3KAGA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 49
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kagA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kagA02
1D7JA 4REXA 1FKJA 1C9HA 3JYJA 4ODOA 1KT1A 2F21A 1EG4A 4QIBA 2YSFA 1FKBA 3O5OA 1TK7A 2ZQSA 4DROA 3CNGA 2L2SA 1ROUA 4GGQA 2KI3A 3O5EA 1J4HA 2MPHA 1A7XA 2M1IA 4DT4A 3CGNA 2OFNA 2DK1A 2K8IA 2RURA 4ODKA 3KCEA 1YATA 1N1AA 1P5QA 2LKNA 2DG4A 2M8JA 3UI4A 1O6WA 1JNTA 1FKSA 2JZVA 2N87A 4MGVA 3JYMA 5I98A 1YW5A 1F40A 3LUOA 4GIVA 2DJYA 3CGMA 4O2TA 2XP9A 2RQSA 2Q5AA 2ZAJA 4TX0A 4W9OA 3UQIA 5GPGA 4TW7A 2VN1A 3KAGA 3RGCA 3UI6A 5HUAA 5CQ2A 3NTPA 1FAPA 1Q6HA 2M8IA 2FAPA 1W26A 4E5RA 2PV3A 2E45A 4G2PA 5HWBA 1FJDA 2PPPA 4DRJA 1TCOC 2KO7A 2L4JA 3KAFA 2PPOA 3FAPA 1BKFA 3IHZA 4TNSA 4NNRA 2PBCA 2FKEA 4J4NA 4ODNA 3TCZA 3H9RB 5HT1A 4TYOA 2MLXA 4DIPA 1QZ2A 1ZCNA 3O5RA 4IQCA 1J4RA 1M5YA 2XP8A 2KGJA 3M85A 5J6EA 5HTGA 4ITZA 2YSGA 1EYMA 3B7XA 4JFLA 2LAJA 1Y0OA 2LJ4A 2LPVA 3NRKA 4DRIA 1L1PA 1BL4A 1WMVA 2M2AA 3IK8A 1D7IA 5HW8A 2RSEA 2Y78A 2YSHA 2ZQTA 3WH0A 3PA7A 3UF8A 2BA1A 2LGOA 3NI6A 3TC5A 1U79A 4BF8A 2RUCA 1EG3A 2ZR6A 1B6CA 1ROTA 2YSIA 2D9FA 1F8AB 2VCDA 2DMVA 4LAVA 5DITA 4DH0A 2DWVA 4DRHA 2XP6A 2RUQA 5B8IC 2MNTA 2MLYA 4MSPA 3O5LA 4IQ2A 3KACA 3KAHA 1NMVA 4G50A 1R9HA 4IPXA 1FKKA 3KZ7A 2XP5A 4FN2A 1HXVA 4ODPA 4ODQA 2JXWA 4U86A 4DRNA 4N19A 2MLZA 1EQ3A 2PPNA 3IKDA 4JFKA 2RUDA 3IKGA 3O5KA 1FKHA 2XPAA 2JV4A 1Q6UA 3EY6A 2ZQUA 1QPFA 4LAWA 1D7HA 2DG9A 2KE0A 3PRBA 1NMWA 4ODLA 4DRMA 2JX8A 3PRDA 2YSBA 2PV2A 1FKFA 2KR7A 2PV1A 2XP4A 1JNSA 1FKRA 5BXJA 1FKTA 4U84A 1FKDA 3UQBA 2ZR4A 2M3OW 3O5JA 2JMFA 4U85A 4JFIA 2UZ5A 1J4IA 3I6CA 2XPBA 1ZK6A 1Q6IA 1PINA 1K9QA 4W9PA 3GPKA 1Q1CA 2F4EA 2KFWA 4FAPA 2AWGA 1I5HW 1NSGA 1JVWA 2M08A 5DIVA 3ODKA 3UI5A 1PBKA 2DK7A 2ITKA 4DRKA 3O5MA 4ODMA 4TW6A 4LAXA 2DG3A 3RFWA 4LAYA 3O5QA 5HKGA 4J4OA 4R0XA 4ODRA 1T11A 1FKIA 3LE4A 1WR7A 4C02B 1K9RA 2XP3A 2ZQVA 2F2DA 5HWCA 1QPLA 4QT3A 3VAWA 3KADA 2KXQA 1FKLA 3M7NA 1FKGA 1J6YA 1FD9A 5D75A 2ZR5A 3O5PA 1KT0A 5HW6A 3O5IA 2EZ5W 3O5DA 2XP7A 2MF9A 3O5FA 1JMQA 5AHTA 2IF4A 4DZ3A 4JYSA 3MDYB 5DIUA 4TW8A 4QT2A 4DRQA 4DZ2A 3OOBA 3O5GA 5HW7A 1D6OA 4JFJA 2MDIA 4JFMA 3L4HA 3KAIA 3JXVA 4W9QA 3UQAA 4DRPA 3KABA 3TDBA 2RE3A
chains in the Genus database with same CATH superfamily
1FKJA 1C9HA 2F21A 2YSFA 4A0TA 2ZQSA 1HJWA 3MQHA 1EHNA 4GGQA 2KI3A 3O5EA 1JNDA 3B9AA 3CGNA 2OFNA 2DK1A 2RURA 4HARA 2LKNA 1O6WA 3MCBB 3CGMA 4W9OA 1LG1A 4TW7A 3KAGA 2WM0A 1UR9A 1WB0A 4WIWA 2M8IA 1W26A 4E5RA 3ARPA 1HKJA 5GPRA 1FJDA 1TCOC 2L4JA 1JNEA 1BKFA 5J6EA 4NNRA 4J4NA 4DIPA 3TCZA 3H9RB 4ZPTR 4WKAA 4ITZA 2B5UB 3B7XA 4UDMA 5JH8A 1WNOA 4L3NA 4DRIA 1L1PA 1BL4A 1WMVA 1E6NA 4ZPVR 2AOSA 4WKFA 4W5UA 4AY1A 3TC5A 1E6ZA 4LAVA 1B6CA 1ROTA 4DH0A 2DMVA 1XRVA 3AS1A 3ARUA 2MNTA 2MLYA 2DSUA 3WD1A 4Z2IA 4HBOA 3AQUA 1ZB5A 1W1TA 4FN2A 3KZ7A 2XP5A 2JXWA 1IX5A 2MLZA 2XPAA 2JV4A 2DG9A 2JX8A 1FFRA 2YSBA 3WD4A 2KR7A 4IT4A 3I6CA 1ZK6A 2EULA 1K9QA 1Q1CA 4L72B 1FFQA 1PBKA 2DK7A 4DRKA 4ODMA 1NWRA 5HKGA 4R0XA 1T11A 3LE4A 5HWCA 2ZQVA 1ZBCA 3WD0A 1WAWA 3PRAA 1J6YA 1KT0A 3B9DA 3RM9A 4DZ3A 4S3KA 4MNMA 4TW8A 1HKMA 1D6OA 2MDIA 3ARYA 3JXVA 3KAIA 3UQAA 1JCHB 4XAKA 3TDBA 2RE3A 4REXA 3G6MA 1X6NA 3RM8A 1ZL1A 1A7XA 4DWSC 3KCEA 1GOIA 1FKSA 2N87A 3JYMA 1YW5A 3LUOA 3FSBA 1TFVA 1KFWA 4O2TA 3UQIA 3RGCA 1W9VA 3UI6A 5CQ2A 3NTPA 2DSZA 1H0GA 1Q6HA 3BMBA 3MQGA 2PPPA 3ALFA 3FAPA 3IHZA 3ARWA 2DT0A 1W1PA 2PBCA 4R5EA 4S3JA 2MLXA 3O5RA 3OA5A 2YSGA 4WKHA 2LAJA 2LJ4A 2M2AA 4P8UA 3PA7A 3MCBA 3LKXB 2DT1A 2YSIA 5DITA 4DRHA 4MAVA 4MSPA 3O5LA 4IQ2A 1E6RA 3KAHA 4ML4A 4IPXA 1FKKA 1FLCA 4ODPA 4DRNA 3IKDA 2RUDA 3IKGA 1LL7A 1FKHA 3O5KA 1HKIA 1Q6UA 4LAWA 2ESCA 2PN0A 4LGXA 2KE0A 3PRBA 3AROA 4ODLA 1NWUA 3PRDA 2PV2A 2XP4A 1XHGA 1JNSA 1FKRA 5DEZA 4U84A 1FKDA 1W9PA 1LJYA 3UQBA 1O6IA 2ZR4A 2M3OW 4U85A 2UZ5A 3EIPA 2XPBA 4PTMA 2ETNA 1PINA 3GPKA 2F4EA 2YBTA 2YAJB 3ODKA 3UI5A 3O5MA 3RFWA 4LAYA 2OLHA 2WK2A 1GUVA 3ARQA 3FY1A 1W1YA 3WQVA 4C02B 1K9RA 2XP3A 1QPLA 1ZU8A 2KXQA 3W4RA 1FD9A 5D75A 1ZBVA 1E44A 3O5FA 1JMQA 1EIBA 3MDYB 5DIUA 4DRQA 4DZ2A 3OOBA 1GRJA 1RP5A 2A3CA 3L4HA 3CH9A 3JYJA 1KT1A 3GU0A 1EG4A 1FKBA 1TK7A 4DROA 1W9UA 2DSVA 2L2SA 4KQZA 2F23A 3ARSA 2MPHA 1GPFA 2M1IA 2K8IA 1ZBWA 1N1AA 2DG4A 2M8JA 3UI4A 5I98A 4MGVA 3ARXA 2IUZA 1RD6A 3B8SA 2DJYA 5DF0A 2RQSA 2ZAJA 5HUAA 1FAPA 3FSCA 4QZVB 2WLYA 4DRJA 2KO7A 4DRMA 5HW8A 4TNSA 5U47A 5GQBA 5HT1A 4TYOA 1ZCNA 4GLXA 1LL6A 4JFLA 2LPVA 2A3AA 1NH6A 1D7IA 2Y78A 3RMEA 2YSHA 2ZQTA 4MNKA 3UF8A 1HJXA 2LGOA 4HBEA 4BF8A 1U79A 5DO2A 4Z2KA 2ZR6A 3WD3A 2VCDA 2XP6A 2RUQA 5B8IC 4Q22A 3WIJA 3FXYA 1OGBA 1R9HA 2A3EA 3ARRA 4U86A 1W1VA 1EQ3A 2PPNA 4JFKA 3AS2A 4MTVA 1LQ0A 2DT2A 4MNJA 1D7HA 1HJVA 2WADA 5E5WA 2PV1A 5BXJA 1FKTA 2G41A 3CHCA 3QOKA 3CHEA 2JMFA 3O5JA 4JFIA 1J4IA 4W9PA 3ARTA 2KFWA 2WLZA 2AWGA 4WJXA 1NSGA 1JVWA 2M08A 2P4VA 5DIVA 1LL4A 2ITKA 1OGGA 4TW6A 4DWSB 1K9TA 1NWSA 3O5QA 4ODRA 2B31A 2F2DA 1NWTA 1HKKA 4KR0B 4QT3A 3VAWA 3KADA 5HBFA 3AS3A 2ZR5A 3O5IA 2EZ5W 3O5DA 2OWOA 2XP7A 2MF9A 2IF4A 5HW7A 4QT2A 4JFJA 1VF8A 1E6PA 4DRPA 3KABA 1TR8A 4ZS6A 1H0IA 5E65A 1D7JA 4ODOA 1UR8A 4QIBA 1E15A 3O5OA 1ZBKA 4P8VA 3CNGA 2PI6A 1ROUA 2YBUA 4Z2GA 1J4HA 3PR9A 2O92A 4DT4A 3G6LA 4ODKA 1YATA 5E64A 1P5QA 3RM4A 1JNTA 2JZVA 2QF8A 4WK9A 4GIVA 4IT6A 3ALGA 2XP9A 2Q5AA 4TX0A 5E66A 5GPGA 2VN1A 4URIA 4DWSD 5E62A 3AS0A 2Y8NB 3WL1A 2FAPA 2PV3A 2E45A 4G2PA 5HWBA 3KAFA 2PPOA 1F40A 1EDQA 4ODNA 2FKEA 1QZ2A 4IQCA 1J4RA 4DWSA 1M5YA 2XP8A 1ITXA 3M85A 2KGJA 5HTGA 4MPKA 3CHDA 1EYMA 1Y0OA 3NRKA 2WAEA 1SR0A 3IK8A 1CTNA 2RSEA 3WH0A 2DT3A 2BA1A 3NI6A 2RUCA 1EG3A 2D9FA 1F8AB 3BXWA 4A0UA 3B9EA 3CHFA 3LKXA 2DWVA 4NSBA 4Z2JA 3KACA 2FDMA 1NMVA 4G50A 1HXVA 4ODQA 4Q7NA 4N19A 4P8WA 3EY6A 2ZQUA 1QPFA 1NMWA 1FKFA 2QRVA 1LG2A 1E9LA 4MNLA 4ZPWR 3GTYX 3ARVA 3PQHA 1Q6IA 3WD2A 4FAPA 3FS8A 1I5HW 4Z2LA 1SYTA 2G8ZA 4LAXA 2DPEA 1OWQA 2DG3A 3WL0A 3WQWA 2DSWA 4P8XA 3ARZA 4J4OA 1FKIA 1WR7A 1X6LA 1FKLA 3M7NA 1FKGA 4Z2HA 3O5PA 5HW6A 5AHTA 4JYSA 4NZCA 3WKZA 2A3BA 3O5GA 4JFMA 3CZ8A 1D2KA 2O9OA 4W9QA
chains in the Genus database with same CATH topology
1FKJA 1C9HA 2F21A 2YSFA 4A0TA 2ZQSA 1HJWA 3MQHA 1EHNA 4GGQA 2KI3A 3O5EA 1JNDA 3B9AA 3CGNA 2OFNA 2DK1A 2RURA 4HARA 2LKNA 1O6WA 3MCBB 3CGMA 4W9OA 1LG1A 4TW7A 3KAGA 2WM0A 1UR9A 1WB0A 4WIWA 2M8IA 1W26A 4E5RA 3ARPA 1HKJA 5GPRA 1FJDA 1TCOC 2L4JA 1JNEA 1BKFA 5J6EA 4NNRA 4J4NA 4DIPA 3TCZA 3H9RB 4ZPTR 4WKAA 4ITZA 3B7XA 5JH8A 1WNOA 4L3NA 4DRIA 1L1PA 1BL4A 1WMVA 1E6NA 4ZPVR 2AOSA 4WKFA 4W5UA 4AY1A 3TC5A 1E6ZA 4LAVA 1B6CA 1ROTA 4DH0A 2DMVA 1XRVA 3AS1A 3ARUA 2MNTA 2MLYA 2DSUA 3WD1A 4Z2IA 4HBOA 3AQUA 1ZB5A 1W1TA 4FN2A 3KZ7A 2XP5A 2JXWA 1IX5A 2MLZA 2XPAA 2JV4A 2DG9A 2JX8A 1FFRA 2YSBA 3WD4A 2KR7A 4IT4A 3I6CA 1ZK6A 1K9QA 1Q1CA 4L72B 1FFQA 1PBKA 2DK7A 4DRKA 4ODMA 1NWRA 5HKGA 4R0XA 1T11A 3LE4A 5HWCA 2ZQVA 1ZBCA 3WD0A 1WAWA 3PRAA 1J6YA 1KT0A 3B9DA 3RM9A 4DZ3A 4S3KA 4MNMA 4TW8A 1HKMA 1D6OA 2MDIA 3ARYA 3JXVA 3KAIA 3UQAA 4XAKA 3TDBA 2RE3A 4REXA 3G6MA 1X6NA 3RM8A 1ZL1A 1A7XA 4DWSC 3KCEA 1GOIA 1FKSA 2N87A 3JYMA 1YW5A 3LUOA 3FSBA 1TFVA 1KFWA 4O2TA 3UQIA 3RGCA 1W9VA 3UI6A 5CQ2A 3NTPA 2DSZA 1H0GA 1Q6HA 3MQGA 2PPPA 3ALFA 3FAPA 3IHZA 3ARWA 2DT0A 1W1PA 2PBCA 4R5EA 4S3JA 2MLXA 3O5RA 3OA5A 2YSGA 4WKHA 2LAJA 2LJ4A 2M2AA 4P8UA 3PA7A 3MCBA 3LKXB 2DT1A 2YSIA 5DITA 4DRHA 4MAVA 4MSPA 3O5LA 4IQ2A 1E6RA 3KAHA 4ML4A 4IPXA 1FKKA 1FLCA 4ODPA 4DRNA 3IKDA 2RUDA 3IKGA 1LL7A 1FKHA 3O5KA 1HKIA 1Q6UA 4LAWA 2ESCA 4LGXA 2KE0A 3PRBA 3AROA 4ODLA 1NWUA 3PRDA 2PV2A 2XP4A 1XHGA 1JNSA 1FKRA 5DEZA 4U84A 1FKDA 1W9PA 1LJYA 3UQBA 1O6IA 2ZR4A 2M3OW 4U85A 2UZ5A 2XPBA 4PTMA 1PINA 3GPKA 2F4EA 2YBTA 2YAJB 3ODKA 3UI5A 3O5MA 3RFWA 4LAYA 2OLHA 2WK2A 1GUVA 3ARQA 3FY1A 1W1YA 3WQVA 4C02B 1K9RA 2XP3A 1QPLA 1ZU8A 2KXQA 3W4RA 1FD9A 5D75A 1ZBVA 3O5FA 1JMQA 1EIBA 3MDYB 5DIUA 4DRQA 4DZ2A 3OOBA 1RP5A 2A3CA 3L4HA 3CH9A 3JYJA 1KT1A 1EG4A 1FKBA 1TK7A 4DROA 1W9UA 2DSVA 2L2SA 4KQZA 3ARSA 2MPHA 1GPFA 2M1IA 2K8IA 1ZBWA 1N1AA 2DG4A 2M8JA 3UI4A 5I98A 4MGVA 3ARXA 2IUZA 1RD6A 3B8SA 2DJYA 5DF0A 2RQSA 2ZAJA 5HUAA 1FAPA 3FSCA 4QZVB 2WLYA 4DRJA 2KO7A 4DRMA 5HW8A 4TNSA 5U47A 5GQBA 5HT1A 4TYOA 1ZCNA 4GLXA 1LL6A 4JFLA 2LPVA 2A3AA 1NH6A 1D7IA 2Y78A 3RMEA 2YSHA 2ZQTA 4MNKA 3UF8A 1HJXA 2LGOA 4HBEA 4BF8A 1U79A 5DO2A 4Z2KA 2ZR6A 3WD3A 2VCDA 2XP6A 2RUQA 5B8IC 4Q22A 3WIJA 3FXYA 1OGBA 1R9HA 2A3EA 3ARRA 4U86A 1W1VA 1EQ3A 2PPNA 4JFKA 3AS2A 4MTVA 1LQ0A 2DT2A 4MNJA 1D7HA 1HJVA 2WADA 5E5WA 2PV1A 5BXJA 1FKTA 2G41A 3CHCA 3QOKA 3CHEA 2JMFA 3O5JA 4JFIA 1J4IA 4W9PA 3ARTA 2KFWA 2WLZA 2AWGA 4WJXA 1NSGA 1JVWA 2M08A 5DIVA 1LL4A 2ITKA 1OGGA 4TW6A 4DWSB 1K9TA 1NWSA 3O5QA 4ODRA 2B31A 2F2DA 1NWTA 1HKKA 4KR0B 4QT3A 3VAWA 3KADA 5HBFA 3AS3A 2ZR5A 3O5IA 2EZ5W 3O5DA 2OWOA 2XP7A 2MF9A 2IF4A 5HW7A 4QT2A 4JFJA 1VF8A 1E6PA 4DRPA 3KABA 1TR8A 4ZS6A 1H0IA 5E65A 1D7JA 4ODOA 1UR8A 4QIBA 1E15A 3O5OA 1ZBKA 4P8VA 3CNGA 2PI6A 1ROUA 2YBUA 4Z2GA 1J4HA 3PR9A 2O92A 4DT4A 3G6LA 4ODKA 1YATA 5E64A 1P5QA 3RM4A 1JNTA 2JZVA 2QF8A 4WK9A 4GIVA 4IT6A 3ALGA 2XP9A 2Q5AA 4TX0A 5E66A 5GPGA 2VN1A 4URIA 4DWSD 5E62A 3AS0A 2Y8NB 3WL1A 2FAPA 2PV3A 2E45A 4G2PA 5HWBA 3KAFA 2PPOA 1F40A 1EDQA 4ODNA 2FKEA 1QZ2A 4IQCA 1J4RA 4DWSA 1M5YA 2XP8A 1ITXA 3M85A 2KGJA 5HTGA 4MPKA 3CHDA 1EYMA 1Y0OA 3NRKA 2WAEA 1SR0A 3IK8A 1CTNA 2RSEA 3WH0A 2DT3A 2BA1A 3NI6A 2RUCA 1EG3A 2D9FA 1F8AB 3BXWA 4A0UA 3B9EA 3CHFA 3LKXA 2DWVA 4NSBA 4Z2JA 3KACA 2FDMA 1NMVA 4G50A 1HXVA 4ODQA 4Q7NA 4N19A 4P8WA 3EY6A 2ZQUA 1QPFA 1NMWA 1FKFA 2QRVA 1LG2A 1E9LA 4MNLA 4ZPWR 3ARVA 3PQHA 1Q6IA 3WD2A 4FAPA 3FS8A 1I5HW 4Z2LA 1SYTA 2G8ZA 4LAXA 2DPEA 1OWQA 2DG3A 3WL0A 3WQWA 2DSWA 4P8XA 3ARZA 4J4OA 1FKIA 1WR7A 1X6LA 1FKLA 3M7NA 1FKGA 4Z2HA 3O5PA 5HW6A 5AHTA 4JYSA 4NZCA 3WKZA 2A3BA 3O5GA 4JFMA 3CZ8A 1D2KA 2O9OA 4W9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7J A;  4REX A;  1FKJ A;  1C9H A;  3JYJ A;  4ODO A;  1KT1 A;  2F21 A;  1EG4 A;  4QIB A;  2YSF A;  1FKB A;  3O5O A;  1TK7 A;  2ZQS A;  4DRO A;  3CNG A;  2L2S A;  1ROU A;  4GGQ A;  2KI3 A;  3O5E A;  1J4H A;  2MPH A;  1A7X A;  2M1I A;  4DT4 A;  3CGN A;  2OFN A;  2DK1 A;  2K8I A;  2RUR A;  4ODK A;  3KCE A;  1YAT A;  1N1A A;  1P5Q A;  2LKN A;  2DG4 A;  2M8J A;  3UI4 A;  1O6W A;  1JNT A;  1FKS A;  2JZV A;  2N87 A;  4MGV A;  3JYM A;  5I98 A;  1YW5 A;  1F40 A;  3LUO A;  4GIV A;  2DJY A;  3CGM A;  4O2T A;  2XP9 A;  2RQS A;  2Q5A A;  2ZAJ A;  4TX0 A;  4W9O A;  3UQI A;  5GPG A;  4TW7 A;  2VN1 A;  3KAG A;  3RGC A;  3UI6 A;  5HUA A;  5CQ2 A;  3NTP A;  1FAP A;  1Q6H A;  2M8I A;  2FAP A;  1W26 A;  4E5R A;  2PV3 A;  2E45 A;  4G2P A;  5HWB A;  1FJD A;  2PPP A;  4DRJ A;  1TCO C;  2KO7 A;  2L4J A;  3KAF A;  2PPO A;  3FAP A;  1BKF A;  3IHZ A;  4TNS A;  4NNR A;  2PBC A;  2FKE A;  4J4N A;  4ODN A;  3TCZ A;  3H9R B;  5HT1 A;  4TYO A;  2MLX A;  4DIP A;  1QZ2 A;  1ZCN A;  3O5R A;  4IQC A;  1J4R A;  1M5Y A;  2XP8 A;  2KGJ A;  3M85 A;  5J6E A;  5HTG A;  4ITZ A;  2YSG A;  1EYM A;  3B7X A;  4JFL A;  2LAJ A;  1Y0O A;  2LJ4 A;  2LPV A;  3NRK A;  4DRI A;  1L1P A;  1BL4 A;  1WMV A;  2M2A A;  3IK8 A;  1D7I A;  5HW8 A;  2RSE A;  2Y78 A;  2YSH A;  2ZQT A;  3WH0 A;  3PA7 A;  3UF8 A;  2BA1 A;  2LGO A;  3NI6 A;  3TC5 A;  1U79 A;  4BF8 A;  2RUC A;  1EG3 A;  2ZR6 A;  1B6C A;  1ROT A;  2YSI A;  2D9F A;  1F8A B;  2VCD A;  2DMV A;  4LAV A;  5DIT A;  4DH0 A;  2DWV A;  4DRH A;  2XP6 A;  2RUQ A;  5B8I C;  2MNT A;  2MLY A;  4MSP A;  3O5L A;  4IQ2 A;  3KAC A;  3KAH A;  1NMV A;  4G50 A;  1R9H A;  4IPX A;  1FKK A;  3KZ7 A;  2XP5 A;  4FN2 A;  1HXV A;  4ODP A;  4ODQ A;  2JXW A;  4U86 A;  4DRN A;  4N19 A;  2MLZ A;  1EQ3 A;  2PPN A;  3IKD A;  4JFK A;  2RUD A;  3IKG A;  3O5K A;  1FKH A;  2XPA A;  2JV4 A;  1Q6U A;  3EY6 A;  2ZQU A;  1QPF A;  4LAW A;  1D7H A;  2DG9 A;  2KE0 A;  3PRB A;  1NMW A;  4ODL A;  4DRM A;  2JX8 A;  3PRD A;  2YSB A;  2PV2 A;  1FKF A;  2KR7 A;  2PV1 A;  2XP4 A;  1JNS A;  1FKR A;  5BXJ A;  1FKT A;  4U84 A;  1FKD A;  3UQB A;  2ZR4 A;  2M3O W;  3O5J A;  2JMF A;  4U85 A;  4JFI A;  2UZ5 A;  1J4I A;  3I6C A;  2XPB A;  1ZK6 A;  1Q6I A;  1PIN A;  1K9Q A;  4W9P A;  3GPK A;  1Q1C A;  2F4E A;  2KFW A;  4FAP A;  2AWG A;  1I5H W;  1NSG A;  1JVW A;  2M08 A;  5DIV A;  3ODK A;  3UI5 A;  1PBK A;  2DK7 A;  2ITK A;  4DRK A;  3O5M A;  4ODM A;  4TW6 A;  4LAX A;  2DG3 A;  3RFW A;  4LAY A;  3O5Q A;  5HKG A;  4J4O A;  4R0X A;  4ODR A;  1T11 A;  1FKI A;  3LE4 A;  1WR7 A;  4C02 B;  1K9R A;  2XP3 A;  2ZQV A;  2F2D A;  5HWC A;  1QPL A;  4QT3 A;  3VAW A;  3KAD A;  2KXQ A;  1FKL A;  3M7N A;  1FKG A;  1J6Y A;  1FD9 A;  5D75 A;  2ZR5 A;  3O5P A;  1KT0 A;  5HW6 A;  3O5I A;  2EZ5 W;  3O5D A;  2XP7 A;  2MF9 A;  3O5F A;  1JMQ A;  5AHT A;  2IF4 A;  4DZ3 A;  4JYS A;  3MDY B;  5DIU A;  4TW8 A;  4QT2 A;  4DRQ A;  4DZ2 A;  3OOB A;  3O5G A;  5HW7 A;  1D6O A;  4JFJ A;  2MDI A;  4JFM A;  3L4H A;  3KAI A;  3JXV A;  4W9Q A;  3UQA A;  4DRP A;  3KAB A;  3TDB A;  2RE3 A; 
#chains in the Genus database with same CATH topology
 1FKJ A;  1C9H A;  2F21 A;  2YSF A;  4A0T A;  2ZQS A;  1HJW A;  3MQH A;  1EHN A;  4GGQ A;  2KI3 A;  3O5E A;  1JND A;  3B9A A;  3CGN A;  2OFN A;  2DK1 A;  2RUR A;  4HAR A;  2LKN A;  1O6W A;  3MCB B;  3CGM A;  4W9O A;  1LG1 A;  4TW7 A;  3KAG A;  2WM0 A;  1UR9 A;  1WB0 A;  4WIW A;  2M8I A;  1W26 A;  4E5R A;  3ARP A;  1HKJ A;  5GPR A;  1FJD A;  1TCO C;  2L4J A;  1JNE A;  1BKF A;  5J6E A;  4NNR A;  4J4N A;  4DIP A;  3TCZ A;  3H9R B;  4ZPT R;  4WKA A;  4ITZ A;  2B5U B;  3B7X A;  4UDM A;  5JH8 A;  1WNO A;  4L3N A;  4DRI A;  1L1P A;  1BL4 A;  1WMV A;  1E6N A;  4ZPV R;  2AOS A;  4WKF A;  4W5U A;  4AY1 A;  3TC5 A;  1E6Z A;  4LAV A;  1B6C A;  1ROT A;  4DH0 A;  2DMV A;  1XRV A;  3AS1 A;  3ARU A;  2MNT A;  2MLY A;  2DSU A;  3WD1 A;  4Z2I A;  4HBO A;  3AQU A;  1ZB5 A;  1W1T A;  4FN2 A;  3KZ7 A;  2XP5 A;  2JXW A;  1IX5 A;  2MLZ A;  2XPA A;  2JV4 A;  2DG9 A;  2JX8 A;  1FFR A;  2YSB A;  3WD4 A;  2KR7 A;  4IT4 A;  3I6C A;  1ZK6 A;  2EUL A;  1K9Q A;  1Q1C A;  4L72 B;  1FFQ A;  1PBK A;  2DK7 A;  4DRK A;  4ODM A;  1NWR A;  5HKG A;  4R0X A;  1T11 A;  3LE4 A;  5HWC A;  2ZQV A;  1ZBC A;  3WD0 A;  1WAW A;  3PRA A;  1J6Y A;  1KT0 A;  3B9D A;  3RM9 A;  4DZ3 A;  4S3K A;  4MNM A;  4TW8 A;  1HKM A;  1D6O A;  2MDI A;  3ARY A;  3JXV A;  3KAI A;  3UQA A;  1JCH B;  4XAK A;  3TDB A;  2RE3 A;  4REX A;  3G6M A;  1X6N A;  3RM8 A;  1ZL1 A;  1A7X A;  4DWS C;  3KCE A;  1GOI A;  1FKS A;  2N87 A;  3JYM A;  1YW5 A;  3LUO A;  3FSB A;  1TFV A;  1KFW A;  4O2T A;  3UQI A;  3RGC A;  1W9V A;  3UI6 A;  5CQ2 A;  3NTP A;  2DSZ A;  1H0G A;  1Q6H A;  3BMB A;  3MQG A;  2PPP A;  3ALF A;  3FAP A;  3IHZ A;  3ARW A;  2DT0 A;  1W1P A;  2PBC A;  4R5E A;  4S3J A;  2MLX A;  3O5R A;  3OA5 A;  2YSG A;  4WKH A;  2LAJ A;  2LJ4 A;  2M2A A;  4P8U A;  3PA7 A;  3MCB A;  3LKX B;  2DT1 A;  2YSI A;  5DIT A;  4DRH A;  4MAV A;  4MSP A;  3O5L A;  4IQ2 A;  1E6R A;  3KAH A;  4ML4 A;  4IPX A;  1FKK A;  1FLC A;  4ODP A;  4DRN A;  3IKD A;  2RUD A;  3IKG A;  1LL7 A;  1FKH A;  3O5K A;  1HKI A;  1Q6U A;  4LAW A;  2ESC A;  2PN0 A;  4LGX A;  2KE0 A;  3PRB A;  3ARO A;  4ODL A;  1NWU A;  3PRD A;  2PV2 A;  2XP4 A;  1XHG A;  1JNS A;  1FKR A;  5DEZ A;  4U84 A;  1FKD A;  1W9P A;  1LJY A;  3UQB A;  1O6I A;  2ZR4 A;  2M3O W;  4U85 A;  2UZ5 A;  3EIP A;  2XPB A;  4PTM A;  2ETN A;  1PIN A;  3GPK A;  2F4E A;  2YBT A;  2YAJ B;  3ODK A;  3UI5 A;  3O5M A;  3RFW A;  4LAY A;  2OLH A;  2WK2 A;  1GUV A;  3ARQ A;  3FY1 A;  1W1Y A;  3WQV A;  4C02 B;  1K9R A;  2XP3 A;  1QPL A;  1ZU8 A;  2KXQ A;  3W4R A;  1FD9 A;  5D75 A;  1ZBV A;  1E44 A;  3O5F A;  1JMQ A;  1EIB A;  3MDY B;  5DIU A;  4DRQ A;  4DZ2 A;  3OOB A;  1GRJ A;  1RP5 A;  2A3C A;  3L4H A;  3CH9 A;  3JYJ A;  1KT1 A;  3GU0 A;  1EG4 A;  1FKB A;  1TK7 A;  4DRO A;  1W9U A;  2DSV A;  2L2S A;  4KQZ A;  2F23 A;  3ARS A;  2MPH A;  1GPF A;  2M1I A;  2K8I A;  1ZBW A;  1N1A A;  2DG4 A;  2M8J A;  3UI4 A;  5I98 A;  4MGV A;  3ARX A;  2IUZ A;  1RD6 A;  3B8S A;  2DJY A;  5DF0 A;  2RQS A;  2ZAJ A;  5HUA A;  1FAP A;  3FSC A;  4QZV B;  2WLY A;  4DRJ A;  2KO7 A;  4DRM A;  5HW8 A;  4TNS A;  5U47 A;  5GQB A;  5HT1 A;  4TYO A;  1ZCN A;  4GLX A;  1LL6 A;  4JFL A;  2LPV A;  2A3A A;  1NH6 A;  1D7I A;  2Y78 A;  3RME A;  2YSH A;  2ZQT A;  4MNK A;  3UF8 A;  1HJX A;  2LGO A;  4HBE A;  4BF8 A;  1U79 A;  5DO2 A;  4Z2K A;  2ZR6 A;  3WD3 A;  2VCD A;  2XP6 A;  2RUQ A;  5B8I C;  4Q22 A;  3WIJ A;  3FXY A;  1OGB A;  1R9H A;  2A3E A;  3ARR A;  4U86 A;  1W1V A;  1EQ3 A;  2PPN A;  4JFK A;  3AS2 A;  4MTV A;  1LQ0 A;  2DT2 A;  4MNJ A;  1D7H A;  1HJV A;  2WAD A;  5E5W A;  2PV1 A;  5BXJ A;  1FKT A;  2G41 A;  3CHC A;  3QOK A;  3CHE A;  2JMF A;  3O5J A;  4JFI A;  1J4I A;  4W9P A;  3ART A;  2KFW A;  2WLZ A;  2AWG A;  4WJX A;  1NSG A;  1JVW A;  2M08 A;  2P4V A;  5DIV A;  1LL4 A;  2ITK A;  1OGG A;  4TW6 A;  4DWS B;  1K9T A;  1NWS A;  3O5Q A;  4ODR A;  2B31 A;  2F2D A;  1NWT A;  1HKK A;  4KR0 B;  4QT3 A;  3VAW A;  3KAD A;  5HBF A;  3AS3 A;  2ZR5 A;  3O5I A;  2EZ5 W;  3O5D A;  2OWO A;  2XP7 A;  2MF9 A;  2IF4 A;  5HW7 A;  4QT2 A;  4JFJ A;  1VF8 A;  1E6P A;  4DRP A;  3KAB A;  1TR8 A;  4ZS6 A;  1H0I A;  5E65 A;  1D7J A;  4ODO A;  1UR8 A;  4QIB A;  1E15 A;  3O5O A;  1ZBK A;  4P8V A;  3CNG A;  2PI6 A;  1ROU A;  2YBU A;  4Z2G A;  1J4H A;  3PR9 A;  2O92 A;  4DT4 A;  3G6L A;  4ODK A;  1YAT A;  5E64 A;  1P5Q A;  3RM4 A;  1JNT A;  2JZV A;  2QF8 A;  4WK9 A;  4GIV A;  4IT6 A;  3ALG A;  2XP9 A;  2Q5A A;  4TX0 A;  5E66 A;  5GPG A;  2VN1 A;  4URI A;  4DWS D;  5E62 A;  3AS0 A;  2Y8N B;  3WL1 A;  2FAP A;  2PV3 A;  2E45 A;  4G2P A;  5HWB A;  3KAF A;  2PPO A;  1F40 A;  1EDQ A;  4ODN A;  2FKE A;  1QZ2 A;  4IQC A;  1J4R A;  4DWS A;  1M5Y A;  2XP8 A;  1ITX A;  3M85 A;  2KGJ A;  5HTG A;  4MPK A;  3CHD A;  1EYM A;  1Y0O A;  3NRK A;  2WAE A;  1SR0 A;  3IK8 A;  1CTN A;  2RSE A;  3WH0 A;  2DT3 A;  2BA1 A;  3NI6 A;  2RUC A;  1EG3 A;  2D9F A;  1F8A B;  3BXW A;  4A0U A;  3B9E A;  3CHF A;  3LKX A;  2DWV A;  4NSB A;  4Z2J A;  3KAC A;  2FDM A;  1NMV A;  4G50 A;  1HXV A;  4ODQ A;  4Q7N A;  4N19 A;  4P8W A;  3EY6 A;  2ZQU A;  1QPF A;  1NMW A;  1FKF A;  2QRV A;  1LG2 A;  1E9L A;  4MNL A;  4ZPW R;  3GTY X;  3ARV A;  3PQH A;  1Q6I A;  3WD2 A;  4FAP A;  3FS8 A;  1I5H W;  4Z2L A;  1SYT A;  2G8Z A;  4LAX A;  2DPE A;  1OWQ A;  2DG3 A;  3WL0 A;  3WQW A;  2DSW A;  4P8X A;  3ARZ A;  4J4O A;  1FKI A;  1WR7 A;  1X6L A;  1FKL A;  3M7N A;  1FKG A;  4Z2H A;  3O5P A;  5HW6 A;  5AHT A;  4JYS A;  4NZC A;  3WKZ A;  2A3B A;  3O5G A;  4JFM A;  3CZ8 A;  1D2K A;  2O9O A;  4W9Q A; 
#chains in the Genus database with same CATH homology
 1FKJ A;  1C9H A;  2F21 A;  2YSF A;  4A0T A;  2ZQS A;  1HJW A;  3MQH A;  1EHN A;  4GGQ A;  2KI3 A;  3O5E A;  1JND A;  3B9A A;  3CGN A;  2OFN A;  2DK1 A;  2RUR A;  4HAR A;  2LKN A;  1O6W A;  3MCB B;  3CGM A;  4W9O A;  1LG1 A;  4TW7 A;  3KAG A;  2WM0 A;  1UR9 A;  1WB0 A;  4WIW A;  2M8I A;  1W26 A;  4E5R A;  3ARP A;  1HKJ A;  5GPR A;  1FJD A;  1TCO C;  2L4J A;  1JNE A;  1BKF A;  5J6E A;  4NNR A;  4J4N A;  4DIP A;  3TCZ A;  3H9R B;  4ZPT R;  4WKA A;  4ITZ A;  3B7X A;  5JH8 A;  1WNO A;  4L3N A;  4DRI A;  1L1P A;  1BL4 A;  1WMV A;  1E6N A;  4ZPV R;  2AOS A;  4WKF A;  4W5U A;  4AY1 A;  3TC5 A;  1E6Z A;  4LAV A;  1B6C A;  1ROT A;  4DH0 A;  2DMV A;  1XRV A;  3AS1 A;  3ARU A;  2MNT A;  2MLY A;  2DSU A;  3WD1 A;  4Z2I A;  4HBO A;  3AQU A;  1ZB5 A;  1W1T A;  4FN2 A;  3KZ7 A;  2XP5 A;  2JXW A;  1IX5 A;  2MLZ A;  2XPA A;  2JV4 A;  2DG9 A;  2JX8 A;  1FFR A;  2YSB A;  3WD4 A;  2KR7 A;  4IT4 A;  3I6C A;  1ZK6 A;  1K9Q A;  1Q1C A;  4L72 B;  1FFQ A;  1PBK A;  2DK7 A;  4DRK A;  4ODM A;  1NWR A;  5HKG A;  4R0X A;  1T11 A;  3LE4 A;  5HWC A;  2ZQV A;  1ZBC A;  3WD0 A;  1WAW A;  3PRA A;  1J6Y A;  1KT0 A;  3B9D A;  3RM9 A;  4DZ3 A;  4S3K A;  4MNM A;  4TW8 A;  1HKM A;  1D6O A;  2MDI A;  3ARY A;  3JXV A;  3KAI A;  3UQA A;  4XAK A;  3TDB A;  2RE3 A;  4REX A;  3G6M A;  1X6N A;  3RM8 A;  1ZL1 A;  1A7X A;  4DWS C;  3KCE A;  1GOI A;  1FKS A;  2N87 A;  3JYM A;  1YW5 A;  3LUO A;  3FSB A;  1TFV A;  1KFW A;  4O2T A;  3UQI A;  3RGC A;  1W9V A;  3UI6 A;  5CQ2 A;  3NTP A;  2DSZ A;  1H0G A;  1Q6H A;  3MQG A;  2PPP A;  3ALF A;  3FAP A;  3IHZ A;  3ARW A;  2DT0 A;  1W1P A;  2PBC A;  4R5E A;  4S3J A;  2MLX A;  3O5R A;  3OA5 A;  2YSG A;  4WKH A;  2LAJ A;  2LJ4 A;  2M2A A;  4P8U A;  3PA7 A;  3MCB A;  3LKX B;  2DT1 A;  2YSI A;  5DIT A;  4DRH A;  4MAV A;  4MSP A;  3O5L A;  4IQ2 A;  1E6R A;  3KAH A;  4ML4 A;  4IPX A;  1FKK A;  1FLC A;  4ODP A;  4DRN A;  3IKD A;  2RUD A;  3IKG A;  1LL7 A;  1FKH A;  3O5K A;  1HKI A;  1Q6U A;  4LAW A;  2ESC A;  4LGX A;  2KE0 A;  3PRB A;  3ARO A;  4ODL A;  1NWU A;  3PRD A;  2PV2 A;  2XP4 A;  1XHG A;  1JNS A;  1FKR A;  5DEZ A;  4U84 A;  1FKD A;  1W9P A;  1LJY A;  3UQB A;  1O6I A;  2ZR4 A;  2M3O W;  4U85 A;  2UZ5 A;  2XPB A;  4PTM A;  1PIN A;  3GPK A;  2F4E A;  2YBT A;  2YAJ B;  3ODK A;  3UI5 A;  3O5M A;  3RFW A;  4LAY A;  2OLH A;  2WK2 A;  1GUV A;  3ARQ A;  3FY1 A;  1W1Y A;  3WQV A;  4C02 B;  1K9R A;  2XP3 A;  1QPL A;  1ZU8 A;  2KXQ A;  3W4R A;  1FD9 A;  5D75 A;  1ZBV A;  3O5F A;  1JMQ A;  1EIB A;  3MDY B;  5DIU A;  4DRQ A;  4DZ2 A;  3OOB A;  1RP5 A;  2A3C A;  3L4H A;  3CH9 A;  3JYJ A;  1KT1 A;  1EG4 A;  1FKB A;  1TK7 A;  4DRO A;  1W9U A;  2DSV A;  2L2S A;  4KQZ A;  3ARS A;  2MPH A;  1GPF A;  2M1I A;  2K8I A;  1ZBW A;  1N1A A;  2DG4 A;  2M8J A;  3UI4 A;  5I98 A;  4MGV A;  3ARX A;  2IUZ A;  1RD6 A;  3B8S A;  2DJY A;  5DF0 A;  2RQS A;  2ZAJ A;  5HUA A;  1FAP A;  3FSC A;  4QZV B;  2WLY A;  4DRJ A;  2KO7 A;  4DRM A;  5HW8 A;  4TNS A;  5U47 A;  5GQB A;  5HT1 A;  4TYO A;  1ZCN A;  4GLX A;  1LL6 A;  4JFL A;  2LPV A;  2A3A A;  1NH6 A;  1D7I A;  2Y78 A;  3RME A;  2YSH A;  2ZQT A;  4MNK A;  3UF8 A;  1HJX A;  2LGO A;  4HBE A;  4BF8 A;  1U79 A;  5DO2 A;  4Z2K A;  2ZR6 A;  3WD3 A;  2VCD A;  2XP6 A;  2RUQ A;  5B8I C;  4Q22 A;  3WIJ A;  3FXY A;  1OGB A;  1R9H A;  2A3E A;  3ARR A;  4U86 A;  1W1V A;  1EQ3 A;  2PPN A;  4JFK A;  3AS2 A;  4MTV A;  1LQ0 A;  2DT2 A;  4MNJ A;  1D7H A;  1HJV A;  2WAD A;  5E5W A;  2PV1 A;  5BXJ A;  1FKT A;  2G41 A;  3CHC A;  3QOK A;  3CHE A;  2JMF A;  3O5J A;  4JFI A;  1J4I A;  4W9P A;  3ART A;  2KFW A;  2WLZ A;  2AWG A;  4WJX A;  1NSG A;  1JVW A;  2M08 A;  5DIV A;  1LL4 A;  2ITK A;  1OGG A;  4TW6 A;  4DWS B;  1K9T A;  1NWS A;  3O5Q A;  4ODR A;  2B31 A;  2F2D A;  1NWT A;  1HKK A;  4KR0 B;  4QT3 A;  3VAW A;  3KAD A;  5HBF A;  3AS3 A;  2ZR5 A;  3O5I A;  2EZ5 W;  3O5D A;  2OWO A;  2XP7 A;  2MF9 A;  2IF4 A;  5HW7 A;  4QT2 A;  4JFJ A;  1VF8 A;  1E6P A;  4DRP A;  3KAB A;  1TR8 A;  4ZS6 A;  1H0I A;  5E65 A;  1D7J A;  4ODO A;  1UR8 A;  4QIB A;  1E15 A;  3O5O A;  1ZBK A;  4P8V A;  3CNG A;  2PI6 A;  1ROU A;  2YBU A;  4Z2G A;  1J4H A;  3PR9 A;  2O92 A;  4DT4 A;  3G6L A;  4ODK A;  1YAT A;  5E64 A;  1P5Q A;  3RM4 A;  1JNT A;  2JZV A;  2QF8 A;  4WK9 A;  4GIV A;  4IT6 A;  3ALG A;  2XP9 A;  2Q5A A;  4TX0 A;  5E66 A;  5GPG A;  2VN1 A;  4URI A;  4DWS D;  5E62 A;  3AS0 A;  2Y8N B;  3WL1 A;  2FAP A;  2PV3 A;  2E45 A;  4G2P A;  5HWB A;  3KAF A;  2PPO A;  1F40 A;  1EDQ A;  4ODN A;  2FKE A;  1QZ2 A;  4IQC A;  1J4R A;  4DWS A;  1M5Y A;  2XP8 A;  1ITX A;  3M85 A;  2KGJ A;  5HTG A;  4MPK A;  3CHD A;  1EYM A;  1Y0O A;  3NRK A;  2WAE A;  1SR0 A;  3IK8 A;  1CTN A;  2RSE A;  3WH0 A;  2DT3 A;  2BA1 A;  3NI6 A;  2RUC A;  1EG3 A;  2D9F A;  1F8A B;  3BXW A;  4A0U A;  3B9E A;  3CHF A;  3LKX A;  2DWV A;  4NSB A;  4Z2J A;  3KAC A;  2FDM A;  1NMV A;  4G50 A;  1HXV A;  4ODQ A;  4Q7N A;  4N19 A;  4P8W A;  3EY6 A;  2ZQU A;  1QPF A;  1NMW A;  1FKF A;  2QRV A;  1LG2 A;  1E9L A;  4MNL A;  4ZPW R;  3ARV A;  3PQH A;  1Q6I A;  3WD2 A;  4FAP A;  3FS8 A;  1I5H W;  4Z2L A;  1SYT A;  2G8Z A;  4LAX A;  2DPE A;  1OWQ A;  2DG3 A;  3WL0 A;  3WQW A;  2DSW A;  4P8X A;  3ARZ A;  4J4O A;  1FKI A;  1WR7 A;  1X6L A;  1FKL A;  3M7N A;  1FKG A;  4Z2H A;  3O5P A;  5HW6 A;  5AHT A;  4JYS A;  4NZC A;  3WKZ A;  2A3B A;  3O5G A;  4JFM A;  3CZ8 A;  1D2K A;  2O9O A;  4W9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...