3KAFA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMAKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 41
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kafA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kafA02
5D75A 1F8AB 3MDYB 1Y0OA 2LJ4A 2KGJA 3JYJA 4ODQA 1FKSA 2PPNA 5HW6A 1P5QA 1D6OA 2M08A 1JNTA 2XP9A 3TC5A 1EG3A 3GPKA 1FKHA 4DRMA 1Q6HA 4J4OA 2ZQUA 3KAHA 4TNSA 4ITZA 4ODOA 1PINA 1JMQA 2PBCA 5HWCA 4ODNA 1C9HA 1FKTA 4C02B 1BL4A 3WH0A 1FD9A 1JVWA 1N1AA 1Q1CA 1Q6IA 2JZVA 4TYOA 4DRKA 2Q5AA 5I98A 2MPHA 1T11A 3O5DA 2DG3A 2MNTA 4W9QA 4TW8A 2XP8A 3IK8A 4IPXA 1D7HA 5HW7A 2YSHA 4QT3A 2ZQVA 4W9OA 1FKIA 1J4IA 2YSFA 1NMWA 2XP6A 2XPBA 1YW5A 2M1IA 2JX8A 4O2TA 5B8IC 5HW8A 3UQAA 4ODMA 3NI6A 3KABA 2MF9A 1Q6UA 4G50A 4GIVA 3UI4A 2ZR5A 2DMVA 2L2SA 3RFWA 3O5GA 1A7XA 5J6EA 4QIBA 2D9FA 2Y78A 4U85A 2RE3A 4JFJA 2KR7A 4JYSA 1QZ2A 2PV3A 2YSIA 1NMVA 3OOBA 1TCOC 2K8IA 4DH0A 4MGVA 4G2PA 2YSGA 3UF8A 2JV4A 3UQIA 2ZR4A 2MLYA 2N87A 4ODLA 4DRQA 4N19A 3LE4A 3KAIA 1FKFA 1ROUA 3CNGA 2VN1A 4DZ2A 2KXQA 3KADA 2DG4A 2LGOA 2LKNA 2EZ5W 3IKGA 4JFKA 3PA7A 1J6YA 4LAXA 2RUCA 3PRBA 3O5MA 2LAJA 4LAWA 2DJYA 1W26A 3M7NA 2KI3A 4LAVA 4DRIA 1J4RA 4R0XA 3RGCA 4MSPA 4U84A 1U79A 2KO7A 2UZ5A 5BXJA 3LUOA 1WMVA 1BKFA 4JFMA 4DROA 2XP4A 3VAWA 4FAPA 1O6WA 5AHTA 2F2DA 3UI6A 4E5RA 2FAPA 1YATA 3H9RB 1KT0A 3O5QA 5HT1A 2MLZA 5HUAA 4DZ3A 1TK7A 1NSGA 3O5KA 1F40A 2M8JA 2ZQSA 2XP5A 1ZK6A 2RUDA 3O5JA 1R9HA 2RUQA 3KACA 4TX0A 4TW6A 1QPLA 1L1PA 2ZAJA 3TDBA 5DITA 1K9RA 1KT1A 5HWBA 2RSEA 3FAPA 2XP3A 2ZQTA 1EYMA 2KE0A 4IQCA 4J4NA 2M8IA 2XPAA 4DRJA 3O5OA 1FKLA 4DIPA 2OFNA 2M3OW 2MLXA 3UQBA 4GGQA 4ODRA 2MDIA 2AWGA 3CGMA 4REXA 2PPPA 3UI5A 2YSBA 3CGNA 5DIUA 2RQSA 1FKJA 1FKKA 2IF4A 4BF8A 2XP7A 2JXWA 4LAYA 3KAGA 3L4HA 2DG9A 2ZR6A 1ZCNA 4QT2A 2DK7A 5CQ2A 2PPOA 2RURA 4IQ2A 4DRNA 1FKBA 3O5PA 3NTPA 4DRHA 3IKDA 4TW7A 4ODPA 1FKRA 1EG4A 4DRPA 1FKDA 3I6CA 2VCDA 3M85A 4NNRA 4DT4A 4U86A 2DWVA 5HTGA 1D7IA 3O5LA 1PBKA 4ODKA 4JFIA 1FAPA 1K9QA 4FN2A 1D7JA 2E45A 2KFWA 2F21A 2LPVA 3B7XA 2ITKA 2BA1A 3JXVA 3JYMA 1ROTA 3ODKA 3EY6A 1WR7A 3KZ7A 3PRDA 5DIVA 5HKGA 1JNSA 1FKGA 2F4EA 3NRKA 2FKEA 3O5IA 3O5RA 4W9PA 1B6CA 1J4HA 2PV1A 2DK1A 2PV2A 4JFLA 1HXVA 3O5FA 2L4JA 3TCZA 5GPGA 1FJDA 3KCEA 1QPFA 1I5HW 1M5YA 1EQ3A 2JMFA 3O5EA 3IHZA 3KAFA 2M2AA
chains in the Genus database with same CATH superfamily
2LJ4A 5E66A 2KGJA 2DSVA 3EIPA 1NWTA 2ETNA 1D6OA 2M08A 3MQHA 1EG3A 3WIJA 1FKHA 1X6NA 3ARUA 1Q6HA 4TNSA 4ITZA 5HBFA 1PINA 1FFQA 1FKTA 1BL4A 4DWSA 4TYOA 1Q6IA 4Z2IA 5I98A 2Y8NB 1T11A 2MNTA 4Z2HA 1RP5A 1K9TA 4IPXA 1TR8A 2ZQVA 2YSFA 2XP6A 2XPBA 2JX8A 4ODMA 1Q6UA 4URIA 3WKZA 2RE3A 2YSIA 1TCOC 2K8IA 4MNJA 4MGVA 1ZB5A 3UF8A 4LGXA 2ZR4A 4WJXA 4ODLA 1FKFA 1E9LA 2KXQA 2DG4A 4IT4A 2WK2A 3O5MA 2LAJA 2DJYA 1W26A 4Z2GA 2KI3A 4LAVA 4MSPA 4DROA 2XP4A 1W9PA 1O6WA 5AHTA 2F2DA 5HT1A 4KR0B 1SR0A 2MLZA 2ZQSA 2RUDA 1R9HA 2F23A 2RUQA 4WKAA 1KT1A 2A3CA 4MTVA 2B5UB 4ZPVR 1E6NA 5E62A 2ZQTA 1EYMA 4J4NA 1H0IA 1GUVA 3ARZA 1VF8A 4DIPA 3UQBA 3UI5A 3WD3A 2AWGA 3CGMA 1WB0A 2YSBA 1ITXA 1FKJA 1FKKA 2IF4A 4LAYA 2FDMA 2ZR6A 3RM4A 1NH6A 1W9VA 1ZBWA 2PPOA 3MQGA 2WAEA 1FKBA 4DRHA 2EULA 2OWOA 3W4RA 3I6CA 4P8XA 2DWVA 3G6LA 1D7IA 3O5LA 3ARRA 4JFIA 4P8VA 1EDQA 1JNEA 2E45A 3JXVA 3ODKA 3PRDA 1JNSA 2DT1A 3O5IA 4Q7NA 4MPKA 1B6CA 3FS8A 2PV1A 4JFLA 3FSCA 1FJDA 1QPFA 3OA5A 1ZL1A 3CHCA 1LG1A 2WADA 4ZPTR 4MNLA 3BMBA 1HJVA 4ODQA 2PPNA 4QZVB 1JNTA 3TC5A 3B9EA 4IT6A 2OLHA 4J4OA 2ZQUA 5HWCA 2AOSA 1LL7A 3WH0A 1Q1CA 4DWSD 5GPRA 1LL6A 4TW8A 2G41A 2WLYA 2XP8A 1O6IA 3IK8A 1D7HA 2YSHA 1W1YA 1FKIA 1J4IA 1NMWA 4O2TA 5B8IC 3UQAA 3KABA 4GIVA 3RFWA 1A7XA 2Y78A 2IUZA 3AS3A 4JYSA 2KR7A 1QZ2A 2PV3A 3OOBA 2DSZA 2YSGA 2MLYA 2G8ZA 2DT0A 4DRQA 3WD1A 4N19A 3AS1A 3LE4A 3KAIA 4MNKA 3CNGA 4DZ2A 1E44A 2PI6A 3ARPA 3GU0A 3IKGA 3WQVA 2A3AA 4LAXA 3RMEA 2RUCA 3PRBA 4WIWA 5E5WA 1SYTA 4WKHA 4W5UA 4P8UA 4FAPA 1XHGA 4E5RA 3O5QA 3AS0A 4DZ3A 3O5KA 2DPEA 2M8JA 3O5JA 4TW6A 1HKKA 1L1PA 3TDBA 1K9RA 5HWBA 2RSEA 3FAPA 1WNOA 3CZ8A 2XPAA 1FKLA 1LQ0A 1NWRA 2M3OW 2MLXA 4GGQA 4ODRA 2PPPA 5U47A 3CGNA 2DT2A 4BF8A 3L4HA 4QT2A 2RURA 4IQ2A 1WAWA 2A3EA 3O5PA 3IKDA 1FKRA 1E15A 4NNRA 4DT4A 4S3JA 5E65A 1FAPA 1K9QA 1D7JA 2LPVA 4MNMA 1RD6A 2ITKA 2BA1A 5D75A 4DWSC 1ROTA 3EY6A 5DIVA 1WR7A 2F4EA 3NRKA 4W9PA 5BXJA 2DSUA 3ARYA 1HXVA 1NWUA 2L4JA 3TCZA 5GPGA 1M5YA 5DO2A 1OWQA 3O5EA 4NSBA 2M2AA 2B31A 3FY1A 3MDYB 1Y0OA 1LG2A 1D2KA 3JYJA 5GQBA 1P5QA 4A0TA 3RM8A 4DRMA 4NZCA 3KAHA 4L72B 3PR9A 4ODNA 1C9HA 1FD9A 1JVWA 2JZVA 3BXWA 3G6MA 2MPHA 3O5DA 2DG3A 4W9QA 5HW7A 3QOKA 3B8SA 2M1IA 3WL0A 3NI6A 1HKIA 3ARSA 2MF9A 5J6EA 2L2SA 3O5GA 2D9FA 4JFJA 1GPFA 1UR8A 1NMVA 1EHNA 2DSWA 2JV4A 1W1TA 3UQIA 2N87A 3LKXB 4S3KA 2LGOA 2LKNA 2DT3A 3PA7A 1J6YA 1OGBA 1EIBA 4LAWA 3ARXA 4L3NA 1TFVA 1J4RA 4R0XA 3MCBB 3PRAA 3LUOA 3UI6A 3MCBA 1ZBCA 5HUAA 1TK7A 1CTNA 1ZK6A 1UR9A 4TX0A 1IX5A 3WQWA 4WK9A 2YBUA 3AS2A 4IQCA 3WD4A 2M8IA 3O5OA 3B9DA 2MDIA 3WD0A 5DIUA 2RQSA 1W1VA 3ARTA 2XP7A 4P8WA 2DG9A 4XAKA 1ZCNA 4HBEA 2WM0A 4PTMA 4TW7A 4DRPA 1FKDA 2VCDA 3ALFA 3AROA 3FXYA 4U86A 1E6RA 5HTGA 1FFRA 4ODKA 2PN0A 2F21A 3KZ7A 1FKGA 3WD2A 4DRNA 2FKEA 4ZS6A 3O5RA 1J4HA 2DK1A 4DWSB 1HKJA 3KCEA 3GTYX 1HJWA 1OGGA 2JMFA 3IHZA 3KADA 3KAFA 2QRVA 3WL1A 1F8AB 3CHEA 3CH9A 1FKSA 5HW6A 2XP9A 3GPKA 3PQHA 3ARWA 1NWSA 2A3BA 3AQUA 4ODOA 1JMQA 2PBCA 4Z2KA 4AY1A 1JNDA 4C02B 4DRKA 1N1AA 1KFWA 4MAVA 2Q5AA 1GRJA 2O9OA 4HBOA 1HKMA 4QT3A 4R5EA 4W9OA 4A0UA 1YW5A 1LJYA 1LL4A 3B9AA 4G50A 3UI4A 4Z2JA 2ZR5A 2DMVA 2O92A 2YAJB 4QIBA 4U85A 4ML4A 4DH0A 4G2PA 1ROUA 3ARQA 1E6ZA 2VN1A 2EZ5W 4JFKA 3RM9A 3M7NA 1X6LA 4DRIA 4UDMA 1JCHB 3RGCA 4U84A 5E64A 1U79A 2KO7A 2UZ5A 1WMVA 1BKFA 4HARA 4JFMA 3VAWA 1E6PA 2FAPA 1YATA 3H9RB 1KT0A 3LKXA 1NSGA 1F40A 3CHDA 2XP5A 1ZBVA 3FSBA 1FLCA 3KACA 1QPLA 2ZAJA 5DITA 1XRVA 2XP3A 2KE0A 4DRJA 3ALGA 2OFNA 1HJXA 4REXA 1W1PA 1H0GA 1GOIA 2QF8A 5DF0A 2JXWA 3KAGA 4GLXA 2DK7A 5CQ2A 1ZBKA 3NTPA 4ODPA 1EG4A 3ARVA 5DEZA 3M85A 2WLZA 4Q22A 4Z2LA 1PBKA 1W9UA 4FN2A 4ZPWR 3CHFA 2KFWA 2P4VA 3B7XA 5HW8A 3JYMA 2ESCA 5HKGA 1ZU8A 2PV2A 5JH8A 3O5FA 2YBTA 4WKFA 1I5HW 1EQ3A 4KQZA
chains in the Genus database with same CATH topology
2LJ4A 5E66A 2KGJA 2DSVA 1NWTA 1D6OA 2M08A 3MQHA 1EG3A 3WIJA 1FKHA 1X6NA 3ARUA 1Q6HA 4TNSA 4ITZA 5HBFA 1PINA 1FFQA 1FKTA 1BL4A 4DWSA 4TYOA 1Q6IA 4Z2IA 5I98A 2Y8NB 1T11A 2MNTA 4Z2HA 1RP5A 1K9TA 4IPXA 1TR8A 2ZQVA 2YSFA 2XP6A 2XPBA 2JX8A 4ODMA 1Q6UA 4URIA 3WKZA 2RE3A 2YSIA 1TCOC 2K8IA 4MNJA 4MGVA 1ZB5A 3UF8A 4LGXA 2ZR4A 4WJXA 4ODLA 1FKFA 1E9LA 2KXQA 2DG4A 4IT4A 2WK2A 3O5MA 2LAJA 2DJYA 1W26A 4Z2GA 2KI3A 4LAVA 4MSPA 4DROA 2XP4A 1W9PA 1O6WA 5AHTA 2F2DA 5HT1A 4KR0B 1SR0A 2MLZA 2ZQSA 2RUDA 1R9HA 2RUQA 4WKAA 1KT1A 2A3CA 4MTVA 4ZPVR 1E6NA 5E62A 2ZQTA 1EYMA 4J4NA 1H0IA 3ARZA 1GUVA 1VF8A 4DIPA 3UQBA 3UI5A 3WD3A 2AWGA 3CGMA 1WB0A 2YSBA 1ITXA 1FKJA 1FKKA 2IF4A 4LAYA 2FDMA 2ZR6A 3RM4A 1NH6A 1W9VA 1ZBWA 2PPOA 3MQGA 2WAEA 1FKBA 4DRHA 2OWOA 3W4RA 3I6CA 4P8XA 2DWVA 3G6LA 1D7IA 3O5LA 3ARRA 4JFIA 4P8VA 1EDQA 1JNEA 2E45A 3JXVA 3ODKA 3PRDA 1JNSA 2DT1A 3O5IA 4Q7NA 4MPKA 1B6CA 3FS8A 2PV1A 4JFLA 3FSCA 1FJDA 1QPFA 3OA5A 1ZL1A 3CHCA 1LG1A 2WADA 4ZPTR 4MNLA 1HJVA 4ODQA 2PPNA 4QZVB 1JNTA 3TC5A 3B9EA 4IT6A 2OLHA 4J4OA 2ZQUA 5HWCA 2AOSA 1LL7A 3WH0A 1Q1CA 4DWSD 5GPRA 1LL6A 4TW8A 2G41A 2WLYA 2XP8A 1O6IA 3IK8A 1D7HA 2YSHA 1W1YA 1FKIA 1J4IA 1NMWA 4O2TA 5B8IC 3UQAA 3KABA 4GIVA 3RFWA 1A7XA 2Y78A 2IUZA 3AS3A 4JYSA 2KR7A 1QZ2A 2PV3A 3OOBA 2DSZA 2YSGA 2MLYA 2G8ZA 2DT0A 4DRQA 3WD1A 4N19A 3AS1A 3LE4A 3KAIA 4MNKA 3CNGA 4DZ2A 2PI6A 3ARPA 3IKGA 3WQVA 2A3AA 4LAXA 3RMEA 2RUCA 3PRBA 4WIWA 5E5WA 1SYTA 4WKHA 4W5UA 4P8UA 4FAPA 1XHGA 4E5RA 3O5QA 3AS0A 4DZ3A 3O5KA 2DPEA 2M8JA 3O5JA 4TW6A 1HKKA 1L1PA 3TDBA 1K9RA 5HWBA 2RSEA 3FAPA 1WNOA 3CZ8A 2XPAA 1FKLA 1LQ0A 1NWRA 2M3OW 2MLXA 4GGQA 4ODRA 2PPPA 5U47A 3CGNA 2DT2A 4BF8A 3L4HA 4QT2A 2RURA 4IQ2A 1WAWA 2A3EA 3O5PA 3IKDA 1FKRA 1E15A 4NNRA 4DT4A 4S3JA 5E65A 1FAPA 1K9QA 1D7JA 2LPVA 4MNMA 1RD6A 2ITKA 2BA1A 5D75A 4DWSC 1ROTA 3EY6A 5DIVA 1WR7A 2F4EA 3NRKA 4W9PA 5BXJA 2DSUA 3ARYA 1HXVA 1NWUA 2L4JA 3TCZA 5GPGA 1M5YA 5DO2A 1OWQA 3O5EA 4NSBA 2M2AA 2B31A 3FY1A 3MDYB 1Y0OA 1LG2A 1D2KA 3JYJA 5GQBA 1P5QA 4A0TA 3RM8A 4DRMA 4NZCA 3KAHA 4L72B 3PR9A 4ODNA 1C9HA 1FD9A 1JVWA 2JZVA 3BXWA 3G6MA 2MPHA 3O5DA 2DG3A 4W9QA 5HW7A 3QOKA 3B8SA 2M1IA 3WL0A 3NI6A 1HKIA 3ARSA 2MF9A 5J6EA 2L2SA 3O5GA 2D9FA 4JFJA 1GPFA 1UR8A 1NMVA 1EHNA 2DSWA 2JV4A 1W1TA 3UQIA 2N87A 3LKXB 4S3KA 2LGOA 2LKNA 2DT3A 3PA7A 1J6YA 1OGBA 1EIBA 4LAWA 3ARXA 4L3NA 1TFVA 1J4RA 4R0XA 3MCBB 3PRAA 3LUOA 3UI6A 3MCBA 1ZBCA 5HUAA 1TK7A 1CTNA 1ZK6A 1UR9A 4TX0A 1IX5A 3WQWA 4WK9A 2YBUA 3AS2A 4IQCA 3WD4A 2M8IA 3O5OA 3B9DA 2MDIA 3WD0A 5DIUA 2RQSA 1W1VA 3ARTA 2XP7A 4P8WA 2DG9A 4XAKA 1ZCNA 4HBEA 2WM0A 4PTMA 4TW7A 4DRPA 1FKDA 2VCDA 3ALFA 3AROA 3FXYA 4U86A 1E6RA 5HTGA 1FFRA 4ODKA 2F21A 3KZ7A 1FKGA 3WD2A 4DRNA 2FKEA 4ZS6A 3O5RA 1J4HA 2DK1A 4DWSB 1HKJA 3KCEA 1HJWA 1OGGA 2JMFA 3IHZA 3KADA 3KAFA 2QRVA 3WL1A 1F8AB 3CHEA 3CH9A 1FKSA 5HW6A 2XP9A 3GPKA 3PQHA 3ARWA 1NWSA 2A3BA 3AQUA 4ODOA 1JMQA 2PBCA 4Z2KA 4AY1A 1JNDA 4C02B 4DRKA 1N1AA 1KFWA 4MAVA 2Q5AA 2O9OA 4HBOA 1HKMA 4QT3A 4R5EA 4W9OA 4A0UA 1YW5A 1LJYA 1LL4A 3B9AA 4G50A 3UI4A 4Z2JA 2ZR5A 2DMVA 2O92A 2YAJB 4QIBA 4U85A 4ML4A 4DH0A 4G2PA 1ROUA 3ARQA 1E6ZA 2VN1A 2EZ5W 4JFKA 3RM9A 3M7NA 1X6LA 4DRIA 3RGCA 4U84A 5E64A 1U79A 2KO7A 2UZ5A 1WMVA 1BKFA 4HARA 4JFMA 3VAWA 1E6PA 2FAPA 1YATA 3H9RB 1KT0A 3LKXA 1NSGA 1F40A 3CHDA 2XP5A 1ZBVA 3FSBA 1FLCA 3KACA 1QPLA 2ZAJA 5DITA 1XRVA 2XP3A 2KE0A 4DRJA 3ALGA 2OFNA 1HJXA 4REXA 1W1PA 1H0GA 1GOIA 2QF8A 5DF0A 2JXWA 3KAGA 4GLXA 2DK7A 5CQ2A 1ZBKA 3NTPA 4ODPA 1EG4A 3ARVA 5DEZA 3M85A 2WLZA 4Q22A 4Z2LA 1PBKA 1W9UA 4FN2A 4ZPWR 3CHFA 2KFWA 5HW8A 3B7XA 3JYMA 2ESCA 5HKGA 1ZU8A 2PV2A 5JH8A 3O5FA 2YBTA 4WKFA 1I5HW 1EQ3A 4KQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D75 A;  1F8A B;  3MDY B;  1Y0O A;  2LJ4 A;  2KGJ A;  3JYJ A;  4ODQ A;  1FKS A;  2PPN A;  5HW6 A;  1P5Q A;  1D6O A;  2M08 A;  1JNT A;  2XP9 A;  3TC5 A;  1EG3 A;  3GPK A;  1FKH A;  4DRM A;  1Q6H A;  4J4O A;  2ZQU A;  3KAH A;  4TNS A;  4ITZ A;  4ODO A;  1PIN A;  1JMQ A;  2PBC A;  5HWC A;  4ODN A;  1C9H A;  1FKT A;  4C02 B;  1BL4 A;  3WH0 A;  1FD9 A;  1JVW A;  1N1A A;  1Q1C A;  1Q6I A;  2JZV A;  4TYO A;  4DRK A;  2Q5A A;  5I98 A;  2MPH A;  1T11 A;  3O5D A;  2DG3 A;  2MNT A;  4W9Q A;  4TW8 A;  2XP8 A;  3IK8 A;  4IPX A;  1D7H A;  5HW7 A;  2YSH A;  4QT3 A;  2ZQV A;  4W9O A;  1FKI A;  1J4I A;  2YSF A;  1NMW A;  2XP6 A;  2XPB A;  1YW5 A;  2M1I A;  2JX8 A;  4O2T A;  5B8I C;  5HW8 A;  3UQA A;  4ODM A;  3NI6 A;  3KAB A;  2MF9 A;  1Q6U A;  4G50 A;  4GIV A;  3UI4 A;  2ZR5 A;  2DMV A;  2L2S A;  3RFW A;  3O5G A;  1A7X A;  5J6E A;  4QIB A;  2D9F A;  2Y78 A;  4U85 A;  2RE3 A;  4JFJ A;  2KR7 A;  4JYS A;  1QZ2 A;  2PV3 A;  2YSI A;  1NMV A;  3OOB A;  1TCO C;  2K8I A;  4DH0 A;  4MGV A;  4G2P A;  2YSG A;  3UF8 A;  2JV4 A;  3UQI A;  2ZR4 A;  2MLY A;  2N87 A;  4ODL A;  4DRQ A;  4N19 A;  3LE4 A;  3KAI A;  1FKF A;  1ROU A;  3CNG A;  2VN1 A;  4DZ2 A;  2KXQ A;  3KAD A;  2DG4 A;  2LGO A;  2LKN A;  2EZ5 W;  3IKG A;  4JFK A;  3PA7 A;  1J6Y A;  4LAX A;  2RUC A;  3PRB A;  3O5M A;  2LAJ A;  4LAW A;  2DJY A;  1W26 A;  3M7N A;  2KI3 A;  4LAV A;  4DRI A;  1J4R A;  4R0X A;  3RGC A;  4MSP A;  4U84 A;  1U79 A;  2KO7 A;  2UZ5 A;  5BXJ A;  3LUO A;  1WMV A;  1BKF A;  4JFM A;  4DRO A;  2XP4 A;  3VAW A;  4FAP A;  1O6W A;  5AHT A;  2F2D A;  3UI6 A;  4E5R A;  2FAP A;  1YAT A;  3H9R B;  1KT0 A;  3O5Q A;  5HT1 A;  2MLZ A;  5HUA A;  4DZ3 A;  1TK7 A;  1NSG A;  3O5K A;  1F40 A;  2M8J A;  2ZQS A;  2XP5 A;  1ZK6 A;  2RUD A;  3O5J A;  1R9H A;  2RUQ A;  3KAC A;  4TX0 A;  4TW6 A;  1QPL A;  1L1P A;  2ZAJ A;  3TDB A;  5DIT A;  1K9R A;  1KT1 A;  5HWB A;  2RSE A;  3FAP A;  2XP3 A;  2ZQT A;  1EYM A;  2KE0 A;  4IQC A;  4J4N A;  2M8I A;  2XPA A;  4DRJ A;  3O5O A;  1FKL A;  4DIP A;  2OFN A;  2M3O W;  2MLX A;  3UQB A;  4GGQ A;  4ODR A;  2MDI A;  2AWG A;  3CGM A;  4REX A;  2PPP A;  3UI5 A;  2YSB A;  3CGN A;  5DIU A;  2RQS A;  1FKJ A;  1FKK A;  2IF4 A;  4BF8 A;  2XP7 A;  2JXW A;  4LAY A;  3KAG A;  3L4H A;  2DG9 A;  2ZR6 A;  1ZCN A;  4QT2 A;  2DK7 A;  5CQ2 A;  2PPO A;  2RUR A;  4IQ2 A;  4DRN A;  1FKB A;  3O5P A;  3NTP A;  4DRH A;  3IKD A;  4TW7 A;  4ODP A;  1FKR A;  1EG4 A;  4DRP A;  1FKD A;  3I6C A;  2VCD A;  3M85 A;  4NNR A;  4DT4 A;  4U86 A;  2DWV A;  5HTG A;  1D7I A;  3O5L A;  1PBK A;  4ODK A;  4JFI A;  1FAP A;  1K9Q A;  4FN2 A;  1D7J A;  2E45 A;  2KFW A;  2F21 A;  2LPV A;  3B7X A;  2ITK A;  2BA1 A;  3JXV A;  3JYM A;  1ROT A;  3ODK A;  3EY6 A;  1WR7 A;  3KZ7 A;  3PRD A;  5DIV A;  5HKG A;  1JNS A;  1FKG A;  2F4E A;  3NRK A;  2FKE A;  3O5I A;  3O5R A;  4W9P A;  1B6C A;  1J4H A;  2PV1 A;  2DK1 A;  2PV2 A;  4JFL A;  1HXV A;  3O5F A;  2L4J A;  3TCZ A;  5GPG A;  1FJD A;  3KCE A;  1QPF A;  1I5H W;  1M5Y A;  1EQ3 A;  2JMF A;  3O5E A;  3IHZ A;  3KAF A;  2M2A A; 
#chains in the Genus database with same CATH topology
 2LJ4 A;  5E66 A;  2KGJ A;  2DSV A;  3EIP A;  1NWT A;  2ETN A;  1D6O A;  2M08 A;  3MQH A;  1EG3 A;  3WIJ A;  1FKH A;  1X6N A;  3ARU A;  1Q6H A;  4TNS A;  4ITZ A;  5HBF A;  1PIN A;  1FFQ A;  1FKT A;  1BL4 A;  4DWS A;  4TYO A;  1Q6I A;  4Z2I A;  5I98 A;  2Y8N B;  1T11 A;  2MNT A;  4Z2H A;  1RP5 A;  1K9T A;  4IPX A;  1TR8 A;  2ZQV A;  2YSF A;  2XP6 A;  2XPB A;  2JX8 A;  4ODM A;  1Q6U A;  4URI A;  3WKZ A;  2RE3 A;  2YSI A;  1TCO C;  2K8I A;  4MNJ A;  4MGV A;  1ZB5 A;  3UF8 A;  4LGX A;  2ZR4 A;  4WJX A;  4ODL A;  1FKF A;  1E9L A;  2KXQ A;  2DG4 A;  4IT4 A;  2WK2 A;  3O5M A;  2LAJ A;  2DJY A;  1W26 A;  4Z2G A;  2KI3 A;  4LAV A;  4MSP A;  4DRO A;  2XP4 A;  1W9P A;  1O6W A;  5AHT A;  2F2D A;  5HT1 A;  4KR0 B;  1SR0 A;  2MLZ A;  2ZQS A;  2RUD A;  1R9H A;  2F23 A;  2RUQ A;  4WKA A;  1KT1 A;  2A3C A;  4MTV A;  2B5U B;  4ZPV R;  1E6N A;  5E62 A;  2ZQT A;  1EYM A;  4J4N A;  1H0I A;  1GUV A;  3ARZ A;  1VF8 A;  4DIP A;  3UQB A;  3UI5 A;  3WD3 A;  2AWG A;  3CGM A;  1WB0 A;  2YSB A;  1ITX A;  1FKJ A;  1FKK A;  2IF4 A;  4LAY A;  2FDM A;  2ZR6 A;  3RM4 A;  1NH6 A;  1W9V A;  1ZBW A;  2PPO A;  3MQG A;  2WAE A;  1FKB A;  4DRH A;  2EUL A;  2OWO A;  3W4R A;  3I6C A;  4P8X A;  2DWV A;  3G6L A;  1D7I A;  3O5L A;  3ARR A;  4JFI A;  4P8V A;  1EDQ A;  1JNE A;  2E45 A;  3JXV A;  3ODK A;  3PRD A;  1JNS A;  2DT1 A;  3O5I A;  4Q7N A;  4MPK A;  1B6C A;  3FS8 A;  2PV1 A;  4JFL A;  3FSC A;  1FJD A;  1QPF A;  3OA5 A;  1ZL1 A;  3CHC A;  1LG1 A;  2WAD A;  4ZPT R;  4MNL A;  3BMB A;  1HJV A;  4ODQ A;  2PPN A;  4QZV B;  1JNT A;  3TC5 A;  3B9E A;  4IT6 A;  2OLH A;  4J4O A;  2ZQU A;  5HWC A;  2AOS A;  1LL7 A;  3WH0 A;  1Q1C A;  4DWS D;  5GPR A;  1LL6 A;  4TW8 A;  2G41 A;  2WLY A;  2XP8 A;  1O6I A;  3IK8 A;  1D7H A;  2YSH A;  1W1Y A;  1FKI A;  1J4I A;  1NMW A;  4O2T A;  5B8I C;  3UQA A;  3KAB A;  4GIV A;  3RFW A;  1A7X A;  2Y78 A;  2IUZ A;  3AS3 A;  4JYS A;  2KR7 A;  1QZ2 A;  2PV3 A;  3OOB A;  2DSZ A;  2YSG A;  2MLY A;  2G8Z A;  2DT0 A;  4DRQ A;  3WD1 A;  4N19 A;  3AS1 A;  3LE4 A;  3KAI A;  4MNK A;  3CNG A;  4DZ2 A;  1E44 A;  2PI6 A;  3ARP A;  3GU0 A;  3IKG A;  3WQV A;  2A3A A;  4LAX A;  3RME A;  2RUC A;  3PRB A;  4WIW A;  5E5W A;  1SYT A;  4WKH A;  4W5U A;  4P8U A;  4FAP A;  1XHG A;  4E5R A;  3O5Q A;  3AS0 A;  4DZ3 A;  3O5K A;  2DPE A;  2M8J A;  3O5J A;  4TW6 A;  1HKK A;  1L1P A;  3TDB A;  1K9R A;  5HWB A;  2RSE A;  3FAP A;  1WNO A;  3CZ8 A;  2XPA A;  1FKL A;  1LQ0 A;  1NWR A;  2M3O W;  2MLX A;  4GGQ A;  4ODR A;  2PPP A;  5U47 A;  3CGN A;  2DT2 A;  4BF8 A;  3L4H A;  4QT2 A;  2RUR A;  4IQ2 A;  1WAW A;  2A3E A;  3O5P A;  3IKD A;  1FKR A;  1E15 A;  4NNR A;  4DT4 A;  4S3J A;  5E65 A;  1FAP A;  1K9Q A;  1D7J A;  2LPV A;  4MNM A;  1RD6 A;  2ITK A;  2BA1 A;  5D75 A;  4DWS C;  1ROT A;  3EY6 A;  5DIV A;  1WR7 A;  2F4E A;  3NRK A;  4W9P A;  5BXJ A;  2DSU A;  3ARY A;  1HXV A;  1NWU A;  2L4J A;  3TCZ A;  5GPG A;  1M5Y A;  5DO2 A;  1OWQ A;  3O5E A;  4NSB A;  2M2A A;  2B31 A;  3FY1 A;  3MDY B;  1Y0O A;  1LG2 A;  1D2K A;  3JYJ A;  5GQB A;  1P5Q A;  4A0T A;  3RM8 A;  4DRM A;  4NZC A;  3KAH A;  4L72 B;  3PR9 A;  4ODN A;  1C9H A;  1FD9 A;  1JVW A;  2JZV A;  3BXW A;  3G6M A;  2MPH A;  3O5D A;  2DG3 A;  4W9Q A;  5HW7 A;  3QOK A;  3B8S A;  2M1I A;  3WL0 A;  3NI6 A;  1HKI A;  3ARS A;  2MF9 A;  5J6E A;  2L2S A;  3O5G A;  2D9F A;  4JFJ A;  1GPF A;  1UR8 A;  1NMV A;  1EHN A;  2DSW A;  2JV4 A;  1W1T A;  3UQI A;  2N87 A;  3LKX B;  4S3K A;  2LGO A;  2LKN A;  2DT3 A;  3PA7 A;  1J6Y A;  1OGB A;  1EIB A;  4LAW A;  3ARX A;  4L3N A;  1TFV A;  1J4R A;  4R0X A;  3MCB B;  3PRA A;  3LUO A;  3UI6 A;  3MCB A;  1ZBC A;  5HUA A;  1TK7 A;  1CTN A;  1ZK6 A;  1UR9 A;  4TX0 A;  1IX5 A;  3WQW A;  4WK9 A;  2YBU A;  3AS2 A;  4IQC A;  3WD4 A;  2M8I A;  3O5O A;  3B9D A;  2MDI A;  3WD0 A;  5DIU A;  2RQS A;  1W1V A;  3ART A;  2XP7 A;  4P8W A;  2DG9 A;  4XAK A;  1ZCN A;  4HBE A;  2WM0 A;  4PTM A;  4TW7 A;  4DRP A;  1FKD A;  2VCD A;  3ALF A;  3ARO A;  3FXY A;  4U86 A;  1E6R A;  5HTG A;  1FFR A;  4ODK A;  2PN0 A;  2F21 A;  3KZ7 A;  1FKG A;  3WD2 A;  4DRN A;  2FKE A;  4ZS6 A;  3O5R A;  1J4H A;  2DK1 A;  4DWS B;  1HKJ A;  3KCE A;  3GTY X;  1HJW A;  1OGG A;  2JMF A;  3IHZ A;  3KAD A;  3KAF A;  2QRV A;  3WL1 A;  1F8A B;  3CHE A;  3CH9 A;  1FKS A;  5HW6 A;  2XP9 A;  3GPK A;  3PQH A;  3ARW A;  1NWS A;  2A3B A;  3AQU A;  4ODO A;  1JMQ A;  2PBC A;  4Z2K A;  4AY1 A;  1JND A;  4C02 B;  4DRK A;  1N1A A;  1KFW A;  4MAV A;  2Q5A A;  1GRJ A;  2O9O A;  4HBO A;  1HKM A;  4QT3 A;  4R5E A;  4W9O A;  4A0U A;  1YW5 A;  1LJY A;  1LL4 A;  3B9A A;  4G50 A;  3UI4 A;  4Z2J A;  2ZR5 A;  2DMV A;  2O92 A;  2YAJ B;  4QIB A;  4U85 A;  4ML4 A;  4DH0 A;  4G2P A;  1ROU A;  3ARQ A;  1E6Z A;  2VN1 A;  2EZ5 W;  4JFK A;  3RM9 A;  3M7N A;  1X6L A;  4DRI A;  4UDM A;  1JCH B;  3RGC A;  4U84 A;  5E64 A;  1U79 A;  2KO7 A;  2UZ5 A;  1WMV A;  1BKF A;  4HAR A;  4JFM A;  3VAW A;  1E6P A;  2FAP A;  1YAT A;  3H9R B;  1KT0 A;  3LKX A;  1NSG A;  1F40 A;  3CHD A;  2XP5 A;  1ZBV A;  3FSB A;  1FLC A;  3KAC A;  1QPL A;  2ZAJ A;  5DIT A;  1XRV A;  2XP3 A;  2KE0 A;  4DRJ A;  3ALG A;  2OFN A;  1HJX A;  4REX A;  1W1P A;  1H0G A;  1GOI A;  2QF8 A;  5DF0 A;  2JXW A;  3KAG A;  4GLX A;  2DK7 A;  5CQ2 A;  1ZBK A;  3NTP A;  4ODP A;  1EG4 A;  3ARV A;  5DEZ A;  3M85 A;  2WLZ A;  4Q22 A;  4Z2L A;  1PBK A;  1W9U A;  4FN2 A;  4ZPW R;  3CHF A;  2KFW A;  2P4V A;  3B7X A;  5HW8 A;  3JYM A;  2ESC A;  5HKG A;  1ZU8 A;  2PV2 A;  5JH8 A;  3O5F A;  2YBT A;  4WKF A;  1I5H W;  1EQ3 A;  4KQZ A; 
#chains in the Genus database with same CATH homology
 2LJ4 A;  5E66 A;  2KGJ A;  2DSV A;  1NWT A;  1D6O A;  2M08 A;  3MQH A;  1EG3 A;  3WIJ A;  1FKH A;  1X6N A;  3ARU A;  1Q6H A;  4TNS A;  4ITZ A;  5HBF A;  1PIN A;  1FFQ A;  1FKT A;  1BL4 A;  4DWS A;  4TYO A;  1Q6I A;  4Z2I A;  5I98 A;  2Y8N B;  1T11 A;  2MNT A;  4Z2H A;  1RP5 A;  1K9T A;  4IPX A;  1TR8 A;  2ZQV A;  2YSF A;  2XP6 A;  2XPB A;  2JX8 A;  4ODM A;  1Q6U A;  4URI A;  3WKZ A;  2RE3 A;  2YSI A;  1TCO C;  2K8I A;  4MNJ A;  4MGV A;  1ZB5 A;  3UF8 A;  4LGX A;  2ZR4 A;  4WJX A;  4ODL A;  1FKF A;  1E9L A;  2KXQ A;  2DG4 A;  4IT4 A;  2WK2 A;  3O5M A;  2LAJ A;  2DJY A;  1W26 A;  4Z2G A;  2KI3 A;  4LAV A;  4MSP A;  4DRO A;  2XP4 A;  1W9P A;  1O6W A;  5AHT A;  2F2D A;  5HT1 A;  4KR0 B;  1SR0 A;  2MLZ A;  2ZQS A;  2RUD A;  1R9H A;  2RUQ A;  4WKA A;  1KT1 A;  2A3C A;  4MTV A;  4ZPV R;  1E6N A;  5E62 A;  2ZQT A;  1EYM A;  4J4N A;  1H0I A;  3ARZ A;  1GUV A;  1VF8 A;  4DIP A;  3UQB A;  3UI5 A;  3WD3 A;  2AWG A;  3CGM A;  1WB0 A;  2YSB A;  1ITX A;  1FKJ A;  1FKK A;  2IF4 A;  4LAY A;  2FDM A;  2ZR6 A;  3RM4 A;  1NH6 A;  1W9V A;  1ZBW A;  2PPO A;  3MQG A;  2WAE A;  1FKB A;  4DRH A;  2OWO A;  3W4R A;  3I6C A;  4P8X A;  2DWV A;  3G6L A;  1D7I A;  3O5L A;  3ARR A;  4JFI A;  4P8V A;  1EDQ A;  1JNE A;  2E45 A;  3JXV A;  3ODK A;  3PRD A;  1JNS A;  2DT1 A;  3O5I A;  4Q7N A;  4MPK A;  1B6C A;  3FS8 A;  2PV1 A;  4JFL A;  3FSC A;  1FJD A;  1QPF A;  3OA5 A;  1ZL1 A;  3CHC A;  1LG1 A;  2WAD A;  4ZPT R;  4MNL A;  1HJV A;  4ODQ A;  2PPN A;  4QZV B;  1JNT A;  3TC5 A;  3B9E A;  4IT6 A;  2OLH A;  4J4O A;  2ZQU A;  5HWC A;  2AOS A;  1LL7 A;  3WH0 A;  1Q1C A;  4DWS D;  5GPR A;  1LL6 A;  4TW8 A;  2G41 A;  2WLY A;  2XP8 A;  1O6I A;  3IK8 A;  1D7H A;  2YSH A;  1W1Y A;  1FKI A;  1J4I A;  1NMW A;  4O2T A;  5B8I C;  3UQA A;  3KAB A;  4GIV A;  3RFW A;  1A7X A;  2Y78 A;  2IUZ A;  3AS3 A;  4JYS A;  2KR7 A;  1QZ2 A;  2PV3 A;  3OOB A;  2DSZ A;  2YSG A;  2MLY A;  2G8Z A;  2DT0 A;  4DRQ A;  3WD1 A;  4N19 A;  3AS1 A;  3LE4 A;  3KAI A;  4MNK A;  3CNG A;  4DZ2 A;  2PI6 A;  3ARP A;  3IKG A;  3WQV A;  2A3A A;  4LAX A;  3RME A;  2RUC A;  3PRB A;  4WIW A;  5E5W A;  1SYT A;  4WKH A;  4W5U A;  4P8U A;  4FAP A;  1XHG A;  4E5R A;  3O5Q A;  3AS0 A;  4DZ3 A;  3O5K A;  2DPE A;  2M8J A;  3O5J A;  4TW6 A;  1HKK A;  1L1P A;  3TDB A;  1K9R A;  5HWB A;  2RSE A;  3FAP A;  1WNO A;  3CZ8 A;  2XPA A;  1FKL A;  1LQ0 A;  1NWR A;  2M3O W;  2MLX A;  4GGQ A;  4ODR A;  2PPP A;  5U47 A;  3CGN A;  2DT2 A;  4BF8 A;  3L4H A;  4QT2 A;  2RUR A;  4IQ2 A;  1WAW A;  2A3E A;  3O5P A;  3IKD A;  1FKR A;  1E15 A;  4NNR A;  4DT4 A;  4S3J A;  5E65 A;  1FAP A;  1K9Q A;  1D7J A;  2LPV A;  4MNM A;  1RD6 A;  2ITK A;  2BA1 A;  5D75 A;  4DWS C;  1ROT A;  3EY6 A;  5DIV A;  1WR7 A;  2F4E A;  3NRK A;  4W9P A;  5BXJ A;  2DSU A;  3ARY A;  1HXV A;  1NWU A;  2L4J A;  3TCZ A;  5GPG A;  1M5Y A;  5DO2 A;  1OWQ A;  3O5E A;  4NSB A;  2M2A A;  2B31 A;  3FY1 A;  3MDY B;  1Y0O A;  1LG2 A;  1D2K A;  3JYJ A;  5GQB A;  1P5Q A;  4A0T A;  3RM8 A;  4DRM A;  4NZC A;  3KAH A;  4L72 B;  3PR9 A;  4ODN A;  1C9H A;  1FD9 A;  1JVW A;  2JZV A;  3BXW A;  3G6M A;  2MPH A;  3O5D A;  2DG3 A;  4W9Q A;  5HW7 A;  3QOK A;  3B8S A;  2M1I A;  3WL0 A;  3NI6 A;  1HKI A;  3ARS A;  2MF9 A;  5J6E A;  2L2S A;  3O5G A;  2D9F A;  4JFJ A;  1GPF A;  1UR8 A;  1NMV A;  1EHN A;  2DSW A;  2JV4 A;  1W1T A;  3UQI A;  2N87 A;  3LKX B;  4S3K A;  2LGO A;  2LKN A;  2DT3 A;  3PA7 A;  1J6Y A;  1OGB A;  1EIB A;  4LAW A;  3ARX A;  4L3N A;  1TFV A;  1J4R A;  4R0X A;  3MCB B;  3PRA A;  3LUO A;  3UI6 A;  3MCB A;  1ZBC A;  5HUA A;  1TK7 A;  1CTN A;  1ZK6 A;  1UR9 A;  4TX0 A;  1IX5 A;  3WQW A;  4WK9 A;  2YBU A;  3AS2 A;  4IQC A;  3WD4 A;  2M8I A;  3O5O A;  3B9D A;  2MDI A;  3WD0 A;  5DIU A;  2RQS A;  1W1V A;  3ART A;  2XP7 A;  4P8W A;  2DG9 A;  4XAK A;  1ZCN A;  4HBE A;  2WM0 A;  4PTM A;  4TW7 A;  4DRP A;  1FKD A;  2VCD A;  3ALF A;  3ARO A;  3FXY A;  4U86 A;  1E6R A;  5HTG A;  1FFR A;  4ODK A;  2F21 A;  3KZ7 A;  1FKG A;  3WD2 A;  4DRN A;  2FKE A;  4ZS6 A;  3O5R A;  1J4H A;  2DK1 A;  4DWS B;  1HKJ A;  3KCE A;  1HJW A;  1OGG A;  2JMF A;  3IHZ A;  3KAD A;  3KAF A;  2QRV A;  3WL1 A;  1F8A B;  3CHE A;  3CH9 A;  1FKS A;  5HW6 A;  2XP9 A;  3GPK A;  3PQH A;  3ARW A;  1NWS A;  2A3B A;  3AQU A;  4ODO A;  1JMQ A;  2PBC A;  4Z2K A;  4AY1 A;  1JND A;  4C02 B;  4DRK A;  1N1A A;  1KFW A;  4MAV A;  2Q5A A;  2O9O A;  4HBO A;  1HKM A;  4QT3 A;  4R5E A;  4W9O A;  4A0U A;  1YW5 A;  1LJY A;  1LL4 A;  3B9A A;  4G50 A;  3UI4 A;  4Z2J A;  2ZR5 A;  2DMV A;  2O92 A;  2YAJ B;  4QIB A;  4U85 A;  4ML4 A;  4DH0 A;  4G2P A;  1ROU A;  3ARQ A;  1E6Z A;  2VN1 A;  2EZ5 W;  4JFK A;  3RM9 A;  3M7N A;  1X6L A;  4DRI A;  3RGC A;  4U84 A;  5E64 A;  1U79 A;  2KO7 A;  2UZ5 A;  1WMV A;  1BKF A;  4HAR A;  4JFM A;  3VAW A;  1E6P A;  2FAP A;  1YAT A;  3H9R B;  1KT0 A;  3LKX A;  1NSG A;  1F40 A;  3CHD A;  2XP5 A;  1ZBV A;  3FSB A;  1FLC A;  3KAC A;  1QPL A;  2ZAJ A;  5DIT A;  1XRV A;  2XP3 A;  2KE0 A;  4DRJ A;  3ALG A;  2OFN A;  1HJX A;  4REX A;  1W1P A;  1H0G A;  1GOI A;  2QF8 A;  5DF0 A;  2JXW A;  3KAG A;  4GLX A;  2DK7 A;  5CQ2 A;  1ZBK A;  3NTP A;  4ODP A;  1EG4 A;  3ARV A;  5DEZ A;  3M85 A;  2WLZ A;  4Q22 A;  4Z2L A;  1PBK A;  1W9U A;  4FN2 A;  4ZPW R;  3CHF A;  2KFW A;  5HW8 A;  3B7X A;  3JYM A;  2ESC A;  5HKG A;  1ZU8 A;  2PV2 A;  5JH8 A;  3O5F A;  2YBT A;  4WKF A;  1I5H W;  1EQ3 A;  4KQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...