3KAFA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMAKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 41
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kafA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kafA02
2KGJA 3MDYB 3UI5A 2Y78A 2ZQVA 3UF8A 4REXA 4MGVA 4W9OA 2XP9A 1I5HW 1N1AA 2F4EA 2LAJA 1A7XA 2PPOA 2DK1A 4DH0A 2ZQTA 1KT1A 2DK7A 2XP6A 2MPHA 3UQBA 3O5IA 1FKDA 5HKGA 1ROTA 2KR7A 4G2PA 3GPKA 2XPAA 2UZ5A 4TX0A 5I98A 2M8IA 1FKTA 3UQIA 4DT4A 2LGOA 3PRBA 2XP3A 4C02B 3WH0A 4DRPA 3KAGA 1B6CA 2DWVA 2KI3A 1J4RA 3RGCA 2K8IA 4JFLA 1FKJA 2PPPA 3TCZA 3M85A 1F8AB 1P5QA 2D9FA 3IHZA 1D6OA 4JYSA 5HWCA 1FKRA 4QT3A 1QZ2A 3KADA 2ZR4A 4JFMA 3O5JA 5B8IC 2XP8A 2RUDA 3O5PA 1K9RA 1JVWA 5GPGA 4TYOA 4G50A 4O2TA 2JX8A 4BF8A 3L4HA 3NI6A 4W9QA 4TW7A 4DZ2A 3KABA 2M2AA 2BA1A 1C9HA 3O5LA 3IKGA 1PINA 5CQ2A 4DZ3A 2RUQA 5HTGA 2F21A 2PV3A 2KFWA 2ITKA 1FKBA 3JXVA 4ODRA 3IK8A 4FN2A 3O5MA 1D7HA 4DRHA 1FJDA 1BKFA 3UI6A 2LPVA 1FAPA 2MF9A 1O6WA 4DRJA 1EG3A 2YSHA 2YSFA 4JFKA 4TNSA 3TC5A 3KAHA 1TCOC 2EZ5W 1YW5A 2JMFA 2YSIA 1ZCNA 4LAYA 2RQSA 4LAXA 3CGNA 1J4HA 2MLYA 1EQ3A 4ODKA 4DRQA 2PPNA 3UI4A 3O5EA 1EG4A 4J4NA 2MNTA 3PA7A 4DRNA 1QPLA 1WR7A 3JYJA 4E5RA 1F40A 3RFWA 2LKNA 3EY6A 3TDBA 1WMVA 4ODLA 1Q6IA 1FKSA 3H9RB 4DIPA 2ZQSA 1FKFA 4LAVA 2DG3A 2PBCA 1M5YA 2M1IA 5AHTA 4DROA 3OOBA 1K9QA 2KE0A 3O5RA 3O5FA 1L1PA 2ZR6A 2F2DA 2E45A 3I6CA 2Q5AA 2YSBA 3KAFA 2JXWA 2PV1A 1J6YA 5HW7A 3O5DA 2RURA 5HW6A 5HWBA 4DRKA 3O5GA 2XP5A 1T11A 3PRDA 5J6EA 4ITZA 2XP4A 4IPXA 1U79A 2RUCA 4ODMA 2L2SA 4QIBA 4ODNA 2KO7A 5HUAA 3FAPA 2DG9A 1FKHA 2M3OW 2VCDA 2XPBA 1FKIA 3O5QA 2OFNA 1FKLA 2IF4A 3O5KA 4FAPA 4ODPA 3B7XA 5HT1A 4J4OA 4DRMA 1FD9A 4U86A 2PV2A 4U84A 2JV4A 3O5OA 4DRIA 3IKDA 1JNSA 1TK7A 1W26A 4LAWA 4NNRA 2DJYA 2DMVA 1HXVA 2XP7A 2FKEA 2MLZA 4QT2A 2DG4A 2AWGA 3KCEA 1D7JA 2ZR5A 4IQ2A 3ODKA 1YATA 3CGMA 3NRKA 1R9HA 4TW8A 3NTPA 2M8JA 1NSGA 1Q6UA 3CNGA 4ODOA 4IQCA 5DIVA 5D75A 2JZVA 3VAWA 2FAPA 1Y0OA 2KXQA 4ODQA 4TW6A 2YSGA 5DIUA 1PBKA 1QPFA 4JFIA 4MSPA 3LE4A 2M08A 4GIVA 5BXJA 2RE3A 2RSEA 1NMVA 3M7NA 4W9PA 1BL4A 1FKKA 1JNTA 3JYMA 5HW8A 4N19A 3KZ7A 2N87A 2MDIA 1ZK6A 3LUOA 3KAIA 5DITA 2VN1A 3KACA 4GGQA 2MLXA 1Q6HA 4R0XA 1J4IA 1FKGA 2LJ4A 1EYMA 1JMQA 1Q1CA 3UQAA 1NMWA 2ZQUA 1D7IA 4JFJA 4U85A 2L4JA 2ZAJA 1ROUA 1KT0A
chains in the Genus database with same CATH superfamily
2YBUA 2KGJA 1OGBA 3MDYB 2EULA 3UI5A 1IX5A 2Y78A 1HKIA 2ZQVA 3UF8A 1EDQA 4REXA 4MGVA 4MNKA 4AY1A 3MCBA 4W9OA 1TR8A 2XP9A 1I5HW 1N1AA 1W1VA 2LAJA 2F4EA 1A7XA 2PPOA 2DK1A 3FSCA 3CHDA 4DH0A 2ZQTA 1KT1A 2DT1A 2DK7A 2XP6A 1UR8A 2MPHA 1X6NA 3UQBA 5E64A 4PTMA 1E6RA 1NWUA 3O5IA 1FKDA 5HKGA 1ROTA 2KR7A 1FFRA 1JCHB 2YBTA 4WIWA 1K9TA 4G2PA 3GPKA 2XPAA 2UZ5A 4TX0A 2G8ZA 1JNDA 1EHNA 5I98A 2M8IA 1FKTA 3UQIA 4DT4A 1TFVA 4P8VA 2LGOA 2WADA 1NWTA 1HKKA 5DO2A 3PRBA 2XP3A 3AS1A 4C02B 3WH0A 4DRPA 1ZBVA 3KAGA 1B6CA 3CH9A 3B9EA 3LKXB 2DWVA 2KI3A 1J4RA 5E66A 3RGCA 2K8IA 2PN0A 4JFLA 4MPKA 2DT2A 1FKJA 2PPPA 3TCZA 3M85A 3RM9A 3WD4A 4WKAA 1F8AB 1P5QA 5E5WA 2D9FA 3AROA 4P8WA 4LGXA 4P8UA 3ARPA 2DPEA 1NWRA 4A0TA 4GLXA 3IHZA 1D6OA 4S3KA 4JYSA 1WNOA 5HWCA 1FKRA 4Z2GA 4QT3A 1QZ2A 4IT6A 3KADA 5E65A 2ZR4A 3LKXA 3ARTA 3O5JA 3AS2A 4JFMA 5B8IC 2XP8A 2RUDA 3O5PA 1K9RA 1JVWA 5GPGA 4TYOA 1E9LA 4G50A 4O2TA 4P8XA 4WK9A 2JX8A 4BF8A 3L4HA 1O6IA 3NI6A 4W9QA 4TW7A 4DZ2A 4R5EA 3KABA 2M2AA 2BA1A 1C9HA 3O5LA 3ARSA 2DSWA 3IKGA 1PINA 4DWSC 5CQ2A 4DZ3A 4WKHA 3WKZA 2RUQA 5HTGA 1RP5A 2F21A 3RM4A 2PV3A 2DSUA 2KFWA 2O9OA 3MQHA 1LQ0A 1WAWA 3CHCA 2OLHA 2ITKA 1FKBA 3JXVA 4NSBA 4Z2JA 4ZPTR 4KR0B 4ODRA 1HJVA 3WD3A 3IK8A 4FN2A 2B31A 1LL6A 3BXWA 3G6LA 2DSZA 3O5MA 4MTVA 1D7HA 4DRHA 1FJDA 4HBOA 1BKFA 3BMBA 2LPVA 3UI6A 1FAPA 2MF9A 1O6WA 4DRJA 1EG3A 3WIJA 3ARRA 2YSHA 2YSFA 3CHFA 4JFKA 2F23A 4Q7NA 4TNSA 3TC5A 3KAHA 1TCOC 4MNJA 3WD0A 1HJXA 2EZ5W 1W1YA 1YW5A 2JMFA 2YSIA 1ZCNA 2ESCA 2RQSA 4LAYA 1W9VA 4LAXA 2YAJB 3ARQA 3CGNA 4WJXA 1SR0A 1J4HA 2MLYA 1EQ3A 4ODKA 4DRQA 2PPNA 1LL7A 3ARXA 3UI4A 3O5EA 1EG4A 4J4NA 2MNTA 3WQVA 3PA7A 4DRNA 1CTNA 1HKJA 1QPLA 1WR7A 3JYJA 2WK2A 4E5RA 5GPRA 1F40A 4ZS6A 3QOKA 1E44A 1ZBWA 4URIA 3RFWA 2LKNA 1GPFA 4NZCA 3EY6A 1ITXA 3TDBA 3B8SA 1HKMA 3WQWA 1W1PA 1WMVA 5HBFA 2AOSA 1FFQA 4ODLA 5JH8A 1Q6IA 3GU0A 1FKSA 3H9RB 4DIPA 2ZQSA 2PI6A 1FKFA 4LAVA 2ETNA 2DG3A 2OWOA 1M5YA 2M1IA 2PBCA 5AHTA 4DROA 3OOBA 1OGGA 1K9QA 2KE0A 3O5RA 1LG2A 3O5FA 1SYTA 1L1PA 4IT4A 2ZR6A 4HARA 2WLYA 1NWSA 3G6MA 2F2DA 2E45A 3I6CA 4Z2KA 2Q5AA 2YSBA 3KAFA 2A3EA 2JXWA 3OA5A 2PV1A 1J6YA 4XAKA 3ARYA 5HW7A 1VF8A 3O5DA 1H0IA 3WD2A 2RURA 1XRVA 3RMEA 5HW6A 5HWBA 4DRKA 3O5GA 2XP5A 1T11A 3PRDA 4UDMA 1GOIA 4DWSD 5J6EA 4ITZA 2Y8NB 4Q22A 2XP4A 4IPXA 2B5UB 2DSVA 2WLZA 1E6PA 1U79A 2RUCA 4ODMA 1D2KA 2L2SA 4QIBA 4ODNA 2KO7A 1ZB5A 1EIBA 2DT0A 4MNLA 3FAPA 5HUAA 2DG9A 5GQBA 1ZU8A 1FKHA 2M3OW 2VCDA 3WD1A 2XPBA 1FKIA 3B9AA 3O5QA 4HBEA 3FSBA 2OFNA 1FKLA 3GTYX 2IF4A 3O5KA 4FAPA 4ODPA 3ALFA 3B7XA 1HJWA 5E62A 5HT1A 1LG1A 3PQHA 1GRJA 3ARVA 4J4OA 4DRMA 3FXYA 1FD9A 4U86A 2PV2A 2WAEA 1FLCA 4U84A 3ARUA 1E15A 2JV4A 4ZPVR 1E6ZA 1RD6A 3FY1A 3O5OA 4DRIA 4MNMA 2A3CA 1W9UA 3IKDA 2QRVA 4Z2LA 1JNSA 4S3JA 1TK7A 4Z2HA 1W26A 2WM0A 4LAWA 4NNRA 2DJYA 2DMVA 1HXVA 2XP7A 2FKEA 4QZVB 2MLZA 4QT2A 2DG4A 4ZPWR 2AWGA 3KCEA 1D7JA 2O92A 4ML4A 2ZR5A 3W4RA 3CHEA 4IQ2A 3ODKA 1YATA 5DEZA 3CGMA 3WL0A 3NRKA 1R9HA 4TW8A 3NTPA 2M8JA 1E6NA 1WB0A 1NSGA 1OWQA 3CNGA 1Q6UA 4ODOA 4KQZA 4IQCA 3EIPA 5DIVA 5D75A 2JZVA 3VAWA 3AS3A 3MQGA 3ALGA 1XHGA 5U47A 1ZL1A 2FAPA 1Y0OA 2KXQA 4ODQA 4TW6A 2YSGA 3PR9A 5DIUA 1PBKA 2FDMA 1W9PA 4A0UA 1QPFA 4JFIA 1LJYA 4MSPA 4DWSB 3LE4A 4W5UA 1UR9A 3CZ8A 2P4VA 2M08A 4GIVA 1KFWA 5BXJA 2RE3A 2RSEA 2QF8A 4L3NA 1NMVA 4Z2IA 3M7NA 4W9PA 4L72B 3RM8A 1GUVA 1H0GA 1BL4A 1FKKA 1JNTA 3JYMA 5HW8A 4N19A 3KZ7A 1NH6A 2A3BA 2N87A 2MDIA 3AQUA 1ZBKA 1ZK6A 3LUOA 3KAIA 3ARZA 2DT3A 5DITA 5DF0A 4DWSA 1X6LA 1W1TA 1ZBCA 2VN1A 2A3AA 3AS0A 3KACA 3MCBB 3ARWA 4GGQA 2MLXA 4MAVA 1Q6HA 4R0XA 1J4IA 1FKGA 3WL1A 2LJ4A 1EYMA 1JMQA 1Q1CA 3UQAA 1NMWA 3PRAA 2ZQUA 3B9DA 4WKFA 1D7IA 2IUZA 2G41A 4JFJA 1LL4A 4U85A 2L4JA 2ZAJA 1JNEA 3FS8A 1ROUA 1KT0A
chains in the Genus database with same CATH topology
2YBUA 2KGJA 1OGBA 3MDYB 3UI5A 1IX5A 2Y78A 1HKIA 2ZQVA 3UF8A 1EDQA 4REXA 4MGVA 4MNKA 4AY1A 3MCBA 4W9OA 1TR8A 2XP9A 1I5HW 1N1AA 1W1VA 2LAJA 2F4EA 1A7XA 2PPOA 2DK1A 3FSCA 3CHDA 4DH0A 2ZQTA 1KT1A 2DT1A 2DK7A 2XP6A 1UR8A 2MPHA 1X6NA 3UQBA 5E64A 4PTMA 1E6RA 1NWUA 3O5IA 1FKDA 5HKGA 1ROTA 2KR7A 1FFRA 2YBTA 4WIWA 1K9TA 4G2PA 3GPKA 2XPAA 2UZ5A 4TX0A 2G8ZA 1JNDA 1EHNA 5I98A 2M8IA 1FKTA 3UQIA 4DT4A 1TFVA 4P8VA 2LGOA 2WADA 1NWTA 1HKKA 5DO2A 3PRBA 2XP3A 3AS1A 4C02B 3WH0A 4DRPA 1ZBVA 3KAGA 1B6CA 3CH9A 3B9EA 3LKXB 2DWVA 2KI3A 1J4RA 5E66A 3RGCA 2K8IA 4JFLA 4MPKA 2DT2A 1FKJA 2PPPA 3TCZA 3M85A 3RM9A 3WD4A 4WKAA 1F8AB 1P5QA 5E5WA 2D9FA 3AROA 4P8WA 4LGXA 4P8UA 3ARPA 2DPEA 1NWRA 4A0TA 4GLXA 3IHZA 1D6OA 4S3KA 4JYSA 1WNOA 5HWCA 1FKRA 4Z2GA 4QT3A 1QZ2A 4IT6A 3KADA 5E65A 2ZR4A 3LKXA 3ARTA 3O5JA 3AS2A 4JFMA 5B8IC 2XP8A 2RUDA 3O5PA 1K9RA 1JVWA 5GPGA 4TYOA 1E9LA 4G50A 4O2TA 4P8XA 4WK9A 2JX8A 4BF8A 3L4HA 1O6IA 3NI6A 4W9QA 4TW7A 4DZ2A 4R5EA 3KABA 2M2AA 2BA1A 1C9HA 3O5LA 3ARSA 2DSWA 3IKGA 1PINA 4DWSC 5CQ2A 4DZ3A 4WKHA 3WKZA 2RUQA 5HTGA 1RP5A 2F21A 3RM4A 2PV3A 2DSUA 2KFWA 2O9OA 3MQHA 1LQ0A 1WAWA 3CHCA 2OLHA 2ITKA 1FKBA 3JXVA 4NSBA 4Z2JA 4ZPTR 4KR0B 4ODRA 1HJVA 3WD3A 3IK8A 4FN2A 2B31A 1LL6A 3BXWA 3G6LA 2DSZA 3O5MA 4MTVA 1D7HA 4DRHA 1FJDA 4HBOA 1BKFA 3UI6A 2LPVA 1FAPA 2MF9A 1O6WA 4DRJA 1EG3A 3WIJA 3ARRA 2YSHA 2YSFA 3CHFA 4JFKA 4Q7NA 4TNSA 3TC5A 3KAHA 1TCOC 4MNJA 3WD0A 1HJXA 2EZ5W 1W1YA 1YW5A 2JMFA 2YSIA 1ZCNA 2ESCA 2RQSA 4LAYA 1W9VA 4LAXA 2YAJB 3ARQA 3CGNA 4WJXA 1SR0A 1J4HA 2MLYA 1EQ3A 4ODKA 4DRQA 2PPNA 1LL7A 3ARXA 3UI4A 3O5EA 1EG4A 4J4NA 2MNTA 3WQVA 3PA7A 4DRNA 1CTNA 1HKJA 1QPLA 1WR7A 3JYJA 2WK2A 4E5RA 5GPRA 1F40A 4ZS6A 3QOKA 1ZBWA 4URIA 3RFWA 2LKNA 1GPFA 4NZCA 3EY6A 1ITXA 3TDBA 3B8SA 1HKMA 3WQWA 1W1PA 1WMVA 5HBFA 2AOSA 1FFQA 4ODLA 5JH8A 1Q6IA 1FKSA 3H9RB 4DIPA 2ZQSA 2PI6A 1FKFA 4LAVA 2DG3A 2OWOA 1M5YA 2M1IA 2PBCA 5AHTA 4DROA 3OOBA 1OGGA 1K9QA 2KE0A 3O5RA 1LG2A 3O5FA 1SYTA 1L1PA 4IT4A 2ZR6A 4HARA 2WLYA 1NWSA 3G6MA 2F2DA 2E45A 3I6CA 4Z2KA 2Q5AA 2YSBA 3KAFA 2A3EA 2JXWA 3OA5A 2PV1A 1J6YA 4XAKA 3ARYA 5HW7A 1VF8A 3O5DA 1H0IA 3WD2A 2RURA 1XRVA 3RMEA 5HW6A 5HWBA 4DRKA 3O5GA 2XP5A 1T11A 3PRDA 1GOIA 4DWSD 5J6EA 4ITZA 2Y8NB 4Q22A 2XP4A 4IPXA 2DSVA 2WLZA 1E6PA 1U79A 2RUCA 4ODMA 1D2KA 2L2SA 4QIBA 4ODNA 2KO7A 1ZB5A 1EIBA 2DT0A 4MNLA 3FAPA 5HUAA 2DG9A 5GQBA 1ZU8A 1FKHA 2M3OW 2VCDA 3WD1A 2XPBA 1FKIA 3B9AA 3O5QA 4HBEA 3FSBA 2OFNA 1FKLA 2IF4A 3O5KA 4FAPA 4ODPA 3ALFA 3B7XA 1HJWA 5E62A 5HT1A 1LG1A 3PQHA 3ARVA 4J4OA 4DRMA 3FXYA 1FD9A 4U86A 2PV2A 2WAEA 1FLCA 4U84A 3ARUA 1E15A 2JV4A 4ZPVR 1E6ZA 1RD6A 3FY1A 3O5OA 4DRIA 4MNMA 2A3CA 1W9UA 3IKDA 2QRVA 4Z2LA 1JNSA 4S3JA 1TK7A 4Z2HA 1W26A 2WM0A 4LAWA 4NNRA 2DJYA 2DMVA 1HXVA 2XP7A 2FKEA 4QZVB 2MLZA 4QT2A 2DG4A 4ZPWR 2AWGA 3KCEA 1D7JA 2O92A 4ML4A 2ZR5A 3W4RA 3CHEA 4IQ2A 3ODKA 1YATA 5DEZA 3CGMA 3WL0A 3NRKA 1R9HA 4TW8A 3NTPA 2M8JA 1E6NA 1WB0A 1NSGA 1OWQA 3CNGA 1Q6UA 4ODOA 4KQZA 4IQCA 5DIVA 5D75A 2JZVA 3VAWA 3AS3A 3MQGA 3ALGA 1XHGA 5U47A 1ZL1A 2FAPA 1Y0OA 2KXQA 4ODQA 4TW6A 2YSGA 3PR9A 5DIUA 1PBKA 2FDMA 1W9PA 4A0UA 1QPFA 4JFIA 1LJYA 4MSPA 4DWSB 3LE4A 4W5UA 1UR9A 3CZ8A 2M08A 4GIVA 1KFWA 5BXJA 2RE3A 2RSEA 2QF8A 4L3NA 1NMVA 4Z2IA 3M7NA 4W9PA 4L72B 3RM8A 1GUVA 1H0GA 1BL4A 1FKKA 1JNTA 3JYMA 5HW8A 4N19A 3KZ7A 1NH6A 2A3BA 2N87A 2MDIA 3AQUA 1ZBKA 1ZK6A 3LUOA 3KAIA 3ARZA 2DT3A 5DITA 5DF0A 4DWSA 1X6LA 1W1TA 1ZBCA 2VN1A 2A3AA 3AS0A 3KACA 3MCBB 3ARWA 4GGQA 2MLXA 4MAVA 1Q6HA 4R0XA 1J4IA 1FKGA 3WL1A 2LJ4A 1EYMA 1JMQA 1Q1CA 3UQAA 1NMWA 3PRAA 2ZQUA 3B9DA 4WKFA 1D7IA 2IUZA 2G41A 4JFJA 1LL4A 4U85A 2L4JA 2ZAJA 1JNEA 3FS8A 1ROUA 1KT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGJ A;  3MDY B;  3UI5 A;  2Y78 A;  2ZQV A;  3UF8 A;  4REX A;  4MGV A;  4W9O A;  2XP9 A;  1I5H W;  1N1A A;  2F4E A;  2LAJ A;  1A7X A;  2PPO A;  2DK1 A;  4DH0 A;  2ZQT A;  1KT1 A;  2DK7 A;  2XP6 A;  2MPH A;  3UQB A;  3O5I A;  1FKD A;  5HKG A;  1ROT A;  2KR7 A;  4G2P A;  3GPK A;  2XPA A;  2UZ5 A;  4TX0 A;  5I98 A;  2M8I A;  1FKT A;  3UQI A;  4DT4 A;  2LGO A;  3PRB A;  2XP3 A;  4C02 B;  3WH0 A;  4DRP A;  3KAG A;  1B6C A;  2DWV A;  2KI3 A;  1J4R A;  3RGC A;  2K8I A;  4JFL A;  1FKJ A;  2PPP A;  3TCZ A;  3M85 A;  1F8A B;  1P5Q A;  2D9F A;  3IHZ A;  1D6O A;  4JYS A;  5HWC A;  1FKR A;  4QT3 A;  1QZ2 A;  3KAD A;  2ZR4 A;  4JFM A;  3O5J A;  5B8I C;  2XP8 A;  2RUD A;  3O5P A;  1K9R A;  1JVW A;  5GPG A;  4TYO A;  4G50 A;  4O2T A;  2JX8 A;  4BF8 A;  3L4H A;  3NI6 A;  4W9Q A;  4TW7 A;  4DZ2 A;  3KAB A;  2M2A A;  2BA1 A;  1C9H A;  3O5L A;  3IKG A;  1PIN A;  5CQ2 A;  4DZ3 A;  2RUQ A;  5HTG A;  2F21 A;  2PV3 A;  2KFW A;  2ITK A;  1FKB A;  3JXV A;  4ODR A;  3IK8 A;  4FN2 A;  3O5M A;  1D7H A;  4DRH A;  1FJD A;  1BKF A;  3UI6 A;  2LPV A;  1FAP A;  2MF9 A;  1O6W A;  4DRJ A;  1EG3 A;  2YSH A;  2YSF A;  4JFK A;  4TNS A;  3TC5 A;  3KAH A;  1TCO C;  2EZ5 W;  1YW5 A;  2JMF A;  2YSI A;  1ZCN A;  4LAY A;  2RQS A;  4LAX A;  3CGN A;  1J4H A;  2MLY A;  1EQ3 A;  4ODK A;  4DRQ A;  2PPN A;  3UI4 A;  3O5E A;  1EG4 A;  4J4N A;  2MNT A;  3PA7 A;  4DRN A;  1QPL A;  1WR7 A;  3JYJ A;  4E5R A;  1F40 A;  3RFW A;  2LKN A;  3EY6 A;  3TDB A;  1WMV A;  4ODL A;  1Q6I A;  1FKS A;  3H9R B;  4DIP A;  2ZQS A;  1FKF A;  4LAV A;  2DG3 A;  2PBC A;  1M5Y A;  2M1I A;  5AHT A;  4DRO A;  3OOB A;  1K9Q A;  2KE0 A;  3O5R A;  3O5F A;  1L1P A;  2ZR6 A;  2F2D A;  2E45 A;  3I6C A;  2Q5A A;  2YSB A;  3KAF A;  2JXW A;  2PV1 A;  1J6Y A;  5HW7 A;  3O5D A;  2RUR A;  5HW6 A;  5HWB A;  4DRK A;  3O5G A;  2XP5 A;  1T11 A;  3PRD A;  5J6E A;  4ITZ A;  2XP4 A;  4IPX A;  1U79 A;  2RUC A;  4ODM A;  2L2S A;  4QIB A;  4ODN A;  2KO7 A;  5HUA A;  3FAP A;  2DG9 A;  1FKH A;  2M3O W;  2VCD A;  2XPB A;  1FKI A;  3O5Q A;  2OFN A;  1FKL A;  2IF4 A;  3O5K A;  4FAP A;  4ODP A;  3B7X A;  5HT1 A;  4J4O A;  4DRM A;  1FD9 A;  4U86 A;  2PV2 A;  4U84 A;  2JV4 A;  3O5O A;  4DRI A;  3IKD A;  1JNS A;  1TK7 A;  1W26 A;  4LAW A;  4NNR A;  2DJY A;  2DMV A;  1HXV A;  2XP7 A;  2FKE A;  2MLZ A;  4QT2 A;  2DG4 A;  2AWG A;  3KCE A;  1D7J A;  2ZR5 A;  4IQ2 A;  3ODK A;  1YAT A;  3CGM A;  3NRK A;  1R9H A;  4TW8 A;  3NTP A;  2M8J A;  1NSG A;  1Q6U A;  3CNG A;  4ODO A;  4IQC A;  5DIV A;  5D75 A;  2JZV A;  3VAW A;  2FAP A;  1Y0O A;  2KXQ A;  4ODQ A;  4TW6 A;  2YSG A;  5DIU A;  1PBK A;  1QPF A;  4JFI A;  4MSP A;  3LE4 A;  2M08 A;  4GIV A;  5BXJ A;  2RE3 A;  2RSE A;  1NMV A;  3M7N A;  4W9P A;  1BL4 A;  1FKK A;  1JNT A;  3JYM A;  5HW8 A;  4N19 A;  3KZ7 A;  2N87 A;  2MDI A;  1ZK6 A;  3LUO A;  3KAI A;  5DIT A;  2VN1 A;  3KAC A;  4GGQ A;  2MLX A;  1Q6H A;  4R0X A;  1J4I A;  1FKG A;  2LJ4 A;  1EYM A;  1JMQ A;  1Q1C A;  3UQA A;  1NMW A;  2ZQU A;  1D7I A;  4JFJ A;  4U85 A;  2L4J A;  2ZAJ A;  1ROU A;  1KT0 A; 
#chains in the Genus database with same CATH topology
 2YBU A;  2KGJ A;  1OGB A;  3MDY B;  2EUL A;  3UI5 A;  1IX5 A;  2Y78 A;  1HKI A;  2ZQV A;  3UF8 A;  1EDQ A;  4REX A;  4MGV A;  4MNK A;  4AY1 A;  3MCB A;  4W9O A;  1TR8 A;  2XP9 A;  1I5H W;  1N1A A;  1W1V A;  2LAJ A;  2F4E A;  1A7X A;  2PPO A;  2DK1 A;  3FSC A;  3CHD A;  4DH0 A;  2ZQT A;  1KT1 A;  2DT1 A;  2DK7 A;  2XP6 A;  1UR8 A;  2MPH A;  1X6N A;  3UQB A;  5E64 A;  4PTM A;  1E6R A;  1NWU A;  3O5I A;  1FKD A;  5HKG A;  1ROT A;  2KR7 A;  1FFR A;  1JCH B;  2YBT A;  4WIW A;  1K9T A;  4G2P A;  3GPK A;  2XPA A;  2UZ5 A;  4TX0 A;  2G8Z A;  1JND A;  1EHN A;  5I98 A;  2M8I A;  1FKT A;  3UQI A;  4DT4 A;  1TFV A;  4P8V A;  2LGO A;  2WAD A;  1NWT A;  1HKK A;  5DO2 A;  3PRB A;  2XP3 A;  3AS1 A;  4C02 B;  3WH0 A;  4DRP A;  1ZBV A;  3KAG A;  1B6C A;  3CH9 A;  3B9E A;  3LKX B;  2DWV A;  2KI3 A;  1J4R A;  5E66 A;  3RGC A;  2K8I A;  2PN0 A;  4JFL A;  4MPK A;  2DT2 A;  1FKJ A;  2PPP A;  3TCZ A;  3M85 A;  3RM9 A;  3WD4 A;  4WKA A;  1F8A B;  1P5Q A;  5E5W A;  2D9F A;  3ARO A;  4P8W A;  4LGX A;  4P8U A;  3ARP A;  2DPE A;  1NWR A;  4A0T A;  4GLX A;  3IHZ A;  1D6O A;  4S3K A;  4JYS A;  1WNO A;  5HWC A;  1FKR A;  4Z2G A;  4QT3 A;  1QZ2 A;  4IT6 A;  3KAD A;  5E65 A;  2ZR4 A;  3LKX A;  3ART A;  3O5J A;  3AS2 A;  4JFM A;  5B8I C;  2XP8 A;  2RUD A;  3O5P A;  1K9R A;  1JVW A;  5GPG A;  4TYO A;  1E9L A;  4G50 A;  4O2T A;  4P8X A;  4WK9 A;  2JX8 A;  4BF8 A;  3L4H A;  1O6I A;  3NI6 A;  4W9Q A;  4TW7 A;  4DZ2 A;  4R5E A;  3KAB A;  2M2A A;  2BA1 A;  1C9H A;  3O5L A;  3ARS A;  2DSW A;  3IKG A;  1PIN A;  4DWS C;  5CQ2 A;  4DZ3 A;  4WKH A;  3WKZ A;  2RUQ A;  5HTG A;  1RP5 A;  2F21 A;  3RM4 A;  2PV3 A;  2DSU A;  2KFW A;  2O9O A;  3MQH A;  1LQ0 A;  1WAW A;  3CHC A;  2OLH A;  2ITK A;  1FKB A;  3JXV A;  4NSB A;  4Z2J A;  4ZPT R;  4KR0 B;  4ODR A;  1HJV A;  3WD3 A;  3IK8 A;  4FN2 A;  2B31 A;  1LL6 A;  3BXW A;  3G6L A;  2DSZ A;  3O5M A;  4MTV A;  1D7H A;  4DRH A;  1FJD A;  4HBO A;  1BKF A;  3BMB A;  2LPV A;  3UI6 A;  1FAP A;  2MF9 A;  1O6W A;  4DRJ A;  1EG3 A;  3WIJ A;  3ARR A;  2YSH A;  2YSF A;  3CHF A;  4JFK A;  2F23 A;  4Q7N A;  4TNS A;  3TC5 A;  3KAH A;  1TCO C;  4MNJ A;  3WD0 A;  1HJX A;  2EZ5 W;  1W1Y A;  1YW5 A;  2JMF A;  2YSI A;  1ZCN A;  2ESC A;  2RQS A;  4LAY A;  1W9V A;  4LAX A;  2YAJ B;  3ARQ A;  3CGN A;  4WJX A;  1SR0 A;  1J4H A;  2MLY A;  1EQ3 A;  4ODK A;  4DRQ A;  2PPN A;  1LL7 A;  3ARX A;  3UI4 A;  3O5E A;  1EG4 A;  4J4N A;  2MNT A;  3WQV A;  3PA7 A;  4DRN A;  1CTN A;  1HKJ A;  1QPL A;  1WR7 A;  3JYJ A;  2WK2 A;  4E5R A;  5GPR A;  1F40 A;  4ZS6 A;  3QOK A;  1E44 A;  1ZBW A;  4URI A;  3RFW A;  2LKN A;  1GPF A;  4NZC A;  3EY6 A;  1ITX A;  3TDB A;  3B8S A;  1HKM A;  3WQW A;  1W1P A;  1WMV A;  5HBF A;  2AOS A;  1FFQ A;  4ODL A;  5JH8 A;  1Q6I A;  3GU0 A;  1FKS A;  3H9R B;  4DIP A;  2ZQS A;  2PI6 A;  1FKF A;  4LAV A;  2ETN A;  2DG3 A;  2OWO A;  1M5Y A;  2M1I A;  2PBC A;  5AHT A;  4DRO A;  3OOB A;  1OGG A;  1K9Q A;  2KE0 A;  3O5R A;  1LG2 A;  3O5F A;  1SYT A;  1L1P A;  4IT4 A;  2ZR6 A;  4HAR A;  2WLY A;  1NWS A;  3G6M A;  2F2D A;  2E45 A;  3I6C A;  4Z2K A;  2Q5A A;  2YSB A;  3KAF A;  2A3E A;  2JXW A;  3OA5 A;  2PV1 A;  1J6Y A;  4XAK A;  3ARY A;  5HW7 A;  1VF8 A;  3O5D A;  1H0I A;  3WD2 A;  2RUR A;  1XRV A;  3RME A;  5HW6 A;  5HWB A;  4DRK A;  3O5G A;  2XP5 A;  1T11 A;  3PRD A;  4UDM A;  1GOI A;  4DWS D;  5J6E A;  4ITZ A;  2Y8N B;  4Q22 A;  2XP4 A;  4IPX A;  2B5U B;  2DSV A;  2WLZ A;  1E6P A;  1U79 A;  2RUC A;  4ODM A;  1D2K A;  2L2S A;  4QIB A;  4ODN A;  2KO7 A;  1ZB5 A;  1EIB A;  2DT0 A;  4MNL A;  3FAP A;  5HUA A;  2DG9 A;  5GQB A;  1ZU8 A;  1FKH A;  2M3O W;  2VCD A;  3WD1 A;  2XPB A;  1FKI A;  3B9A A;  3O5Q A;  4HBE A;  3FSB A;  2OFN A;  1FKL A;  3GTY X;  2IF4 A;  3O5K A;  4FAP A;  4ODP A;  3ALF A;  3B7X A;  1HJW A;  5E62 A;  5HT1 A;  1LG1 A;  3PQH A;  1GRJ A;  3ARV A;  4J4O A;  4DRM A;  3FXY A;  1FD9 A;  4U86 A;  2PV2 A;  2WAE A;  1FLC A;  4U84 A;  3ARU A;  1E15 A;  2JV4 A;  4ZPV R;  1E6Z A;  1RD6 A;  3FY1 A;  3O5O A;  4DRI A;  4MNM A;  2A3C A;  1W9U A;  3IKD A;  2QRV A;  4Z2L A;  1JNS A;  4S3J A;  1TK7 A;  4Z2H A;  1W26 A;  2WM0 A;  4LAW A;  4NNR A;  2DJY A;  2DMV A;  1HXV A;  2XP7 A;  2FKE A;  4QZV B;  2MLZ A;  4QT2 A;  2DG4 A;  4ZPW R;  2AWG A;  3KCE A;  1D7J A;  2O92 A;  4ML4 A;  2ZR5 A;  3W4R A;  3CHE A;  4IQ2 A;  3ODK A;  1YAT A;  5DEZ A;  3CGM A;  3WL0 A;  3NRK A;  1R9H A;  4TW8 A;  3NTP A;  2M8J A;  1E6N A;  1WB0 A;  1NSG A;  1OWQ A;  3CNG A;  1Q6U A;  4ODO A;  4KQZ A;  4IQC A;  3EIP A;  5DIV A;  5D75 A;  2JZV A;  3VAW A;  3AS3 A;  3MQG A;  3ALG A;  1XHG A;  5U47 A;  1ZL1 A;  2FAP A;  1Y0O A;  2KXQ A;  4ODQ A;  4TW6 A;  2YSG A;  3PR9 A;  5DIU A;  1PBK A;  2FDM A;  1W9P A;  4A0U A;  1QPF A;  4JFI A;  1LJY A;  4MSP A;  4DWS B;  3LE4 A;  4W5U A;  1UR9 A;  3CZ8 A;  2P4V A;  2M08 A;  4GIV A;  1KFW A;  5BXJ A;  2RE3 A;  2RSE A;  2QF8 A;  4L3N A;  1NMV A;  4Z2I A;  3M7N A;  4W9P A;  4L72 B;  3RM8 A;  1GUV A;  1H0G A;  1BL4 A;  1FKK A;  1JNT A;  3JYM A;  5HW8 A;  4N19 A;  3KZ7 A;  1NH6 A;  2A3B A;  2N87 A;  2MDI A;  3AQU A;  1ZBK A;  1ZK6 A;  3LUO A;  3KAI A;  3ARZ A;  2DT3 A;  5DIT A;  5DF0 A;  4DWS A;  1X6L A;  1W1T A;  1ZBC A;  2VN1 A;  2A3A A;  3AS0 A;  3KAC A;  3MCB B;  3ARW A;  4GGQ A;  2MLX A;  4MAV A;  1Q6H A;  4R0X A;  1J4I A;  1FKG A;  3WL1 A;  2LJ4 A;  1EYM A;  1JMQ A;  1Q1C A;  3UQA A;  1NMW A;  3PRA A;  2ZQU A;  3B9D A;  4WKF A;  1D7I A;  2IUZ A;  2G41 A;  4JFJ A;  1LL4 A;  4U85 A;  2L4J A;  2ZAJ A;  1JNE A;  3FS8 A;  1ROU A;  1KT0 A; 
#chains in the Genus database with same CATH homology
 2YBU A;  2KGJ A;  1OGB A;  3MDY B;  3UI5 A;  1IX5 A;  2Y78 A;  1HKI A;  2ZQV A;  3UF8 A;  1EDQ A;  4REX A;  4MGV A;  4MNK A;  4AY1 A;  3MCB A;  4W9O A;  1TR8 A;  2XP9 A;  1I5H W;  1N1A A;  1W1V A;  2LAJ A;  2F4E A;  1A7X A;  2PPO A;  2DK1 A;  3FSC A;  3CHD A;  4DH0 A;  2ZQT A;  1KT1 A;  2DT1 A;  2DK7 A;  2XP6 A;  1UR8 A;  2MPH A;  1X6N A;  3UQB A;  5E64 A;  4PTM A;  1E6R A;  1NWU A;  3O5I A;  1FKD A;  5HKG A;  1ROT A;  2KR7 A;  1FFR A;  2YBT A;  4WIW A;  1K9T A;  4G2P A;  3GPK A;  2XPA A;  2UZ5 A;  4TX0 A;  2G8Z A;  1JND A;  1EHN A;  5I98 A;  2M8I A;  1FKT A;  3UQI A;  4DT4 A;  1TFV A;  4P8V A;  2LGO A;  2WAD A;  1NWT A;  1HKK A;  5DO2 A;  3PRB A;  2XP3 A;  3AS1 A;  4C02 B;  3WH0 A;  4DRP A;  1ZBV A;  3KAG A;  1B6C A;  3CH9 A;  3B9E A;  3LKX B;  2DWV A;  2KI3 A;  1J4R A;  5E66 A;  3RGC A;  2K8I A;  4JFL A;  4MPK A;  2DT2 A;  1FKJ A;  2PPP A;  3TCZ A;  3M85 A;  3RM9 A;  3WD4 A;  4WKA A;  1F8A B;  1P5Q A;  5E5W A;  2D9F A;  3ARO A;  4P8W A;  4LGX A;  4P8U A;  3ARP A;  2DPE A;  1NWR A;  4A0T A;  4GLX A;  3IHZ A;  1D6O A;  4S3K A;  4JYS A;  1WNO A;  5HWC A;  1FKR A;  4Z2G A;  4QT3 A;  1QZ2 A;  4IT6 A;  3KAD A;  5E65 A;  2ZR4 A;  3LKX A;  3ART A;  3O5J A;  3AS2 A;  4JFM A;  5B8I C;  2XP8 A;  2RUD A;  3O5P A;  1K9R A;  1JVW A;  5GPG A;  4TYO A;  1E9L A;  4G50 A;  4O2T A;  4P8X A;  4WK9 A;  2JX8 A;  4BF8 A;  3L4H A;  1O6I A;  3NI6 A;  4W9Q A;  4TW7 A;  4DZ2 A;  4R5E A;  3KAB A;  2M2A A;  2BA1 A;  1C9H A;  3O5L A;  3ARS A;  2DSW A;  3IKG A;  1PIN A;  4DWS C;  5CQ2 A;  4DZ3 A;  4WKH A;  3WKZ A;  2RUQ A;  5HTG A;  1RP5 A;  2F21 A;  3RM4 A;  2PV3 A;  2DSU A;  2KFW A;  2O9O A;  3MQH A;  1LQ0 A;  1WAW A;  3CHC A;  2OLH A;  2ITK A;  1FKB A;  3JXV A;  4NSB A;  4Z2J A;  4ZPT R;  4KR0 B;  4ODR A;  1HJV A;  3WD3 A;  3IK8 A;  4FN2 A;  2B31 A;  1LL6 A;  3BXW A;  3G6L A;  2DSZ A;  3O5M A;  4MTV A;  1D7H A;  4DRH A;  1FJD A;  4HBO A;  1BKF A;  3UI6 A;  2LPV A;  1FAP A;  2MF9 A;  1O6W A;  4DRJ A;  1EG3 A;  3WIJ A;  3ARR A;  2YSH A;  2YSF A;  3CHF A;  4JFK A;  4Q7N A;  4TNS A;  3TC5 A;  3KAH A;  1TCO C;  4MNJ A;  3WD0 A;  1HJX A;  2EZ5 W;  1W1Y A;  1YW5 A;  2JMF A;  2YSI A;  1ZCN A;  2ESC A;  2RQS A;  4LAY A;  1W9V A;  4LAX A;  2YAJ B;  3ARQ A;  3CGN A;  4WJX A;  1SR0 A;  1J4H A;  2MLY A;  1EQ3 A;  4ODK A;  4DRQ A;  2PPN A;  1LL7 A;  3ARX A;  3UI4 A;  3O5E A;  1EG4 A;  4J4N A;  2MNT A;  3WQV A;  3PA7 A;  4DRN A;  1CTN A;  1HKJ A;  1QPL A;  1WR7 A;  3JYJ A;  2WK2 A;  4E5R A;  5GPR A;  1F40 A;  4ZS6 A;  3QOK A;  1ZBW A;  4URI A;  3RFW A;  2LKN A;  1GPF A;  4NZC A;  3EY6 A;  1ITX A;  3TDB A;  3B8S A;  1HKM A;  3WQW A;  1W1P A;  1WMV A;  5HBF A;  2AOS A;  1FFQ A;  4ODL A;  5JH8 A;  1Q6I A;  1FKS A;  3H9R B;  4DIP A;  2ZQS A;  2PI6 A;  1FKF A;  4LAV A;  2DG3 A;  2OWO A;  1M5Y A;  2M1I A;  2PBC A;  5AHT A;  4DRO A;  3OOB A;  1OGG A;  1K9Q A;  2KE0 A;  3O5R A;  1LG2 A;  3O5F A;  1SYT A;  1L1P A;  4IT4 A;  2ZR6 A;  4HAR A;  2WLY A;  1NWS A;  3G6M A;  2F2D A;  2E45 A;  3I6C A;  4Z2K A;  2Q5A A;  2YSB A;  3KAF A;  2A3E A;  2JXW A;  3OA5 A;  2PV1 A;  1J6Y A;  4XAK A;  3ARY A;  5HW7 A;  1VF8 A;  3O5D A;  1H0I A;  3WD2 A;  2RUR A;  1XRV A;  3RME A;  5HW6 A;  5HWB A;  4DRK A;  3O5G A;  2XP5 A;  1T11 A;  3PRD A;  1GOI A;  4DWS D;  5J6E A;  4ITZ A;  2Y8N B;  4Q22 A;  2XP4 A;  4IPX A;  2DSV A;  2WLZ A;  1E6P A;  1U79 A;  2RUC A;  4ODM A;  1D2K A;  2L2S A;  4QIB A;  4ODN A;  2KO7 A;  1ZB5 A;  1EIB A;  2DT0 A;  4MNL A;  3FAP A;  5HUA A;  2DG9 A;  5GQB A;  1ZU8 A;  1FKH A;  2M3O W;  2VCD A;  3WD1 A;  2XPB A;  1FKI A;  3B9A A;  3O5Q A;  4HBE A;  3FSB A;  2OFN A;  1FKL A;  2IF4 A;  3O5K A;  4FAP A;  4ODP A;  3ALF A;  3B7X A;  1HJW A;  5E62 A;  5HT1 A;  1LG1 A;  3PQH A;  3ARV A;  4J4O A;  4DRM A;  3FXY A;  1FD9 A;  4U86 A;  2PV2 A;  2WAE A;  1FLC A;  4U84 A;  3ARU A;  1E15 A;  2JV4 A;  4ZPV R;  1E6Z A;  1RD6 A;  3FY1 A;  3O5O A;  4DRI A;  4MNM A;  2A3C A;  1W9U A;  3IKD A;  2QRV A;  4Z2L A;  1JNS A;  4S3J A;  1TK7 A;  4Z2H A;  1W26 A;  2WM0 A;  4LAW A;  4NNR A;  2DJY A;  2DMV A;  1HXV A;  2XP7 A;  2FKE A;  4QZV B;  2MLZ A;  4QT2 A;  2DG4 A;  4ZPW R;  2AWG A;  3KCE A;  1D7J A;  2O92 A;  4ML4 A;  2ZR5 A;  3W4R A;  3CHE A;  4IQ2 A;  3ODK A;  1YAT A;  5DEZ A;  3CGM A;  3WL0 A;  3NRK A;  1R9H A;  4TW8 A;  3NTP A;  2M8J A;  1E6N A;  1WB0 A;  1NSG A;  1OWQ A;  3CNG A;  1Q6U A;  4ODO A;  4KQZ A;  4IQC A;  5DIV A;  5D75 A;  2JZV A;  3VAW A;  3AS3 A;  3MQG A;  3ALG A;  1XHG A;  5U47 A;  1ZL1 A;  2FAP A;  1Y0O A;  2KXQ A;  4ODQ A;  4TW6 A;  2YSG A;  3PR9 A;  5DIU A;  1PBK A;  2FDM A;  1W9P A;  4A0U A;  1QPF A;  4JFI A;  1LJY A;  4MSP A;  4DWS B;  3LE4 A;  4W5U A;  1UR9 A;  3CZ8 A;  2M08 A;  4GIV A;  1KFW A;  5BXJ A;  2RE3 A;  2RSE A;  2QF8 A;  4L3N A;  1NMV A;  4Z2I A;  3M7N A;  4W9P A;  4L72 B;  3RM8 A;  1GUV A;  1H0G A;  1BL4 A;  1FKK A;  1JNT A;  3JYM A;  5HW8 A;  4N19 A;  3KZ7 A;  1NH6 A;  2A3B A;  2N87 A;  2MDI A;  3AQU A;  1ZBK A;  1ZK6 A;  3LUO A;  3KAI A;  3ARZ A;  2DT3 A;  5DIT A;  5DF0 A;  4DWS A;  1X6L A;  1W1T A;  1ZBC A;  2VN1 A;  2A3A A;  3AS0 A;  3KAC A;  3MCB B;  3ARW A;  4GGQ A;  2MLX A;  4MAV A;  1Q6H A;  4R0X A;  1J4I A;  1FKG A;  3WL1 A;  2LJ4 A;  1EYM A;  1JMQ A;  1Q1C A;  3UQA A;  1NMW A;  3PRA A;  2ZQU A;  3B9D A;  4WKF A;  1D7I A;  2IUZ A;  2G41 A;  4JFJ A;  1LL4 A;  4U85 A;  2L4J A;  2ZAJ A;  1JNE A;  3FS8 A;  1ROU A;  1KT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...