3KADA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMAKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 44
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kadA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kadA02
4DZ2A 2XP9A 4DRIA 4LAWA 5D75A 3ODKA 3KABA 4JFKA 4DZ3A 4LAVA 1FKDA 4W9QA 3LE4A 4DRQA 5B8IC 2XPAA 3CGMA 1M5YA 1KT0A 4JFLA 2RE3A 1EQ3A 1TK7A 5HKGA 2DK1A 1PBKA 4JFJA 4W9OA 3H9RB 2RUDA 1BL4A 4N19A 3KACA 1FKFA 1QZ2A 5HWCA 1TCOC 2ZAJA 1Q1CA 3PRDA 2FAPA 3IKDA 1F8AB 5I98A 2MLYA 3FAPA 2DWVA 2M8JA 4GIVA 1L1PA 4E5RA 1FKHA 3O5EA 1QPFA 2RUCA 3UF8A 2VCDA 1R9HA 2RSEA 3O5DA 4JFMA 2JXWA 2JX8A 1YATA 1D7IA 3EY6A 4U84A 4G50A 5HW6A 3TC5A 3B7XA 3O5PA 1EYMA 3O5JA 4QT3A 2YSBA 5HTGA 4JFIA 1F40A 5CQ2A 2LJ4A 2DJYA 3MDYB 3O5KA 4FN2A 3UQBA 4DRHA 1J4IA 3GPKA 2MLXA 1FKIA 1ROUA 2XP6A 4LAXA 4LAYA 1FD9A 2DG9A 1QPLA 1J4HA 4QIBA 2Q5AA 3JXVA 5HUAA 4ODLA 4DRKA 2YSGA 4DRJA 1FKBA 4ODKA 3KAIA 1A7XA 2MLZA 2XP8A 4TW7A 1T11A 1ZK6A 1FKKA 5DIUA 4ODOA 2PV3A 3UQAA 3NRKA 1ZCNA 1Q6IA 2KO7A 4ITZA 2XP5A 3TDBA 2OFNA 3UI4A 4DROA 1J6YA 3KZ7A 1B6CA 2EZ5W 1BKFA 5AHTA 2RUQA 4W9PA 2F4EA 2ZQVA 2E45A 4DRMA 4ODMA 1KT1A 4TW6A 1FJDA 3KAGA 3I6CA 3NI6A 4QT2A 2LPVA 1K9RA 3UQIA 4DRNA 5HW7A 1P5QA 3KCEA 2F21A 1NMVA 2VN1A 3M85A 3PRBA 2PV2A 3RFWA 4IQ2A 3IHZA 5HWBA 1YW5A 2PPNA 5GPGA 4IPXA 4TNSA 3LUOA 3WH0A 4REXA 2FKEA 2MPHA 4DT4A 2RQSA 4DH0A 1FKLA 2UZ5A 1U79A 2YSIA 4C02B 2Y78A 4DRPA 1Y0OA 5DITA 1J4RA 3RGCA 2N87A 2KFWA 3KAFA 2DG3A 3UI5A 2IF4A 3O5RA 1D6OA 1JVWA 2M2AA 2DG4A 2MDIA 1JMQA 4TW8A 4R0XA 2KI3A 4FAPA 2ZR6A 3O5LA 1W26A 3O5QA 1Q6UA 2M1IA 4JYSA 4TYOA 3O5IA 2LKNA 2PPPA 1EG4A 4DIPA 4NNRA 5HT1A 1O6WA 2PPOA 3O5MA 1HXVA 5BXJA 3IKGA 1K9QA 3CNGA 1NMWA 4ODPA 2XP4A 4BF8A 1WR7A 2LGOA 4ODRA 2XP7A 2ZR4A 2ITKA 1I5HW 4ODNA 1FKTA 3UI6A 2F2DA 3NTPA 2LAJA 2M8IA 2XP3A 2L4JA 2M3OW 4G2PA 5J6EA 4U86A 2JZVA 5HW8A 2MF9A 2ZR5A 2JMFA 3KAHA 1N1AA 1FAPA 3JYJA 4TX0A 2D9FA 1NSGA 4ODQA 2MNTA 4J4NA 1FKSA 3JYMA 1FKRA 3M7NA 2BA1A 5DIVA 3IK8A 2PBCA 3VAWA 2ZQTA 1FKGA 3O5OA 2KXQA 4O2TA 2KE0A 4MGVA 4GGQA 3PA7A 1JNSA 3CGNA 4U85A 2AWGA 2DMVA 3O5GA 1FKJA 4IQCA 2L2SA 1PINA 2DK7A 2KGJA 3KADA 3O5FA 2K8IA 1Q6HA 2KR7A 1EG3A 2YSHA 4MSPA 3L4HA 1C9HA 1D7HA 1WMVA 2ZQSA 2M08A 2XPBA 2YSFA 1ROTA 2ZQUA 2JV4A 4J4OA 2PV1A 3OOBA 1D7JA 2RURA 1JNTA 3TCZA
chains in the Genus database with same CATH superfamily
4DZ2A 2XP9A 4DRIA 4LAWA 1SYTA 2YBTA 5D75A 3ODKA 2DT3A 1HKIA 3KABA 2O9OA 2Y8NB 4JFKA 4L3NA 1HKKA 4DZ3A 4LAVA 5GPRA 1FKDA 3FSBA 2OWOA 1W1YA 4W9QA 3LE4A 2WM0A 4QZVB 4DRQA 5B8IC 3AS0A 2XPAA 4NZCA 1RD6A 3CGMA 1M5YA 1KT0A 1UR8A 4JFLA 3BXWA 3ARXA 2RE3A 5DF0A 1EQ3A 1TK7A 5HKGA 2DK1A 2A3AA 1PBKA 4P8XA 3AQUA 3ARSA 4Z2IA 3AS3A 4JFJA 4W9OA 1LL6A 3WD3A 3WKZA 3H9RB 2RUDA 1BL4A 3CHEA 4N19A 3KACA 1FLCA 1FKFA 1QZ2A 1W1VA 5HWCA 1D2KA 1TCOC 2ZAJA 1Q1CA 3PRDA 2FAPA 3IKDA 4Z2GA 1F8AB 5I98A 2MLYA 3FAPA 2F23A 3GU0A 1E6NA 1H0IA 2DWVA 4Q22A 1LG1A 2M8JA 3QOKA 4GIVA 1RP5A 1L1PA 4E5RA 1FKHA 5DO2A 3O5EA 4S3JA 2O92A 1QPFA 2RUCA 4LGXA 4MNMA 4A0TA 3RM9A 3UF8A 2VCDA 1R9HA 2RSEA 3O5DA 1HJVA 4JFMA 2JXWA 2JX8A 4MNLA 1YATA 1D7IA 4DWSA 1LJYA 1LL7A 3EY6A 4U84A 4WKAA 4G50A 5HW6A 3ARZA 1LG2A 5E64A 3WL0A 3ARPA 3TC5A 3B7XA 3O5PA 2DSUA 1EYMA 3O5JA 4QT3A 3WQWA 2YSBA 5HTGA 5DEZA 4JFIA 5U47A 1F40A 1ZBKA 5CQ2A 2LJ4A 2DJYA 3MDYB 4ML4A 3O5KA 1ZBCA 2DT2A 3CHDA 4FN2A 3UQBA 3CH9A 4DRHA 1NWRA 3RM8A 1J4IA 1E6ZA 3GPKA 4URIA 3WD0A 2MLXA 1FKIA 1ROUA 2XP6A 1W9PA 4LAXA 3MQHA 3ARWA 1GPFA 4LAYA 5GQBA 1E9LA 1FFRA 5E66A 1FD9A 2DG9A 4KQZA 1OGBA 1QPLA 4WIWA 1GUVA 1J4HA 1HJXA 4QIBA 2Q5AA 1GOIA 4HARA 3JXVA 2OLHA 5HUAA 3MCBA 4ODLA 3CHCA 2A3EA 2YSGA 3PRAA 4DRJA 4DRKA 4DWSB 1FKBA 3B9AA 4ODKA 3KAIA 4L72B 1OGGA 1A7XA 4HBOA 2MLZA 2XP8A 4TW7A 1T11A 1ZK6A 1FKKA 2FDMA 2WLZA 1TR8A 5DIUA 1W9UA 4ODOA 4GLXA 1HJWA 2PV3A 3UQAA 1K9TA 3NRKA 1ZCNA 1Q6IA 2QRVA 2KO7A 4ITZA 1ZU8A 2XP5A 4HBEA 2YAJB 3WD1A 4Q7NA 3TDBA 2OFNA 3UI4A 4DROA 1J6YA 3KZ7A 1B6CA 2EZ5W 3OA5A 1BKFA 5AHTA 2RUQA 4Z2HA 4W9PA 1NH6A 2F4EA 2ZQVA 2E45A 2A3CA 4DRMA 4ODMA 1HKJA 1KT1A 4TW6A 2DT0A 3KAGA 3I6CA 1FJDA 3NI6A 1W9VA 4QT2A 3MCBB 1WB0A 1K9RA 2LPVA 3ARYA 3FY1A 3UQIA 3CHFA 4DRNA 5HW7A 1EHNA 2PN0A 1P5QA 2DT1A 4WK9A 3KCEA 3MQGA 2F21A 1UR9A 1NMVA 3GTYX 3B9EA 1ZL1A 2VN1A 3CZ8A 3M85A 3PRBA 2PV2A 2WAEA 3G6LA 3RFWA 4IQ2A 3IHZA 2G41A 5HWBA 1YW5A 2PPNA 5GPGA 4IPXA 4TNSA 3LUOA 4Z2KA 1E15A 3WH0A 2P4VA 2EULA 4REXA 2A3BA 2FKEA 2MPHA 4DT4A 2RQSA 4DH0A 1FKLA 4MNJA 1JNEA 1U79A 2YSIA 2UZ5A 4C02B 3AS1A 2Y78A 2B31A 1SR0A 4DRPA 1Y0OA 1ZB5A 5DITA 1J4RA 3RGCA 2N87A 2KFWA 4P8WA 3KAFA 2DG3A 1IX5A 4IT6A 3B8SA 4UDMA 3UI5A 2PI6A 2IF4A 3O5RA 1KFWA 1D6OA 3AS2A 1JVWA 2M2AA 2DG4A 2MDIA 1JMQA 4TW8A 1HKMA 4KR0B 4R0XA 1OWQA 2KI3A 1GRJA 1ZBVA 4FAPA 2ZR6A 3O5LA 1W26A 3O5QA 1VF8A 1Q6UA 2M1IA 4JYSA 4WKFA 1X6NA 3FSCA 4TYOA 3O5IA 2LKNA 2AOSA 2PPPA 1EG4A 4DIPA 4NNRA 4W5UA 5HT1A 1O6WA 4MAVA 2PPOA 3O5MA 1HXVA 5BXJA 1E6PA 3IKGA 3ARRA 4WJXA 2DSWA 1X6LA 1K9QA 3CNGA 3W4RA 4ZPTR 1NMWA 2QF8A 4ODPA 1E6RA 2XP4A 4BF8A 3B9DA 4ZS6A 5E62A 1LL4A 1WR7A 1WNOA 3PQHA 3WQVA 4AY1A 4MNKA 1O6IA 4IT4A 1XHGA 3FXYA 2LGOA 2XP7A 2ZR4A 4ODRA 2ITKA 3ARTA 4ZPVR 2YBUA 1I5HW 4ODNA 1FKTA 3UI6A 2F2DA 4MPKA 3NTPA 2LAJA 1H0GA 2M8IA 2XP3A 3G6MA 2L4JA 3ALFA 2M3OW 4G2PA 4MTVA 1E44A 1W1PA 5J6EA 1EIBA 4U86A 2JZVA 5HW8A 3WIJA 2MF9A 4DWSC 2ZR5A 2IUZA 2JMFA 1JCHB 3KAHA 1N1AA 1FAPA 3RMEA 3PR9A 4ZPWR 1FFQA 3JYJA 3AROA 3LKXA 4TX0A 4R5EA 2WADA 2D9FA 3ALGA 1NSGA 4ODQA 2MNTA 4J4NA 1FKSA 4Z2JA 2ESCA 3WD4A 3JYMA 1FKRA 4P8VA 5HBFA 2ETNA 3BMBA 1JNDA 3M7NA 4A0UA 2BA1A 5DIVA 1NWTA 3IK8A 2DPEA 2PBCA 3WD2A 5JH8A 3VAWA 2ZQTA 3FS8A 5E65A 1ZBWA 2DSZA 1NWUA 4NSBA 1FKGA 1XRVA 3O5OA 4S3KA 2KXQA 3EIPA 4O2TA 2KE0A 4MGVA 1CTNA 4GGQA 3PA7A 4Z2LA 1JNSA 2WK2A 2WLYA 3CGNA 2DSVA 4U85A 2AWGA 4PTMA 2DMVA 3O5GA 1FKJA 4IQCA 1NWSA 2L2SA 1PINA 2DK7A 3RM4A 2KGJA 3KADA 1EDQA 3O5FA 2K8IA 1Q6HA 1W1TA 2KR7A 1EG3A 2B5UB 2YSHA 3LKXB 3ARQA 4WKHA 4MSPA 3ARUA 3L4HA 1C9HA 1D7HA 1WMVA 4P8UA 1ITXA 2ZQSA 2G8ZA 2M08A 2XPBA 4XAKA 1LQ0A 2YSFA 3WL1A 1ROTA 4DWSD 2ZQUA 2JV4A 4J4OA 2PV1A 3ARVA 1TFVA 3OOBA 1D7JA 2RURA 1WAWA 5E5WA 1JNTA 3TCZA
chains in the Genus database with same CATH topology
4DZ2A 2XP9A 4DRIA 4LAWA 1SYTA 2YBTA 5D75A 3ODKA 2DT3A 1HKIA 3KABA 2O9OA 2Y8NB 4JFKA 4L3NA 1HKKA 4DZ3A 4LAVA 5GPRA 1FKDA 3FSBA 2OWOA 1W1YA 4W9QA 3LE4A 2WM0A 4QZVB 4DRQA 5B8IC 3AS0A 2XPAA 4NZCA 1RD6A 3CGMA 1M5YA 1KT0A 1UR8A 4JFLA 3BXWA 3ARXA 2RE3A 5DF0A 1EQ3A 1TK7A 5HKGA 2DK1A 2A3AA 1PBKA 4P8XA 3AQUA 3ARSA 4Z2IA 3AS3A 4JFJA 4W9OA 1LL6A 3WD3A 3WKZA 3H9RB 2RUDA 1BL4A 3CHEA 4N19A 3KACA 1FLCA 1FKFA 1QZ2A 1W1VA 5HWCA 1D2KA 1TCOC 2ZAJA 1Q1CA 3PRDA 2FAPA 3IKDA 4Z2GA 1F8AB 5I98A 2MLYA 3FAPA 1E6NA 1H0IA 2DWVA 4Q22A 1LG1A 2M8JA 3QOKA 4GIVA 1RP5A 1L1PA 4E5RA 1FKHA 5DO2A 3O5EA 4S3JA 2O92A 1QPFA 2RUCA 4LGXA 4MNMA 4A0TA 3RM9A 3UF8A 2VCDA 1R9HA 2RSEA 3O5DA 1HJVA 4JFMA 2JXWA 2JX8A 4MNLA 1YATA 1D7IA 4DWSA 1LJYA 1LL7A 3EY6A 4U84A 4WKAA 4G50A 5HW6A 3ARZA 1LG2A 5E64A 3WL0A 3ARPA 3TC5A 3B7XA 3O5PA 2DSUA 1EYMA 3O5JA 4QT3A 3WQWA 2YSBA 5HTGA 5DEZA 4JFIA 5U47A 1F40A 1ZBKA 5CQ2A 2LJ4A 2DJYA 3MDYB 4ML4A 3O5KA 1ZBCA 2DT2A 3CHDA 4FN2A 3UQBA 3CH9A 4DRHA 1NWRA 3RM8A 1J4IA 1E6ZA 3GPKA 4URIA 3WD0A 2MLXA 1FKIA 1ROUA 2XP6A 1W9PA 4LAXA 3MQHA 3ARWA 1GPFA 4LAYA 5GQBA 1E9LA 1FFRA 5E66A 1FD9A 2DG9A 4KQZA 1OGBA 1QPLA 4WIWA 1GUVA 1J4HA 1HJXA 4QIBA 2Q5AA 1GOIA 4HARA 3JXVA 2OLHA 5HUAA 3MCBA 4ODLA 3CHCA 2A3EA 2YSGA 3PRAA 4DRJA 4DRKA 4DWSB 1FKBA 3B9AA 4ODKA 3KAIA 4L72B 1OGGA 1A7XA 4HBOA 2MLZA 2XP8A 4TW7A 1T11A 1ZK6A 1FKKA 2FDMA 2WLZA 1TR8A 5DIUA 1W9UA 4ODOA 4GLXA 1HJWA 2PV3A 3UQAA 1K9TA 3NRKA 1ZCNA 1Q6IA 2QRVA 2KO7A 4ITZA 1ZU8A 2XP5A 4HBEA 2YAJB 3WD1A 4Q7NA 3TDBA 2OFNA 3UI4A 4DROA 1J6YA 3KZ7A 1B6CA 2EZ5W 3OA5A 1BKFA 5AHTA 2RUQA 4Z2HA 4W9PA 1NH6A 2F4EA 2ZQVA 2E45A 2A3CA 4DRMA 4ODMA 1HKJA 1KT1A 4TW6A 2DT0A 3KAGA 3I6CA 1FJDA 3NI6A 1W9VA 4QT2A 3MCBB 1WB0A 1K9RA 2LPVA 3ARYA 3FY1A 3UQIA 3CHFA 4DRNA 5HW7A 1EHNA 1P5QA 2DT1A 4WK9A 3KCEA 3MQGA 2F21A 1UR9A 1NMVA 3B9EA 1ZL1A 2VN1A 3CZ8A 3M85A 3PRBA 2PV2A 2WAEA 3G6LA 3RFWA 4IQ2A 3IHZA 2G41A 5HWBA 1YW5A 2PPNA 5GPGA 4IPXA 4TNSA 3LUOA 4Z2KA 1E15A 3WH0A 4REXA 2A3BA 2FKEA 2MPHA 4DT4A 2RQSA 4DH0A 1FKLA 4MNJA 1JNEA 1U79A 2YSIA 2UZ5A 4C02B 3AS1A 2Y78A 2B31A 1SR0A 4DRPA 1Y0OA 1ZB5A 5DITA 1J4RA 3RGCA 2N87A 2KFWA 4P8WA 3KAFA 2DG3A 1IX5A 4IT6A 3B8SA 3UI5A 2PI6A 2IF4A 3O5RA 1KFWA 1D6OA 3AS2A 1JVWA 2M2AA 2DG4A 2MDIA 1JMQA 4TW8A 1HKMA 4KR0B 4R0XA 1OWQA 2KI3A 1ZBVA 4FAPA 2ZR6A 3O5LA 1W26A 3O5QA 1VF8A 1Q6UA 2M1IA 4JYSA 4WKFA 1X6NA 3FSCA 4TYOA 3O5IA 2LKNA 2AOSA 2PPPA 1EG4A 4DIPA 4NNRA 4W5UA 5HT1A 1O6WA 4MAVA 2PPOA 3O5MA 1HXVA 5BXJA 1E6PA 3IKGA 3ARRA 4WJXA 2DSWA 1X6LA 1K9QA 3CNGA 3W4RA 4ZPTR 1NMWA 2QF8A 4ODPA 1E6RA 2XP4A 4BF8A 3B9DA 4ZS6A 5E62A 1LL4A 1WR7A 1WNOA 3PQHA 3WQVA 4AY1A 4MNKA 1O6IA 4IT4A 1XHGA 3FXYA 2LGOA 2XP7A 2ZR4A 4ODRA 2ITKA 3ARTA 4ZPVR 2YBUA 1I5HW 4ODNA 1FKTA 3UI6A 2F2DA 4MPKA 3NTPA 2LAJA 1H0GA 2M8IA 2XP3A 3G6MA 2L4JA 3ALFA 2M3OW 4G2PA 4MTVA 1W1PA 5J6EA 1EIBA 4U86A 2JZVA 5HW8A 3WIJA 2MF9A 4DWSC 2ZR5A 2IUZA 2JMFA 3KAHA 1N1AA 1FAPA 3RMEA 3PR9A 4ZPWR 1FFQA 3JYJA 3AROA 3LKXA 4TX0A 4R5EA 2WADA 2D9FA 3ALGA 1NSGA 4ODQA 2MNTA 4J4NA 1FKSA 4Z2JA 2ESCA 3WD4A 3JYMA 1FKRA 4P8VA 5HBFA 1JNDA 3M7NA 4A0UA 2BA1A 5DIVA 1NWTA 3IK8A 2DPEA 2PBCA 3WD2A 5JH8A 3VAWA 2ZQTA 3FS8A 5E65A 1ZBWA 2DSZA 1NWUA 4NSBA 1FKGA 1XRVA 3O5OA 4S3KA 2KXQA 4O2TA 2KE0A 4MGVA 1CTNA 4GGQA 3PA7A 4Z2LA 1JNSA 2WK2A 2WLYA 3CGNA 2DSVA 4U85A 2AWGA 4PTMA 2DMVA 3O5GA 1FKJA 4IQCA 1NWSA 2L2SA 1PINA 2DK7A 3RM4A 2KGJA 3KADA 1EDQA 3O5FA 2K8IA 1Q6HA 1W1TA 2KR7A 1EG3A 2YSHA 3LKXB 3ARQA 4WKHA 4MSPA 3ARUA 3L4HA 1C9HA 1D7HA 1WMVA 4P8UA 1ITXA 2ZQSA 2G8ZA 2M08A 2XPBA 4XAKA 1LQ0A 2YSFA 3WL1A 1ROTA 4DWSD 2ZQUA 2JV4A 4J4OA 2PV1A 3ARVA 1TFVA 3OOBA 1D7JA 2RURA 1WAWA 5E5WA 1JNTA 3TCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DZ2 A;  2XP9 A;  4DRI A;  4LAW A;  5D75 A;  3ODK A;  3KAB A;  4JFK A;  4DZ3 A;  4LAV A;  1FKD A;  4W9Q A;  3LE4 A;  4DRQ A;  5B8I C;  2XPA A;  3CGM A;  1M5Y A;  1KT0 A;  4JFL A;  2RE3 A;  1EQ3 A;  1TK7 A;  5HKG A;  2DK1 A;  1PBK A;  4JFJ A;  4W9O A;  3H9R B;  2RUD A;  1BL4 A;  4N19 A;  3KAC A;  1FKF A;  1QZ2 A;  5HWC A;  1TCO C;  2ZAJ A;  1Q1C A;  3PRD A;  2FAP A;  3IKD A;  1F8A B;  5I98 A;  2MLY A;  3FAP A;  2DWV A;  2M8J A;  4GIV A;  1L1P A;  4E5R A;  1FKH A;  3O5E A;  1QPF A;  2RUC A;  3UF8 A;  2VCD A;  1R9H A;  2RSE A;  3O5D A;  4JFM A;  2JXW A;  2JX8 A;  1YAT A;  1D7I A;  3EY6 A;  4U84 A;  4G50 A;  5HW6 A;  3TC5 A;  3B7X A;  3O5P A;  1EYM A;  3O5J A;  4QT3 A;  2YSB A;  5HTG A;  4JFI A;  1F40 A;  5CQ2 A;  2LJ4 A;  2DJY A;  3MDY B;  3O5K A;  4FN2 A;  3UQB A;  4DRH A;  1J4I A;  3GPK A;  2MLX A;  1FKI A;  1ROU A;  2XP6 A;  4LAX A;  4LAY A;  1FD9 A;  2DG9 A;  1QPL A;  1J4H A;  4QIB A;  2Q5A A;  3JXV A;  5HUA A;  4ODL A;  4DRK A;  2YSG A;  4DRJ A;  1FKB A;  4ODK A;  3KAI A;  1A7X A;  2MLZ A;  2XP8 A;  4TW7 A;  1T11 A;  1ZK6 A;  1FKK A;  5DIU A;  4ODO A;  2PV3 A;  3UQA A;  3NRK A;  1ZCN A;  1Q6I A;  2KO7 A;  4ITZ A;  2XP5 A;  3TDB A;  2OFN A;  3UI4 A;  4DRO A;  1J6Y A;  3KZ7 A;  1B6C A;  2EZ5 W;  1BKF A;  5AHT A;  2RUQ A;  4W9P A;  2F4E A;  2ZQV A;  2E45 A;  4DRM A;  4ODM A;  1KT1 A;  4TW6 A;  1FJD A;  3KAG A;  3I6C A;  3NI6 A;  4QT2 A;  2LPV A;  1K9R A;  3UQI A;  4DRN A;  5HW7 A;  1P5Q A;  3KCE A;  2F21 A;  1NMV A;  2VN1 A;  3M85 A;  3PRB A;  2PV2 A;  3RFW A;  4IQ2 A;  3IHZ A;  5HWB A;  1YW5 A;  2PPN A;  5GPG A;  4IPX A;  4TNS A;  3LUO A;  3WH0 A;  4REX A;  2FKE A;  2MPH A;  4DT4 A;  2RQS A;  4DH0 A;  1FKL A;  2UZ5 A;  1U79 A;  2YSI A;  4C02 B;  2Y78 A;  4DRP A;  1Y0O A;  5DIT A;  1J4R A;  3RGC A;  2N87 A;  2KFW A;  3KAF A;  2DG3 A;  3UI5 A;  2IF4 A;  3O5R A;  1D6O A;  1JVW A;  2M2A A;  2DG4 A;  2MDI A;  1JMQ A;  4TW8 A;  4R0X A;  2KI3 A;  4FAP A;  2ZR6 A;  3O5L A;  1W26 A;  3O5Q A;  1Q6U A;  2M1I A;  4JYS A;  4TYO A;  3O5I A;  2LKN A;  2PPP A;  1EG4 A;  4DIP A;  4NNR A;  5HT1 A;  1O6W A;  2PPO A;  3O5M A;  1HXV A;  5BXJ A;  3IKG A;  1K9Q A;  3CNG A;  1NMW A;  4ODP A;  2XP4 A;  4BF8 A;  1WR7 A;  2LGO A;  4ODR A;  2XP7 A;  2ZR4 A;  2ITK A;  1I5H W;  4ODN A;  1FKT A;  3UI6 A;  2F2D A;  3NTP A;  2LAJ A;  2M8I A;  2XP3 A;  2L4J A;  2M3O W;  4G2P A;  5J6E A;  4U86 A;  2JZV A;  5HW8 A;  2MF9 A;  2ZR5 A;  2JMF A;  3KAH A;  1N1A A;  1FAP A;  3JYJ A;  4TX0 A;  2D9F A;  1NSG A;  4ODQ A;  2MNT A;  4J4N A;  1FKS A;  3JYM A;  1FKR A;  3M7N A;  2BA1 A;  5DIV A;  3IK8 A;  2PBC A;  3VAW A;  2ZQT A;  1FKG A;  3O5O A;  2KXQ A;  4O2T A;  2KE0 A;  4MGV A;  4GGQ A;  3PA7 A;  1JNS A;  3CGN A;  4U85 A;  2AWG A;  2DMV A;  3O5G A;  1FKJ A;  4IQC A;  2L2S A;  1PIN A;  2DK7 A;  2KGJ A;  3KAD A;  3O5F A;  2K8I A;  1Q6H A;  2KR7 A;  1EG3 A;  2YSH A;  4MSP A;  3L4H A;  1C9H A;  1D7H A;  1WMV A;  2ZQS A;  2M08 A;  2XPB A;  2YSF A;  1ROT A;  2ZQU A;  2JV4 A;  4J4O A;  2PV1 A;  3OOB A;  1D7J A;  2RUR A;  1JNT A;  3TCZ A; 
#chains in the Genus database with same CATH topology
 4DZ2 A;  2XP9 A;  4DRI A;  4LAW A;  1SYT A;  2YBT A;  5D75 A;  3ODK A;  2DT3 A;  1HKI A;  3KAB A;  2O9O A;  2Y8N B;  4JFK A;  4L3N A;  1HKK A;  4DZ3 A;  4LAV A;  5GPR A;  1FKD A;  3FSB A;  2OWO A;  1W1Y A;  4W9Q A;  3LE4 A;  2WM0 A;  4QZV B;  4DRQ A;  5B8I C;  3AS0 A;  2XPA A;  4NZC A;  1RD6 A;  3CGM A;  1M5Y A;  1KT0 A;  1UR8 A;  4JFL A;  3BXW A;  3ARX A;  2RE3 A;  5DF0 A;  1EQ3 A;  1TK7 A;  5HKG A;  2DK1 A;  2A3A A;  1PBK A;  4P8X A;  3AQU A;  3ARS A;  4Z2I A;  3AS3 A;  4JFJ A;  4W9O A;  1LL6 A;  3WD3 A;  3WKZ A;  3H9R B;  2RUD A;  1BL4 A;  3CHE A;  4N19 A;  3KAC A;  1FLC A;  1FKF A;  1QZ2 A;  1W1V A;  5HWC A;  1D2K A;  1TCO C;  2ZAJ A;  1Q1C A;  3PRD A;  2FAP A;  3IKD A;  4Z2G A;  1F8A B;  5I98 A;  2MLY A;  3FAP A;  2F23 A;  3GU0 A;  1E6N A;  1H0I A;  2DWV A;  4Q22 A;  1LG1 A;  2M8J A;  3QOK A;  4GIV A;  1RP5 A;  1L1P A;  4E5R A;  1FKH A;  5DO2 A;  3O5E A;  4S3J A;  2O92 A;  1QPF A;  2RUC A;  4LGX A;  4MNM A;  4A0T A;  3RM9 A;  3UF8 A;  2VCD A;  1R9H A;  2RSE A;  3O5D A;  1HJV A;  4JFM A;  2JXW A;  2JX8 A;  4MNL A;  1YAT A;  1D7I A;  4DWS A;  1LJY A;  1LL7 A;  3EY6 A;  4U84 A;  4WKA A;  4G50 A;  5HW6 A;  3ARZ A;  1LG2 A;  5E64 A;  3WL0 A;  3ARP A;  3TC5 A;  3B7X A;  3O5P A;  2DSU A;  1EYM A;  3O5J A;  4QT3 A;  3WQW A;  2YSB A;  5HTG A;  5DEZ A;  4JFI A;  5U47 A;  1F40 A;  1ZBK A;  5CQ2 A;  2LJ4 A;  2DJY A;  3MDY B;  4ML4 A;  3O5K A;  1ZBC A;  2DT2 A;  3CHD A;  4FN2 A;  3UQB A;  3CH9 A;  4DRH A;  1NWR A;  3RM8 A;  1J4I A;  1E6Z A;  3GPK A;  4URI A;  3WD0 A;  2MLX A;  1FKI A;  1ROU A;  2XP6 A;  1W9P A;  4LAX A;  3MQH A;  3ARW A;  1GPF A;  4LAY A;  5GQB A;  1E9L A;  1FFR A;  5E66 A;  1FD9 A;  2DG9 A;  4KQZ A;  1OGB A;  1QPL A;  4WIW A;  1GUV A;  1J4H A;  1HJX A;  4QIB A;  2Q5A A;  1GOI A;  4HAR A;  3JXV A;  2OLH A;  5HUA A;  3MCB A;  4ODL A;  3CHC A;  2A3E A;  2YSG A;  3PRA A;  4DRJ A;  4DRK A;  4DWS B;  1FKB A;  3B9A A;  4ODK A;  3KAI A;  4L72 B;  1OGG A;  1A7X A;  4HBO A;  2MLZ A;  2XP8 A;  4TW7 A;  1T11 A;  1ZK6 A;  1FKK A;  2FDM A;  2WLZ A;  1TR8 A;  5DIU A;  1W9U A;  4ODO A;  4GLX A;  1HJW A;  2PV3 A;  3UQA A;  1K9T A;  3NRK A;  1ZCN A;  1Q6I A;  2QRV A;  2KO7 A;  4ITZ A;  1ZU8 A;  2XP5 A;  4HBE A;  2YAJ B;  3WD1 A;  4Q7N A;  3TDB A;  2OFN A;  3UI4 A;  4DRO A;  1J6Y A;  3KZ7 A;  1B6C A;  2EZ5 W;  3OA5 A;  1BKF A;  5AHT A;  2RUQ A;  4Z2H A;  4W9P A;  1NH6 A;  2F4E A;  2ZQV A;  2E45 A;  2A3C A;  4DRM A;  4ODM A;  1HKJ A;  1KT1 A;  4TW6 A;  2DT0 A;  3KAG A;  3I6C A;  1FJD A;  3NI6 A;  1W9V A;  4QT2 A;  3MCB B;  1WB0 A;  1K9R A;  2LPV A;  3ARY A;  3FY1 A;  3UQI A;  3CHF A;  4DRN A;  5HW7 A;  1EHN A;  2PN0 A;  1P5Q A;  2DT1 A;  4WK9 A;  3KCE A;  3MQG A;  2F21 A;  1UR9 A;  1NMV A;  3GTY X;  3B9E A;  1ZL1 A;  2VN1 A;  3CZ8 A;  3M85 A;  3PRB A;  2PV2 A;  2WAE A;  3G6L A;  3RFW A;  4IQ2 A;  3IHZ A;  2G41 A;  5HWB A;  1YW5 A;  2PPN A;  5GPG A;  4IPX A;  4TNS A;  3LUO A;  4Z2K A;  1E15 A;  3WH0 A;  2P4V A;  2EUL A;  4REX A;  2A3B A;  2FKE A;  2MPH A;  4DT4 A;  2RQS A;  4DH0 A;  1FKL A;  4MNJ A;  1JNE A;  1U79 A;  2YSI A;  2UZ5 A;  4C02 B;  3AS1 A;  2Y78 A;  2B31 A;  1SR0 A;  4DRP A;  1Y0O A;  1ZB5 A;  5DIT A;  1J4R A;  3RGC A;  2N87 A;  2KFW A;  4P8W A;  3KAF A;  2DG3 A;  1IX5 A;  4IT6 A;  3B8S A;  4UDM A;  3UI5 A;  2PI6 A;  2IF4 A;  3O5R A;  1KFW A;  1D6O A;  3AS2 A;  1JVW A;  2M2A A;  2DG4 A;  2MDI A;  1JMQ A;  4TW8 A;  1HKM A;  4KR0 B;  4R0X A;  1OWQ A;  2KI3 A;  1GRJ A;  1ZBV A;  4FAP A;  2ZR6 A;  3O5L A;  1W26 A;  3O5Q A;  1VF8 A;  1Q6U A;  2M1I A;  4JYS A;  4WKF A;  1X6N A;  3FSC A;  4TYO A;  3O5I A;  2LKN A;  2AOS A;  2PPP A;  1EG4 A;  4DIP A;  4NNR A;  4W5U A;  5HT1 A;  1O6W A;  4MAV A;  2PPO A;  3O5M A;  1HXV A;  5BXJ A;  1E6P A;  3IKG A;  3ARR A;  4WJX A;  2DSW A;  1X6L A;  1K9Q A;  3CNG A;  3W4R A;  4ZPT R;  1NMW A;  2QF8 A;  4ODP A;  1E6R A;  2XP4 A;  4BF8 A;  3B9D A;  4ZS6 A;  5E62 A;  1LL4 A;  1WR7 A;  1WNO A;  3PQH A;  3WQV A;  4AY1 A;  4MNK A;  1O6I A;  4IT4 A;  1XHG A;  3FXY A;  2LGO A;  2XP7 A;  2ZR4 A;  4ODR A;  2ITK A;  3ART A;  4ZPV R;  2YBU A;  1I5H W;  4ODN A;  1FKT A;  3UI6 A;  2F2D A;  4MPK A;  3NTP A;  2LAJ A;  1H0G A;  2M8I A;  2XP3 A;  3G6M A;  2L4J A;  3ALF A;  2M3O W;  4G2P A;  4MTV A;  1E44 A;  1W1P A;  5J6E A;  1EIB A;  4U86 A;  2JZV A;  5HW8 A;  3WIJ A;  2MF9 A;  4DWS C;  2ZR5 A;  2IUZ A;  2JMF A;  1JCH B;  3KAH A;  1N1A A;  1FAP A;  3RME A;  3PR9 A;  4ZPW R;  1FFQ A;  3JYJ A;  3ARO A;  3LKX A;  4TX0 A;  4R5E A;  2WAD A;  2D9F A;  3ALG A;  1NSG A;  4ODQ A;  2MNT A;  4J4N A;  1FKS A;  4Z2J A;  2ESC A;  3WD4 A;  3JYM A;  1FKR A;  4P8V A;  5HBF A;  2ETN A;  3BMB A;  1JND A;  3M7N A;  4A0U A;  2BA1 A;  5DIV A;  1NWT A;  3IK8 A;  2DPE A;  2PBC A;  3WD2 A;  5JH8 A;  3VAW A;  2ZQT A;  3FS8 A;  5E65 A;  1ZBW A;  2DSZ A;  1NWU A;  4NSB A;  1FKG A;  1XRV A;  3O5O A;  4S3K A;  2KXQ A;  3EIP A;  4O2T A;  2KE0 A;  4MGV A;  1CTN A;  4GGQ A;  3PA7 A;  4Z2L A;  1JNS A;  2WK2 A;  2WLY A;  3CGN A;  2DSV A;  4U85 A;  2AWG A;  4PTM A;  2DMV A;  3O5G A;  1FKJ A;  4IQC A;  1NWS A;  2L2S A;  1PIN A;  2DK7 A;  3RM4 A;  2KGJ A;  3KAD A;  1EDQ A;  3O5F A;  2K8I A;  1Q6H A;  1W1T A;  2KR7 A;  1EG3 A;  2B5U B;  2YSH A;  3LKX B;  3ARQ A;  4WKH A;  4MSP A;  3ARU A;  3L4H A;  1C9H A;  1D7H A;  1WMV A;  4P8U A;  1ITX A;  2ZQS A;  2G8Z A;  2M08 A;  2XPB A;  4XAK A;  1LQ0 A;  2YSF A;  3WL1 A;  1ROT A;  4DWS D;  2ZQU A;  2JV4 A;  4J4O A;  2PV1 A;  3ARV A;  1TFV A;  3OOB A;  1D7J A;  2RUR A;  1WAW A;  5E5W A;  1JNT A;  3TCZ A; 
#chains in the Genus database with same CATH homology
 4DZ2 A;  2XP9 A;  4DRI A;  4LAW A;  1SYT A;  2YBT A;  5D75 A;  3ODK A;  2DT3 A;  1HKI A;  3KAB A;  2O9O A;  2Y8N B;  4JFK A;  4L3N A;  1HKK A;  4DZ3 A;  4LAV A;  5GPR A;  1FKD A;  3FSB A;  2OWO A;  1W1Y A;  4W9Q A;  3LE4 A;  2WM0 A;  4QZV B;  4DRQ A;  5B8I C;  3AS0 A;  2XPA A;  4NZC A;  1RD6 A;  3CGM A;  1M5Y A;  1KT0 A;  1UR8 A;  4JFL A;  3BXW A;  3ARX A;  2RE3 A;  5DF0 A;  1EQ3 A;  1TK7 A;  5HKG A;  2DK1 A;  2A3A A;  1PBK A;  4P8X A;  3AQU A;  3ARS A;  4Z2I A;  3AS3 A;  4JFJ A;  4W9O A;  1LL6 A;  3WD3 A;  3WKZ A;  3H9R B;  2RUD A;  1BL4 A;  3CHE A;  4N19 A;  3KAC A;  1FLC A;  1FKF A;  1QZ2 A;  1W1V A;  5HWC A;  1D2K A;  1TCO C;  2ZAJ A;  1Q1C A;  3PRD A;  2FAP A;  3IKD A;  4Z2G A;  1F8A B;  5I98 A;  2MLY A;  3FAP A;  1E6N A;  1H0I A;  2DWV A;  4Q22 A;  1LG1 A;  2M8J A;  3QOK A;  4GIV A;  1RP5 A;  1L1P A;  4E5R A;  1FKH A;  5DO2 A;  3O5E A;  4S3J A;  2O92 A;  1QPF A;  2RUC A;  4LGX A;  4MNM A;  4A0T A;  3RM9 A;  3UF8 A;  2VCD A;  1R9H A;  2RSE A;  3O5D A;  1HJV A;  4JFM A;  2JXW A;  2JX8 A;  4MNL A;  1YAT A;  1D7I A;  4DWS A;  1LJY A;  1LL7 A;  3EY6 A;  4U84 A;  4WKA A;  4G50 A;  5HW6 A;  3ARZ A;  1LG2 A;  5E64 A;  3WL0 A;  3ARP A;  3TC5 A;  3B7X A;  3O5P A;  2DSU A;  1EYM A;  3O5J A;  4QT3 A;  3WQW A;  2YSB A;  5HTG A;  5DEZ A;  4JFI A;  5U47 A;  1F40 A;  1ZBK A;  5CQ2 A;  2LJ4 A;  2DJY A;  3MDY B;  4ML4 A;  3O5K A;  1ZBC A;  2DT2 A;  3CHD A;  4FN2 A;  3UQB A;  3CH9 A;  4DRH A;  1NWR A;  3RM8 A;  1J4I A;  1E6Z A;  3GPK A;  4URI A;  3WD0 A;  2MLX A;  1FKI A;  1ROU A;  2XP6 A;  1W9P A;  4LAX A;  3MQH A;  3ARW A;  1GPF A;  4LAY A;  5GQB A;  1E9L A;  1FFR A;  5E66 A;  1FD9 A;  2DG9 A;  4KQZ A;  1OGB A;  1QPL A;  4WIW A;  1GUV A;  1J4H A;  1HJX A;  4QIB A;  2Q5A A;  1GOI A;  4HAR A;  3JXV A;  2OLH A;  5HUA A;  3MCB A;  4ODL A;  3CHC A;  2A3E A;  2YSG A;  3PRA A;  4DRJ A;  4DRK A;  4DWS B;  1FKB A;  3B9A A;  4ODK A;  3KAI A;  4L72 B;  1OGG A;  1A7X A;  4HBO A;  2MLZ A;  2XP8 A;  4TW7 A;  1T11 A;  1ZK6 A;  1FKK A;  2FDM A;  2WLZ A;  1TR8 A;  5DIU A;  1W9U A;  4ODO A;  4GLX A;  1HJW A;  2PV3 A;  3UQA A;  1K9T A;  3NRK A;  1ZCN A;  1Q6I A;  2QRV A;  2KO7 A;  4ITZ A;  1ZU8 A;  2XP5 A;  4HBE A;  2YAJ B;  3WD1 A;  4Q7N A;  3TDB A;  2OFN A;  3UI4 A;  4DRO A;  1J6Y A;  3KZ7 A;  1B6C A;  2EZ5 W;  3OA5 A;  1BKF A;  5AHT A;  2RUQ A;  4Z2H A;  4W9P A;  1NH6 A;  2F4E A;  2ZQV A;  2E45 A;  2A3C A;  4DRM A;  4ODM A;  1HKJ A;  1KT1 A;  4TW6 A;  2DT0 A;  3KAG A;  3I6C A;  1FJD A;  3NI6 A;  1W9V A;  4QT2 A;  3MCB B;  1WB0 A;  1K9R A;  2LPV A;  3ARY A;  3FY1 A;  3UQI A;  3CHF A;  4DRN A;  5HW7 A;  1EHN A;  1P5Q A;  2DT1 A;  4WK9 A;  3KCE A;  3MQG A;  2F21 A;  1UR9 A;  1NMV A;  3B9E A;  1ZL1 A;  2VN1 A;  3CZ8 A;  3M85 A;  3PRB A;  2PV2 A;  2WAE A;  3G6L A;  3RFW A;  4IQ2 A;  3IHZ A;  2G41 A;  5HWB A;  1YW5 A;  2PPN A;  5GPG A;  4IPX A;  4TNS A;  3LUO A;  4Z2K A;  1E15 A;  3WH0 A;  4REX A;  2A3B A;  2FKE A;  2MPH A;  4DT4 A;  2RQS A;  4DH0 A;  1FKL A;  4MNJ A;  1JNE A;  1U79 A;  2YSI A;  2UZ5 A;  4C02 B;  3AS1 A;  2Y78 A;  2B31 A;  1SR0 A;  4DRP A;  1Y0O A;  1ZB5 A;  5DIT A;  1J4R A;  3RGC A;  2N87 A;  2KFW A;  4P8W A;  3KAF A;  2DG3 A;  1IX5 A;  4IT6 A;  3B8S A;  3UI5 A;  2PI6 A;  2IF4 A;  3O5R A;  1KFW A;  1D6O A;  3AS2 A;  1JVW A;  2M2A A;  2DG4 A;  2MDI A;  1JMQ A;  4TW8 A;  1HKM A;  4KR0 B;  4R0X A;  1OWQ A;  2KI3 A;  1ZBV A;  4FAP A;  2ZR6 A;  3O5L A;  1W26 A;  3O5Q A;  1VF8 A;  1Q6U A;  2M1I A;  4JYS A;  4WKF A;  1X6N A;  3FSC A;  4TYO A;  3O5I A;  2LKN A;  2AOS A;  2PPP A;  1EG4 A;  4DIP A;  4NNR A;  4W5U A;  5HT1 A;  1O6W A;  4MAV A;  2PPO A;  3O5M A;  1HXV A;  5BXJ A;  1E6P A;  3IKG A;  3ARR A;  4WJX A;  2DSW A;  1X6L A;  1K9Q A;  3CNG A;  3W4R A;  4ZPT R;  1NMW A;  2QF8 A;  4ODP A;  1E6R A;  2XP4 A;  4BF8 A;  3B9D A;  4ZS6 A;  5E62 A;  1LL4 A;  1WR7 A;  1WNO A;  3PQH A;  3WQV A;  4AY1 A;  4MNK A;  1O6I A;  4IT4 A;  1XHG A;  3FXY A;  2LGO A;  2XP7 A;  2ZR4 A;  4ODR A;  2ITK A;  3ART A;  4ZPV R;  2YBU A;  1I5H W;  4ODN A;  1FKT A;  3UI6 A;  2F2D A;  4MPK A;  3NTP A;  2LAJ A;  1H0G A;  2M8I A;  2XP3 A;  3G6M A;  2L4J A;  3ALF A;  2M3O W;  4G2P A;  4MTV A;  1W1P A;  5J6E A;  1EIB A;  4U86 A;  2JZV A;  5HW8 A;  3WIJ A;  2MF9 A;  4DWS C;  2ZR5 A;  2IUZ A;  2JMF A;  3KAH A;  1N1A A;  1FAP A;  3RME A;  3PR9 A;  4ZPW R;  1FFQ A;  3JYJ A;  3ARO A;  3LKX A;  4TX0 A;  4R5E A;  2WAD A;  2D9F A;  3ALG A;  1NSG A;  4ODQ A;  2MNT A;  4J4N A;  1FKS A;  4Z2J A;  2ESC A;  3WD4 A;  3JYM A;  1FKR A;  4P8V A;  5HBF A;  1JND A;  3M7N A;  4A0U A;  2BA1 A;  5DIV A;  1NWT A;  3IK8 A;  2DPE A;  2PBC A;  3WD2 A;  5JH8 A;  3VAW A;  2ZQT A;  3FS8 A;  5E65 A;  1ZBW A;  2DSZ A;  1NWU A;  4NSB A;  1FKG A;  1XRV A;  3O5O A;  4S3K A;  2KXQ A;  4O2T A;  2KE0 A;  4MGV A;  1CTN A;  4GGQ A;  3PA7 A;  4Z2L A;  1JNS A;  2WK2 A;  2WLY A;  3CGN A;  2DSV A;  4U85 A;  2AWG A;  4PTM A;  2DMV A;  3O5G A;  1FKJ A;  4IQC A;  1NWS A;  2L2S A;  1PIN A;  2DK7 A;  3RM4 A;  2KGJ A;  3KAD A;  1EDQ A;  3O5F A;  2K8I A;  1Q6H A;  1W1T A;  2KR7 A;  1EG3 A;  2YSH A;  3LKX B;  3ARQ A;  4WKH A;  4MSP A;  3ARU A;  3L4H A;  1C9H A;  1D7H A;  1WMV A;  4P8U A;  1ITX A;  2ZQS A;  2G8Z A;  2M08 A;  2XPB A;  4XAK A;  1LQ0 A;  2YSF A;  3WL1 A;  1ROT A;  4DWS D;  2ZQU A;  2JV4 A;  4J4O A;  2PV1 A;  3ARV A;  1TFV A;  3OOB A;  1D7J A;  2RUR A;  1WAW A;  5E5W A;  1JNT A;  3TCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...