3KAFA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMAKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 41
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kafA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kafA02
3NRKA 2PV2A 1KT0A 2DWVA 2ZQUA 4W9PA 4JFKA 2JV4A 2L2SA 2RUCA 4R0XA 2ZR5A 4TW8A 1JVWA 4REXA 4DH0A 3CGNA 3VAWA 4JFIA 3O5EA 1TCOC 2M8IA 3KCEA 1FKGA 4DRQA 1Q6IA 3M7NA 3O5KA 2F21A 4MSPA 4IPXA 3M85A 3IKGA 5DIUA 3NI6A 4TYOA 1F40A 2F4EA 4QIBA 4J4NA 2Q5AA 1WR7A 4DRJA 5HTGA 2RE3A 2XPAA 3PRDA 4DZ3A 3CGMA 1QZ2A 5D75A 2MPHA 2Y78A 5BXJA 1JNTA 1FKRA 2BA1A 1PINA 1ZK6A 1NSGA 3UI6A 3MDYB 4TW6A 3O5MA 2XP6A 5DITA 2PPPA 4TW7A 4DZ2A 1YW5A 5HWCA 2VCDA 2YSBA 1W26A 3O5FA 2N87A 2ZR6A 1YATA 3LE4A 2XP8A 1D6OA 2ITKA 4FN2A 1L1PA 4ITZA 4NNRA 2M2AA 2PPNA 4MGVA 4TNSA 3O5JA 2MLYA 2XPBA 3LUOA 1EG4A 2JX8A 2DG4A 1D7HA 4GGQA 1F8AB 5HUAA 2IF4A 4DRMA 3KZ7A 4ODNA 2MLXA 3O5GA 1J6YA 2RSEA 2RURA 3TDBA 3H9RB 2DK1A 4W9QA 2PV3A 4C02B 3NTPA 4W9OA 4QT2A 1O6WA 4U84A 4IQCA 3FAPA 3UQAA 4JYSA 4DRNA 1U79A 2PBCA 2KGJA 4LAXA 3L4HA 2AWGA 5CQ2A 4ODOA 5DIVA 2KO7A 2JZVA 3O5QA 3UQIA 5AHTA 3UI4A 1KT1A 2LGOA 4O2TA 4QT3A 3O5DA 2RUQA 3B7XA 2ZQTA 3RGCA 4U86A 4ODPA 2K8IA 3KAGA 3IHZA 2RUDA 3KAIA 1J4HA 2PPOA 2VN1A 1PBKA 3PRBA 2KE0A 2M1IA 3EY6A 2D9FA 1EQ3A 1M5YA 2M08A 1EYMA 1D7JA 2FKEA 1FKBA 4LAYA 2ZAJA 2KFWA 3O5IA 2EZ5W 4ODRA 5HKGA 1EG3A 1JMQA 2MLZA 2YSGA 1BL4A 5HW8A 1WMVA 1Q1CA 3CNGA 1ROUA 1BKFA 4IQ2A 1FJDA 2FAPA 4J4OA 2JXWA 3WH0A 3KAHA 3UQBA 4ODQA 1N1AA 2OFNA 5B8IC 2KI3A 1FKIA 5HWBA 1Y0OA 1ZCNA 3KADA 3KAFA 1T11A 3PA7A 1C9HA 1QPFA 2MNTA 4G50A 1FKKA 1P5QA 3IK8A 2DG9A 2ZQSA 1FD9A 3IKDA 5J6EA 3KACA 3O5RA 2XP3A 3JYMA 2JMFA 4DT4A 1K9RA 4JFMA 2XP9A 1HXVA 2LKNA 2M3OW 3TCZA 2M8JA 1A7XA 2YSFA 5GPGA 2PV1A 4TX0A 1R9HA 4ODMA 5HW6A 5HT1A 1FAPA 3O5OA 4G2PA 1FKLA 2XP5A 3UI5A 1B6CA 2KXQA 1J4RA 2L4JA 3GPKA 2MDIA 1FKJA 4DRPA 1J4IA 2XP7A 4LAVA 4DRKA 3KABA 4DIPA 1ROTA 4E5RA 4DRIA 2ZR4A 2F2DA 1TK7A 5HW7A 2DJYA 2KR7A 5I98A 1Q6HA 1QPLA 4N19A 2YSIA 2MF9A 4DRHA 1FKSA 4U85A 1FKHA 3I6CA 4JFJA 4FAPA 1K9QA 2LJ4A 3O5LA 4BF8A 2XP4A 2ZQVA 4JFLA 1FKDA 3O5PA 3UF8A 2LAJA 4GIVA 4LAWA 2DK7A 1FKTA 1NMWA 1D7IA 1JNSA 4DROA 4ODKA 1FKFA 2UZ5A 1Q6UA 2YSHA 3TC5A 2E45A 3RFWA 1I5HW 1NMVA 2DG3A 4ODLA 3OOBA 3ODKA 3JXVA 2LPVA 2RQSA 2DMVA 3JYJA
chains in the Genus database with same CATH superfamily
2WADA 3NRKA 2PV2A 1KT0A 2DWVA 2ZQUA 3FS8A 5GQBA 1E6NA 3G6LA 2IUZA 2PN0A 4W9PA 4JFKA 2JV4A 2L2SA 2RUCA 4ZPTR 4PTMA 4R0XA 2G41A 4L3NA 2ZR5A 4TW8A 1JVWA 4REXA 4HBOA 4DH0A 3LKXB 1X6LA 3AS1A 2O92A 3CGNA 3VAWA 4JFIA 1OWQA 3O5EA 4QZVB 1TCOC 2M8IA 3KCEA 1FKGA 4DRQA 2DT2A 1Q6IA 2AOSA 3M7NA 3GTYX 3O5KA 2F21A 4ZPVR 3ARQA 1NWTA 4MSPA 3FSBA 4IPXA 3M85A 3OA5A 3IKGA 5DIUA 3NI6A 3BMBA 4TYOA 1WAWA 1F40A 4WKAA 2F4EA 4QIBA 4ML4A 4J4NA 4L72B 1GRJA 3ARTA 5U47A 2Q5AA 1WR7A 1WNOA 3EIPA 1LL6A 4DRJA 1ZBVA 5HTGA 2F23A 2RE3A 2XPAA 3PRDA 4DZ3A 1HJWA 3CGMA 4IT4A 1QZ2A 5D75A 2OWOA 2MPHA 2Y78A 3WQVA 5BXJA 1JNTA 1FKRA 3PQHA 2BA1A 3GU0A 1LG2A 1PINA 1HJXA 5E66A 1ZK6A 1ITXA 2QRVA 1NSGA 4KQZA 3UI6A 1HJVA 3MDYB 3B8SA 4TW6A 3O5MA 2XP6A 1KFWA 5DITA 4DWSA 2PPPA 4TW7A 4DZ2A 1YW5A 2PI6A 2FDMA 5HWCA 2VCDA 3B9DA 2YSBA 4ZPWR 1EHNA 5E65A 1W26A 2WM0A 3O5FA 2N87A 3FXYA 2Y8NB 3WD1A 3G6MA 1LJYA 1NWSA 4MPKA 4Z2LA 3ALGA 3PRAA 2ZR6A 1YATA 3LE4A 1TFVA 3ARXA 3B9AA 1XRVA 1NWRA 4MAVA 2XP8A 5E62A 2ITKA 1D6OA 4FN2A 1L1PA 4ITZA 4NNRA 3BXWA 2M2AA 2PPNA 4W5UA 4MGVA 4TNSA 3O5JA 2MLYA 2XPBA 3LUOA 1EG4A 2JX8A 2DG4A 2DSVA 1D7HA 2QF8A 4GGQA 2A3BA 1F8AB 1NH6A 1W9UA 2DSWA 5HUAA 2IF4A 4Z2IA 4DRMA 3MCBB 4MNMA 3KZ7A 4ODNA 4P8WA 2MLXA 3O5GA 2DSUA 1OGGA 1J6YA 1LL7A 2RSEA 3FSCA 3WQWA 2RURA 2DSZA 3TDBA 3H9RB 2B5UB 1ZBCA 3WD4A 2DK1A 1VF8A 4W9QA 2ETNA 2PV3A 4C02B 3CZ8A 3NTPA 4W9OA 3CHFA 4QT2A 1O6WA 1HKJA 4U84A 2G8ZA 4IQCA 3FAPA 3UQAA 5DF0A 2ESCA 3AS3A 5E5WA 3CHCA 1W9PA 4JYSA 4DRNA 1U79A 3ARYA 2PBCA 3ARVA 2KGJA 4LAXA 4DWSC 3L4HA 1JNDA 2AWGA 1K9TA 5CQ2A 4ODOA 5DIVA 4WKFA 2KO7A 3AROA 2JZVA 3O5QA 3UQIA 4IT6A 5AHTA 3UI4A 1KT1A 4S3JA 2LGOA 3RM4A 4O2TA 3LKXA 4QT3A 3ARZA 1TR8A 3O5DA 4S3KA 2RUQA 1E44A 3B7XA 2ZQTA 3RGCA 4Q7NA 4U86A 1EDQA 3CHDA 1H0IA 5HW6A 4ODPA 2K8IA 3ARRA 4UDMA 3KAGA 1E6PA 1JNEA 3PR9A 3IHZA 3AQUA 4XAKA 2RUDA 3KAIA 1J4HA 4GLXA 2PPOA 2VN1A 1LG1A 1PBKA 3PRBA 1RP5A 2KE0A 4Z2HA 3MQGA 2M1IA 3EY6A 1D2KA 2D9FA 2DT3A 4LGXA 3WL1A 1EQ3A 1M5YA 1HKKA 2M08A 1EYMA 1D7JA 3B9EA 2FKEA 4AY1A 3ARWA 1LQ0A 1FKBA 4LAYA 2ZAJA 2KFWA 3O5IA 2EZ5W 4ODRA 5HKGA 1EG3A 1JMQA 2MLZA 3ALFA 2YSGA 1BL4A 3MQHA 5HW8A 1WMVA 1Q1CA 3CNGA 1ROUA 1W9VA 1H0GA 1BKFA 4IQ2A 4P8XA 1FJDA 1SYTA 2DT0A 3ARSA 2FAPA 4J4OA 1LL4A 2JXWA 3ARUA 3WH0A 3KAHA 3UQBA 4ODQA 2OLHA 2YBUA 1N1AA 2OFNA 1ZB5A 2A3AA 5B8IC 1JCHB 2KI3A 5E64A 5HBFA 1FKIA 5HWBA 1Y0OA 1ZCNA 3KADA 3KAFA 4A0UA 3W4RA 1T11A 3PA7A 1C9HA 1QPFA 4HBEA 2A3CA 1UR9A 1SR0A 2MNTA 3AS2A 4G50A 3QOKA 3ARPA 4NZCA 1FKKA 1P5QA 3IK8A 1IX5A 3FY1A 2DG9A 2ZQSA 1FD9A 3IKDA 5J6EA 4URIA 3KACA 4R5EA 3O5RA 2XP3A 3JYMA 2JMFA 4DT4A 1K9RA 4JFMA 2XP9A 1FFRA 1HKMA 4A0TA 1E6ZA 5JH8A 1HXVA 4KR0B 1NWUA 2LKNA 2M3OW 3TCZA 2M8JA 4MNKA 1A7XA 2YSFA 5GPGA 2PV1A 4TX0A 1R9HA 4ODMA 1ZBKA 4MNLA 5HT1A 4Z2GA 1FAPA 1O6IA 3O5OA 4G2PA 4P8UA 3RM9A 2P4VA 1FLCA 2WLYA 4Q22A 4DWSB 3WIJA 4ZS6A 2WK2A 1FKLA 1W1TA 1HKIA 1X6NA 1GPFA 2XP5A 3MCBA 3UI5A 1FFQA 2DT1A 1B6CA 3RM8A 2KXQA 5DO2A 2WLZA 2YBTA 1J4RA 2L4JA 1W1PA 3GPKA 2MDIA 1FKJA 4DRPA 1J4IA 2XP7A 3WD0A 4LAVA 4DRKA 3KABA 2WAEA 1ROTA 3RMEA 2DPEA 4DIPA 4E5RA 4DRIA 1OGBA 2ZR4A 3CHEA 4WK9A 2F2DA 1TK7A 4DWSD 5HW7A 1CTNA 2EULA 2DJYA 2KR7A 5I98A 1Q6HA 1QPLA 4HARA 4N19A 4Z2JA 2MF9A 2YSIA 1W1VA 1WB0A 4DRHA 1FKSA 4U85A 1ZU8A 1FKHA 3I6CA 4WIWA 4JFJA 4FAPA 1ZL1A 2B31A 1K9QA 2O9OA 2LJ4A 3CH9A 3O5LA 1RD6A 4BF8A 2XP4A 4NSBA 4MNJA 2ZQVA 1W1YA 4JFLA 4P8VA 5GPRA 3WL0A 1FKDA 3O5PA 3UF8A 3AS0A 2LAJA 4GIVA 4LAWA 2DK7A 1FKTA 1NMWA 1ZBWA 4WJXA 1D7IA 2YAJB 4WKHA 1JNSA 1E6RA 3WD2A 1E15A 4DROA 4ODKA 1XHGA 1FKFA 1UR8A 3WD3A 2A3EA 2UZ5A 1Q6UA 2YSHA 4Z2KA 3TC5A 2E45A 3RFWA 1I5HW 1NMVA 2DG3A 4MTVA 4ODLA 5DEZA 3OOBA 1GUVA 1EIBA 3WKZA 3ODKA 1E9LA 3JXVA 2LPVA 2RQSA 1GOIA 2DMVA 3JYJA
chains in the Genus database with same CATH topology
2WADA 3NRKA 2PV2A 1KT0A 2DWVA 2ZQUA 3FS8A 5GQBA 1E6NA 3G6LA 2IUZA 4W9PA 4JFKA 2JV4A 2L2SA 2RUCA 4ZPTR 4PTMA 4R0XA 2G41A 4L3NA 2ZR5A 4TW8A 1JVWA 4REXA 4HBOA 4DH0A 3LKXB 1X6LA 3AS1A 2O92A 3CGNA 3VAWA 4JFIA 1OWQA 3O5EA 4QZVB 1TCOC 2M8IA 3KCEA 1FKGA 4DRQA 2DT2A 1Q6IA 2AOSA 3M7NA 3O5KA 2F21A 4ZPVR 3ARQA 1NWTA 4MSPA 3FSBA 4IPXA 3M85A 3OA5A 3IKGA 5DIUA 3NI6A 4TYOA 1WAWA 1F40A 4WKAA 2F4EA 4QIBA 4ML4A 4J4NA 4L72B 3ARTA 5U47A 2Q5AA 1WR7A 1WNOA 4DRJA 1LL6A 5HTGA 1ZBVA 2RE3A 2XPAA 3PRDA 4DZ3A 1HJWA 3CGMA 4IT4A 1QZ2A 5D75A 2OWOA 2MPHA 2Y78A 3WQVA 5BXJA 1JNTA 1FKRA 3PQHA 2BA1A 1LG2A 1PINA 1HJXA 5E66A 1ZK6A 1ITXA 2QRVA 1NSGA 4KQZA 3UI6A 1HJVA 3MDYB 3B8SA 4TW6A 3O5MA 2XP6A 1KFWA 5DITA 4DWSA 2PPPA 4TW7A 4DZ2A 1YW5A 2PI6A 2FDMA 5HWCA 2VCDA 3B9DA 2YSBA 4ZPWR 1EHNA 5E65A 1W26A 2WM0A 3O5FA 2N87A 3FXYA 2Y8NB 3WD1A 3G6MA 1LJYA 1NWSA 4MPKA 4Z2LA 3ALGA 3PRAA 2ZR6A 1YATA 3LE4A 1TFVA 3ARXA 3B9AA 1XRVA 1NWRA 4MAVA 2XP8A 5E62A 2ITKA 1D6OA 4FN2A 1L1PA 4ITZA 4NNRA 3BXWA 2M2AA 2PPNA 4W5UA 4MGVA 4TNSA 3O5JA 2MLYA 2XPBA 3LUOA 1EG4A 2JX8A 2DG4A 2DSVA 1D7HA 2QF8A 4GGQA 2A3BA 1F8AB 1NH6A 1W9UA 2DSWA 5HUAA 2IF4A 4Z2IA 4DRMA 3MCBB 4MNMA 3KZ7A 4ODNA 4P8WA 2MLXA 3O5GA 2DSUA 1OGGA 1J6YA 1LL7A 2RSEA 3FSCA 3WQWA 2RURA 2DSZA 3TDBA 3H9RB 1ZBCA 3WD4A 2DK1A 1VF8A 4W9QA 2PV3A 4C02B 3CZ8A 3NTPA 4W9OA 3CHFA 4QT2A 1O6WA 1HKJA 4U84A 2G8ZA 4IQCA 3FAPA 3UQAA 5DF0A 2ESCA 3AS3A 5E5WA 3CHCA 1W9PA 4JYSA 4DRNA 1U79A 3ARYA 2PBCA 3ARVA 2KGJA 4LAXA 4DWSC 3L4HA 1JNDA 2AWGA 1K9TA 5CQ2A 4ODOA 5DIVA 4WKFA 2KO7A 3AROA 2JZVA 3O5QA 3UQIA 4IT6A 5AHTA 3UI4A 1KT1A 4S3JA 2LGOA 3RM4A 4O2TA 3LKXA 4QT3A 3ARZA 1TR8A 3O5DA 4S3KA 2RUQA 3B7XA 2ZQTA 3RGCA 4Q7NA 4U86A 1EDQA 3CHDA 1H0IA 5HW6A 4ODPA 2K8IA 3ARRA 3KAGA 1E6PA 1JNEA 3PR9A 3IHZA 3AQUA 4XAKA 2RUDA 3KAIA 1J4HA 4GLXA 2PPOA 2VN1A 1LG1A 1PBKA 3PRBA 1RP5A 2KE0A 4Z2HA 3MQGA 2M1IA 3EY6A 1D2KA 2D9FA 2DT3A 4LGXA 3WL1A 1EQ3A 1M5YA 1HKKA 2M08A 1EYMA 1D7JA 3B9EA 2FKEA 4AY1A 3ARWA 1LQ0A 1FKBA 4LAYA 2ZAJA 2KFWA 3O5IA 2EZ5W 4ODRA 5HKGA 1EG3A 1JMQA 2MLZA 3ALFA 2YSGA 1BL4A 3MQHA 5HW8A 1WMVA 1Q1CA 3CNGA 1ROUA 1W9VA 1H0GA 1BKFA 4IQ2A 4P8XA 1FJDA 1SYTA 2DT0A 3ARSA 2FAPA 4J4OA 1LL4A 2JXWA 3ARUA 3WH0A 3KAHA 3UQBA 4ODQA 2OLHA 2YBUA 1N1AA 2OFNA 1ZB5A 2A3AA 5B8IC 2KI3A 5HBFA 5E64A 1FKIA 5HWBA 1Y0OA 1ZCNA 3KADA 3KAFA 4A0UA 3W4RA 1T11A 3PA7A 1C9HA 1QPFA 4HBEA 2A3CA 1UR9A 1SR0A 2MNTA 3AS2A 4G50A 3QOKA 3ARPA 4NZCA 1FKKA 1P5QA 3IK8A 1IX5A 3FY1A 2DG9A 2ZQSA 1FD9A 3IKDA 5J6EA 4URIA 3KACA 4R5EA 3O5RA 2XP3A 3JYMA 2JMFA 4DT4A 1K9RA 4JFMA 2XP9A 1FFRA 1HKMA 4A0TA 1E6ZA 5JH8A 1HXVA 4KR0B 1NWUA 2LKNA 2M3OW 3TCZA 2M8JA 4MNKA 1A7XA 2YSFA 5GPGA 2PV1A 4TX0A 1R9HA 4ODMA 1ZBKA 4MNLA 5HT1A 4Z2GA 1FAPA 1O6IA 3O5OA 4G2PA 4P8UA 3RM9A 4DWSB 1FLCA 2WLYA 4Q22A 3WIJA 4ZS6A 2WK2A 1FKLA 1W1TA 1HKIA 1X6NA 1GPFA 2XP5A 3MCBA 3UI5A 1FFQA 2DT1A 1B6CA 3RM8A 2KXQA 5DO2A 2WLZA 2YBTA 1J4RA 2L4JA 1W1PA 3GPKA 2MDIA 1FKJA 4DRPA 1J4IA 2XP7A 3WD0A 4LAVA 4DRKA 3KABA 2WAEA 1ROTA 3RMEA 2DPEA 4DIPA 4E5RA 4DRIA 1OGBA 2ZR4A 3CHEA 4WK9A 2F2DA 1TK7A 4DWSD 5HW7A 1CTNA 2DJYA 2KR7A 5I98A 1Q6HA 1QPLA 4HARA 4N19A 4Z2JA 2YSIA 1W1VA 1WB0A 2MF9A 4DRHA 1FKSA 4U85A 1ZU8A 1FKHA 3I6CA 4WIWA 4JFJA 4FAPA 1ZL1A 2B31A 1K9QA 2O9OA 2LJ4A 3CH9A 3O5LA 1RD6A 4BF8A 2XP4A 4NSBA 4MNJA 2ZQVA 1W1YA 4JFLA 4P8VA 5GPRA 3WL0A 1FKDA 3O5PA 3UF8A 3AS0A 2LAJA 4GIVA 4LAWA 2DK7A 1FKTA 1NMWA 1ZBWA 4WJXA 1D7IA 2YAJB 4WKHA 1JNSA 1E6RA 3WD2A 1E15A 4DROA 4ODKA 1XHGA 1FKFA 1UR8A 3WD3A 2A3EA 2UZ5A 1Q6UA 2YSHA 4Z2KA 3TC5A 2E45A 3RFWA 1I5HW 1NMVA 2DG3A 4MTVA 4ODLA 5DEZA 3OOBA 1GUVA 1EIBA 3WKZA 3ODKA 1E9LA 3JXVA 2LPVA 2RQSA 1GOIA 2DMVA 3JYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRK A;  2PV2 A;  1KT0 A;  2DWV A;  2ZQU A;  4W9P A;  4JFK A;  2JV4 A;  2L2S A;  2RUC A;  4R0X A;  2ZR5 A;  4TW8 A;  1JVW A;  4REX A;  4DH0 A;  3CGN A;  3VAW A;  4JFI A;  3O5E A;  1TCO C;  2M8I A;  3KCE A;  1FKG A;  4DRQ A;  1Q6I A;  3M7N A;  3O5K A;  2F21 A;  4MSP A;  4IPX A;  3M85 A;  3IKG A;  5DIU A;  3NI6 A;  4TYO A;  1F40 A;  2F4E A;  4QIB A;  4J4N A;  2Q5A A;  1WR7 A;  4DRJ A;  5HTG A;  2RE3 A;  2XPA A;  3PRD A;  4DZ3 A;  3CGM A;  1QZ2 A;  5D75 A;  2MPH A;  2Y78 A;  5BXJ A;  1JNT A;  1FKR A;  2BA1 A;  1PIN A;  1ZK6 A;  1NSG A;  3UI6 A;  3MDY B;  4TW6 A;  3O5M A;  2XP6 A;  5DIT A;  2PPP A;  4TW7 A;  4DZ2 A;  1YW5 A;  5HWC A;  2VCD A;  2YSB A;  1W26 A;  3O5F A;  2N87 A;  2ZR6 A;  1YAT A;  3LE4 A;  2XP8 A;  1D6O A;  2ITK A;  4FN2 A;  1L1P A;  4ITZ A;  4NNR A;  2M2A A;  2PPN A;  4MGV A;  4TNS A;  3O5J A;  2MLY A;  2XPB A;  3LUO A;  1EG4 A;  2JX8 A;  2DG4 A;  1D7H A;  4GGQ A;  1F8A B;  5HUA A;  2IF4 A;  4DRM A;  3KZ7 A;  4ODN A;  2MLX A;  3O5G A;  1J6Y A;  2RSE A;  2RUR A;  3TDB A;  3H9R B;  2DK1 A;  4W9Q A;  2PV3 A;  4C02 B;  3NTP A;  4W9O A;  4QT2 A;  1O6W A;  4U84 A;  4IQC A;  3FAP A;  3UQA A;  4JYS A;  4DRN A;  1U79 A;  2PBC A;  2KGJ A;  4LAX A;  3L4H A;  2AWG A;  5CQ2 A;  4ODO A;  5DIV A;  2KO7 A;  2JZV A;  3O5Q A;  3UQI A;  5AHT A;  3UI4 A;  1KT1 A;  2LGO A;  4O2T A;  4QT3 A;  3O5D A;  2RUQ A;  3B7X A;  2ZQT A;  3RGC A;  4U86 A;  4ODP A;  2K8I A;  3KAG A;  3IHZ A;  2RUD A;  3KAI A;  1J4H A;  2PPO A;  2VN1 A;  1PBK A;  3PRB A;  2KE0 A;  2M1I A;  3EY6 A;  2D9F A;  1EQ3 A;  1M5Y A;  2M08 A;  1EYM A;  1D7J A;  2FKE A;  1FKB A;  4LAY A;  2ZAJ A;  2KFW A;  3O5I A;  2EZ5 W;  4ODR A;  5HKG A;  1EG3 A;  1JMQ A;  2MLZ A;  2YSG A;  1BL4 A;  5HW8 A;  1WMV A;  1Q1C A;  3CNG A;  1ROU A;  1BKF A;  4IQ2 A;  1FJD A;  2FAP A;  4J4O A;  2JXW A;  3WH0 A;  3KAH A;  3UQB A;  4ODQ A;  1N1A A;  2OFN A;  5B8I C;  2KI3 A;  1FKI A;  5HWB A;  1Y0O A;  1ZCN A;  3KAD A;  3KAF A;  1T11 A;  3PA7 A;  1C9H A;  1QPF A;  2MNT A;  4G50 A;  1FKK A;  1P5Q A;  3IK8 A;  2DG9 A;  2ZQS A;  1FD9 A;  3IKD A;  5J6E A;  3KAC A;  3O5R A;  2XP3 A;  3JYM A;  2JMF A;  4DT4 A;  1K9R A;  4JFM A;  2XP9 A;  1HXV A;  2LKN A;  2M3O W;  3TCZ A;  2M8J A;  1A7X A;  2YSF A;  5GPG A;  2PV1 A;  4TX0 A;  1R9H A;  4ODM A;  5HW6 A;  5HT1 A;  1FAP A;  3O5O A;  4G2P A;  1FKL A;  2XP5 A;  3UI5 A;  1B6C A;  2KXQ A;  1J4R A;  2L4J A;  3GPK A;  2MDI A;  1FKJ A;  4DRP A;  1J4I A;  2XP7 A;  4LAV A;  4DRK A;  3KAB A;  4DIP A;  1ROT A;  4E5R A;  4DRI A;  2ZR4 A;  2F2D A;  1TK7 A;  5HW7 A;  2DJY A;  2KR7 A;  5I98 A;  1Q6H A;  1QPL A;  4N19 A;  2YSI A;  2MF9 A;  4DRH A;  1FKS A;  4U85 A;  1FKH A;  3I6C A;  4JFJ A;  4FAP A;  1K9Q A;  2LJ4 A;  3O5L A;  4BF8 A;  2XP4 A;  2ZQV A;  4JFL A;  1FKD A;  3O5P A;  3UF8 A;  2LAJ A;  4GIV A;  4LAW A;  2DK7 A;  1FKT A;  1NMW A;  1D7I A;  1JNS A;  4DRO A;  4ODK A;  1FKF A;  2UZ5 A;  1Q6U A;  2YSH A;  3TC5 A;  2E45 A;  3RFW A;  1I5H W;  1NMV A;  2DG3 A;  4ODL A;  3OOB A;  3ODK A;  3JXV A;  2LPV A;  2RQS A;  2DMV A;  3JYJ A; 
#chains in the Genus database with same CATH topology
 2WAD A;  3NRK A;  2PV2 A;  1KT0 A;  2DWV A;  2ZQU A;  3FS8 A;  5GQB A;  1E6N A;  3G6L A;  2IUZ A;  2PN0 A;  4W9P A;  4JFK A;  2JV4 A;  2L2S A;  2RUC A;  4ZPT R;  4PTM A;  4R0X A;  2G41 A;  4L3N A;  2ZR5 A;  4TW8 A;  1JVW A;  4REX A;  4HBO A;  4DH0 A;  3LKX B;  1X6L A;  3AS1 A;  2O92 A;  3CGN A;  3VAW A;  4JFI A;  1OWQ A;  3O5E A;  4QZV B;  1TCO C;  2M8I A;  3KCE A;  1FKG A;  4DRQ A;  2DT2 A;  1Q6I A;  2AOS A;  3M7N A;  3GTY X;  3O5K A;  2F21 A;  4ZPV R;  3ARQ A;  1NWT A;  4MSP A;  3FSB A;  4IPX A;  3M85 A;  3OA5 A;  3IKG A;  5DIU A;  3NI6 A;  3BMB A;  4TYO A;  1WAW A;  1F40 A;  4WKA A;  2F4E A;  4QIB A;  4ML4 A;  4J4N A;  4L72 B;  1GRJ A;  3ART A;  5U47 A;  2Q5A A;  1WR7 A;  1WNO A;  3EIP A;  1LL6 A;  4DRJ A;  1ZBV A;  5HTG A;  2F23 A;  2RE3 A;  2XPA A;  3PRD A;  4DZ3 A;  1HJW A;  3CGM A;  4IT4 A;  1QZ2 A;  5D75 A;  2OWO A;  2MPH A;  2Y78 A;  3WQV A;  5BXJ A;  1JNT A;  1FKR A;  3PQH A;  2BA1 A;  3GU0 A;  1LG2 A;  1PIN A;  1HJX A;  5E66 A;  1ZK6 A;  1ITX A;  2QRV A;  1NSG A;  4KQZ A;  3UI6 A;  1HJV A;  3MDY B;  3B8S A;  4TW6 A;  3O5M A;  2XP6 A;  1KFW A;  5DIT A;  4DWS A;  2PPP A;  4TW7 A;  4DZ2 A;  1YW5 A;  2PI6 A;  2FDM A;  5HWC A;  2VCD A;  3B9D A;  2YSB A;  4ZPW R;  1EHN A;  5E65 A;  1W26 A;  2WM0 A;  3O5F A;  2N87 A;  3FXY A;  2Y8N B;  3WD1 A;  3G6M A;  1LJY A;  1NWS A;  4MPK A;  4Z2L A;  3ALG A;  3PRA A;  2ZR6 A;  1YAT A;  3LE4 A;  1TFV A;  3ARX A;  3B9A A;  1XRV A;  1NWR A;  4MAV A;  2XP8 A;  5E62 A;  2ITK A;  1D6O A;  4FN2 A;  1L1P A;  4ITZ A;  4NNR A;  3BXW A;  2M2A A;  2PPN A;  4W5U A;  4MGV A;  4TNS A;  3O5J A;  2MLY A;  2XPB A;  3LUO A;  1EG4 A;  2JX8 A;  2DG4 A;  2DSV A;  1D7H A;  2QF8 A;  4GGQ A;  2A3B A;  1F8A B;  1NH6 A;  1W9U A;  2DSW A;  5HUA A;  2IF4 A;  4Z2I A;  4DRM A;  3MCB B;  4MNM A;  3KZ7 A;  4ODN A;  4P8W A;  2MLX A;  3O5G A;  2DSU A;  1OGG A;  1J6Y A;  1LL7 A;  2RSE A;  3FSC A;  3WQW A;  2RUR A;  2DSZ A;  3TDB A;  3H9R B;  2B5U B;  1ZBC A;  3WD4 A;  2DK1 A;  1VF8 A;  4W9Q A;  2ETN A;  2PV3 A;  4C02 B;  3CZ8 A;  3NTP A;  4W9O A;  3CHF A;  4QT2 A;  1O6W A;  1HKJ A;  4U84 A;  2G8Z A;  4IQC A;  3FAP A;  3UQA A;  5DF0 A;  2ESC A;  3AS3 A;  5E5W A;  3CHC A;  1W9P A;  4JYS A;  4DRN A;  1U79 A;  3ARY A;  2PBC A;  3ARV A;  2KGJ A;  4LAX A;  4DWS C;  3L4H A;  1JND A;  2AWG A;  1K9T A;  5CQ2 A;  4ODO A;  5DIV A;  4WKF A;  2KO7 A;  3ARO A;  2JZV A;  3O5Q A;  3UQI A;  4IT6 A;  5AHT A;  3UI4 A;  1KT1 A;  4S3J A;  2LGO A;  3RM4 A;  4O2T A;  3LKX A;  4QT3 A;  3ARZ A;  1TR8 A;  3O5D A;  4S3K A;  2RUQ A;  1E44 A;  3B7X A;  2ZQT A;  3RGC A;  4Q7N A;  4U86 A;  1EDQ A;  3CHD A;  1H0I A;  5HW6 A;  4ODP A;  2K8I A;  3ARR A;  4UDM A;  3KAG A;  1E6P A;  1JNE A;  3PR9 A;  3IHZ A;  3AQU A;  4XAK A;  2RUD A;  3KAI A;  1J4H A;  4GLX A;  2PPO A;  2VN1 A;  1LG1 A;  1PBK A;  3PRB A;  1RP5 A;  2KE0 A;  4Z2H A;  3MQG A;  2M1I A;  3EY6 A;  1D2K A;  2D9F A;  2DT3 A;  4LGX A;  3WL1 A;  1EQ3 A;  1M5Y A;  1HKK A;  2M08 A;  1EYM A;  1D7J A;  3B9E A;  2FKE A;  4AY1 A;  3ARW A;  1LQ0 A;  1FKB A;  4LAY A;  2ZAJ A;  2KFW A;  3O5I A;  2EZ5 W;  4ODR A;  5HKG A;  1EG3 A;  1JMQ A;  2MLZ A;  3ALF A;  2YSG A;  1BL4 A;  3MQH A;  5HW8 A;  1WMV A;  1Q1C A;  3CNG A;  1ROU A;  1W9V A;  1H0G A;  1BKF A;  4IQ2 A;  4P8X A;  1FJD A;  1SYT A;  2DT0 A;  3ARS A;  2FAP A;  4J4O A;  1LL4 A;  2JXW A;  3ARU A;  3WH0 A;  3KAH A;  3UQB A;  4ODQ A;  2OLH A;  2YBU A;  1N1A A;  2OFN A;  1ZB5 A;  2A3A A;  5B8I C;  1JCH B;  2KI3 A;  5E64 A;  5HBF A;  1FKI A;  5HWB A;  1Y0O A;  1ZCN A;  3KAD A;  3KAF A;  4A0U A;  3W4R A;  1T11 A;  3PA7 A;  1C9H A;  1QPF A;  4HBE A;  2A3C A;  1UR9 A;  1SR0 A;  2MNT A;  3AS2 A;  4G50 A;  3QOK A;  3ARP A;  4NZC A;  1FKK A;  1P5Q A;  3IK8 A;  1IX5 A;  3FY1 A;  2DG9 A;  2ZQS A;  1FD9 A;  3IKD A;  5J6E A;  4URI A;  3KAC A;  4R5E A;  3O5R A;  2XP3 A;  3JYM A;  2JMF A;  4DT4 A;  1K9R A;  4JFM A;  2XP9 A;  1FFR A;  1HKM A;  4A0T A;  1E6Z A;  5JH8 A;  1HXV A;  4KR0 B;  1NWU A;  2LKN A;  2M3O W;  3TCZ A;  2M8J A;  4MNK A;  1A7X A;  2YSF A;  5GPG A;  2PV1 A;  4TX0 A;  1R9H A;  4ODM A;  1ZBK A;  4MNL A;  5HT1 A;  4Z2G A;  1FAP A;  1O6I A;  3O5O A;  4G2P A;  4P8U A;  3RM9 A;  2P4V A;  1FLC A;  2WLY A;  4Q22 A;  4DWS B;  3WIJ A;  4ZS6 A;  2WK2 A;  1FKL A;  1W1T A;  1HKI A;  1X6N A;  1GPF A;  2XP5 A;  3MCB A;  3UI5 A;  1FFQ A;  2DT1 A;  1B6C A;  3RM8 A;  2KXQ A;  5DO2 A;  2WLZ A;  2YBT A;  1J4R A;  2L4J A;  1W1P A;  3GPK A;  2MDI A;  1FKJ A;  4DRP A;  1J4I A;  2XP7 A;  3WD0 A;  4LAV A;  4DRK A;  3KAB A;  2WAE A;  1ROT A;  3RME A;  2DPE A;  4DIP A;  4E5R A;  4DRI A;  1OGB A;  2ZR4 A;  3CHE A;  4WK9 A;  2F2D A;  1TK7 A;  4DWS D;  5HW7 A;  1CTN A;  2EUL A;  2DJY A;  2KR7 A;  5I98 A;  1Q6H A;  1QPL A;  4HAR A;  4N19 A;  4Z2J A;  2MF9 A;  2YSI A;  1W1V A;  1WB0 A;  4DRH A;  1FKS A;  4U85 A;  1ZU8 A;  1FKH A;  3I6C A;  4WIW A;  4JFJ A;  4FAP A;  1ZL1 A;  2B31 A;  1K9Q A;  2O9O A;  2LJ4 A;  3CH9 A;  3O5L A;  1RD6 A;  4BF8 A;  2XP4 A;  4NSB A;  4MNJ A;  2ZQV A;  1W1Y A;  4JFL A;  4P8V A;  5GPR A;  3WL0 A;  1FKD A;  3O5P A;  3UF8 A;  3AS0 A;  2LAJ A;  4GIV A;  4LAW A;  2DK7 A;  1FKT A;  1NMW A;  1ZBW A;  4WJX A;  1D7I A;  2YAJ B;  4WKH A;  1JNS A;  1E6R A;  3WD2 A;  1E15 A;  4DRO A;  4ODK A;  1XHG A;  1FKF A;  1UR8 A;  3WD3 A;  2A3E A;  2UZ5 A;  1Q6U A;  2YSH A;  4Z2K A;  3TC5 A;  2E45 A;  3RFW A;  1I5H W;  1NMV A;  2DG3 A;  4MTV A;  4ODL A;  5DEZ A;  3OOB A;  1GUV A;  1EIB A;  3WKZ A;  3ODK A;  1E9L A;  3JXV A;  2LPV A;  2RQS A;  1GOI A;  2DMV A;  3JYJ A; 
#chains in the Genus database with same CATH homology
 2WAD A;  3NRK A;  2PV2 A;  1KT0 A;  2DWV A;  2ZQU A;  3FS8 A;  5GQB A;  1E6N A;  3G6L A;  2IUZ A;  4W9P A;  4JFK A;  2JV4 A;  2L2S A;  2RUC A;  4ZPT R;  4PTM A;  4R0X A;  2G41 A;  4L3N A;  2ZR5 A;  4TW8 A;  1JVW A;  4REX A;  4HBO A;  4DH0 A;  3LKX B;  1X6L A;  3AS1 A;  2O92 A;  3CGN A;  3VAW A;  4JFI A;  1OWQ A;  3O5E A;  4QZV B;  1TCO C;  2M8I A;  3KCE A;  1FKG A;  4DRQ A;  2DT2 A;  1Q6I A;  2AOS A;  3M7N A;  3O5K A;  2F21 A;  4ZPV R;  3ARQ A;  1NWT A;  4MSP A;  3FSB A;  4IPX A;  3M85 A;  3OA5 A;  3IKG A;  5DIU A;  3NI6 A;  4TYO A;  1WAW A;  1F40 A;  4WKA A;  2F4E A;  4QIB A;  4ML4 A;  4J4N A;  4L72 B;  3ART A;  5U47 A;  2Q5A A;  1WR7 A;  1WNO A;  4DRJ A;  1LL6 A;  5HTG A;  1ZBV A;  2RE3 A;  2XPA A;  3PRD A;  4DZ3 A;  1HJW A;  3CGM A;  4IT4 A;  1QZ2 A;  5D75 A;  2OWO A;  2MPH A;  2Y78 A;  3WQV A;  5BXJ A;  1JNT A;  1FKR A;  3PQH A;  2BA1 A;  1LG2 A;  1PIN A;  1HJX A;  5E66 A;  1ZK6 A;  1ITX A;  2QRV A;  1NSG A;  4KQZ A;  3UI6 A;  1HJV A;  3MDY B;  3B8S A;  4TW6 A;  3O5M A;  2XP6 A;  1KFW A;  5DIT A;  4DWS A;  2PPP A;  4TW7 A;  4DZ2 A;  1YW5 A;  2PI6 A;  2FDM A;  5HWC A;  2VCD A;  3B9D A;  2YSB A;  4ZPW R;  1EHN A;  5E65 A;  1W26 A;  2WM0 A;  3O5F A;  2N87 A;  3FXY A;  2Y8N B;  3WD1 A;  3G6M A;  1LJY A;  1NWS A;  4MPK A;  4Z2L A;  3ALG A;  3PRA A;  2ZR6 A;  1YAT A;  3LE4 A;  1TFV A;  3ARX A;  3B9A A;  1XRV A;  1NWR A;  4MAV A;  2XP8 A;  5E62 A;  2ITK A;  1D6O A;  4FN2 A;  1L1P A;  4ITZ A;  4NNR A;  3BXW A;  2M2A A;  2PPN A;  4W5U A;  4MGV A;  4TNS A;  3O5J A;  2MLY A;  2XPB A;  3LUO A;  1EG4 A;  2JX8 A;  2DG4 A;  2DSV A;  1D7H A;  2QF8 A;  4GGQ A;  2A3B A;  1F8A B;  1NH6 A;  1W9U A;  2DSW A;  5HUA A;  2IF4 A;  4Z2I A;  4DRM A;  3MCB B;  4MNM A;  3KZ7 A;  4ODN A;  4P8W A;  2MLX A;  3O5G A;  2DSU A;  1OGG A;  1J6Y A;  1LL7 A;  2RSE A;  3FSC A;  3WQW A;  2RUR A;  2DSZ A;  3TDB A;  3H9R B;  1ZBC A;  3WD4 A;  2DK1 A;  1VF8 A;  4W9Q A;  2PV3 A;  4C02 B;  3CZ8 A;  3NTP A;  4W9O A;  3CHF A;  4QT2 A;  1O6W A;  1HKJ A;  4U84 A;  2G8Z A;  4IQC A;  3FAP A;  3UQA A;  5DF0 A;  2ESC A;  3AS3 A;  5E5W A;  3CHC A;  1W9P A;  4JYS A;  4DRN A;  1U79 A;  3ARY A;  2PBC A;  3ARV A;  2KGJ A;  4LAX A;  4DWS C;  3L4H A;  1JND A;  2AWG A;  1K9T A;  5CQ2 A;  4ODO A;  5DIV A;  4WKF A;  2KO7 A;  3ARO A;  2JZV A;  3O5Q A;  3UQI A;  4IT6 A;  5AHT A;  3UI4 A;  1KT1 A;  4S3J A;  2LGO A;  3RM4 A;  4O2T A;  3LKX A;  4QT3 A;  3ARZ A;  1TR8 A;  3O5D A;  4S3K A;  2RUQ A;  3B7X A;  2ZQT A;  3RGC A;  4Q7N A;  4U86 A;  1EDQ A;  3CHD A;  1H0I A;  5HW6 A;  4ODP A;  2K8I A;  3ARR A;  3KAG A;  1E6P A;  1JNE A;  3PR9 A;  3IHZ A;  3AQU A;  4XAK A;  2RUD A;  3KAI A;  1J4H A;  4GLX A;  2PPO A;  2VN1 A;  1LG1 A;  1PBK A;  3PRB A;  1RP5 A;  2KE0 A;  4Z2H A;  3MQG A;  2M1I A;  3EY6 A;  1D2K A;  2D9F A;  2DT3 A;  4LGX A;  3WL1 A;  1EQ3 A;  1M5Y A;  1HKK A;  2M08 A;  1EYM A;  1D7J A;  3B9E A;  2FKE A;  4AY1 A;  3ARW A;  1LQ0 A;  1FKB A;  4LAY A;  2ZAJ A;  2KFW A;  3O5I A;  2EZ5 W;  4ODR A;  5HKG A;  1EG3 A;  1JMQ A;  2MLZ A;  3ALF A;  2YSG A;  1BL4 A;  3MQH A;  5HW8 A;  1WMV A;  1Q1C A;  3CNG A;  1ROU A;  1W9V A;  1H0G A;  1BKF A;  4IQ2 A;  4P8X A;  1FJD A;  1SYT A;  2DT0 A;  3ARS A;  2FAP A;  4J4O A;  1LL4 A;  2JXW A;  3ARU A;  3WH0 A;  3KAH A;  3UQB A;  4ODQ A;  2OLH A;  2YBU A;  1N1A A;  2OFN A;  1ZB5 A;  2A3A A;  5B8I C;  2KI3 A;  5HBF A;  5E64 A;  1FKI A;  5HWB A;  1Y0O A;  1ZCN A;  3KAD A;  3KAF A;  4A0U A;  3W4R A;  1T11 A;  3PA7 A;  1C9H A;  1QPF A;  4HBE A;  2A3C A;  1UR9 A;  1SR0 A;  2MNT A;  3AS2 A;  4G50 A;  3QOK A;  3ARP A;  4NZC A;  1FKK A;  1P5Q A;  3IK8 A;  1IX5 A;  3FY1 A;  2DG9 A;  2ZQS A;  1FD9 A;  3IKD A;  5J6E A;  4URI A;  3KAC A;  4R5E A;  3O5R A;  2XP3 A;  3JYM A;  2JMF A;  4DT4 A;  1K9R A;  4JFM A;  2XP9 A;  1FFR A;  1HKM A;  4A0T A;  1E6Z A;  5JH8 A;  1HXV A;  4KR0 B;  1NWU A;  2LKN A;  2M3O W;  3TCZ A;  2M8J A;  4MNK A;  1A7X A;  2YSF A;  5GPG A;  2PV1 A;  4TX0 A;  1R9H A;  4ODM A;  1ZBK A;  4MNL A;  5HT1 A;  4Z2G A;  1FAP A;  1O6I A;  3O5O A;  4G2P A;  4P8U A;  3RM9 A;  4DWS B;  1FLC A;  2WLY A;  4Q22 A;  3WIJ A;  4ZS6 A;  2WK2 A;  1FKL A;  1W1T A;  1HKI A;  1X6N A;  1GPF A;  2XP5 A;  3MCB A;  3UI5 A;  1FFQ A;  2DT1 A;  1B6C A;  3RM8 A;  2KXQ A;  5DO2 A;  2WLZ A;  2YBT A;  1J4R A;  2L4J A;  1W1P A;  3GPK A;  2MDI A;  1FKJ A;  4DRP A;  1J4I A;  2XP7 A;  3WD0 A;  4LAV A;  4DRK A;  3KAB A;  2WAE A;  1ROT A;  3RME A;  2DPE A;  4DIP A;  4E5R A;  4DRI A;  1OGB A;  2ZR4 A;  3CHE A;  4WK9 A;  2F2D A;  1TK7 A;  4DWS D;  5HW7 A;  1CTN A;  2DJY A;  2KR7 A;  5I98 A;  1Q6H A;  1QPL A;  4HAR A;  4N19 A;  4Z2J A;  2YSI A;  1W1V A;  1WB0 A;  2MF9 A;  4DRH A;  1FKS A;  4U85 A;  1ZU8 A;  1FKH A;  3I6C A;  4WIW A;  4JFJ A;  4FAP A;  1ZL1 A;  2B31 A;  1K9Q A;  2O9O A;  2LJ4 A;  3CH9 A;  3O5L A;  1RD6 A;  4BF8 A;  2XP4 A;  4NSB A;  4MNJ A;  2ZQV A;  1W1Y A;  4JFL A;  4P8V A;  5GPR A;  3WL0 A;  1FKD A;  3O5P A;  3UF8 A;  3AS0 A;  2LAJ A;  4GIV A;  4LAW A;  2DK7 A;  1FKT A;  1NMW A;  1ZBW A;  4WJX A;  1D7I A;  2YAJ B;  4WKH A;  1JNS A;  1E6R A;  3WD2 A;  1E15 A;  4DRO A;  4ODK A;  1XHG A;  1FKF A;  1UR8 A;  3WD3 A;  2A3E A;  2UZ5 A;  1Q6U A;  2YSH A;  4Z2K A;  3TC5 A;  2E45 A;  3RFW A;  1I5H W;  1NMV A;  2DG3 A;  4MTV A;  4ODL A;  5DEZ A;  3OOB A;  1GUV A;  1EIB A;  3WKZ A;  3ODK A;  1E9L A;  3JXV A;  2LPV A;  2RQS A;  1GOI A;  2DMV A;  3JYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...