A;  5I98 A;  5HTG A;  1EHN A;  2LAJ A;  5DF0 A;  3RM9 A;  5DIT A;  1PBK A;  1K9T A;  3ARS A;  2JZV A;  2YBU A;  2PV3 A;  5DIU A;  3O5I A;  1LQ0 A;  5HWC A;  4ZPV R;  4DZ3 A;  4R0X A;  4FAP A;  1JNS A;  3LKX A;  2M08 A;  3ARR A;  3KAF A;  1J4R A;  3O5F A;  4W9P A;  3WD2 A;  1FKS A;  1ZBC A;  3QOK A;  3MQG A;  2ESC A;  2G41 A;  2PV1 A;  2IF4 A;  3KAI A;  4BF8 A;  1B6C A;  2XP9 A;  1W9V A;  3PQH A;  3CGN A;  1SR0 A;  4L72 B;  3WQV A;  1KT1 A;  1R9H A;  5AHT A;  2DK7 A;  2MLZ A;  1D7H A;  1X6N A;  4MTV A;  3ARZ A;  4QT2 A;  2PPN A;  4J4N A;  3LKX B;  1ROU A;  4JFK A;  3FS8 A;  2KE0 A;  2RSE A;  1F8A B;  2M1I A;  1L1P A;  1FKK A;  2XP6 A;  1WMV A;  3I6C A;  2RE3 A;  3M7N A;  1QPF A;  4N19 A;  1NMV A;  5J6E A;  2DG4 A;  3KZ7 A;  4C02 B;  2B31 A;  4URI A;  2LJ4 A;  3AS0 A;  4DRI A;  2RUD A;  2DT2 A;  1VF8 A;  4DRJ A;  4TNS A;  1HJX A;  3O5R A;  2MPH A;  2M3O W;  5U47 A;  2WAD A;  3O5J A;  3CHE A;  1Q6I A;  4KQZ A;  4TW7 A;  1ZCN A;  3O5D A;  4ODP A;  4LAW A;  3ARO A;  1E6R A;  2DG9 A;  4Z2J A;  3ART A;  1W1Y A;  1FJD A;  3O5Q A;  4LAY A;  5HW6 A;  4ODQ A;  3ARP A;  3O5M A;  2M8I A;  4JYS A;  1YAT A;  4GLX A;  1U79 A;  3W4R A;  3FXY A;  4U85 A;  4A0T A;  3PRB A;  2A3C A;  1BL4 A;  1TR8 A;  4MAV A;  1E9L A;  3ODK A;  1OWQ A;  2KO7 A;  1FKL A;  5GPG A;  1TFV A;  3MCB A;  3O5P A;  2YSB A;  2L2S A;  3LUO A;  3OOB A;  1LL4 A;  2VN1 A;  2Y8N B;  1A7X A;  1X6L A;  4IT6 A;  1ZU8 A;  4DRQ A;  3B8S A;  4J4O A;  1NWR A;  1HXV A;  2YSG A;  3O5L A;  2PBC A;  2OWO A;  4ZS6 A;  4FN2 A;  4DWS A;  5JH8 A;  1NMW A;  3ALG A;  1W1T A;  3G6L A;  1FKF A;  2DT1 A;  1EDQ A;  1ZBW A;  4DWS C;  2RQS A;  1NSG A;  4P8V A;  2DPE A;  3O5K A;  2ZR4 A;  3RME A;  3IHZ A;  1KT0 A;  2XP3 A;  2DK1 A;  4MGV A;  4U86 A;  2KFW A;  1HKJ A;  2MLY A;  4GGQ A;  4P8U A;  3G6M A;  2F2D A;  3WD1 A;  3CHC A;  3ARX A;  5D75 A;  4TX0 A;  4W9Q A;  4MNK A;  4QZV B;  3BXW A;  2YSI A;  3O5E A;  4G50 A;  2ZQT A;  2A3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...