3KAKA

Structure of homoglutathione synthetase from glycine max in open conformation with gamma-glutamyl-cysteine bound.
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
473
structure length
443
Chain Sequence
PLFDYHRIDQKLLQNIVYDALVWSTLNCLLVGDKSVQRSGRVPGVGLVHLPLSLLPGPFPESHWKQGCELAPIFNELVDRVSLDGKFLQESLSRDEFTSRLLDIHSKMLQINKDIRMGIVRSDYMIDEKTKSLLQIEMNTISTSFALIGCLMTGLHKSLLSQYGKFLGLNSNRVPANNAVDQSAEALAKAWSEYNNPRAAILVVVQVEERNMYEQHYISALLREKHHIRSIRKTLTEIDQEGKILPDGTLSVDGQAISVVYFRAGYTPKDYPSESEWRARLLMEQSSAIKCPTISYHLVGTKKIQQELAKPGVLERFVENKDHIAKLRACFAGLWSLEDSDIVKKAIENPELFVMKPQNNIYGDELRETLLKAAYILMQRIFPATSPAILVRDGNWDTGHVISEAGIFGTYLRNKDKIIINNESGYMVRTKISFGVVDTVYLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Evolution of Product Diversity in Soybean Glutathione Biosynthesis.
pubmed doi rcsb
source organism Glycine max
molecule tags Ligase
molecule keywords Homoglutathione synthetase
total genus 147
structure length 443
sequence length 473
chains with identical sequence B
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03199 GSH_synthase Eukaryotic glutathione synthase
A PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1080.10 Mainly Alpha Orthogonal Bundle Glutathione Synthetase; Chain A, domain 3 Glutathione Synthetase; Chain A, domain 3 3kakA03
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3kakA02
3.30.1490.50 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kakA05
3.30.1490.80 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kakA01
3.40.50.1760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glutathione synthase, substrate-binding domain superfamily, eukaryotic 3kakA04
4O7SA 1VKZA 5HV6A 3ORQA 3HBLA 4ZHQF 1ULZA 4FGRA 4FFLA 4ZQIA 1GSAA 2FPGB 3DF7A 5EZYF 1IOVA 4O7VA 1VBHA 5LA6F 4O7TA 5J2UF 5IYZF 2R87A 3RFCA 4NYEA 1DIKA 4O2BF 1AUXA 2X0SA 3ETHA 3R5XA 2IP4A 4EGJA 2DWCA 1A48A 2PBZA 2VR1A 4TV8F 5GONF 4ZI7F 4O4HF 1DV2A 2R86A 4YAKB 4EGQA 2NU8B 3QFFA 1W96A 4FE2A 3JRXA 5DMXA 2FPPB 3TQTA 4HNUA 5C8YF 2YYAA 3K5IA 1I7NA 2W71A 3N8DA 4XX0B 4QSHA 4WBNF 3AX6A 2XCLA 1KUTA 1KJ9A 2V59A 1Z2OX 3E5NA 1DV1A 1EUDB 3MWEA 4O7YA 1M0WA 3LWBA 4IZOA 2NU9B 2WYOA 4HQ6A 1CS0A 4C5AA 2R7MA 4I55F 1OBGA 4MAMA 4MV8A 1Z2NX 2QF7A 4O82A 3TIGA 2QK4A 1M0TA 1B6SA 1C3OA 1KJ8A 2W6PA 2Z02A 4O4LF 4O86A 4YJ2F 5CAEB 3SE7A 3VOTA 5CA1F 1C30A 4ME6A 2PN1A 3Q1KA 3JRWA 4O2AF 3JZFA 4Y8VB 1KBLA 4FU0A 1B6RA 3V4SA 3VPBA 2YRWA 3BG5A 3TIIA 4O4JF 4C5BA 5LP6F 4HNTA 3VA7A 3KAJA 2C00A 3GIDA 4HNVA 2YZMA 4I4TF 4XYLB 1KEEA 2W6QA 2R82A 2I80A 3LP8A 3VMMA 2CNVA 5J2TF 5FNVF 2V5AA 1KJIA 1Z2PX 3AW8A 2GQRA 2ZDHA 4MA0A 2VQDA 1EZ1A 2YS7A 1PX2A 2PVPA 4MV3A 3WNZA 1JDEA 1BXRA 2XD4A 3WO1A 5KKNB 4TUYF 5JQWA 2GQSA 2ZDGA 3OUZA 3R5FA 2YS6A 3U54A 3I12A 3JZIA 2R7NA 3U9SA 1E4EB 2R7KA 4FFRA 3KREA 1SCUB 2YRXA 4O7LA 3ORRA 1I7LA 4MA5A 5H80A 2YW2A 5CB4F 1IOWA 4EG0A 5D8DA 2R84A 1BNCA 2HJWA 2NU6B 3K3PA 2GLTA 2YZLA 5BMVF 3KALA 1CQIB 2FP4B 2W6OA 2YZGA 4YAJB 4O83A 4O7ZA 2NUAB 2W6NA 4MV6A 2DIKA 1EYZA 2ZDQA 1GGOA 3RV3A 3U55A 5JVLA 1GSOA 1KJJA 1OBDA 4XYMB 3MJFA 1AUVA 3Q2OA 1GLVA 2YWVA 5JVDF 4YJ3F 4FFMA 1EHIA 2V58A 1VBGA 3GLKA 3TW6A 4L1KA 1WR2A 2DLNA 2GPSA 3HO8A 4MV7A 3V4ZA 5JQGF 3UFXB 2P0AA 4C5CA 4ZOLF 2FPIB 1KC7A 1A9XA 2NU7B 4FFOA 3NUAA 2DZDA 4XZ3B 2W70A 4DIMA 5LOVF 2YZNA 4FFPA 4RZQA 1JLLB 4YB8B 3KAKA 2R7LA 1CE8A 4MV9A 3VPCA 2OLSA 2I87A 3K5HA 3OUUA 4MV4A 3U9TA 2W6MA 4IIJF 4O7WA 3TINA 2Z04A 1GSHA 3MWDA 4HR7A 2W6ZA 4I50F 4FFNA 4YBZB 3RV4A 4MV1A 3R5HA 4O84A 3WO0A 2FB9A 5LYJF 1PK8A 2HGSA 4M9UA 4O81A 2GPWA 1JKJB 1M6VA 3G8CA 3R9RA 5C1PA 4O7RA 2J9GA 2R85A 1KJQA 1JDBB 2SCUB 2CZGA 3R23A 1W93A 4O4IF 4TV9F 3RUPA 5BPFA 1CQJB 2CNUA 2CNQA 3HB9A 5C1OA 3N6RA 3ETJA 4DLKA 4IHJF 5HBRB 3G8DA 1EUCB 2VPQA 2I8CA 4E4TA 5CA0F 5JH7F 5KX5F 2YL2A 1T36A 5BPHA 4O7NA 5LXTF 1E4EA
chains in the Genus database with same CATH superfamily
3VR0A 2Y0EA 1QIHA 4UUQA 3SYLA 2P3OA 1JTFA 3V3TA 1C4XA 5KJCA 2B82A 2O2CA 2NWQA 4W8HA 1IMJA 2FFQA 3ETHA 2P4QA 4EGJA 1C7JA 2DWCA 2F00A 1RI5A 2IPLA 2GN2A 2VXYA 5FNZA 2UXBB 1DIBA 3H6HA 1E5QA 3WQBA 5C3EG 3IJ5A 3DP7A 1HTBA 4OFBA 3FOAA 1O75A 3HI6A 4PHFA 5HGJA 1ZI8A 2Q3CA 4RDCA 2P2DA 2V59A 2QL9A 3N7UA 4X5OA 3S1AB 2X0RA 3PNLA 5JALA 1M3SA 1ZMXA 6CHYA 4QELA 1FA9A 4HNAB 4JC4A 1KYIA 3IQXA 4KCGA 4BASA 2FZLA 1BXGB 1Y7LA 2H1IA 1S9HA 3HCEA 1RMTA 2TSYB 5M3BA 1JN0A 4O86A 4HT3B 4Q00A 4B83A 3T7RA 5IT4A 3LKBA 1VYUA 1C0LA 2ISCA 4KDEA 3A8TA 3KVVA 4NZZA 1KR5A 2PV0A 2WWXA 1IYDA 4U2KA 3WIDA 4AQDA 4WOPA 3ZE8A 4N47A 1M5TA 1VIAA 1ZJ5A 1RADA 5ENVA 3UH1A 3VNNA 1N56A 1N3YA 2JCVA 2MINB 3FWHA 3MRSA 4PZLA 1FJHA 4LRTB 1E7MA 1SXJB 4BGEA 2I80A 3L0PA 1I3QA 2CNVA 3KFLA 4RNNA 4OB6A 5AFSA 4F8EA 1PJTA 3CY6A 3DFMA 1F0NA 1AV7A 2IXAA 3L7NA 4NAVA 5DGXA 5DNYB 1XZ8A 3WYNA 1CKNA 5AIBA 3PX2A 5CK4A 2ILTA 4X3PA 3RAPR 4OD0A 1SXGA 4FR5A 5D01A 1NXPA 4RGYA 3OJEA 2V9WA 2VNIA 2IYEA 1G291 2EZTA 3AJ8A 1YCFA 3WGOA 3LP6A 3TBHA 2CVFA 2JA8G 4NECA 4NMMA 5HQTA 4G5OA 3IOCA 1WP4A 4ARAA 1C2YA 1L8QA 1ONNA 1QMGA 4FI3F 3UMSA 1LPAB 4DBLC 2VTBB 1XPJA 2I76A 1WXFA 3UZUA 2HXYA 3Q9LA 4MCHA 2WU0A 3BRWA 3ENKA 4TVBA 3TQSA 1J8FA 1Q16A 1L7XA 2UVVA 2WUDA 4QXRA 3SBOA 3H9EO 1KVSA 1VE9A 2RF4A 4LFBB 3VKHA 1E3EA 2VSQA 3QE3A 3V4ZA 3WLSA 5JQGB 1NVFA 3O7WA 1OREA 2D62A 3VX4A 3C3WA 2ZYVX 1YQUA 2Z8YM 2D5BA 3SC6A 2FZ5A 4DL3A 1A7AA 2FMUA 2H2FA 5SY9A 4DYDA 1OZAA 4MVXA 3V32A 2BHTA 1PT6A 3IPYA 2PQ0A 3U7QA 4KR2A 3TNFA 4X6YA 4BNIA 1DO0A 2ONCA 4GOXA 1EWYA 5DGDA 3NHKA 2WIJA 4RTNA 2A2ZA 4MVJP 4NXMH 1HL7A 5KFWA 3RYTC 1OGIA 2QPOA 1EGQA 2AQHA 3U7RA 4EA7A 3HDJA 1QBGA 1R5NA 3FUWA 4V0SA 2JFVA 4DILA 4CEJA 5BR4A 4KE9A 2IY7A 4CKXA 3F67A 3RBEA 1P8JA 2LXNA 1VE7A 1OPXA 5I4IA 1QZZA 1XVTA 1AMOA 4GYJA 2VJMA 2BFFB 5FHRA 1XFAA 1M2GA 1Z7BA 1TLLA 2I2WA 1N2HA 2ZFUA 3B3AA 3MW8A 1S3IA 2VXBA 4KXVA 4P5DA 3PUKA 2C03A 2QZ4A 2V4MA 3PFCA 4PV7A 4G0WA 5ITSA 4G3IA 5KFGA 1XLVA 3AU9A 3KUCA 4J1TC 2Y1WA 1Q7GA 3ZDZB 1U8EA 1R8SA 3K2IA 2B61A 4KE6A 4D6XA 5K3BA 4KXQA 2BR5A 3OQJA 4CV0A 1CJVC 1ZJJA 4M0MA 5I5WA 2OMEA 3K32A 3P2JA 4H15A 3GJ3A 4JX9A 2XKBA 4I3FA 3CR8A 5DVZA 1N8KA 2ZM6H 1I7NA 3E9YA 1AGXA 4LBYA 4M6WB 2DFKB 2F7SA 1N6PA 3DZDA 3I92A 3MPOA 4K9NA 5EPOA 3K70C 4R3WA 2EVWX 3AF0A 4O82A 1D2EA 4FW9A 1E9EA 3H1EA 1KHHA 2VP4A 4KWTA 3NRBA 2EIYA 2IYXA 1PJCA 4D46A 3GGOA 3NNSA 2ZIWB 3A2KA 3VHXB 4DG8A 4K6KA 4P84A 1YR1A 4GRIA 1KBLA 2POQX 5L4SA 4YC7A 3D6FA 3T5LA 2ES4A 3WWYA 4WUTA 3MS4A 4GOMD 3HUTA 4RNOA 3GIDA 1V8ZA 4GEKA 4QYMA 4OA5A 2WAMA 1FS6A 1EIZA 2QD5A 1KMQA 4ND2A 5FFNA 4LDPA 2JA6G 1E60A 4EYGA 5C5DA 2A3NA 2QRVB 2JEIA 1ENPA 4RHFA 4MMZB 4Q03A 1RP1A 3HRHA 2VHZA 2ZPTX 4LY3A 5LQSA 3RGWS 4U3JB 2Q0XA 4KBYA 5JTTA 1Q1EA 3QEBZ 1P0QA 1FRQA 2IHUA 4DYVA 4RZ2A 4EGCB 5J1SB 1J0XO 2NU6B 1HFKA 2HPVA 2D13A 1EEXB 3O5AA 1B74A 4GI1A 1DG1G 3I04A 4DW8A 4YUAA 6YASA 1B1CA 4AECA 4IILA 2IHBA 2W4QA 3A9UA 5IU6A 4YYZA 4I9GA 3IBGA 2XXJA 2J07A 3HP1A 1XR3A 3U40A 3GLFB 3ZTTA 1OFVA 1NI4B 1E8MA 1V16B 1IEWA 4I7EA 1YOBA 2JD0A 2HK9A 3E9CA 1BIFA 3PGVA 4XYGA 5E8JA 1OX6A 1YR7A 3PNPA 4FDAA 4MYTA 4AS2A 4NH0A 2A0WA 4B75A 3M6FA 2HVSA 2X2FA 1JIUA 2CV0A 4MWCA 3HOZG 1FVXA 5JMPA 1KGDA 3GCDA 5KFYA 1XZFA 1E1RD 1XZHA 4MRNA 5D3MA 5IBPA 5TEVA 1T34A 1CEQA 2DT8A 3BE5A 4Q93A 1ESNA 3RVLA 1HNWB 3DEJA 1DZ3A 3MGBA 4YCMA 1USIA 1C80A 4BV8A 4CLRA 2VL7A 5JXIA 2IL1A 1A2QA 4CLDA 1E2FA 3SN6A 1J49A 1V5GA 2NT4A 2J3QA 1Y1PA 2UVPB 3D3JA 3IO5A 4GZ3A 2R85A 1NJ1A 3Q3VA 4P83A 3C4VA 5CVDA 4WY2A 4ZP1A 3SICE 2B2XA 2XX3A 3UJ9A 3ODGA 3TBFA 3VKFA 3WY9A 1UBUS 1XZCA 4LX0A 3T06B 2PNFA 4UFPA 3ZZUA 3H1BA 1G8HA 1KJYA 2QVYX 3V4RA 5HBRB 4ZVRA 4F5DA 3AR8A 5DGTA 1XBTA 4JSYA 4RZSA 3AVYA 2HTFA 3OM8A 2OM2A 5DYWA 2QG9A 3I53A 1C4KA 1YCDA 4NG4A 1M6WA 1S5PA 4XUCA 1VZ3A 2NSYA 5BWXA 4UHCA 2HF8A 4CIXA 1CKOA 2FQWA 3D1VA 5C8DA 1CKMA 1YFJA 3LSTA 3OM9A 2WWYA 1MQAA 2YWJA 3GRVA 1FDRA 1WXEA 2AXPA 2GNAA 3B6IA 3PGXA 2VR1A 4WD3A 2VH5R 1EBFA 1N0WA 2JGJA 1XP5A 4H3HB 2IOQA 4NFYA 2EBHX 3TLMA 1IZ8A 4IQ4A 4KH1A 4XPIB 1YJ8A 2AJBA 4KUHA 4QDKA 3RF7A 4EG7A 3BA1A 4H6PA 2OV3A 3L5KA 1BEUB 4FXPA 4QG7A 2HB6A 3C6BA 2IV3A 3R9WA 3G6XA 5E4YA 3AVVA 3MELA 1R5BA 1L1QA 3N53A 4FYJA 3BGOS 3LLCA 1DS6A 4H7FA 1W36B 2CL5A 3L8ZA 4QVKA 1T9KA 2YIDA 3RYHB 4CUJA 3A3KA 3IALA 4LZPA 1C30A 4L8WB 2BMVA 4C4TA 4CUZA 3INRA 5EHIA 2ETVA 1LI7A 3NATA 3NKLA 3S44A 1QUEA 3PHLA 1E3IA 1EFHA 3GRPA 1FQKA 1JT2A 2VCYA 2G06A 2WLSA 4N3AA 4OQPA 4DXDA 3NIWA 3LP8A 5DHRA 3NBFA 2REBA 4ZC8A 2FRVA 5L3QB 3RS9A 4KQMA 4WKOA 1PFKA 3L1UA 5AIAA 5K0CA 3L8EA 1E2JA 3SZUA 3C8MA 4UEJA 1QE5A 4O7LA 1YL6A 3I3SR 3M6XA 2JGEA 3CZMA 4UARA 2QM3A 4C3UA 1ZYUA 2R84A 3QFTA 3WI7A 3WWEA 4JJEA 4NBLA 2Q1TA 1LNQA 1IYEA 1Y1WG 4BGDA 1VBMA 2HBQA 2JBHA 3B9QA 4X54A 1UPBA 3EDOA 1J8VA 3K6RA 3ACBA 4AZVA 3S2YA 2EFJA 3PGMA 5FBLB 2NUAB 3ETCA 1JHZA 4ZQEA 3ZH2A 3UVEA 1KDOA 1KSJA 3TZBA 1GKLA 2NO6A 3HOVG 4BBRG 4D74A 4BNKA 5AKHA 4XYLA 4FHFA 3SC2B 3GLQA 2BQ3A 1FNSA 4IV5A 3Q2OA 1B26A 1T3TA 3IVGA 2JCSA 3KHRA 1JVBA 3V9PA 4W5TA 4UTXA 4RVGA 3MJTA 1AHIA 2BEWB 2FN8A 2QM0A 3IP3A 3NP9A 4ZOLF 4KBGA 4W1PA 3RVJA 2XVMA 1NMEA 3LDFA 3ZE1B 3UY4A 4B9AA 1XQXA 1HH4A 2Q0HA 1PT9A 1I4WA 4MS1B 3VBEA 1JPNA 4CQJA 3EQ2A 3AM1A 4Q16A 3UAZA 4ZV4A 4YMSA 4D3SA 2BGWA 3I1FA 1CRWG 2FPSA 2BMAA 1HXHA 3JPYA 3JAWB 4MR9A 1XZQA 1XEWX 2VYQA 3FNEA 3JX9A 3DL7A 1TYEB 3GT0A 2MIIA 3LRXA 4S0ZA 2O2SA 5FD8A 2FLNA 3TOSA 2V9PA 3OESA 2CBGA 3U16A 3PW7A 4CEIA 5KQPA 2J3LA 2KSQA 3SIPA 5HYVA 1L8XA 4DV0B 3L04A 1CQZA 3NVDA 4UXIA 1ZWKA 1G7TA 2BC9A 4W7SA 3STUA 4ALNA 5K03A 1OWLA 1VJTA 4C30A 1WAMA 2JEZA 4QODA 5D51S 4JUBA 3W2IA 4C43A 1EP1B 4HYYA 3IGFA 5JATA 5JSZA 4N3CA 2F48A 4ZHQB 1GYFA 3KYJB 1VL2A 4ZU3A 4EY8A 3EEFA 3OZCA 5AJYA 3K6SA 1TVKB 1D9XA 3FTPA 4JJIA 4JUIA 4QEDA 4EQ6B 1RI2A 3V4FA 1NTRA 2DPHA 2YHIA 4FTWA 1ACLA 2JATA 1YB5A 4RJLA 3D6JA 1P16A 1XMXA 2IBMA 2P9JA 3L8HA 2OBMA 4NBSA 2AF3C 3CE6A 4RLQA 4WTOA 3RABA 4EY6A 3O83A 2AEFA 1LXCA 1OAAA 2F8SA 2FPRA 3GBVA 2JI7A 4X93A 3N8DA 2OILA 1D1QA 4DR6H 1ORRA 3PEFA 4JMPA 3F3KA 5BN3A 2VP3A 1EXNA 1OB5A 3SHOA 4RADA 3GAAA 1CS0A 1SUSA 1ZNYA 2GD2A 5JECA 4I4IA 2HDWA 2JLVA 2YFQA 4QW9A 1TUGA 3ZNOA 3JQBC 4B5LA 4CMIB 2P35A 1B6TA 3IHWA 4HDMA 3SQWA 2WZDA 4BLOA 3K15A 2O8DB 1TM4E 4NIMA 1LBHA 4YB8A 4CQLA 3HKZA 2PRKA 5A2QA 3ZWBA 1R12A 4J1SA 2QT9A 1BOOA 1M72A 1STOA 1BN6A 4RZUA 1J21A 1U2GA 1D4ZA 1XTVA 4DMLA 4F6RA 1KMNA 1W2WB 4YAKA 1OI2A 3SI8A 1K0FA 1LNZA 2Q5EA 1T1IA 3HWSA 5E9AA 4U2DA 3GTOA 1U0HC 2V5AA 5KYYB 1MNAA 2VYCA 1NNLA 3BT7A 3OCWA 2QNBA 5ALEA 2Z3VA 4JUZA 3Q6MA 2RB5A 3R0XA 4LOLA 5EKXA 1CUEA 4F97A 3OUZA 3L4JA 5EDWA 1RJ9B 4Q1BA 5BQXA 2QR5A 4P82A 4GO1A 3BFVA 1CY4A 3I72A 4ESVA 5H8WA 2W43A 3AM4A 3BBPA 3KXIA 1ZIDA 3HYTA 3EVCA 2QTVB 1MO2A 2HT1A 2XDYA 4AMBA 5IAJA 2R8RA 4AO6A 2HU7A 5CB8A 4PYQA 5KQLA 2ZBDA 4DV4H 5BWLA 3Q9UA 3EHDA 2VP9A 2YZGA 1R9GA 1O6FA 2N47A 2QIPA 4P8RA 4R9SA 4EX7A 1C8LA 5ICSA 1TWGA 3ZGNA 5EPEA 3VFDA 1V5EA 4D4MA 1TAEA 3SS8A 5CEFA 3U55A 1NLZA 3VYRB 2QLTA 5ICMA 2JAHA 1KOGA 1A9QA 2OHFA 3NHFA 4HZIA 1FP6A 1OCEA 1DBVO 1PSDA 2UAGA 4ZVSA 1OFTA 2ZM6B 1O9BA 3TN7A 3NHYA 5AVZA 1SG9A 4RZ3A 4FEYA 3RU7A 1YFLA 2ENWA 3F71A 4I1RA 4Q1VA 3D8SA 3DT8A 2HRQA 2W83A 4URYR 1JXQA 4NABA 3W05A 5JSUA 4B3CA 4NI5A 4JJGA 1QJCA 3BTOA 2EZ9A 3G1UA 3L7YA 3P4UA 3KOXA 1NJGA 4P3KA 5DP1A 4YCCA 2O7QA 2QENA 2V96A 5D1PA 1GEEA 1Z0FA 4FT2A 4GHWA 4MP3A 1WABA 3LKZA 2DQKA 3F0TA 3IBFA 4E2ZA 2IZ1A 5CXSA 1WV1A 5JNWA 4JXXA 1KA9H 3DOOA 3BRQA 3EY9A 3C70A 1B93A 4RNMA 4WKPA 4CQMA 2ZRJA 3R9IA 4R83A 4RCYA 2QN9A 5P21A 1KRXA 1UFVA 5FADA 1Z63A 4EBBA 4KLAA 4BNTA 2QP4A 5F5XA 2CNUA 2DU8A 2NSJA 2WT8A 1PG2A 3C6QA 2E3JA 2FFBA 2Q1SA 2BTQB 3F49S 2F8LA 3PUJA 2WNHA 2HJ9A 4ZRNA 1UDWA 4UUMA 3LCCA 1Y6ZA 5L8VA 3TZCA 3I2IA 5FL7A 1N2ZA 2X42A 3B2QA 4DTCA 1E4GT 1DKMA 2MU1A 1WSBA 1S7CA 4ICIA 4MRRA 5C0OE 2HYDA 1CP2A 1UFOA 5DI3B 1KI3A 4J75A 3WRVA 1P7PA 3II6X 4N0DA 2RAUA 4RM3A 4CJXA 1FXWA 1GGJA 3KXKA 5KFOA 2Z0MA 3NCHA 5LDGA 4CI0B 3C1OA 3FKQA 4OV6B 3KKLA 1XTZA 3LQQA 1AN7A 1WIWA 1DWOA 3WWZA 3NHBA 2P6UA 2ODNA 2ZI3A 3HBNA 3CZQA 3IT2A 1P62B 3IODA 3OQHA 3DOCA 5AW6A 5CLFA 4JJFA 3C7KA 1Z82A 2FZKA 4C4RA 1U0NA 1MV8A 1V9SA 2ZR9A 5HKKD 3MBIA 2IS2A 3EVBA 3TW4A 2A57A 2ZUSA 2ZJ8A 3D6VA 4KRFA 5DGHA 2ZIFA 3O47A 3OEHD 2PUAA 4BO9A 1MR3F 4Q4AA 4AN1A 4XCVA 5J2TB 2F2TA 2HWUA 4MUMA 3RGGA 3FPKA 3QI2A 4DNOA 2GK3A 3QWIA 5J63A 3FTQA 2I6TA 1GGFA 5EHNA 4E3WA 2WKPA 5FWYA 5JJCA 1V43A 5DCUA 3VU8A 4WZBB 2PBRA 1NXTA 2GYYA 1HY3A 2POCA 2Q46A 4CR6A 1PSZA 2PZKA 2HUNA 4UNSA 3CJQA 4HBZA 2PKXA 1NIPA 3HXLA 2O06A 3ABSB 2OCYC 2Z1NA 2ZTHA 3EZYA 2GETA 2ZQZA 4HDOB 1Z26A 3BUSA 4HDSB 4WWHA 5HIIA 3K0BA 3IIIA 5T6BA 5C51B 4IFIA 4L2IB 4RKFA 3UG7A 1VSUA 2VNJA 2WMDA 2PMZE 4CGYA 1P4AA 4OK5A 1QO9A 2BGIA 4K1XA 2Q7OE 3H4DA 3FHLA 5B3AA 3LYHA 3ZWPA 1QB8A 3ESXA 4ZGGA 4K81B 2MJLA 1ZD9A 3T4EA 1L5SA 1XPRA 4E21A 2EDCA 1SELA 5LIPA 2E4AA 3ZK8A 4LF6H 1S01A 2QMQA 1B04A 1DBSA 1OKKD 5KT2A 2GS9A 3H1FA 3LDUA 1USKA 4H27A 5BQ5A 5E7IA 4IXNA 5AW8A 2QROA 3HMQA 4FNMA 4GX2A 3SHFA 3VNUA 1H9CA 1GOTA 1ULTA 1FLVA 1DQYA 2I8LA 3BTVA 3NC0C 1PUIA 1PW7A 4X8MA 4XZ3A 3EQ6A 3P26A 4U9HS 5DCLA 1VLZA 3NRJA 1IBKH 2IY8A 3DF9A 5TMEA 2W9CA 4ER6A 2YQZA 4YAGA 4CG2A 5CXQA 1UMBA 3CKYA 3PENA 3UJ7A 2HPZA 5LMNH 2EEPA 5C1PA 2OQIA 2ZIXA 4B43A 4CCYA 4ALMA 4XW2A 4DB2A 1A8UA 1YDGA 2OGZA 2UXCB 2XB6A 1T5OA 3DVSX 4QOGA 2D4AA 4B6PA 3K05A 5KFPA 5B53A 1T3HA 3G9QA 4TWZA 5JCJD 3FVVA 4AFNA 3UJNA 1YQXA 1Q84A 1O6GA 2HHLA 3GUHA 4KO3S 5JPIA 4YCNA 3ZDQA 3ZE0B 1AV6A 3LA6A 3GRZA 5KHAA 1ZAUA 1Z4NA 3FGPA 3FVTA 3NBQA 4GT1A 2CEAA 4FFVA 3UK2A 4BJ3A 2NADA 1AB5A 2ZS7A 5CHEA 1Z6ZA 5A1JA 3MK31 4Y1GA 2AIRA 3S28A 4Z4EA 1H2FA 1FRZA 1DE0A 1JEYB 1YQTA 1JQJC 1E4VA 4X8OA 5EJFA 3SJ7A 4G0XA 4K40A 1QXSA 1BS1A 4DRZA 4KE7A 4RB1A 4Z4CA 5DNCA 3LXXA 3W6ZA 4OU5A 4WGFA 3MTQA 3FNQA 1Q6ZA 3GJ6A 1O5TA 1BH6A 4FJ1A 5ECYA 3VOAA 3V4LA 3JRXA 3LCUA 5CYFA 1ZLYA 2NTNA 2QPLA 2WSBA 1TTQB 3E70C 4FGZA 4OO3A 4TS1A 2YKGA 2XCLA 1B1AA 1N7JA 3DHEA 1U65A 2M1XA 2A9PA 1VKOA 3FIUA 3KTOA 1DWUA 1E32A 2A5GA 3E3MA 3LY8A 5EN4A 1ZL0A 2FPWA 2PUHA 3UOWA 2GPBA 5KFZA 2HGWA 4RZRA 4IRUB 4BLRA 3EVFA 5GGXA 1D1TA 2ODWA 4BYGA 2V0NA 2XYRA 1KDZA 3VDQA 1PF7E 2YQ4A 4KV7A 2WF8A 4LJSA 3ZE7A 3SJBA 4B3TB 2WAYA 2H1WA 3OKAA 4LECA 4UAGA 2G8LA 4DR7H 2QTLA 5J59A 1UMKA 1N3LA 1I3CA 2IA5A 2GZ1A 3LGSA 3R6GA 4BC0A 3TG8A 3GYBA 3OU2A 3DFZA 2ZULA 3SKXA 3NC0B 1JIJA 1HTWA 1RWWA 1GZDA 1DRKA 1HZZC 4LDJA 1LBQA 2NXEA 2I8AA 4OQMA 5CTJA 5EZ6B 4AJ9A 1SYXB 2HSEA 2A0FA 3CZPA 2RGXA 2OT3B 3I8XA 5B4TA 2GCNA 1KJWA 4EW3A 2GMWA 3L8DA 3AUXA 3RSQA 5KKNB 3U81A 1VJ1A 3KOWA 4ZYZA 4GGMX 3I2GA 3LHFA 2PX3A 3A4MA 1PVOA 1UC9A 1N6LA 1P5FA 1QM5A 2N9UA 3CNQS 4TVOA 1NKSA 1UDBA 3ASZA 2KS6A 4YRCA 2PZMA 4DC0A 1M5RA 4JI7H 2DPJA 3BEOA 3X1XA 1AHNA 4GYKA 2OYSA 4A82A 5CPFA 1RZRD 4Q3CA 4R7ZA 5AUQA 1U0SY 1P5RA 1YVUA 3FBTA 3AEXA 3IT1A 3RWOA 2DIKA 1JLRA 2PUEA 3OBBA 5JWRA 3BGVA 3HRIA 1ULHA 2B78A 3BL5A 3BJRA 3FLMA 5E6UA 5F77A 1KDVA 4DRXB 3CCFA 2BWJA 3SCZA 4PYOA 1CYEA 3H3VH 4MJLA 4DUYH 4ZD6A 3UJDA 2XD9A 4TT8A 4FMBB 3C3CA 1Q92A 1T0UA 2VBCA 2ZUTA 1W46A 2O5CA 1ZJZA 1T9BA 1XTPA 2ENUA 3IA7A 3K9NA 4PWYA 5IT0A 3FSRA 5A6SA 4PXAA 1U81A 1VFPA 4BRZA 4LWOA 3ZD6A 1NNSA 4MKFA 5KTOA 1KP2A 2JFNA 2VP2A 3BF8A 4NLLA 3RT9A 3V8VA 4MUNA 4IIEA 1C7EA 1N75A 2JCBA 3OCZA 4QL3A 1FRNA 4JV5H 1A98A 2ZIEA 5E95A 3FFBA 5J1TB 4EZBA 2QN3A 4LBWA 4ZDJA 2UVQA 1VHWA 4Y6OA 3HPRA 4B80A 1V2HE 1Y82A 3CLRD 3E15A 4KO4S 4C7OB 1QFJA 4YJ3B 2P90A 3E23A 3GRFA 3E8SA 2DH5A 2D54A 4A8JA 5LQUA 1KRHA 1U28A 2RBKA 2VA9A 2ZE8A 2ACKA 1Y4SA 2V4ZA 3EE6A 4JVOA 3TPCA 3VZSA 1IY2A 3T5JA 5IUKC 2Y1EA 1AC5A 2FF5A 2FDRA 1O6ZA 1CUYA 1P29A 2ZUCA 2P6NA 5T67A 5I5VA 3UK6A 1K83A 4YLEA 5BN5A 5AK5A 4XPZA 3Q5GA 6ADHA 3RS7A 4IIYA 2ZYHA 1AS2A 1M8FA 5FORA 1M8GA 1R8XA 3GPCA 3H9GA 2J7PD 4HH4A 3EMBA 2ISSD 4D3ZA 2JA1A 3NAZA 3FMAA 1XELA 4M9ZA 1I24A 1YO6A 3OD1A 3UK1A 3R1IA 4CEIB 1N2IA 2VOJA 5AKIA 5C31A 2Q6OA 1CBUA 1E1NA 1PWYE 2DSTA 4FFSA 1ONPA 1KDYA 2C9MA 4COKA 4HX9A 2XRYA 1WZ2A 4GR9A 1EVJA 1TW3A 1V8BA 3RHZA 3GLTA 4EO9A 3R6WA 3LCVB 4F9FA 3WRXA 1OIWA 3SQDA 3A3YA 4CMEC 1MZPA 4RKRA 3EUAA 5A3VA 2WFLA 2XA9A 3ZC3A 4QEZA 1E77A 5JCPA 4BATA 1WXXA 1YMVA 2B5WA 1V95A 2GT1A 4DBVO 4YRAA 2QR3A 2BTQA 2QU8A 3PI7A 1PQYA 3T34A 1KFCB 1WB9A 2CK3D 1GRQA 4HS4A 4I8IA 3VXKA 5IPFA 3IDSA 3DDUA 1U04A 5MN5A 4A15A 3G2KA 2P62A 3F96A 4QGBA 2ONJA 3PJEA 1S2OA 3OHAA 2DBRA 4M9XA 4WACA 1C2TA 3DULA 4B4OA 2PYIA 2G8NA 3QBVA 3GOQA 3S2ZA 3RK0A 4XTCS 4E5NA 1ODKA 5J4HA 4KPYA 4ZJPA 3KJHA 3CNHA 4Q3AA 1U0FA 4V1CI 2ZRLA 3FAZA 1FC0A 1ZOIA 3PCTA 4PGFA 1ZKDA 3K8QA 1N0HA 4CMIA 3DXYA 3VISA 3L0OA 1YGPA 2Z4SA 5FPSA 1TO2E 3FTCA 1J0EA 3DW1X 2ZJ0A 1WUIS 3DP9A 2AN4A 3GRCA 1N34H 1JEQA 4S1NA 5K45A 1Z4LA 5HILA 1KAQA 3MG9A 5L7WA 3OTOH 2Z6UA 2IUSA 4P34A 1YHNA 1T15A 2E4YA 2X6QA 5T4FA 3UUWA 3WLTA 4BBZA 2LDBA 4KVFA 1Q3HA 1VL1A 1XDBA 3E6AA 2DHEA 5BMVF 4FB5A 2I55A 1LLDA 2Q50A 1NR1A 4DR6B 1LF5A 1JT9A 3I5YA 4D0LB 1ISJA 1YAHA 4RAZA 1YB1A 1ZGJA 1DADA 1EK0A 3ZHZA 2DQYA 2WD7A 3EZGA 3L6CA 4WKNA 2IHYA 1KERA 1OV4A 3CZ9A 3EDMA 4IHAA 4RKWA 4GBED 2C1EA 2QRLA 1GNSA 1VA4A 1PE0A 2HXSA 3LBNA 5BSUA 1P2SA 3VDRA 4ZT7A 4DM7A 3RFFA 1GCUA 1HKHA 3Q0EA 4K9LA 1QYVA 5DISB 4DARA 1TAQA 3GELA 4XM0A 1TAGA 3QFHA 1L4EA 4EJSA 5CHYA 4ZCLA 1XXHE 5K3FB 3UMCA 3STVA 1MEEA 1KYTA 1P4RA 3L8GA 1YMQA 1CDZA 1S8NA 2DH6A 3E22B 3DGFC 3GWZA 3ICVA 3O94A 1BCRB 4RZXA 3ZDXB 1F4PA 3D7MA 2JGRA 1WDKA 3NAGA 4K87A 4O4HB 4L78A 1JQLB 3MWGA 4AY5A 3MIZA 4PLWA 4UREA 3OIGA 1WQ3A 3EB9A 4M7WA 4PCUA 1ZLXA 4QQFA 2YUTA 3WB2A 5ER9A 3GIQA 1MO6A 2B2NA 1WETA 4DREA 3OEEA 1HLFA 3ZE6A 2LD4A 3FE2A 1KBZA 3OCCA 5FTKA 3NWPA 1N5JA 2JFUA 4KODA 4L4ZA 2R1VB 2VJAA 1ZETA 1VHJA 2CNDA 2WM2A 3IRUA 1E6CA 4FCTA 3AUSA 1P2FA 2V98A 4IHJF 1KMIY 4P80A 3T3PB 1M6NA 2SNIE 2WYHA 2PKEA 1LLUA 1U31A 2Z8ZA 3TO5A 4F2PA 1CWUA 4IWXA 4Q21A 3CZAA 4MR8B 2I91A 1QCDA 3TOVA 5BWUA 3NYIA 3H5LA 3MQFA 4DV4B 1ODIA 5ALLA 1WP9A 2QQ5A 4RORA 3ESRA 4TMYA 2JLUA 3ECCA 4V0MA 4C1NA 4KOAA 1OFIA 2FPLA 1Z0AA 1SUDA 3OA2A 2F3QA 3ZCSA 3TNDA 2AQ8A 1BKSB 1UJBA 1GU7A 5IHXA 4OAOA 3THOA 3LG2A 3D0RA 1Y9DA 4I55F 2G63A 2WWTA 1U6IA 4IDCA 4PZPA 2PA3A 1RZVA 3F6YA 1JJIA 4NHOA 2I03A 2B3TA 5CDHA 3IP7A 3AI1A 3EBLA 3WFIA 4Y2GA 2ECQA 1VC2A 4QKQA 1ND6A 4OJKA 3VU1A 3GGGA 4NOLA 3MHTA 3TG2A 4GXRA 1RWQA 1QANA 2JI6A 5F4BA 3OCXA 3T9AA 4RFVA 1Y6RA 1I7SB 3E0XA 4KQ2A 4S04A 1Q1QA 3A1WA 1NN0A 5JI2E 2H4HA 3QTBA 3COJA 4WLNA 1NHWA 4FGJA 4MUBA 2JAOA 4G5SA 2VJCA 3L05A 3HCBA 1LJUA 4CMDA 3OPQA 4G9GA 5AVWA 3AR4A 2JB9A 2P1ZA 2R7NA 4XM1A 3PHJA 2ATVA 6GPBA 1K0UA 5EZYB 3ZGZA 1PTJC 3A2MA 3I83A 1DCKA 4KJZA 3FMOB 1WHTB 3GCWA 1FDIA 1OXUA 3EFOB 1GL3A 1GQYA 4YMIA 1Z4PX 2G70A 2I66A 2FA9A 5C4IA 1M83A 5JYBA 1FX0B 2DUNA 3NJ4A 1IONA 4YN3A 1WXGA 4C0BA 5DTRA 4CMHA 2FETA 5IKXA 2Z98A 3CURA 3FTNA 5DN9A 5K8TA 2OG1A 4J7UA 1G3UA 4CLHA 1KJJA 1A88A 1XWWA 2NUAA 1CJUC 1PL0A 1VIDA 2GHTA 4BQQA 4CHIA 2AOXA 4II7A 5C44G 4YLGA 5GP1A 1B6GA 3AF2A 5M29A 3L7LA 3RC1A 1H0RA 2Q1UA 5LOVF 3RH0A 3EFEA 4JEHA 4CM4B 2ERXA 3LUCA 4JL6A 2GZSA 5L9AA 1V45E 4UM9D 3C3MA 4NPAA 3BEDA 3BMOA 1YR2A 3R3UA 4HJXA 4OUDA 1ZK4A 5IXYA 2NNWB 1A3CA 2I67A 2GAFA 4IF4A 2JC3A 4YJGB 5AM4A 1MDBA 4Z9AA 2Y0SE 4BNJA 4LJ8A 4MHSA 7ADHA 3THWB 1Y0BA 3VAAA 2Z09A 3EPPA 3LQRA 1O8BA 2B30A 3LX4A 5CFQA 4NPHA 1D6NA 1IXZA 1NUAA 3K96A 2R6FA 4PLTA 1VLLA 4WBNA 2MCFA 1X92A 1HE5A 4CNQA 1KEEB 1U99A 1CCWA 1JFVA 3DBHB 4KH0A 2VUMG 2JI4A 4GPAA 3QXXA 1U63A 4GLXA 3CISA 3AOEA 3AF4A 1R6VA 3IHKA 4HGRA 1Z34A 3WOVA 4PR3A 1JJAA 3U1VA 3U3OA 3D8HA 1U0RA 4RIFA 2D1YA 2OC9A 4I46A 4FFLA 5JAHA 3WWIA 4YDHB 1SOAA 5EOVA 5A9RA 1M8PA 5ICFA 3FOFC 2LR0A 2OZPA 3M5DA 2QRKA 2X86A 3EPKA 3ASVA 1ES9A 4GIBA 3W9YA 1GL7A 2HGZA 3FPFA 4ZQFA 3QW2A 1UBKS 3GRUA 5C80A 2AOTA 3IEIA 1NJ8A 3TTTA 1JU4A 3GGPA 3NBMA 5HV6A 2G5PA 1ULAA 4Y3UA 1YQEA 3CINA 3DZGA 5ICCA 1VIMA 2Q8NA 2AC4A 1K86A 1ID8A 3BRCA 5FEUA 2AJCA 2PJUA 5AKEA 4BWGA 4KSCA 5DQIA 3VQTA 4JDPA 1JVSA 2YWCA 1P0MA 1RM3A 3W9SA 5JAZA 3DUFB 4TTJA 2A5YB 2JH8A 1JQ3A 1V4NA 3TY5A 3STHA 2IYYA 2ZYIA 3L7IA 1HV8A 3JARA 1AZTA 2OAGA 4J2TA 3T5KA 1WW3A 1XMQH 3V4SA 1ZHSA 1U98A 2CDBA 1IY9A 1EWTA 2H7CA 2PCJA 4X65H 1N0IA 2WU4A 2OV1A 2QPTA 2VF8A 4R69A 2E4XA 2HC9A 4C0XA 5AR1A 1GGNA 2APJA 4A1OA 4MA0A 3E7XA 4J0JA 1DKLA 5GQSA 3ZHYA 3QUQA 4Y2PA 4JJ6A 4D9KA 1JU9A 2VJKA 3K94A 2EKZA 5K3DA 3BGDA 1NDHA 4L73A 4DCTA 4PN7A 2R9VA 3QY0A 4JYAB 1DBIA 4AS1A 4KI0A 3RODA 2GEJA 1X19A 3OLCX 2D3WA 4LZLA 3T7JA 3LT4A 4N65A 1U2ZA 2ZSHA 2R4UA 2IP1A 4B71A 1COZA 4UHFA 4BVLA 1X0XA 3WHKA 2D7DA 4XSVA 3A9RA 1NYRA 2DGDA 3ASUA 3Q85A 2R2AA 1CUZA 3LPDA 3M70A 4FFBB 4ND8A 1C7RA 4ZAGA 4C2MA 2A67A 3ZXYA 1Q0LA 3DHYA 4IV8A 2A5JA 2PMKA 5DM4A 3HTXA 3D7LA 5CDYA 1PZXA 3QWHA 4TWAA 3PXDA 4HVAA 1UDRA 5KVAA 1Y7PA 3MERA 1UEJA 5E2BA 3M6WA 4CEJB 3TD2A 3T5AA 5SV2A 2A9VA 1L7VC 3SM3A 5DN6D 1UINA 5F9HA 1FOEB 1WMBA 2QLMA 5BOVA 4RB2C 2D4HA 1D2NA 1ORIA 2QB5A 5IVPA 5K3WA 4NCHA 2VSFA 1SU4A 1CEXA 1JR2A 3AB3A 3FNFA 4O81A 1TUEA 1XC7A 5FWXA 2ACVA 2E6UX 5CBPA 1P4GA 1NQ5A 2QLFA 3I4NG 2TMDA 4FE7A 4MZXA 5EUBA 1L5HB 4CFZA 1KJQA 1SCJA 2Q3FA 4RHXA 5CCBA 3GLGB 2QTZA 4TYQA 4ACAA 1TZKA 3RUEA 3R5TA 3N0TA 3FMPB 3J7AK 2WT4A 1N3BA 4Y2TA 1G7CA 5HEKA 4RGBA 3S81A 5CA0F 3ZD8A 4CL8A 1D0IA 2IEGA 3GPDG 4OPMA 1BHSA 3PYLA 2QBYA 4D4LA 1J0BA 3OTHA 1IM8A 2QT1A 2UYYA 3BS4A 5C37A 4B6RA 1IWOA 2X4GA 2ZB7A 4H7PA 4O7VA 4OYRA 3TI7A 2AMJA 4AZ3B 5IM4A 3PN1A 1U94A 1Z7YA 4HNAA 4LY0A 3GQBB 1T10A 2ZRGA 1GV1A 1HQYE 3GZ4A 5L3RA 2VBIA 3W1VA 4MUXA 2J4CA 4DQNA 2RHRA 4PU0A 2VJDA 4EA6A 4EVIA 4I5EA 4N48A 2QRZA 4OFXA 3HT5A 3NH9A 3DBOB 3ROZA 1LRJA 2J5KA 4WV3A 1JX4A 4Z0TA 1MJGM 4EY7A 4NEHB 4YMTA 4ZT3A 4F86A 2VNHA 2WJJA 1XX6A 3BL8A 4YRFA 4CF4A 1VRVA 3QE4A 4IKEA 1JFSA 5DGAA 3H18A 1QCCA 2CXRA 4C03A 3I6IA 1E2PA 2OD2A 4DC1A 4XEHA 4BWFB 4HB2A 1D6SA 1QNFA 3EYYA 2EBFX 1EFVA 5CA1B 1RQNA 3RUHA 4G1MB 1IBMB 4UJ3A 1P0FA 2ZAMA 4P1ZA 4R0VA 1OZGA 3S2IA 1CR6A 3UAXA 4LSXA 2FVYA 4PO3X 2P9QA 2F8TA 3NKVA 2ORYA 3RTBA 3JS5A 2BDTA 3EVNA 4GMFA 4IL5A 4WXYB 3T3NA 3EIHA 3H13A 3N1UA 2YJZA 3WGTA 3BILA 4JVSB 4WHMA 2AL7A 1CB7A 2BKXA 1XT6A 4ZVVA 1UFRA 1S9DA 3H3XA 3ICPA 1IFXA 8MHTA 4F4UA 1KJIA 4B3IA 1S96A 4HQFA 2IHZA 3KQQA 4MW6A 2FMTA 3EA0A 4H6WA 4YRBA 3CZ4A 5BVGB 1VCHA 5LDDC 5F3DA 3BIXA 1JXLA 2X3UA 4M8NE 4QEKA 2CNLA 3ECSA 3HV0A 4CM3A 2CXQA 4Q45A 3I9V6 4OGKA 3X1JA 1DG9A 5HKBA 2CJWB 1AD2A 1NQXA 3EX7C 2GN9A 3VJRA 4JU8A 4JI8H 4RTPA 5K51A 3EF3A 3IX7A 2JFHA 3UNXA 5L3ZA 2EFGA 5SYNA 3RUDA 4OCZA 3ESAA 3A1UA 1MOZA 2HA4A 5CU7A 4JXUA 4I14A 3JQFC 2DBQA 2HBRA 3LOUA 3L7KA 5EIWA 3S2GA 3TI9A 4I4TB 4E4YA 2FX5A 4HZGA 5NLLA 4BN4A 3RC8A 1TQDA 2PT6A 4QM7A 3ZDDA 3EH1A 3LY9A 2UXBH 1XOIA 2RHBA 4LYFA 3TRDA 4FE3A 2FEOA 4J0CA 3TS1A 1ULBA 3TLBA 1R0RE 2YJ5A 1K3UB 2PUJA 3FYUB 3E2MA 2PZLA 3TIXB 5DOZA 4QGSA 5IABA 5IN5A 2CL7X 4DIMA 3U7IA 3B53X 2MWMA 4GH5A 4YAIA 4HV4A 4Q66C 3OMLA 4N7MA 3K9BA 2E9SA 1PGPA 2B7CA 2TYSB 5MHTA 2QZZA 2EG5A 4RLSA 4DVJA 4G0OA 4MINA 2XCUA 3WAJA 3EEBA 3RUIA 2BUCA 2LCQA 2H4WA 1VYHA 4FMCF 4ITVA 4RK6A 4WNCA 3F4BA 3RO7A 2O2DA 4JELA 4LQDA 1E20A 2RSLA 1VBKA 2J3HA 4MPRA 3LF2A 4ZVKA 1TW2A 1WB6A 5EC8A 5FYDA 4QSMA 3SLGA 1RPZA 1USGA 2XUIA 1DC8A 1SOWA 4MQFA 2MT9A 3BZWA 3JYLA 4RXMA 1V41E 4JGBA 5T4EA 4QYWA 3HB4X 4AJEA 3L7AA 1ZJWA 1NBHA 1I6KA 2Q9BA 3GROA 4TZ0A 1KPGA 1MIOB 3AXTA 1JSCA 2QYHA 2Z9CA 1BXGA 1YZQA 2P0EA 3NIDB 3I45A 4LF8B 3H42B 4YTEA 2EW2A 2P9CA 3LF1A 2QU7A 5A4IS 2AYZA 4P0TA 1GHTA 1E2NA 1M7GA 5KPJA 3I8OA 5IYZF 5ISMA 2IVFA 3DBIA 3EPIA 1D4OA 1WPQA 4TSRA 5JFTA 4PG7A 1VJRA 5C34B 4F4CA 2C3MA 1TCBA 3DT6A 3ZWKA 2GDJA 2BM0A 3RVOA 1OFUA 3AG6A 4GOND 1S0UA 5DMXA 1Y5LA 4HK4A 4Q0MA 1NURA 4KPEC 3NTRA 5EWFA 4ZICA 2QXUA 4TYNA 3W5CA 1MKYA 5C5EA 5SZJA 4QT0A 5FJ8G 3FSGA 4JI2B 2HTEA 4BKOA 3EJWA 3UJ6A 3G2JA 4JLAA 1FMTA 2E37A 4DDKA 2A8YA 4B7XA 3CRQA 3T41A 2V6IA 3U4AA 5CLIA 4ZEOA 3EXIA 1FP7A 4GGOA 1R88A 3EAQA 1GR1A 1RQ7A 2V45A 3PXAA 4R51A 3ISTA 1P73A 4RCZA 1L1EA 1GKUB 1JV2B 3GGCA 2FR8A 2PD6A 2YN4A 3COYA 4LMAA 1ZRMA 4BFCA 4PYLA 2W6IA 1US8A 3DZJA 3SPXA 3KELA 4BEJA 1ZN2A 2OZLB 4JK3A 3ID6C 1IM2A 4J2HA 4N9QA 4P4TA 1B4DA 5IP5A 3SHVA 4A6PA 5ITZA 2C7PA 5HKLA 5ES3A 4ILKA 1E3DA 3IXQA 2DCMA 1E92A 2R7ZA 3NZEA 5IC6A 3N41B 1SHUX 3H19A 3RIXA 1PW5A 4KSYA 4BQIA 5JO9A 3RF6A 1F8YA 1RVV1 4WBNB 2CCGA 3KK0A 2VF2A 4B0OA 1HFWA 3FB4A 2FWPA 2AZDA 2P9TA 3GFSA 3HMKA 3WMWA 1JSLA 3K3PA 3T61A 3TFOA 1REQA 3E7PA 3DEHA 4YY3B 4KMRA 3RR5A 4KUEA 4FILA 4LV6A 3Q2KA 2FZEA 3NGLA 2GPJA 5D5HA 5ALKA 4DWJA 1S89A 1FFEA 2C04A 2F1HA 3NM6B 4WKCA 2JBWA 3F7NA 5LA6B 3TW0A 4KDRA 4HXYA 1ZK1A 4HZUA 1IULA 1V8FA 2Q2OA 3TGWA 5E4FA 4YP9A 1OWNA 2XYVA 4HLCA 1EFVB 5CA1A 4KITB 4YJ3A 3DMTC 1VB3A 3I62A 4ND5A 4HPXB 2WZQA 3HGQA 4PRYA 1CNFA 3UFXB 1WF6A 2P9GA 5CB4A 1XU4A 1V5FA 1Y1TA 4Y2VA 1MENA 3RIGA 4R0MA 3UAWA 2VUTA 3P9PA 2FWAA 3BZUA 4EHAA 2Q5LA 3X2FA 4H1VA 1HETA 2VP0A 1XU9A 3LIIA 3UCXA 2C0QA 3UTCA 1CF2O 3ZCXA 4Z7OB 1KO1A 3UCEA 2IPMA 3NI2A 4APMA 2Y4NA 4QX6A 5IDYA 3CW8X 1EBUA 5AVOA 1BO6A 1T4MA 1FF9A 1QK5A 1RXUA 2FN9A 1YZGA 3CLHA 4Q1DA 2AI1A 4C07A 1U8TA 4HDNB 2F1IA 1UJNA 2BM1A 4I5FA 2DUUA 5KKAA 5AESA 2EJVA 3OKPA 4UUGA 1R6TA 4IGIA 3RVPA 4WY8A 4OM7A 1NF8A 3H8WA 3R23A 5AK6A 4O4IF 2QX8A 3OG9A 1TVEA 1JQ5A 1SWVA 2J3DA 4K6HA 3OWHA 4QFBA 4LW8A 4A3BG 3HKDB 4G0MA 5FBHA 2GZRA 3AGPA 1UKVY 2WIDA 3C3YA 4E5UA 2ZUFA 4FYVA 1TDJA 3BE4A 3PXBA 4MUHA 3HYSA 2M05A 4FQ8A 4U6QA 4EG3A 2WSSA 2H2AA 2OK7A 3LLMA 4X24A 3MWKA 3BH7A 4G01B 3PLAE 3AEYA 3WL3A 5LA6F 4NAHA 4IDEA 2CHUA 2G07A 4RHEA 1A4IA 1D7AA 1Q5PA 3ZOZA 4OHVA 3VVCA 3GBSA 1GPNA 3WBKA 1E9VA 1UT6A 2ZWOA 1ZM2A 3ESQA 1G5TA 3EVGA 3SHTA 3VO2A 5DM60 2QMUA 4DQXA 5GADl 4YLYA 3W5IA 3WGKA 2JJ1A 1VLQA 3GTPA 3H99A 1IBLH 1Z6QA 2VH1A 3JQGA 2BMEA 2YIVX 3NASA 4TXHA 3LO5A 3AM3A 5K0SA 3AHJA 4L72A 4DG9A 5KYWB 1EXMA 3X44A 1W35A 3VUEA 4W1RA 4IVRA 5ELXA 3QNUA 1YRYE 1A5BB 1DU4A 1XZJA 2NP7A 5AVVA 4YJ2F 4XIGS 1UOQA 5I51A 1DAIA 1PR6A 2C5BA 3EZ9A 5BUSA 2EJ3A 2FOIA 1I8TA 2Z2XA 3JRWA 1TK3A 3O38A 4QOEA 3GA5A 3G89A 2X0JA 3TH5A 5KYGA 5GM1A 4GC9A 5HF8A 1O4VA 16PKA 2VT3A 4FC6A 1GZ5A 4KLRA 3RFVA 2NYUA 3L6EA 5DLPA 5EFZA 3JVEA 2Y68A 3IP5A 3IQGX 4S1VA 2K2WA 4P6VF 5TGDA 3ZGOA 5DEOA 2G72A 4CQMB 1MNQA 3ACCA 1K5DA 2VSYA 5ESWA 1Q7TA 2YJ4A 2DCUA 4PSAA 3AEQB 4XJVA 4JC5A 2ZDGA 1WWKA 1RQRA 3GLHE 1Z56C 1ZG3A 1B16A 2UZ1B 2I7CA 3FROA 3IV6A 3GGJA 3KKOA 3HHPA 4GXNA 4OOEA 1K88A 4TV8A 5ILGA 4DA7A 4DY6A 8AT1A 1W36C 1IOWA 2ZSDA 3KAQA 4AY3A 2ZTMA 3T5MA 2HMWA 1RYHA 1D4AA 1HYBA 1E5VA 3CUUA 5DHQA 3S7ZA 3AUJB 2NZWA 4Q01A 4ZPJA 1MB3A 1T35A 4KN6A 3EXFB 3WNVA 1EI9A 4FW8A 4YX9A 5JADA 5LNK1 1RRCA 4NZNA 3MZ0A 4MCAA 5JAMA 4H6XA 3I8SA 5DBGA 1NONA 3VR5A 1JLLA 1UZAA 1OWMA 2P2GA 2XNDD 4WSOA 2Q2TA 4A3SA 1CUXA 5I9LA 3U3ZA 1PKXA 3AVWA 5KG4A 5E8RA 3BQMB 3ZLVA 4F4JA 5KDOA 4R1OA 4R2KA 5HF9A 2HYIC 1LTKA 2FHPA 2RH9B 1S02A 4LQ4A 1LGYA 1GJRA 1RYMA 3KYDB 1NNI1 1PR2A 2Y27A 1CJCA 2C5GA 5TQ0B 1BG6A 1YRHA 1O87A 4CMEA 3UZOA 5IJ9B 1VMIA 2VPWA 3C5HA 2F1RA 4H7EA 1UC5B 5TQ0A 4W5QA 1CQXA 3WRXC 4JODA 4CXMA 1KO8A 1U1CA 3WP0A 4YMGA 3VH4A 4RVCA 3MWDA 2YNMA 3NTXA 1KI8A 3JWGA 1TCCA 2XWJI 4HSEA 4IXWA 1F14A 2WB1E 4G09A 4LTDA 2UU9H 3ABQB 3D4OA 5T64A 3RQSA 2R92G 1I6UA 1EQUA 1WV0A 2PMDA 5D6OA 4DE5A 1T25A 2CGEA 3KSDO 5FWYB 2IYQA 4EKYA 4YFYA 4JI3B 3BH0A 4ZO4A 4C14A 1T2EA 4AY4A 1RQLA 3OLQA 5TE9A 3HXTA 4FE4A 1T1RA 3RS5A 4LRQA 4QTZA 4HSGA 1SUWA 2F62A 4H0FA 3C6MA 4GVLA 1JAYA 2DWOA 2RHJA 4NBNA 3NBAA 1T8PA 3H11B 3OZ7A 1IL0A 1CNEA 3QVVA 5G2OA 2JG3A 1NVAA 3JQQA 1NI3A 3CH6A 2WTUA 1QG4A 2OV4A 5JRDS 1G9TA 1IOVA 1J5EB 3LD9A 3IEVA 2E82A 3O74A 1CS0B 3RSLA 5BW5A 2IS1A 2X0SA 3PNYA 5DO9A 1DAMA 3TIVA 5FBVB 2B98A 2IOFA 3I2FA 3ANMA 4G0PA 5D3MB 4Z4GA 1TC1A 3RRBA 4Q1EA 2A5FA 3HJCA 4LKOA 2BTEA 1ZMOA 1XCOA 4X8LA 1U8FO 4Q6BA 3DAHA 3QJGA 3RRYA 1LDYA 1H0KA 3JR7A 1JMYA 1NNUA 5FOTA 2X1VA 3I32A 3CVVA 1JEAA 3NNNA 2VHCA 3RT1A 3PSAA 1TOAA 1GKIA 4U6PA 2W7TA 2Z95A 3AHCA 4MR9B 2FMIA 4ZI2A 5ADWA 1RPAA 1OHHD 1IIBA 3PUIA 4TSFD 3SAJA 5KI6A 3NWJA 1U7PA 3B2EA 4RZHA 2CXOA 3EXEA 1V1RA 1MAUA 3D6HA 4KTTE 2IBTA 2A78A 4FOLA 4OUKX 2YU9A 2LP4Y 3T3GA 1QV6A 2DPXA 1CY2A 1VHQA 2AI3A 2JI8A 1AGRA 2G82A 2ZSBA 4PVCA 1X3LA 4LPSA 4YAFA 5BSVA 3NORA 1O95C 1KE1A 4QUEA 3ICEA 4AO7A 1X7HA 3F47A 4WLOA 1SULA 3HB1A 1H69A 1U2RA 5IZCC 3IEUA 5IN4A 1FDWA 3OE7A 3IIJA 2W00A 3FDJA 1TCUA 2XT9A 2REOA 1JWBB 1ZGZA 2X9VA 1P2UA 1YHYA 4I7HA 2FJZA 1IEQA 3OX3A 3AEKA 3S7TA 3H5VA 2PT5A 3A10A 3TCKA 5KTYA 3EQ8A 4IDPA 1L7RA 4B4VA 4CM9A 3KNZA 2FLVA 4R2MA 1WTCA 1XRNA 2RCYA 2FZVA 3FCOA 2BFDB 3HDHA 1MIOA 3TE7A 4AJIA 2CLLB 1XJ0A 2PX2A 3FDZB 4EAQA 4ZZ0A 1J23A 5HGXA 1TF2A 1OXSC 4A2WA 1MVOA 3UQYS 2B4TO 1DKUA 1TJ5A 3IRVA 2B92A 4L8YA 4LHZA 1GQ2A 1RSZA 4MQFB 3GV8B 2FLKA 2WMNB 3N2YA 1I9GA 4YJ3F 4M55A 1CULC 3SQNA 3DLCA 3LCMA 5FF9A 4E1VA 3HA2A 4NCBA 1R9MA 1T6NA 3UOGA 5T3UA 1U7UA 3UQZA 1J8DA 3CPSA 2GZHA 2FCAA 3W5DA 2UVRA 1KTVA 2PL3A 1U1EA 2RAFA 2ZYDA 2ZWAA 3DZFA 2JEFA 2C8KA 4Y7DA 3R7FA 2B4YA 3IMGA 2OLSA 2NACA 3O2NA 3OTWA 4C0HA 2Q28A 5DM1A 4BFXA 4F46A 3K71B 2J6UA 1HDCA 2XZDA 4M1EA 4Y30A 3EPJA 5EQTA 1Y3BE 3TZLA 1QS0A 2WJPA 5KSPA 5HP4A 1VG1A 3V1KA 1GWNA 1BVRA 1M7HA 3AW9A 3CWCA 4GLBA 5CNJA 4CT0A 3B9BA 5ALVA 1GDTA 4RTJA 1TRHA 2HMVA 1R15A 4O7RA 1IN4A 4F5ZA 1RJ9A 2AOTB 1C14A 2DUMA 5KINB 3B6JA 1DLIA 1NLYA 3H17A 2ZUDA 4I6EA 3QUTA 1E9CA 2WG2A 4AP9A 1TGYA 2A0XA 4XLTA 1J24A 3V8QA 3S1SA 4I55A 2WBLC 4MLCA 2VOEA 2AUTA 2O23A 3A3NA 3O8QA 4I50A 4V0QA 4AD8A 1FFGA 4TLDA 2ZITA 3MBOA 1RPJA 4IIBA 3MTAA 2QUIA 2XCRB 3DB1A 3N2ZB 5G0SA 1N5OX 1FEZA 2X8LA 2OFFA 1KWKA 3CTPA 4RQBA 2R79A 3T1QA 2BQRA 4ZTUB 2IBKA 5TC4A 3ZE9A 1YL5A 1Z7EA 4BP8A 2H4YA 1YIDA 1GY8A 1MC8A 3FDZA 1WQ1R 2FG6C 3R20A 5ITZB 5AXDA 4B8ZA 5JMWA 1JAZA 2WAOA 1XZPA 2WSIA 3GDEA 3FYSA 3TRFA 3PDIB 2C7BA 4YO8A 3U1TA 1CU1A 1G6OA 2A0KA 3V6JA 3WYFA 4C6HA 4UBLA 5LD2B 3KO8A 3ZPXA 4B6GA 3HM9A 3FVRA 3LXUX 2J9RA 3VJLA 5FLEX 3C2QA 3B8EA 1ZHOA 1YIAA 1TECE 2DP4E 1QG2A 2IUFA 3AUTA 2WE8A 3K0EA 4GGPA 4FYHA 1REQB 2NQ2C 4RVUA 2RI6A 4HC4A 4ZVUA 4B4DA 4P0PB 2IGBA 3JQ8B 1TYZA 3PZBA 3GLIA 4OLBA 1V6CA 4ND1A 3BMNA 4DR5B 1UH5A 3GTKA 3CSSA 4FHZA 3L46A 3ST7A 3FJ1A 1X14A 2G7ZA 5I3CA 1OBVA 2QKYA 3NETA 2QMHA 1GTMA 1NY6A 3EXHA 3PFHA 5HZKA 2NQTA 1H3EA 3TSZA 4Q1AA 1V11B 2WJHA 1RK6A 4OQFA 2G5TA 4FMCB 3ESDA 2EAUA 3EIEA 5EIHA 2X5RA 5KOIA 4HWKA 3ZD7A 2XV1A 2GQSA 3TM5A 1JSXA 2ZZMA 2AE1A 2VNKA 2P9ZA 4BUCA 5B4UA 4JNCA 2NSHA 5AKGA 3ZYZA 1EG2A 5DPMA 4ZDWA 3WWDA 4UTRA 4N3GA 4RV9A 2GFHA 1CV2A 3LLSA 5THKA 3NIGB 4UOEA 5AM5A 1NQAO 4C3VA 5JH7A 4NZOA 3N9IA 3SEFA 3IPCA 1B0AA 1POWA 2FGJA 4I8DA 1L4FA 4UTVA 1T36B 1L1FA 3WFJA 2X0EA 1USUA 3I9MA 1U0LA 1NFRA 5JR3A 4WFKA 3EVAA 2DFNA 1AKNA 3K9WA 2AZMA 3AHFA 3L41A 1B0ZA 1J4AA 1MGOA 2VEDA 4BVHA 3LUFA 5ALGA 5MF6A 4HH3C 1IZ0A 1PWHA 1HM5A 3RBDA 4HFJA 3GLGA 2O07A 2ZSJA 3EF1A 4V0RA 1WZCA 4YRIA 1Y8QB 4OSPA 4PO1A 1A9XA 1JDZA 5BOSB 2CV2A 5AUNB 1QHIA 2J9XB 3D7RA 4I1IA 2ERCA 1U0JA 4EQ5A 3H2SA 1B42A 3S8MA 3T4XA 4EG8A 4PAWA 3TRKA 4DCUA 4DV6B 3HABA 3MYYA 2GTIA 5KG1A 4OX9H 1MV5A 4P7KA 1G5FA 2IKQA 3PD7A 3RLIA 1PN3A 4LQLA 1RWPA 3SZOA 1U0TA 4ZYLA 3B12A 5CFNA 3W2TA 3A1TA 2IUYA 3PCXA 1LVUA 3UYYA 2B4KA 1KO7A 3CVJA 4HEJA 3H9QA 5K05A 3TVDA 2W9XA 2GNOA 3AJRA 1KJNA 5C1OA 1UM8A 4N03A 3IUQA 1T3GA 5CX1A 2PY6A 2DJIA 5FBZA 4DL5A 3PEVA 4YUXA 1RM0A 5I7OA 4XFKA 3GLIB 1XXHB 2HR1A 4KGDA 2WF5A 4GOKA 1B41A 3KKPA 2VTEA 4H1UA 1ZC4A 1MOQA 1TZCA 2UYGA 5LU9A 4HNSA 4B45A 4OHOA 1K8RA 2XVZA 2X6TA 3H5WA 3LDHA 2NUTA 3VI4B 4G1BA 3OM1A 3M3HA 3FPSA 4Q37A 3PHIA 5A6VA 4WFJA 3SZ3A 1HYGA 3ON5A 1NX6A 3G2NA 1LRKA 4ZI7A 1G8GA 4M86A 2R44A 1EJBA 3MJVA 3B5JA 4JGIA 1MORA 1THGA 4M60A 1YKFA 2OENG 1RRFA 3JD2A 2F4VH 4TQGA 5DK4A 3QVTA 5LUAA 1JSRA 3RBAA 2ZRBA 5A6SB 5DDIP 2JJ2A 1YR9A 2IZ6A 3QU4A 4YMVA 5BORA 2FMHA 4N0QA 1LY1A 3E4CA 1DTWA 4J9MA 1SUAA 1ZEJA 2EV9A 4IEIA 1ZS9A 3DTVB 4OXRA 1SVUA 4WCFC 3R75A 1TVMA 1W0KA 1WSCA 3A4NA 3AVQA 1AXGA 1U8XX 4JLVA 4TVKA 1UC8A 2RJ3A 4PRZA 4XVQA 2GXSA 1ZUNA 3M34A 5DRTA 3HHEA 4F3YA 1T0HB 5BN4A 4KYTA 3BBLA 5FPRA 1M1YE 3GJZA 4QVGA 2GASA 5K0NA 5BWMA 2QRUA 2IPNA 4RQUA 2P11A 4I81A 1HUQA 4CMKA 1QVAA 1EHYA 1SC6A 2AD5A 1KEWA 1EZ1A 2AJTA 3GQBA 3K09C 4OI4A 4DQUA 1EUCA 1WQ4A 2VEOA 4CNBA 4O63O 1I4OA 3OOJA 1LK0A 4X60A 3ZVNA 1S97A 1TJPB 2JZCA 3A31A 4WN9A 5KU1A 1C50A 3MT9A 3B82A 4XYBA 3U3MA 3R3YA 1Z6XA 1DELA 3L4BA 1IAVA 3PUVA 4AW9A 1ZAYA 5FOXA 1DHTA 4MMXB 1FZTA 1PT5A 4O3NA 1FFXA 4MRVA 3VAZA 2AKEA 3MSCA 5DQGA 2ASDA 4O4IA 4RD2A 4MKRA 3UIEA 4UAJA 3ZWAA 1XV5A 3SLKA 4D5EA 2OCPA 3NQ41 3RS2A 1P17A 2EKLA 4Q3DA 2ZR7A 3ICCA 1Y7TA 4NOMA 4F3TA 1SKQA 1D5CA 3T7DA 1GG5A 4DTIA 1T5BA 5J2UA 1ISSA 2ZXFA 3MMPA 5AVKA 1EE9A 1CR1A 2WFLB 2ATCA 2COGA 2JARA 3E58A 4NFSA 4PR0A 4MS4B 4A7PA 4BKPA 1CJMA 1GD1O 1ZUHA 1I2ZA 2IIVA 5T57A 3ULKA 1MB2A 4G6ZA 1U3VA 2PGLA 4PPQA 4UCOA 3SY8A 4Q3KA 2CLHB 1HT3A 3PFBA 2VPIA 1X1TA 2AUNA 4M87A 3N0RA 1P1FA 2E2WA 5TPZA 4KQJA 4XDZA 2AG1A 3EMKA 3N0VA 5SZHB 5F76A 4V0ME 1FVFA 1KE2A 5A3JA 1PI3A 3KZVA 2E18A 3GZNA 2FPXA 4EGAA 1JDNA 4IH9A 3NYWA 1PG0A 1Y5MA 3Q3EA 4OHPA 4OQYA 1Q12A 1LEHA 1TADA 1UPCA 2EATA 3ZUGA 4R8RA 2BPOA 5C52B 5JO0A 1XDNA 2C83A 3K6JA 5DJ5A 4UCFA 3DTGA 1MBZA 5HJEA 1Y1LA 1QHEA 4FJ2A 5DSZA 1K8YB 3FYUC 3OFJA 1S03G 4M0FA 4D98A 2PD3A 3I23A 3DM9B 3L6RA 3ZJUA 1OV6A 1VYTA 3HDVA 1H94A 3BX1A 2AT1A 3HN6A 2RHLA 2ZRMA 5EUCA 2YCBA 5L4LA 2Q6TA 4H9GA 2E2HA 4LZNA 1SC1A 3V00A 4C01A 5AM2A 2FZWA 1A9RA 3I9LA 4NBTA 4B3GA 1UF9A 4BNMA 2V1UA 1NGSA 3DG9A 4UEOA 2MSLA 1Q0PA 3A1SA 1CY0A 4QZVA 5L9XA 2WWWA 3E8XA 3EZXA 3IXLA 3BJIC 1K6EA 4BY1G 1JUDA 1M2VA 4BVFA 2DLCX 3T0IA 2R6AA 3R5XA 1L4HA 1Q3KA 1DV2A 1Z5ZA 2IH2A 2ET6A 1CZUA 3I1YA 3IIKA 3R3ZA 2YWDA 2YX1A 3GUUA 4QDXA 4ZZ3A 5M34A 2AG0A 2C2RA 2JRLA 2A30A 3I9KA 4PVDA 3L3BA 1QGYA 1JHVA 4M1TA 3ZIUA 3C3EA 2P27A 2M98A 1M1NA 1KC1A 3PRKE 2RGAA 4UPVA 2VPSA 4Y9TA 2XHEA 4E4RA 3QA3E 2XA2A 2XTZA 1KQFA 5EJ8A 4OAQA 1T4BA 4XCXA 4DHEA 1UDAA 4L5JA 2CDAA 3NGXA 3BA9A 3SSMA 2X40A 3W1EA 4EFEA 2IVZA 9LDBA 1ADGA 2DLDA 2O59A 3T3IA 3JYNA 5F23A 2FF7A 1NATA 4DZRA 1Z33A 3PB3A 1ST2A 5HSGA 3R9KA 5FOWA 1RLOA 3A04A 2QAGB 1IOLA 1HZJA 4ECQA 3T7EA 1YZVA 2HIGA 2PS0A 2Z9BA 5BQOA 2QJWA 1RJFA 1DXHA 2KWIA 2V3WA 3B7GA 4HWOA 1OROA 5CFZA 5HCUA 2AUMA 2VF7A 1J9GA 1EFPA 3OZXA 3TQHA 4B09A 2PX0A 2Z3WA 4JLOA 3ZCTA 4XDYA 4AS3A 3OQ6A 2QLNA 1C7FA 3DUFA 4PG6A 1J0DA 2AVDA 2YZLA 5JAIA 2ZRAA 4GSLA 4ALKA 2H5EA 5GONB 2AFRA 4KQFA 4DV2H 4X64B 1PTKA 5I7UA 3S0JA 1KDPA 2XUOA 5DBEX 3ZIAD 1NFFA 1E5TA 3CFYA 2QNRA 3KUXA 1DDIA 1NWHA 4OHBA 4EUSA 4ZRDA 2PWBA 4F3CA 5JZVA 1TU4A 3DWGA 3FRJA 4E46A 2QLLA 1GQFA 1QR6A 2G1KA 3ES9A 3OU7A 4UM8B 4U7PB 2CZQA 4V0KA 5LWHA 4QTYA 2QVXX 4BMZA 2FI1A 2QS9A 5A2QW 3LUPA 1N6OA 4ZI5A 1H2ZA 2NVUB 4DLNA 2DBYA 5EY5B 3W5OA 1ZEMA 4CDGA 4XUEA 4E03A 3I9NA 2OYRA 4UNIA 4JC0A 5C4XG 5AMXA 3U56A 3CPHA 1BQ4A 1ZESA 2HMAA 1RM5A 2GAOA 2PMWB 3RIEA 1FLNA 3ROFA 2IYZA 1GZ7A 4U5XA 1XCBA 3T1NA 2FB9A 3MCAA 3LLVA 2F59A 1P39A 2C7RA 4KR9A 1N6NA 4GEGA 2FR8C 3FZQA 5DI9A 5ALSA 5ALXA 5LZ2A 2UDPA 2PMEA 3VKUA 1DZIA 1YJQA 2XQKA 2FE4A 5JD5A 4KVAA 4BZWA 1SVOA 1ZUWA 5DSTA 4CKCA 1PK7A 5FD5A 1DIRA 2FDXA 2ZE6A 3INTA 3MLEA 4JB0A 3RC2A 4F93B 3IDZA 1Z7WA 4M36A 1QYRA 4L16A 4BBJA 2LRHA 3CX4A 3M2TA 4A3DG 3EFOA 3FTFA 1DUVG 2P4EA 3R7SA 2AKYA 2C3UA 4F3NA 1VJ5A 3KWJA 4BZXA 5HWSA 4EMBA 4UMDA 1K6IA 3STTA 2D5AA 2IA6A 1NASA 1RYDA 1W8DA 1W75A 2ZI6A 5E0OA 4HATA 1RR6A 3Q98A 5MFPA 3WTBA 3T7SA 4DL2A 5EWJB 1UQRA 2QE6A 3P2OA 1UOEA 3ZV5A 3PDUA 1UXHA 3RYIA 5DRYA 1JBEA 1VJGA 2FPMA 2A86A 4Z54A 5LQDA 2R6GA 4EGQA 2FPOA 2YYYA 3AFOA 3MMNA 4TKVB 3SGIA 4ZAWA 1FNDA 4YQYA 3RYIB 4A8PA 2VA3A 1XAHA 1IQRA 1GYPA 1PR4A 4FWBA 4G8BA 3X1ZA 3ETDA 4P7GA 1EJ6A 4QPDA 4WERA 2BEUB 3LYAA 4DCOA 1FTWA 1L5KA 1U5BB 2X0FA 3KT6A 2Y8EA 1EVYA 1LFAA 3JXEA 4UFOA 5BMOA 2JZOA 1U7OA 1JG2A 1C4OA 2NP6A 3E9QA 3RFTA 3CLTD 4BFZA 5LMCA 4P92A 1CLUA 3BHMA 3GT4A 2Z5FA 2L2QA 3G1WA 1JI0A 5F7OA 3SXUB 1VLHA 2OLJA 4JX8A 3WYCA 5BSKA 2OORA 4ZU6X 5TVKA 3VPHA 3KQMA 2VAXA 1U0GA 4KX3A 5ADVA 5G1NA 5JUWA 2RK6A 3RKSA 3PUHA 5LP1A 3QMMA 1OXMA 4KRGA 4M1MA 5LYYA 4P08A 1WMFA 4NJEB 4Y1RB 3PGA1 1OE0A 2AG8A 1OU4A 1HOTA 1Q50A 1U9YA 2RGYA 5EVCA 1K1EA 3SYRA 5FL7D 4ZGBA 5BUCA 1EDDA 4ZO9A 1SHZA 4RNDB 5JUMA 4J0EA 4BZPA 3WQSB 2G08A 1CJKC 4JI7B 4RD6A 2IPXA 3EODA 1RLTA 4GSKA 4YUWA 3T1YB 1I2KA 1A9TA 2GF2A 3E53A 3B2NA 4BUJA 5KFEA 1JE1A 3N2KB 1H2AS 4R16A 4CT5A 1FTYA 3MM4A 4PYRA 2E85A 4UBOA 2VHWA 4OSOA 4EITA 3OIFA 3QE0A 4A3KG 5I7VA 4DKJA 4XAQA 2C9OA 5HJ2A 1AJEA 1KVQA 3DFIA 1FU7A 2YWVA 4OQZA 4FFMA 1GZ4A 3IOYA 4NEGA 3JU3A 1J2JA 3MUFA 4AF7A 2MMGA 2HEIA 2CQYA 3RRMA 1EKVA 3OTGA 1K1QA 5E2IA 5JZMA 1U9ZA 3QVUA 4FZJA 4C6RA 3P52A 5ECWA 4TQAA 1W85B 2WIAA 3AP3A 3ZU3A 4GPBA 4UEQA 1LZKA 3WTCA 2N1MA 2OBNA 1KO4A 2D2XA 2OHXA 3NM4A 4TOIA 4QFCA 4F92B 1SCAA 3RHFA 2Z2ZA 3DDCA 3RU9A 3EZ2A 3ZLTA 5LC1A 1KZ9A 3BZBA 4HTFB 3TJRA 2WTFA 2O8BA 5IBQA 4M9CA 5TV2A 5LM3A 3VI3B 2CW5A 5DTMA 2W9AA 1XQWA 1ZH8A 2PS9A 1V51A 2PZJA 3GLHB 4FONA 4LS3A 1SOMA 3TQOA 1XAGA 1E4FT 4PC1A 4P4LA 1A5ZA 1DAAA 4G0QA 5K9ZA 4R8UA 3UBMA 2OY0A 2DUJA 4ZFNA 1N9KA 1IB6A 1E2EA 4FPXA 4Q9LA 5HPYB 4X97A 1UBSB 1RJEA 3R2JA 1NZFA 4H2DA 3WK9A 1K7SN 2BEWA 2WD7B 5ALPA 1IUKA 1I4LD 3NHUA 3SR3A 1QRUA 1Z0ZA 4EYIB 1Y1QA 4ZMSA 1FTNA 2FCRA 4P54A 4BFSA 4C08A 4P58A 1F8FA 2E5WA 4TWRA 5BWVA 1ADJA 2ZWMA 3S27A 3PC8C 1QFYA 4EUKA 1FDVA 1IWPB 4C29A 4ARCA 4HLUC 1DXYA 1GUAA 1QFSA 4K9QA 2PUCA 2NGRA 3VRHA 1AUOA 2CVHA 4TQRA 3KQYA 5SYMA 2NUBA 5T3YA 5B12A 1FFYA 1NPTO 2VKTA 1TI7A 3DE4X 1K63A 2QLBA 3I6ZA 1G8YA 4ZRMA 4D43A 5F21A 1D04A 4ND4A 3HDYA 5ALIA 1UM9A 4MRMB 4KAFA 1AX9A 1GIAA 5I9MA 1ILWA 4ISCA 3GP3A 1Z7GA 1NY5A 2CLCX 2FWJA 3L7BA 3OSZA 5BQFA 1AZLA 2EC5A 3R5KA 4KXNA 2P2LA 4L5IA 3EBPA 1K6MA 3H0KA 1OZ0A 5BSEA 4HQOA 1Z5VA 2OAP1 3OMXA 5CA1F 1C81A 1FDOA 4DMMA 1T3ZA 2F9FA 4KMMA 2BGMA 2UZ3A 3IMKA 4YRQA 4G5HA 2GCEA 5ABPA 3JD4A 1D6JA 3OVMA 4N9WA 1JWAB 3URMA 1HYHA 1LX7A 1NT2A 2NO9A 2CW8A 4HNVA 4H7IA 1C9EA 1XZAA 1FRFS 3MQ2A 4H59A 2W6QA 4BV2A 4TKZA 3RAEC 1E96A 2BW0A 3WA7A 5KJFA 4ADSG 3EH2A 1K5HA 3RVDA 2QIOA 4BQOA 3PDJA 2C2ZA 2H1CA 2REXB 1OA1A 1R0ZA 4JS0A 3FHCB 2RGEA 1L7NA 3DDNA 5KYKA 1XZMA 3HXKA 2QL5A 1E1QD 1O1YA 2YWRA 2ZLBA 5UKDA 1KBQA 5EERA 2H65A 4ZOLA 3U4QB 3HV2A 1R16A 4FQ7A 4IR7A 1JJBA 5KNBA 1BD3A 5KVCA 1L5GB 4E5YA 4YR0A 3IVMA 1OB2A 3Q87B 3C45A 1UAGA 3B1WA 4CQLB 5IDXA 1C3VA 4O83A 4NBVA 1WW2A 1QVRA 1GZSA 1TWAA 3DBLA 3PRYA 4LBVA 4P4NA 3MFHA 4XI9A 1B8OA 1AK9A 2AYYA 4M1OA 1E89A 3MBKA 3WDLA 3LXRA 5AW0A 4G8JA 1E66A 2BUBA 1Z4KA 1DKQA 3OZSA 3O91A 1QC5B 4E09A 3SXJA 3L07A 1KY5A 4UCSA 1HNXH 3WS7A 2I6XA 4DV5B 2G6BA 3DEYX 1PDOA 1QTIA 1TA8A 1FFXB 4TLAA 5JYDA 1XMQB 4O4LA 1Q11A 2ZAIA 4GI3A 5FO1A 4R0NA 2XYQA 1FQWA 4FFPA 1XN4A 1KJZA 2CB0A 3FSEA 3K1ZA 4R9VA 3KUDA 1UK9A 1UXIA 5FI5A 5TQVA 3Q3CA 3S68A 1J5EH 4P81A 1EVLA 4O8CA 4EQ6A 4IJKA 1PFUA 1W5FA 1BS2A 5H82A 3I2KA 2PX4A 4Q48A 2C4KA 3HJRA 3QLVA 4MK4A 4ZK6A 4MKIA 1NVMB 1O03A 1SKUA 5SZKB 3GEHA 5DLGA 3I42A 3KS9A 4EY3A 4V1CB 5IG2A 4QLOA 1EX7A 3OEYA 1AKYA 2P3LA 2ECOA 5A06A 3FCYA 3JQAD 4D9JA 3CPJB 4TLBA 2EJBA 2GPAA 4EPTA 1W73A 4DIFA 3M3DA 1E8DA 2J41A 4L9AA 3OO0A 5A7GA 4GZ5A 4KQCA 3HB9A 4EBEA 4E51A 2QX7A 4KHZA 5LB4A 2WF9A 2FMFA 3IQFA 4OQNA 3T9EA 4K88A 5I9IA 1I4DD 5EP1A 1MXFA 4IDFA 4QHYA 3TNJA 5B7QA 3LBFA 5A5FA 1W76A 3DD1A 2ZAGA 2DC1A 3H9BA 5F2KA 1UPUA 1KI6A 4EB8A 5FLXA 1IBLB 4I50B 1VBHA 2CB9A 3IUNA 2GBLC 5EL0A 3HU1A 2QUJA 1H2BA 1TAUA 3U39A 1CDEA 1PEDA 2QAGA 3B3JA 4JBWA 3BXXA 1RZRA 5LKAA 1SIUA 2QSZA 5KFLA 2OSBA 1ZNZA 3FVQA 4YH1A 3TLAA 4BMCA 1UK6A 2CLMB 1I2CA 3PA6A 3LK7A 4M49A 5E6UB 3RK1A 2WPDA 3MCZA 2AW5A 3KJGA 3UMRA 3AX6A 1J7KA 4QBGB 4BEVA 4G84A 2FW0A 5K20A 3JQFA 4C5AA 2OCXA 3P9NA 1W87A 4G0ZA 1UIMA 1M1ZA 3PRJA 4NV1A 1M9NA 4BO2A 1SHTX 1WXDA 4HQ0A 3WDSA 5FR9A 2FEXA 5KWIA 4UASA 4TUYA 2PGDA 1GXSA 3IQWA 4PC2A 4ED6A 1V8DA 3BC1A 5DLYA 2REQB 2IW3A 3UGKA 1UK8A 4NFLA 3J81A 4S1TA 3DBHA 3OQOA 2W8LA 4RACA 3PD1A 1R9NA 2QXYA 1M54A 2PSEA 4I55B 4ECAA 4B8YA 2O2YA 2Q0SA 3O2JA 3RS4A 4D4IA 3AYHB 4UCTA 2L0XA 1IBCA 1MC4A 2HWWA 1J20A 3VU3A 2V7QD 1P9LA 4ZJZA 4G24A 4F4XA 1A2KC 1BN7A 3VMMA 3G82C 4TTQA 2OXFA 1UQTA 3ZVKA 4KR6A 4J9SA 1DBRA 4RHUA 3EEQA 2GQRA 4UD2A 2EJUA 1ZN9A 4ZODA 5HKOA 3DYBA 3NUQA 4H0NA 5ENDA 1WBDA 1P91A 3R5FA 2QRHA 1J00A 3VNQA 4CDMA 4EMUA 4ENRA 1DEXA 3WKAA 4CKCB 3U61B 1L5OA 3CEMA 1I7LA 1WY5A 2F1JA 5JBNA 4GC6A 3G9ZA 1W59A 1FSPA 1TMOA 1A5TA 1SUPA 1P4HA 2CLDX 2YMPA 1JJVA 4HEA1 3RC7A 1QR2A 3DAPA 1L4LA 2B6NA 4BNZA 3FMGA 1RKBA 2QTRA 2WJAA 1NIJA 2DFPA 3MT7A 5JY6A 3KSBC 2WK1A 1WXIA 2C0CA 4UKDA 4Q39A 2R96A 3ITKA 3OX4A 2RGCA 1DG3A 1KOLA 4WLUA 2I6UA 3KOUA 4QXAA 1W44A 4A3EG 1E1CA 3BMQA 4UC0A 4YT8A 1GYQA 4ACBA 2UUBH 3W9UA 4MCJA 2OUKA 5T14A 1VG8A 4UMFA 1HGXA 3JTMA 4FDLA 3GF4A 1NWCA 1SQ6A 3H5AA 3BJMA 4ITRC 5C5JA 1C1HA 2HVRA 1NFQA 2AS0A 3KB2A 4M8SA 2NTEA 4EIWA 3RB6A 3KSUA 4MV4A 4Q43A 4TUYB 3SC3A 1TRKA 5IWAH 3ODPA 2JA7G 3JALB 1XJQA 1PGQA 3ZCVA 1FFSA 1S1MA 3SBDA 1AQNA 3FUUA 2VTKA 5HF5A 4F9EA 3OPYI 3CLUC 4FDUA 2BBTA 1S1CA 1BEZA 1I7DA 3H97A 1JW9B 3GCXA 5EESA 3WLAA 3O3OB 4F11A 2LKCA 3W1WA 5HQ3B 2H85A 5KWJA 1YRAA 5TARA 2RGRA 1NM5A 3TFQA 4IZ6A 2YIMA 2X13A 1W30A 2P6RA 1CQJB 2VWQA 4DCSA 4RUAA 4IQ0A 1RBMA 4EVRA 1V0JA 1HDXA 4C04A 2C07A 2VDUE 1V1RB 4JASB 5DTIA 5GWXA 1KFBB 2WYUA 4XXHA 1SUBA 1XRJA 5EIAA 3SWWA 4J16A 3FGOA 1PS0A 2GGSA 2G3YA 3K1TA 5CFRA 3ACDA 1XAJA 3LBYA 3FWPA 3R8XA 1TO1E 2O48X 3V8NA 2NV2B 3MWDB 3OFVA 3KJXA 1SHKA 3BQ2A 2RGNA 4TS4A 3ZZ1A 4YUZA 1CDDA 1TMKA 1DEAA 4NYEA 2D0PB 3CGWA 2NNLD 3GFOA 2IT1A 3Q15C 1ZIXA 2ZP1A 4GRDA 1FBTA 4RS3A 5FTWA 1S3GA 3D4BA 4DJTA 1LJ8A 3WZMA 4QRDA 4B3JA 3I30X 3PHGA 1JXMA 2Y71A 4WPGA 1QDEA 3Q3JB 2QZ9A 3WOHA 4N6OA 4L8FA 3V6LA 3ZXXA 4BO3A 3QEOA 4BDTA 1SIOA 4QIHA 4LJ9A 4F6LA 1NVUQ 3PG5A 5B57C 2AOVA 3D4IA 3FZGA 5AW9A 1F06A 3VHRA 3ANLA 5CB6A 2BP7B 3K9HA 1GU0A 2Q4DA 2YRFA 6Q21A 3OE4A 2GARA 1VBFA 2QUHA 1DIGA 5CTAA 5ARCA 1P61B 1KO5A 2CSUA 3DEAA 5AVSA 1RXIA 3TSYA 3QPWA 4G0UA 4DA4A 1SRRA 4IQ8A 1DAHA 3PQ7A 2E4UA 5CR9A 4B7CA 3R3JA 3WLMA 4DGQA 3JZFA 4WCFA 5KAPA 1IUOA 4K9KA 3HJGA 1NQTA 1PAUA 4OHXA 1MOSA 3SXPA 3F2IA 2QAJA 3DOJA 1GCAA 3BMCA 3OEHA 3OF3A 4K2AA 2RBEA 1L7AA 4G5RA 4PCAA 2J9YB 3REGA 2C7VA 4OJQA 5G4KB 2HU5A 3HY3A 1MQ8B 4EELA 3LUBA 2Z2IA 2JAPA 1C7QA 1GTG1 2X7JA 3DHWC 4Y1EA 4CCAA 5JC1A