3KAGA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 49
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kagA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kagA02
2LGOA 1QPFA 4G50A 1FKRA 5GPGA 2RUQA 2KO7A 4IQ2A 3H9RB 4FAPA 4MGVA 1FKSA 1K9RA 1QZ2A 4IQCA 1NMVA 1ROUA 2PV3A 1PINA 1FKFA 2KR7A 4W9OA 2F4EA 4ODOA 3PA7A 3O5RA 4DIPA 2M1IA 1FKIA 4GIVA 2LKNA 1R9HA 1B6CA 2JV4A 3L4HA 3ODKA 4TW6A 5HTGA 3UI4A 4TNSA 2PPPA 3O5QA 4W9PA 4J4NA 1FKDA 4DRMA 2ZR5A 1FKHA 1TCOC 1JNTA 1Q6IA 2DG3A 4TW8A 2M8IA 4FN2A 5CQ2A 1P5QA 4G2PA 2ITKA 2M2AA 4W9QA 3NTPA 1FKLA 3O5FA 2UZ5A 3O5LA 2M08A 2VN1A 3O5MA 3RFWA 1EQ3A 4IPXA 5BXJA 2LJ4A 3O5PA 3KAGA 3KABA 3KAIA 3UI5A 1ZK6A 2XP7A 3NI6A 4ODQA 1ROTA 4DZ3A 4DRKA 2F21A 4U84A 2DG9A 1FJDA 4JYSA 2JZVA 1WMVA 4R0XA 1TK7A 2RUCA 2RSEA 2RURA 3FAPA 2LPVA 2JX8A 1Q6HA 5DIVA 4ODLA 1Q1CA 2YSGA 4U85A 3RGCA 4J4OA 4JFJA 3CGMA 2MF9A 2ZQSA 2DG4A 5DITA 4ODMA 3O5OA 1KT1A 2FAPA 1W26A 5J6EA 1D7HA 4QIBA 4REXA 1J4IA 1D7IA 2IF4A 1Q6UA 1L1PA 2DMVA 4JFLA 1NMWA 1ZCNA 3JYJA 1FKKA 2PPOA 3JXVA 1KT0A 5HUAA 3UQAA 2ZQTA 1JMQA 2FKEA 3KAFA 5HT1A 1FKGA 5AHTA 3KAHA 3LUOA 4LAWA 3KADA 2KI3A 2AWGA 3KCEA 2XP9A 4DRQA 2DWVA 1M5YA 3CGNA 1D7JA 2JXWA 2ZR6A 1U79A 4TW7A 1D6OA 1EYMA 3PRDA 1BL4A 2MNTA 1JNSA 4DRPA 4DRNA 2YSFA 3GPKA 3JYMA 2DK7A 1I5HW 3IK8A 2LAJA 5HW8A 3UQBA 2F2DA 4LAXA 2JMFA 3O5KA 2XP5A 1WR7A 4DRJA 2N87A 5B8IC 2KXQA 2OFNA 1QPLA 4LAVA 3TC5A 3O5JA 1EG3A 1FKBA 3IKDA 2MPHA 2M8JA 2VCDA 1N1AA 3UI6A 1NSGA 1YATA 2XPAA 2K8IA 2YSIA 1FD9A 2KE0A 4LAYA 3TDBA 2ZQUA 5HW6A 2XPBA 3O5DA 3EY6A 1O6WA 1J4HA 2KGJA 5HWCA 1YW5A 3UQIA 2EZ5W 2MLZA 3KZ7A 2Q5AA 2M3OW 2DJYA 2MLYA 4TX0A 2MDIA 4GGQA 1FAPA 3IHZA 2BA1A 1F8AB 2DK1A 3IKGA 4N19A 4U86A 1A7XA 2ZAJA 5HKGA 2XP8A 3O5GA 2XP6A 1Y0OA 4DZ2A 3M7NA 4NNRA 2YSBA 3NRKA 2XP3A 3TCZA 3CNGA 2RUDA 5HWBA 2E45A 2PBCA 1FKTA 4JFMA 4ODPA 4ODKA 3MDYB 2KFWA 2PPNA 2L4JA 4ODNA 1FKJA 4DRHA 4ODRA 3B7XA 1J6YA 1T11A 3KACA 1HXVA 2RE3A 2ZR4A 3LE4A 2D9FA 4DRIA 1BKFA 3OOBA 5D75A 5DIUA 2XP4A 3VAWA 3O5EA 2YSHA 4JFKA 2MLXA 2Y78A 2PV2A 4TYOA 5HW7A 2L2SA 4QT2A 3M85A 4E5RA 2PV1A 3I6CA 3WH0A 4DT4A 4MSPA 2RQSA 5I98A 1JVWA 1EG4A 2ZQVA 4C02B 1K9QA 4O2TA 4BF8A 4JFIA 4DH0A 4ITZA 3PRBA 1PBKA 1J4RA 1F40A 3UF8A 3O5IA 4QT3A 4DROA 1C9HA
chains in the Genus database with same CATH superfamily
2LGOA 1K9TA 1FLCA 3ALGA 3RMEA 1ZBWA 4Z2GA 1FFRA 1OGGA 1QPFA 4G50A 1FKRA 4WKFA 5GPGA 4MAVA 2RUQA 2KO7A 4IQ2A 3H9RB 3QOKA 4FAPA 1VF8A 2DSZA 4MGVA 4PTMA 3GU0A 2B31A 4HBOA 1FKSA 1K9RA 1JNDA 1W9VA 1QZ2A 3ALFA 4IQCA 1HJVA 1NMVA 2F23A 3ARUA 4IT6A 1ROUA 2PV3A 1PINA 1FKFA 2KR7A 3ARTA 4W9OA 2F4EA 4ODOA 3PA7A 2OWOA 4P8XA 3O5RA 4DWSB 4DIPA 2O92A 2M1IA 3B9AA 1FKIA 4GIVA 2LKNA 1R9HA 1B6CA 3LKXA 2JV4A 3L4HA 3ODKA 2A3CA 2ETNA 4TW6A 5DO2A 1CTNA 2WLYA 5HTGA 3UI4A 4TNSA 2PPPA 3O5QA 4W9PA 3ARRA 4J4NA 1FKDA 1GUVA 1WNOA 3AS0A 1RD6A 2WM0A 1ZB5A 1O6IA 4DRMA 4MNMA 3AROA 2ZR5A 1FKHA 1TCOC 3CZ8A 1JNTA 5E64A 3OA5A 4XAKA 1EHNA 1Q6IA 2DG3A 4TW8A 4L3NA 2M8IA 4FN2A 5CQ2A 1P5QA 4MNKA 3ARZA 4G2PA 2ITKA 4KR0B 3AS1A 2M2AA 1XHGA 4W9QA 1LJYA 3NTPA 1FKLA 2B5UB 4URIA 3O5FA 2UZ5A 4WK9A 3O5LA 4WKHA 1ITXA 3G6MA 3PR9A 3RM4A 1ZBVA 2M08A 1HJXA 2VN1A 4Q22A 1HKKA 3G6LA 3O5MA 2YBTA 3RFWA 1EQ3A 4IPXA 5BXJA 4NZCA 2WLZA 4Z2KA 4AY1A 2LJ4A 3O5PA 3CHEA 1JCHB 3KAGA 3AS3A 2DT0A 3KABA 3KAIA 3MQGA 3UI5A 2DT1A 1OWQA 1ZK6A 2XP7A 3WD0A 3NI6A 4ODQA 2G8ZA 2A3EA 2DSWA 1ROTA 4DZ3A 4DRKA 1OGBA 1FFQA 4GLXA 4Z2IA 2F21A 4ZPWR 4U84A 2DG9A 1FJDA 4JYSA 4DWSD 2DT2A 3FXYA 3W4RA 3FSBA 1X6LA 2JZVA 1WMVA 3ARPA 4Z2JA 4R0XA 5DF0A 1NWSA 1TK7A 2RUCA 2RSEA 4DWSC 2ESCA 2RURA 3FAPA 5E5WA 2AOSA 2LPVA 2JX8A 1Q6HA 5DIVA 4ODLA 2YBUA 3CHDA 1Q1CA 2YSGA 4U85A 1W1VA 3RGCA 1ZU8A 4J4OA 1SYTA 4JFJA 3CGMA 4WJXA 2MF9A 4S3KA 2ZQSA 2DG4A 5DITA 4Q7NA 4ODMA 3ARXA 3O5OA 1KT1A 2FAPA 1W26A 5J6EA 1D7HA 4QIBA 4REXA 1J4IA 1D7IA 2IF4A 4MTVA 2WK2A 1Q6UA 1L1PA 2DMVA 4JFLA 1XRVA 5E62A 1WB0A 1NMWA 2DSUA 3WL0A 1ZCNA 3JYJA 1RP5A 1FKKA 2PPOA 3JXVA 2P4VA 3FSCA 1KT0A 5HUAA 3UQAA 4KQZA 5E66A 2ZQTA 1JMQA 1KFWA 2FKEA 3KAFA 3WD2A 4P8WA 5HT1A 3WL1A 1FKGA 5AHTA 3KAHA 3LUOA 4LAWA 3KADA 1TFVA 2KI3A 1GPFA 2AWGA 3KCEA 2XP9A 3ARQA 1SR0A 4DRQA 2DWVA 5JH8A 1M5YA 4P8VA 3CGNA 1D7JA 2JXWA 2ZR6A 1LQ0A 3CHCA 3MCBA 1GRJA 3LKXB 1U79A 2QF8A 3WQVA 2FDMA 4TW7A 1H0IA 3ARVA 1D6OA 1EYMA 3PRDA 1EDQA 1BL4A 2OLHA 2MNTA 1JNSA 4DRPA 5HBFA 4DRNA 2YSFA 1W1YA 3GPKA 3JYMA 2DK7A 1I5HW 3IK8A 2DSVA 2LAJA 1E44A 3WQWA 5HW8A 4QZVB 4W5UA 2G41A 2F2DA 3UQBA 1ZBCA 4LAXA 4IT4A 2JMFA 3O5KA 2XP5A 1WR7A 1EIBA 4DRJA 2N87A 5E65A 5B8IC 2KXQA 1E6RA 1UR8A 3AS2A 4S3JA 4HARA 3WD1A 2OFNA 1QPLA 4LAVA 1H0GA 3TC5A 3O5JA 1EG3A 3AQUA 3CHFA 3BMBA 1FKBA 3IKDA 1HKIA 3WD3A 2MPHA 2M8JA 2VCDA 1E6NA 4DWSA 1N1AA 4MNLA 3UI6A 3MQHA 4HBEA 3WD4A 1NSGA 1YATA 2XPAA 1LG1A 3RM9A 1ZL1A 2K8IA 2YSIA 1FD9A 2KE0A 4ZS6A 4LAYA 3TDBA 2ZQUA 5HW6A 2XPBA 2O9OA 3O5DA 2A3AA 2WAEA 3EY6A 1TR8A 1O6WA 1J4HA 2KGJA 3CH9A 4ZPTR 5HWCA 1YW5A 3UQIA 2EZ5W 2DT3A 2MLZA 4Z2HA 2PN0A 2IUZA 3KZ7A 2Q5AA 2PI6A 2M3OW 2DJYA 2MLYA 4TX0A 2MDIA 1E6PA 4GGQA 1FAPA 4MPKA 3IHZA 2BA1A 4ML4A 1F8AB 2DK1A 3IKGA 4N19A 5DEZA 4U86A 1A7XA 5GPRA 2ZAJA 1GOIA 1IX5A 5HKGA 1LL6A 2YAJB 2XP8A 3O5GA 2XP6A 1Y0OA 5U47A 4DZ2A 2WADA 3M7NA 4NNRA 4WIWA 1NWTA 2YSBA 3ARWA 3NRKA 2XP3A 1HKJA 3TCZA 3CNGA 3WIJA 2RUDA 5HWBA 2E45A 1HKMA 2PBCA 1FKTA 4LGXA 1X6NA 1D2KA 4JFMA 4ODPA 2A3BA 3BXWA 3PRAA 4ODKA 4MNJA 3GTYX 3MDYB 2KFWA 2Y8NB 3B9EA 3PQHA 2PPNA 1LL7A 2L4JA 4ODNA 1FKJA 4DRHA 4NSBA 4ODRA 3B7XA 3ARYA 1W1PA 1W1TA 1J6YA 1T11A 4UDMA 1LL4A 3WKZA 1E15A 3KACA 1HXVA 4Z2LA 2RE3A 2EULA 2ZR4A 3LE4A 2D9FA 4DRIA 1WAWA 1BKFA 3OOBA 5D75A 4ZPVR 3FS8A 3EIPA 4WKAA 5DIUA 2XP4A 4L72B 3VAWA 3O5EA 1LG2A 2YSHA 4R5EA 4JFKA 2MLXA 2Y78A 2PV2A 2QRVA 4A0TA 3B8SA 1HJWA 4TYOA 5HW7A 1NWUA 2L2SA 4P8UA 4QT2A 3M85A 4E5RA 2DPEA 2PV1A 3ARSA 3I6CA 3WH0A 1W9UA 4DT4A 4A0UA 2RQSA 1W9PA 4MSPA 5I98A 1ZBKA 1JVWA 1EG4A 2ZQVA 1E9LA 4C02B 1K9QA 4O2TA 4BF8A 4JFIA 4DH0A 5GQBA 4ITZA 3PRBA 1PBKA 1NWRA 3RM8A 3MCBB 1J4RA 1F40A 1E6ZA 3FY1A 1JNEA 3UF8A 1NH6A 1UR9A 3O5IA 4QT3A 3B9DA 4DROA 1C9HA
chains in the Genus database with same CATH topology
2LGOA 1K9TA 1FLCA 3ALGA 3RMEA 1ZBWA 4Z2GA 1FFRA 1OGGA 1QPFA 4G50A 1FKRA 4WKFA 5GPGA 4MAVA 2RUQA 2KO7A 4IQ2A 3H9RB 3QOKA 4FAPA 1VF8A 2DSZA 4MGVA 4PTMA 2B31A 4HBOA 1FKSA 1K9RA 1JNDA 1W9VA 1QZ2A 3ALFA 4IQCA 1HJVA 1NMVA 3ARUA 4IT6A 1ROUA 2PV3A 1PINA 1FKFA 2KR7A 3ARTA 4W9OA 2F4EA 4ODOA 3PA7A 2OWOA 4P8XA 3O5RA 4DWSB 4DIPA 2O92A 2M1IA 3B9AA 1FKIA 4GIVA 2LKNA 1R9HA 1B6CA 3LKXA 2JV4A 3L4HA 3ODKA 2A3CA 4TW6A 5DO2A 1CTNA 2WLYA 5HTGA 3UI4A 4TNSA 2PPPA 3O5QA 4W9PA 3ARRA 4J4NA 1FKDA 1GUVA 1WNOA 3AS0A 1RD6A 2WM0A 1ZB5A 1O6IA 4DRMA 4MNMA 3AROA 2ZR5A 1FKHA 1TCOC 3CZ8A 1JNTA 5E64A 3OA5A 4XAKA 1EHNA 1Q6IA 2DG3A 4TW8A 4L3NA 2M8IA 4FN2A 5CQ2A 1P5QA 4MNKA 3ARZA 4G2PA 2ITKA 4KR0B 3AS1A 2M2AA 1XHGA 4W9QA 1LJYA 3NTPA 1FKLA 4URIA 3O5FA 2UZ5A 4WK9A 3O5LA 4WKHA 1ITXA 3G6MA 3PR9A 3RM4A 1ZBVA 2M08A 1HJXA 2VN1A 4Q22A 1HKKA 3G6LA 3O5MA 2YBTA 3RFWA 1EQ3A 4IPXA 5BXJA 4NZCA 2WLZA 4Z2KA 4AY1A 2LJ4A 3O5PA 3CHEA 3KAGA 3AS3A 2DT0A 3KABA 3KAIA 3MQGA 3UI5A 2DT1A 1OWQA 1ZK6A 2XP7A 3WD0A 3NI6A 4ODQA 2G8ZA 2A3EA 2DSWA 1ROTA 4DZ3A 4DRKA 1OGBA 1FFQA 4GLXA 4Z2IA 2F21A 4ZPWR 4U84A 2DG9A 1FJDA 4JYSA 4DWSD 2DT2A 3FXYA 3W4RA 3FSBA 1X6LA 2JZVA 1WMVA 3ARPA 4Z2JA 4R0XA 5DF0A 1NWSA 1TK7A 2RUCA 2RSEA 4DWSC 2ESCA 2RURA 3FAPA 5E5WA 2AOSA 2LPVA 2JX8A 1Q6HA 5DIVA 4ODLA 2YBUA 3CHDA 1Q1CA 2YSGA 4U85A 1W1VA 3RGCA 1ZU8A 4J4OA 1SYTA 4JFJA 3CGMA 4WJXA 2MF9A 4S3KA 2ZQSA 2DG4A 5DITA 4Q7NA 4ODMA 3ARXA 3O5OA 1KT1A 2FAPA 1W26A 5J6EA 1D7HA 4QIBA 4REXA 1J4IA 1D7IA 2IF4A 4MTVA 2WK2A 1Q6UA 1L1PA 2DMVA 4JFLA 1XRVA 5E62A 1WB0A 1NMWA 2DSUA 3WL0A 1ZCNA 3JYJA 1RP5A 1FKKA 2PPOA 3JXVA 3FSCA 1KT0A 5HUAA 3UQAA 4KQZA 5E66A 2ZQTA 1JMQA 1KFWA 2FKEA 3KAFA 3WD2A 4P8WA 5HT1A 3WL1A 1FKGA 5AHTA 3KAHA 3LUOA 4LAWA 3KADA 1TFVA 2KI3A 1GPFA 2AWGA 3KCEA 2XP9A 3ARQA 1SR0A 4DRQA 2DWVA 5JH8A 1M5YA 4P8VA 3CGNA 1D7JA 2JXWA 2ZR6A 1LQ0A 3CHCA 3MCBA 2QF8A 3LKXB 1U79A 3WQVA 2FDMA 4TW7A 1H0IA 3ARVA 1D6OA 1EYMA 3PRDA 1EDQA 1BL4A 2OLHA 2MNTA 1JNSA 4DRPA 5HBFA 4DRNA 2YSFA 1W1YA 3GPKA 3JYMA 2DK7A 1I5HW 3IK8A 2DSVA 2LAJA 3WQWA 5HW8A 4QZVB 4W5UA 2G41A 2F2DA 3UQBA 1ZBCA 4LAXA 4IT4A 2JMFA 3O5KA 2XP5A 1WR7A 1EIBA 4DRJA 2N87A 5E65A 5B8IC 2KXQA 1E6RA 1UR8A 3AS2A 4S3JA 4HARA 3WD1A 2OFNA 1QPLA 4LAVA 1H0GA 3TC5A 3O5JA 1EG3A 3AQUA 3CHFA 1FKBA 3IKDA 1HKIA 3WD3A 2MPHA 2M8JA 2VCDA 1E6NA 4DWSA 1N1AA 4MNLA 3UI6A 3MQHA 4HBEA 3WD4A 1NSGA 1YATA 2XPAA 1LG1A 3RM9A 1ZL1A 2K8IA 2YSIA 1FD9A 2KE0A 4ZS6A 4LAYA 3TDBA 2ZQUA 5HW6A 2XPBA 2O9OA 3O5DA 2A3AA 2WAEA 3EY6A 1TR8A 1O6WA 1J4HA 2KGJA 3CH9A 4ZPTR 5HWCA 1YW5A 3UQIA 2EZ5W 2DT3A 2MLZA 4Z2HA 2IUZA 3KZ7A 2Q5AA 2PI6A 2M3OW 2DJYA 2MLYA 4TX0A 2MDIA 1E6PA 4GGQA 1FAPA 4MPKA 3IHZA 2BA1A 4ML4A 1F8AB 2DK1A 3IKGA 4N19A 5DEZA 4U86A 1A7XA 5GPRA 2ZAJA 1GOIA 1IX5A 5HKGA 1LL6A 2YAJB 2XP8A 3O5GA 2XP6A 1Y0OA 5U47A 4DZ2A 2WADA 3M7NA 4NNRA 4WIWA 1NWTA 2YSBA 3ARWA 3NRKA 2XP3A 1HKJA 3TCZA 3CNGA 3WIJA 2RUDA 5HWBA 2E45A 1HKMA 2PBCA 1FKTA 4LGXA 1X6NA 1D2KA 4JFMA 4ODPA 2A3BA 3BXWA 3PRAA 4ODKA 4MNJA 3MDYB 2KFWA 2Y8NB 3B9EA 3PQHA 2PPNA 1LL7A 2L4JA 4ODNA 1FKJA 4DRHA 4NSBA 4ODRA 3B7XA 3ARYA 1W1PA 1W1TA 1J6YA 1T11A 1LL4A 3WKZA 1E15A 3KACA 1HXVA 4Z2LA 2RE3A 2ZR4A 3LE4A 2D9FA 4DRIA 1WAWA 1BKFA 3OOBA 5D75A 4ZPVR 3FS8A 4WKAA 5DIUA 2XP4A 4L72B 3VAWA 3O5EA 1LG2A 2YSHA 4R5EA 4JFKA 2MLXA 2Y78A 2PV2A 2QRVA 4A0TA 3B8SA 1HJWA 4TYOA 5HW7A 1NWUA 2L2SA 4P8UA 4QT2A 3M85A 4E5RA 2DPEA 2PV1A 3ARSA 3I6CA 3WH0A 1W9UA 4DT4A 4A0UA 2RQSA 1W9PA 4MSPA 5I98A 1ZBKA 1JVWA 1EG4A 2ZQVA 1E9LA 4C02B 1K9QA 4O2TA 4BF8A 4JFIA 4DH0A 5GQBA 4ITZA 3PRBA 1PBKA 1NWRA 3RM8A 3MCBB 1J4RA 1F40A 1E6ZA 3FY1A 1JNEA 3UF8A 1NH6A 1UR9A 3O5IA 4QT3A 3B9DA 4DROA 1C9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGO A;  1QPF A;  4G50 A;  1FKR A;  5GPG A;  2RUQ A;  2KO7 A;  4IQ2 A;  3H9R B;  4FAP A;  4MGV A;  1FKS A;  1K9R A;  1QZ2 A;  4IQC A;  1NMV A;  1ROU A;  2PV3 A;  1PIN A;  1FKF A;  2KR7 A;  4W9O A;  2F4E A;  4ODO A;  3PA7 A;  3O5R A;  4DIP A;  2M1I A;  1FKI A;  4GIV A;  2LKN A;  1R9H A;  1B6C A;  2JV4 A;  3L4H A;  3ODK A;  4TW6 A;  5HTG A;  3UI4 A;  4TNS A;  2PPP A;  3O5Q A;  4W9P A;  4J4N A;  1FKD A;  4DRM A;  2ZR5 A;  1FKH A;  1TCO C;  1JNT A;  1Q6I A;  2DG3 A;  4TW8 A;  2M8I A;  4FN2 A;  5CQ2 A;  1P5Q A;  4G2P A;  2ITK A;  2M2A A;  4W9Q A;  3NTP A;  1FKL A;  3O5F A;  2UZ5 A;  3O5L A;  2M08 A;  2VN1 A;  3O5M A;  3RFW A;  1EQ3 A;  4IPX A;  5BXJ A;  2LJ4 A;  3O5P A;  3KAG A;  3KAB A;  3KAI A;  3UI5 A;  1ZK6 A;  2XP7 A;  3NI6 A;  4ODQ A;  1ROT A;  4DZ3 A;  4DRK A;  2F21 A;  4U84 A;  2DG9 A;  1FJD A;  4JYS A;  2JZV A;  1WMV A;  4R0X A;  1TK7 A;  2RUC A;  2RSE A;  2RUR A;  3FAP A;  2LPV A;  2JX8 A;  1Q6H A;  5DIV A;  4ODL A;  1Q1C A;  2YSG A;  4U85 A;  3RGC A;  4J4O A;  4JFJ A;  3CGM A;  2MF9 A;  2ZQS A;  2DG4 A;  5DIT A;  4ODM A;  3O5O A;  1KT1 A;  2FAP A;  1W26 A;  5J6E A;  1D7H A;  4QIB A;  4REX A;  1J4I A;  1D7I A;  2IF4 A;  1Q6U A;  1L1P A;  2DMV A;  4JFL A;  1NMW A;  1ZCN A;  3JYJ A;  1FKK A;  2PPO A;  3JXV A;  1KT0 A;  5HUA A;  3UQA A;  2ZQT A;  1JMQ A;  2FKE A;  3KAF A;  5HT1 A;  1FKG A;  5AHT A;  3KAH A;  3LUO A;  4LAW A;  3KAD A;  2KI3 A;  2AWG A;  3KCE A;  2XP9 A;  4DRQ A;  2DWV A;  1M5Y A;  3CGN A;  1D7J A;  2JXW A;  2ZR6 A;  1U79 A;  4TW7 A;  1D6O A;  1EYM A;  3PRD A;  1BL4 A;  2MNT A;  1JNS A;  4DRP A;  4DRN A;  2YSF A;  3GPK A;  3JYM A;  2DK7 A;  1I5H W;  3IK8 A;  2LAJ A;  5HW8 A;  3UQB A;  2F2D A;  4LAX A;  2JMF A;  3O5K A;  2XP5 A;  1WR7 A;  4DRJ A;  2N87 A;  5B8I C;  2KXQ A;  2OFN A;  1QPL A;  4LAV A;  3TC5 A;  3O5J A;  1EG3 A;  1FKB A;  3IKD A;  2MPH A;  2M8J A;  2VCD A;  1N1A A;  3UI6 A;  1NSG A;  1YAT A;  2XPA A;  2K8I A;  2YSI A;  1FD9 A;  2KE0 A;  4LAY A;  3TDB A;  2ZQU A;  5HW6 A;  2XPB A;  3O5D A;  3EY6 A;  1O6W A;  1J4H A;  2KGJ A;  5HWC A;  1YW5 A;  3UQI A;  2EZ5 W;  2MLZ A;  3KZ7 A;  2Q5A A;  2M3O W;  2DJY A;  2MLY A;  4TX0 A;  2MDI A;  4GGQ A;  1FAP A;  3IHZ A;  2BA1 A;  1F8A B;  2DK1 A;  3IKG A;  4N19 A;  4U86 A;  1A7X A;  2ZAJ A;  5HKG A;  2XP8 A;  3O5G A;  2XP6 A;  1Y0O A;  4DZ2 A;  3M7N A;  4NNR A;  2YSB A;  3NRK A;  2XP3 A;  3TCZ A;  3CNG A;  2RUD A;  5HWB A;  2E45 A;  2PBC A;  1FKT A;  4JFM A;  4ODP A;  4ODK A;  3MDY B;  2KFW A;  2PPN A;  2L4J A;  4ODN A;  1FKJ A;  4DRH A;  4ODR A;  3B7X A;  1J6Y A;  1T11 A;  3KAC A;  1HXV A;  2RE3 A;  2ZR4 A;  3LE4 A;  2D9F A;  4DRI A;  1BKF A;  3OOB A;  5D75 A;  5DIU A;  2XP4 A;  3VAW A;  3O5E A;  2YSH A;  4JFK A;  2MLX A;  2Y78 A;  2PV2 A;  4TYO A;  5HW7 A;  2L2S A;  4QT2 A;  3M85 A;  4E5R A;  2PV1 A;  3I6C A;  3WH0 A;  4DT4 A;  4MSP A;  2RQS A;  5I98 A;  1JVW A;  1EG4 A;  2ZQV A;  4C02 B;  1K9Q A;  4O2T A;  4BF8 A;  4JFI A;  4DH0 A;  4ITZ A;  3PRB A;  1PBK A;  1J4R A;  1F40 A;  3UF8 A;  3O5I A;  4QT3 A;  4DRO A;  1C9H A; 
#chains in the Genus database with same CATH topology
 2LGO A;  1K9T A;  1FLC A;  3ALG A;  3RME A;  1ZBW A;  4Z2G A;  1FFR A;  1OGG A;  1QPF A;  4G50 A;  1FKR A;  4WKF A;  5GPG A;  4MAV A;  2RUQ A;  2KO7 A;  4IQ2 A;  3H9R B;  3QOK A;  4FAP A;  1VF8 A;  2DSZ A;  4MGV A;  4PTM A;  3GU0 A;  2B31 A;  4HBO A;  1FKS A;  1K9R A;  1JND A;  1W9V A;  1QZ2 A;  3ALF A;  4IQC A;  1HJV A;  1NMV A;  2F23 A;  3ARU A;  4IT6 A;  1ROU A;  2PV3 A;  1PIN A;  1FKF A;  2KR7 A;  3ART A;  4W9O A;  2F4E A;  4ODO A;  3PA7 A;  2OWO A;  4P8X A;  3O5R A;  4DWS B;  4DIP A;  2O92 A;  2M1I A;  3B9A A;  1FKI A;  4GIV A;  2LKN A;  1R9H A;  1B6C A;  3LKX A;  2JV4 A;  3L4H A;  3ODK A;  2A3C A;  2ETN A;  4TW6 A;  5DO2 A;  1CTN A;  2WLY A;  5HTG A;  3UI4 A;  4TNS A;  2PPP A;  3O5Q A;  4W9P A;  3ARR A;  4J4N A;  1FKD A;  1GUV A;  1WNO A;  3AS0 A;  1RD6 A;  2WM0 A;  1ZB5 A;  1O6I A;  4DRM A;  4MNM A;  3ARO A;  2ZR5 A;  1FKH A;  1TCO C;  3CZ8 A;  1JNT A;  5E64 A;  3OA5 A;  4XAK A;  1EHN A;  1Q6I A;  2DG3 A;  4TW8 A;  4L3N A;  2M8I A;  4FN2 A;  5CQ2 A;  1P5Q A;  4MNK A;  3ARZ A;  4G2P A;  2ITK A;  4KR0 B;  3AS1 A;  2M2A A;  1XHG A;  4W9Q A;  1LJY A;  3NTP A;  1FKL A;  2B5U B;  4URI A;  3O5F A;  2UZ5 A;  4WK9 A;  3O5L A;  4WKH A;  1ITX A;  3G6M A;  3PR9 A;  3RM4 A;  1ZBV A;  2M08 A;  1HJX A;  2VN1 A;  4Q22 A;  1HKK A;  3G6L A;  3O5M A;  2YBT A;  3RFW A;  1EQ3 A;  4IPX A;  5BXJ A;  4NZC A;  2WLZ A;  4Z2K A;  4AY1 A;  2LJ4 A;  3O5P A;  3CHE A;  1JCH B;  3KAG A;  3AS3 A;  2DT0 A;  3KAB A;  3KAI A;  3MQG A;  3UI5 A;  2DT1 A;  1OWQ A;  1ZK6 A;  2XP7 A;  3WD0 A;  3NI6 A;  4ODQ A;  2G8Z A;  2A3E A;  2DSW A;  1ROT A;  4DZ3 A;  4DRK A;  1OGB A;  1FFQ A;  4GLX A;  4Z2I A;  2F21 A;  4ZPW R;  4U84 A;  2DG9 A;  1FJD A;  4JYS A;  4DWS D;  2DT2 A;  3FXY A;  3W4R A;  3FSB A;  1X6L A;  2JZV A;  1WMV A;  3ARP A;  4Z2J A;  4R0X A;  5DF0 A;  1NWS A;  1TK7 A;  2RUC A;  2RSE A;  4DWS C;  2ESC A;  2RUR A;  3FAP A;  5E5W A;  2AOS A;  2LPV A;  2JX8 A;  1Q6H A;  5DIV A;  4ODL A;  2YBU A;  3CHD A;  1Q1C A;  2YSG A;  4U85 A;  1W1V A;  3RGC A;  1ZU8 A;  4J4O A;  1SYT A;  4JFJ A;  3CGM A;  4WJX A;  2MF9 A;  4S3K A;  2ZQS A;  2DG4 A;  5DIT A;  4Q7N A;  4ODM A;  3ARX A;  3O5O A;  1KT1 A;  2FAP A;  1W26 A;  5J6E A;  1D7H A;  4QIB A;  4REX A;  1J4I A;  1D7I A;  2IF4 A;  4MTV A;  2WK2 A;  1Q6U A;  1L1P A;  2DMV A;  4JFL A;  1XRV A;  5E62 A;  1WB0 A;  1NMW A;  2DSU A;  3WL0 A;  1ZCN A;  3JYJ A;  1RP5 A;  1FKK A;  2PPO A;  3JXV A;  2P4V A;  3FSC A;  1KT0 A;  5HUA A;  3UQA A;  4KQZ A;  5E66 A;  2ZQT A;  1JMQ A;  1KFW A;  2FKE A;  3KAF A;  3WD2 A;  4P8W A;  5HT1 A;  3WL1 A;  1FKG A;  5AHT A;  3KAH A;  3LUO A;  4LAW A;  3KAD A;  1TFV A;  2KI3 A;  1GPF A;  2AWG A;  3KCE A;  2XP9 A;  3ARQ A;  1SR0 A;  4DRQ A;  2DWV A;  5JH8 A;  1M5Y A;  4P8V A;  3CGN A;  1D7J A;  2JXW A;  2ZR6 A;  1LQ0 A;  3CHC A;  3MCB A;  1GRJ A;  3LKX B;  1U79 A;  2QF8 A;  3WQV A;  2FDM A;  4TW7 A;  1H0I A;  3ARV A;  1D6O A;  1EYM A;  3PRD A;  1EDQ A;  1BL4 A;  2OLH A;  2MNT A;  1JNS A;  4DRP A;  5HBF A;  4DRN A;  2YSF A;  1W1Y A;  3GPK A;  3JYM A;  2DK7 A;  1I5H W;  3IK8 A;  2DSV A;  2LAJ A;  1E44 A;  3WQW A;  5HW8 A;  4QZV B;  4W5U A;  2G41 A;  2F2D A;  3UQB A;  1ZBC A;  4LAX A;  4IT4 A;  2JMF A;  3O5K A;  2XP5 A;  1WR7 A;  1EIB A;  4DRJ A;  2N87 A;  5E65 A;  5B8I C;  2KXQ A;  1E6R A;  1UR8 A;  3AS2 A;  4S3J A;  4HAR A;  3WD1 A;  2OFN A;  1QPL A;  4LAV A;  1H0G A;  3TC5 A;  3O5J A;  1EG3 A;  3AQU A;  3CHF A;  3BMB A;  1FKB A;  3IKD A;  1HKI A;  3WD3 A;  2MPH A;  2M8J A;  2VCD A;  1E6N A;  4DWS A;  1N1A A;  4MNL A;  3UI6 A;  3MQH A;  4HBE A;  3WD4 A;  1NSG A;  1YAT A;  2XPA A;  1LG1 A;  3RM9 A;  1ZL1 A;  2K8I A;  2YSI A;  1FD9 A;  2KE0 A;  4ZS6 A;  4LAY A;  3TDB A;  2ZQU A;  5HW6 A;  2XPB A;  2O9O A;  3O5D A;  2A3A A;  2WAE A;  3EY6 A;  1TR8 A;  1O6W A;  1J4H A;  2KGJ A;  3CH9 A;  4ZPT R;  5HWC A;  1YW5 A;  3UQI A;  2EZ5 W;  2DT3 A;  2MLZ A;  4Z2H A;  2PN0 A;  2IUZ A;  3KZ7 A;  2Q5A A;  2PI6 A;  2M3O W;  2DJY A;  2MLY A;  4TX0 A;  2MDI A;  1E6P A;  4GGQ A;  1FAP A;  4MPK A;  3IHZ A;  2BA1 A;  4ML4 A;  1F8A B;  2DK1 A;  3IKG A;  4N19 A;  5DEZ A;  4U86 A;  1A7X A;  5GPR A;  2ZAJ A;  1GOI A;  1IX5 A;  5HKG A;  1LL6 A;  2YAJ B;  2XP8 A;  3O5G A;  2XP6 A;  1Y0O A;  5U47 A;  4DZ2 A;  2WAD A;  3M7N A;  4NNR A;  4WIW A;  1NWT A;  2YSB A;  3ARW A;  3NRK A;  2XP3 A;  1HKJ A;  3TCZ A;  3CNG A;  3WIJ A;  2RUD A;  5HWB A;  2E45 A;  1HKM A;  2PBC A;  1FKT A;  4LGX A;  1X6N A;  1D2K A;  4JFM A;  4ODP A;  2A3B A;  3BXW A;  3PRA A;  4ODK A;  4MNJ A;  3GTY X;  3MDY B;  2KFW A;  2Y8N B;  3B9E A;  3PQH A;  2PPN A;  1LL7 A;  2L4J A;  4ODN A;  1FKJ A;  4DRH A;  4NSB A;  4ODR A;  3B7X A;  3ARY A;  1W1P A;  1W1T A;  1J6Y A;  1T11 A;  4UDM A;  1LL4 A;  3WKZ A;  1E15 A;  3KAC A;  1HXV A;  4Z2L A;  2RE3 A;  2EUL A;  2ZR4 A;  3LE4 A;  2D9F A;  4DRI A;  1WAW A;  1BKF A;  3OOB A;  5D75 A;  4ZPV R;  3FS8 A;  3EIP A;  4WKA A;  5DIU A;  2XP4 A;  4L72 B;  3VAW A;  3O5E A;  1LG2 A;  2YSH A;  4R5E A;  4JFK A;  2MLX A;  2Y78 A;  2PV2 A;  2QRV A;  4A0T A;  3B8S A;  1HJW A;  4TYO A;  5HW7 A;  1NWU A;  2L2S A;  4P8U A;  4QT2 A;  3M85 A;  4E5R A;  2DPE A;  2PV1 A;  3ARS A;  3I6C A;  3WH0 A;  1W9U A;  4DT4 A;  4A0U A;  2RQS A;  1W9P A;  4MSP A;  5I98 A;  1ZBK A;  1JVW A;  1EG4 A;  2ZQV A;  1E9L A;  4C02 B;  1K9Q A;  4O2T A;  4BF8 A;  4JFI A;  4DH0 A;  5GQB A;  4ITZ A;  3PRB A;  1PBK A;  1NWR A;  3RM8 A;  3MCB B;  1J4R A;  1F40 A;  1E6Z A;  3FY1 A;  1JNE A;  3UF8 A;  1NH6 A;  1UR9 A;  3O5I A;  4QT3 A;  3B9D A;  4DRO A;  1C9H A; 
#chains in the Genus database with same CATH homology
 2LGO A;  1K9T A;  1FLC A;  3ALG A;  3RME A;  1ZBW A;  4Z2G A;  1FFR A;  1OGG A;  1QPF A;  4G50 A;  1FKR A;  4WKF A;  5GPG A;  4MAV A;  2RUQ A;  2KO7 A;  4IQ2 A;  3H9R B;  3QOK A;  4FAP A;  1VF8 A;  2DSZ A;  4MGV A;  4PTM A;  2B31 A;  4HBO A;  1FKS A;  1K9R A;  1JND A;  1W9V A;  1QZ2 A;  3ALF A;  4IQC A;  1HJV A;  1NMV A;  3ARU A;  4IT6 A;  1ROU A;  2PV3 A;  1PIN A;  1FKF A;  2KR7 A;  3ART A;  4W9O A;  2F4E A;  4ODO A;  3PA7 A;  2OWO A;  4P8X A;  3O5R A;  4DWS B;  4DIP A;  2O92 A;  2M1I A;  3B9A A;  1FKI A;  4GIV A;  2LKN A;  1R9H A;  1B6C A;  3LKX A;  2JV4 A;  3L4H A;  3ODK A;  2A3C A;  4TW6 A;  5DO2 A;  1CTN A;  2WLY A;  5HTG A;  3UI4 A;  4TNS A;  2PPP A;  3O5Q A;  4W9P A;  3ARR A;  4J4N A;  1FKD A;  1GUV A;  1WNO A;  3AS0 A;  1RD6 A;  2WM0 A;  1ZB5 A;  1O6I A;  4DRM A;  4MNM A;  3ARO A;  2ZR5 A;  1FKH A;  1TCO C;  3CZ8 A;  1JNT A;  5E64 A;  3OA5 A;  4XAK A;  1EHN A;  1Q6I A;  2DG3 A;  4TW8 A;  4L3N A;  2M8I A;  4FN2 A;  5CQ2 A;  1P5Q A;  4MNK A;  3ARZ A;  4G2P A;  2ITK A;  4KR0 B;  3AS1 A;  2M2A A;  1XHG A;  4W9Q A;  1LJY A;  3NTP A;  1FKL A;  4URI A;  3O5F A;  2UZ5 A;  4WK9 A;  3O5L A;  4WKH A;  1ITX A;  3G6M A;  3PR9 A;  3RM4 A;  1ZBV A;  2M08 A;  1HJX A;  2VN1 A;  4Q22 A;  1HKK A;  3G6L A;  3O5M A;  2YBT A;  3RFW A;  1EQ3 A;  4IPX A;  5BXJ A;  4NZC A;  2WLZ A;  4Z2K A;  4AY1 A;  2LJ4 A;  3O5P A;  3CHE A;  3KAG A;  3AS3 A;  2DT0 A;  3KAB A;  3KAI A;  3MQG A;  3UI5 A;  2DT1 A;  1OWQ A;  1ZK6 A;  2XP7 A;  3WD0 A;  3NI6 A;  4ODQ A;  2G8Z A;  2A3E A;  2DSW A;  1ROT A;  4DZ3 A;  4DRK A;  1OGB A;  1FFQ A;  4GLX A;  4Z2I A;  2F21 A;  4ZPW R;  4U84 A;  2DG9 A;  1FJD A;  4JYS A;  4DWS D;  2DT2 A;  3FXY A;  3W4R A;  3FSB A;  1X6L A;  2JZV A;  1WMV A;  3ARP A;  4Z2J A;  4R0X A;  5DF0 A;  1NWS A;  1TK7 A;  2RUC A;  2RSE A;  4DWS C;  2ESC A;  2RUR A;  3FAP A;  5E5W A;  2AOS A;  2LPV A;  2JX8 A;  1Q6H A;  5DIV A;  4ODL A;  2YBU A;  3CHD A;  1Q1C A;  2YSG A;  4U85 A;  1W1V A;  3RGC A;  1ZU8 A;  4J4O A;  1SYT A;  4JFJ A;  3CGM A;  4WJX A;  2MF9 A;  4S3K A;  2ZQS A;  2DG4 A;  5DIT A;  4Q7N A;  4ODM A;  3ARX A;  3O5O A;  1KT1 A;  2FAP A;  1W26 A;  5J6E A;  1D7H A;  4QIB A;  4REX A;  1J4I A;  1D7I A;  2IF4 A;  4MTV A;  2WK2 A;  1Q6U A;  1L1P A;  2DMV A;  4JFL A;  1XRV A;  5E62 A;  1WB0 A;  1NMW A;  2DSU A;  3WL0 A;  1ZCN A;  3JYJ A;  1RP5 A;  1FKK A;  2PPO A;  3JXV A;  3FSC A;  1KT0 A;  5HUA A;  3UQA A;  4KQZ A;  5E66 A;  2ZQT A;  1JMQ A;  1KFW A;  2FKE A;  3KAF A;  3WD2 A;  4P8W A;  5HT1 A;  3WL1 A;  1FKG A;  5AHT A;  3KAH A;  3LUO A;  4LAW A;  3KAD A;  1TFV A;  2KI3 A;  1GPF A;  2AWG A;  3KCE A;  2XP9 A;  3ARQ A;  1SR0 A;  4DRQ A;  2DWV A;  5JH8 A;  1M5Y A;  4P8V A;  3CGN A;  1D7J A;  2JXW A;  2ZR6 A;  1LQ0 A;  3CHC A;  3MCB A;  2QF8 A;  3LKX B;  1U79 A;  3WQV A;  2FDM A;  4TW7 A;  1H0I A;  3ARV A;  1D6O A;  1EYM A;  3PRD A;  1EDQ A;  1BL4 A;  2OLH A;  2MNT A;  1JNS A;  4DRP A;  5HBF A;  4DRN A;  2YSF A;  1W1Y A;  3GPK A;  3JYM A;  2DK7 A;  1I5H W;  3IK8 A;  2DSV A;  2LAJ A;  3WQW A;  5HW8 A;  4QZV B;  4W5U A;  2G41 A;  2F2D A;  3UQB A;  1ZBC A;  4LAX A;  4IT4 A;  2JMF A;  3O5K A;  2XP5 A;  1WR7 A;  1EIB A;  4DRJ A;  2N87 A;  5E65 A;  5B8I C;  2KXQ A;  1E6R A;  1UR8 A;  3AS2 A;  4S3J A;  4HAR A;  3WD1 A;  2OFN A;  1QPL A;  4LAV A;  1H0G A;  3TC5 A;  3O5J A;  1EG3 A;  3AQU A;  3CHF A;  1FKB A;  3IKD A;  1HKI A;  3WD3 A;  2MPH A;  2M8J A;  2VCD A;  1E6N A;  4DWS A;  1N1A A;  4MNL A;  3UI6 A;  3MQH A;  4HBE A;  3WD4 A;  1NSG A;  1YAT A;  2XPA A;  1LG1 A;  3RM9 A;  1ZL1 A;  2K8I A;  2YSI A;  1FD9 A;  2KE0 A;  4ZS6 A;  4LAY A;  3TDB A;  2ZQU A;  5HW6 A;  2XPB A;  2O9O A;  3O5D A;  2A3A A;  2WAE A;  3EY6 A;  1TR8 A;  1O6W A;  1J4H A;  2KGJ A;  3CH9 A;  4ZPT R;  5HWC A;  1YW5 A;  3UQI A;  2EZ5 W;  2DT3 A;  2MLZ A;  4Z2H A;  2IUZ A;  3KZ7 A;  2Q5A A;  2PI6 A;  2M3O W;  2DJY A;  2MLY A;  4TX0 A;  2MDI A;  1E6P A;  4GGQ A;  1FAP A;  4MPK A;  3IHZ A;  2BA1 A;  4ML4 A;  1F8A B;  2DK1 A;  3IKG A;  4N19 A;  5DEZ A;  4U86 A;  1A7X A;  5GPR A;  2ZAJ A;  1GOI A;  1IX5 A;  5HKG A;  1LL6 A;  2YAJ B;  2XP8 A;  3O5G A;  2XP6 A;  1Y0O A;  5U47 A;  4DZ2 A;  2WAD A;  3M7N A;  4NNR A;  4WIW A;  1NWT A;  2YSB A;  3ARW A;  3NRK A;  2XP3 A;  1HKJ A;  3TCZ A;  3CNG A;  3WIJ A;  2RUD A;  5HWB A;  2E45 A;  1HKM A;  2PBC A;  1FKT A;  4LGX A;  1X6N A;  1D2K A;  4JFM A;  4ODP A;  2A3B A;  3BXW A;  3PRA A;  4ODK A;  4MNJ A;  3MDY B;  2KFW A;  2Y8N B;  3B9E A;  3PQH A;  2PPN A;  1LL7 A;  2L4J A;  4ODN A;  1FKJ A;  4DRH A;  4NSB A;  4ODR A;  3B7X A;  3ARY A;  1W1P A;  1W1T A;  1J6Y A;  1T11 A;  1LL4 A;  3WKZ A;  1E15 A;  3KAC A;  1HXV A;  4Z2L A;  2RE3 A;  2ZR4 A;  3LE4 A;  2D9F A;  4DRI A;  1WAW A;  1BKF A;  3OOB A;  5D75 A;  4ZPV R;  3FS8 A;  4WKA A;  5DIU A;  2XP4 A;  4L72 B;  3VAW A;  3O5E A;  1LG2 A;  2YSH A;  4R5E A;  4JFK A;  2MLX A;  2Y78 A;  2PV2 A;  2QRV A;  4A0T A;  3B8S A;  1HJW A;  4TYO A;  5HW7 A;  1NWU A;  2L2S A;  4P8U A;  4QT2 A;  3M85 A;  4E5R A;  2DPE A;  2PV1 A;  3ARS A;  3I6C A;  3WH0 A;  1W9U A;  4DT4 A;  4A0U A;  2RQS A;  1W9P A;  4MSP A;  5I98 A;  1ZBK A;  1JVW A;  1EG4 A;  2ZQV A;  1E9L A;  4C02 B;  1K9Q A;  4O2T A;  4BF8 A;  4JFI A;  4DH0 A;  5GQB A;  4ITZ A;  3PRB A;  1PBK A;  1NWR A;  3RM8 A;  3MCB B;  1J4R A;  1F40 A;  1E6Z A;  3FY1 A;  1JNE A;  3UF8 A;  1NH6 A;  1UR9 A;  3O5I A;  4QT3 A;  3B9D A;  4DRO A;  1C9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...