3KAKA

Structure of homoglutathione synthetase from glycine max in open conformation with gamma-glutamyl-cysteine bound.
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
473
structure length
443
Chain Sequence
b'PLFDYHRIDQKLLQNIVYDALVWSTLNCLLVGDKSVQRSGRVPGVGLVHLPLSLLPGPFPESHWKQGCELAPIFNELVDRVSLDGKFLQESLSRDEFTSRLLDIHSKMLQINKDIRMGIVRSDYMIDEKTKSLLQIEMNTISTSFALIGCLMTGLHKSLLSQYGKFLGLNSNRVPANNAVDQSAEALAKAWSEYNNPRAAILVVVQVEERNMYEQHYISALLREKHHIRSIRKTLTEIDQEGKILPDGTLSVDGQAISVVYFRAGYTPKDYPSESEWRARLLMEQSSAIKCPTISYHLVGTKKIQQELAKPGVLERFVENKDHIAKLRACFAGLWSLEDSDIVKKAIENPELFVMKPQNNIYGDELRETLLKAAYILMQRIFPATSPAILVRDGNWDTGHVISEAGIFGTYLRNKDKIIINNESGYMVRTKISFGVVDTVYLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoglutathione synthetase
publication title Structural Basis for Evolution of Product Diversity in Soybean Glutathione Biosynthesis.
pubmed doi rcsb
source organism Glycine max
molecule tags Ligase
total genus 147
structure length 443
sequence length 473
chains with identical sequence B
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03199 GSH_synthase Eukaryotic glutathione synthase
A PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1080.10 Mainly Alpha Orthogonal Bundle Glutathione Synthetase; Chain A, domain 3 Glutathione Synthetase; Chain A, domain 3 3kakA03
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3kakA02
3.30.1490.50 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kakA05
3.30.1490.80 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kakA01
3.40.50.1760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glutathione synthase, substrate-binding domain superfamily, eukaryotic 3kakA04
2VR1A 3WO0A 2CNQA 1GSAA 1KJ9A 2GPSA 3VOTA 4XYMB 4MAMA 3KAKA 1T36A 5C1PA 4HNUA 3LP8A 2HJWA 1CQJB 2YRWA 4QSHA 4O83A 2ZDQA 1OBGA 4TV9F 3MWEA 3OUUA 4EGJA 1SCUB 3ORQA 2FPGB 2FPIB 4O81A 3BG5A 5C8YF 3AW8A 1PK8A 3U9SA 2FPPB 5JH7F 3R23A 2W6MA 2R7KA 2YL2A 4ZI7F 2NU9B 1JDBB 4FFPA 1VBGA 5LOVF 3I12A 3HB9A 5LYJF 3NUAA 2NU6B 3JZIA 2YWVA 5IYZF 4HNTA 4DIMA 1EUCB 4ZOLF 2CNVA 4MV1A 3KALA 2GQSA 2R82A 2W6OA 1A48A 3K5IA 3ETJA 1CE8A 3KREA 1GLVA 5BMVF 1KUTA 4O7ZA 2P0AA 1JDEA 4YJ3F 3E5NA 4FFRA 3TINA 4YAKB 4O7TA 2OLSA 5CA0F 2W6QA 3N6RA 4EGQA 4MA5A 2GQRA 2J9GA 5BPFA 2YZNA 2X0SA 4FU0A 4IHJF 3JRWA 3LWBA 5CB4F 4O2AF 2W70A 4MV6A 4MV8A 4MV7A 2Z02A 1CQIB 2NU8B 5CA1F 3UFXB 4XYLB 4WBNF 1B6RA 2HGSA 1W96A 2GPWA 3RUPA 4YBZB 2YZLA 3JRXA 1BXRA 4O82A 4FFOA 2PVPA 2W6NA 1VKZA 3K3PA 4HNVA 4YAJB 4ZHQF 4HR7A 1KEEA 1EZ1A 4O7VA 1Z2PX 4TUYF 1VBHA 4C5BA 2YZGA 2NUAB 4MV3A 1KJJA 4YJ2F 2R84A 3TQTA 2W71A 4C5AA 2PN1A 2CZGA 4C5CA 4FFMA 2IP4A 1Z2NX 4O4IF 3ORRA 2DWCA 2YYAA 2ZDHA 4NYEA 4TV8F 5CAEB 2V58A 4I55F 5LXTF 2YS7A 4O4JF 5LA6F 3TIIA 3VPCA 4IIJF 2SCUB 2QK4A 1B6SA 5JVLA 2I80A 4MV4A 2W6ZA 1I7NA 4L1KA 3U55A 3OUZA 1M6VA 4O4LF 4O7YA 5EZYF 1EYZA 3R5FA 2FP4B 3AX6A 2YZMA 3RFCA 5LP6F 3HBLA 3WO1A 4ZQIA 3VMMA 1W93A 1ULZA 2R7MA 4O86A 3R5XA 5JQGF 5HV6A 4E4TA 3TW6A 1WR2A 1C30A 3DF7A 3N8DA 3R5HA 2Z04A 3KAJA 3VPBA 1OBDA 1DIKA 4XZ3B 4O7RA 4FGRA 4IZOA 3WNZA 3TIGA 5H80A 2YRXA 4ME6A 1M0WA 2ZDGA 1KJIA 3V4ZA 4FE2A 4I4TF 4YB8B 1JKJB 1E4EA 2NU7B 5JVDF 1GGOA 3SE7A 1DV2A 5JQWA 2XD4A 2R87A 1KBLA 4O7LA 5D8DA 3K5HA 1A9XA 1KC7A 1GSHA 5BPHA 4Y8VB 2R7NA 2R85A 5J2UF 5J2TF 4EG0A 2R86A 1CS0A 4O7NA 3Q2OA 5C1OA 1PX2A 2DLNA 3G8CA 2XCLA 4O84A 5GONF 4MA0A 4RZQA 5FNVF 2FB9A 1Z2OX 2R7LA 1BNCA 4MV9A 1IOVA 2YW2A 5DMXA 2W6PA 3JZFA 3MJFA 4M9UA 5KX5F 2GLTA 4DLKA 3HO8A 1KJ8A 4O2BF 5KKNB 2DZDA 3ETHA 1C3OA 3GLKA 2V59A 2QF7A 2YS6A 1DV1A 2I87A 3RV4A 1E4EB 4FFNA 3V4SA 2C00A 3RV3A 2I8CA 4FFLA 1IOWA 3R9RA 1AUXA 1EUDB 2CNUA 1GSOA 3U54A 1JLLB 1KJQA 2WYOA 4O4HF 3MWDA 3G8DA 3QFFA 1AUVA 3VA7A 5HBRB 3Q1KA 4HQ6A 3U9TA 2PBZA 2VPQA 1M0TA 4O7WA 1I7LA 2V5AA 2DIKA 2VQDA 4XX0B 4I50F 3GIDA 4O7SA 1EHIA
chains in the Genus database with same CATH superfamily
4BU0A 1GL9B 4HDCA 1OWPA 3Q9SA 4EBEA 3G2PA 3D3EA 1EE2A 1CB0A 1M2GA 2Z2ZA 1U8UA 4CNQA 2HJWA 1Z08A 4ZCMA 2VP9A 1DFHA 1B41A 3DS8A 1UDXA 5EJ5A 3H3FA 3L1VA 3LLUA 4EVRA 3RJMA 3FJOA 3R09A 2YHAA 3N58A 3GFVA 1A88A 3AW8A 1TCBA 4L8LA 4TRRA 1X80B 4QYWA 1OVMA 1JYSA 1GYRA 4Q37A 4PTYA 4DQDA 3I4LA 3RYHB 1A27A 2CLLB 2QRVB 2B94A 3DGEC 2RAVA 1UBRS 3KJZA 1F20A 4RDIA 1U8CB 3RG2A 2HF9A 4O8ZA 1QTRA 4D6YA 3AR9A 1NBMD 4LSXA 2CK3D 3P5BA 4X7PA 2L19A 1GZSA 2YWCA 4RANA 4UD2A 3UGKA 2VTKA 1FMLA 4Z4GA 2QXUA 5J2UA 4BDSA 4M7RA 5AJUA 3BBLA 1PGPA 2ZK7A 1HFWA 2QMZA 1JN0A 4QDXA 4CE6A 4CLOA 2JHGA 1Z2EA 1CBUA 1WVGA 2YZNA 3N1UA 1L2ZA 1W35A 3K0CC 1GUZA 4RLHA 4TYPA 5EXEA 3OZBA 1AT1A 3NHUA 1BGXT 2CUNA 3X44A 1G59A 3LCJA 5J1SB 3LU1A 4ENWA 4GW3A 3GWGA 1KVRA 3FNEA 4LJLA 2CLOB 4I08A 5G0VA 2CL7X 3HJNA 3E82A 2D0OB 3NUGA 3FE2A 4IJWA 3TY9A 2V7GA 3VJMA 3DE6X 4NXNB 1GOTA 3LBNA 1BOOA 3EOAI 4NV0A 1SK8A 5DFAA 4NR0A 1RJDA 3PDUA 3PICA 4FSDA 1J8YF 5KSPA 3PFBA 3G17A 2ZWPA 1ZVJA 2PH7A 2PXAA 1EWKA 5K6AC 1CJKC 4S1NA 4TTPA 1V3TA 1W75A 2YY7A 1WXIA 2ZBUA 1IBLB 2P11A 3D3NA 3B6ZA 1MZBA 5NLLA 1G7RA 3W8EA 2D54A 1RJEA 4P3KA 3VYWA 5ADHA 1CY0A 2WHYA 5AUOB 2ECOA 2Z5VA 4V0LA 1ZAUA 5C8YA 3ZWAA 4F84A 3OCYA 4LOLA 4OIFA 4IIHA 1R0BA 4XKJA 3CXRA 5LOVA 4A0SA 1I4WA 2ZAMA 4IFEA 2XB9A 3CC8A 1G8GA 4RQAA 3FHTA 3PR5B 1I10A 4FGRA 2HT6A 5J4KA 2BI8A 1OWMA 1BVYF 3NORA 2FPRA 1RCUA 4F7WA 4ARBA 4KOAA 3BGSA 1U8YA 2P4SA 3A4LA 4X6UA 1YDGA 1ZGBA 2Q1XA 4QIHA 2QN7A 2C4NA 4KREA 3DB1A 1JFTA 1PT7A 5AW7A 3E5RA 2VTBA 4LOAA 1K2VN 4RS4A 3G0DA 4M88A 4LISA 3EXIA 4DRYA 1O5IA 4ZDKA 2VN8A 5BW5A 2Z5LA 4N8DA 3KLMX 1N78A 2G7MC 4ZEVA 3UZUA 3N9IA 2X5OA 4E3ZA 5CX1A 1KJ8A 3AYZB 2C88A 4LBVA 3VTAA 1VE1A 2AFIA 5ALEA 5TEVA 1ZHFA 3TQQA 3G2LA 5UKDA 4MQ6A 4LHZA 5CE8A 3WXMA 5FBQB 3FZQA 5KFYA 4LMPA 4MJXA 4KPEC 3KOXA 2CZCA 2YVKA 3PDIB 2FZCA 4NQRA 3DEFA 4YRKA 3JAMA 2BMWA 3A1SA 4AK9A 4A82A 3RB6A 2HNBA 1RBQA 3L18A 4PW0A 4TT8A 1SXJE 5I47A 2I91A 2QVBA 1ORTA 1SVWA 5DBEX 3EDMA 1VPDA 4B3FX 1AQUA 4PSDA 1E2LA 2HA3A 4JA2A 1CP3A 3GRRA 2RARA 2F48A 3PJEA 1T3HA 1DKNA 1Y3HA 3BJRA 4H7DA 3VVCA 3CNOA 2H9AA 1QYWA 4G0QA 4DV4B 1HTBA 2EEZA 1YC2A 2CHEA 1GPAA 4TVOA 4RCVA 3A28A 4RVUA 3OQMA 5CA0A 2DBQA 4BNNA 3U3XA 2OGSA 3WWJA 1JLSA 3T54A 3LBYA 2HQBA 2J6BA 2H18A 4UDOA 1II8A 3IR6A 3AR2A 3AUUA 5FWYB 2FEXA 3OEED 1FXUA 1ACJA 3IT1A 3ED1A 2B99A 3QWAA 4MHSA 3LUDA 4IZHA 4F8EA 5TX7A 3RYCA 2UVPA 3NKLA 1TK2A 2OCLA 1IG0A 3H5RA 4WKCA 3NTUA 4NMMA 1QO0A 1KO4A 2JATA 5ESDA 4NU0A 4F97A 1GTJ1 4KQKA 5KFDA 2Z83A 1YE5A 3ZXSA 3T5BA 5HNEA 2XC9A 1JA0A 2Z2KA 2ZOSA 1WW3A 4RSHA 1VJ1A 2WC1A 2CXOA 3ROGA 4F9FA 5BSWA 5EP4A 3ZY4A 1KS2A 3EXAA 3MJCA 1LBTA 3UMVA 2X5KO 3G82C 2TSYB 2XNSA 3C15C 4GAEA 1U7HA 2EJWA 1CUIA 5CVVA 3F9RA 1YCHA 2O59A 3TVYA 3I1IA 3SIPA 2P3LA 2AS0A 2IV2X 1QWSA 1I2CA 4R2XA 1Q7CA 4IX1A 1FUKA 1JR6A 2WR8A 4RGVA 5LD2B 4WXYB 1ZY2A 4QYIB 4EKDA 1U63A 1UZLA 4EYSA 4JUFA 4KE6A 4UQPA 3UTCA 4A6XA 1GKYA 2JFWA 2XB4A 4EECA 2C2BA 2REQB 3CZAA 5SICE 1TVCA 3HP7A 5C7LO 4KQGA 2BMEA 3WWPA 3COVA 5I7FA 4DL5A 1QYXA 4QPJC 2PTGA 5IP7G 4YJ2F 3AOGA 2ECQA 3LNTA 1JEYA 4ASUD 1I51A 4YC7A 2FSUA 3GPDG 2JGMA 4KXYA 2NYAA 2A78A 4BY1G 1OFUA 4IIJF 3M2PA 3DAFA 4XB6B 3FMIA 1CK4A 4ZREA 3WI7A 2ZJ0A 4KK4A 4KE7A 4DN6A 1UT8A 2DPYA 3I4CA 3T5AA 2FLVA 1C9MA 4YDHB 1FF9A 1PNTA 3V3TA 2XZOA 3B48A 4WK4B 2Q2WA 4QRHA 4H9GA 1EFKA 1GL6A 4AULA 1IUOA 2G77B 4OB8A 1CLEA 1D1QA 4DV6B 3TE7A 1ZJ6A 1IBMH 3DMHA 3VO8A 2BVNA 4DSOA 3CRQA 5JZOA 2VYND 4H3VA 621PA 3KM0A 3RF7A 5FEUA 1TF2A 5ITSA 2I9PA 2QNIA 1TQ4A 2YJTD 3TNLA 5J2UB 4ALKA 4N9QA 4IXWA 5ALGA 5FOVA 3Q3VA 2BR3A 3N2KA 3FKIA 3HJAA 1NZDA 2YCLA 4C29A 2I8AA 2GAJA 1SJ9A 1IZYA 1EDDA 3PENA 1MB0A 2XCAA 4EO4A 4G8CA 4V0ME 4DV7B 1R4AA 5K4HA 4BGUA 1RQGA 4QATA 4W8HA 3E0QA 4WXHA 1NC3A 1HQKA 3B89A 4O2BF 2BZ1A 1CY1A 3R8XA 1TZCA 3FGPA 2NVYA 1NJSA 4XFJA 5DG7A 1CDOA 4HZGA 3NRJA 2Q49A 2QIOA 4WNAA 3W6UA 1OCEA 2AQIA 3GJ5A 3V6LA 1I0ZA 4D8UA 1KQGA 1DC6A 4NBVA 2X5JO 2C8JA 3GCDA 1NVTA 2XIQA 4HAZA 4NI5A 1TJYA 1L7AA 2GPBA 3BD8A 2HU2A 1P0PA 3D43A 3JCZA 2ZGIA 1J5XA 1GSAA 3K16A 4D4GA 3DDZX 3DBIA 1ZK1A 3LUAA 1TGVA 2VK1A 1JR4A 3WHLA 1QNLA 3BE5A 3K8ZA 3AI3A 3ZH2A 9ABPA 4AKIA 2VUMA 2HJGA 5LOVB 2AMVA 1RIFA 3UATA 4DCCA 3MVEA 3Q5DA 1OAOA 3OY7A 3Q8MA 4M87A 4P84A 3CH7A 2XXAA 3PJFA 5F1YA 2ALZA 3Q4GA 3TI9A 2O8CA 3R41A 2DUWA 4PRLA 5TR9A 5AVOA 3GIIA 3HWRA 1P0MA 3PRJA 4YXWA 4UBLA 1RQLA 1TKRA 4MVJH 5ERYA 4TM7A 2QT9A 1JT9A 1HO3A 4F72A 3DWEX 2YJ4A 2P9QA 4LZZA 3QF4B 3IDOA 3WB0A 3OFJA 2C54A 3NBZC 4Z86A 1SUEA 3ZDXB 1J9EA 4TWIA 4M9XA 2JAUA 1SH7A 3UK7A 2F3UA 2HT1A 5J47A 2C77A 1UQUA 1KH3A 3UH0A 521PA 3DDSA 5IJWA 1GGNA 2YMMA 5CX1B 2CL5A 3G7UA 4LF9H 2V8BA 1Z3IX 4FFDA 1ZITA 4DGQA 3L8ZA 4TWAA 5DM0A 1ZISA 3L5OA 3O2JA 3OIGA 2WP8J 1L2TA 3KE8A 4EHNA 4RD1A 2PX4A 4Q9LA 4J6FA 2GA8A 4B3TH 3LMLA 3A3KA 4HL6A 3UM9A 3W5UA 4J75A 3EBLA 3UJ6A 1UBGA 3U5ZB 2OFOA 1IM5A 3K96A 4EFKA 5F23A 1IAQA 2RDJA 1J99A 2QG6A 4IP0A 1UK8A 4YHHH 1KDRA 2Y4RA 2FSIA 3L06A 4RUCA 2BF4A 3VNAA 3KZXA 1U0LA 3CO0S 5LKRA 2HC9A 3F9IA 2JBAA 1I7NA 1UXIA 1II8B 3EOBI 3BWYA 1C4KA 2RGUA 1IVSA 2MYTA 1F5SA 3MG9A 5FJJA 3RYCB 3IG0A 3TNFA 2ZRKA 3P2YA 1DKRA 3CHYA 1CKNA 4J1NA 1U3DA 3LT4A 4RZUA 1FQOA 2Q8QA 5JAMA 5K0EA 4P0PB 3OJ0A 2CF6A 2BP7A 1ZUWA 2Z57A 4UHCA 5J9FA 4KMMA 1WH2A 2PZFA 4EBFA 3DZDA 4FE4A 3GELA 3VSCA 3WIOA 4YPOA 2PS3A 3HYSA 1ZGAA 5LJIA 2WJ6A 3GRYA 1RK5A 1KEVA 2GK6A 3E3AA 2P6RA 5CTAA 1QG4A 1J6UA 1MXFA 3OY2A 2DPGA 4JBGA 2OLKA 3PUWA 5LU8A 4O7NA 4YCSA 3T5PA 2AYZA 4ZYYA 4J9KA 1C1DA 2YNMD 1OFUX 3S44A 1IM2A 1DC3A 2GKSA 3K0FA 3VR3D 5DQHA 3GRCA 3F6SA 1Z13A 1QP0A 2R7LA 1AF4A 4J9NA 2BFCA 4AMBA 4JI2H 4UNNA 1T9DA 2P4EA 4HXGA 2CKMA 4ZC1A 5FHQA 1P29A 4GIBA 3IA7A 4JXJA 1H0HA 4L8FA 3T5KA 4R98A 2OGWA 1CQXA 1Q12A 3O4VA 4LH7A 4IDFA 3F4KA 3DL4A 4L75A 3QYJA 2C2MA 3LW7A 1UWVA 3PV0A 1Z2DA 4C06A 2H4WA 1L7XA 4Y7DA 1FUIA 4AJHA 4W4TA 3NKFA 3ICQB 3UQZA 3B38A 1OFVA 4GMHA 2QP4A 4KBYA 4J0KA 2OV6A 1PNRA 1SIUA 1IUKA 3UUGA 3WDMA 3FCAA 4MB2A 3RS2A 2Z9CA 5BV0A 3TJMA 4KC0A 1USKA 2XPCA 3FKSA 3DEYX 4BLQA 2QX6A 4D9BA 3GZ4A 1U4NA 2XRYA 3F6PA 2X77A 1BC5A 4Q0YA 1BJKA 4X84A 4D8YA 4J3JA 3VPHA 3QTLA 4ZT5A 2HQOA 3BTVA 2P78A 2I67A 5ALPA 2YL2A 1G4AE 1PT8A 4YGYA 4EJ2A 4KN8A 1O0BA 5LYJF 5LQKA 4M6WA 1EX7A 3GCZA 3JZIA 2VJDA 2OZLA 1SA0B 1B0PA 1DO8A 3KSMA 4DIMA 1XA0A 3ETNA 3FFXA 2AEMA 1EA5A 4R1PA 5I9LA 1UMBA 3TL6A 1A48A 4WN3A 2VG8A 3VGJA 2F4VB 3DJFA 1QJCA 3FB1A 1ZOOA 2Z98A 3RDPA 3TGWA 1OBHA 4URXR 4Z7QB 4JI5B 3ES9A 4M7EA 4R9RA 4UFZA 1KAQA 4P4NA 3MFYA 3PNOA 1VYUA 4IL5A 4I8IA 3X0DA 1IU9A 1I80A 4WZ6A 1C4WA 3N5KA 3WJAA 3HLKA 3LK6A 1GCGA 1KFEB 3G7SA 4GMGA 1EA7A 2H57A 2EZ4A 4CMKA 2B5VA 3O8LA 2GETA 4OAOA 5CW1A 4C43A 1C7FA 2GZRA 3P9ZA 1FJHA 1E9EA 2P6NA 1NR5A 3AHJA 1TM7E 5HOEA 2NOAA 1CJSA 5CPFA 4AG3A 2GYWA 1ZCJA 4FOPA 4UEOA 1F8GA 4ARCA 1Q20A 2Z8XA 3WA7A 2W9BA 4KQJA 1ONNA 1UMCB 4WXRA 1MX9A 3AHDA 2PIAA 1YQQA 4EKIA 4MH0R 5KTTA 3FTQA 3GP8A 4HI0E 5LC1A 1J07A 2Y0DA 1P2BA 4QYMA 4BXOA 4YR9A 2ZIWB 1Y14B 1RXEA 5FQNA 4MR8A 3KQKA 5E6RA 1WXDA 5CFZA 1P33A 3N5CA 2OPHA 2GOYA 1QPGA 4AJIA 2OXFA 1X7ZA 5T8KC 1CY8A 3IKJA 3CG0A 3FPHA 1BE0A 5IVHA 5LBTA 3QMWA 3QFCA 2I2XB 2YOHA 4OJQA 3FTCA 3DPUA 4EO7A 1Y8ZA 1P45A 1NLMA 2YXDA 3RRBA 2H51A 1PD0A 1L5YA 2XXAB 1P0IA 3ESBA 4QBKA 1X7HA 1GTMA 2JAQA 1NV9A 4HGPA 5C51B 1O7JA 1NV8A 4F4ZA 3QKUA 2O8CB 4CR7A 1Z16A 1P4RA 4D43A 3H7IA 1UBHS 1WR8A 2X15A 2LP4Y 2IOFK 3PIIA 3RVJA 2O2EA 5AW3A 2VPSA 1W6RA 4WIAA 2K87A 1A76A 3AB3A 4ENTA 3K2EA 2W8LA 2RJOA 2QTZA 4OGWA 4KNYA 1Y7TA 3QWBA 4NU6A 3AR4A 4O3QA 3UUEA 2XUPA 4ZD6A 1SHTX 3TBFA 4Y18A 4DRXB 2BEWB 4V03A 1DMRA 3K9FC 4O84A 1WHSA 3I5AA 3K32A 5CVJA 3T3IA 3DBVO 5I7EA 1MCZA 2W58A 4ZZ3A 2ILTA 1I32A 4FX5A 4WE3A 4GEKA 4W9NA 2K2QB 4M9UA 2D2VA 3LGAA 3MRXA 1TA0A 2O2HA 1W29A 1DX9A 5BN5A 3BMNA 1NBMA 3R2JA 3OHBA 4X64H 1Z4KA 2RGWA 3C3CA 1ICIA 4KDRA 2PX5A 2R0QC 2FX5A 2DY1A 1KP3A 2JFBA 1PR2A 1SK9A 2DPMA 1GA6A 1MPXA 3BJMA 3QTBA 2OTCA 1X9HA 2RK3A 4AO8A 4CIAA 5I8ZA 3SOPA 5LD2C 1ODTC 1QQBA 3FWHA 2QTTA 2KMLA 4P6VF 1ECBA 5I5VA 4QTZA 2H1HA 3EGXB 1ORDA 4O4JA 4Y1RA 4UCSA 3FPJA 1DFGA 4IJVA 3LWDA 2HF8A 4EZIA 1K98A 2YIVX 1II0A 4UAVA 3BYZA 5BT9A 3FDXA 3FVWA 2Q5IA 1YCDA 4Z1OA 1NYLA 3WLPA 4J2OA 1ETHA 2FRXA 4RCZA 1CKNB 1LPPA 1WP4A 3P9CA 1QDEA 3JSAA 3DVSX 3QI2A 3C5WP 1UBKS 1WKVA 4F6LA 4I4CA 4CMEC 1JIXA 1NUTA 4PX2A 5BWWA 1GARA 3TX2A 1XVAA 1VJCA 1UKAA 3TZQA 1GNQA 3UAOA 2B78A 3T0FA 3ZXYA 1NI3A 4YJ3F 1QNFA 5LQMA 3L9WA 3DOOA 5KMGA 1BH2A 3TTYA 5ERGB 1D4ZA 4V02A 3D6FA 2G25A 2QD3A 4Y8VA 4RD2A 3JRWA 2XGPA 3DAAA 3I04M 4M21A 4TRMA 1XGKA 4YX9A 4OAPA 2J9XB 4OXXA 4D4JA 2MSKA 4CKXA 1W96A 2ZTLA 4JLOA 2PAAA 1IPHA 2C2HA 1YI8A 1Q22A 4DM3A 2QMUA 4BLSA 2D06A 1ZCBA 4DWVA 3HCCA 1CVLA 1E2BA 2GCEA 1J49A 4H3KB 1Q21A 1B4DA 4L22A 4G0YA 4RTPA 3VNUA 4WAUA 5BW8A 3B5IA 3IHLA 4MP6A 1ESEA 5L3SB 3ZWCA 3JAKA 3KSRA 1GPDG 4RZXA 3ECAA 2J6IA 2IYEA 2ET6A 4G1MB 4Y2HA 4KIJA 3KLPX 3DE7X 3KKKA 2C7VA 3I4FA 3ZUPA 1UZAA 1U2GA 2Q0XA 2HFJA 3Q6MA 4RDCA 2BISA 4PG6A 1M2OA 1S8OA 4MLDA 3W5HA 4DJJA 4F3NA 1Z36A 3DWGA 3O4HA 2M2IA 1DC7A 2O2YA 2ORIA 4DLPA 3WIEA 3SJBA 1VB3A 4C0XA 4QQRA 4BAUA 4NONA 3WRXA 4MYSA 1DMSA 4EVSA 4CHGA 4H1VA 1HE2A 4M6WB 3ZE8A 2FU5C 5DM70 4JGIA 1UM8A 3OE1A 1ZGJA 1ETUA 4KW7A 2Q5FA 1LFDB 1U5BA 1AF7A 4O5AA 3KXIA 3JSXA 1V8BA 1LPAB 2JD1A 2H4HA 2X8JA 2CDRA 5EWLA 2PNJA 2FX3A 1OXUA 3V46A 5CCDA 1Z4OA 4MB6A 1I3MA 4XIYA 1KK1A 3GEEA 5FLXA 2IV7A 4O7LA 3FPLA 1H94A 3PQEA 5HRUA 4KUHA 2V96A 4CMCA 4OHXA 2J31A 3FY4A 1L5OA 4XYGA 1OXSC 3ZWBA 1GN9A 4BWGA 1Z0AA 2ID4A 4HQNA 3ZIDA 2J0VA 1S4MA 3KSDO 1X92A 2M32A 1OV4A 4YN3A 3UXMA 1RABA 1PFWA 1A5BB 2RC5A 5LKAA 2GLTA 5KTSA 1RLIA 2HMTA 3PHCA 3H2JA 1C3OA 1NF2A 2P9YA 5HWSA 2C00A 3O84A 4GM0A 2Q5QA 4TT3A 4A2QA 3SYLA 3I6YA 1PR9A 3STVA 2ZG6A 5BR8H 2YHBA 5JXIA 8MHTA 1DAIA 4MVJM 1LH0A 2FZWA 1M1ZA 4RSRA 3DFFA 3ZHXA 2IELA 1U1CA 4E15A 1PKXA 1XCJA 3RB4A 1NXPA 4HUJA 1ZVVA 1X3LA 4D80A 2NXEA 2VR1A 5TF0A 2QRQA 2NVOA 2X4GA 2P5TB 3SDBA 2YIJA 4X92A 4QEDA 5JSFA 4ZTBA 3GEIA 1FMFA 4X00A 3Q7IA 3CM0A 1U3GA 5TQ0B 1XQVA 1P0CA 3OOHA 1R2QA 2O8FA 3F67A 2JKVA 1UKVY 4B1FA 3IOMA 2IEBA 3OFVA 1UAYA 3VZSA 2ATIA 1JVBA 4Y2GA 2B1GA 1X7GA 2Y93A 4L85A 1EK5A 4ASUA 1Z25A 5TJHA 4TKZA 2YWVA 3E1KA 4H4CA 1D1PA 5FPYA 1KI1A 5CLFA 3DUFB 5IVIA 1X15A 1JR3E 4G1VA 4DDKA 4EPTA 3SKVA 5CVUA 1J5EH 5LWHA 5FPKA 1Q50A 4DV5H 1UBNA 1I5RA 5IM4F 2TYSB 1JTFA 3A6ZA 3RF2A 1SBNE 1RI1A 5J2TA 3HH8A 5EIEA 5KFGA 3C16C 5CYOA 2R93A 5KFXA 5DGXA 3L0SA 2XCIA 2MSNA 5IC6A 1LTQA 3FROA 3IAUA 5CB6A 1Q17A 3T4EA 2RH4A 4JI7B 1TM4E 3U4DA 4K3VA 5BSHA 4L95C 5FWNA 4P54A 4OV6B 4ED9A 1YRQA 2VDMB 3F3YA 3BMNB 3QXXA 3LL7A 3L6OO 4M36A 2DWQA 1XAIA 3RKUA 4RTSA 4L8GA 1B2LA 1KY3A 4GVXA 1PV2A 1LS6A 1KI8A 1WB5A 4FNGA 1UM9B 2ZUUA 3KQNA 1RWVA 4DNQA 2OUIA 1KERA 4U6QA 3HS3A 4O3NA 4RZSA 4C4SA 4C1BA 3S28A 3U4HA 2GFHA 4HH3C 1T5DX 3D64A 2PVSA 1P2TA 4FIZA 1DQSA 1KGDA 2PRKA 2Z3WA 3VV2A 2UVQA 3KJQA 2KE5A 5EXSA 4DR5H 3BK1A 4O4JB 3DSRA 1ZEMA 1C1XA 4JH0A 3BGIA 2BE7A 3AFHA 3IVAA 1IQUA 4QRIA 3A4IA 1Z37A 1XVUA 2VDUE 2WNHA 3DOUA 3VH1A 4YB8A 4O4HB 3RIGA 3F5FA 3U62A 2WM3A 1UKYA 2CE7A 2JFYA 4WEOA 3HBLA 2DH6A 4MQ4A 5C44G 3O74A 3ZK9A 5I01A 1G8FA 2AH5A 3KZ1E 2GASA 3X43A 5DK6A 3HCDA 3QG1A 2XNHA 3PITA 3E3MA 3L7YA 4H1TA 5HV6A 2PTHA 3A1NA 3MUOA 1QJ4A 3RVQA 5LQSA 1CIVA 3M4JA 1OBOA 1TMGE 1EK0A 5K8LA 4MTCA 1XMJA 1JB1A 3ANNA 3IVRA 5FF9A 5JZVA 1FFDA 5EVCA 3M6XA 1E79A 3NC1C 5FR9A 5EKDA 4W7HA 2WAXA 4YA6A 2FMHA 2UVDA 4QIWE 3BE6A 1ESZA 2VUIB 4MVYA 4IINA 4YCJA 1ZG3A 4DMFA 3UJ7A 2RF4A 4RELA 4Y8VB 1VKNA 2E4AA 5ITZA 3CV3A 1L5WA 4NVRA 1TKCA 4AWBA 1JLRA 2DF8A 1R3UA 3S99A 4JVOA 4LRXA 3ZV6A 1CF9A 4YRPA 3LHKA 1XU7A 2GM3A 2FLPA 1LBEA 2W90A 1VPEA 4Z5XA 4IIEA 5LZ8A 5A04A 3U37A 1P9NA 3HHPA 4LJ5A 4Q1VA 2WT4A 2NO4A 2ASLA 3GJ6A 4I5IA 1FVIA 3JQPA 3MINA 1TWAA 4BO1A 3NHBA 3CEAA 4V38A 3D8RA 4POOA 3JAKB 1WUHS 2WYHA 3TY8A 3ZGXA 4CM1A 2IXDA 3DDUA 4YFVA 1L5FA 4ICIA 1CRPA 3K8YA 1DQYA 5BWCA 4FBLA 1M2OB 4MICA 4JQYA 2NQTA 4CCAA 1N5KA 3BT7A 1I4OA 4TKVA 3KZVA 1X9NA 3LKDA 3RC3A 2BKVA 1U1DA 3THXB 5H4HA 3LVRE 3DO6A 5IAGA 2PWZA 3V00A 3FKSD 2UU9B 2FE4A 5HOQA 2P1DA 1DRKA 3TTWA 2IIVA 2FOLA 1KGSA 3C7AA 2ZJYA 1VHWA 3L0DA 2C99A 3FRHA 3FMGA 2R7KA 3RE1A 4CMIB 4WDRA 1U5BB 4NV1A 4JUDX 3PF9A 3KSBC 3Q8KA 4MPJA 3E1GA 1G55A 3QE3A 1BRTA 3DAYA 2X8JB 2JZCA 5F51A 5KU1A 5EWLB 1G7CA 5KNDD 1RQ7A 5G53C 3EVFA 5BW6B 1HC7A 1Q6YA 2WK1A 5KFJA 1SZPA 4E32A 3HCAA 4N5IX 4QAQA 1E9AA 4FKZA 2XDQA 3FVRA 2ONZA 2RGGA 3NM5A 5D3KA 3LRTA 4GC6A 2YIDA 5FIUA 3QU9A 4RK5A 4C4RA 1OYOA 3L0OA 3IELA 2WV9A 1YB1A 3I9V6 3NJ4A 1ONOA 5CHEA 3GV0A 5A4DA 4M53A 5F5NA 1GITA 2E9SA 3H8SA 4HH0A 821PA 1MA0A 1K7SN 2REOA 1SOWA 5CA1F 2IHYA 1YQDA 1N2GA 4U9UA 4PRKA 3AERA 3ST7A 3VBCA 5IKMA 1XK5A 4HAOA 3MGAA 3CZPA 5AKZA 4NXMH 1C7IA 5H81A 1B8NA 1V9LA 4GHWA 4HR7A 4FWTA 3BQ9A 1N7GA 4BC0A 4C6SA 3NUZA 3O4JA 3ZWYA 4KFCA 3WYBA 2M6KA 4GGOA 2FG6C 4TVKA 1H1DA 5T7BA 1TLFA 4EF4A 2OV1A 4HZUB 3GFTA 4QA9A 3NS7A 3Q2IA 4YAWA 5BN4A 1DGQA 5E9QA 1E2NA 4QYXA 3BTUA 1TO2E 1FNBA 3H05A 4LJ4A 1SU8A 1A8IA 4IG9A 1OXKB 1JAXA 2J67A 2GBLC 5JCXA 1X39A 1RFLA 4U39A 3RVOA 1VL1A 2WF6A 1YACA 3IUQA 3MQ4A 1YR2A 1KDOA 2G40A 2WJVA 1GZ7A 1GL7A 3EZXA 4ETSA 3M3PA 1U9CA 5AVVA 2Q4DA 4IS2A 4YRRA 3PQ3A 4JOCA 1QAQA 4MUBA 1G4UR 3FLEA 1TJPB 1A7JA 1RAFA 4N47A 4I50B 3PUHA 4RF4A 5AKIA 5ARBA 3H0GA 2Q3BA 2H8GA 1FUYB 4YV7A 3KRTA 2JHFA 3HSSA 3L1JA 4LZWA 2GYUA 4G3XA 2XGSA 1Q6ZA 2IPLA 2VZ9A 3ZHYA 4OQEA 2AOUA 4LNHA 4EA7A 2C5BA 3TRDA 2H0RA 3HVRA 4MI9A 2HYIC 3J81W 5IBCA 1CUXA 3P0EA 5KG7A 4RAYA 3BRQA 1T4BA 5DWDA 1M34B 3OQHA 5KTMA 4RHUA 2MDTA 3QFSA 1P9LA 3PTLA 1D6SA 4OSOA 3Q6IA 1IOVA 2R7ZA 5K8IA 3SY8A 4RVSA 3W4KA 2ABWA 3DHWC 1YGPA 4JL5A 3ODGA 2IUSA 2DFLA 4X7MA 1S0NA 2JLBA 3AL0C 1H9CA 4FFNA 3PWZA 5JDIA 2II6A 3FA2A 1QIEA 3I9MA 3GI1A 2FR8A 5FO0A 1C8KA 1PK9A 3OX3A 2VEOA 3LT1A 4O3PA 1TWHA 4IDCA 3PCXA 3N2YA 2YV1A 5E2AA 1FMJA 4MRSA 5A4MS 5ED4A 4WCDA 1ZA1A 5G3ZA 3SYRA 4JI4B 3I0NA 3OPYI 5HIKA 3PHLA 1L4GA 1C1XB 3TOVA 4FW9A 1GTVA 5GV8A 1E2KA 3V8VA 3D8NA 1DCTA 1XKXA 2R11A 4G5QA 1JT2A 1EHIA 4HK4A 3R6DA 1IBRA 1A0OA 1XVTA 3DCJA 4XR4A 3TLGA 2P5SA 3VR1A 1PL6A 1DEOA 1MAWA 1YV9A 2EAUA 1ZH0A 1QFJA 4G0WA 3FZEA 3VKHA 2QN2A 2RBEA 3HXOA 4A91A 5A2QA 4BO3A 2EQBA 1HF3A 2BGKA 4OTZA 3GTQA 3PNSA 1IK6A 4PGFA 1GNSA 1N9GB 4NU5A 5ALXA 3ET4A 4LNUB 5EE0A 4EHFA 1GO2A 3ESCA 2JFUA 2WHPA 4DUPA 4LZNA 3NDRA 4PFJA 3PFFA 2VOEA 1EVIA 1YI0A 2KHZA 2H65A 2HV8A 1E5TA 1ZEJA 4N6GA 1BQEA 3GFOA 2VZ8A 2NPOA 5SY6A 3EPLA 4YDRA 1IRXA 2AUNA 3G2HA 2LIPA 1V8OA 1P7PA 3MGCA 1XD2B 4D56A 1E3MA 5JMWA 3CH4B 5I9NA 2ODAA 1YB4A 5EIXA 3EDYA 3K8QA 3WSVA 2PXHA 2OFPA 1NLUA 1J1ZA 5DHTA 4L5IA 1H5QA 2V4RA 4GX0A 2GJSA 3NTXA 3STXA 3BIJA 5BURA 1P3Y1 2W2PA 5E4JA 1W46A 4CM3A 5I9MA 3DP9A 4WZAE 2QTLA 1E3DA 3GFPA 4BN4A 4ZGWA 1ELOA 3I1JA 1VE9A 1C0KA 2NT3A 1YI1A 3BAFA 1EVLA 3MRSA 4KAXA 4BE4A 1SUWA 3PL5A 3AEUA 3TIVA 4NLLA 4LY3A 2VJKA 3SYNA 2EJVA 4I19A 4M0JA 3LX8A 2H5LA 3LO5A 4OSPA 4DIBA 2IU6A 2ZRBA 1E99A 2EW2A 4GKAA 3GCWA 5LA6F 4TZTA 4D3YA 3GFSA 3I9JA 2ZYSA 5TARA 4UQOA 4ZU6X 2VT6A 4OYHA 3LKZA 4EYHB 3AETB 1RI5A 3OFNA 2OKCA 4BTLA 2AEJA 1AJEA 2V0NA 4LV8B 1R12A 3HG7A 4J9VA 1LBHA 4PNZA 4QUDA 1T6YA 2HOQA 5I5XA 4ZI7A 1JBQA 1NN5A 1SGWA 2CLEB 3W3AA 4BNJA 2R6DA 4CT0A 3EPHA 4DC1A 2O3RA 4MQ5A 2D5BA 3MCAA 2WIKA 2RAPA 1AGRA 3TOSA 1H1LA 4QOFA 4DFDA 1J25A 2BD0A 2GERA 2QUBA 2XDQB 3L04A 1M1YE 1CHNA 4OQNA 2JPDA 2QNRA 2B4YA 1R0CA 3TB4A 1JAHA 1HQDA 2I4TA 3OU6A 2WUVA 3H2SA 3UKOA 4QPCA 4BO9A 1K75A 4KPUA 4ZAVA 2H6EA 2G5CA 4LQLA 1Q1AA 5TVKA 3F97A 2C58A 4J1TA 3OUTA 5GONF 2M98A 2WDTA 2Q0HA 1I94B 2SNIE 1BJTA 2F3PA 4E7PA 4P36A 1RE1A 2ZCVA 4O0LA 3AR3A 2A94A 5EN4A 4JNCA 2W6PA 4MB0A 4BGIA 5KSOA 3ZGZA 1ILEA 3L4KA 4JY7A 4OHFA 3BDIA 5COQA 1DS6A 3BZBA 1ZOSA 1GPJA 5DBGA 2I87A 4FQ8A 5HK9A 3U7HB 4MW0A 5DXJA 1Q0SA 1MOSA 1J22A 3JQBC 4G07A 5LYYA 4D9MA 1DEKA 1MVOA 3HWWA 3OO0A 4I4IA 2A0YA 4FYKA 4O63O 2LDXA 1Q5PA 4DUYB 3CPEA 2VK4A 1AQLA 2QT1A 3DMFA 3PXDA 1EG7A 2HSZA 4TT3D 4DDWA 2WBLC 3DP7A 4V2IA 3V4RA 3ABZA 2B82A 3SD7A 2BMFA 3INGA 5BN4B 4LF5B 2I7TA 4E4YA 1IL0A 3VZDA 3IO3A 2HRZA 4GVLA 3FLBA 4YMIA 3F3MA 5EZQA 2E4ZA 1Q7GA 5M04A 5JNUA 4NP6A 1IFXA 2BY4A 3EY9A 4JLJA 4EW1A 5DB4A 4V0KA 3A1UA 4ECUA 3OM1A 3SWWA 5KT7A 2QA5A 5YASA 2KPOA 3S2UA 4PLPA 3K1ZA 1VLMA 4R8SA 4AZSA 2Q2QA 2JHCA 3IBTA 2WWVD 4U02A 3H5TA 1EH5A 3MCWA 3RUEA 5JHHB 5FAXA 1KMCA 3IKLA 4WZZA 5HFJA 3VC2A 2HIVA 5JU6A 2AOUB 1R6DA 2C3UA 2IA5A 4HPJB 2GN4A 4MVCA 3GB8B 5LQUA 3VISA 3N42B 5EERA 4RCNA 1U7TA 4IZIA 1PBTA 4GD3Q 3FZYA 2YMPA 5TRTA 4GI2A 1PUXA 2ZSHA 5EMHA 1U8XX 1TF7A 1Z7BA 1H42A 1KFBB 2WUFA 4QUEA 2HJ9A 4FFBA 3CEMA 4U7CA 4JBLA 4H35A 2I7DA 4DA7A 2YQZA 3JQFC 2P2ZA 4CLDA 2PO5A 3I4NG 1D2RA 1K7EB 5FI3A 2RGEA 3EVGA 5AM2A 2FV8A 3D7KA 2C0CA 2Q3MA 1MV8A 3O0DA 2J0SA 2IP1A 4MULA 2PJRA 1K5PA 1YZQA 1YBVA 4N39A 1E2GA 3TZ6A 4MIKA 3RUPA 1Z12A 5T57A 1QLWA 1SELA 4KSBA 2IT1A 1ZBQA 3FPAA 1K7CA 2JEJA 1LVUA 5L1LA 2Q0QA 3FLMA 4CLOB 4WDQA 5K0TA 5K0ZA 4H60A 5A5FA 1RHRA 3C43A 5EINA 4H17A 4L9AA 2ZYGA 3F9CA 3V7FA 3BUSA 2PLAA 5LZ4A 3MOSA 3ITEA 4ZKEA 2HHCA 2OXEA 1M10A 3WZMA 4JK3A 4A03A 2LWIA 4IDGA 5JTUA 4PC6A 1CZKA 1RJPA 5J23A 1WZIA 1TFRA 2YXPX 3PLRA 3M6VA 1KHTA 2VYQA 4EI8A 3UPTA 1CY4A 1XL1A 3KZKA 2D1YA 4H7PA 3N0RA 1EGHA 2WHXA 3IQEA 2UVVA 3HZOA 2FPIA 5IVDA 2NP6A 2POQX 1U0HC 5EFZA 1WR2A 4LFCB 2XMQA 3E3LA 4B76A 1K2WA 3E9QA 3KSAC 5CH5A 2J5XA 4PBCA 3QY0A 1N0IA 4HPXB 5JHGB 4JLUA 3A1CA 3ELBA 4BQEA 2XVXA 4LZOA 1VP3A 5JS7A 1E79D 1E18A 1GEGA 1DKUA 3W9UA 1A2OA 3PXBA 2PMCA 4WMLA 5C8YB 4JXUA 4ZO4A 1P4SA 4AG6A 4CEHA 2I2DA 3EIQA 1CUWA 2BKLA 4HY3A 1S2IA 2FYTA 4KITB 4EG7A 4IVRA 2R7NA 5KFQA 5KOHA 1U65A 1IHXA 2GUGA 2ZI3A 4EY6A 5K2OA 1JDSA 4L07A 2Q1YA 3EWNA 2I6XA 4GLLA 1EP3B 3LRXA 1RAGA 3F5SA 4FMDB 2FOXA 4QJ4A 1G17A 1BA2A 2ZANA 3RU9A 2GTHA 3PBKA 1XMQB 3E53A 2CT8A 1W7AA 2B5WA 4BWFB 1E0KA 5DAAA 3EQ6A 4QXAA 4M1EA 3ZCSA 2FSGA 2EZTA 4D8WA 3ZYZA 3HBJA 1NT2A 4M1OA 1BROA 4MTDA 2VTBB 5A4JA 3B5JA 1RVV1 3HKZA 3GIPA 4RIEA 1WMEA 4RF5A 3EXIB 3CJQA 4KE8A 4D9GA 3QVTA 4EOGA 1H2RS 2R1TA 4KV7A 1X7YA 3MB5A 1NPDA 4UAJA 1I7LA 4QECA 3KFXA 4DNFA 1SQ0A 5I7SA 5G0UA 3UKJA 4AQYB 2AFIB 1XMOB 5EWMA 3K9HA 1PRYA 5ELMA 3I64A 4KU4A 2IYXA 1RC8A 1MO3A 2DHCA 4QSHA 3BRCA 4J9SA 4PLYA 2ZDQA 4OA5A 5I7VA 4BP3A 3V55A 3EJ6A 3ET5A 4KOEC 5ALQA 1NVVR 3PVSA 3EPJA 2XVMA 2OD2A 3DLAA 1GRQA 2JEIA 4QG7A 1A1SA 3QYAA 4U2KA 2ZUEA 1R6VA 3SQDA 3ZK8A 5IC5A 5F64A 5HQTA 1GAXA 4QPZA 4ROTA 3PO2G 1RYBA 1AGYA 1FSGA 1MW9X 1Z5GA 1ESMA 1PFYA 1PL0A 3VH2A 4KXXA 1EINA 4FMBB 2FUG1 2HPVA 2JIBA 4QELA 5HUQA 3U31A 4IZ6A 3MILA 2NTNA 2G67A 2LR0A 3HY3A 5CA0B 4IUBS 4KPUB 1NHGA 2REBA 1RJGA 2VNIA 2QLBA 2HHLA 1T5SA 4FFRA 1CU1A 3AF2A 3IB6A 1KK2A 4CGYA 1YL5A 4PPNA 1J8DA 4IIYA 4FU0A 3WWIA 1S03G 3EE6A 2FN4A 2UVPB 2ZSAA 1N6IA 2M9MA 2H0AA 1X1QA 4BDTA 3KPYA 4ES6A 3L0YA 5ALFA 1FFCA 4P2BA 5AXCA 2WWFA 1LDGA 2CMKA 2P2YA 1L5LA 3CYFA 3IAFA 3Q5EA 3K3PA 4IGAA 4B6RA 4ZI2A 3VSBA 1W4BA 4TL7A 4LE2A 5MFPA 2AL7A 5AM4A 1QMPA 3Q8RB 3H1PA 4TQGA 4FD2A 1O0SA 3F6YA 4M3NA 4KXLA 3VRHA 5EGNA 5M7EA 2ZT5A 1IC6A 3VKUA 3SYKA 1NVFA 4XDHA 4TPKA 3W2HA 1WZNA 3OTIA 5HIIA 1A2KC 3I5XA 2WTMA 2I99A 1IIBA 3E9YA 1MV5A 2M05A 3LCMA 3I6ZA 1ZESA 4MV0A 3OWXA 5LXTF 1ZNWA 4ILKA 2FJPA 4EI9A 3WHPA 3HXTA 3BFPA 2BFNA 5BWNA 3NIGB 5B3AA 2P79A 1G2IA 2Y0SA 3O38A 3NOOA 5LQJA 3NANA 4N5LA 1CRLA 1PT5A 1IE3A 3AIKA 2DHRA 1IUPA 4GDFA 3VPBA 5JCOC 1JEYB 3IHTA 1ENYA 2CBZA 3WYFA 1KO8A 3N7AA 5J4LA 5L8VA 3M5DA 1XX6A 2AW5A 5J59A 4B2LA 2BIFA 3TSZA 2C1EA 4PO9A 1A7UA 1LNZA 3EZ9A 4BBJA 3O90A 3PVZA 1KC7A 4GBJA 4IJMA 2VPZA 3D02A 1B6GA 3BWVA 3W0LB 1ZM7A 5AFSA 3EHEA 3KHHA 3GYGA 3UA3A 4K46A 1YRHA 3WGJA 4Z8YA 2QQEA 2X22A 5BXQC 5FR1A 2QE7D 1Z3CA 1BNCA 1W19A 2RD2A 2F7SA 1LWOA 3P2EA 5KNDA 1T3NA 1FZTA 2LGJA 3UBMA 4Q6WA 2LNDA 1XF9A 4K9KA 3NWJA 3ORHA 3W5VA 4U7GA 5JEDA 2R79A 1W85A 4A8JA 1Y7PA 4LHVA 4OYRA 4ML3A 2WYOA 3N2KB 2OCBA 3OOYA 4IDPA 5KOIA 1OASA 4UCUA 4XLLA 2FPPA 3LGSA 2RGNC 1M3SA 5EUMA 1JFLA 1XTKA 1PT6A 4R16A 3RVRA 3I5MA 2XKBA 5JDCC 2GEKA 3AT1A 1E1LA 1V4NA 4WNIA 7GPBA 5EXDA 4UM5A 2CV0A 4QARA 2ZIEA 4W6QA 3A31A 3AVPA 5DPMA 3QXGA 2B2NA 1P2SA 3BCHA 4M46A 2J7KA 4WNAB 1PO7A 1N7IA 4QPDA 3CLTD 3T1YH 3WGZA 3OE7A 2FPIB 3OC6A 4W7IA 1HSZA 3UT5A 2DLCX 2DETA 1O8BA 2R8ZA 4J9PA 4FYYA 4UPVA 1BXZA 3WNBA 2HNAA 4JU8A 4N6OA 3C5CA 3B2NA 3FGZA 4F4WA 3CVVA 2Z8YM 3O26A 4TMTA 4FCVA 1V43A 2NN3C 5JD5A 5FRDA 3V2HA 3C0KA 3SKYA 3KZOA 2CNVA 2HHJA 4NDZA 1N0VC 1XRSB 1SUDA 3UH1A 4RVCA 3QVUA 3L46A 3EIHA 4LCJA 5F3WB 3GIWA 2HZ7A 3E84A 3CEHA 1Z83A 4Y2XA 3CLRD 5KOHB 1L5NA 2NO7A 4ZIRA 4XUEA 4KGVA 3EIOA 3HADA 4G0ZA 3F78A 3KG2A 5E4TA 2H8KA 1LK5A 1A8QA 2J9GA 1PK7A 3G02A 2TECE 1Z22A 2V4QA 4WECA 1JR2A 1GQYA 3NT5A 4X45A 4JBIA 4NH4A 2O9JA 2B37A 4MV6A 4KR3A 4UPEA 1MH1A 2ZJ6A 2ZE7A 1V1JA 1HL7A 1XL0A 4ED3A 5BXYA 5JD4A 1RZUA 3PC2A 1U7ZA 1LJ8A 5TT0A 5T3YA 4S2EA 4EY4A 3DLPX 3S5JA 4ADSG 2XB2A 5FTLA 1A4IA 5LB2A 1AQJA 1P80A 1X7YB 2ETVA 1NU8A 4EJFA 1UWKA 1U8TA 5IJ0A 4YNBA 1UAAA 4LVNA 3F2IA 4NHOA 5LQNA 2XMDA 5LL6P 5EWMB 1JXAA 4RKQA 1ENPA 2V58A 2Y0EA 4Z0TA 2YNMC 4YVFA 3ULKA 5AKEA 1XTRA 3QBTA 3CLUD 3SQXA 3BORA 1WUIS 1AKYA 4M1ZA 4TV9A 1NKSA 4QXOA 4QVIA 4MR9A 4Y30A 2DR0A 3EZ6A 5LLDA 3SDSA 5E95A 4F92B 4C6TA 3OFND 5FPOA 1Z4NA 2Q2TA 5DLDA 1WSDA 1GWNA 3H84A 4HSEA 3WQHA 3W3AD 2PMDA 4G25A 5IYZA 3DD5A 3P9IA 1M6NA 1W5TA 2J9ZB 5D1OA 5H9VA 2NU9A 2OQVA 3LA8A 2RB5A 3UW3A 1JJAA 4HS9A 1YB7A 1XLTC 1GDHA 3GT4A 3SNKA 3O94A 4KWHA 5J5VA 3P0FA 1XVLA 3D4IA 3WGUA 3HT5A 2FZEA 3B6JA 2JBAB 3IBYA 2H7YA 2VUUA 4Z2AA 4BXXG 4Q9DA 2ACEA 5D8DA 5IULC 4UCRA 3GHYA 2D6FA 2INGX 4ZCPA 2I4RA 3UICA 2QLMA 3EY4A 3O3OB 4R2HA 4J16A 5D3QA 2BFBA 2BP7B 4OQFA 4FGLA 3WYEA 3GEPA 5KYXA 4EGSA 2H11A 1FU4A 2HX1A 2XEDA 1AM4D 2IYVA 3VR2A 1MFZA 1B0UA 4RM3A 4H7FA 4OHZA 3HDJA 4JLDA 3UB3A 4JI0H 3ASUA 2MCTA 1F6DA 5BNTA 2EQAA 3ONFA 3U61B 5EXPA 3ZGOA 4BBAA 1UJ2A 2CNUA 2A84A 3TZKA 2WYVA 3SI7A 1UJ4A 5DX8A 3CIOA 2P41A 1N5RA 2EFGA 1ISFA 1C1DB 3HYRA 3K0FB 4Z9AA 5JZSA 2PK3A 3FN4A 4LJKA 3RK0A 2EU8A 2BFCB 3DLBA 1UPUA 4BZQA 3ANLA 4KEAA 1K1SA 2WFAA 1UPCA 5EGSA 4IV8A 5HE8A 4KXMA 1UFVA 3KUUA 4M0UA 4RLFA 5CT8A 3PW4A 1E6KA 5DTRA 2G09A 4Y2VA 3HNRA 1WMDA 1N34B 1GNPA 2FPLA 3ILXA 5LP1A 1YH3A 3GRVA 1VRWA 3KPWA 1MT3A 1SURA 3F4BA 2XRMA 3PLAE 3RJZA 3R7LA 2R48A 4L0QA 3ZS9A 2CMHA 4GL4A 2I33A 5J63A 3NUAA 1EI9A 4Q1DA 1DIOB 1DBWA 3P27A 4KI0A 3HVKA 3OF3A 4UARA 2P1RA 1X1SA 4CF6A 4X8OA 2ZRFA 1DDGA 2I78A 3LYAA 1SVLA 2YV5A 3BS4A 4DC9A 1FP6A 2A1TS 1B8PA 3ILSA 4MCAA 1TYAE 3D4PA 2ZWIA 3V32A 5FEMA 1AK1A 2EHJA 4NBRA 4QO7A 2ZTMA 3RFXA 3X2FA 3UGJA 4L5AA 5TGDA 4RVGA 1R7RA 4MDFA 1N2HA 4YDSA 5TEWA 5EJ4A 5H7XA 1CD5A 2JA1A 3NEPX 3IR7A 5B5SA 5EJIA 1KMHA 1Z62A 2OZLB 4IJUA 3Q7RA 2LXNA 1DRJA 4XWKA 2VTDA 2ARKA 5BWBA 3CUUA 1W85B 2GR9A 1UMBB 4R1OA 5SZJA 3LIPA 4R5HA 4A8JB 1TE2A 4HX2A 4RKRA 4JR1A 3J7AC 3H3VH 1QKJA 4JVLA 2BH9A 2QYZA 4Q7JB 4NC9A 3BWMA 5GAJA 3SR4A 2IOHA 1RQNA 1S97A 1JXLA 2IK8A 3MTBA 3EHDA 1VKHA 3L6EA 1TUIA 1BE6A 5KNBH 2ODWA 4LTDA 3IEPA 5B2FA 3EJWA 4XRRA 2W71A 3GJXB 5J5CA 3SQMA 5MN5A 4M1TA 1GAJA 2ZUVA 4MWOA 1GV1A 2O0KA 3GUHA 2J8ZA 1JAYA 1XVIA 3PHIA 2EFEB 5JMOA 5KNCH 4M0EA 4QPNA 3C6MA 4GQAA 2VH5R 3KWMA 1NDQA 4F3KA 3M1YA 1Y5MA 1G2WA 5DNEA 2W9BB 4J43A 4Q34A 3GG9A 1G5PA 4WGFA 1HNZB 2JJQA 3LWNA 3VX3A 3FCEA 4BXOB 2O2CA 1B8VA 1RWXA 3RRMA 3A6HA 4XD7D 2WE7A 2HGZA 2JJMA 1DNPA 4MR8B 3SDZA 2BELA 5E6RB 5LU9A 1PEYA 2WG1A 1Q3TA 3DYIA 3U4MA 1MRNA 2YUTA 1KZHA 1X7ZB 5IXJA 3RBAA 1Z82A 2QXYA 4XTCS 4OFBA 5AQEA 5F73A 5FDFA 4Q66C 4K6CA 1SU4A 1SC3A 1SVKA 4NPCA 2MR6A 3TPFA 3A0RB 1G64A 5C7IO 4LWZA 1DTEA 1GGOA 2IY7A 3U1VA 1HFKA 4Z4HA 4EFMA 1K8ZB 3KZCA 1J8QA 4HB2A 1NN3A 4CEJA 5M3BA 1NVEA 1CS0A 1R5JA 1YOVA 3CLSD 2VNHA 2PGDA 2OBNA 1QE5A 1UJNA 3AR6A 1X19A 4OB7A 2ORYA 3EPKA 4JIMA 4BVLA 5JCZA 2NGRA 1FRQA 3FGNA 4CR8A 1XZDA 4WK0B 4X65H 1F9EA 1XQYA 2QBYA 4P1ZA 3AQIA 1IN8A 3QJ5A 5AVYA 2WAYA 4KUEA 4Q7MB 2FDRA 1YGYA 8LDHA 3CF4G 3PTAA 3VKFA 1Z6YA 3CW8X 3TL3A 2V7UA 5IJ0B 2A9KA 4MRAA 4FGZA 4ZO9A 1WHSB 3BTOA 4UASA 1JDTA 3I32A 3Q8QB 3ZE7A 3G23A 4RVHA 1V8DA 5BN5B 1GU1A 2IIPA 2BDUA 3UOAB 2B6NA 4ECQA 3DTNA 4ZT6A 2FLNA 4AY5A 4Q9HA 2VQEH 3BBPA 2X2FA 5DG9A 1SBZA 4MR9B 3VDQA 2VDWA 4EMBA 2PAFA 1X7WA 5ES4B 4C6TB 3RR5A 3HOWG 3OT1A 3TO5A 3KIPA 4C4AA 4M0KA 1SG0A 3UMFA 4K8OA 1OX5A 4J0JA 3SJUA 2R6CA 4PBRA 2ADFA 1H3EA 5IYZB 2NU9B 4F91B 3G0GA 5GJCA 1RM5A 2PRJA 2JEZA 3OPYA 2X9VA 2HHFA 4NE7A 5T4EA 4Y1RB 2AA3A 1VGVA 1HDIA 3VX4A 2P9HA 1J0XO 4H16A 4Z9XA 5DIFA 2AVNA 3SHVA 2G9NA 5IAOA 1YR9A 2X0KA 3O1LA 3AINA 4KO2S 1SRRA 1O54A 3D0KA 2R8XA 1A3GA 3EFOA 4DXAA 3CLHA 4PPYA 4U0JA 4LQ4A 3ICVA 4RWEA 3S4YA 4HGRA 3U0BA 4XUCA 3JS5A 1HT1E 3N6VA 2N75A 2RGXA 1LRKA 1CY7A 4C01A 1PVDA 2BFBB 3O2NA 5KYXB 1DCFA 4N6NA 1EDEA 3COJA 3STTA 2YJ6A 1ILWA 5CM9C 1T9AA 4JGBA 3ELYA 1VAJA 4KN6A 4P4LA 2GPWA 1NOIA 5J3JA 1U3UA 4TMKA 5DRYA 4F8JA 5IDVA 3KKOA 4HVTA 1KOGA 4DDUA 5KMGB 4IYJA 1K5GA 3P4UA 1L9KA 1RM0A 4FW8A 5KFIA 2E5LB 1PLKA 2VWGA 3T7SA 2IZ6A 4UUPA 4D4IA 4J9MA 1CZOA 1PJCA 4WOKA 2ZSKA 3NXKA 1FL9A 1ISSA 3RVLA 4RD4A 4AZVA 3H04A 3NTLA 3A6FA 4MTEA 3VPCA 5C3UA 3MT7A 1UNNC 3ZEAA 1WKBA 4FKMA 3GTOA 1SUIA 1H93A 2ZSJA 4DSZA 3LT2A 4F0JA 4OKSA 5DGAA 3ESQA 5DNWA 5EOYA 1M54A 1T1GA 4S24A 3A9TA 5C1BA 2FXIA 4RZ3A 1O9BA 1YK0A 2ZYDA 4NEHB 4MGKR 3M89A 3VYTB 3PQCA 1G8PA 1TF5A 2Z3ZA 3L0PA 4R84A 1C7EA 1GQ2A 1M76A 4COOA 5L4SA 1W49A 2WSMA 2Q5LA 2JRLA 2R00A 3ADKA 3TD2A 3CLVA 3QWFA 4BZXA 2BRUA 3NOQA 4NCNA 2G88A 2HRRA 3D3JA 4EB6A 1PV4A 5J1TB 1F6WA 3NT2A 3ZD9A 3FI9A 5K0SA 3E61A 2YDYA 3UT6A 4C14A 3OI7A 3ORYA 2D4AA 4L3OA 5LDDC 2W83A 2RFLA 4F11A 2BKAA 1XTIA 1LFAA 4JN6B 1CZLA 3SC6A 3ADBA 2PO7A 5I6DA 3NRBA 2XA2A 1YAJA 4IQ4A 3MCTA 1FB5A 2VHWA 2QAIA 4WOPA 4NBWA 2IQIA 3I0ZA 3TLYA 3RYIA 5G0SA 1T0UA 1FTNA 3EF0A 4ZCSA 3H1GA 3BFXA 3I01M 5TQJA 2B21A 1MVNA 4DY4A 1OAOC 1YR3A 2PEZA 1O58A 3UPUA 4P38A 2UYCA 4CLRA 4ENVA 4RLSA 3ONWA 3IEVA 2FEWB 4N3NA 4ECRA 5KS2A 1HE5A 2WNSA 2OE2A 4KLAA 1SXQA 4IHQA 1Y4AE 3QVKA 2PXXA 3I62A 4JJ8A 1XQ1A 3WNVA 1OH7A 3TQOA 2E0IA 4EGFA 4QLBA 1ZR4A 2Q3FA 2OM2A 1KOFA 1C3OB 4AL4A 5FD6A 3DKPA 2B1IA 4M1QA 2AQ8A 2N9UA 4DM7A 1VLQA 4DOMA 1WMBA 1H66A 3B1YA 2PUEA 4WH0A 4YP3A 4O81A 1PDVA 3FYCA 3OE7D 3RT1A 1Z06A 3V8QA 3Q12A 3L8FA 2JGNA 5JAHA 1ADCA 4ER5A 4G0OA 1NNI1 2W4QA 4F60A 1RBMA 3TJZA 3QLEA 1DXHA 3OZUA 3WK6A 2JKZA 3KAQA 5SY4A 1YK1A 4B32A 1R10A 3DCNA 2OMEA 2XBUA 4CKYA 3UFXA 4ZXFA 4D3FA 3L7NA 1RZVA 4IBOA 1V3UA 3E8MA 3L0CA 4F9EA 1QHXA 1DTSA 3EGDA 4LJRA 3RFFA 3U4GA 4F1JA 1E9SA 4B46A 2O8FB 3JW8A 4WWHA 1YOVB 4C0KA 4HNRA 5E7MA 4G9GA 3UMSA 5CFLA 2F9LA 1ZBDA 1LA2A 3KQSA 4IDOA 3OMLA 1QFZA 1R4MA 1KI4A 5KWJA 2MTBA 3ZOZA 2I6UA 3TGLA 2Y2VA 3Q7SA 3D8SA 3NPAA 1AS2A 2I71A 3DMTA 1JI0A 4EPWA 3ETLA 3AI2A 4E13A 3C6KA 4CKZA 3DMGA 3EXEA 4OU4A 3I9FA 1NIJA 5J2TB 2A14A 4J49A 2Z6QA 1OT5A 3LLCA 3ICWA 3SS8A 1DIHA 1E7SA 1B3BA 5LB4A 4E2WA 4K05A 1G5RA 2GFQA 2QE7A 3OM8A 1G8JA 5JTTA 3BXZA 3EZGA 4QBTA 1NMSA 1S2NA 3ZLBA 4ND3A 1IOLA 2FI1A 2OECA 3TUZC 5IT4A 2O3SA 2GLUA 1GL3A 4QGSA 3KEQA 3IVCA 1R0KA 2HRBA 2EW1A 4CTKA 3GPCA 3KOOA 3BICA 3ZU5A 2C2GA 5EZYF 3AL2A 3HM9A 5K3DA 2D1RA 5JFGA 1R74A 4DEXA 5DSXA 2R44A 3LV8A 4XB2A 3PYXA 1Z0FA 2ZIXA 2C2KA 2WYIA 1Z0IA 3WGYA 4JI8H 4WNCA 4CPDA 2HHFB 4GI3A 3I2KA 3TNYA 4CTNA 4E5DA 3LOUA 2Q28A 2HK7A 4G8BA 1WB4A 4DC0A 4Q8EA 1C3XA 1NR1A 1ENZA 1GV0A 1LLFA 3N8GA 1GRNA 5AOCA 2Z3VA 4ND2A 4NQZA 4M1SA 5KOYA 4AI6A 1ZC3A 4YB8B 1MC5A 4N48A 2C2DA 5FXMA 2NTYC 2ENWA 2FH5B 3N43B 4AZTA 4U7PB 2HRCA 3I52A 3K2QA 1TT5A 5AM1A 3HP4A 2NUPA 4ZYTA 1O9GA 3I6BA 3QUCA 3DBHA 4E33A 4FTWA 1OXTA 4R31A 3PQDA 2HYDA 4D3ZA 5HKOA 4GLJA 3P2JA 2C3PA 4PLZA 3CT6A 1AA6A 1EQAA 4GMFA 3PW7A 4I5FA 1QK3A 4FSXA 3VGPA 4FT2A 3VR2D 3RB8A 4Q7LA 4DQNA 1M5RA 2IH4A 3NG1A 2P27A 1GSOA 3HDTA 5A1JA 3TTUA 3NRCA 4D0LB 3G8DA 1WWKA 1QQTA 2H3EA 5ITZB 1IEQA 3NTOA 1G8KA 4A3BG 3U7FB 2YDXA 1OWLA 4DVJA 4AYBE 3VNVA 3A3YA 1RRVA 5AOAA 1NUQA 3L6RA 4YMTA 3JALA 3RBEA 3ID6C 1SQFA 2DABA 1USVA 2R6ZA 4HEA6 4Q1AA 1G3QA 4TMXA 3R6TA 5BOVA 2E4YA 1F5NA 2BI7A 3UB2A 5HIAA 4XPZA 1XZCA 1QUEA 1HEIA 1UBTS 3CISA 3GXBA 3EAQA 1OVGA 4DCPA 2IF2A 1Z17A 3MINB 4LRUA 4YR0A 3GJXC 4XCVA 4J9QA 3O8OA 1XKTA 3S7TA 5HSGA 2ZRJA 3QBVA 3GHHA 4HMOA 4RFVA 4BRWA 3BSYA 1NJ6A 3S29A 5LQRA 5C5IA 2F4NA 4KB5A 1RP1A 3HB9A 4BQNA 1AUPA 3KFLA 3C5VA 4UU0A 2ZZMA 3IILA 3URKA 1TD9A 1JGTA 4E0BA 2BBSA 4EB6B 4TKVB 5JAUA 1RQ2A 4GX5A 3ZDDA 2W6OA 4FLMA 3H9UA 2WA2A 1AKQA 4IOMA 1LPSA 5L6MB 4CMAA 1JG4A 3GGCA 4FB5A 2RGRA 4FX2A 3DZIA 4WACA 4LCEA 2A0FA 2O2IA 1M2VA 3KQLA 5DHPA 3VDNB 1KNQA 3E9EA 4BAGA 2GEBA 4KHPB 3G9XA 3O9VA 2G3YA 4L9RA 1AGNA 1E9VA 2WUDA 4ENUA 2GCGA 4QE3A 3S1LA 1IBKH 1H05A 2G4LA 2TMDA 4N8EA 3QLVA 3IHKA 2ZAIA 5KVAA 2CXPA 1PBNA 2IOFA 1X1BA 5KT4A 3RB3A 1JZTA 4V1CI 3DTGA 4MW2A 1WCMA 5DCYA 2I29A 3PYLA 4Z9BA 3N70A 1XPRA 4UDNA 1OBFO 2IODA 4UU1A 5DM60 1DXYA 4HDNA 1PHRA 3Q87B 1KIMA 5EZSA 4KGXA 2WTXA 4YBRA 2UVWA 4AIIA 4MV3A 3LRPA 3T1HB 4QQNA 3LQKA 5GY7A 2ZBPA 1FFGA 3LUJA 3CNNA 3GFFA 1NRIA 5AVJA 4QULA 4TLDA 2VJPA 1Z8NA 3AERB 3ZGNA 4JKOA 3F3KA 1KY4A 4PY2A 1FYDA 1E61A 2D00A 4YJFA 3H2GA 4RK7A 2W6ZA 4PIMA 3K30A 1NVUQ 1Y3FE 2ZEJA 4W9NC 13PKA 1TCUA 4RUKA 2AOXA 4FR5A 1JV2B 2E1RA 1U7WA 1N5OX 5JH7A 4RHYA 1OIXA 2JLSA 1SQGA 1HE3A 3WNQA 4D4LA 5CXQA 4ZOBA 1PZHA 2JGFA 2Q29A 3T5LA 3NETA 4PPFA 5IP9G 4TTTS 2PBLA 2PGOA 2FWMX 2RAUA 1D2NA 1YDHA 1VL5A 3QUSA 5ALWA 2X8LA 3SZOA 2FZGA 4Z7NB 2F43A 2OORA 1PR1A 4PICA 1VE5A 3MC1A 4D4HA 2I76A 1FCJA 2B4AA 4LC1A 5ICFA 2RIPA 3ABRB 1CR1A 3N8HA 3WHIA 1ZD3A 2ATVA 2CDCA 4R3WA 1R8XA 2RHJA 8GPBA 4UXJA 1NSYA 4KMSA 3SJCA 2ALJA 4LHWA 3PQFA 5ULLA 4P33A 2IV3A 1E96A 1PNOA 2HL6A 3I58A 1N5JA 4REQA 4A3MG 3PGKA 4RMJA 3N86A 3OLCX 3UUWA 4RLQA 2R2AA 4K6GA 4P7KA 4EYGA 3TYXA 1EJ2A 3GR6A 2VAVA 4UEJA 1IXKA 1Y5IA 3W6OA 4TUYA 4YAJA 2ZJ8A 5BQOA 3T7TA 3ZHTA 3KYDA 4RNOA 1YZHA 1AUVA 3DD1A 1P4JA 2WDZA 3X1WA 4MEAA 2RC6A 1YRWA 2E6UX 1JHVA 3H9QA 4PZLA 4B74A 3TZCA 2V5AA 1CSEE 4C08A 3TRHA 4K6KA 2AGOA 3BIWA 4P83A 4I8XA 4LQCA 4PVCA 4KKVA 4I55A 2AOVA 1WDKA 2V6MA 3K6KA 4BX9A 1QGED 2X1LA 4DR6H 3ZLVA 3M33A 3WQRA 2Q3DA 1ZONA 3PPWA 1MX5A 4DIKA 3C7TA 1HEUA 2WAAA 1NZJA 1T35A 5TGTA 3LLVA 5K3SA 5LWQA 2D0PB 5AD1A 2ZWMA 3AFMA 1JS1X 3C1AA 3HEAA 1CJCA 2FK2A 3R5TA 5IX8A 3K0SA 3RB0A 3O5AA 4CIBA 4HNSA 3FOFC 3RHTA 4L28A 2GSDA 1V8FA 3HBAA 2IRWA 1OOEA 4B47A 3GQVA 3DW3X 1DJQA 1RJFA 3UHAA 5AUPB 1VCIA 3RK1A 2H85A 3PVCA 1U1IA 1JJBA 4DXHA 1DG1G 4JYAH 1U3WA 4DLUA 1V9CA 4EY5A 4MVJF 3BABA 4Q4JA 2DTXA 4MWCA 1PSZA 3TLGB 2FF5A 1E1RA 1LGYA 2FG5A 4CTJA 2QTFA 4JJGA 1DRVA 1AO3A 4WPGA 2J7PA 5TDHA 2E85A 1JDEA 5B4UA 3U7EB 2DBVO 1WDLA 2DUNA 3LP6A 3HJCA 3DBHB 1U2GC 4XD7A 2G1KA 4KMOA 2NXCA 4ITVA 1JDPA 3NT4A 5IWCA 3CPSA 5AMXA 4ZO7A 4TV8A 1U0FA 1MJHA 4Q01A 2ZRCA 4LDZA 2Q1UA 1MO2A 4NCIA 2EKQA 3F71A 2Q2OA 4MWBA 5JADA 4JGGA 3JSNA 1UR5A 3IT3A 4CFSA 1DBIA 5ALOA 2OV3A 2YFKA 3ZE0B 5CITA 2WHPB 3WRXC 5JW6A 4E31A 4OG2A 3RW9A 1MRSA 1ZOLA 5CEEA 2B35A 1RYNA 3U56A 4AJEA 2DBZA 1Z8FA 4LF4H 4BVBA 5K0NA 1P2UA 3H11A 3V7YA 1J06A 4LFAB 3TCNA 2V74B 3RROA 2GN0A 3VR6A 1V3QE 4RJKA 3HN7A 5ALRA 2O3QA 4M4SA 3IJRA 3BMOA 3EISA 3RF6A 1DDIA 2E5WA 4I14A 4PNPA 3C1TA 2Z2IA 4YXFA 1KEKA 2QRMA 1NYQA 2QN6A 2VPXA 1HM5A 1BYUA 1GVNB 4HAYA 3UG6A 4JQSA 4ZO6A 4R0VA 4C7XA 4TRNA 4FFSA 1E2PA 4TTJA 3R0VA 2BFWA 1GCIA 3O8OB 4NDAA 1GPH1 2JCSA 5LP6F 1V8PA 3MTAA 4RHTA 3IPCA 2PZMA 1WZUA 3C87A 2QJTA 2BC9A 3DFMA 4LUCA 1DEXA 3WLOA 3AJ9A 4E4TA 4NICA 3DF7A 4TVSA 2RI0A 3ZTWA 3AEUB 5JZ9A 1NJGA 3EIWA 3K9QO 3HR7A 4H1UA 1R9TA 1BMTA 1C3LA 5AXBA 4YV2A 2KJQA 4R7GA 1TAGA 4PN7A 3G7NA 1R8SA 5KHAA 2OCGA 1N48A 1QCDA 4MUEA 1E4EA 1USWA 1R0WA 5L40A 1M2VB 3V2IA 4MLZA 5EJ6A 2JGAA 5EJGA 2YJZA 2CFTA 1XQ6A 2P6UA 2EZ8A 4W82A 4ZI7B 3AWIA 1T10A 3TMYA 1BN6A 3JWEA 3O4IA 4OQLA 4KO1S 1NPYA 3G2JA 5AK0A 4HB0A 5M2QA 4COKA 5DMXA 1H1LB 2FWNA 5CRIA 2NVWA 2NUBA 4EJMA 4LF6H 5HF5A 4ZN6A 4MW5A 2E55A 5MFZA 2KS6A 4YDQA 1IJBA 4KLNA 1OB2A 4FDAA 4BJHB 3ONDA 4FOLA 3KQPA 3E9ZA 1FKAH 4K87A 4PNHA 5KO2A 3NYIA 3RIZA 1M7HA 4MGHA 3KLBA 5KAMA 1B23P 3PNYA 5IDWA 1XB2A 4N9WA 1G41A 1RQPA 1JG3A 5HM6A 2FMTA 2EJUA 1EFPA 2X42A 3CSSA 4AZ0A 3C74A 3INYA 1OH5A 1E58A 1GQQA 2BTOA 2ZJ7A 5DV9A 1FLVA 2WW8A 1RMQA 4S1VA 2Y6VA 3P5SA 2QSJA 3I30X 4KMRA 1SHZA 1DAFA 1RKVA 3FOEC 5JSUA 3BDAA 4KYUA 4HDAA 3GUVA 4R1SA 2PZ8A 5JH7B 1O5OA 4AKGA 4A5OA 3GJZA 3EVTA 1BVHA 3B60A 2QZZA 4FFWA 4DV3B 2Q6LA 3DCYA 4MQEA 4DWWA 4EG3A 4ZOEA 2HA2A 4BWSC 1OJ7A 2JGJA 4LYHA 4ED1A 3GL9A 1PL8A 4OQZA 1XOIA 2ODQA 4HXYA 4OEHA 1N2SA 4QUGA 3MAGA 4Q45A 1UEXC 1V8ZA 2HKIA 4K9QA 3FX2A 3R5KA 3GNLA 2ZWOA 5K3AA 1CRWG 2DERA 1J2UA 1U2DA 4PSCA 2FQWA 3WLEA 3K5IA 3TOXA 1WZ2A 1WCYA 1D03A 2ZAGA 4UEQA 4UUBA 3QA9A 2VRCD 2HHHH 1V1RA 1PG5A 4GF5A 1EFLA 3G9UA 4LJ6A 3HKEA 2GVDC 3FDFA 4ZJUA 1EXMA 3KJNA 2DOKA 3LF1A 4ZVLA 4E11A 3LCRA 1P74A 4G5YA 1FYEA 1RYYA 2MSWA 1UBJS 4Q3CA 3R44A 3AM1A 5CDSA 3RSSA 4TLLB 3AVTA 2CF5A 3KT8A 4RTRA 4LPSA 1TGYA 5IPFA 3O93A 4DZRA 3C3BA 4HAUA 3DWIA 4YP1A 3KOWA 1T91A 4TGLA 1NQAO 4TUYB 4YAJB 4ZHQF 2XIGA 3N8NA 5TQ2A 2IH2A 4FFBB 3WHKA 2VSQA 5A0FA 1EWQA 1U28A 2QPTA 1EIZA 3LXXA 4CHIA 1GKUB 4Q5IA 2QN8A 5K3BA 2F64A 2AIRA 4KQIA 5BYKA 1N32B 4FFMA 3L8EA 3X2SA 3TBKA 1DRUA 1PFVA 4A8TA 3GX1A 4BVKA 3FHJA 5JS8A 4IOKA 5F77A 3LP5A 4KQWA 3WWEA 2X5XA 2FF7A 4DL6A 3LXRA 4KRGA 1FEZA 2IEZA 5JY1A 4O4LF 3PI6A 2DUUA 3LMKA 1CZNA 4H7HA 1DXOA 3REFA 3EXHA 5L9XA 3SGIA 1QIHA 1S0OA 1U9YA 1XEFA 4B3SH 2OK7A 5U4XA 3WZ2A 3I9LA 1YKSA 4XFDA 3BDVA 1OZ0A 4RDHA 1MXHA 4OQQA 4D9IA 3MYRA 1NNLA 4Q4JB 4Z4FA 4M0DA 3HB0A 1I1LA 5C32A 5C1DA 4DV0B 5H3HA 2LDBA 3PYMA 2RH8A 1UZUA 2OFFA 5DGDA 1VTKA 2Q5CA 5FA5A 1ZHQA 5ANRB 4L8VA 2ODBA 4DRFA 4HSGA 3IE2A 4RULA 3OTOB 3FPGA 3QM1A 4V0QA 3LY7A 2WSLA 1Y9ZA 2HTEA 5BPHA 2AJ8A 3HNOA 1KRXA 2PUCA 1PYGA 3D0OA 2MIIA 5CB4A 3EGWA 1R5BA 3VPGA 3UF0A 1H8HA 4D6PA 2QN3A 3WADA 2CHVA 1BS2A 4X62H 2OL4A 2IPOA 4NAUA 4OP2A 3TAXA 3SOZA 1UBCA 2XZTA 3KHLA 4XEHA 1XWIA 3H6HA 4RKYA 4DJEC 2W48A 2JIOA 1KE2A 3R3YA 1XNGA 2BKEA 3UAGA 2JF0A 1G21E 5EZ5A 2V6GA 3HZRA 1KY5A 1Q0ZA 5C52B 4CEHB 3NH9A 1ABFA 3P19A 3AB8A 4EYIB 4FYJA 2BEVA 1P3DA 3BMOB 4LDAA 2ZRHA 4ESHA 5G2OA 4XX1A 4RTLA 3LUGA 3USES 3RIHA 2XJ9A 3IDZA 3OWOA 2NXWA 3DOFA 1AKMA 4NMLA 3O31A 3LFTA 4EM6A 1WUTA 2BHLA 2WAQA 1KARA 4NYMQ 2E5FA 2WTUA 3ZCUA 1ZGZA 3H83A 1RHJA 2R65A 4LFBB 2AGQA 1RRCA 1FS5A 1P81A 3ZKWA 4HF7A 1JECA 2HXYA 2IA6A 2HLDA 5L1KA 5BNIA 2O5EA 2RHBA 4B3MB 2JAWA 1LZKA 4JKYA 5L53A 2J6TA 3LY8A 1G60A 4P3PA 1CQPA 2AFHA 4YCCA 3LZDA 2R1TB 1P1CA 5I7AA 5A9SA 4KFSA 4WEQA 1N7JA 1OW3B 1UKEA 1OFTA 2JI9A 1BFDA 4O08A 2F9FA 4B83A 4KPGA 2I2WA 1YNOA 3GT3A 3W8NA 4A6PA 3IULA 4Z4CA 3PNMA 3KALA 1YZUA 1GUYA 4XM0A 1OU0A 3QRWA 4BMYA 5B2EA 3JYOA 5F98A 4ECAA 4EB0A 4LMAA 4YQYA 1M0EA 2HSJA 5DBFA 2TMKA 5JSZA 5F9LA 2NZ8A 1W0CA 1JA9A 2AXNA 4B4DA 3CCFA 2PKYX 1FJGH 4RK4A 1J24A 3WGKA 3JAMW 2B4TO 2QQGA 5FAKA 3HCWA 2PH1A 1U2QA 1MEEA 4O2AF 2JASA 3K6JA 1OH8A 1HLGA 4EVQA 4BO7A 3BULA 4KR9A 4NDNE 4QZVA 3QEJA 3IL2A 1SO8A 4ECZA 2H2HA 1PS9A 4LS3A 4JDPA 2XYPA 5F9NA 2IYAA 4E5PA 5EIBD 2W6NA 4PQRA 2AUMA 5IJ9A 5D01A 2OLEA 1Z4PX 1A9ZA 1TU3A 1YBMA 3CBQA 2ORED 1WE2A 2WZBA 1XIVA 1FFWA 3W1BA 3ZBQA 1EZ1A 1GU0A 4HT3B 4LX0A 5BY2A 2HIAA 1ZM2A 3IAHA 1XXHA 1MENA 1W8IA 2F8LA 5AUNB 4WKBA 3QEKA 4NLGA 3ZHOA 3TQTA 1QDUA 2B0CA 2EBHX 3H5OA 2F90A 4XX0A 3MUNA 1WW8A 1LW7A 3EIEA 4EFDA 1ESDA 2C5EA 2NZXA 4NE2A 1I2MA 1YD7A 4IWNA 1N92A 5JZBA 3X2EA 5KWIA 4MQEB 4OO3A 4MZDA 1ZOIA 4GNKA 3ENNA 5DHFA 4U6PA 3PC6A 3KXLA 4NBNA 2NV0A 5JDIC 2X0RA 3O2QB 3LT5A 2FR8C 3D6HA 1ZRNA 2B69A 1E4VA 1K9VF 1M0WA 3WTCA 4CKEA 1HH4A 1H2AS 4KIUA 2QI9F 2QGNA 2OAEA 3R24A 3RFVA 2W2XA 1V1RB 3V8RA 2VOJA 2C4KA 3PFIA 4G0NA 4HGOA 1I4EB 1GKIA 3GMTA 3HKEB 4KDEA 4PAOA 1I36A 4ZVRA 3DOJA 2NVBA 1S68A 1A8SA 3W1WA 4RM2A 2R8YA 3C4QA 2XCSB 3VR4H 1QVAA 1PX2A 1UDWA 2JZOA 1PEKE 3QPCA 3CLTC 1C3JA 1EX9A 4JOQA 4KQHA 4UCOA 3GT0A 3TQHA 3HUEA 5B64A 2PMWB 4FDTA 1YTUA 3WYAA 1BVUA 3WMGA 3O4FA 5DLYA 2WINI 1RPNA 1AX9A 4A3SA 5F21A 5C18A 3K05A 2Q8PA 3OQPA 4IICA 1YNSA 2IZ5A 2WIDA 3N2NA 1J9GA 2VXYA 2Y0PA 2ASDA 3N8IA 1XDUA 3KDAA 4K2AA 5AP9A 3ZOKA 1YS7A 4PGHA 4U2GA 3Q88A 4O4IA 1YL6A 4D41A 2UAGA 1PUIA 5P21A 4EFLA 1YAHA 4TRJA 4DZZA 4UTNA 2JA6A 3NV7A 2NYVA 5JPCA 4GC7A 5CAEA 2ZJ4A 1PSWA 1L5VA 1PD1A 4JODA 3HOVG 3PU6A 2V0CA 1IONA 4H7KA 5TS2A 4EHJA 2Q5EA 4G85A 3GA5A 2FPPB 4X6LA 4BB6A 1NVGA 5JQGA 3BSFA 5EA2A 4MUGA 1RRFA 3RLIA 4LGMA 2PX0A 4MLPA 3D1LA 1J2TA 3RK4A 1V4VA 1PJTA 5KDDA 3KXDA 3N3BC 1JWLA 2AE2A 4F5EA 2C4TA 2VHCA 1NW6A 1OXXK 4I4LA 1Z0KA 3F2VA 3KTOA 2W8KA 1M74A 5IN5A 3AEYA 4G36A 1E1RD 1QU2A 1SBHA 1SVMA 3DAOA 4KVGA 1RJWA 2H7VA 2Z95A 3TK1A 1MJGA 2J7PD 5MHTA 3VVLA 3WAGA 3UT5B 4W1RA 5CB4B 2I0FA 3CLUC 1F8UA 4PG7A 4Q8FA 4LWPA 3I37X 2QM3A 2VQSA 4LSWA 2OZKA 4IV0A 2CNNA 4UDYX 2B63A 4RTQA 4NJOA 3S8EA 3E81A 4ESOA 4B2IA 4WSOA 4DMKA 2DM6A 2DLDA 1KKUA 2IITA 4R83A 4Q1BA 2LBPA 5HX7A 1NT4A 4O82A 1B73A 4EYEA 2PVPA 1VKZA 1RS0A 4XDZA 1JLKA 2ZE6A 2ZJ3A 4ZIRB 2VF8A 5E1DA 1YSCA 2ZGVA 3KDPA 4KO8A 1N33B 2KSWA 1JLMA 1MGPA 3MCUA 4LF8B 2FP3A 3NWEA 3AF6A 3EGOA 5F12A 1D3AA 3VR6D 5T5QA 3EC1A 1DUVG 1LJUA 3TR0A 3PQ7A 4GYJA 2C5SA 4HXEB 1DAGA 3QVVA 1WDMA 4RY9A 1M6WA 4G84A 4U5QA 4UE6A 4RFLA 4P0QB 3SEFA 1XN1A 3GJ8A 3UMRA 4DLBA 4D0SA 2ZR0A 4J1TC 4U7JA 2A5LA 4D3SA 2FMAA 3B1KA 4P32A 2P9ZA 3IPYA 3WJ1A 2ZI5A 2HADA 2AFHB 2EF0A 5FTMA 1DAPA 4TM5A 3Q10A 4I3HA 4EABA 2EFCB 3LZ6A 2UV8A 4HQ0A 4UULA 1JQLB 4ZPXA 4MRRA 2PZJA 2QMEA 4BN5A 1BS1A 3TUJC 1T9KA 5KQRA 2FK8A 4IGFA 1HY3A 3PRHA 1FRNA 3GVXA 2QW8A 1N77A 4MUHA 1OIWA 1TO1E 1UFKA 3OLWA 4ZAYA 2I7XA 2RBKA 5JSZB 4U7WA 1C9NA 3GIJA 4TV9B 3C39A 5JE8A 3TWOA 3HFJA 3BK2A 3QI7A 4NCHA 4Q1CA 3SVZA 1AMNA 4I66A 2NYUA 4MUNA 4IDAA 3SSMA 4LKOA 5B58T 3V6HA 4JT2A 3KS9A 4G5SA 1ONSA 1SXIA 4DXDA 1LBSA 1LS1A 1P7CA 5D1OB 3HGMA 1F12A 1ZCFA 5C8VA 4AMGA 3Q40A 1V6AA 3CNQS 3NBFA 2XYRA 1MF7A 1EVJA 5IJ9B 3D2BA 3AFIA 3EGIA 3PWKA 3BJEA 3K92A 1W5FA 4PGAA 1XXHB 3HRKA 2CXTA 1CNMA 1WF3A 1TM1E 1UPXA 3OEWA 4LV6A 1IBSA 2UUCH 4A2AA 4KLRA 2NZVG 2P2CA 4KR7A 3HM2A 2BFEA 4JMPA 3LNCA 4XX0B 1MX1A 2QVYX 4TKLA 1NSTA 3CVZA 5K4GA 3PUXA 2H9IA 1TCAA 3NOXA 3NKVA 3F98A 3PR3A 2IFTA 1IWOA 4JWTA 2OAQ1 3C6ZA 4DYHA 1W4ZA 2YWGA 3S7ZA 3AEKA 5FOUA 3FETA 4RAOA 4R5MA 1GZHB 4BUCA 1V1MA 2YICA 1IHPA 4HB4A</