3KAKA

Structure of homoglutathione synthetase from glycine max in open conformation with gamma-glutamyl-cysteine bound.
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
473
structure length
443
Chain Sequence
PLFDYHRIDQKLLQNIVYDALVWSTLNCLLVGDKSVQRSGRVPGVGLVHLPLSLLPGPFPESHWKQGCELAPIFNELVDRVSLDGKFLQESLSRDEFTSRLLDIHSKMLQINKDIRMGIVRSDYMIDEKTKSLLQIEMNTISTSFALIGCLMTGLHKSLLSQYGKFLGLNSNRVPANNAVDQSAEALAKAWSEYNNPRAAILVVVQVEERNMYEQHYISALLREKHHIRSIRKTLTEIDQEGKILPDGTLSVDGQAISVVYFRAGYTPKDYPSESEWRARLLMEQSSAIKCPTISYHLVGTKKIQQELAKPGVLERFVENKDHIAKLRACFAGLWSLEDSDIVKKAIENPELFVMKPQNNIYGDELRETLLKAAYILMQRIFPATSPAILVRDGNWDTGHVISEAGIFGTYLRNKDKIIINNESGYMVRTKISFGVVDTVYLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Evolution of Product Diversity in Soybean Glutathione Biosynthesis.
pubmed doi rcsb
source organism Glycine max
molecule tags Ligase
molecule keywords Homoglutathione synthetase
total genus 147
structure length 443
sequence length 473
chains with identical sequence B
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03199 GSH_synthase Eukaryotic glutathione synthase
A PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1080.10 Mainly Alpha Orthogonal Bundle Glutathione Synthetase; Chain A, domain 3 Glutathione Synthetase; Chain A, domain 3 3kakA03
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3kakA02
3.30.1490.50 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kakA05
3.30.1490.80 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kakA01
3.40.50.1760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glutathione synthase, substrate-binding domain superfamily, eukaryotic 3kakA04
3GLKA 3N6RA 1B6RA 2Z02A 3WO0A 1IOVA 2Z04A 1JKJB 4O83A 4RZQA 2WYOA 1KJIA 1KJQA 5H80A 3E5NA 1Z2PX 2R7KA 2GQRA 4O7TA 2YZGA 2YWVA 3MWDA 2V59A 5DMXA 2VPQA 4MV9A 1I7NA 4YJ2F 4E4TA 3ORQA 4YB8B 3BG5A 1KJJA 3VPCA 5JQWA 1E4EA 1GGOA 2HJWA 1KUTA 2YYAA 3SE7A 4YAKB 4HNVA 3JRXA 1KC7A 5LYJF 1EUDB 3K3PA 1KBLA 4MA5A 3LWBA 1E4EB 1DV1A 4O7WA 2NU8B 5KX5F 4I55F 3JRWA 3TINA 4XZ3B 3RV3A 2ZDGA 3HBLA 2YS6A 2YZNA 4I50F 5IYZF 3RUPA 1VBGA 1VKZA 4O7RA 1C3OA 1PX2A 3KALA 2PVPA 2PN1A 3MWEA 2W6PA 4XYLB 3R5FA 3TQTA 5C1PA 1OBDA 2W6ZA 4MV4A 5CB4F 1M6VA 2CNUA 5KKNB 1JDBB 2J9GA 3V4SA 4WBNF 2W6OA 2GPSA 1CQJB 2YZMA 3KAKA 1DIKA 2V58A 1JDEA 2XCLA 4HR7A 4EGQA 5JVLA 4HNTA 2NU7B 5FNVF 1GSHA 2GQSA 3UFXB 5BMVF 4XX0B 1C30A 2W6NA 4O4LF 3N8DA 2YRXA 2R7LA 4C5AA 2PBZA 5CA0F 3ETJA 2QF7A 2GLTA 4MV1A 3TIGA 5BPHA 1SCUB 3KAJA 1T36A 3NUAA 4O2AF 2QK4A 3TIIA 1CE8A 2YW2A 3Q1KA 4MV7A 2OLSA 5JVDF 4MA0A 2FP4B 1OBGA 2W6QA 2R7NA 4HQ6A 3QFFA 5CA1F 2FPPB 4O82A 2YZLA 4ZQIA 5LOVF 4MV6A 2ZDHA 4ME6A 1GSAA 3R5HA 3VA7A 5J2UF 4O4JF 1WR2A 4Y8VB 3V4ZA 1KJ9A 3GIDA 2R87A 3K5HA 4IIJF 4TV9F 5HBRB 4ZHQF 1CQIB 1Z2OX 3LP8A 4MAMA 3K5IA 3MJFA 1GSOA 4O4IF 4O7VA 4ZOLF 5CAEB 3KREA 2NU9B 3WO1A 5C1OA 4HNUA 3R23A 1KJ8A 2FB9A 5LXTF 4DLKA 4YAJB 2NUAB 4TUYF 3RV4A 2R7MA 3OUZA 1BXRA 3VPBA 2VQDA 2X0SA 4O7ZA 3R9RA 1GLVA 1M0WA 4O7SA 1W96A 1KEEA 2YS7A 4O7LA 1AUVA 3G8CA 1EYZA 2CNVA 5D8DA 4TV8F 3HO8A 4EG0A 2I87A 2R84A 3AX6A 3RFCA 2DLNA 4O84A 1I7LA 1CS0A 1A48A 1EZ1A 2DIKA 2FPGB 3U9TA 3VMMA 4FFRA 5HV6A 4O86A 4YJ3F 2XD4A 2GPWA 1DV2A 2SCUB 4IZOA 1EUCB 4YBZB 2W6MA 2ZDQA 4L1KA 2YL2A 2C00A 3JZIA 1BNCA 4IHJF 4FGRA 5GONF 3U55A 2IP4A 2NU6B 4XYMB 4FE2A 5EZYF 4C5CA 2CZGA 1W93A 2I8CA 3JZFA 4O7YA 4O7NA 3VOTA 2V5AA 5J2TF 4FFNA 3U54A 4QSHA 1IOWA 4C5BA 1A9XA 3OUUA 4FU0A 1PK8A 3G8DA 5LA6F 5BPFA 5LP6F 3Q2OA 4NYEA 2R85A 1ULZA 1M0TA 2DZDA 2R86A 1AUXA 2R82A 4M9UA 4MV3A 3AW8A 3WNZA 2DWCA 1B6SA 1EHIA 4FFOA 4FFLA 2CNQA 3I12A 4DIMA 2I80A 4ZI7F 5JH7F 3R5XA 2VR1A 1Z2NX 2HGSA 2FPIB 2YRWA 4I4TF 4O4HF 2W70A 5JQGF 2W71A 3HB9A 3ORRA 4FFPA 4O81A 3TW6A 4FFMA 4EGJA 1JLLB 3U9SA 2P0AA 3DF7A 1VBHA 3ETHA 4O2BF 5C8YF 4MV8A
chains in the Genus database with same CATH superfamily
2GN4A 2VHYA 1CDZA 3FM9A 1ZD9A 5I7SA 1AO3A 3FWKA 1KDRA 2ZSUA 1IBLB 1PTJA 1PJRA 4OATA 2SCUA 3QVWA 1TKCA 3PK0A 5KSPA 5D7NA 4CYMA 5JECA 2XCUA 4O2AB 2VDUE 5HZHA 2UUAH 5ECDA 3NDIA 3PFCA 4HWKA 2YHBA 3PFKA 2NVXA 4ID3A 2AD5A 4E6NA 2QQFA 1SUEA 2ZYIA 4LDRA 3R3SA 4RMJA 5L1IA 1NW7A 3W1GA 1RD4A 3F7OA 5EQDA 4KN8A 1C81A 1E7WA 3K1ZA 3L93A 3QVXA 4FKZA 3BMCB 1BD3A 1NMSA 2OFWA 5E6UA 3U44A 1AGRA 2HKIA 1RBMA 3H5WA 3LNCA 2IHZA 3R44A 4E21A 2QEQA 1YC2A 2CLIB 2XZPA 1FY2A 1FZQA 1O9BA 2RG7A 3P7MA 1CW2B 5CXQA 2BFCB 1HQDA 3NAMA 4CCYA 1XTKA 4GL4A 2VYCA 1VHJA 1PR2A 2CXUA 3ISJA 4TV8A 3CNLA 5DYIA 5ENZA 2F9FA 3LHDA 2FW8A 1BA2A 4R4JA 5BR7A 3U4IA 3V1LA 2PZAA 5AI5A 2FPPA 1GPH1 3EC1A 4PQYA 4E2ZA 2VT3A 1P1CA 2HWWA 3EMDA 3W8NA 3IR5A 2OYRA 3D6NB 5CCEA 2GDJA 5IKMA 2AW3A 3CX6A 3BGWA 3L06A 5E6RB 2GHRA 3QXCA 5DULA 2E2IA 1RLOA 2DCUA 2C61A 3Q4GA 3DE1X 4RGQA 4ZOLF 3FR7A 2ARKA 3L3BA 3LSTA 3LIPA 4G09A 4TYPA 4EX6A 1AJEA 3CKLA 4NYIR 4BJ1A 3RIYA 3OA2A 5LJIA 3Q40A 4J4BA 1L8XA 1YNOA 3G0CA 4TZKA 3CNOA 4ER3A 2O2SA 4NZZA 3BORA 3GGJA 1QPGA 4FYMA 3AU9A 5KREA 4JXXA 1PEDA 5JH7A 4A2QA 2UXDH 4Z6KA 2JA2A 4C6TA 1A8HA 2JA5A 1L4EA 5KDOA 1WDTA 2RCYA 2JBAB 1CU1A 4P1ZA 5H3HA 3S70A 3AYXB 5C32A 5A7FA 3ED5A 3AL3A 4YGYA 2L82A 4IKPA 1LBHA 2PSDA 3A9RA 2F1KA 2I7DA 1AGYA 2Q4EA 3C6MA 4JEIA 4NYJQ 1WKVA 3D4IA 3P2OA 3RO7A 3IUJA 4TM7A 3WOVA 1N2XA 3OVMA 4ML3A 4P38A 5JJKA 3WFIA 1YJBA 2IS6A 1KZ6A 2GZMA 4B43A 4DG5A 2VAMA 1GKKA 3U54A 1YUMA 4QIHA 1VI5A 4N5DA 2GS9A 1Y6ZA 2I4RA 3AF2A 1IZ7A 3KQMA 2VL7A 3DTVB 2IU6A 3OM9A 1NYTA 4KXVA 2DZDA 1SVLA 3P9XA 4YMWA 1JV2B 3WNZA 3H1FA 3JYPA 3BH0A 2HWYA 2X0EA 1Q95A 1IZ9A 4MQBA 5CDSA 4IQ4A 4B34A 1RLJA 2XMRA 5BWBA 3A0RB 2QIOA 4MLZA 1WU7A 3M6WA 1ZHSA 4ZMRA 1FVOA 3KL2A 3HOUG 1E1YA 2FWAA 4BNLA 2BEVA 1FDUA 2I4MA 1TJPB 4DCNA 4YAIA 5L9XA 1V4YA 2OCXA 3D3KA 4XJSA 3HNRA 5FUXA 3V4RA 1GG9A 5J5VA 3KHKA 3GTGA 3N76A 3HJTA 3MINB 4DUGA 4MQEB 4YP6A 1ODIA 5L6MB 4KIFA 4UHJA 3AF6A 2J6HA 5JANA 2HBZA 2GXAA 1ECFA 3DBOB 4J3NA 1FPQA 2CVFA 5HEKA 2LV8A 5A6SA 2RGCA 3F5SA 2ZJBA 3A1DA 4FIDA 3OZ7A 3CV3A 5DNAA 2G4LA 4ZGBA 9LDTA 2GGSA 1JJBA 4LV6A 3R0QA 5K6TA 5J2UF 1HNWH 5EUBA 4BFXA 1V7ZA 4QU5A 3K0AA 3L6BA 4EZBA 1UP4A 2YH2A 1CR6A 5KTYA 2QN8A 1WCMG 1U9IC 4HQNA 4AP6A 3ICOA 2ZBUA 1DRUA 2BEUA 1Z33A 5JDIA 5GINE 1GA4A 3A6ZA 5IPFA 4EEKA 4R40A 1BXKA 5F7JA 1KSFX 4P3NA 3R3ZA 3KOMA 3ZR4B 3WHKA 1CJTC 1H4SA 2JA1A 3FYUC 3VGJA 1IK6A 2C03A 2GYVA 1U1FA 4GS5A 2CKZB 3D6TB 3W90A 4HH1A 1V0JA 5HRAA 4MRAA 5A9SA 5JNSA 4NU5A 4MYHA 1RI3A 4MO9A 4ABYA 3WY9A 3GQBA 2ON6A 2G76A 4F7WA 4E2WA 3AVTA 3K8ZA 1L7XA 5D5HA 5B5SA 5K0CA 3DO6A 2WWGA 1SRRA 2Z6AA 2E5WA 2XSZD 4KO8A 1O4WA 4RFLA 2A78A 3LLMA 4WIAA 3NGDA 5B55A 1P6UA 1Z4PX 4Z7QB 1XCPA 3MCUA 3P71T 4LTNA 2IS4A 4RJJA 5EESA 3RHZA 1Z6AA 2H06A 3HJRA 4B44A 1Q7RA 2XYQA 3PENA 4LF5B 8MHTA 1DWOA 1E63A 1OA0A 1I4OA 2VWPA 4HATA 4HJXA 1QYIA 1Z4OA 4HSEA 4HGZA 1D5WA 3CZ5A 4L4YA 1W47A 4JELA 4KVFA 3SXUB 3WKDA 1ZM9A 4A0HA 1O89A 3AIMA 3EOBI 3MN1A 2A9QA 4PAWA 5EJMA 2R8KA 2R87A 3NBAA 3OECA 3CG0A 5KYYA 4Q9KA 1BMTA 4HNAB 4YXWA 4AN4A 2O8FB 2BT4A 4RTMA 3C5CA 3IHLA 1ZGJA 4XZ3A 4D9BA 2OBXA 1IEWA 3KKZA 4OGWA 5AUPB 2OSVA 2AK3A 4MUBA 5JQGB 2HMWA 4TLEA 3R7DA 5CIYA 2HU7A 4A0SA 2C29D 5DVZA 2B7BA 1U31A 2BF7A 3UO8B 3ZWVA 3TMKA 3HEBA 5CNKA 3NX4A 3F8TA 4IX1A 5EP3A 2GPJA 3F3SA 4ED3A 1IN8A 3IKJA 5B1IA 1QHSA 2SCUB 1Q0TA 2GMWA 4L72A 1G21B 1MFPA 4HC4A 4RVHA 3FUCA 2OHGA 4GW3A 2PX4A 5EY5B 5B3JA 1JWAB 5IM4A 4BKMA 2QMOA 3LQ4A 1KP3A 1DPFA 1FU8A 3O4RA 4LHSA 4GEKA 2NQ2C 3G02A 5KFHA 1FQWA 3FPGA 5BQPA 4B7XA 2W37A 3G0HA 4QOGA 3RUFA 2XCIA 1WXQA 3P0EA 3P2KA 4DAAA 4RTOA 2PRIA 1ZGGA 2EGGA 1FX1A 3D8RA 2J32A 2GZAA 4OQZA 4NPAA 5E2IA 4NNOA 1YVPA 2NUPB 1OD6A 4UARA 3UY4A 1XZBA 2FRVA 1GPNA 3ZJ4A 3R0ZA 1W34A 2FUCA 3T9FA 4Q47A 3IP8A 4M0CA 4PTLA 3KYBA 4ZU3A 1X7XA 4QVIA 3FMAA 4I50A 4F5ZA 3QVVA 1SA0B 3MLEA 4PRKA 4CT0A 1W4LA 1GLGA 1XVUA 1F2UB 4RELA 4DY6A 3IVGA 4D6XA 2WFZA 1J39A 1PT7A 2QMEA 1DIOB 2TS1A 3DD1A 2FE1A 4C88A 5BXQC 5KYWA 5LWHA 3QPWA 1USUA 5NLLA 4OQFA 4DTIA 1OROA 1D6MA 2HZ7A 3LP6A 4P8RA 4RYLA 4UCQA 2PUJA 1SK8A 4M83A 1ZOLA 4GMFA 1GN8A 1KVUA 4XI9A 4BO4A 1R88A 4KYVA 2GEJA 2GXSA 4OI2A 4P36A 1A88A 4AJPA 5B2FA 1RHJA 3R7AA 3O1HB 4NZYA 3GL9A 1WXWA 2HA6A 4R2WA 4IFBA 3RS2A 5IANA 1AMNA 2I34A 1V4VA 4XLTA 2IL1A 1X1CA 1ZHQA 3OHAA 1BRTA 3V7FA 4LC9A 4JWKA 1DIGA 4LOLA 3JRWA 1AQIA 2R96A 3HBFA 3JATA 5BSRA 2IYFA 4QXMA 4E0BA 1GO2A 1FYVA 1PFQA 3CGGA 3KLNA 5KVQA 5G0VA 4O4JA 2WD7B 3HKEB 3PDUA 1NI4A 3A27A 1UMDA 2WV7A 1J6UA 2Q4OA 2XE6A 5ICSA 5ELXA 2QX9A 5KFMA 1COWA 2P5YA 5DYTA 3JQ6A 2C4WA 2ZIUB 2RHMA 2VA3A 1V5EA 2X2FA 1XLTC 1XQ1A 1VE3A 2BR5A 3FHCB 1V26A 4HNHA 4Q3OA 4YWHA 3NYQA 3INNA 3GIIA 3GBPA 4IP0A 1RLIA 4IXTA 1RMYA 2DBVO 4YACA 1IVSA 2VQ6A 2IUEA 5L7WA 4OJNA 5K3OA 4C1BA 5G0UA 5KC9A 4KRFA 4ND2A 1RTKA 1E2PA 4HDRA 4MHSA 5TMEA 4R5MA 4LYJA 2CMDA 5JSFA 1P81A 3U7EB 2PBFA 4RMGA 5JVDF 3OICA 3LVRE 3ND5A 2COJA 1PV1A 4X94A 2P30A 3LPCA 1P5FA 3RGWS 1JHDA 2QE7D 1WL8A 5EXSA 4YN3A 3KQPA 3NXSA 5AVYA 4JYCA 1YSCA 3M1IA 2BFDA 5ITVA 3FPLA 4NMXB 4UREA 4AUNA 3G0DA 5I5WA 4IV8A 2GBLC 4TL8A 4BLQA 2DUJA 5JD6A 1ZCAA 1XC7A 2UUPA 5YASA 1EKFA 2XB6A 3ZNOA 1XNRH 1A2QA 2BCJQ 3HCWA 3SF0A 4DL7A 1EBFA 5EEGA 3U3OA 4MWZA 1ZK0A 4NDAA 3UJAA 2YV1A 5K0JA 4LDJA 2OKGA 2P9TA 4IO1A 5ALKA 4O4HA 1IQ0A 1U7WA 2KW5A 3H7AA 3O2QB 3USES 5A4KA 5BW5A 5JD5A 4PHHA 1S2LA 4QT0A 5I7RA 1LBQA 3AQ4A 2GCGA 1WVGA 2V7PA 2BAGA 4TRNA 4ENRA 1Z0DA 2C9MA 1GEEA 4C7VA 2GYWA 1NXSA 3LF2A 2FPLA 3MD9A 3UUFA 1K97A 1H94A 1M72A 1VOTA 4YS6A 4QREA 2FMHA 4XM0A 1TW2A 4YBZA 2NVBA 3NHBA 4QDUA 2LWIA 1NU6A 2AC2A 5CIQA 4OAOA 1ZI9A 3DOCA 4B2LA 2A59A 2AXPA 1CUBA 3HKDA 4X8OA 1OAOA 2W2PA 5IAOA 2JI7A 1NN5A 1IZZA 3NHWA 1DWQA 4P4SA 4Q3LA 1TEZA 1E1CA 2DWCA 1V3TA 2PX6A 3NPMA 3IT1A 2C4UA 3N2NA 2HB6A 1HFWA 2B1GA 1QYXA 2N0SA 3EUEA 4OFBA 1BQEA 3V9PA 2FRXA 2HMYB 1BX0A 3PQCA 2R8YA 2KSQA 4LWZA 1NNSA 1EVEA 3VKFA 3TEJA 2QVYX 2YZ7A 4O02B 4TSKA 3C6QA 3VSCA 4V0MA 3E48A 4BVBA 2PKEA 2HW8A 3X0DA 1JN0A 1MCZA 4DANA 4YWJA 4PO3X 3EUAA 4E5MA 5K01A 5IN4A 3PHHA 4YQFA 1DNPA 3I2HA 4EL0A 5KFSA 1CZRA 5IXSA 3SQDA 2J9ZB 4B8WA 3A1EA 3KOYA 3ZGLA 3QU2A 3FYTA 2AHOA 4C03A 1JSCA 4XDZA 5TMPA 3AT1A 1L4BA 1E1KA 2W93A 1GZSA 3NBYB 3AEXA 1Y4DE 3FCCA 4NENB 4CMIA 4EHFA 5B7NA 4CGZA 3B85A 4XWAA 1YB6A 1F1BA 2Y92A 2NUAA 2I2AA 2V9CA 4JODA 4UNSA 3U3DA 5JBQA 4W5TA 1YZKA 2HO5A 2Q28A 1BE8A 5FWXA 1UC4B 3WQRA 3AB7A 4LPSA 1WH2A 1LU9A 3OKPA 2HR1A 2BFEB 4FGWA 5EE1A 1UNNC 3I5XA 1WOMA 1CJVC 2B7CA 1QK3A 1SVSA 3EMKA 3FNQA 1GPYA 1TF7A 3PUHA 4I46A 4P54A 4W7IA 2MSDB 2H8KA 3ORFA 4QJBA 1YXMA 4QD3A 1SBIA 1QC5B 2WFLA 3QEKA 1L1RA 4QDZA 3AESB 1QGOA 1JBQA 1RKBA 1RLTA 3EZXA 1U1EA 5FD5A 3AWDA 5FBRB 3UNXA 5KG4A 4F4ZA 1IXKA 3NOXA 2ZUDA 4DKJA 1W7AA 5F9LA 4JU8A 3LUDA 4KXYA 2C1EA 3DUFB 3M82A 2B6NA 4TLLB 1NPDA 1JQLB 4OHPA 3WS7A 3SHVA 3IAXA 1OHHA 1USWA 4UEWA 1Z5OA 4ZVVA 2OILA 1NASA 1N1DA 4XE5A 1B33N 3IEVA 1JFTA 2KSWA 3DT8A 3M6XA 4Y9DA 2J4CA 2PYZA 5GIPE 2BIFA 4WOCA 1OTXA 2WT9A 4TV9F 1L4NA 3MRTA 2WU3A 4IGFA 4WJZA 5EHGA 4QIWA 2R5WA 3RUHA 2EZ4A 1AZWA 1OF1A 3BFXA 2QM3A 5AT1A 2ZQ5A 4LZNA 1YKSA 3MC1A 4EAAA 3R3UA 5TQVA 4L27A 2JLZA 2AJ8A 2FYTA 2J0VA 1IRXA 4Z9BA 1VB5A 2E4AA 2JBAA 1NI3A 3QBDA 4E5KA 2CLEB 4J2OA 3T7RA 1IU9A 1PZMA 3HFRA 3G8CA 3QK7A 4X20B 5DHUA 1IY9A 2PMFA 3R6WA 4AN0A 4HWTA 1JYSA 3P9SA 3IEXA 1SCIA 1TEHA 2D4AA 3AX6A 1GYFA 2H2GA 2LGJA 3JQ8A 1UOPA 4MGYR 1CETA 4JT4A 4EVSA 1KWGA 1FFGA 5AKZA 3MCWA 2BFFA 2PLWA 2VATA 4QDKA 1BJTA 4XYMA 3JWEA 3ZLUA 4OHVA 4N48A 1QZZA 4ZOQI 3R4VA 4GX1A 1H4VB 1L7QA 3H0KA 1EVJA 4D81A 4UTZA 2QRLA 4CG0A 4RC9A 3T9DA 1E66A 5C8YA 1NY6A 3PPXA 3GLGE 4M0PA 4PFKA 3WKEA 5G3ZA 4CIAA 4XB2A 3FOBA 2C3OA 5C8YB 3M6VA 1MA3A 2E82A 4BNVA 4ARUA 4YEDA 1OH5A 2BEVB 2GFIA 2ZOSA 3BRCA 4JV5B 3COVA 2X9VA 5AVUA 1KMHA 1IDOA 2Z4RA 5EFZA 3DLBA 3FBTA 1C7ZA 1H6AA 1NURA 3CCBA 3DMPA 3CF2A 3VNNA 1UQTA 1VBHA 3JY6A 3FGPA 2W2TA 1QOZA 3OOYA 3PD0A 3CO0S 2G04A 3COJA 4G65A 5I4CA 4Q7LA 1XYVA 3AEYA 4L51A 1AIPA 2PT5A 2X2PA 3E82A 3KKNA 1C29B 1LTHR 2HNKA 2G25A 3FPCA 1DI0A 5K3CA 5IULC 4OI4A 2WA1A 1VKHA 2HF8A 1TCAA 1XDZA 3F3MA 3OZSA 1SUPA 1Y14B 3PTLA 4HRYA 4X3PA 4B79A 3QKSA 5D3QA 1ETUA 3SJUA 3A2KA 4DQNA 3TW8A 5DLFA 5DV9A 3DJYA 1G98A 4S1PA 1F0KA 2PH7A 1G0OA 1GA6A 1HQCA 4KK3A 3RABA 1PIWA 3U3JA 5EJ9A 2FWMX 4IW3B 4F91B 4C0HA 1ZK2A 4QXAA 1N9GB 2PKCA 1OI2A 3U7QB 3PF9A 1FVFA 5CFOA 1HLGA 4K0KH 3DZBA 1Q77A 2NUBA 2HEIA 2JVJA 3AI2A 3ENZA 3FYDA 4CF7A 5AW8A 2H59A 4OQEA 3X1JA 2PR7A 4PM4A 1SQ5A 2DPHA 3DYVA 4ZN6A 3KU1A 5EC8A 4EHIA 3FUWA 3BIOA 5FOVA 1P16A 1I6WA 2Q2NA 3OCJA 5JAPA 3KHTA 1WXXA 5KJ1A 1KQNA 10MHA 3QFCA 2YYZA 2BGUA 3GVHA 3ZWYA 1JALA 3C0KA 3QMVA 4IGAA 4AIRA 3KUCA 2B8EA 5C4GB 1T8RA 1T9KA 2CVPA 3HCDA 4QWCA 1UZMA 3EDYA 4ERNA 3OQBA 1NATA 5LNK6 2WU1A 4FMDB 1JR3A 2VQEH 2B21A 4U02A 5CA1B 4RTJA 3BK1A 1J5XA 4IYRA 3RFUA 3OFJA 4LDQA 3VPHA 1U0SY 2H6EA 2WR8A 2WYIA 1TKRA 3VYRB 5JAMA 2ZLBA 4DR3B 1CBUA 1QUFA 3TK1A 3VHXA 4N7BA 4NH4A 1OWMA 4WY5A 3V2GA 4HS4A 4NZ9A 5FPSA 2I6UA 4CMIB 3NHFA 1TK3A 3VSEA 3AVWA 2PUEA 1BAPA 2OM2A 2VUHB 7MDHA 2QW1A 1RK6A 3CF4G 4DYVA 2Q4TA 1Y8QA 4GFDA 4DWJA 3T3DA 5A04A 1EUYA 1H22A 3CR7A 2CNBA 2Q0QA 2B78A 2X5NA 2G07A 4RKQA 4PS1A 2VLIA 3CUEF 4EEYA 2COGA 1UXGA 1DIBA 2VJPA 3SDZA 4R41A 1JDBC 1XTRA 2VBGA 2XUIA 2NSJA 4DR5H 4HY3A 3CLTC 1DJNA 1A76A 4XQCA 1FFCA 5WRFA 2VUUA 3ACBA 1ZCZA 4U7WA 1T1SA 4CV1A 4KGDA 1ZS9A 1J8YF 3AILA 4WQMA 5I6DA 2CNNA 3R5SA 1SQ0A 1WAMA 5HQJA 1JJIA 2PS0A 2WTAA 2GBIA 2PSHA 4L07A 4S12A 4FJ0A 4FVTA 1NGSA 4WPGA 3ET4A 1ADYA 2BGIA 1XZNA 4LV8B 4B2YA 3B8HA 3JQRA 3C74A 2B99A 4R2XA 1XTUA 4H1TA 3TKYA 3A6EA 2G28A 1Z45A 4KPGA 4LQLA 2Q5EA 4UQLA 5KUTA 4CW7A 4HT3B 4G8JA 2H1LA 4O4JB 4Z4EA 4M46A 5CUQA 5JRZA 1GTJ1 3T61A 1XZQA 3D2CA 3LOUA 2G67A 1HFKA 3ZI4A 1B6SA 4N4AA 2DLCX 4BY1G 3IPRA 4YNBA 2I54A 2IPLA 4X7BA 1QG6A 4PPQA 3S1AA 4B85A 3FJYA 1TWFA 4BP1A 5K3SA 1XMOB 4U1RA 2I3DA 2E21A 1P8AA 3O1JC 4O2RA 1LLUA 1S8OA 4Q03A 3B5IA 3F1KA 2GAFA 4NFSA 4PYQA 4E51A 3BAFA 4EGFA 4UM9B 5CFLA 3ETHA 5DE3A 3VPXA 2QT1A 4JSYA 3W5VA 5JC8A 3TSZA 1FLDA 4MWEA 3GH1A 3PQ4A 3TOZA 2AS0A 1TVKA 4ND3A 3ZYCA 2GD2A 2AOTB 2O14A 4TVSA 3T7JA 1KJQA 1JQ5A 3JVDA 1L8QA 1QV9A 3TCNA 1NSYA 2LR0A 2C95A 1KH2A 2BI8A 2ET6A 3IVXA 4DUGD 1DEAA 3TPCA 4HVCA 5ISMA 1DKLA 2SKCA 3R9XB 1YOBA 5IKOA 3F46A 3TR0A 5CT4A 1W19A 3GY0A 4WI1A 4ZT7A 4DR1H 1K89A 1OYWA 3AR3A 2GXQA 5TVKA 4RZXA 2W2MA 4V0OA 1P9RA 3UB2A 2GX6A 1SG9A 5HDQA 3USCS 1CXZA 3CH7A 3OJEA 3Q6NA 1GCUA 2L18A 4IDGA 3UHOA 2UV8A 2K4MA 3WRVA 4EFLA 4QYIB 3RVBA 1M33A 4BC0A 1YIDA 1GNRA 1N2JA 3AV0B 5SZHB 4RVNA 4F2HA 4QOIA 4RK5A 4F0JA 1F7VA 4K6NA 3WLFA 1YAJA 1PU2A 2NSDA 4MW5A 4B3BA 2IC5A 4IDDA 2YIVX 4DL9A 3H5TA 2H65A 4U8HA 4Y6RA 1N36B 3ND9A 2VDMB 1P39A 3FNIA 2WQ6A 4A6DA 2C5SA 2Y99A 1HNXB 5JAUA 2VJBA 1DAFA 2V96A 3QX9A 1RBYA 4LWOA 1NW8A 5ITWA 3R3JA 4MZXA 4I55A 4XJXA 3PEUA 3TM5A 3HN2A 4FDTA 1RHQA 5CA1F 4TMXA 2HV8A 5KG1A 3N9IA 5ITZB 2ODPA 2O6LA 3GJRA 3VA7A 4IIGA 4X1IB 4C0XA 4C3UA 2QZPA 3LZ6A 5I48A 2REXB 3MS7A 4UAVA 3LY7A 4TWJA 4IIYA 5CH5A 2ZRMA 3HDJA 1FP4A 2FG6C 4J16C 4FQ7A 3DBLA 3DEZA 1MJFA 1Y3DE 2Y67A 3EMVA 5CYPA 2EIYA 1J1ZA 5JT1A 1A7UA 1P29A 3QPUA 3UTCA 1G4HA 3AERA 4UATA 1VMDA 2D7DA 3G89A 4GZ3A 4EF6A 1VBMA 4V0KA 4AQ7A 3RRBA 4M22A 3G2JA 2I7TA 1VPTA 2FK7A 4P5EA 1W581 3QRWA 3DE7X 2B94A 4HB3A 4KCGA 2BYTA 4B3TB 3BMXA 3RFCA 2PT6A 4NJOA 2RJNA 3VTZA 3U60B 1OTHA 3INYA 2SHKA 3KHRA 2QVZX 1J1UA 4AXBA 5EYPB 4CU5A 3GO4A 3SSNA 5DG8A 3QBVA 3TQOA 1EKVA 3V48A 3D02A 3NP7A 3THSA 4ZMBA 4BGEA 1MRSA 3JXEA 4JLMA 1SC3A 4CMAA 2KBEA 3RTAA 2I8CA 1HTBA 5F23A 1T2NA 1TJNA 4QYTA 3EUFA 1ZZGA 3QW4B 4HUTA 5IFKA 4C0QC 2V65A 2VNSA 2Y2UA 4HDMB 5T4BA 1URPA 2X8LA 3QNUA 3D7RA 2R97A 2DC1A 1N7GA 1XMVA 2BHNA 1KDYA 1YK1A 3I34X 4EARA 2Y27A 4RTKA 1QE3A 3ETNA 2GEVA 1NTOA 4OOEA 1B8VA 5KFBA 2IHKA 3WLIA 4EKEA 1O96B 4ZV4A 2HGSA 1SURA 2C5BA 2YVKA 4ZJUA 1GZ6A 1J2RA 3G2KA 1SUBA 4L3VA 3M4YA 3D9QX 3DAGA 2GRAA 5HFAA 3L8HA 4KXUA 1ZHFA 1OKKD 1UADA 3SHTA 5ARCA 4MUYA 4Q01A 3OE4A 4ITRC 4F5YA 5LQUA 2O3QA 4F4YA 4EPWA 1RT9A 4M1QA 4WGFA 4R8SA 4LZLA 1BMQA 1BHJA 1JL3A 1HRDA 5FBWB 1OW3B 1OV6A 2O7NA 3DDNA 3ON5A 4PZLA 4X1IA 3K9GA 3I9MA 5T57A 4DT1A 5CJ2A 3PX7A 1Q1NA 3U3KA 3UHFA 4EFKA 3C6ZA 5AVJA 2Q8PA 2Q5HA 1EGMB 3G0OA 3L49A 1QBGA 4RE5A 4IFIA 3T7DA 3PNLA 3UJBA 3W4JA 5SYAA 2F62A 3A3YA 5FBKA 4UM9D 1U2QA 3DOEA 3NHUA 1SKQA 4X1YB 1NE7A 3DKKA 1R5BA 1AKWA 2XTJA 3VVLA 2QN2A 2WHYA 2NU8A 4F11A 4QUDA 3ONVA 1CUAA 2OZVA 5HM8A 2WJVA 3RI3A 5KINB 4PCVA 3VPFA 1HT0A 4QBFA 1NX6A 2OFXA 5ER6A 2ZITA 2QLTA 4PSUA 4BY9E 5KFWA 1M7BA 1C8BA 1ZSVA 2BFDB 4DB2A 4KPFC 4F4HA 2PGAA 2VYFA 1H0SA 4RHCA 5K4AA 5JW6A 1XZFA 4OXKA 4OYYA 3O8OB 1BKYA 3TBKA 4LFAB 2BR3A 2XODA 5E3HA 1CKNA 4J9SA 3I83A 1I01A 2YV2A 3PFIA 3PQ8A 5BPHA 1XROA 3GX1A 2AKEA 4HAXA 1GILA 4LZWA 1A5AB 1OXBB 2WG2A 3SS8A 2D06A 2ONCA 2PT7A 3W2GA 4KXMA 1RJFA 3PU6A 3T5HA 3R77A 1L4KA 3UB3A 1TLTA 3L0DA 2ZCVA 5DHPA 4V0LA 3T3HA 2PKQO 4UTNA 4NU8X 1WZIA 3HCAA 1Z2EA 2FN3A 1R8XA 3K6KA 4OJKA 4XCXA 3OE1A 3UMMA 1KEVA 3INRA 3AV3A 3M89A 3UJ7A 4LQCA 3ZUGA 3PXGA 3GMSA 1EG2A 1ZNXA 2VCYA 1ZDMA 4EMBA 5J4VA 4O5AA 3F1LA 4BNDA 2IDMA 4ECTA 3MAGA 3HBNA 2XKKA 2C57A 4JB0A 2W43A 3OOSA 4L9SA 1E2LA 1Y3IA 1G8JA 2ZUTA 4AQDA 2AKAB 5H4GA 1JIQA 2CD9A 1AQYA 1Z36A 3K0CA 4NZPA 1ESMA 1X70A 3PC3A 3A58B 1NVMB 2B5OA 3TN7A 5FWNA 1OFUA 3MWEB 3QVOA 3REFA 3FUTA 3U4MA 4K6HA 3KQLA 2GTPA 3A06A 1Q2XA 1A48A 4OGFA 4DG8A 4G5RA 2QM8A 3RSQA 4MS3B 3DDOA 2PEYA 3NFRA 4OKIA 3RBVA 1ZXBA 5LQMA 2VVTA 2JGFA 1R6UA 4I1OA 3MWGA 1IJFA 4C7OB 5LLTA 5CFPA 1HQYE 2YWBA 3RK1A 1TQHA 2QY6A 5JMPA 5F9FA 3ZXYA 3D64A 1RM5A 1OZGA 2VXBA 3RT9A 2C7BA 4FCVA 1YULA 5CDFE 1VCMA 1GQQA 4BNJA 5TS3A 3SQLA 2ACWA 2ZJ7A 1JWLA 5LQDA 3WLAA 5I5VA 1CNMA 2Q7XA 1A8QA 4RPIA 2BHTA 1X7XB 4ZMSA 3RF2A 1MGPA 2IUTA 3L4BA 4ZCRA 1G16A 1SCBA 1A2BA 1WD5A 5KT2A 2Z3WA 3HYLA 3RAEC 2KPOA 1LSJA 2BKVA 1KBOA 2C3PA 1GTSA 4EAQA 4LQDA 3E4DA 3JSAA 4CKEA 2IOFK 5HF8A 3OCCA 1U94A 2X0FA 4GKJB 4J1NA 4DYHA 2ZRHA 1H23A 1SXJC 4TPKA 3T9EA 1MH1A 3VC7A 2C3YA 2Z04A 4O83A 2AFIE 2GA8A 4M8IA 2JJ2A 1PG0A 1DKUA 1GNPA 1IONA 1PWXA 3EVZA 2QSZA 1FFEA 4M55A 4KRGA 1F0YA 5JXHA 1N33H 1XMPA 4R2KA 2B9VA 1IPHA 4BNIA 1ADGA 2WEKA 2BZ0A 4NG5A 4B6OA 2QTMA 5EIOA 3F90A 3NWPA 3ANTA 4LOJA 4B4DA 1DO2A 3RS4A 4GI5A 1EUZA 1ZUIA 2RKBA 4L8WB 3WSTA 5TLSA 4O7WA 4UNPA 1E3MA 2Q46A 3A70A 4EVQA 3GRZA 1Q7GA 2VP4A 4IXMA 4ARSA 4JNCA 5A2QA 5G0WA 1SBZA 1B8UA 4H0CA 4H4DA 1GGEA 5DX0A 4GMHA 1JR3D 2XWSA 1E4FT 4HTAA 5BRAA 1ADJA 2UZIR 2F48A 2V6IA 2XUGA 1JIVA 2X1MA 3K9QO 3VV3A 4KXXA 1X9IA 3BK2A 2NO1A 5FPYA 2HDOA 2V1UA 3L43A 3V33A 2V1XA 2A9RA 5T4HA 4D0NA 4KP7A 5IHPA 3O6VA 3UUGA 2NXCA 3QE0A 1E18A 3I8XA 5HYVA 5I45A 1TU0A 5L1JA 1IL0A 5DLYA 5KQPA 4U7CA 1R7RA 2WKPA 5K3FA 4JYPA 4PNPA 4ZVNA 5B58T 3N8DA 2MINA 4LYDA 1U0EA 2ZE7A 3HYCA 4G1MB 1AH2A 2WTFA 4G07A 1FMCA 1MTZA 2F9LA 2E55A 1CY4A 2G0TA 4G01B 1N36H 1CE8A 4EQ5A 4IZ6A 2RCNA 4HTFA 3WWOA 4Y6GB 5FUBA 4Q48A 1Z38A 3SS9X 5CD9A 3EODA 4PXAA 4EEQA 4ZD6A 3RANA 2V4MA 2CVOA 5KSYA 4GRIA 1UK9A 3ZLBA 2R9VA 2AKYA 4WESA 3KR9A 3ROZA 3OG9A 2DULA 2PPVA 3U26A 4BKQA 4O2LA 1QJ4A 3BF7A 4HYQA 1AK1A 3ABZA 2O2GA 5ALGA 4DRXA 5I9BA 1A1VA 3RC1A 2QBYA 2C4HA 1RK5A 1VJ0A 3ENVA 5JUMA 2RHRA 4ENTA 1DAOA 1AM4D 3DOJA 1KYTA 2TMYA 2Y4NA 3IURA 4P0QB 4RPJA 2C2MA 1VKRA 2Q07A 4HAWA 4KKXB 1EVKA 1P18A 1Q92A 1V41E 2EJVA 3BEOA 3HB4X 3L6EA 3LXMA 4MARA 4DABA 1TGVA 1F0PA 1W88A 1QKKA 4KQIA 4BNTA 1NVTA 2IITA 5A4AA 4RY0A 3KQSA 1Y1SA 2W2NA 4YYZA 2E4YA 5HV6A 4R9VA 1NRWA 3DC7A 4GQBA 3RIEA 4ITVA 1JZSA 3EXAA 5B1SA 1Q83A 2XLCA 1XCMA 3AFGA 3IQDB 2IBSA 4KG7A 3HP7A 1DOAA 3U4AA 4PSCA 2HA7A 1V8ZA 5EZYF 4PF1A 5L7TA 1NXVA 3EFOB 4AB1A 4L4UA 1JG6A 4CKCB 1Q15A 2Q5OA 4L5IA 3FHJA 1T6BY 1PK8A 4GI7A 4YMTA 4MR7A 3TTYA 3Q9UA 4JT8A 4CT4B 3PPYA 2XUOA 3BWVA 1T8UA 5KWIA 1WRVA 1P3Y1 3FWZA 3IMGA 3GXBA 3N70A 3BZUA 4LXHA 4DYDA 3ZDDA 1GYPA 4IL5A 5C44G 2ZYGA 3QLJA 2ZROA 2HHHH 3N8IA 2HTFA 2EARA 3PGVA 2YIJA 1FMLA 7YASA 5JXIA 4CHIA 3DBHA 3UQ8A 4JKOA 1OA1A 1RRVA 1X1TA 5E2AA 3H4DA 1OU4A 2QJWA 1QH0A 3K1TA 4MRVA 1JAXA 2YZ2A 1ECJA 2EDAA 1JDSA 1M34E 2ECOA 2VOJA 1U9CA 2BGNA 3ASZA 3C8ZA 4WH0A 5FBHA 3VZQA 4C3VA 4JLNA 1T3LA 1RKQA 1Y8RB 4P4TA 1DXHA 1N8TA 1WXIA 3PNVA 5KFNA 4GNKA 4KC0A 1B74A 4WKPA 3X1KA 1IUPA 3X1XA 2IH4A 3AKDA 3HLYA 4DBLC 1V16B 2XMSA 3P0JA 1ONBA 3CJQA 4JBXA 2ZAIA 1KJJA 5LZ2A 1QU2A 4AUEA 3DM9B 3G6YA 3SICE 1Z4MA 4NP6A 1E3QA 1QDUA 3LOPA 4YAUA 3HEMA 1TIPA 3UMCA 3Q15C 4QA9A 2GM5A 3IVAA 5CLQA 2OVFA 2X0RA 3M6IA 3UHAA 1MNQA 2ZATA 4KR2A 1X14A 2VJMB 3DHNA 4YI3A 4PLYA 1R9GA 1AZTA 4IJQA 5DQGA 1JX6A 3FPFA 4MS1A 5HOEA 2AR9A 4IUYA 3ZXUB 4FOOA 4PYOA 2ZCJA 5LZ5A 3VKGA 3PGXA 4G24A 1OWTA 1ZIXA 3KZXA 2VJQA 2F17A 5EMLA 4BRSA 1O4VA 3MHTA 1EJ0A 2GCOB 2WUVA 3ESQA 1NR5A 3FI0A 4BNXA 2M6SA 3P9YA 5C2JB 2FEPA 3DFIA 4CQLB 1HKUA 3A04A 1G291 4YECA 5JCOC 4LYHA 2ID7A 1UIRA 3E70C 2NZUG 2YX1A 3KR1A 2ZT5A 2FSVC 1B04A 1P4SA 2CL5A 2WVHA 4HQRA 5ERYA 5KSZA 1NLYA 4B6QA 2ZIWB 1KK1A 4BKUA 2HSJA 4QHTA 3GAAA 4HYTA 3UAYA 4CGYA 2K2WA 3R8XA 4BEBA 1KAGA 3FDIA 3TSCA 5IBCA 1IC6A 1R9JA 4YUVA 3RBZA 2FSVA 3DKPA 1EZZA 3OX1A 5J2TA 2A5FA 3U13A 4DA8A 1Z7YA 2XUHA 1NNI1 4Y2UA 5BSUA 5F35A 1QRSA 3AGPA 9MHTA 4QOEA 2ODWA 3R23A 4DLKA 1DB3A 3IPAA 2UYYA 3EQZA 1LSSA 3L7BA 3T4EA 2MCTA 2DM6A 8LDHA 1ZY2A 5BSFA 3IQIX 4R1TA 1S2MA 1X8XA 3SC2A 5JCXA 3SCZA 2QAIA 2B3DA 4RSRA 4MQLA 4REQB 2PG3A 4M8NE 5K2OA 1R9NA 2P0EA 1LQTA 1XVVA 4TWRA 3GEHA 2PQ2A 1EA5A 2UVWA 1PYOA 3OJLA 3TOXA 5BYAA 4OLBA 4E1VA 2X0KA 2Y1OA 1GPLA 1XZGA 5G40A 2FW7A 3A2MA 3V55A 4F2WA 5A2GA 5IWCA 1XZKA 3MNFA 2DBYA 2P6MA 1RWMA 4PE5B 5EUCA 1W93A 2HLNA 3EIXA 2GQ0A 2AXNA 3HE3A 4Q4HB 2AJCA 3DXFA 5I8ZA 5JJ5A 2UYHA 1QP0A 1A9XA 1MAWA 4HAIA 2E48A 4YAFA 4B6EA 3VR6D 3A6KA 2J41A 3QITA 1Y8RA 1WZNA 2H48A 4GZMA 5FD8A 3P2EA 3PI7A 2OBBA 4QM7A 3A14A 4G4GA 1EHIA 3MJCA 1EDBA 4C3ZA 1NVVQ 2O07A 3J81A 1UT5A 4FDVA 4DWOA 1PRYA 1T6NA 3IE2A 3AGQA 3O4VA 4OHXA 3V6JA 2MU1A 4ECUA 2W71A 1T8TA 2IPAB 4MQFB 1E0DA 3WL3A 3PLAE 3FE2A 4CLEA 4RZSA 5MN5A 1Y3AA 2XPCA 2XGPA 2AUTA 1IE3A 2BM1A 2UKDA 3KYDA 5AD1A 1P8LA 4JP1A 4K26A 3GLKA 4WKBA 2RFLA 3EGXB 2NPOA 5KVCA 2EHDA 1XA3A 4ZAFA 1GL7A 3HB7A 1NUUA 1C7QA 2R25B 3BMNB 2H4JA 3MJRA 1G63A 4IJMA 2Z8YA 2FX5A 3H0GA 3ASVA 3IQZA 4X85A 4ZO4A 4CUJA 5AVOA 2HF9A 4E09A 1E4OA 4JQZA 3U7HB 4FQ8A 4A1FA 2CLHB 3GTMA 3Q72A 4Q1CA 4LVUA 3PHIA 5FO1A 3PW5A 2Q3MA 4MMZB 4BE7B 1WCYA 1WXDA 4ER0A 4S1TA 4JBNA 4KV7A 5LD2C 5MDHA 3TEFA 3WK8A 3ZE2B 4B40A 1K8XB 2F1HA 1IUKA 3OEHD 5H70A 3FMVA 1FRZA 3ESBA 2VF5X 1CB0A 1EVZA 3QUBA 1SB9A 1YU6A 3QTTA 1UUFA 1M2OB 2OEPA 3MCVA 3GPLA 2FWRA 2NM0A 1BWQA 2J9GA 4WBNF 2CFTA 1G64A 2OCKA 2R6FA 2VPXA 2XKAA 4Q4AA 1VPLA 3OMXA 3KAKA 1G20E 3DB1A 3I6MA 3L46A 4WFQA 1BEUB 3P8ZA 3RQIA 3UH1A 2CFCA 2HIMA 2O2JA 1DMSA 3E05A 3DEHA 3EZ7A 4HPJB 3CLSD 3I1YA 3DHWC 3NUZA 4HWGA 2CEKA 3ABOB 5E6SB 2OV6A 3MJTA 1Y3HA 2MYUA 2HD4A 1UDWA 2WINI 4RD1A 1KGSA 5AHRA 2GAOA 4MQ4A 4UCFA 1HE3A 2XGGA 5F51A 2CEAA 2NTJA 1RZVA 4R9UC 5FT9A 2G9VA 1HDRA 1U1DA 1IY2A 1U0LA 4C7KA 1T5IA 4BB6A 5MN4A 3JAKB 3HNOA 4CIVA 4DY4A 2VOEA 3A1CA 4IGEA 4E22A 1GGMA 3RASA 3GLHB 1A1SA 1XF1A 1TUIA 4NL4H 3WYBA 6ADHA 3DDCA 3DD5A 2AW5A 3G8BA 3QYFA 4UBIA 4AQYB 4MVJG 4G67A 2HK7A 2UVPA 1YV9A 2HVQA 4NVRA 4W1QA 4BE4A 1H3NA 3DCJA 4H4EA 4NS1A 3BBLA 4GLBA 3V80A 4RAYA 1KTAA 7REQA 2DAPA 1UZNA 2JIOA 2RGBA 5HIMA 4C6HA 4O3SA 2HPVA 5F1PA 2IZ5A 2OD7A 2PSEA 4C0JA 2G5CA 3WFZA 1UMCB 4PG5A 3UGJA 1T13A 1JAZA 3VAZA 1M6VB 1WMAA 2BOVA 4XYBA 4EJ2A 5K7SA 1P7PA 4FFRA 2M2IA 3H0EA 2O8CA 1YR2A 1T1JA 2PXXA 4MDFA 2XIQA 1MN6A 1L3BA 3HRIA 1ZUD1 5GM2A 2NU9A 5T6MA 4L5AA 4F21A 4W8OA 3DKIA 1HXHA 1DT3A 3WX0A 3O74A 4Y67A 3LC1O 2CHFA 5ESRA 3PDJA 1NRJB 2B0CA 2VK4A 3NV7A 1I2ZA 1IATA 2A5DA 2UZ1A 3KSUA 1CQPA 3O9ZA 3RR2A 4OKNA 2VA8A 1YJ8A 4BRUA 4WZBB 2KB0A 1C7JA 1PDOA 2OUKA 2Q5FA 4JLBA 1GDDA 1ZN9A 3W1WA 2PUDA 2DPGA 2ZE6A 3QI7A 4P93A 2C2OA 1KRWA 1EM8B 1FTNA 3O83A 4WERA 3AH8A 1M8FA 1KPGA 1L5WA 3MJEA 1BMDA 3D8SA 1F6DA 3NM4A 1TYAE 3H8WA 4YJDA 4LF4B 1KMMA 3ZY4A 2Q49A 5CLHA 1NULA 1IHOA 4ZO8A 1YQUA 4J4HA 1HDZA 1MV5A 1L1QA 4WJLA 4Y1RA 1CZNA 3H5AA 3L8ZA 3P9PA 4LQ4A 2GRJA 4DEVA 3UC5A 3A7DA 1Q3KA 1EBBA 2ACKA 5KOHA 4YDQA 1NVAA 4A8JA 4K6FA 2LKCA 5THKA 5LP6A 1MX5A 5FOWA 2IEGA 3WIEA 5J58A 1VLZA 1YIOA 2OZLA 2ORVA 1QIHA 1UK6A 3SHOA 4D8VA 3NEYA 2AQHA 2OC4A 2H1SA 3TJZA 2I1QA 3BMQA 3TE6A 4AO7A 1JMKC 3JAWB 1ZD2P 1CUWA 3TFOA 2OC9A 5I7HA 1DV1A 2WIAA 1G7RA 3L40A 5FADA 1Q0QA 3IMEA 3NTLA 2VKQA 4JA2A 5DIZA 2E85A 3FSEA 3GFFA 3L0ZA 1AX9A 2EKPA 1DAPA 5BOSB 2B69A 3N7AA 4LE0A 4RA9B 2PUCA 4Q93A 2GFQA 3FWNA 2WTNA 5BT8A 1NAIA 1Y42X 3KYCB 1T5LA 4GC7A 1NW3A 4KDCA 3FPEA 4PCUA 5CJJA 1CNEA 4ZVRA 4DCJA 3AY6A 3A4TA 4OO3A 1TQ2A 3O8RA 4PAMA 1ULSA 4IV5A 4YC7A 3MFHA 3UK7A 1M5TA 5E25A 4N54A 4ZTUB 1QJCA 3EA4A 5TDHA 4LW8A 4BZQA 2V54A 4FBUA 1LCIA 1GQYA 4US0R 3B60A 4L73A 3ZHZA 4A6EA 4F4DA 1GXSA 2A4MA 2HYDA 4RAQA 4JX9A 3S7TA 1DC5A 3UCXA 2BMFA 2IELA 2VSNA 4CODB 1BTOA 4LMYA 4MTCA 4GLFA 3WRXA 3SNOA 1V96A 4LYFA 2C94A 4NDNE 4ZQIA 2NZJA 1X8KA 1JI3A 2C96A 3OLYA 4OX9H 1VLHA 3K20A 1SBCA 1ZU4A 1GA1A 5E9WA 1VP9A 4L7QA 1MC8A 2MYTA 4HDNA 4ZCPA 2IWRA 1UF9A 1F2VA 3JTMA 3UHPA 3W5IA 4EBCA 1XMQB 5BWVA 3FBGA 4HGQA 2UVUA 4UMVA 1S1MA 1SIUA 4RB2C 2FZWA 3EULA 1J2TA 2C2DA 2XB8A 4J1SA 4LXIA 1TWAA 1PWYE 4TMFA 1AO0A 3S3TA 1RC1A 4BMNA 2I0FA 1LJ8A 4WK6A 4B9EA 5BN4A 1YK0A 2OM6A 5A7HA 5D8DA 1FLAA 2P27A 2I2XB 2E5LH 2C59A 2R47A 1LLCA 3NGMA 1QK5A 3PFGA 4JFAA 4IIEA 5CHYA 2AL7A 3ENQA 5H02A 4C20A 2NP6A 3IPXA 3LBYA 2DFTA 3EWNA 3FSJX 1VRCA 3G5UA 3QHQA 4YJ3F 3R24A 2H63A 3A1TA 4OQQA 1EUCB 2G5TA 3V8QA 4GVXA 3VFDA 2IZ7A 1L1EA 3BIJA 4F12A 2D0DA 2H31A 4L3OA 4LRYA 1P91A 3F5QA 1RZ3A 4EYGA 4MHTA 4R3NA 3JARA 4OB6A 3WWCA 1WJGA 1J8FA 2DYKA 1KDTA 1QFMA 2FMUA 2J30A 3DFMA 3ZOKA 1JNXX 5LQNA 1EUQA 1TF2A 1CR1A 2IYSA 3FTDA 1Z4QA 4XYEA 5KMGB 2ZR8A 1H9AA 1KEWA 1RFLA 3FCUB 3HHPA 1VJDA 2A9OA 5GJWC 4AZWA 4GMKA 4OP3A 4D4MA 5IYZB 2XXAA 1L3CA 5ERXA 2R1UA 2BJVA 2QUAA 3CSUA 3QOFA 5DOVA 5TV2A 3SF8B 2JDIA 4GI2A 1P9OA 2VCEA 4O3NA 3LTEA 4CLDA 4ZXFA 2JFFA 2CFRA 4XEUA 1UXKA 4GYKA 1LQ2A 4QUKA 3CS3A 1GHTA 3SWWA 1VBNA 3NIGB 4D3ZA 4O2BF 1C8LA 4W5HA 5IBRA 3LPNA 2Y3IA 3P0FA 1XZCA 1LNZA 5KNDD 4NMLA 3TL3A 4H7KA 3II6X 4LY6A 2BKEA 1NVWQ 2JHGA 4MMYB 2IS2A 4J94A 4FYXA 4X20A 1V7QA 5ALRA 3MCZA 1Q14A 4Q6WA 3KZNA 3WMEA 3WWIA 2YY5A 1OBVA 1EAYA 3FNGA 5KZMB 3U7GA 3WISA 2WSSD 3EVTA 1XK5A 1U8CB 2BGJA 2V9PA 1G5TA 1K9SA 2C4NA 1IBKB 2FPIA 1WCIB 4HNVA 1E1RD 3VJMA 2PU7A 4JI2B 2SKEA 2I62A 3STHA 1Z5ZA 1U2PA 4QOFA 4CWAA 4AJ2A 1Y5NA 2GYUA 2WLSA 4MEAA 3PHBE 1Q7CA 1Z18A 4BUJA 1JZQA 1Z4NA 4I5DA 4F92B 5IYZF 3OZEA 2UU9B 5CEEA 3GRCA 2CW5A 3BL8A 3QUTA 1EX6A 1Z7GA 2EJUA 2IIBA 2ZJ1A 5ALOA 1KE2A 3SF8A 3ZH9B 3ROFA 4BMOB 4GXTA 1FS6A 2R8PA 3WGHA 5EXPA 3JV7A 2IY9A 1OFHA 4PR0A 1TZMA 2HYIC 1FXSA 1THZA 4RV5A 2JK1A 1WM1A 3EGVA 1C9DB 4IVNA 4URWR 4HKTA 2WV9A 3G1WA 2CL6X 4RH0A 1XE3A 3LFUA 4RM3A 4DKXA 3PUJA 1C3VA 2R00A 3LT5A 5I7WA 4IINA 1JLKA 1OX5A 1QQAA 2OD9A 4MWCA 1UH5A 1K98A 3CFYA 4IDHA 4YMHA 1KC3A 1W1IA 4DMGA 2R6JA 1TAQA 2H4XA 4KLAA 4PQFA 2RE8A 4YDRA 1C80A 2XSZA 1JR4A 3LW8A 4FS1A 1Y4ZA 2Y76A 5HA5A 1IEXA 2P9EA 3VBEA 1KVQA 2A1TS 2AXQA 3RUAA 1Z0IA 2YMMA 3VPSA 3B3AA 1MRZA 2X2EA 1U2GA 3DDWA 5E4FA 1UBLS 5FJIA 3A6DA 1YZHA 3BA1A 4DCSA 4IDFA 2EZ8A 2CSUA 5EP1A 1IH8A 1AUQA 1M75A 1EI9A 2B30A 2PZ8A 3EGDB 4TXNA 3VZSA 2H4FA 1X19A 3J81W 3ANLA 4GLWA 2VJOA 4EJ0A 4LFBB 1D2RA 1X9GA 5B6JA 2LCIA 1OASA 3QU9A 3OPNA 3S2UA 3LLSA 1UPFA 4ARVA 2AJTA 5M2QA 4U9IS 5F78A 4FS2A 2RHLA 5DBHX 1GNVA 3DKRA 2CNVA 2I8LA 4UU8A 5ALPA 3KNZA 5H68A 4POOA 1KQFA 5DGBA 1I4TD 3SOZA 3MYRA 1NN0A 1EP2B 3GYGA 3G5LA 4MP8A 3F67A 4LMBA 3PG5A 4HB0A 4NSNA 3R7WB 1NI5A 3RHTA 4V02A 1HBJA 2YFHA 2HBYA 1LX7A 3PDWA 2P1RA 4RYDA 5B7PA 2VUGA 1PS8A 5ERGB 4M1SA 3HWRA 1JHYA 3S1LA 5CFQA 3CKKA 3R9XA 2JAUA 2FUG1 1NSTA 2XHEA 3KXLA 5SY4A 3NVKI 4BP9A 3IXLA 4E6PA 2O20A 4HH3C 4BXOA 1JSRA 3RBEA 3DNFA 1KJZA 1RHKA 1J0AA 1WMBA 2WUEA 4Q21A 5DK4A 4D6PA 2J6UA 3O91A 1JH8A 1RXEA 4MKZA 2CKDA 4YMUA 3C4JA 4ENPA 4BY7G 2ZIXB 4PC2A 3NT2A 3BHIA 1ABBA 3W9UA 4NYIQ 3OETA 4KDFA 1RE0A 3L4SO 4JNKA 2RHWA 4PPFA 2WDZA 4UUOA 2HT6A 3S55A 4CM4B 4RENA 3DV2A 4DTCA 2C9DA 3RYIA 1IWOA 3ZU6A 3R9WA 4EHLA 2Z0MA 3GA0A 4Q43A 1B2RA 2ORIA 3LO5A 3QVSA 2BJHA 3CF6R 2HBQA 1MC4A 3E3LA 2CCJA 3KSDO 3KP1A 4BP8A 4D99A 3BJIC 3I3OA 4KWHA 5DW3A 4U6PA 4QXRA 4DSTA 3FYHA 1I51A 3OCWA 4HNGA 1MAHA 4W9NA 3VNQA 2R7KA 1BEZA 5LMCA 1REQA 4R98A 3RFXA 4HPXB 1YS6A 2PRSA 4TGLA 3C8HA 5AW5A 5KYKA 5ICMA 4MO2A 2EKZA 3M1LA 2F3TA 3GLIE 1S3IA 2ZSJA 1R4AA 1RAFA 1IUOA 1T5HX 1TFRA 1IAQA 3T1OA 4BLOA 2FF5A 4AROA 5BWXA 5LQAA 4C2TA 4OM8A 1FJHA 3B6ZA 4Q9NA 4J76A 1QORA 1ZSNA 1U9IA 3GH3A 4IVQA 4DV4B 3FSGA 4PZ6A 4EJFA 4RFSB 2BGMA 4F06A 4URFA 4CHTA 4OHYA 1J00A 4ZCMA 4Y98A 1AQLA 4FMCB 4L3WA 3AIKA 1EMDA 3RVMA 2J7PA 4QJ5A 5HK9A 5HTOA 1IXSB 4WZAE 1L4LA 3PDHA 2BY4A 2GPSA 1J9ZA 4P3OA 2V8OA 4OG2A 5KPJA 3W8RA 2C4VA 5FNVF 2VAVA 1IPEA 3A1WA 4KN5A 1I94B 4JJ8A 2RGNC 3O4HA 1E2GA 4K2HA 3CPEA 2OTCA 1VBFA 1AXGA 1SUSA 3M9NB 1H42A 1HLFA 2Q4DA 2WZDA 3JQGB 2E89A 5F77A 4ZFNA 5AVQA 1REQB 5CVTA 4NCHA 3P9KA 1IHUA 4OB8A 3GGOA 3H7IA 1ODKA 1RQLA 1OMOA 1MPXA 2YJ3A 2R44A 3HKEA 2P3SA 1OBGA 1SC9A 1SCJA 3C2QA 4FS8A 1AGXA 4HN9A 5JEDA 1K8YB 3N2GA 1ANKA 3ZCXA 3SI8A 3VR3A 3ZGVA 1NLMA 2Y6UA 2BE7A 3HZRA 4W1RA 3BAAA 3SGLA 1M34B 1AT1A 1PWHA 3D0RA 3HGMA 2QB5A 1A5SB 4WCDA 1J8VA 3M6UA 4H27A 4JLAA 1XWFA 2BFNA 1GGNA 3CIFA 1WUKS 2GZRA 1COZA 3CCFA 1RKVA 4W4TA 2HT1A 5DLEA 4PIMA 3KTFA 1XAHA 4KN6A 4ZAYA 2VIIA 1DXOA 2ECQA 1A9XB 2VQDA 3KVOA 2WAQE 1GTG1 4FKMA 1A97A 2D8MA 2CMFA 5T3YA 5JI2E 2VSOA 5KIAA 2ZRJA 3LPAA 4WA8A 1YR6A 5DSZA 1NW4A 2QAGC 5KNBA 4LE2A 2HHHB 5HGXA 2X3UA 4R2JA 1F17A 1I7LA 4N0DA 1EZ1A 1N5IA 4K9NA 4RETA 3THRA 2AWNA 4KH0A 1UKAA 3L7YA 5K6AA 4KQCA 5H3LA 4ZAZA 4BUZA 1MEJA 2PFSA 4IWNA 4LRXA 1SA0A 4EBDA 2WYVA 1U0NA 3NBQA 3NHJA 5CU7A 2C5AA 1W5SA 1KO5A 5LDHA 2QUKA 2ZR7A 1D2EA 3GEBA 3R3YA 3PR4A 5L1LA 1H85A 4NABA 4DXDA 1SCAA 4CMEA 1AG9A 5CFNA 3UA3A 2YCHA 1FSFA 5GOTA 5FL7D 3GA7A 4R0MA 1CB7A 4NAHA 3MCAA 4IPTA 2EFCB 3ZE0B 1EU1A 5EE3A 2V0GA 3QFSA 2XKJE 2QTGA 4DL5A 5AHXA 4QDOA 2XR1A 3T9CA 3H8VA 3GDGA 4HMOA 2ECKA 3OWOA 1ORDA 2ZTLA 5HILA 1AQNA 4EG1A 5DCLA 1BXRB 2FP3A 2R1TB 1A9QA 3HCBA 2P6OA 5LBTA 2JFPA 2O59A 5FFMA 4WZZA 3D2LA 3L1JA 5E8RA 4F3RA 4U7JA 3FOAA 1GDTA 2VDNB 3HJUA 3J7AK 1MOQA 2WIKA 3UPUA 5AFSA 1FTSA 2I71A 2FPXA 2JGJA 2XCOA 3KSZO 4XOUA 3MRXA 1T5BA 2BP7A 2QYHA 3S6JA 1Z2PX 4A3BG 2P2NA 3I6IA 1HFJA 3ZGXA 4EI7A 3MWDA 4EG6A 4MW4A 2VPQA 3QP9A 1KY5A 3R5JA 1QHHB 2NZ8A 4R1SA 1YI8A 4V2UA 4XRRA 2JCSA 3U4HA 5BRJA 2ZUBA 5ICGA 2QVCA 2F59A 2GO7A 3B6MA 1PW7A 4DQVA 3U56A 3EB9A 4A91A 4F2PA 1JHZA 3DP7A 4JYMA 1M3SA 4RPHA 1DG1G 1QHFA 1B93A 1H9CA 2NNLD 3G9XA 3ZEIA 2IF2A 5DAAA 3N07A 3D2BA 3NYRA 2N47A 2C0CA 3KOXA 2IIPA 1ISRA 1CWUA 1LW7A 2AX3A 2ONYA 1VPVA 2VP6A 2HEGA 4HYYA 3CVXA 1G5FA 4JC4A 2UUBH 1C1HA 4TQGA 521PA 3K2EA 4NBVA 4RVDA 5D1NA 3AM5A 3G6KA 4F97A 2GA9A 3G79A 4DUPA 3G9UA 2D2EA 3L7LA 1QK4A 4AF8A 1CDEA 2XNKA 2A5YB 1PZHA 1NR7A 4AYBE 2X76A 3QENA 3AJRA 4V0SA 4J9VA 3VVBA 4C4OA 2H2IA 5EMJA 4TN5A 1JR6A 3AU8A 3KQWA 1J7KA 1WUTA 5AXBA 1NMQA 3PKZA 1ZVQA 3EDOA 3ITEA 3NCTA 5AVSA 4OI0A 5J2TB 5L4LA 2DSTA 5EIHA 5KTRA 2J31A 2MJLA 1Z7EA 2O1WA 3LH5A 1SUIA 3AOGA 3HACA 3LDGA 3KJIA 2CFSA 1KH3A 1J56A 1T2DA 1VL8A 2A86A 4D4IA 5JV5A 5MFZA 3OA0A 4BXXG 3BFPA 3FJ1A 3KREA 1ML3A 1HSZA 2DE0X 1S3GA 1NMXA 1Y1PA 2X1VA 3R6LA 1TTTA 2C8LA 1BJRE 3KHGA 1ZIOA 2R92G 1VSVA 1GV0A 1X15A 3HXLA 4K87A 1YS4A 5CH3A 2IYXA 5DFAA 4GICA 4BV8A 1TDJA 4WOBA 5DSTA 1SXQA 4O7SA 3I42A 4DADA 2X0IA 3FZEA 4EBEA 4NCXA 1UFRA 4CV3A 1ICIA 2EP5A 3EA0A 4Y9UA 3DAHA 2BQRA 1PJQA 2WE8A 2WJAA 3HOYG 1XR3A 3PDCA 5LPNA 1U2DC 2GJSA 4AK9A 4Y0NA 1EP9A 1K7FB 1IN7A 1GFIA 1WR8A 3E7FA 4BTEA 4GSLA 2FSPA 4OXQA 3OLCX 1SRQA 4GYJA 3E18A 2GJ9A 2CDAA 1QGUA 4RBNA 4JLVA 1C4OA 3I8OA 3ILYA 4DLRA 1XTQA 1L7AA 4UOQA 3RC3A 2PLRA 4NAUA 1CY8A 3QWFA 3KETA 4JZKA 3CA8A 2H57A 1GCAA 4Q7KA 4A2BA 5E4TA 1U80A 2WYWA 1T1GA 3P0HA 1X7ZA 4I3HA 3HWX1 2QUJA 3NHRA 3H1BA 1AUXA 1Q22A 1UODA 5FQOA 3SZMA 4XEHA 2EEZA 3V2IA 3QEAZ 3L6OO 4YUXA 5KX5A 2MR6A 2YWXA 3F96A 1N7HA 3AVOA 4YX9A 1QGED 2H4YA 2QRMA 5KDLA 4IILA 1E61A 2I91A 3GNSA 4QNNA 4CLRB 4YALA 1ADBA 2HGWA 4FFMA 2AR0A 3IB3A 1JLMA 2O52A 2VJCA 1FYDA 1JKFA 3B78A 2A2ZA 4GWLA 2AI3A 4BYGA 1D1TA 1WLYA 1QTNA 2RONA 1TM7E 3DTYA 3FGNA 3K0HA 4UMEA 2P9HA 4ROSA 2FI1A 2BUCA 2MINB 1PZNA 3JSXA 3KTAB 4ZZ0A 3MQ2A 5H80A 3PZBA 4YPOA 5FPOA 1MENA 4FYIA 3RAXA 3WICA 4AJOA 2J7KA 3EPHA 1AGPA 4NOLA 3ZE1B 4LFCH 1BX3A 2AE2A 3LUHA 4HQKA 4J75A 1KUTA 4URHA 2VA2A 2ZPTX 4MA5A 1AHIA 1CQXA 3HY6A 2WSMA 3RAFC 4EF4A 1M34A 4EBFA 2Q50A 5EJ5A 1Q21A 1ZVJA 1IK4A 4CMDA 3ZNQA 5BVHB 5F4ZA 3UV3A 3ZV6A 1PFUA 3MGGA 3T06B 1U7ZA 1CX9B 2J6BA 1V9PA 4H08A 3SZOA 3V8EA 1R2QA 2W6PA 5EMNA 2CJYA 4II7A 3K0EA 4E3ZA 2IQ5A 1CS0B 1DC6A 1ONPA 1P80A 1S7GA 2AI2A 3C1UA 4CPDA 1A3CA 1F8XA 2WFMA 1CUUA 1SEPA 3QW2A 2X8AA 3DCYA 4OHMA 1M74A 4AWBA 5C7LO 3QX3A 3AWIA 4N5IX 3S27A 3UFXB 3MR3A 3NWEA 1OV4A 4C87A 4D82A 3SYTA 1C8KA 3AIOA 3KHSA 3S1SA 4C2UA 4DCCA 2H7CA 4EY6A 3N2YA 4F6RA 4TT3D 5FOQA 3L0CA 3CEHA 2FPWA 3IJPA 5SICE 4AJKA 2R8EA 2IHBA 4MCIA 4MV7A 5DLQC 5DQIA 6GPBA 1WBBA 1XDWA 2YWRA 3KWMA 3MFYA 1CUDA 3DVRX 1WXEA 1SOVA 1KOJA 3RJ5A 3KAQA 3UYKA 4YRZA 4GUDA 4JR0A 3A6JA 4CL2A 1QR6A 1MT0A 4CMHA 4ME6A 4RQUA 3PGMA 1HDGO 5IFLA 5DF1A 2O2HA 4D4GA 4HWSA 4MUIA 3KE8A 1XNQB 2JAXA 3V1MA 1IYDA 3PW4A 2GF2A 4HXEB 4TKMA 1B16A 2GHIA 4EFBA 2HPAA 5AW0A 3G9QA 2PV7A 4ARBA 4ZT5A 2HAEA 3ZHRA 4QTYA 4JH0A 4BNYA 4DPMA 2PBRA 5BWNA 2QRQA 2FZ4A 1EWYA 1FW6A 1M2OA 2CLLB 5JQGA 1D2HA 4CQMB 3PEYA 1PLLA 2IGTA 4REMA 4RMNA 1ND5A 2XXAB 4KAXA 4J9OA 3OTOH 2OHJA 4PBSA 3E81A 3EXHC 3GOQA 4AMVA 3E5HA 2W6MA 2FEWB 3B13B 4Q3CA 4CM4A 5IBQA 1ZH8A 2C00A 2Q3JA 3HYTA 4JQCA 1YTLA 3BXXA 4OUDA 4QYWA 5BW6B 5EPEA 4YLYA 1H5QA 2EERA 3A25A 3DNMA 4GLOA 4E30A 1E0JA 3RF6A 4J7XA 3W5HA 3QA9A 4E2YA 1ULHA 2NAFA 2Q2WA 4GOND 1ZIPA 4Q02A 1ZFNA 4HRXA 3DO8A 3E2PA 1YR3A 3F7MA 5LN1A 3ABSB 2PZJA 3RHSA 1U7HA 3KEMA 4ODIA 5IVKA 3OZXA 1Y89A 3D3EA 3I32A 4Z3KA 5HQTA 4MS4B 4ATNA 5JAOA 3OIVA 4W5RA 5FDFA 4XFJA 1L7NA 4OJQA 2W42A 1J0DA 2O7VA 1IEVA 2XT9A 4F7DA 1EEXB 2QZ9A 4H7PA 4PGFA 1MJGM 4Q1BA 3LQFA 3WSVA 1WTAA 4LC0A 4ZYXA 3LXRA 5T4EA 5ABPA 4R8LA 2JAPA 1U8UA 3B1JA 4U3JB 4FTWA 2YBDA 2GBGA 2W7TA 4A3GG 3D5QA 3R2JA 4L15A 4GVPA 2X3YA 3SX0A 2XE8A 5IJZA 4A3MG 1DAIA 1FNNA 1RMTA 1PGNA 2WSSA 3G7UA 1KJIA 4D4KA 1ISSA 5HUQA 3DULA 3WGVA 3MWYW 2H3EA 3IT3A 4MNTA 3ZWPA 4Z1MD 4EHAA 2ZGVA 4JOCA 3TPFA 3E4CA 4MVJM 4YT4A 1Q3HA 1F2TB 1WVMA 3PYLA 1SVWA 4OUKX 4Q4HA 1ZJWA 5HR5A 1G21A 3I04A 1G38A 1QIJA 1Z8DA 3BWDD 4OQDA 4AZ3B 1P7CA 1OI4A 1PX0A 1JDNA 2OGSA 5EXEA 4GOJA 1YL7A 4LSZA 2FR8A 2FQWA 2JJYA 1W8DA 3P2MA 3P1JA 2QX4A 3Q6IA 3GJ4A 4BV2A 2PVPA 2BWJA 5LDGA 5ADVA 2Q6VA 1UEIA 2VRWA 1NDQA 4ZHQA 2QWXA 1P4AA 3WI7A 5AVVA 2ZKIA 2ZYSA 5KKNB 2GZSA 1VGQA 2XDQB 2CLMB 3SC2B 1JDBB 5T7BA 4MS3A 1FFAA 2I8AA 1GZ7A 4HCJA 1GGKA 3MBKA 1JIHA 2AGVA 4FD2A 4LEIA 5HQ3B 5IJXA 3K2BA 1LA2A 2BR0A 4HNAA 1AXEA 4BO1A 5ICCA 2LKDA 3NIFB 3JPWA 4QGBA 2MWMA 3A11A 1P7VA 4J6EA 2B3TA 3W9SA 4C0WA 2QI9F 1WCXA 3K2IA 3VUEA 1Z0FA 4LRWA 1A9SA 4L0DA 2BPOA 1A82A 3AR2A 3E61A 4UHFA 4F1JA 3IDZA 1XVLA 3NEAA 2Z2XA 5FP0A 5JCPA 1K5GA 1NRIA 1QG0A 2A9JA 1RQXA 2HFJA 2CJFA 2NO9A 1GL6A 1OPXA 3BIWA 4ZZIA 2WHQA 3H65A 4MDHA 4L2IB 5F9NA 1OLUA 1YRHA 4D3DA 1EK0A 2GARA 3MGBA 2WJJA 1TO1E 5EZYA 1WMDA 4BGVA 1T8PA 5E0OA 3O8QA 3TRDA 1ZD5A 3LX4A 4I50B 1N5LA 1XU4A 2XB4A 3IKTA 2ESRA 4CQLA 1NYQA 3KEFA 3IT2A 2K7FA 1WUJS 1WBDA 2N46A 4MZDA 4WECA 2W2LD 2VHXA 1OFIA 1LF0A 4Y30A 2VZ0A 2R7MA 2XBUA 1L7OA 1RIIA 3OZAA 1D2AA 3R4CA 3P26A 3HFGA 4JL6A 3A4MA 2Y1XA 1CY2A 4UCSA 3N8NA 3T7SA 2OP1A 4ED1A 1T91A 1QWSA 3TTXA 3TOSA 1RXWA 2NN3C 1ECPA 4G2TA 1VAJA 2CL0X 4FONA 5GY7A 5KOJB 1BWSA 3OZFA 2C2ZA 2UZ3A 2UYCA 2D0IA 4EG7A 5DYWA 2VYVA 3ZN2A 2PKQP 1L4HA 3G49A 3FTNA 4DA9A 3K0AB 4Y1EA 4HFJA 4DV3B 3COWA 1R15A 4KNWA 1DVRA 1L4MA 2VDQB 4KR0A 4LY3A 1WW8A 4PSVA 3AHDA 4Y1GA 4BNWA 5LOVB 3A6PC 4RKEA 1I3CA 1LK0A 3B3FA 1KNXA 4BYMA 3GEPA 2FXVA 4O4IB 1NL3A 1EVLA 3C15C 2HADA 3EBLA 3GW8A 3ZZ1A 3I09A 3CUVA 3AKZA 2ZRLA 1EDZA 1XVAA 2R1TA 2G9RA 4FKBA 3R5XA 2NZXA 1XL0A 4Q44A 2ZBRA 3JAWA 1KWKA 1VL1A 4FB5A 4DL6A 3KHLA 4GECA 1ZESA 4OJTA 3V8VA 4LHWA 1PT8A 2JC3A 1ST2A 4UE2A 5I8WA 5D87A 1RE1A 5GONA 1FTGA 1A27A 1WE2A 2Z8XA 3QF7A 1RAIA 4FE4A 1DJLA 1FNMA 1SR8A 2Z9CA 3HZHA 4YV2A 2GF0A 2YHIA 2A0WA 1X1QA 5J4KA 1DUVG 5M29A 3M7IA 4GVLA 4OMUA 4Z8XA 4F72A 1YASA 5CT5A 3EFOA 4J1QA 4HVTA 4RF5A 3AZOA 3R9KA 3JQQA 3KHHA 3MUOA 1X9NA 2JLBA 1RCUA 4QNMA 4TS4A 3KB2A 3CMMA 4I55F 4K3VA 4OQLA 2Q21A 4BLTA 2D3TA 1KXZA 5DXFA 3T4UA 2RGGA 2JKYA 5JIBA 2AX4A 2DPXA 4YGXB 4DWVA 3G9TA 2G83A 4JKYA 1W88B 2AZDA 3BQ2A 2V6BA 3N5CA 3P9CA 4CEIB 3K8OE 2W83A 2YHSA 5EG5A 4P4GA 1G8FA 4QGAA 3JW8A 4TKUB 1RWKA 2LW7A 4HX2A 3W5UA 4A2WA 4RKYA 1ZPDA 1J2JA 1YFKA 3MWFA 2WMDA 3S81A 4OLHA 2AN3A 3EVFA 5EGSA 4DVGA 4NCIA 5TRTA 1E2QA 1DQYA 4BIMA 2VK1A 4QOSA 4YV0A 5IWAB 1OC4A 3EFBA 1G3UA 4N01A 2BP7B 4MWDA 5FI5A 3UFBA 2QLLA 2AZXA 4ND6A 1PNRA 4DEXA 5JS6A 2XXJA 4YDSA 4LXQA 2BMJA 3OQIB 4CKWB 1XJ0A 4YUYA 3IUQA 3THWA 2ZDHA 3KV1A 1F4PA 2J9RA 1Z5VA 4TYQA 1VTKA 4KVAA 2Q99A 4HDCA 4MAMA 2ZAMA 3DAPA 2QTZA 3FF4A 5KFYA 5A03A 5KCZA 3OU6A 4FJ2A 4DLXA 3C7TA 3TAUA 1PSZA 3U80A 5KVAA 2VP5A 1FP4B 3LCJA 3VR4H 1JPUA 3TXAA 2ZSFA 5AVZA 1I3NA 1LTQA 1JIKA 4WXEA 2R11A 1IQPA 3OFSA 3X1ZA 2OV3A 4BHTA 1ENPA 2J3QA 2V7QA 4LNUB 3KKOA 1RABA 5DLGA 1D5CA 2TECE 2LP4Y 2VXCA 2R6DA 1RQNA 3AI3A 1PV4A 1B0AA 4Z8YA 1T24A 3PJDA 3HLTA 4CCAA 2P35A 5JO0A 5C8VA 1H2HA 3GC6A 3MM4A 1RQ2A 3PNYA 2RKWA 3NDPA 4DDTA 2GKGA 3PS9A 4UAGA 4TXMA 3FNEA 4QWWA 5LA6F 4YRDA 1B7GO 4EECA 5IXYA 1T0BA 1XQ6A 2OHVA 1N1EA 4BCCA 1BW9B 4D9HA 4QC2A 3QQMA 5DK6A 3RLIA 1FW8A 5H59A 5CDTA 3VOSA 2AWOA 5IP9G 5I5GA 3HSYA 1SBQA 3ZE7A 3OLQA 1R37A 2GWRA 3ZDFA 1SCNE 5B12A 4LJ6A 4DHEA 2W70A 2M1XA 3AR7A 3GA5A 1GAWA 3ZPXA 4YP9A 1ZICA 2B35A 1WPQA 3NT5A 3JASB 5E9JA 4WOPA 1A77A 1OYVA 3TW6A 1JQDA 1JE0A 2DU8A 2PFGA 1DXYA 2RJOA 4GLLA 4EPRA 4OY3A 3QF4A 5JG7A 5KFQA 1E5TA 2NPIA 3GGSA 3JQBC 4QLOA 3C97A 4RGBA 2VDLB 4JJEA 3DZHA 4W5JA 3KUXA 5FTNA 4O0MA 4MUKA 1ORRA 4KTVE 1ZYUA 3HP4A 4QGFA 5FQNA 2WOJA 3EIOA 3OSZA 1DGSA 4B3MB 3PC8C 4EPXA 1Z28A 4E5SA 3HN6A 1CQIA 3U31A 2PJDA 4J3JA 5EHNA 1EE9A 4Z99A 1XZPA 3EYAA 2OHOA 3DA8A 6LDHA 5TE9A 3IOMA 2TYSB 3EZGA 4A2CA 1TIKA 2ADFA 2ZVDA 3D1VA 3FY4A 1YB1A 3T7TA 2AN4A 5K6AC 5AQ1A 3QXSA 1FS4A 4MA4A 2OXCA 3F0TA 3MWEA 5C1PA 1NBEA 5BOVA 2PCLA 3WBJA 1M73E 4OXIA 4FILA 4RTSA 2OHXA 1C3OB 1QZXA 1XOIA 2Q8QA 1CIPA 3QKUA 3ISVA 1AS2A 2DP4E 1S4MA 4ND5A 1F2DA 3WB0A 3OTQA 1KC1A 3EGDA 1BDIA 4XWOA 3RJ9A 1E9DA 2NTVA 3NU1A 1P5HA 3FCOA 3T7KA 1N3BA 5EERA 4AZSA 3NVMB 4ZO7A 3REGA 6ABPA 4LCJA 2I67A 4D8XA 1T0JB 2DFPA 4RB3C 3OPVA 5K8CA 5C4MA 4HMQA 2R92A 1X1SA 3QUAA 1MHPA 4F85A 1BQ4A 2FFJA 3ZKWA 4CC6A 2DHCA 5HS6A 5BN1A 2JFUA 2RIPA 1WP9A 1CUGA 1PEAA 1Q1ZA 4M4SA 1VM6A 2JH8A 2JLWA 4AVYA 3R0JA 3WJ1A 5SYMA 2YWFA 1VLLA 4QATA 2X8WA 4X5OA 4UU0A 4JLDA 2GOYA 2X6QA 3JVUA 1KYQA 1SBYA 4AUKA 2WAMA 1K4MA 1NZDA 1R6BX 3B38A 4M3NA 1G1MA 5KYXB 2O8BA 1W30A 4R9RA 4Z2AA 1I80A 1J8DA 4LJ8A 4ZV7A 5GMOA 3IE1A 1CQZA 1UMCA 3PDIB 4D9IA 3GIKA 1M0WA 1GYRA 5TS2A 5BSGA 5JZ9A 5HIAA 2HXYA 5COBA 1TA4A 2C83A 2VDRB 1ARZA 2GZHA 3B1FA 3VJLA 5TY0A 4IHAA 1FK8A 3FTFA 1BEEA 2Q62A 3DV0B 3EXHA 4I9HA 4TMZA 5DM0A 4O1MA 1GEGA 4R1LA 5DI3B 3T1TA 4CKBA 1DX6A 3GJ8A 1Y63A 1Y4AE 1B43A 1WW3A 2BBSA 1NJFA 2HWUA 1QZUA 4QEDA 2GUWA 5GP1A 3W5JA 4F5WA 3H20A 2FPKA 5K03A 3N1UA 3OM0A 3QXHA 4J7UA 4QSHA 3TI7A 2RHCA 2I4OA 3O1IC 5CTJA 2AFVA 4H17A 1P3DA 5GTDA 1M76A 2OGTA 2FN9A 3KDSE 2G40A 5T8KA 1AD2A 3V1UA 2P2DA 2CYCA 2DKOA 4UUQA 2FPGA 1S2OA 2VHZA 3R6GA 4DR1B 3BB3A 3VZPA 4TWBA 4MRRA 3WGJA 2XOKD 3HGQA 2CNOA 2SICE 5A5VA 3LZCA 4V03A 1EDDA 4J9QA 1UJ4A 1YJQA 3B6IA 2BMWA 2R48A 2XKBA 1Z0ZA 3K2QA 1HDXA 3KB1A 1EDEA 1H1LB 3RJ0A 3HKBB 3MMZA 5IKXA 3L6RA 3JVVA 3B3GA 4GKVA 4JLUA 3F6EX 4JP8A 3ZWBA 2VWHA 1ONSA 2II6A 4O59O 5KJCA 221PA 3O26A 2AF3C 2CJXA 2PY6A 3ADOA 4G5XA 4YAOA 3X44A 1RWOA 1CEQA 3BQNB 1HK7A 3CNHA 3O03A 3N28A 5AJTA 4DJAA 3DZIA 1CQJA 2A1UA 3NIBA 4A0FA 3KUDA 2JGKA 2R1ZA 3CRQA 3DBVO 1ZH6A 4JGGA 3UMVA 2GSWA 4DVJA 4UTPA 5BWTA 1EXNA 1MB2A 3QFRA 2D6FA 1YBFA 3RODA 1RPNA 2FFBA 1GQRA 2PWAA 4YCDA 1HA3A 4U6QA 4YJHA 1YC5A 1PFWA 2RG1A 3H13A 3RTDA 3JQEA 3GZNA 4KFTA 3ROPA 5AM3A 5LWQA 2LPMA 1ZN2A 2AGQA 4FWBA 2CYBA 2Q2OA 3GZNB 4F93B 4N9WA 1OXSC 4ZDIA 2EFEB 1YDGA 2VPWA 4KVGA 4MWGA 2P7HA 3W5CA 1Q84A 1X1EA 1HX7A 1A3GA 3E6AA 2Z95A 4E1BA 1K7YA 4Q4CA 1W1UA 3X43A 2NLOA 2OCBA 1YRYE 3I9FA 5JWHA 2GCOA 4UZFA 2ONZA 1GZUA 5EJ6A 2IU0A 3ETJA 1ENYA 4B73A 2IX3A 3R7NA 4LI0A 1UWLA 4NG4A 3WBBA 1C9EA 3CSWA 3G6WA 5CM8B 3MT0A 2P40A 2AH5A 4Q4DA 1CJUC 2WF8A 2Y93A 3L01A 4MS1B 4QQNA 3WIDA 4DNFA 1SCDA 2J3EA 2QE6A 1PR6A 3E7DA 4OF4A 4ZZ1A 1IBRA 1SQSA 1UBFA 4DOMA 2E1PA 1BS1A 2C20A 2CNKA 1L5ZA 2XRMA 4JL8A 4IIJF 4AKGA 1ZITA 5K8UA 3RVDA 1G41A 4EMTA 4EGAA 1K6EA 1BA3A 4RZ3A 2AU0A 3I39X 4G0VA 1XQYA 5AMXA 3IUPA 4YK7A 5FHRA 1Z73A 2HQRA 1UQUA 3G2NA 4O7ZA 3BJZA 2XB2A 1NVUQ 1KPHA 2EG5A 5DRTA 4XWGA 4LXXA 4NPCA 1Q44A 3OY7A 4N5LA 4OKSA 6CHYA 1V3QE 3GP3A 4BFYA 2E4ZA 2BZSA 4L76A 4TWZA 2D2VA 1DUIA 1G2WA 4U2FA 2VHWA 3RVNA 1JFLA 1M5RA 2I3GA 4IZOA 1FYXA 2IYYA 1SCQA 4YO8A 1MJGA 3JQDA 3NC0C 2J48A 3AHJA 1GR0A 3IJ5A 3QNMA 2V0CA 4C43A 1BQ3A 2XDWA 2CWWA 3G9ZA 2ENWA 1CRZA 3RRJA 4CL3A 2I2FA 1JQKA 3DOFA 3BCSA 3N87A 4WCVA 3H2YA 1N8KA 1KYZA 4M1YA 4BECA 4CXMA 3ONWA 4RK6A 1RYZA 3RTGA 3QXGA 3VTKA 2WJHA 3FRIA 3UC9A 2PXCA 3NKFA 4MVYA 3RRFA 2IHVA 5FBZA 3RRNA 2HCJB 3M9XA 1MB9A 3RIGA 2TMGA 4IDNA 1G6HA 3S5UA 2V55B 3U39A 4EJMA 4N40A 4AY5A 2BE9A 1HKHA 5KI6A 4OUDB 3SJBA 2PRJA 1NN1A 4RXTA 4YQWA 4C2AA 4X95A 1R4NA 3LGAA 4DCPA 3RC2A 1NFQA 1XRPA 1SU7A 2CUNA 2R751 1UBJS 3IR6A 2MSLA 2W00A 4P82A 1ZNYA 4EK9A 1C2YA 1CP3A 1C0IA 1Z16A 2GETA 1XQXA 3E8MA 1BW9A 2IDZA 4OHFA 3A0UA 4PLWA 3ZLJA 3DM5A 1DKQA 1MVOA 4AY4A 4CLHA 2JLAA 4YJ2F 3C3EA 2BL4A 2QJTA 3QI2A 2JB9A 2VJKA 2XYGA 1ZK4A 5CR5A 2Y1KA 5FOXA 3ZD6A 4O2AA 3LK6A 2IODA 4FCWA 4PQGA 1RWPA 1E1QA 4RNCA 1ZM7A 2JA8G 5K1ZA 2ZDGA 3IALA 4I4TA 4OPMA 4X6YA 5IC6A 3AK4A