3KADA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMAKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 44
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kadA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kadA02
3GPKA 2LKNA 2ZQUA 4JFMA 1T11A 1J4HA 2DK1A 2N87A 2RUCA 3CGMA 4G2PA 4ITZA 3FAPA 2DG3A 1Y0OA 4IPXA 1NSGA 5HWCA 4DIPA 1EG3A 2KFWA 4GGQA 2L4JA 4DRJA 3KAHA 2PBCA 4ODRA 1ZK6A 5B8IC 1QZ2A 4LAWA 2ZR6A 1Q6IA 2XP5A 3CGNA 3UI5A 3UQBA 1D6OA 1FKHA 2DG4A 2PV1A 5CQ2A 2M3OW 5HT1A 4DT4A 4ODOA 5DIUA 3LUOA 3MDYB 3IK8A 5HW8A 4JFKA 3L4HA 2MPHA 1QPFA 1ROUA 2M08A 2ZR5A 1FAPA 2MDIA 2MLYA 4TYOA 2YSIA 4ODPA 4TW6A 2XPBA 2KO7A 2KR7A 3O5PA 4BF8A 2DG9A 3I6CA 1PINA 4MSPA 1TK7A 2M8JA 3O5IA 4LAVA 4LAYA 2RQSA 3KAIA 3PRBA 2M8IA 4O2TA 5HWBA 1EQ3A 4GIVA 4FN2A 1D7IA 1KT1A 2BA1A 2RSEA 4DRHA 2ZR4A 3KAGA 3KABA 2RURA 4IQCA 5D75A 4ODNA 1J6YA 4QT2A 3ODKA 4ODLA 2ZQSA 3RGCA 2KE0A 1FKGA 3O5EA 4JYSA 1A7XA 2K8IA 2UZ5A 1ROTA 2XPAA 3OOBA 3KZ7A 1JMQA 3NI6A 2AWGA 3O5DA 1O6WA 3PRDA 4JFJA 3TCZA 2MNTA 1JVWA 3KCEA 5DIVA 2RE3A 4REXA 3JYJA 3O5JA 4NNRA 2PV3A 3JYMA 4DRPA 4TW7A 3NRKA 1J4RA 2EZ5W 1Q6HA 2XP8A 1WMVA 1B6CA 4TNSA 2DJYA 4C02B 1L1PA 1F8AB 3TC5A 1R9HA 1FKIA 1F40A 1EYMA 2MLXA 2F21A 3O5GA 2KXQA 3KACA 2ITKA 1Q1CA 2PV2A 3B7XA 2YSFA 2D9FA 3KADA 3M7NA 2LPVA 2JMFA 1M5YA 2ZAJA 2M1IA 2VN1A 4U86A 1QPLA 1FKFA 2L2SA 3UF8A 4JFLA 5HW6A 1FKLA 1HXVA 1TCOC 1JNTA 4LAXA 5J6EA 4DRQA 1PBKA 3O5MA 2JZVA 4DRKA 5HW7A 2KGJA 1EG4A 1NMVA 1ZCNA 3O5FA 1K9QA 2YSBA 2ZQTA 4W9OA 2ZQVA 1JNSA 4DRMA 4ODKA 4JFIA 4QT3A 1FJDA 1D7JA 1Q6UA 1FKRA 2KI3A 4DZ3A 4MGVA 3O5RA 1KT0A 3PA7A 4FAPA 1FKKA 4U84A 5HUAA 1D7HA 2F2DA 2RUDA 5BXJA 5HTGA 3O5LA 2PPNA 3IHZA 3RFWA 3UQAA 2YSGA 4N19A 2IF4A 1W26A 2JV4A 5AHTA 2XP4A 4W9PA 2E45A 4DRIA 3M85A 1U79A 2PPOA 2PPPA 4J4NA 1BL4A 3IKGA 4U85A 3JXVA 5I98A 3CNGA 3LE4A 2F4EA 2LJ4A 4TW8A 5DITA 1N1AA 3UI4A 3O5QA 2DK7A 5HKGA 4TX0A 4ODQA 3EY6A 2MF9A 1FKSA 3KAFA 1NMWA 1J4IA 1P5QA 1K9RA 2JX8A 1FKJA 3WH0A 2MLZA 2VCDA 1FKBA 4W9QA 4DRNA 2LGOA 2LAJA 2Y78A 1YW5A 3O5KA 3O5OA 2FAPA 2FKEA 3UQIA 3VAWA 2DWVA 1C9HA 4G50A 4ODMA 1WR7A 5GPGA 2RUQA 4DZ2A 2JXWA 1YATA 4R0XA 2XP6A 1BKFA 2XP9A 4IQ2A 2XP7A 4QIBA 1I5HW 2XP3A 3H9RB 3IKDA 2Q5AA 4J4OA 2DMVA 1FD9A 1FKTA 3UI6A 2YSHA 3TDBA 1FKDA 4DH0A 2OFNA 4DROA 2M2AA 4E5RA 3NTPA
chains in the Genus database with same CATH superfamily
1WNOA 3GPKA 2WM0A 4JFMA 4WKAA 3AS3A 4G2PA 2O92A 1GUVA 1NSGA 4KQZA 4ODRA 1ZK6A 4KR0B 5E5WA 4LAWA 2ZR6A 2AOSA 1D6OA 3MQHA 4Q7NA 2A3AA 4IT6A 5HT1A 3MDYB 1W9PA 4S3KA 1W1PA 5DO2A 3MCBA 1FFRA 1FFQA 2DG9A 4LAVA 1ZBVA 3AROA 2M8IA 1D7IA 2RSEA 2ZR4A 3KAGA 1J6YA 4ODNA 4A0UA 3ARRA 1FKGA 2UZ5A 3O5DA 1HKMA 3WD3A 3G6LA 4P8VA 1E6NA 4NNRA 1LQ0A 3ARTA 1J4RA 3PQHA 1Q6HA 3ARXA 2B31A 3WL0A 3KACA 2ITKA 1Q1CA 2YSFA 1H0IA 2LPVA 4MNMA 1QPLA 1FKFA 2L2SA 4A0TA 3ARZA 1HKKA 4AY1A 3ALFA 3O5MA 2YSBA 2ETNA 2ZQVA 2WK2A 1HKJA 3WQVA 4DWSD 4Z2LA 3AS1A 4DZ3A 1SR0A 4MNKA 3PA7A 1FKKA 2PN0A 2DT2A 4HBEA 3PRAA 2RUDA 4Z2GA 3IHZA 1NWTA 3WD0A 3CHFA 4N19A 2JV4A 4DRIA 4W9PA 2OWOA 4J4NA 5I98A 2F4EA 4TW8A 4DWSC 5GPRA 3WD1A 2DK7A 2G8ZA 1EHNA 2MF9A 3KAFA 1JNSA 1OGGA 3ARQA 3WH0A 1HJXA 4P8XA 1FKBA 3O5KA 3O5OA 1LJYA 1C9HA 1NWRA 1W9UA 2DPEA 4WKHA 5GPGA 1E6ZA 2JXWA 4R0XA 4NZCA 1HKIA 4DWSA 2DMVA 2YSHA 3TDBA 4DROA 4O2TA 2O9OA 4ML4A 3W4RA 2LKNA 4ZPWR 1T11A 1E9LA 4ITZA 1Y0OA 5HWCA 4DIPA 4DRJA 4GGQA 1JCHB 2OLHA 5B8IC 3AQUA 1FKHA 2PV1A 5CQ2A 2M3OW 3GU0A 1JNDA 5HW8A 3LKXA 1UR9A 5JH8A 2ZR5A 1FAPA 2MLYA 4WKFA 3FSCA 2XPBA 1TR8A 4GLXA 1GPFA 3ARPA 3WKZA 1PINA 1TK7A 1EDQA 4GIVA 4W5UA 4MTVA 3KABA 2RURA 4QT2A 4ODLA 2ZQSA 1XHGA 3O5EA 4JYSA 3KZ7A 2XPAA 2AWGA 3TCZA 2WLZA 1LG1A 2PV3A 4ZS6A 4WIWA 3NRKA 2XP8A 1WMVA 3AS2A 3O5GA 1OGBA 3KADA 2JMFA 2VN1A 4U86A 4DRQA 4DRKA 1EG4A 2A3CA 1HJVA 4ODKA 4JFIA 1FJDA 3CZ8A 2KI3A 1ZB5A 1SYTA 3FXYA 3O5RA 4P8WA 4U84A 1D7HA 5HTGA 3RFWA 3UQAA 2WLYA 2XP4A 3M85A 2PPPA 4DWSB 3CNGA 5E62A 2LJ4A 5DITA 3UI4A 5HKGA 2FDMA 4ODQA 3EY6A 1FKSA 5E65A 1J4IA 1FKJA 2LGOA 2LAJA 3CHCA 1YW5A 2QRVA 3ARVA 2FAPA 2FKEA 3VAWA 4MPKA 4ODMA 1X6LA 1WR7A 1LG2A 2XP6A 1BKFA 4IQ2A 4QIBA 1I5HW 3B8SA 2XP3A 2Q5AA 4J4OA 3BXWA 4DH0A 3ALGA 3WD2A 3PR9A 3WL1A 2N87A 4MAVA 1EG3A 2DSWA 1TFVA 2KFWA 3WD4A 2PBCA 4Z2IA 2WADA 2DSZA 3MQGA 1QZ2A 3CGNA 4Z2HA 2A3EA 4DT4A 4ODOA 5DIUA 3LUOA 4TYOA 2MDIA 2YSIA 3CHDA 4ODPA 2KO7A 1CTNA 3I6CA 2M8JA 2RQSA 1H0GA 1KT1A 1RD6A 5D75A 3ODKA 1A7XA 2K8IA 3ARUA 3RMEA 3NI6A 4JFJA 1O6WA 1LL4A 1E15A 4DRPA 2RE3A 4REXA 3O5JA 3QOKA 3JYMA 4Z2KA 4TNSA 1L1PA 1B6CA 1LL6A 2DJYA 4HARA 4C02B 1F8AB 1EYMA 2MLXA 4ZPVR 3B7XA 1E44A 2EULA 2D9FA 3M7NA 1M5YA 2ZAJA 1VF8A 5HW6A 1OWQA 1TCOC 1JNTA 4LAXA 5J6EA 4MNLA 1O6IA 1NWUA 2JZVA 5HW7A 2KGJA 1ZCNA 1K9QA 2ZQTA 4W9OA 4DRMA 2B5UB 3EIPA 4QT3A 1D7JA 1Q6UA 3RM4A 4FAPA 1KFWA 1UR8A 5HUAA 3WIJA 5BXJA 1WAWA 2DT0A 3FS8A 4XAKA 3OA5A 2IF4A 1W26A 2DSVA 4MNJA 1NH6A 2E45A 1U79A 2PPOA 1W1YA 4U85A 3JXVA 1X6NA 3LE4A 3FSBA 1E6PA 3O5QA 5HBFA 4TX0A 1W1VA 1NMWA 1P5QA 1K9RA 4W9QA 4DRNA 2YBTA 2Y78A 1NWSA 1ZBKA 3UQIA 2DWVA 3B9DA 4L3NA 2RUQA 4DZ2A 1YATA 4LGXA 4P8UA 2XP9A 2XP7A 1HJWA 3IKDA 4ZPTR 1FD9A 3UI6A 2A3BA 2ESCA 2OFNA 3CHEA 3UQBA 2QF8A 4E5RA 3NTPA 4L72B 2ZQUA 1J4HA 2DK1A 2RUCA 3CGMA 3FAPA 3RM9A 2DG3A 1E6RA 4IPXA 2L4JA 3KAHA 5DEZA 1RP5A 4Z2JA 1LL7A 1Q6IA 2XP5A 4NSBA 5E64A 4WJXA 2DG4A 3IK8A 1WB0A 4JFKA 3L4HA 2MPHA 1QPFA 1ROUA 2M08A 4WK9A 5U47A 4TW6A 4URIA 2KR7A 3O5PA 4BF8A 4MSPA 2PI6A 1XRVA 3O5IA 3UI5A 4LAYA 2G41A 1FKRA 3KAIA 3PRBA 5HWBA 1EQ3A 4FN2A 2BA1A 4DRHA 4IQCA 3RGCA 2KE0A 2DSUA 1ROTA 3OOBA 3GTYX 2P4VA 1JMQA 3PRDA 2MNTA 1JVWA 3KCEA 5DIVA 3JYJA 2WAEA 3MCBB 4TW7A 2Y8NB 5DF0A 1ZU8A 2YBUA 2EZ5W 4QZVB 4Q22A 1K9TA 4S3JA 3TC5A 1R9HA 1F40A 1FKIA 1JNEA 1GRJA 2F21A 2KXQA 2PV2A 4R5EA 2M1IA 3G6MA 1EIBA 4JFLA 3UF8A 1FKLA 1HXVA 3B9EA 1PBKA 2DT1A 2IUZA 5GQBA 3WQWA 1NMVA 3CH9A 3O5FA 1IX5A 1W9VA 1ITXA 5E66A 4MGVA 1KT0A 4PTMA 3FY1A 2F2DA 3O5LA 2PPNA 3ARSA 2YSGA 1D2KA 3B9AA 5AHTA 1BL4A 3IKGA 2DT3A 1N1AA 1ZL1A 3ARWA 2JX8A 2MLZA 2VCDA 1W1TA 3BMBA 3RM8A 4UDMA 4IT4A 1FLCA 2F23A 4G50A 1ZBWA 1ZBCA 2YAJB 4HBOA 3AS0A 3H9RB 1FKTA 1FKDA 3ARYA 1GOIA 2M2AA 3LKXB
chains in the Genus database with same CATH topology
1WNOA 3GPKA 2WM0A 4JFMA 4WKAA 3AS3A 4G2PA 2O92A 1GUVA 1NSGA 4KQZA 4ODRA 1ZK6A 4KR0B 5E5WA 4LAWA 2ZR6A 2AOSA 1D6OA 3MQHA 4Q7NA 2A3AA 4IT6A 5HT1A 3MDYB 1W9PA 4S3KA 1W1PA 5DO2A 3MCBA 1FFRA 1FFQA 2DG9A 4LAVA 1ZBVA 3AROA 2M8IA 1D7IA 2RSEA 2ZR4A 3KAGA 1J6YA 4ODNA 4A0UA 3ARRA 1FKGA 2UZ5A 3O5DA 1HKMA 3WD3A 3G6LA 4P8VA 1E6NA 4NNRA 1LQ0A 3ARTA 1J4RA 3PQHA 1Q6HA 3ARXA 2B31A 3WL0A 3KACA 2ITKA 1Q1CA 2YSFA 1H0IA 2LPVA 4MNMA 1QPLA 1FKFA 2L2SA 4A0TA 3ARZA 1HKKA 4AY1A 3ALFA 3O5MA 2YSBA 2ZQVA 2WK2A 1HKJA 3WQVA 4DWSD 4Z2LA 3AS1A 4DZ3A 1SR0A 4MNKA 3PA7A 1FKKA 2DT2A 4HBEA 3PRAA 2RUDA 4Z2GA 3IHZA 1NWTA 3WD0A 3CHFA 4N19A 2JV4A 4DRIA 4W9PA 2OWOA 4J4NA 5I98A 2F4EA 4TW8A 4DWSC 5GPRA 3WD1A 2DK7A 2G8ZA 1EHNA 2MF9A 3KAFA 1JNSA 3ARQA 1OGGA 3WH0A 1HJXA 4P8XA 1FKBA 3O5KA 3O5OA 1LJYA 1C9HA 1NWRA 1W9UA 2DPEA 4WKHA 5GPGA 1E6ZA 2JXWA 4R0XA 4NZCA 1HKIA 4DWSA 2DMVA 2YSHA 3TDBA 4DROA 4O2TA 2O9OA 4ML4A 3W4RA 2LKNA 4ZPWR 1T11A 1E9LA 4ITZA 1Y0OA 5HWCA 4DIPA 4DRJA 4GGQA 2OLHA 5B8IC 3AQUA 1FKHA 2PV1A 5CQ2A 2M3OW 1JNDA 5HW8A 3LKXA 1UR9A 5JH8A 2ZR5A 1FAPA 2MLYA 4WKFA 3FSCA 2XPBA 1TR8A 4GLXA 1GPFA 3ARPA 3WKZA 1PINA 1TK7A 1EDQA 4GIVA 4W5UA 4MTVA 3KABA 2RURA 4QT2A 4ODLA 2ZQSA 1XHGA 3O5EA 4JYSA 3KZ7A 2XPAA 2AWGA 3TCZA 2WLZA 1LG1A 2PV3A 4ZS6A 4WIWA 3NRKA 2XP8A 1WMVA 3AS2A 3O5GA 1OGBA 3KADA 2JMFA 2VN1A 4U86A 4DRQA 4DRKA 1EG4A 2A3CA 1HJVA 4ODKA 4JFIA 1FJDA 3CZ8A 2KI3A 1ZB5A 1SYTA 3FXYA 3O5RA 4P8WA 4U84A 1D7HA 5HTGA 3RFWA 3UQAA 2WLYA 2XP4A 3M85A 2PPPA 4DWSB 3CNGA 5E62A 2LJ4A 5DITA 3UI4A 5HKGA 2FDMA 4ODQA 3EY6A 1FKSA 5E65A 1J4IA 1FKJA 2LGOA 2LAJA 3CHCA 1YW5A 2QRVA 3ARVA 2FAPA 2FKEA 3VAWA 4MPKA 4ODMA 1X6LA 1WR7A 1LG2A 2XP6A 1BKFA 4IQ2A 4QIBA 1I5HW 3B8SA 2XP3A 2Q5AA 4J4OA 3BXWA 4DH0A 3ALGA 3WD2A 3PR9A 3WL1A 2N87A 4MAVA 1EG3A 2DSWA 1TFVA 2KFWA 3WD4A 2PBCA 4Z2IA 2WADA 2DSZA 3MQGA 1QZ2A 3CGNA 4Z2HA 2A3EA 4DT4A 4ODOA 5DIUA 3LUOA 4TYOA 2MDIA 2YSIA 3CHDA 4ODPA 2KO7A 1CTNA 3I6CA 2M8JA 2RQSA 1H0GA 1KT1A 1RD6A 5D75A 3ODKA 1A7XA 2K8IA 3ARUA 3RMEA 3NI6A 4JFJA 1O6WA 1LL4A 1E15A 4DRPA 2RE3A 4REXA 3O5JA 3QOKA 3JYMA 4Z2KA 4TNSA 1L1PA 1B6CA 1LL6A 2DJYA 4HARA 4C02B 1F8AB 1EYMA 2MLXA 4ZPVR 3B7XA 2D9FA 3M7NA 1M5YA 2ZAJA 1VF8A 5HW6A 1OWQA 1TCOC 1JNTA 4LAXA 5J6EA 4MNLA 1O6IA 1NWUA 2JZVA 5HW7A 2KGJA 1ZCNA 1K9QA 2ZQTA 4W9OA 4DRMA 4QT3A 1D7JA 1Q6UA 3RM4A 4FAPA 1KFWA 1UR8A 5HUAA 3WIJA 5BXJA 1WAWA 2DT0A 3FS8A 4XAKA 3OA5A 2IF4A 1W26A 2DSVA 4MNJA 1NH6A 2E45A 1U79A 2PPOA 1W1YA 4U85A 3JXVA 1X6NA 3LE4A 3FSBA 1E6PA 3O5QA 5HBFA 4TX0A 1W1VA 1NMWA 1P5QA 1K9RA 4W9QA 4DRNA 2YBTA 2Y78A 1NWSA 1ZBKA 3UQIA 2DWVA 3B9DA 4L3NA 2RUQA 4DZ2A 1YATA 4LGXA 4P8UA 2XP9A 2XP7A 1HJWA 3IKDA 4ZPTR 1FD9A 3UI6A 2A3BA 2ESCA 2OFNA 3CHEA 3UQBA 2QF8A 4E5RA 3NTPA 4L72B 2ZQUA 1J4HA 2DK1A 2RUCA 3CGMA 3FAPA 3RM9A 2DG3A 1E6RA 4IPXA 2L4JA 3KAHA 5DEZA 1RP5A 4Z2JA 1LL7A 1Q6IA 2XP5A 4NSBA 5E64A 4WJXA 2DG4A 3IK8A 1WB0A 4JFKA 3L4HA 2MPHA 1QPFA 1ROUA 2M08A 4WK9A 5U47A 4TW6A 4URIA 2KR7A 3O5PA 4BF8A 4MSPA 2PI6A 1XRVA 3O5IA 3UI5A 4LAYA 2G41A 1FKRA 3KAIA 3PRBA 5HWBA 1EQ3A 4FN2A 2BA1A 4DRHA 4IQCA 3RGCA 2KE0A 2DSUA 1ROTA 3OOBA 3PRDA 1JMQA 2MNTA 1JVWA 3KCEA 5DIVA 3JYJA 2WAEA 3MCBB 4TW7A 2Y8NB 5DF0A 1ZU8A 2YBUA 2EZ5W 4QZVB 4Q22A 1K9TA 4S3JA 3TC5A 1R9HA 1F40A 1FKIA 1JNEA 2F21A 2KXQA 2PV2A 4R5EA 2M1IA 3G6MA 1EIBA 4JFLA 3UF8A 1FKLA 1HXVA 3B9EA 1PBKA 2DT1A 2IUZA 5GQBA 3WQWA 1NMVA 3CH9A 3O5FA 1IX5A 1W9VA 1ITXA 5E66A 4MGVA 1KT0A 4PTMA 3FY1A 2F2DA 3O5LA 2PPNA 3ARSA 2YSGA 1D2KA 3B9AA 5AHTA 1BL4A 3IKGA 2DT3A 1N1AA 1ZL1A 3ARWA 2JX8A 2MLZA 2VCDA 1W1TA 3RM8A 4IT4A 1FLCA 4G50A 1ZBWA 1ZBCA 2YAJB 4HBOA 3AS0A 3H9RB 1FKTA 1FKDA 3ARYA 1GOIA 2M2AA 3LKXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPK A;  2LKN A;  2ZQU A;  4JFM A;  1T11 A;  1J4H A;  2DK1 A;  2N87 A;  2RUC A;  3CGM A;  4G2P A;  4ITZ A;  3FAP A;  2DG3 A;  1Y0O A;  4IPX A;  1NSG A;  5HWC A;  4DIP A;  1EG3 A;  2KFW A;  4GGQ A;  2L4J A;  4DRJ A;  3KAH A;  2PBC A;  4ODR A;  1ZK6 A;  5B8I C;  1QZ2 A;  4LAW A;  2ZR6 A;  1Q6I A;  2XP5 A;  3CGN A;  3UI5 A;  3UQB A;  1D6O A;  1FKH A;  2DG4 A;  2PV1 A;  5CQ2 A;  2M3O W;  5HT1 A;  4DT4 A;  4ODO A;  5DIU A;  3LUO A;  3MDY B;  3IK8 A;  5HW8 A;  4JFK A;  3L4H A;  2MPH A;  1QPF A;  1ROU A;  2M08 A;  2ZR5 A;  1FAP A;  2MDI A;  2MLY A;  4TYO A;  2YSI A;  4ODP A;  4TW6 A;  2XPB A;  2KO7 A;  2KR7 A;  3O5P A;  4BF8 A;  2DG9 A;  3I6C A;  1PIN A;  4MSP A;  1TK7 A;  2M8J A;  3O5I A;  4LAV A;  4LAY A;  2RQS A;  3KAI A;  3PRB A;  2M8I A;  4O2T A;  5HWB A;  1EQ3 A;  4GIV A;  4FN2 A;  1D7I A;  1KT1 A;  2BA1 A;  2RSE A;  4DRH A;  2ZR4 A;  3KAG A;  3KAB A;  2RUR A;  4IQC A;  5D75 A;  4ODN A;  1J6Y A;  4QT2 A;  3ODK A;  4ODL A;  2ZQS A;  3RGC A;  2KE0 A;  1FKG A;  3O5E A;  4JYS A;  1A7X A;  2K8I A;  2UZ5 A;  1ROT A;  2XPA A;  3OOB A;  3KZ7 A;  1JMQ A;  3NI6 A;  2AWG A;  3O5D A;  1O6W A;  3PRD A;  4JFJ A;  3TCZ A;  2MNT A;  1JVW A;  3KCE A;  5DIV A;  2RE3 A;  4REX A;  3JYJ A;  3O5J A;  4NNR A;  2PV3 A;  3JYM A;  4DRP A;  4TW7 A;  3NRK A;  1J4R A;  2EZ5 W;  1Q6H A;  2XP8 A;  1WMV A;  1B6C A;  4TNS A;  2DJY A;  4C02 B;  1L1P A;  1F8A B;  3TC5 A;  1R9H A;  1FKI A;  1F40 A;  1EYM A;  2MLX A;  2F21 A;  3O5G A;  2KXQ A;  3KAC A;  2ITK A;  1Q1C A;  2PV2 A;  3B7X A;  2YSF A;  2D9F A;  3KAD A;  3M7N A;  2LPV A;  2JMF A;  1M5Y A;  2ZAJ A;  2M1I A;  2VN1 A;  4U86 A;  1QPL A;  1FKF A;  2L2S A;  3UF8 A;  4JFL A;  5HW6 A;  1FKL A;  1HXV A;  1TCO C;  1JNT A;  4LAX A;  5J6E A;  4DRQ A;  1PBK A;  3O5M A;  2JZV A;  4DRK A;  5HW7 A;  2KGJ A;  1EG4 A;  1NMV A;  1ZCN A;  3O5F A;  1K9Q A;  2YSB A;  2ZQT A;  4W9O A;  2ZQV A;  1JNS A;  4DRM A;  4ODK A;  4JFI A;  4QT3 A;  1FJD A;  1D7J A;  1Q6U A;  1FKR A;  2KI3 A;  4DZ3 A;  4MGV A;  3O5R A;  1KT0 A;  3PA7 A;  4FAP A;  1FKK A;  4U84 A;  5HUA A;  1D7H A;  2F2D A;  2RUD A;  5BXJ A;  5HTG A;  3O5L A;  2PPN A;  3IHZ A;  3RFW A;  3UQA A;  2YSG A;  4N19 A;  2IF4 A;  1W26 A;  2JV4 A;  5AHT A;  2XP4 A;  4W9P A;  2E45 A;  4DRI A;  3M85 A;  1U79 A;  2PPO A;  2PPP A;  4J4N A;  1BL4 A;  3IKG A;  4U85 A;  3JXV A;  5I98 A;  3CNG A;  3LE4 A;  2F4E A;  2LJ4 A;  4TW8 A;  5DIT A;  1N1A A;  3UI4 A;  3O5Q A;  2DK7 A;  5HKG A;  4TX0 A;  4ODQ A;  3EY6 A;  2MF9 A;  1FKS A;  3KAF A;  1NMW A;  1J4I A;  1P5Q A;  1K9R A;  2JX8 A;  1FKJ A;  3WH0 A;  2MLZ A;  2VCD A;  1FKB A;  4W9Q A;  4DRN A;  2LGO A;  2LAJ A;  2Y78 A;  1YW5 A;  3O5K A;  3O5O A;  2FAP A;  2FKE A;  3UQI A;  3VAW A;  2DWV A;  1C9H A;  4G50 A;  4ODM A;  1WR7 A;  5GPG A;  2RUQ A;  4DZ2 A;  2JXW A;  1YAT A;  4R0X A;  2XP6 A;  1BKF A;  2XP9 A;  4IQ2 A;  2XP7 A;  4QIB A;  1I5H W;  2XP3 A;  3H9R B;  3IKD A;  2Q5A A;  4J4O A;  2DMV A;  1FD9 A;  1FKT A;  3UI6 A;  2YSH A;  3TDB A;  1FKD A;  4DH0 A;  2OFN A;  4DRO A;  2M2A A;  4E5R A;  3NTP A; 
#chains in the Genus database with same CATH topology
 1WNO A;  3GPK A;  2WM0 A;  4JFM A;  4WKA A;  3AS3 A;  4G2P A;  2O92 A;  1GUV A;  1NSG A;  4KQZ A;  4ODR A;  1ZK6 A;  4KR0 B;  5E5W A;  4LAW A;  2ZR6 A;  2AOS A;  1D6O A;  3MQH A;  4Q7N A;  2A3A A;  4IT6 A;  5HT1 A;  3MDY B;  1W9P A;  4S3K A;  1W1P A;  5DO2 A;  3MCB A;  1FFR A;  1FFQ A;  2DG9 A;  4LAV A;  1ZBV A;  3ARO A;  2M8I A;  1D7I A;  2RSE A;  2ZR4 A;  3KAG A;  1J6Y A;  4ODN A;  4A0U A;  3ARR A;  1FKG A;  2UZ5 A;  3O5D A;  1HKM A;  3WD3 A;  3G6L A;  4P8V A;  1E6N A;  4NNR A;  1LQ0 A;  3ART A;  1J4R A;  3PQH A;  1Q6H A;  3ARX A;  2B31 A;  3WL0 A;  3KAC A;  2ITK A;  1Q1C A;  2YSF A;  1H0I A;  2LPV A;  4MNM A;  1QPL A;  1FKF A;  2L2S A;  4A0T A;  3ARZ A;  1HKK A;  4AY1 A;  3ALF A;  3O5M A;  2YSB A;  2ETN A;  2ZQV A;  2WK2 A;  1HKJ A;  3WQV A;  4DWS D;  4Z2L A;  3AS1 A;  4DZ3 A;  1SR0 A;  4MNK A;  3PA7 A;  1FKK A;  2PN0 A;  2DT2 A;  4HBE A;  3PRA A;  2RUD A;  4Z2G A;  3IHZ A;  1NWT A;  3WD0 A;  3CHF A;  4N19 A;  2JV4 A;  4DRI A;  4W9P A;  2OWO A;  4J4N A;  5I98 A;  2F4E A;  4TW8 A;  4DWS C;  5GPR A;  3WD1 A;  2DK7 A;  2G8Z A;  1EHN A;  2MF9 A;  3KAF A;  1JNS A;  1OGG A;  3ARQ A;  3WH0 A;  1HJX A;  4P8X A;  1FKB A;  3O5K A;  3O5O A;  1LJY A;  1C9H A;  1NWR A;  1W9U A;  2DPE A;  4WKH A;  5GPG A;  1E6Z A;  2JXW A;  4R0X A;  4NZC A;  1HKI A;  4DWS A;  2DMV A;  2YSH A;  3TDB A;  4DRO A;  4O2T A;  2O9O A;  4ML4 A;  3W4R A;  2LKN A;  4ZPW R;  1T11 A;  1E9L A;  4ITZ A;  1Y0O A;  5HWC A;  4DIP A;  4DRJ A;  4GGQ A;  1JCH B;  2OLH A;  5B8I C;  3AQU A;  1FKH A;  2PV1 A;  5CQ2 A;  2M3O W;  3GU0 A;  1JND A;  5HW8 A;  3LKX A;  1UR9 A;  5JH8 A;  2ZR5 A;  1FAP A;  2MLY A;  4WKF A;  3FSC A;  2XPB A;  1TR8 A;  4GLX A;  1GPF A;  3ARP A;  3WKZ A;  1PIN A;  1TK7 A;  1EDQ A;  4GIV A;  4W5U A;  4MTV A;  3KAB A;  2RUR A;  4QT2 A;  4ODL A;  2ZQS A;  1XHG A;  3O5E A;  4JYS A;  3KZ7 A;  2XPA A;  2AWG A;  3TCZ A;  2WLZ A;  1LG1 A;  2PV3 A;  4ZS6 A;  4WIW A;  3NRK A;  2XP8 A;  1WMV A;  3AS2 A;  3O5G A;  1OGB A;  3KAD A;  2JMF A;  2VN1 A;  4U86 A;  4DRQ A;  4DRK A;  1EG4 A;  2A3C A;  1HJV A;  4ODK A;  4JFI A;  1FJD A;  3CZ8 A;  2KI3 A;  1ZB5 A;  1SYT A;  3FXY A;  3O5R A;  4P8W A;  4U84 A;  1D7H A;  5HTG A;  3RFW A;  3UQA A;  2WLY A;  2XP4 A;  3M85 A;  2PPP A;  4DWS B;  3CNG A;  5E62 A;  2LJ4 A;  5DIT A;  3UI4 A;  5HKG A;  2FDM A;  4ODQ A;  3EY6 A;  1FKS A;  5E65 A;  1J4I A;  1FKJ A;  2LGO A;  2LAJ A;  3CHC A;  1YW5 A;  2QRV A;  3ARV A;  2FAP A;  2FKE A;  3VAW A;  4MPK A;  4ODM A;  1X6L A;  1WR7 A;  1LG2 A;  2XP6 A;  1BKF A;  4IQ2 A;  4QIB A;  1I5H W;  3B8S A;  2XP3 A;  2Q5A A;  4J4O A;  3BXW A;  4DH0 A;  3ALG A;  3WD2 A;  3PR9 A;  3WL1 A;  2N87 A;  4MAV A;  1EG3 A;  2DSW A;  1TFV A;  2KFW A;  3WD4 A;  2PBC A;  4Z2I A;  2WAD A;  2DSZ A;  3MQG A;  1QZ2 A;  3CGN A;  4Z2H A;  2A3E A;  4DT4 A;  4ODO A;  5DIU A;  3LUO A;  4TYO A;  2MDI A;  2YSI A;  3CHD A;  4ODP A;  2KO7 A;  1CTN A;  3I6C A;  2M8J A;  2RQS A;  1H0G A;  1KT1 A;  1RD6 A;  5D75 A;  3ODK A;  1A7X A;  2K8I A;  3ARU A;  3RME A;  3NI6 A;  4JFJ A;  1O6W A;  1LL4 A;  1E15 A;  4DRP A;  2RE3 A;  4REX A;  3O5J A;  3QOK A;  3JYM A;  4Z2K A;  4TNS A;  1L1P A;  1B6C A;  1LL6 A;  2DJY A;  4HAR A;  4C02 B;  1F8A B;  1EYM A;  2MLX A;  4ZPV R;  3B7X A;  1E44 A;  2EUL A;  2D9F A;  3M7N A;  1M5Y A;  2ZAJ A;  1VF8 A;  5HW6 A;  1OWQ A;  1TCO C;  1JNT A;  4LAX A;  5J6E A;  4MNL A;  1O6I A;  1NWU A;  2JZV A;  5HW7 A;  2KGJ A;  1ZCN A;  1K9Q A;  2ZQT A;  4W9O A;  4DRM A;  2B5U B;  3EIP A;  4QT3 A;  1D7J A;  1Q6U A;  3RM4 A;  4FAP A;  1KFW A;  1UR8 A;  5HUA A;  3WIJ A;  5BXJ A;  1WAW A;  2DT0 A;  3FS8 A;  4XAK A;  3OA5 A;  2IF4 A;  1W26 A;  2DSV A;  4MNJ A;  1NH6 A;  2E45 A;  1U79 A;  2PPO A;  1W1Y A;  4U85 A;  3JXV A;  1X6N A;  3LE4 A;  3FSB A;  1E6P A;  3O5Q A;  5HBF A;  4TX0 A;  1W1V A;  1NMW A;  1P5Q A;  1K9R A;  4W9Q A;  4DRN A;  2YBT A;  2Y78 A;  1NWS A;  1ZBK A;  3UQI A;  2DWV A;  3B9D A;  4L3N A;  2RUQ A;  4DZ2 A;  1YAT A;  4LGX A;  4P8U A;  2XP9 A;  2XP7 A;  1HJW A;  3IKD A;  4ZPT R;  1FD9 A;  3UI6 A;  2A3B A;  2ESC A;  2OFN A;  3CHE A;  3UQB A;  2QF8 A;  4E5R A;  3NTP A;  4L72 B;  2ZQU A;  1J4H A;  2DK1 A;  2RUC A;  3CGM A;  3FAP A;  3RM9 A;  2DG3 A;  1E6R A;  4IPX A;  2L4J A;  3KAH A;  5DEZ A;  1RP5 A;  4Z2J A;  1LL7 A;  1Q6I A;  2XP5 A;  4NSB A;  5E64 A;  4WJX A;  2DG4 A;  3IK8 A;  1WB0 A;  4JFK A;  3L4H A;  2MPH A;  1QPF A;  1ROU A;  2M08 A;  4WK9 A;  5U47 A;  4TW6 A;  4URI A;  2KR7 A;  3O5P A;  4BF8 A;  4MSP A;  2PI6 A;  1XRV A;  3O5I A;  3UI5 A;  4LAY A;  2G41 A;  1FKR A;  3KAI A;  3PRB A;  5HWB A;  1EQ3 A;  4FN2 A;  2BA1 A;  4DRH A;  4IQC A;  3RGC A;  2KE0 A;  2DSU A;  1ROT A;  3OOB A;  3GTY X;  2P4V A;  1JMQ A;  3PRD A;  2MNT A;  1JVW A;  3KCE A;  5DIV A;  3JYJ A;  2WAE A;  3MCB B;  4TW7 A;  2Y8N B;  5DF0 A;  1ZU8 A;  2YBU A;  2EZ5 W;  4QZV B;  4Q22 A;  1K9T A;  4S3J A;  3TC5 A;  1R9H A;  1F40 A;  1FKI A;  1JNE A;  1GRJ A;  2F21 A;  2KXQ A;  2PV2 A;  4R5E A;  2M1I A;  3G6M A;  1EIB A;  4JFL A;  3UF8 A;  1FKL A;  1HXV A;  3B9E A;  1PBK A;  2DT1 A;  2IUZ A;  5GQB A;  3WQW A;  1NMV A;  3CH9 A;  3O5F A;  1IX5 A;  1W9V A;  1ITX A;  5E66 A;  4MGV A;  1KT0 A;  4PTM A;  3FY1 A;  2F2D A;  3O5L A;  2PPN A;  3ARS A;  2YSG A;  1D2K A;  3B9A A;  5AHT A;  1BL4 A;  3IKG A;  2DT3 A;  1N1A A;  1ZL1 A;  3ARW A;  2JX8 A;  2MLZ A;  2VCD A;  1W1T A;  3BMB A;  3RM8 A;  4UDM A;  4IT4 A;  1FLC A;  2F23 A;  4G50 A;  1ZBW A;  1ZBC A;  2YAJ B;  4HBO A;  3AS0 A;  3H9R B;  1FKT A;  1FKD A;  3ARY A;  1GOI A;  2M2A A;  3LKX B; 
#chains in the Genus database with same CATH homology
 1WNO A;  3GPK A;  2WM0 A;  4JFM A;  4WKA A;  3AS3 A;  4G2P A;  2O92 A;  1GUV A;  1NSG A;  4KQZ A;  4ODR A;  1ZK6 A;  4KR0 B;  5E5W A;  4LAW A;  2ZR6 A;  2AOS A;  1D6O A;  3MQH A;  4Q7N A;  2A3A A;  4IT6 A;  5HT1 A;  3MDY B;  1W9P A;  4S3K A;  1W1P A;  5DO2 A;  3MCB A;  1FFR A;  1FFQ A;  2DG9 A;  4LAV A;  1ZBV A;  3ARO A;  2M8I A;  1D7I A;  2RSE A;  2ZR4 A;  3KAG A;  1J6Y A;  4ODN A;  4A0U A;  3ARR A;  1FKG A;  2UZ5 A;  3O5D A;  1HKM A;  3WD3 A;  3G6L A;  4P8V A;  1E6N A;  4NNR A;  1LQ0 A;  3ART A;  1J4R A;  3PQH A;  1Q6H A;  3ARX A;  2B31 A;  3WL0 A;  3KAC A;  2ITK A;  1Q1C A;  2YSF A;  1H0I A;  2LPV A;  4MNM A;  1QPL A;  1FKF A;  2L2S A;  4A0T A;  3ARZ A;  1HKK A;  4AY1 A;  3ALF A;  3O5M A;  2YSB A;  2ZQV A;  2WK2 A;  1HKJ A;  3WQV A;  4DWS D;  4Z2L A;  3AS1 A;  4DZ3 A;  1SR0 A;  4MNK A;  3PA7 A;  1FKK A;  2DT2 A;  4HBE A;  3PRA A;  2RUD A;  4Z2G A;  3IHZ A;  1NWT A;  3WD0 A;  3CHF A;  4N19 A;  2JV4 A;  4DRI A;  4W9P A;  2OWO A;  4J4N A;  5I98 A;  2F4E A;  4TW8 A;  4DWS C;  5GPR A;  3WD1 A;  2DK7 A;  2G8Z A;  1EHN A;  2MF9 A;  3KAF A;  1JNS A;  3ARQ A;  1OGG A;  3WH0 A;  1HJX A;  4P8X A;  1FKB A;  3O5K A;  3O5O A;  1LJY A;  1C9H A;  1NWR A;  1W9U A;  2DPE A;  4WKH A;  5GPG A;  1E6Z A;  2JXW A;  4R0X A;  4NZC A;  1HKI A;  4DWS A;  2DMV A;  2YSH A;  3TDB A;  4DRO A;  4O2T A;  2O9O A;  4ML4 A;  3W4R A;  2LKN A;  4ZPW R;  1T11 A;  1E9L A;  4ITZ A;  1Y0O A;  5HWC A;  4DIP A;  4DRJ A;  4GGQ A;  2OLH A;  5B8I C;  3AQU A;  1FKH A;  2PV1 A;  5CQ2 A;  2M3O W;  1JND A;  5HW8 A;  3LKX A;  1UR9 A;  5JH8 A;  2ZR5 A;  1FAP A;  2MLY A;  4WKF A;  3FSC A;  2XPB A;  1TR8 A;  4GLX A;  1GPF A;  3ARP A;  3WKZ A;  1PIN A;  1TK7 A;  1EDQ A;  4GIV A;  4W5U A;  4MTV A;  3KAB A;  2RUR A;  4QT2 A;  4ODL A;  2ZQS A;  1XHG A;  3O5E A;  4JYS A;  3KZ7 A;  2XPA A;  2AWG A;  3TCZ A;  2WLZ A;  1LG1 A;  2PV3 A;  4ZS6 A;  4WIW A;  3NRK A;  2XP8 A;  1WMV A;  3AS2 A;  3O5G A;  1OGB A;  3KAD A;  2JMF A;  2VN1 A;  4U86 A;  4DRQ A;  4DRK A;  1EG4 A;  2A3C A;  1HJV A;  4ODK A;  4JFI A;  1FJD A;  3CZ8 A;  2KI3 A;  1ZB5 A;  1SYT A;  3FXY A;  3O5R A;  4P8W A;  4U84 A;  1D7H A;  5HTG A;  3RFW A;  3UQA A;  2WLY A;  2XP4 A;  3M85 A;  2PPP A;  4DWS B;  3CNG A;  5E62 A;  2LJ4 A;  5DIT A;  3UI4 A;  5HKG A;  2FDM A;  4ODQ A;  3EY6 A;  1FKS A;  5E65 A;  1J4I A;  1FKJ A;  2LGO A;  2LAJ A;  3CHC A;  1YW5 A;  2QRV A;  3ARV A;  2FAP A;  2FKE A;  3VAW A;  4MPK A;  4ODM A;  1X6L A;  1WR7 A;  1LG2 A;  2XP6 A;  1BKF A;  4IQ2 A;  4QIB A;  1I5H W;  3B8S A;  2XP3 A;  2Q5A A;  4J4O A;  3BXW A;  4DH0 A;  3ALG A;  3WD2 A;  3PR9 A;  3WL1 A;  2N87 A;  4MAV A;  1EG3 A;  2DSW A;  1TFV A;  2KFW A;  3WD4 A;  2PBC A;  4Z2I A;  2WAD A;  2DSZ A;  3MQG A;  1QZ2 A;  3CGN A;  4Z2H A;  2A3E A;  4DT4 A;  4ODO A;  5DIU A;  3LUO A;  4TYO A;  2MDI A;  2YSI A;  3CHD A;  4ODP A;  2KO7 A;  1CTN A;  3I6C A;  2M8J A;  2RQS A;  1H0G A;  1KT1 A;  1RD6 A;  5D75 A;  3ODK A;  1A7X A;  2K8I A;  3ARU A;  3RME A;  3NI6 A;  4JFJ A;  1O6W A;  1LL4 A;  1E15 A;  4DRP A;  2RE3 A;  4REX A;  3O5J A;  3QOK A;  3JYM A;  4Z2K A;  4TNS A;  1L1P A;  1B6C A;  1LL6 A;  2DJY A;  4HAR A;  4C02 B;  1F8A B;  1EYM A;  2MLX A;  4ZPV R;  3B7X A;  2D9F A;  3M7N A;  1M5Y A;  2ZAJ A;  1VF8 A;  5HW6 A;  1OWQ A;  1TCO C;  1JNT A;  4LAX A;  5J6E A;  4MNL A;  1O6I A;  1NWU A;  2JZV A;  5HW7 A;  2KGJ A;  1ZCN A;  1K9Q A;  2ZQT A;  4W9O A;  4DRM A;  4QT3 A;  1D7J A;  1Q6U A;  3RM4 A;  4FAP A;  1KFW A;  1UR8 A;  5HUA A;  3WIJ A;  5BXJ A;  1WAW A;  2DT0 A;  3FS8 A;  4XAK A;  3OA5 A;  2IF4 A;  1W26 A;  2DSV A;  4MNJ A;  1NH6 A;  2E45 A;  1U79 A;  2PPO A;  1W1Y A;  4U85 A;  3JXV A;  1X6N A;  3LE4 A;  3FSB A;  1E6P A;  3O5Q A;  5HBF A;  4TX0 A;  1W1V A;  1NMW A;  1P5Q A;  1K9R A;  4W9Q A;  4DRN A;  2YBT A;  2Y78 A;  1NWS A;  1ZBK A;  3UQI A;  2DWV A;  3B9D A;  4L3N A;  2RUQ A;  4DZ2 A;  1YAT A;  4LGX A;  4P8U A;  2XP9 A;  2XP7 A;  1HJW A;  3IKD A;  4ZPT R;  1FD9 A;  3UI6 A;  2A3B A;  2ESC A;  2OFN A;  3CHE A;  3UQB A;  2QF8 A;  4E5R A;  3NTP A;  4L72 B;  2ZQU A;  1J4H A;  2DK1 A;  2RUC A;  3CGM A;  3FAP A;  3RM9 A;  2DG3 A;  1E6R A;  4IPX A;  2L4J A;  3KAH A;  5DEZ A;  1RP5 A;  4Z2J A;  1LL7 A;  1Q6I A;  2XP5 A;  4NSB A;  5E64 A;  4WJX A;  2DG4 A;  3IK8 A;  1WB0 A;  4JFK A;  3L4H A;  2MPH A;  1QPF A;  1ROU A;  2M08 A;  4WK9 A;  5U47 A;  4TW6 A;  4URI A;  2KR7 A;  3O5P A;  4BF8 A;  4MSP A;  2PI6 A;  1XRV A;  3O5I A;  3UI5 A;  4LAY A;  2G41 A;  1FKR A;  3KAI A;  3PRB A;  5HWB A;  1EQ3 A;  4FN2 A;  2BA1 A;  4DRH A;  4IQC A;  3RGC A;  2KE0 A;  2DSU A;  1ROT A;  3OOB A;  3PRD A;  1JMQ A;  2MNT A;  1JVW A;  3KCE A;  5DIV A;  3JYJ A;  2WAE A;  3MCB B;  4TW7 A;  2Y8N B;  5DF0 A;  1ZU8 A;  2YBU A;  2EZ5 W;  4QZV B;  4Q22 A;  1K9T A;  4S3J A;  3TC5 A;  1R9H A;  1F40 A;  1FKI A;  1JNE A;  2F21 A;  2KXQ A;  2PV2 A;  4R5E A;  2M1I A;  3G6M A;  1EIB A;  4JFL A;  3UF8 A;  1FKL A;  1HXV A;  3B9E A;  1PBK A;  2DT1 A;  2IUZ A;  5GQB A;  3WQW A;  1NMV A;  3CH9 A;  3O5F A;  1IX5 A;  1W9V A;  1ITX A;  5E66 A;  4MGV A;  1KT0 A;  4PTM A;  3FY1 A;  2F2D A;  3O5L A;  2PPN A;  3ARS A;  2YSG A;  1D2K A;  3B9A A;  5AHT A;  1BL4 A;  3IKG A;  2DT3 A;  1N1A A;  1ZL1 A;  3ARW A;  2JX8 A;  2MLZ A;  2VCD A;  1W1T A;  3RM8 A;  4IT4 A;  1FLC A;  4G50 A;  1ZBW A;  1ZBC A;  2YAJ B;  4HBO A;  3AS0 A;  3H9R B;  1FKT A;  1FKD A;  3ARY A;  1GOI A;  2M2A A;  3LKX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...