3KAGA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 49
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kagA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kagA02
4JFLA 3O5PA 3KABA 5GPGA 1ROTA 2JZVA 2PBCA 2Q5AA 3KAFA 2LPVA 1P5QA 1NSGA 1QZ2A 4IQCA 1QPFA 2MLZA 1W26A 1R9HA 5BXJA 1J4IA 3PA7A 4C02B 1PBKA 2F4EA 2RURA 1KT0A 4JYSA 4U84A 4ODPA 4TNSA 1F8AB 3LUOA 4DROA 4DZ3A 2JXWA 2PPNA 3M85A 1EG4A 3B7XA 3CGMA 4TW8A 4W9OA 1Q6IA 3CNGA 3JYMA 4QT3A 4IPXA 3UQBA 1FKKA 3H9RB 5AHTA 1YATA 1FKBA 1EG3A 4R0XA 2YSFA 4TYOA 4QT2A 5DIUA 4ODQA 4LAVA 3KZ7A 2DG9A 4U85A 4DH0A 3MDYB 1FKRA 4QIBA 4N19A 1Q6UA 1M5YA 4DIPA 2XP4A 2PV1A 4ODKA 1FKSA 1EQ3A 2RUDA 4LAXA 2LJ4A 4J4NA 3NRKA 1K9QA 1QPLA 4IQ2A 4FAPA 2MLXA 4ODRA 1I5HW 3RFWA 5DIVA 2PV2A 2PPPA 4TW6A 4DRIA 2DG4A 2L4JA 3KAHA 4U86A 3UI5A 1F40A 1D7IA 4BF8A 1C9HA 5HWBA 1FKIA 5DITA 3IKGA 4DRKA 4DRQA 1D7HA 3JXVA 5HWCA 2YSBA 3FAPA 1KT1A 2DWVA 2ZQSA 4G50A 3PRBA 4TX0A 2KGJA 3O5EA 2KI3A 2DK1A 4W9QA 4DRJA 2M3OW 4TW7A 1JVWA 3UF8A 5HW7A 5CQ2A 3IKDA 1FKFA 5HUAA 2XPBA 3OOBA 3O5GA 4JFJA 2JX8A 2RUQA 3O5MA 2F21A 2AWGA 2XP9A 1FKJA 3TCZA 1WMVA 3KACA 4O2TA 2KFWA 1N1AA 3VAWA 3M7NA 4DRHA 2XP7A 2XPAA 1BKFA 2MLYA 5HT1A 3O5IA 2L2SA 1FD9A 2JV4A 2DJYA 1D7JA 1JNTA 4DZ2A 4GIVA 1FKHA 2M8IA 3O5OA 1ROUA 2OFNA 2E45A 3NTPA 5I98A 4REXA 2ZR5A 2PPOA 2YSIA 2DMVA 1ZCNA 2MF9A 2K8IA 2KE0A 2M8JA 3NI6A 2DG3A 3PRDA 1HXVA 1PINA 4ODLA 2ZR6A 5HW8A 3KAGA 2LKNA 1Q6HA 4JFIA 2MNTA 2MPHA 4DRMA 2Y78A 4G2PA 3O5JA 3O5LA 3KCEA 4ODOA 2M08A 5HW6A 1J4RA 3UQAA 3O5DA 2KO7A 1FKGA 2ZQUA 1K9RA 2ITKA 2F2DA 2UZ5A 2XP8A 2EZ5W 3ODKA 2VN1A 1JNSA 2LAJA 2JMFA 2N87A 3JYJA 2YSHA 4LAYA 3UQIA 3WH0A 3LE4A 3O5FA 3L4HA 2FKEA 4GGQA 2RQSA 2ZQVA 1NMVA 2RE3A 4DT4A 4JFMA 1TK7A 2ZQTA 2XP6A 2KXQA 2LGOA 5B8IC 1T11A 2VCDA 4DRNA 1YW5A 3UI4A 1O6WA 1Q1CA 1NMWA 4ODNA 3TDBA 1JMQA 1ZK6A 2PV3A 4LAWA 2XP3A 3RGCA 3TC5A 3IHZA 2XP5A 1FKLA 3I6CA 2BA1A 1A7XA 4ITZA 3CGNA 2MDIA 2RSEA 2YSGA 2D9FA 2M2AA 5J6EA 4W9PA 1J4HA 2KR7A 4NNRA 3KADA 5HKGA 1FJDA 5D75A 1EYMA 4J4OA 4DRPA 3O5KA 2ZAJA 2M1IA 3IK8A 1Y0OA 4ODMA 2RUCA 4JFKA 1D6OA 3UI6A 4MGVA 3EY6A 3GPKA 1TCOC 4MSPA 4E5RA 2DK7A 1FKDA 2ZR4A 1B6CA 2IF4A 2FAPA 3O5RA 1FKTA 1J6YA 5HTGA 1U79A 1FAPA 3O5QA 1L1PA 4FN2A 1WR7A 3KAIA 1BL4A
chains in the Genus database with same CATH superfamily
4JFLA 1E15A 3RM9A 1E6RA 3O5PA 3KABA 5GPGA 1ROTA 1JNEA 3ARRA 2JZVA 3EIPA 2PBCA 2B5UB 2Q5AA 1ITXA 3KAFA 3BXWA 3WD2A 3ALGA 2LPVA 1P5QA 4Z2HA 1NSGA 1QZ2A 4IQCA 1QPFA 2MLZA 1W26A 1R9HA 5BXJA 3WL1A 5E62A 4MNMA 4UDMA 1J4IA 4DWSC 5GQBA 3PA7A 4C02B 4DWSB 3WD0A 1PBKA 4MAVA 2F4EA 2RURA 1KT0A 4JYSA 4U84A 4ODPA 2O92A 4TNSA 4DWSA 1ZL1A 4HBEA 1F8AB 3LKXB 3LUOA 3MQHA 2OLHA 1E6PA 3QOKA 4DROA 4DZ3A 1NWUA 2JXWA 4DWSD 1FFRA 2PPNA 1JCHB 3M85A 4P8XA 1LJYA 1EG4A 3LKXA 2A3CA 2WLZA 3ARXA 3B7XA 2YAJB 3CGMA 4TW8A 4W9OA 1Q6IA 3CNGA 3JYMA 4QT3A 5DF0A 4Z2IA 4IPXA 3UQBA 1FKKA 3H9RB 3RM4A 5AHTA 1EHNA 3FS8A 2PI6A 4ML4A 1YATA 1FKBA 1EG3A 4R0XA 2YSFA 1W9PA 4TYOA 4NZCA 4QT2A 3MCBA 2WK2A 1CTNA 5DIUA 3CHFA 4ODQA 1W1YA 3AS0A 1ZBWA 4LAVA 3KZ7A 1SR0A 2DG9A 4U85A 4IT6A 4DH0A 1W9UA 2A3AA 3MDYB 4PTMA 1FKRA 4QIBA 3G6MA 4N19A 1Q6UA 1M5YA 1W1PA 4W5UA 4DIPA 2XP4A 1VF8A 2PV1A 2WADA 4ODKA 3FXYA 1LQ0A 1FKSA 1EQ3A 2RUDA 4LAXA 3AS2A 2LJ4A 2DT2A 4J4NA 3FY1A 3PRAA 3NRKA 1K9QA 4P8VA 1QPLA 3WD3A 4IQ2A 1OWQA 4FAPA 2MLXA 4ODRA 1I5HW 3RFWA 5DIVA 2PV2A 2PPPA 1ZBCA 4TW6A 2PN0A 1ZB5A 4DRIA 2DG4A 2B31A 3MQGA 3CHDA 3ARSA 4Z2GA 2L4JA 3KAHA 4U86A 2WLYA 4WKFA 1GPFA 1NWRA 3UI5A 1O6IA 1F40A 4ZPTR 1HJVA 3WKZA 1GUVA 1D7IA 3WD4A 4BF8A 1C9HA 5HWBA 1OGGA 1FKIA 5DITA 3GU0A 3IKGA 4DRKA 4DRQA 1D7HA 3JXVA 1WAWA 5HWCA 2YSBA 3FAPA 1KT1A 4Z2JA 3CHCA 3AQUA 3AS3A 2YBTA 2DWVA 2ZQSA 4G50A 1ZBVA 3PRBA 2QF8A 1SYTA 2WAEA 2DSUA 4TX0A 2KGJA 3RM8A 3WD1A 3O5EA 2KI3A 2DK1A 4W9QA 4DRJA 2M3OW 3CH9A 2DT3A 4TW7A 1RP5A 1JVWA 4P8WA 3UF8A 5HW7A 5CQ2A 3IKDA 1FKFA 5HUAA 3FSCA 2XPBA 3OOBA 3O5GA 4JFJA 2JX8A 2RUQA 3O5MA 4R5EA 2F21A 2AWGA 4AY1A 2XP9A 2Y8NB 1FKJA 3TCZA 2O9OA 1LL7A 1FFQA 1WMVA 3KACA 3PR9A 1NH6A 4O2TA 4Q7NA 2KFWA 1N1AA 3VAWA 3M7NA 2YBUA 1EIBA 4P8UA 2XP7A 3PQHA 2XPAA 4DRHA 1BKFA 4MNLA 2MLYA 4NSBA 4IT4A 5HT1A 3O5IA 2L2SA 1FD9A 2JV4A 2DJYA 3W4RA 1D7JA 5JH8A 1XHGA 1WNOA 1X6LA 5HBFA 1JNTA 4HARA 4DZ2A 4GIVA 2EULA 1ZBKA 1FKHA 2M8IA 1GOIA 3O5OA 1ROUA 2OFNA 2E45A 3NTPA 5I98A 4REXA 1E9LA 3B8SA 2ZR5A 2PPOA 2YSIA 2DMVA 1ZCNA 2MF9A 2K8IA 2KE0A 1JNDA 2M8JA 4URIA 4Q22A 1HJWA 5E5WA 3NI6A 2DG3A 3PRDA 1HXVA 5E65A 3ARQA 1PINA 1LG2A 2ETNA 4ODLA 2ZR6A 5HW8A 1IX5A 3KAGA 3ARUA 1KFWA 2LKNA 1Q6HA 4JFIA 2MNTA 2MPHA 2DT1A 2F23A 4DRMA 2Y78A 3ARWA 4G2PA 1H0IA 3O5JA 3O5LA 1HJXA 3KCEA 4ODOA 2M08A 5HW6A 1J4RA 2DPEA 3UQAA 3ARVA 3O5DA 1LL6A 3B9EA 4WIWA 5DO2A 2KO7A 1FKGA 3FSBA 1HKMA 2ZQUA 1K9RA 1LL4A 2ITKA 3AROA 2G8ZA 2A3EA 2F2DA 1K9TA 1UR9A 3B9AA 2UZ5A 1X6NA 4Z2KA 1RD6A 2XP8A 4KR0B 2EZ5W 3ODKA 2VN1A 1JNSA 2LAJA 2JMFA 2N87A 1E44A 4HBOA 3JYJA 2YSHA 4LAYA 1GRJA 5GPRA 3ARTA 3UQIA 3WH0A 1E6NA 1LG1A 3LE4A 3O5FA 4ZPVR 3ARPA 3L4HA 2FKEA 4LGXA 5E66A 4GGQA 4WJXA 2RQSA 2ZQVA 2DSWA 4MNKA 4KQZA 1NMVA 2G41A 2RE3A 4DT4A 4JFMA 1TK7A 2ZQTA 2XP6A 2KXQA 1FLCA 2LGOA 5B8IC 2A3BA 4S3JA 1T11A 3AS1A 1HKJA 2P4VA 2VCDA 4DRNA 4MNJA 4MPKA 1YW5A 1O6WA 1Q1CA 3UI4A 1NMWA 3ARZA 4ODNA 4ZS6A 4A0TA 3CHEA 2DSVA 3OA5A 3TDBA 1JMQA 2AOSA 1ZK6A 2PV3A 4L3NA 4LAWA 4Z2LA 2XP3A 3RGCA 3TC5A 3IHZA 1UR8A 3ALFA 2XP5A 1FKLA 1W1VA 2OWOA 3GTYX 3WIJA 3I6CA 2BA1A 2WM0A 3B9DA 1A7XA 4ITZA 3CGNA 2MDIA 2RSEA 2YSGA 3MCBB 2DSZA 5U47A 1TR8A 2D9FA 5DEZA 2M2AA 3CZ8A 3RMEA 5J6EA 4W9PA 1ZU8A 1J4HA 2KR7A 4NNRA 3KADA 5HKGA 2ESCA 4ZPWR 4WK9A 4S3KA 1FJDA 1D2KA 4L72B 5D75A 1NWTA 5E64A 1EYMA 1OGBA 4J4OA 1EDQA 4DRPA 3O5KA 4MTVA 2ZAJA 1HKIA 2DT0A 2M1IA 2QRVA 3WQWA 3IK8A 1W9VA 1HKKA 1Y0OA 3WQVA 4ODMA 2RUCA 4JFKA 1H0GA 1D6OA 3UI6A 4MGVA 4WKAA 4XAKA 3EY6A 3GPKA 4WKHA 1TCOC 4MSPA 4E5RA 2DK7A 1FKDA 1W1TA 4A0UA 1TFVA 3ARYA 2FDMA 4GLXA 2ZR4A 3WL0A 1B6CA 2IF4A 3BMBA 1XRVA 2FAPA 1E6ZA 1FKTA 3O5RA 1J6YA 5HTGA 1U79A 1FAPA 2IUZA 3O5QA 1L1PA 4FN2A 1NWSA 4QZVB 1WR7A 1WB0A 3KAIA 3G6LA 1BL4A
chains in the Genus database with same CATH topology
4JFLA 1E15A 3RM9A 1E6RA 3O5PA 3KABA 5GPGA 1ROTA 1JNEA 3ARRA 2JZVA 2PBCA 2Q5AA 1ITXA 3KAFA 3BXWA 3WD2A 3ALGA 2LPVA 1P5QA 4Z2HA 1NSGA 1QZ2A 4IQCA 1QPFA 2MLZA 1W26A 1R9HA 5BXJA 3WL1A 5E62A 4MNMA 1J4IA 4DWSC 5GQBA 3PA7A 4C02B 4DWSB 3WD0A 1PBKA 4MAVA 2F4EA 2RURA 1KT0A 4JYSA 4U84A 4ODPA 2O92A 4TNSA 4DWSA 1ZL1A 4HBEA 1F8AB 3LKXB 3LUOA 3MQHA 2OLHA 1E6PA 3QOKA 4DROA 4DZ3A 1NWUA 2JXWA 4DWSD 1FFRA 2PPNA 3M85A 4P8XA 1LJYA 1EG4A 3LKXA 2A3CA 2WLZA 3ARXA 3B7XA 2YAJB 3CGMA 4TW8A 4W9OA 1Q6IA 3CNGA 3JYMA 4QT3A 5DF0A 4Z2IA 4IPXA 3UQBA 1FKKA 3H9RB 3RM4A 5AHTA 1EHNA 3FS8A 2PI6A 4ML4A 1YATA 1FKBA 1EG3A 4R0XA 2YSFA 1W9PA 4TYOA 4NZCA 4QT2A 3MCBA 2WK2A 1CTNA 5DIUA 3CHFA 4ODQA 1W1YA 3AS0A 1ZBWA 4LAVA 3KZ7A 1SR0A 2DG9A 4U85A 4IT6A 4DH0A 1W9UA 2A3AA 3MDYB 4PTMA 1FKRA 4QIBA 3G6MA 4N19A 1Q6UA 1M5YA 1W1PA 4W5UA 4DIPA 2XP4A 1VF8A 2PV1A 2WADA 4ODKA 3FXYA 1LQ0A 1FKSA 1EQ3A 2RUDA 4LAXA 3AS2A 2LJ4A 2DT2A 4J4NA 3FY1A 3PRAA 3NRKA 1K9QA 4P8VA 1QPLA 3WD3A 4IQ2A 1OWQA 4FAPA 2MLXA 4ODRA 1I5HW 3RFWA 5DIVA 2PV2A 2PPPA 1ZBCA 4TW6A 1ZB5A 4DRIA 2DG4A 2B31A 3MQGA 3CHDA 3ARSA 4Z2GA 2L4JA 3KAHA 4U86A 2WLYA 4WKFA 1GPFA 1NWRA 3UI5A 1O6IA 1F40A 4ZPTR 1HJVA 3WKZA 1GUVA 1D7IA 3WD4A 4BF8A 1C9HA 5HWBA 1OGGA 1FKIA 5DITA 3IKGA 4DRKA 4DRQA 1D7HA 3JXVA 1WAWA 5HWCA 2YSBA 3FAPA 1KT1A 4Z2JA 3CHCA 3AQUA 3AS3A 2YBTA 2DWVA 2ZQSA 4G50A 1ZBVA 3PRBA 2QF8A 1SYTA 2WAEA 2DSUA 4TX0A 2KGJA 3RM8A 3WD1A 3O5EA 2KI3A 2DK1A 4W9QA 4DRJA 2M3OW 3CH9A 2DT3A 4TW7A 1RP5A 1JVWA 4P8WA 3UF8A 5HW7A 5CQ2A 3IKDA 1FKFA 5HUAA 3FSCA 2XPBA 3OOBA 3O5GA 4JFJA 2JX8A 2RUQA 3O5MA 4R5EA 2F21A 2AWGA 4AY1A 2XP9A 2Y8NB 1FKJA 3TCZA 2O9OA 1LL7A 1FFQA 1WMVA 3KACA 3PR9A 1NH6A 4O2TA 4Q7NA 2KFWA 1N1AA 3VAWA 3M7NA 2YBUA 1EIBA 4P8UA 2XP7A 3PQHA 2XPAA 4DRHA 1BKFA 4MNLA 2MLYA 4NSBA 4IT4A 5HT1A 3O5IA 2L2SA 1FD9A 2JV4A 2DJYA 3W4RA 1D7JA 5JH8A 1XHGA 1WNOA 1X6LA 5HBFA 1JNTA 4HARA 4DZ2A 4GIVA 1ZBKA 1FKHA 2M8IA 1GOIA 3O5OA 1ROUA 2OFNA 2E45A 3NTPA 5I98A 4REXA 1E9LA 3B8SA 2ZR5A 2PPOA 2YSIA 2DMVA 1ZCNA 2MF9A 2K8IA 2KE0A 1JNDA 2M8JA 4URIA 4Q22A 1HJWA 5E5WA 3NI6A 2DG3A 3PRDA 1HXVA 5E65A 3ARQA 1PINA 1LG2A 4ODLA 2ZR6A 5HW8A 1IX5A 3KAGA 3ARUA 1KFWA 2LKNA 1Q6HA 4JFIA 2MNTA 2MPHA 2DT1A 4DRMA 2Y78A 3ARWA 4G2PA 1H0IA 3O5JA 3O5LA 1HJXA 3KCEA 4ODOA 2M08A 5HW6A 1J4RA 2DPEA 3UQAA 3ARVA 3O5DA 1LL6A 3B9EA 4WIWA 5DO2A 2KO7A 1FKGA 3FSBA 1HKMA 2ZQUA 1K9RA 1LL4A 2ITKA 3AROA 2G8ZA 2A3EA 2F2DA 1K9TA 1UR9A 3B9AA 2UZ5A 1X6NA 4Z2KA 1RD6A 2XP8A 4KR0B 2EZ5W 3ODKA 2VN1A 1JNSA 2LAJA 2JMFA 2N87A 4HBOA 3JYJA 2YSHA 4LAYA 5GPRA 3ARTA 3UQIA 3WH0A 1E6NA 1LG1A 3LE4A 3O5FA 4ZPVR 3ARPA 3L4HA 2FKEA 4LGXA 5E66A 4GGQA 4WJXA 2RQSA 2ZQVA 2DSWA 4MNKA 4KQZA 1NMVA 2G41A 2RE3A 4DT4A 4JFMA 1TK7A 2ZQTA 2XP6A 2KXQA 1FLCA 2LGOA 5B8IC 2A3BA 4S3JA 1T11A 3AS1A 1HKJA 2VCDA 4DRNA 4MNJA 4MPKA 1YW5A 1O6WA 1Q1CA 3UI4A 1NMWA 3ARZA 4ODNA 4ZS6A 4A0TA 3CHEA 2DSVA 3OA5A 3TDBA 1JMQA 2AOSA 1ZK6A 2PV3A 4L3NA 4LAWA 4Z2LA 2XP3A 3RGCA 3TC5A 3IHZA 1UR8A 3ALFA 2XP5A 1FKLA 1W1VA 2OWOA 3WIJA 3I6CA 2BA1A 2WM0A 3B9DA 1A7XA 4ITZA 3CGNA 2MDIA 2RSEA 2YSGA 3MCBB 2DSZA 5U47A 1TR8A 2D9FA 5DEZA 2M2AA 3CZ8A 3RMEA 5J6EA 4W9PA 1ZU8A 1J4HA 2KR7A 4NNRA 3KADA 5HKGA 2ESCA 4ZPWR 4WK9A 4S3KA 1FJDA 1D2KA 4L72B 5D75A 1NWTA 5E64A 1EYMA 1OGBA 4J4OA 1EDQA 4DRPA 3O5KA 4MTVA 2ZAJA 1HKIA 2DT0A 2M1IA 2QRVA 3WQWA 3IK8A 1W9VA 1HKKA 1Y0OA 3WQVA 4ODMA 2RUCA 4JFKA 1H0GA 1D6OA 3UI6A 4MGVA 4WKAA 4XAKA 3EY6A 3GPKA 4WKHA 1TCOC 4MSPA 4E5RA 2DK7A 1FKDA 1W1TA 4A0UA 1TFVA 3ARYA 2FDMA 4GLXA 2ZR4A 3WL0A 1B6CA 2IF4A 1XRVA 2FAPA 1E6ZA 1FKTA 3O5RA 1J6YA 5HTGA 1U79A 1FAPA 2IUZA 3O5QA 1L1PA 4FN2A 1NWSA 4QZVB 1WR7A 1WB0A 3KAIA 3G6LA 1BL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFL A;  3O5P A;  3KAB A;  5GPG A;  1ROT A;  2JZV A;  2PBC A;  2Q5A A;  3KAF A;  2LPV A;  1P5Q A;  1NSG A;  1QZ2 A;  4IQC A;  1QPF A;  2MLZ A;  1W26 A;  1R9H A;  5BXJ A;  1J4I A;  3PA7 A;  4C02 B;  1PBK A;  2F4E A;  2RUR A;  1KT0 A;  4JYS A;  4U84 A;  4ODP A;  4TNS A;  1F8A B;  3LUO A;  4DRO A;  4DZ3 A;  2JXW A;  2PPN A;  3M85 A;  1EG4 A;  3B7X A;  3CGM A;  4TW8 A;  4W9O A;  1Q6I A;  3CNG A;  3JYM A;  4QT3 A;  4IPX A;  3UQB A;  1FKK A;  3H9R B;  5AHT A;  1YAT A;  1FKB A;  1EG3 A;  4R0X A;  2YSF A;  4TYO A;  4QT2 A;  5DIU A;  4ODQ A;  4LAV A;  3KZ7 A;  2DG9 A;  4U85 A;  4DH0 A;  3MDY B;  1FKR A;  4QIB A;  4N19 A;  1Q6U A;  1M5Y A;  4DIP A;  2XP4 A;  2PV1 A;  4ODK A;  1FKS A;  1EQ3 A;  2RUD A;  4LAX A;  2LJ4 A;  4J4N A;  3NRK A;  1K9Q A;  1QPL A;  4IQ2 A;  4FAP A;  2MLX A;  4ODR A;  1I5H W;  3RFW A;  5DIV A;  2PV2 A;  2PPP A;  4TW6 A;  4DRI A;  2DG4 A;  2L4J A;  3KAH A;  4U86 A;  3UI5 A;  1F40 A;  1D7I A;  4BF8 A;  1C9H A;  5HWB A;  1FKI A;  5DIT A;  3IKG A;  4DRK A;  4DRQ A;  1D7H A;  3JXV A;  5HWC A;  2YSB A;  3FAP A;  1KT1 A;  2DWV A;  2ZQS A;  4G50 A;  3PRB A;  4TX0 A;  2KGJ A;  3O5E A;  2KI3 A;  2DK1 A;  4W9Q A;  4DRJ A;  2M3O W;  4TW7 A;  1JVW A;  3UF8 A;  5HW7 A;  5CQ2 A;  3IKD A;  1FKF A;  5HUA A;  2XPB A;  3OOB A;  3O5G A;  4JFJ A;  2JX8 A;  2RUQ A;  3O5M A;  2F21 A;  2AWG A;  2XP9 A;  1FKJ A;  3TCZ A;  1WMV A;  3KAC A;  4O2T A;  2KFW A;  1N1A A;  3VAW A;  3M7N A;  4DRH A;  2XP7 A;  2XPA A;  1BKF A;  2MLY A;  5HT1 A;  3O5I A;  2L2S A;  1FD9 A;  2JV4 A;  2DJY A;  1D7J A;  1JNT A;  4DZ2 A;  4GIV A;  1FKH A;  2M8I A;  3O5O A;  1ROU A;  2OFN A;  2E45 A;  3NTP A;  5I98 A;  4REX A;  2ZR5 A;  2PPO A;  2YSI A;  2DMV A;  1ZCN A;  2MF9 A;  2K8I A;  2KE0 A;  2M8J A;  3NI6 A;  2DG3 A;  3PRD A;  1HXV A;  1PIN A;  4ODL A;  2ZR6 A;  5HW8 A;  3KAG A;  2LKN A;  1Q6H A;  4JFI A;  2MNT A;  2MPH A;  4DRM A;  2Y78 A;  4G2P A;  3O5J A;  3O5L A;  3KCE A;  4ODO A;  2M08 A;  5HW6 A;  1J4R A;  3UQA A;  3O5D A;  2KO7 A;  1FKG A;  2ZQU A;  1K9R A;  2ITK A;  2F2D A;  2UZ5 A;  2XP8 A;  2EZ5 W;  3ODK A;  2VN1 A;  1JNS A;  2LAJ A;  2JMF A;  2N87 A;  3JYJ A;  2YSH A;  4LAY A;  3UQI A;  3WH0 A;  3LE4 A;  3O5F A;  3L4H A;  2FKE A;  4GGQ A;  2RQS A;  2ZQV A;  1NMV A;  2RE3 A;  4DT4 A;  4JFM A;  1TK7 A;  2ZQT A;  2XP6 A;  2KXQ A;  2LGO A;  5B8I C;  1T11 A;  2VCD A;  4DRN A;  1YW5 A;  3UI4 A;  1O6W A;  1Q1C A;  1NMW A;  4ODN A;  3TDB A;  1JMQ A;  1ZK6 A;  2PV3 A;  4LAW A;  2XP3 A;  3RGC A;  3TC5 A;  3IHZ A;  2XP5 A;  1FKL A;  3I6C A;  2BA1 A;  1A7X A;  4ITZ A;  3CGN A;  2MDI A;  2RSE A;  2YSG A;  2D9F A;  2M2A A;  5J6E A;  4W9P A;  1J4H A;  2KR7 A;  4NNR A;  3KAD A;  5HKG A;  1FJD A;  5D75 A;  1EYM A;  4J4O A;  4DRP A;  3O5K A;  2ZAJ A;  2M1I A;  3IK8 A;  1Y0O A;  4ODM A;  2RUC A;  4JFK A;  1D6O A;  3UI6 A;  4MGV A;  3EY6 A;  3GPK A;  1TCO C;  4MSP A;  4E5R A;  2DK7 A;  1FKD A;  2ZR4 A;  1B6C A;  2IF4 A;  2FAP A;  3O5R A;  1FKT A;  1J6Y A;  5HTG A;  1U79 A;  1FAP A;  3O5Q A;  1L1P A;  4FN2 A;  1WR7 A;  3KAI A;  1BL4 A; 
#chains in the Genus database with same CATH topology
 4JFL A;  1E15 A;  3RM9 A;  1E6R A;  3O5P A;  3KAB A;  5GPG A;  1ROT A;  1JNE A;  3ARR A;  2JZV A;  3EIP A;  2PBC A;  2B5U B;  2Q5A A;  1ITX A;  3KAF A;  3BXW A;  3WD2 A;  3ALG A;  2LPV A;  1P5Q A;  4Z2H A;  1NSG A;  1QZ2 A;  4IQC A;  1QPF A;  2MLZ A;  1W26 A;  1R9H A;  5BXJ A;  3WL1 A;  5E62 A;  4MNM A;  4UDM A;  1J4I A;  4DWS C;  5GQB A;  3PA7 A;  4C02 B;  4DWS B;  3WD0 A;  1PBK A;  4MAV A;  2F4E A;  2RUR A;  1KT0 A;  4JYS A;  4U84 A;  4ODP A;  2O92 A;  4TNS A;  4DWS A;  1ZL1 A;  4HBE A;  1F8A B;  3LKX B;  3LUO A;  3MQH A;  2OLH A;  1E6P A;  3QOK A;  4DRO A;  4DZ3 A;  1NWU A;  2JXW A;  4DWS D;  1FFR A;  2PPN A;  1JCH B;  3M85 A;  4P8X A;  1LJY A;  1EG4 A;  3LKX A;  2A3C A;  2WLZ A;  3ARX A;  3B7X A;  2YAJ B;  3CGM A;  4TW8 A;  4W9O A;  1Q6I A;  3CNG A;  3JYM A;  4QT3 A;  5DF0 A;  4Z2I A;  4IPX A;  3UQB A;  1FKK A;  3H9R B;  3RM4 A;  5AHT A;  1EHN A;  3FS8 A;  2PI6 A;  4ML4 A;  1YAT A;  1FKB A;  1EG3 A;  4R0X A;  2YSF A;  1W9P A;  4TYO A;  4NZC A;  4QT2 A;  3MCB A;  2WK2 A;  1CTN A;  5DIU A;  3CHF A;  4ODQ A;  1W1Y A;  3AS0 A;  1ZBW A;  4LAV A;  3KZ7 A;  1SR0 A;  2DG9 A;  4U85 A;  4IT6 A;  4DH0 A;  1W9U A;  2A3A A;  3MDY B;  4PTM A;  1FKR A;  4QIB A;  3G6M A;  4N19 A;  1Q6U A;  1M5Y A;  1W1P A;  4W5U A;  4DIP A;  2XP4 A;  1VF8 A;  2PV1 A;  2WAD A;  4ODK A;  3FXY A;  1LQ0 A;  1FKS A;  1EQ3 A;  2RUD A;  4LAX A;  3AS2 A;  2LJ4 A;  2DT2 A;  4J4N A;  3FY1 A;  3PRA A;  3NRK A;  1K9Q A;  4P8V A;  1QPL A;  3WD3 A;  4IQ2 A;  1OWQ A;  4FAP A;  2MLX A;  4ODR A;  1I5H W;  3RFW A;  5DIV A;  2PV2 A;  2PPP A;  1ZBC A;  4TW6 A;  2PN0 A;  1ZB5 A;  4DRI A;  2DG4 A;  2B31 A;  3MQG A;  3CHD A;  3ARS A;  4Z2G A;  2L4J A;  3KAH A;  4U86 A;  2WLY A;  4WKF A;  1GPF A;  1NWR A;  3UI5 A;  1O6I A;  1F40 A;  4ZPT R;  1HJV A;  3WKZ A;  1GUV A;  1D7I A;  3WD4 A;  4BF8 A;  1C9H A;  5HWB A;  1OGG A;  1FKI A;  5DIT A;  3GU0 A;  3IKG A;  4DRK A;  4DRQ A;  1D7H A;  3JXV A;  1WAW A;  5HWC A;  2YSB A;  3FAP A;  1KT1 A;  4Z2J A;  3CHC A;  3AQU A;  3AS3 A;  2YBT A;  2DWV A;  2ZQS A;  4G50 A;  1ZBV A;  3PRB A;  2QF8 A;  1SYT A;  2WAE A;  2DSU A;  4TX0 A;  2KGJ A;  3RM8 A;  3WD1 A;  3O5E A;  2KI3 A;  2DK1 A;  4W9Q A;  4DRJ A;  2M3O W;  3CH9 A;  2DT3 A;  4TW7 A;  1RP5 A;  1JVW A;  4P8W A;  3UF8 A;  5HW7 A;  5CQ2 A;  3IKD A;  1FKF A;  5HUA A;  3FSC A;  2XPB A;  3OOB A;  3O5G A;  4JFJ A;  2JX8 A;  2RUQ A;  3O5M A;  4R5E A;  2F21 A;  2AWG A;  4AY1 A;  2XP9 A;  2Y8N B;  1FKJ A;  3TCZ A;  2O9O A;  1LL7 A;  1FFQ A;  1WMV A;  3KAC A;  3PR9 A;  1NH6 A;  4O2T A;  4Q7N A;  2KFW A;  1N1A A;  3VAW A;  3M7N A;  2YBU A;  1EIB A;  4P8U A;  2XP7 A;  3PQH A;  2XPA A;  4DRH A;  1BKF A;  4MNL A;  2MLY A;  4NSB A;  4IT4 A;  5HT1 A;  3O5I A;  2L2S A;  1FD9 A;  2JV4 A;  2DJY A;  3W4R A;  1D7J A;  5JH8 A;  1XHG A;  1WNO A;  1X6L A;  5HBF A;  1JNT A;  4HAR A;  4DZ2 A;  4GIV A;  2EUL A;  1ZBK A;  1FKH A;  2M8I A;  1GOI A;  3O5O A;  1ROU A;  2OFN A;  2E45 A;  3NTP A;  5I98 A;  4REX A;  1E9L A;  3B8S A;  2ZR5 A;  2PPO A;  2YSI A;  2DMV A;  1ZCN A;  2MF9 A;  2K8I A;  2KE0 A;  1JND A;  2M8J A;  4URI A;  4Q22 A;  1HJW A;  5E5W A;  3NI6 A;  2DG3 A;  3PRD A;  1HXV A;  5E65 A;  3ARQ A;  1PIN A;  1LG2 A;  2ETN A;  4ODL A;  2ZR6 A;  5HW8 A;  1IX5 A;  3KAG A;  3ARU A;  1KFW A;  2LKN A;  1Q6H A;  4JFI A;  2MNT A;  2MPH A;  2DT1 A;  2F23 A;  4DRM A;  2Y78 A;  3ARW A;  4G2P A;  1H0I A;  3O5J A;  3O5L A;  1HJX A;  3KCE A;  4ODO A;  2M08 A;  5HW6 A;  1J4R A;  2DPE A;  3UQA A;  3ARV A;  3O5D A;  1LL6 A;  3B9E A;  4WIW A;  5DO2 A;  2KO7 A;  1FKG A;  3FSB A;  1HKM A;  2ZQU A;  1K9R A;  1LL4 A;  2ITK A;  3ARO A;  2G8Z A;  2A3E A;  2F2D A;  1K9T A;  1UR9 A;  3B9A A;  2UZ5 A;  1X6N A;  4Z2K A;  1RD6 A;  2XP8 A;  4KR0 B;  2EZ5 W;  3ODK A;  2VN1 A;  1JNS A;  2LAJ A;  2JMF A;  2N87 A;  1E44 A;  4HBO A;  3JYJ A;  2YSH A;  4LAY A;  1GRJ A;  5GPR A;  3ART A;  3UQI A;  3WH0 A;  1E6N A;  1LG1 A;  3LE4 A;  3O5F A;  4ZPV R;  3ARP A;  3L4H A;  2FKE A;  4LGX A;  5E66 A;  4GGQ A;  4WJX A;  2RQS A;  2ZQV A;  2DSW A;  4MNK A;  4KQZ A;  1NMV A;  2G41 A;  2RE3 A;  4DT4 A;  4JFM A;  1TK7 A;  2ZQT A;  2XP6 A;  2KXQ A;  1FLC A;  2LGO A;  5B8I C;  2A3B A;  4S3J A;  1T11 A;  3AS1 A;  1HKJ A;  2P4V A;  2VCD A;  4DRN A;  4MNJ A;  4MPK A;  1YW5 A;  1O6W A;  1Q1C A;  3UI4 A;  1NMW A;  3ARZ A;  4ODN A;  4ZS6 A;  4A0T A;  3CHE A;  2DSV A;  3OA5 A;  3TDB A;  1JMQ A;  2AOS A;  1ZK6 A;  2PV3 A;  4L3N A;  4LAW A;  4Z2L A;  2XP3 A;  3RGC A;  3TC5 A;  3IHZ A;  1UR8 A;  3ALF A;  2XP5 A;  1FKL A;  1W1V A;  2OWO A;  3GTY X;  3WIJ A;  3I6C A;  2BA1 A;  2WM0 A;  3B9D A;  1A7X A;  4ITZ A;  3CGN A;  2MDI A;  2RSE A;  2YSG A;  3MCB B;  2DSZ A;  5U47 A;  1TR8 A;  2D9F A;  5DEZ A;  2M2A A;  3CZ8 A;  3RME A;  5J6E A;  4W9P A;  1ZU8 A;  1J4H A;  2KR7 A;  4NNR A;  3KAD A;  5HKG A;  2ESC A;  4ZPW R;  4WK9 A;  4S3K A;  1FJD A;  1D2K A;  4L72 B;  5D75 A;  1NWT A;  5E64 A;  1EYM A;  1OGB A;  4J4O A;  1EDQ A;  4DRP A;  3O5K A;  4MTV A;  2ZAJ A;  1HKI A;  2DT0 A;  2M1I A;  2QRV A;  3WQW A;  3IK8 A;  1W9V A;  1HKK A;  1Y0O A;  3WQV A;  4ODM A;  2RUC A;  4JFK A;  1H0G A;  1D6O A;  3UI6 A;  4MGV A;  4WKA A;  4XAK A;  3EY6 A;  3GPK A;  4WKH A;  1TCO C;  4MSP A;  4E5R A;  2DK7 A;  1FKD A;  1W1T A;  4A0U A;  1TFV A;  3ARY A;  2FDM A;  4GLX A;  2ZR4 A;  3WL0 A;  1B6C A;  2IF4 A;  3BMB A;  1XRV A;  2FAP A;  1E6Z A;  1FKT A;  3O5R A;  1J6Y A;  5HTG A;  1U79 A;  1FAP A;  2IUZ A;  3O5Q A;  1L1P A;  4FN2 A;  1NWS A;  4QZV B;  1WR7 A;  1WB0 A;  3KAI A;  3G6L A;  1BL4 A; 
#chains in the Genus database with same CATH homology
 4JFL A;  1E15 A;  3RM9 A;  1E6R A;  3O5P A;  3KAB A;  5GPG A;  1ROT A;  1JNE A;  3ARR A;  2JZV A;  2PBC A;  2Q5A A;  1ITX A;  3KAF A;  3BXW A;  3WD2 A;  3ALG A;  2LPV A;  1P5Q A;  4Z2H A;  1NSG A;  1QZ2 A;  4IQC A;  1QPF A;  2MLZ A;  1W26 A;  1R9H A;  5BXJ A;  3WL1 A;  5E62 A;  4MNM A;  1J4I A;  4DWS C;  5GQB A;  3PA7 A;  4C02 B;  4DWS B;  3WD0 A;  1PBK A;  4MAV A;  2F4E A;  2RUR A;  1KT0 A;  4JYS A;  4U84 A;  4ODP A;  2O92 A;  4TNS A;  4DWS A;  1ZL1 A;  4HBE A;  1F8A B;  3LKX B;  3LUO A;  3MQH A;  2OLH A;  1E6P A;  3QOK A;  4DRO A;  4DZ3 A;  1NWU A;  2JXW A;  4DWS D;  1FFR A;  2PPN A;  3M85 A;  4P8X A;  1LJY A;  1EG4 A;  3LKX A;  2A3C A;  2WLZ A;  3ARX A;  3B7X A;  2YAJ B;  3CGM A;  4TW8 A;  4W9O A;  1Q6I A;  3CNG A;  3JYM A;  4QT3 A;  5DF0 A;  4Z2I A;  4IPX A;  3UQB A;  1FKK A;  3H9R B;  3RM4 A;  5AHT A;  1EHN A;  3FS8 A;  2PI6 A;  4ML4 A;  1YAT A;  1FKB A;  1EG3 A;  4R0X A;  2YSF A;  1W9P A;  4TYO A;  4NZC A;  4QT2 A;  3MCB A;  2WK2 A;  1CTN A;  5DIU A;  3CHF A;  4ODQ A;  1W1Y A;  3AS0 A;  1ZBW A;  4LAV A;  3KZ7 A;  1SR0 A;  2DG9 A;  4U85 A;  4IT6 A;  4DH0 A;  1W9U A;  2A3A A;  3MDY B;  4PTM A;  1FKR A;  4QIB A;  3G6M A;  4N19 A;  1Q6U A;  1M5Y A;  1W1P A;  4W5U A;  4DIP A;  2XP4 A;  1VF8 A;  2PV1 A;  2WAD A;  4ODK A;  3FXY A;  1LQ0 A;  1FKS A;  1EQ3 A;  2RUD A;  4LAX A;  3AS2 A;  2LJ4 A;  2DT2 A;  4J4N A;  3FY1 A;  3PRA A;  3NRK A;  1K9Q A;  4P8V A;  1QPL A;  3WD3 A;  4IQ2 A;  1OWQ A;  4FAP A;  2MLX A;  4ODR A;  1I5H W;  3RFW A;  5DIV A;  2PV2 A;  2PPP A;  1ZBC A;  4TW6 A;  1ZB5 A;  4DRI A;  2DG4 A;  2B31 A;  3MQG A;  3CHD A;  3ARS A;  4Z2G A;  2L4J A;  3KAH A;  4U86 A;  2WLY A;  4WKF A;  1GPF A;  1NWR A;  3UI5 A;  1O6I A;  1F40 A;  4ZPT R;  1HJV A;  3WKZ A;  1GUV A;  1D7I A;  3WD4 A;  4BF8 A;  1C9H A;  5HWB A;  1OGG A;  1FKI A;  5DIT A;  3IKG A;  4DRK A;  4DRQ A;  1D7H A;  3JXV A;  1WAW A;  5HWC A;  2YSB A;  3FAP A;  1KT1 A;  4Z2J A;  3CHC A;  3AQU A;  3AS3 A;  2YBT A;  2DWV A;  2ZQS A;  4G50 A;  1ZBV A;  3PRB A;  2QF8 A;  1SYT A;  2WAE A;  2DSU A;  4TX0 A;  2KGJ A;  3RM8 A;  3WD1 A;  3O5E A;  2KI3 A;  2DK1 A;  4W9Q A;  4DRJ A;  2M3O W;  3CH9 A;  2DT3 A;  4TW7 A;  1RP5 A;  1JVW A;  4P8W A;  3UF8 A;  5HW7 A;  5CQ2 A;  3IKD A;  1FKF A;  5HUA A;  3FSC A;  2XPB A;  3OOB A;  3O5G A;  4JFJ A;  2JX8 A;  2RUQ A;  3O5M A;  4R5E A;  2F21 A;  2AWG A;  4AY1 A;  2XP9 A;  2Y8N B;  1FKJ A;  3TCZ A;  2O9O A;  1LL7 A;  1FFQ A;  1WMV A;  3KAC A;  3PR9 A;  1NH6 A;  4O2T A;  4Q7N A;  2KFW A;  1N1A A;  3VAW A;  3M7N A;  2YBU A;  1EIB A;  4P8U A;  2XP7 A;  3PQH A;  2XPA A;  4DRH A;  1BKF A;  4MNL A;  2MLY A;  4NSB A;  4IT4 A;  5HT1 A;  3O5I A;  2L2S A;  1FD9 A;  2JV4 A;  2DJY A;  3W4R A;  1D7J A;  5JH8 A;  1XHG A;  1WNO A;  1X6L A;  5HBF A;  1JNT A;  4HAR A;  4DZ2 A;  4GIV A;  1ZBK A;  1FKH A;  2M8I A;  1GOI A;  3O5O A;  1ROU A;  2OFN A;  2E45 A;  3NTP A;  5I98 A;  4REX A;  1E9L A;  3B8S A;  2ZR5 A;  2PPO A;  2YSI A;  2DMV A;  1ZCN A;  2MF9 A;  2K8I A;  2KE0 A;  1JND A;  2M8J A;  4URI A;  4Q22 A;  1HJW A;  5E5W A;  3NI6 A;  2DG3 A;  3PRD A;  1HXV A;  5E65 A;  3ARQ A;  1PIN A;  1LG2 A;  4ODL A;  2ZR6 A;  5HW8 A;  1IX5 A;  3KAG A;  3ARU A;  1KFW A;  2LKN A;  1Q6H A;  4JFI A;  2MNT A;  2MPH A;  2DT1 A;  4DRM A;  2Y78 A;  3ARW A;  4G2P A;  1H0I A;  3O5J A;  3O5L A;  1HJX A;  3KCE A;  4ODO A;  2M08 A;  5HW6 A;  1J4R A;  2DPE A;  3UQA A;  3ARV A;  3O5D A;  1LL6 A;  3B9E A;  4WIW A;  5DO2 A;  2KO7 A;  1FKG A;  3FSB A;  1HKM A;  2ZQU A;  1K9R A;  1LL4 A;  2ITK A;  3ARO A;  2G8Z A;  2A3E A;  2F2D A;  1K9T A;  1UR9 A;  3B9A A;  2UZ5 A;  1X6N A;  4Z2K A;  1RD6 A;  2XP8 A;  4KR0 B;  2EZ5 W;  3ODK A;  2VN1 A;  1JNS A;  2LAJ A;  2JMF A;  2N87 A;  4HBO A;  3JYJ A;  2YSH A;  4LAY A;  5GPR A;  3ART A;  3UQI A;  3WH0 A;  1E6N A;  1LG1 A;  3LE4 A;  3O5F A;  4ZPV R;  3ARP A;  3L4H A;  2FKE A;  4LGX A;  5E66 A;  4GGQ A;  4WJX A;  2RQS A;  2ZQV A;  2DSW A;  4MNK A;  4KQZ A;  1NMV A;  2G41 A;  2RE3 A;  4DT4 A;  4JFM A;  1TK7 A;  2ZQT A;  2XP6 A;  2KXQ A;  1FLC A;  2LGO A;  5B8I C;  2A3B A;  4S3J A;  1T11 A;  3AS1 A;  1HKJ A;  2VCD A;  4DRN A;  4MNJ A;  4MPK A;  1YW5 A;  1O6W A;  1Q1C A;  3UI4 A;  1NMW A;  3ARZ A;  4ODN A;  4ZS6 A;  4A0T A;  3CHE A;  2DSV A;  3OA5 A;  3TDB A;  1JMQ A;  2AOS A;  1ZK6 A;  2PV3 A;  4L3N A;  4LAW A;  4Z2L A;  2XP3 A;  3RGC A;  3TC5 A;  3IHZ A;  1UR8 A;  3ALF A;  2XP5 A;  1FKL A;  1W1V A;  2OWO A;  3WIJ A;  3I6C A;  2BA1 A;  2WM0 A;  3B9D A;  1A7X A;  4ITZ A;  3CGN A;  2MDI A;  2RSE A;  2YSG A;  3MCB B;  2DSZ A;  5U47 A;  1TR8 A;  2D9F A;  5DEZ A;  2M2A A;  3CZ8 A;  3RME A;  5J6E A;  4W9P A;  1ZU8 A;  1J4H A;  2KR7 A;  4NNR A;  3KAD A;  5HKG A;  2ESC A;  4ZPW R;  4WK9 A;  4S3K A;  1FJD A;  1D2K A;  4L72 B;  5D75 A;  1NWT A;  5E64 A;  1EYM A;  1OGB A;  4J4O A;  1EDQ A;  4DRP A;  3O5K A;  4MTV A;  2ZAJ A;  1HKI A;  2DT0 A;  2M1I A;  2QRV A;  3WQW A;  3IK8 A;  1W9V A;  1HKK A;  1Y0O A;  3WQV A;  4ODM A;  2RUC A;  4JFK A;  1H0G A;  1D6O A;  3UI6 A;  4MGV A;  4WKA A;  4XAK A;  3EY6 A;  3GPK A;  4WKH A;  1TCO C;  4MSP A;  4E5R A;  2DK7 A;  1FKD A;  1W1T A;  4A0U A;  1TFV A;  3ARY A;  2FDM A;  4GLX A;  2ZR4 A;  3WL0 A;  1B6C A;  2IF4 A;  1XRV A;  2FAP A;  1E6Z A;  1FKT A;  3O5R A;  1J6Y A;  5HTG A;  1U79 A;  1FAP A;  2IUZ A;  3O5Q A;  1L1P A;  4FN2 A;  1NWS A;  4QZV B;  1WR7 A;  1WB0 A;  3KAI A;  3G6L A;  1BL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...