3KAKA

Structure of homoglutathione synthetase from glycine max in open conformation with gamma-glutamyl-cysteine bound.
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
473
structure length
443
Chain Sequence
PLFDYHRIDQKLLQNIVYDALVWSTLNCLLVGDKSVQRSGRVPGVGLVHLPLSLLPGPFPESHWKQGCELAPIFNELVDRVSLDGKFLQESLSRDEFTSRLLDIHSKMLQINKDIRMGIVRSDYMIDEKTKSLLQIEMNTISTSFALIGCLMTGLHKSLLSQYGKFLGLNSNRVPANNAVDQSAEALAKAWSEYNNPRAAILVVVQVEERNMYEQHYISALLREKHHIRSIRKTLTEIDQEGKILPDGTLSVDGQAISVVYFRAGYTPKDYPSESEWRARLLMEQSSAIKCPTISYHLVGTKKIQQELAKPGVLERFVENKDHIAKLRACFAGLWSLEDSDIVKKAIENPELFVMKPQNNIYGDELRETLLKAAYILMQRIFPATSPAILVRDGNWDTGHVISEAGIFGTYLRNKDKIIINNESGYMVRTKISFGVVDTVYLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoglutathione synthetase
publication title Structural Basis for Evolution of Product Diversity in Soybean Glutathione Biosynthesis.
pubmed doi rcsb
source organism Glycine max
molecule tags Ligase
total genus 147
structure length 443
sequence length 473
chains with identical sequence B
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03199 GSH_synthase Eukaryotic glutathione synthase
A PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1080.10 Mainly Alpha Orthogonal Bundle Glutathione Synthetase; Chain A, domain 3 Glutathione Synthetase; Chain A, domain 3 3kakA03
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3kakA02
3.30.1490.50 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kakA05
3.30.1490.80 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kakA01
3.40.50.1760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glutathione synthase, substrate-binding domain superfamily, eukaryotic 3kakA04
2NUAB 4DIMA 3U9TA 4O7WA 3RFCA 1OBGA 4YJ2F 3N8DA 2ZDQA 2PN1A 1PK8A 5J2UF 2V58A 5BPFA 2W6MA 5BMVF 2WYOA 4RZQA 2W6ZA 1M6VA 2VR1A 1W96A 3DF7A 3WNZA 2X0SA 5D8DA 3V4SA 1C30A 3ORQA 4M9UA 3R9RA 2DLNA 1CE8A 4FGRA 2YWVA 4XZ3B 3JRXA 4O7RA 1Z2NX 4HNTA 1CQJB 2Z04A 1SCUB 4I55F 1B6SA 4YAKB 2YRWA 2CNQA 4WBNF 4O7ZA 3E5NA 5CA1F 2R7KA 1VBGA 4XYLB 1B6RA 4EGJA 4O82A 3VPCA 2IP4A 1ULZA 1GSHA 1CS0A 2NU8B 3GIDA 2R7MA 5LYJF 4YBZB 2W6NA 4E4TA 4ME6A 2YRXA 3MWEA 4XYMB 2C00A 3Q2OA 2GPWA 4I4TF 3QFFA 4ZI7F 5LOVF 1T36A 4MV7A 2R84A 4HNUA 4TV9F 3G8CA 2YZGA 5CAEB 3RV3A 5C1PA 2CNVA 4Y8VB 5JH7F 5H80A 4QSHA 2I80A 3JRWA 3JZIA 2XCLA 1DIKA 1JDBB 3K3PA 3K5HA 4C5BA 4O81A 1E4EB 5DMXA 1VBHA 1OBDA 3TW6A 3UFXB 2R87A 4O84A 1JLLB 2I87A 2Z02A 3MJFA 1M0TA 3HB9A 2R82A 3U9SA 4MA0A 4MV4A 4O2AF 5LA6F 3K5IA 4O7YA 2R7NA 1Z2PX 4O4JF 1A9XA 2SCUB 4O4HF 2OLSA 2R7LA 1I7LA 1GGOA 5C1OA 4FFNA 5KX5F 1W93A 4TV8F 4FFMA 2DZDA 4FFRA 3AW8A 3ETHA 2P0AA 1EUDB 1KJJA 4MV8A 4MV1A 4FFOA 1GSAA 1WR2A 2DWCA 3OUUA 4HR7A 1CQIB 3ORRA 2QF7A 1EYZA 2YZLA 2HGSA 2YL2A 2ZDGA 3V4ZA 4O7LA 3MWDA 2W6OA 4FU0A 3TIIA 4MV3A 5LP6F 1BNCA 1EUCB 3Q1KA 5JQWA 1DV1A 2W70A 3KAKA 1IOWA 2PVPA 5LXTF 2W6PA 3WO1A 4FFPA 5J2TF 2QK4A 2CZGA 2DIKA 1C3OA 3SE7A 2NU7B 1GSOA 3TINA 1KJIA 2NU6B 3OUZA 4O7VA 3RV4A 2W6QA 2YS7A 3R5HA 1PX2A 3U54A 3R5FA 4O86A 3R23A 2VPQA 4YB8B 3TQTA 2GQRA 3AX6A 1JKJB 3KREA 2HJWA 2V5AA 3LP8A 4IZOA 1A48A 3R5XA 5JVLA 4DLKA 4MV6A 4ZOLF 3VPBA 2ZDHA 1KC7A 5IYZF 3RUPA 2FPIB 4MAMA 2GQSA 3BG5A 3GLKA 4L1KA 3G8DA 1AUXA 1I7NA 2FPGB 2R86A 3WO0A 5CB4F 5BPHA 2YZNA 4YJ3F 4I50F 4MA5A 4MV9A 4XX0B 2YYAA 3U55A 2GLTA 4C5CA 5EZYF 3ETJA 5HBRB 4EGQA 4TUYF 2R85A 3KAJA 2FPPB 4O7NA 4O7SA 5FNVF 1EHIA 4HNVA 1KJ8A 3LWBA 4NYEA 3NUAA 2GPSA 4IHJF 2NU9B 4O7TA 4FFLA 4HQ6A 1KUTA 5JVDF 4IIJF 4O83A 3JZFA 2YS6A 1KJQA 3KALA 5C8YF 2J9GA 1KEEA 4O2BF 5CA0F 3TIGA 1JDEA 1KBLA 2XD4A 1VKZA 5GONF 1Z2OX 2W71A 3HO8A 2FB9A 5KKNB 2YZMA 1IOVA 4C5AA 3VOTA 3I12A 2FP4B 1BXRA 2V59A 4YAJB 3VA7A 1AUVA 1EZ1A 2YW2A 3VMMA 1DV2A 2CNUA 3HBLA 4FE2A 5HV6A 1KJ9A 4O4LF 2PBZA 2VQDA 4EG0A 1E4EA 1GLVA 4ZHQF 3N6RA 2I8CA 4O4IF 4ZQIA 1M0WA 5JQGF
chains in the Genus database with same CATH superfamily
2GHRA 4JU8A 4D45A 4TOIA 1MB0A 5AVWA 4YUXA 1Z4LA 2CUKA 3H4MA 1T94A 4CCYA 1AQJA 2EKQA 2IEYA 3GTKA 4RKEA 1N36H 4LHXA 3NHRA 1WHTA 2HJVA 3BZWA 3IE0A 4BNXA 3WIEA 5BRAA 3YASA 1YR7A 2XNDA 2ZIVB 3GWZA 3GDFA 3KKEA 3RYIA 2IXDA 4NXMB 4DA7A 3TEMA 3EY9A 2C5EA 1T5SA 1VB3A 1E60A 5HCIA 4RADA 3IPXA 1I2KA 1SHLA 4C0BA 3CISA 3GR6A 3AYHB 2DX7A 1U90A 1T2UA 4AY5A 5EKDA 5I5SA 2HUNA 4P7FA 5H59A 4FR5A 1D3AA 2WJHA 4G07A 5FPRA 3BMXA 3QPDA 3ADKA 3OOEA 4KQCA 5E4FA 1FRQA 3CV3A 4CU5A 2DECA 2FSGA 4NYJQ 3FDXA 2HHJA 2VLIA 4X44A 4GZMA 3RHFA 3WYBA 1G6Q1 5FLXW 1Y42X 1O95D 4M9XA 2OOSA 2MHCA 1FMLA 4DXAA 4QOHA 3B60A 3H5NA 5FUVA 5ECYA 1ESZA 1H1TA 1YK1A 4G01B 3EXEB 1Y9DA 1YV9A 1YHNA 3OKAA 2JGDB 2CLKB 5TEVA 4LF6B 3SG0A 1JXAA 3E58A 3PFGA 2RC6A 5AI0A 5JPCA 2J5KA 3QPAA 3QEOA 4X3OA 1USVA 4D4KA 4UATA 2J5QA 3AG5A 4M7WA 3LVBA 1SEPA 4CG2A 4MW9A 3UAVA 5K8UA 2GZ3A 4IH4A 1T2EA 1R66A 1QFZA 3DBIA 4DR6H 3TAUA 3SLRA 3AUUA 4U39A 3H1BA 3ACDA 1C30B 3JQAA 1GRCA 3GMTA 4YDHB 4ZKDA 5K3EA 4DVJA 1U3UA 5I7UA 3CINA 2FK3A 3IP9A 2XZDA 4G2TA 4MV5A 2AN4A 5KG3A 3SS9X 4JNCA 1UL1X 3ELBA 1P0PA 1DLIA 4WSOA 3UO8B 4V0OA 2GN6A 3NTUA 1N9GA 2N0SA 1FTGA 4Z54A 1C1XB 1UXGA 5AP9A 3DMTC 3WLFA 1GCUA 2XBUA 4BNJA 1XWFA 3SX2A 3EIEA 1Z56C 3CR3C 2Q8QA 4TRJA 5A06A 5DDIP 4B4KA 4HWKA 2OH2A 1U2TA 5AJTA 1RC0A 3TZHA 2H06A 2H51A 3PBKA 3QVVA 2Y8EA 3DV0A 3KJXA 5EP3A 4DM4A 1G63A 3I6MA 1LVGA 1R0KA 3H99A 5TX7A 3KQPA 2VTVA 5BVHA 2P9EA 1H5UA 5JYEA 4C2AA 4KU4A 3GT3A 1P8LA 2JW5A 5F9LA 4DREA 2N75A 8GPBA 4JA2A 2W37A 4IXDA 1C7EA 5SY6A 3CX8A 3IMFA 3FF4A 2UUCH 1POWA 3UJBA 4CLRA 1G9XA 5I8PA 3T1OA 3WLJA 2CJXA 2X76A 3QVLA 3W4KA 2RHTA 2WI8A 4JJZA 1NJ5A 3ZXSA 5BQPA 2UV8A 2H17A 4BEBA 2BEVA 4WCFC 1LPMA 4JR2A 3ZDRA 2COEA 1Z6XA 4UUOA 3N58A 3KVRA 1HXHA 2X9QA 3UGTA 3B1FA 4O2BF 5CA0F 2E4YA 4FFBA 1IWOA 2JLRA 4BMZA 5A6SB 3NFRA 1Z2OX 1HDRA 2GJSA 1E1RD 4TTAA 1XMXA 3H19A 1OR8A 1PN3A 4NOLA 2YW2A 1W1UA 5JNUA 3EB9A 2XGSA 3PO2G 1DJOA 4DMCA 2VP5A 4Q7EA 4JH0A 2WM3A 2JPDA 4MUNA 4Y8VA 2PUCA 2YMQA 4JJ7A 2QI9C 1I0LA 4WZZA 2EQ5A 4NMWA 4EFMA 5TVKA 2H1SA 3SU8A 2XNKA 4B4OA 3BCUA 4QWBA 1P6XA 2RIPA 5MN5A 2UAGA 1X87A 2X1MA 5BRNA 1VA5A 4K03A 2DT8A 2IYNA 3OESA 2MSLA 3FDSA 4TUYB 4P3PA 2PXHA 1PFKA 2J3IA 1IY2A 4M9RA 2RDJA 3OQIB 5BWOA 1R9JA 4LJRA 4F5YA 2O2DA 4DV7H 3T99A 5CT4A 3JVDA 4GIBA 3QFSA 4OK3A 4DV6B 4Q9AA 1WSDA 1ZPDA 2JIZD 3CKKA 3VM6A 2CUZA 3WRYA 2OXCA 4DZZA 2WSYB 4ED7A 4V0NA 2GVZC 3AESA 4N3BA 4PSVA 1S0NA 2I3BA 4G3XA 2AMJA 3E8XA 3AOEA 2XKJE 4DANA 3P0JA 4OXRA 2C4MA 3EZGA 3O5AA 2G25A 2Q29A 1YQUA 3DBHB 2MR5A 3KQYA 3FCSB 3GCZA 2VNSA 3VR6A 3AG6A 4H3VA 4IHKA 2HRQA 3JQPA 1RBMA 4S24A 3LVFO 3WADA 1NR7A 4EJSA 4EHJA 2GWRA 4OGWA 2D54A 1X6VA 1U80A 3VJKA 5HTKA 1MOQA 2GZRA 3FKIA 4NIMA 3HC7A 4WN9A 1GNQA 5C8XA 1Z5VA 4L57A 1GN8A 4PYNA 1JLLB 4CMIA 1X86B 2OMEA 3ZDBA 4FX5A 4BN0A 2FX2A 5ILGA 4WJZA 4W7HA 2X8AA 1TWHA 3DDZX 1YSCA 2XSZD 5KVQA 4CKCA 3VPHA 5LYJA 3EQ9A 3ZDXB 3NJ4A 4YAOA 5K3SA 1Y7TA 4O1MA 1DDGA 3HY6A 3A0UA 2CJWA 5E2AA 4YALA 2RKWA 2WD7B 2ODQA 3D3NA 3M6XA 4GR9A 1X15A 3FTDA 4CFSA 4N01A 5ALJA 1ZHQA 2B4TO 4YP5A 3KELA 4CUKA 4AZ0A 4FW9A 3RYTC 4U7FA 3QVSA 2FP4A 4JJ4A 3B78A 4ZHQB 5CXXA 1SJ9A 1EKPA 1CPYA 1WZNA 3Q8KA 5B57C 2G5PA 3G0IA 3NGMA 3P9KA 4BNLA 4HS9A 3HOYG 3G17A 2ASDA 2NX2A 5A02A 3AB7A 4M6WB 3TE6A 3LRTA 4MDHA 4X8HA 1OI4A 4E08A 2XGJA 3RGWS 3V34A 3IEKA 3QFTA 3ZCRA 1H8HD 5KX5A 1C1DA 1P75A 4L9SA 4BGEA 2DPXA 4BMSA 2NYVA 5K5EA 1QCZA 4H7KA 5FAKA 4ABTA 1RRPA 2HIXA 5IYZF 3L18A 4PAMA 2GRUA 2OCAA 4PIPA 3FDIA 3MS4A 3A58B 1XHFA 2E9SA 3H42B 2L17A 4MA5A 5BWCA 1WF3A 2NQ2C 3EAQA 3H84A 3UJ3X 4GF5A 2NZ2A 4C3ZA 3FZEA 3LU1A 2QE6A 3SVTA 2BGRA 4QGHA 3RVSA 4QGSA 4ND2A 3NUAA 3W5SA 3LCCA 1B41A 1DIAA 3V8NA 4J9NA 2IYRA 5L4LA 4H9GA 3BWMA 3FFXA 1GCGA 4GE0A 3OM1A 4EFLA 2ORVA 3PXEA 5TNXA 2Q3LA 5GONF 3TSYA 1Q3TA 3T3NA 2ZE8A 1NZJA 2WEKA 1V8ZA 1D1TA 3M4JA 3VOTA 3UPDA 1L7DA 2HTEA 2YY6A 4JI1B 4R31A 3M4XA 5K0TA 4IMRA 1HUQA 1XPUA 3U2QA 3ZW9A 1CDDA 3QU7A 3R41A 3VR3A 2M1ZA 3ZHYA 4OSEA 1JJAA 1LPBB 2AOUB 1EHYA 1MB2A 4LYJA 2FFRA 1Z34A 2RGDA 1U65A 3H16A 1P3DA 3C6XA 2WWTA 3ND5A 1JL3A 2O07A 1A5ZA 1GTMA 3PVXA 3NHAA 4BO2A 1QHXA 2PVSA 3GUZA 1QTRA 3ZXIA 4HH0A 1UT6A 3PD1A 5YASA 2B5VA 3MWGA 3ZX4A 1JQDA 2W6ZA 1QHNA 3EQ7A 3WWEA 4ED1A 3BD9A 3AGPA 2X0SA 2B37A 1T13A 4HMPA 3R5JA 4U2GA 5GGXA 2NO7A 5BN5A 1RXYA 1Y7PA 4GU5A 2WOOA 1Q21A 3GO4A 1QRRA 1CY7A 1YQGA 4DSUA 5C5DA 5LXTB 2HN9A 3P94A 4HATA 4JC5A 2R7ZA 2FZGA 4OHRA 3UMMA 5F9FA 2LTAA 4PG5A 2HH9A 3KDAA 1CKNA 1MC4A 2I1QA 2MOKA 1CRWG 5HKKA 2QTTA 4ZO7A 1GITA 4YRTA 3NNNA 4RXMA 2DEUA 2QV0A 1OFGA 1QAMA 3VFDA 2ZS8A 4MW5A 3IODA 1CKMA 2XITA 2NU7A 3HJFA 2BMWA 4KN5A 2PX4A 4WRRA 4HT3B 2J4CA 2QZZA 3AZQA 1S10A 2FWJA 4HDOB 2VSFA 1VL6A 4ZOLB 2MSCB 2D1SA 4WI1A 5U9CA 2VA8A 3UJ7A 3QVJA 1TLLA 1KKLA 4HGOA 4J9QA 3WBBA 3GDHA 1VBHA 4EJFA 4ZGGA 2ZUSA 4GOND 3H3JA 2G8LA 4B3JA 3MTDA 2OAP1 4QPNA 3PNPA 4MA0A 3O75A 3RBDA 3G2IA 5LA6F 2XMPA 3RRYA 1KXZA 4QD3A 2V4UA 3QH4A 1XTPA 1KDPA 1G3QA 3B85A 4Y2GA 5JUMA 3ORYA 5LDGA 3JATA 2VRCA 2BBSA 1E2HA 4UZEA 4ZVOA 2WOJA 1LQ2A 4Z6KA 4BJ3A 3U4IA 1TEHA 3EHDA 3AEZA 2P9BA 2EYQA 3AVUA 2E5LB 1TQ6A 1ETHA 2ENWA 3GLIB 2QKYA 3DO5A 3MHTA 1JKIA 2PX5A 4GRAA 5K8VA 4ZQGA 4QYIB 1V1RB 2IKSA 3HZHA 3MOSA 5FXMA 4KYTA 4NE2A 3MEQA 1M72A 2Y99A 1CP2A 2HMSA 4LF7B 2V6MA 2X2PA 1W0CA 3K2IA 2OGSA 4KQ6A 5ER9A 1PNRA 2X7HA 1T0JB 3CU5A 4DCPA 2GZAA 2AYZA 2BSAA 4B6OA 4J43A 5BSVA 2Y4OA 4AQYH 2B34A 2C4KA 1K06A 5A9SA 4FS8A 1LTHR 3R3WA 2OO7A 1WY5A 3PN1A 4BLPA 1U04A 3R75A 3PXBA 2CLDX 1H8ED 1ZRSA 1NMYA 3GGDA 3O74A 4ZKEA 3RAXA 2XAUA 2X41A 3M81A 4TYQA 2E5FA 2X9GA 3QK7A 5CB4F 3B6ZA 4ETMA 3OTHA 5FR1A 4FSXA 4HNAA 2Y6VA 5F1KA 2NT3A 3W05A 3L0IB 1Z2EA 4B3BA 1F1BA 1CP3A 1E9VA 2ZXUA 4IS3A 1GNLA 3MCAA 2FPMA 2GM3A 5IJ0A 4JL5A 3Q6IA 4D4GA 1Q0RA 4G0NA 3JZFA 1FLAA 3DDCA 1EX6A 4B6QA 2GHIA 1GPNA 4LC0A 1RQGA 3KJEA 3LW8A 1C9KA 1TF5A 2EF1A 4EGSA 1HF3A 3DLCA 3RC2A 3GLGA 3ZXYA 1DKUA 5AVVA 1ZXLA 3K6KA 4JUBA 4ICIA 4GL2A 2J3QA 2YVLA 4QLOA 4WECA 5FWYA 4LY0A 3P9IA 3FAZA 1YB1A 2JZCA 4IWXA 4YXWD 3QOYA 3HKEB 3SC4A 4YLEA 3VPSA 3V3KA 1PVDA 1XD2A 5CIWA 1FQKA 4K3UA 2FPXA 1SUEA 4N0QA 1OBGA 4WXHA 1URPA 3HA7A 2BEUB 5GJVC 3OCJA 4IJ6A 1SVIA 3ZH9B 1L5SA 1Y48E 4EQ6A 4LIPD 2Y27A 2JS7A 1J23A 5KPJA 2I4RA 3L49A 1Y3IA 4OX9H 2EF0A 1T9HA 2TMYA 1L5GB 4OB8A 4PTZA 2QZPA 5CBPA 5CA1F 3WFJA 5K4AA 2FFJA 2HLHA 4IOLA 5KREA 2R00C 2J9FB 3TLBA 2AJTA 3KKLA 1JA9A 5E95A 4DRXA 5E0KB 1RCTE 4UTPA 5HRCA 3C7TA 3LKZA 1RQRA 4QDKA 4LMPA 5AJVB 2RHCA 4C7MA 5T5QA 3VKWA 4EFEA 4K9PA 3AYXB 1GUYA 3GRPA 3Q8LA 1EA7A 1T2DA 4ECSA 3QP9A 2EZUA 2F9FA 5DX8A 1YNSA 1KK0A 4H0CA 4AWBA 3C7CB 3KOZA 2GA8A 1L4GA 2PXAA 2A5YB 4F4FA 3DE4X 3HABA 1ZGBA 1QCYA 2WKSA 1ORDA 4QU0A 5H9WA 4PNEA 1Q3KA 4BFCA 1HQKA 3W1WA 3ZI0A 4ZZIA 1DXYA 2FW0A 3B9PA 3QTTA 2D0IA 3C85A 1OX5A 1EXDA 5EZQA 4J0DA 4UZSA 2OHIA 1U4SA 4NRDA 2BFWA 3NTLA 1T5TA 1G7CA 1HOXA 2VSYA 4PBRA 2A2ZA 1V7QA 4M0KA 3NR2A 2GHTA 4Y2SA 2JASA 4AF8A 3QUTA 4HXEB 5HK8A 4EKEA 4A2AA 3ABQB 2VUMG 2O0MA 3KVOA 1JPUA 1BX3A 3SBEA 5FBWB 1SU8A 2ZKLA 3PK0A 4Z7OB 4UHFA 3KZ1E 4DF3A 4P81A 1NDUA 2HGSA 3H8WA 3OEHA 1YC5A 5J3JA 4FYVA 4LBZA 4WIAA 3EMBA 2GETA 1PGNA 3ZZNA 1N5OX 3E48A 4YWJA 3QXXA 2QVXX 1PSZA 3L07A 4RGQA 4EY7A 2V1XA 1N9GB 4B84A 1IHYA 3OFNA 5CM9C 4L6AA 3EIOA 2Q9AA 1YR6A 4GQBA 3L77A 4LXQA 3KT8A 3X2EA 4BBZA 4BB5A 1L7QA 3UIEA 2VHEA 1ODJA 2GNPA 1JUDA 1BGXT 1O0SA 1L8OA 2V7GA 3PCTA 4B8WA 3H2SA 1HWYA 4OGLA 2CXTA 2F6RA 2HIMA 1TYCA 3KHHA 5GOTA 3TZ6A 4Y9TA 4S1WA 2EWMA 3HXMA 2COJA 3DTNA 4R7TA 5EUMA 1TEZA 4V1CI 2MSEB 1NRXA 4ZOBA 2CFTA 3MUEA 5B55A 3ZWQA 1I3OA 1R27A 3PXAA 1JDZA 2FOLA 4CLRB 2B69A 1BS1A 2WZCA 3KWLA 1QOQB 1YJ8A 4F72A 5C8YF 1SR8A 3OHAA 3K2EA 3OBIA 4EATA 1O75A 2NGRA 1QQ6A 2CFRA 1L8AA 4MGYR 1UZAA 4KN9S 3QVUA 4UXJA 5BUZA 3ED1A 4FYHA 1ZBDA 4E51A 2VHCA 3R7FA 4J9MA 3FTQA 1FDOA 1WBDA 3WYCA 3ZHZA 3MINB 4B3RB 1TU4A 5K4HA 4GI2A 4YRSA 2QBYB 3EXEA 4GEGA 4LWQA 2JGDA 3R0JA 4OHMA 2HK8A 4JLOA 1CETA 3AVWA 1FFAA 3K5WA 4L95C 2PGNA 3TRKA 4Y2TA 3DB1A 1F20A 5LNK1 1Z33A 2CVQA 2WE6A 1UJ6A 1CJCA 4EDFA 1LZLA 4JOBA 1U2PA 1PZMA 4WPGA 2C3OA 1ZL0A 5CFRA 5AVXA 4PRKA 1SVLA 2JFXA 3RRNA 1Z68A 1C30A 2Y6UA 3PR5B 4ND5A 2CHFA 2FLWA 5KFAA 5E6SB 4EL0A 3TSOA 2ODBA 3J7AC 1YQ9A 1I30A 4GOMD 4E46A 4L5AA 5EOVA 2I65A 1CY8A 4G5XA 5FJIA 2VRBA 3DE3X 2OT3B 4RF2A 3VPCA 2HWKA 2JBHA 1FBNA 2AQHA 2VK1A 4AN1A 4W5TA 1C1XA 2G80A 1FVXA 2Z8YM 1WXFA 5JWRA 1JTFA 4E4TA 2OAEA 4PNZA 2JF0A 3O82A 3HSKA 2HT6A 3CIOA 3QLUC 3L0SA 2R66A 4NJMB 4ND8B 4JQYA 1UXOA 5KQSA 2GD0A 2N1MA 2J6BA 3ER8A 1A9QA 1RKBA 4JNKA 2EDCA 4EI2A 4YT2A 1N5MA 2PG3A 4O33A 1CY0A 1FVHA 2XCUA 4M1WA 4DDHA 4B6GA 3KHGA 3OZEA 5BVGB 5E9WA 4A3KG 4A92A 4Q0MA 4J9PA 4JY7A 1MHPA 3PHCA 1S97A 3ZUPA 5HOQA 5ALQA 1V4VA 4B4VA 5J23A 2NO0A 3V4OA 1U0OC 3U19A 4IHJB 3ZEIA 2C7BA 4PHHA 2W9CA 3LGSA 2ZQYA 4XGQA 1RHRA 2CFMA 3MQ2A 2B6NA 3EF3A 3EQZA 4FCVA 1J0BA 2JAUA 4ZYVA 1OZHA 4KHZA 3KJGA 2V3WA 3TZEA 1EVLA 2ZZNA 4JGBA 4LF4H 3IILA 2HHHH 2HV8A 3R7AA 3KQQA 4Q3NA 1ND6A 2GNAA 2WJ3A 1E94E 4HR7A 4MMYB 1NOIA 4DIBA 2FG6C 1U9IC 5A6SA 2WB1E 1O7JA 3MXOA 2JZNA 1ECGA 4LQDA 4UNIA 4RIFA 4LVNA 4MLPA 4DL9A 2WSIA 3PC7A 1YK0A 2UXDB 4DDVA 1NLZA 3BTUA 3ZDCA 2Q99A 2GKSA 4RDIA 3ILSA 2F9MA 1T1EA 3I4NG 3TS1A 3VC7A 3NU1A 4A10A 2NTNA 1P1KA 1JIVA 2O2HA 3E53A 4F5EA 1NQUA 3O0DA 3CNQS 2JFFA 5DTMA 4TUYA 3KOMA 3I6BA 2NYAA 1HM5A 5BORA 4MRSA 5CHEA 3H75A 5AVSA 3OQIA 4RK5A 2CVPA 2R751 4PIVA 1P2GA 1MBZA 1SVMA 3NOQA 1QGZA 5IWAH 1AGYA 4QBFA 3PCXA 3ETJA 4EGQA 3KSDO 3NAMA 2M9MA 3H0EA 2PGXA 1YO6A 3GF4A 4AYXA 2Q49A 4EMBA 3PNOA 4K28A 1V11B 3IQFA 1OCEA 1E7MA 1YTLA 4OQ4A 5FYDA 4K6KA 4J16C 3NDPA 5F3DA 1XQWA 4B3FX 3T95A 3R7NA 1E1CB 2FE1A 3WY9A 3DBHA 1QNLA 3DFIA 3VDNB 3SZUA 2IUSA 2XYPA 3M6MD 3H5WA 4B1FA 4ASUA 3K0SA 3LK7A 4CFZA 2ZU6A 1QWSA 1R15A 4RACA 3WLOA 1EM6A 2ONYA 3F4KA 3U40A 3LBFA 3KO8A 2GDJA 4JEHA 3GVXA 4NOKA 2D5AA 3LCUA 2IHUA 2HWWA 4MKXA 4A16A 5CYPA 4PLHA 1PEDA 1JLLA 1GIAA 5HP4A 2B63A 2A0KA 1RAFA 2OBMA 2GN9A 3TEJA 1AV6A 3K8OE 3BIWA 2WIBA 3EUWA 1SQ0A 4QICA 3GG2A 1W96A 5AKEA 2Q3BA 1W5AA 2UVQA 1WXDA 4CBVA 2ZRQA 3OQPA 3M83A 2BTOA 2DAPA 1ID1A 3QV1A 4TM8A 4LI3X 4B5LA 1W85B 1KI6B 1TIBA 2BFPA 2KX7A 4MW4A 4ZEOA 1XTVA 3FYCA 3GC6A 2WD7A 2QOEA 4HLNA 1QYIA 3HACA 2V5VA 1LVUA 3FETA 4OFZA 4DA8A 4JENA 5C1DA 4EF4A 1VGVA 3HCNA 2Z3ZA 5CTJA 3LYUA 5JD5A 3DHYA 1P18A 1KEPA 3A2MA 3C5EA 1CS0A 4HN2A 2XT9A 3FYHA 3IP3A 1PIWA 4G4IA 2QAJA 4ZHQA 5FIUA 3NBAA 5EJ5A 1CUJA 5SYNA 3RS7A 3H3FA 4H2DA 4W5HA 2WC1A 4R0NA 4OTZA 1J07A 1CKNB 1SEIA 3NTRA 2ZATA 5GM2A 2X58A 4RZUA 1QP8A 4IQ4A 4M6WA 3GNTA 1UAYA 2DBVO 2Z2KA 4HOYA 3MRTA 4QJ5A 4TWRA 2BV3A 2QMQA 2LE0A 1KPHA 4N7MA 1SELA 3TGLA 1RMTA 1ZSNA 3DE1X 2DR3A 4KVGA 1VSBA 4RB3C 4L3OA 4F4CA 1DAAA 1IBMH 5BSKA 4QFCA 4ZIRB 1E2EA 3R3SA 2ZRPA 3CLHA 4YLGA 1FSFA 2HB6A 4OHXA 3Q7TA 2PT9A 5COAA 3P9NA 2CLEB 4Z0PA 4L02A 4M1EA 2XX3A 2HHFB 1HE8B 4Z8XA 2DU8A 3JATB 2P4QA 1C3EA 3O90A 3NTXA 2RGCA 3INRA 3B70A 3WLQA 1XZQA 1V6CA 3ZE0B 2YKGA 3QMMA 4WOCA 2HRRA 3TMKA 4J3JA 4HI0E 1HFJA 2I6XA 3UQZA 5BSUA 5TPZD 1BEUB 2M2IA 2J9YB 1U1GA 4TTRA 2K7FA 1MA3A 4ZRMA 5A7GA 2AOUA 3F9CA 1T29A 2G1AA 2GVDC 3B6IA 4BMNA 4RZSA 3VZCA 2QHXA 2O0HA 2YQ5A 2HHCA 3WWIA 1R3UA 1VL0A 1S89A 4LRUA 4DBLC 1DO8A 3FGNA 4I19A 4NXNB 5FOQA 3U4DA 1GPBA 5E4TA 2GYUA 4RVCA 7MHTA 4LYFA 2F8MA 4EUFA 3FZNA 1ZUNB 4N0MA 1XZKA 1XNRH 1N6OA 4HAWA 3CM0A 3HJCA 4KUGA 3O4FA 2VJNA 2AHOA 1QGUB 3Q3HA 3DKPA 4ZCTA 4DV1H 4G1EB 1KI7A 5LXTA 3CVVA 1I10A 5JXIA 1KIFA 1RYEA 1WWKA 4N54A 1K92A 3KKZA 5DB4A 2QGFA 3T3MB 4EO9A 4OYHA 1WQ4A 3EEOA 5DU2A 1YRQA 3LC1O 1DZ3A 3C1UA 2Q6LA 4FZ3A 1QLHA 3E9QA 1VP9A 1PQPA 2VK2A 1LBEA 1P9WA 4Y30A 4FQ7A 5TQVA 3DDWA 1U7ZA 4ZOLA 2BEKA 2PT7A 3T61A 5BSWA 1OC2A 2PKQO 3M9NB 4C7JA 3QEJA 5HHTA 3ILXA 1N33H 1ZK3A 4YDRA 3U5ZB 1C0KA 1XA4A 1KU0A 1PWXA 3AHHA 5HBGA 4IAOA 2P9GA 4K6MA 1O1YA 3KUDA 4NABA 2EIXA 3ZD8A 4DAOA 1JLSA 1XNQB 4JI5H 1H2RS 3DH0A 7AT1A 4IFTA 4UBKA 4QUKA 4UBMA 1TL7C 2JI9A 4H7FA 3URMA 4RMHA 5AIBA 2VQSA 1B1AA 1ZY2A 5E8RA 4WBSA 1WXIA 3ND9A 1YT5A 2ZB4A 3F46A 3F73A 1ESNA 1E32A 3KNZA 1DCFA 4HAXA 5KNDD 4O82A 1VCOA 4RVOA 1TTQB 1KRHA 4QYIA 4TKZA 1V1RA 3GAMA 4W1RA 1ULTA 4K9LA 2A9KA 4P98A 3DAYA 3IE1A 1PJAA 2DY0A 3K6RA 1LC3A 1JLKA 2SBTA 3N86A 5B3LA 1ZUD1 2X6RA 1HFKA 3HWRA 4GS5A 1UC8A 4IKPA 1YJBA 3OI7A 2C9ZA 2QMHA 1J7JA 1U0TA 3BGDA 1YDHA 5C1BA 2R1TB 5AMXA 3WDLA 1A76A 3A9SA 1G16A 3QVXA 2O5VA 2HUPA 3S2GA 2XQJA 5LZ8A 2O5CA 2P79A 1G6HA 2H2FA 1EQ2A 2M6KA 4LRYA 4JHLA 5F3WB 1DRWA 2H5EA 2WT8A 1G291 4G65A 1HETA 4KGZA 4BY7G 2PL1A 2JGNA 1GDDA 5GIPE 4BEJA 2AQ8A 3MLBA 5I3CA 2ATXA 1HDOA 1OZGA 4GPIB 1X19A 5BXYA 3S27A 3BCRA 3N0TA 2HOQA 4HDSB 3KL2A 1ST2A 3U7HB 2VS1A 3WNBA 1R6TA 3WB0A 1FU4A 3W5OA 3ECCA 3TJZA 1J5EB 3OZIA 1BCRB 4X8OA 4Q15A 3HKZA 1RKVA 3EUEA 1HMYA 1LGYA 3SKVA 2IZZA 3C0FB 4IQFA 1PHPA 4O3SA 2F59A 4NEHB 1GAXA 4JYAB 1NSFA 5J2TF 4GRIA 2YH2A 3UOGA 4B17A 3LUBA 1VPWA 3AF0A 4A8TA 3MOIA 4X1OA 4DR1B 3AILA 3EGOA 3IJEB 4AY4A 1QK3A 2XMSA 3WSTA 4O7VA 4AAYA 3DT9A 3G2JA 3JYQA 2D3TA 3F47A 3HKEA 4G1CA 1TUGA 3S99A 5E9AA 4KBFA 1WXHA 2VEOA 2YBEA 2O1SA 3G9XA 2BEUA 3CSSA 5FCDA 5KNDH 1QHIA 4JYCA 4MGKR 4I6GA 1RLJA 4YX9A 4G5QA 1FPQA 2MJLA 1QRAA 3OSUA 4M9QA 2FDCA 4L73A 2QGZA 3FCUB 3RUPA 2FPIB 5BWUA 5DJ5A 2RAVA 1Z07A 4KDCA 2PH7A 4MLZA 1XAIA 1F0KA 4JGIA 4N76A 3LPNA 4CETA 2XGGA 5IC4A 5CNKA 2FZ4A 2O14A 3RREA 4QXAA 2C7OA 1KI8A 1W36D 3EA4A 1P1IA 2ZB7A 2VOBA 3RYHB 4GSLA 1OKKD 3LT1A 2HPHA 5HKAA 2EZTA 4PLTA 5J1TB 3KHLA 2A92A 2J9FA 5KSOA 4HUQB 3D8NA 4AJ9A 1FDWA 2IP2A 2ZR0A 2I4TA 4BVHA 1Z0ZA 2XUIA 4DLSA 2WIFA 4IVNA 3GRAA 4MWTA 1U0JA 1JDEA 4FJ2A 4KMMA 1ENZA 2GRAA 2RKOA 3RUCA 2GILA 3U3DA 3UKJA 4R8RA 1PBTA 3X44A 1IMJA 1KSGA 2CVOA 1P7PA 1U7DA 2RCYA 1Y8ZA 1OOEA 4YTEA 1ZIYA 1IONA 5DSZA 2HCTA 5DLDA 2PBZA 3MSCA 5AHOA 3OZXA 2VQDA 1XNHA 3HXKA 2ZROA 4UM9B 4AZTA 1FYFA 3GOQA 1U9YA 2A35A 4DYDA 1MVLA 2GAFA 4XGIA 3RTCA 1CVRA 4ZVVA 2R25B 3BC1A 4UEQA 2HPAA 2VAVA 1JKMA 1P5ZB 3O3OB 3DWGA 4OL9A 1SVWA 4MRMB 4D2IA 4L4ZA 5IVIA 1RM4A 2FMAA 1OWMA 1OD6A 2B30A 2I66A 1KO8A 2Q4DA 4JOCA 4JA0A 1HKHA 4N6OA 1XNGA 4ENWA 5AYVA 3FNBA 4D3SA 1TVKB 4ITRC 3KETA 4KPGA 4X0EA 2B78A 2CK3D 2O7QA 1NXXA 1SQFA 5TJHA 5FPKA 1GJRA 4F85A 1D5WA 3KYIB 2C29D 2QU8A 1RXCA 1J0XO 1NUSA 4R9RA 3GROA 1A4UA 2I6TA 4QOJA 4IV5A 1I14A 2G1UA 3LP5A 4MGZR 2RH9B 3L46A 5LZ2A 4B32A 2BFAA 3WWPA 3KYDB 2L18A 4OB7A 1PGPA 3AEQB 4AI6A 2JKYA 1UBOS 1Z3CA 4AY2A 3LY7A 1E4EB 2R8BA 5JAUA 4DV4H 1RWNA 4F97A 5JJCA 5G40A 4IJ5A 5E3HA 5T8KA 5HQTA 4BPRA 3EFBA 4QWCA 4J7AA 4KIFA 2HSDA 4JVLA 4H27A 2O6HA 3ASUA 2RD2A 5HUJA 5KYKA 5C18A 4KNYA 3MUFA 4HEA1 3WB9A 1W8IA 1XK7A 2WIJA 3VDXA 1U1FA 4O2BB 5JRJA 1LPNA 1FNMA 5EKXA 4EQ5A 2W9CB 1PFUA 4IIXA 3RIEA 1VFNA 4CZ2A 4JUIA 4TTVA 2PZFA 1OLUB 3IVRA 4GPD1 1SBYA 5KNBA 1VI2A 3WGIA 2FZLA 2R3SA 3DCJA 4II2A 3RAGA 1EWVA 4XARA 1GOTA 1JWAB 4MI6A 3ZVMA 4MZXA 5HIMA 1SGWA 2VJQA 3NC4A 4FNMA 4JWKA 3LZDA 3BTOA 5C5IA 4UVDA 1NYTA 1CY1A 4JI7B 2EBHX 2ZJ1A 3WGMA 3MINA 5CNJA 3BL6A 1EQUA 1IIBA 4R6XA 2C8KA 3L6EA 2QBYA 1B8VA 3BKXA 3WBFA 4UCWA 3LLSA 1HEYA 4N0DA 1FTSA 1H5NA 3GJ5A 2E4XA 2J4DA 4A93G 1C4WA 1DCTA 1U1EA 2BZSA 3S2SA 1GD1O 2DB3A 5AWFC 4KE6A 1D03A 3N8IA 3AF2A 5DTQA 1MVOA 4YRGA 2Y1WA 3LXMA 5EIBD 4EB3A 3LECA 3FNRA 1PNTA 1VJ1A 2HM7A 3GGGA 4KACA 3JWPA 4XX0A 2OENG 1KMQA 2WAQA 1X1BA 1U2SA 1TE2A 1I7NA 4Q3BA 1C7IA 5E6SA 3G5AA 5JMWA 4J7CA 2CWDA 2A9FA 1FL9A 2IW1A 4R98A 2HNAA 3HU2A 2RJNA 2NZ8A 3HQ4O 1EQAA 4EUKA 4EBEA 3ZHQA 3H87A 4G0VA 5LMZA 5IX8A 3A4VA 3N2GB 2JI8A 4RJKA 3AR9A 5L95A 3GIQA 2YJ4A 2P4UA 1C3VA 3RUFA 2OQVA 2C2MA 1FW6A 4H4DA 4DJAA 1TJNA 2I2FA 4NJMA 4ND8A 4BLUA 2I29A 3M9WA 3OURA 4CHIA 3DVSX 2X3FA 2IWRA 4RUCA 4PG4A 3F6CA 4IUCS 1W1IA 1RWVA 3NC0C 3D4OA 1RYYA 1VA4A 2ZCJA 2K2WA 2O7VA 3WR5A 2AMFA 4TTJA 4WDRA 2A4KA 2DOKA 1SBHA 2XMCA 3ZXXA 3UAWA 1R37A 5BVGA 2GM9A 2RARA 1QDUA 3ZNNA 1QIKA 1N0HA 2XRZA 4RGVA 3TFOA 3JD2A 1T9GS 4ERXA 4YPVA 2IPOA 4IHJA 4Y1GA 5BNTA 1NUQA 4TYYA 3FRHA 3M82A 4BZPA 3K53A 4DHWA 1R6XA 3U3MA 3BWDD 2ZSBA 1LRJA 5IH3A 3RHSA 4OA8A 1O54A 4MB0A 5DGBA 4UPEA 2CBGA 3TWOA 4D0LB 3ROQA 3F7TA 2V7BA 4AECA 5CJ2A 4YA6A 3KPUA 3O8RA 2X4DA 1OI7A 2CL7X 2OKGA 1GA4A 2KQUA 5TS2A 2XA1A 3WDKA 5JV5A 1BDJA 2UVRA 1SHUX 3D02A 4YUYA 2R8HA 5BY2A 4LFAH 2R9VA 1CS0B 4LJ9A 5JQGA 1I2AA 3W6PA 2FK7A 1UMDB 1NRWA 1A7JA 3RGZA 4IXNA 3TG2A 2CSXA 3L0YA 2P6MA 4YRZA 4BQEA 2YQZA 2DR0A 5E4YA 1EPUA 1NVDA 3HBMA 1SA0B 3GMDA 1VPVA 4O5AA 3TBHA 2IXBA 5CK4A 3F2IA 3KWFA 1K1QA 2FNAA 1CZNA 3DE6X 1OPXA 1IG3A 2P2CA 3L7AA 1V16B 4MPRA 4O4JF 3GFQA 2LXNA 1DGSA 3OF2A 3I9OA 1PJLA 3KTFA 1TD1A 4D3DA 1BD4A 3ZWVA 3SXUB 2W4IA 4X1KB 2AJDA 1DXQA 4MW6A 4ACAA 2QY6A 4BVFA 2DUWA 5SZKB 3MT7A 3K2BA 4FFRA 1EFTA 3GLUA 4PS1A 2O4UX 5GONB 1V11A 2V7XA 3G2HA 2BP7B 5LP1A 4W8OA 3ENNA 3MGCA 4ZEVA 2ICAA 3SN6A 3UJAA 2D06A 3DFUA 1E1CA 3A28A 1A8SA 4FYKA 4Y1EA 3WWDA 3CUVA 4C4OA 4MSUA 4W5WA 1PGQA 3LKBA 2ZZMA 1VBNA 1WUIS 4U7PB 1K3UB 2H57A 4RLQA 3K0EA 1WXEA 1XAHA 1Z35A 1RAAA 2CNDA 4QYXA 1P74A 2W6PA 5DSTA 5JATA 3A25A 5LMNB 4YNBA 3KZKA 3G13A 4OREX 2HQSA 3AB8A 1EUYA 2FE4A 5MF6A 3ZY5A 5EHIA 3D5TA 3NDBB 3FOZA 2GCIA 1OH8A 1U2GC 1VE3A 2DHCA 5EGSA 4X62B 3OCUA 2UUPA 2GF2A 2EZ9A 4ZO4A 1Y7HA 1F4PA 1TTTA 1O8CA 1EFCA 4ID3A 2F4VB 4NICA 4ZCPA 1G8HA 2RGNA 4NBUA 3G8DA 3K3VA 1EXVA 3E9CA 1T3TA 4XR4A 1W85A 4LZWA 1KI6A 4UJ3A 4BFTA 3GRFA 3ANSA 4WY2A 3LPDA 4FCWA 1TJYA 5KNCD 4REMA 1EJ0A 5H0IA 4BB0A 3CEJA 4W8HA 3QNMA 3QVTA 1B0ZA 1NBMA 1T0UA 3TQOA 1FLVA 3GPBA 2C9MA 1CB0A 3DW3X 3PUYA 2R6HA 4KLNA 1XF9A 2XTAA 4IO0A 5DBFA 3OWXA 4G5RA 3IHTA 3FCCA 1XMPA 2V6BA 3SBXA 4LGMA 1KAMA 1A5SB 3NBUA 3IKMB 1NX9A 4UBIA 3F4BA 4ZT7A 2PKCA 1NXPA 4MWGA 2YVKA 1NJ8A 3WLEA 3PW5A 2W2KB 2ZULA 1YE3A 4D80A 4B3SH 3JQBA 2ZT8A 4Q6BA 4GDFA 4AZ3B 1OA1A 1XCBA 3GVHA 1TCVA 4XGNA 3GEBA 1BGWA 1GFZA 3GJZA 4ECXA 5EMHA 4ZIRA 1M5UA 1KDYA 1GNVA 1NQWA 1WOYA 3P97A 2ORIA 1RRFA 4WBXC 3AEKA 4YAWA 3C3PA 1UKVY 4KKVA 3BB3A 3FUUA 2GXQA 4D98A 3HI6A 4PBCA 4BWYA 4YPFA 1BWSA 4UCQA 2QD1A 2HSWA 3L8FA 3L1JA 1KO5A 2QVGA 3DF9A 4CMAA 1KORA 4N48A 3L7IA 3GTLA 2X14A 2ADMA 2HHFA 2P9HA 1BH2A 3VYRB 4ON9A 3IXLA 1TM4E 3MR6A 2B61A 3CY6A 3KFXA 3JVUA 1VJ5A 3MIZA 3BA8A 3CF4A 3IUBA 5B1IA 1B43A 4HRXA 1OWNA 4EGJA 3UMSA 1R4AA 1XYGA 1CFZA 3NP7A 1KKMA 1FMCA 1ULZA 1YOBA 3SZLA 1XZCA 4YC7A 1EFUA 3WYNA 4GZ6A 5IFKA 3IPLA 1DBSA 2H0QA 4X66B 2GKOA 4CWAA 4Q82A 3IYLW 3QHQA 2WE8A 1XEFA 3BQ0A 3FUVA 3FFWA 2HADA 3UKOA 1F6BA 4UBJA 3TGWA 1SD1A 2VWGA 5KYUB 5CFPA 3G3EA 1XA0A 4AYBE 3PS9A 3KQMA 4CJXA 4PN3A 2FWBA 2AWOA 1I36A 2GBCA 3BIFA 2WJGA 1PSWA 4AG6A 5KNCH 2WT9A 3U48A 1TTPB 1G60A 4BHTA 1KJZA 3AVTA 4Q7LA 5ISMA 1MP0A 5CB4B 2YOFA 3THSA 3WQRA 3ZJ5A 4BC0A 1NNEA 1ZUNA 1XA3A 1ZISA 3HXQA 1RJFA 2CCGA 3UK0A 1GRVA 4ER5A 3MUOA 3T5LA 1QGUA 1YH3A 1PDVA 4E7OA 4IM7A 4C4PA 4EP1A 3B7WA 5ALYA 1SXPA 4CXMA 4ZEMA 2CMFA 3UK6A 2V45A 4O2LA 1Y4DE 3G5TA 4PC1A 1B3BA 3GP5A 3CH4B 3DMPA 3FCXA 2IHTA 3EQ8A 4JCCA 1Q19A 1YQQA 4UARA 3R5KA 4GD3Q 1U2DC 4N5DA 4DUYH 2YJZA 5FWXB 2Y1KA 1U8TA 4G0OA 5FBLB 4UMVA 5B3JC 1LC0A 5KOIA 3K4QA 1DKQA 2PCLA 1VMKA 1AN9A 4EB6B 1JX6A 3PIDA 4AY6A 4KO8A 1Z6AA 4WFJA 1WM1A 1SPXA 5DBOA 5FA6A 4L07A 4KVZA 5AJUA 4ZQFA 3S5JA 2GO7A 4EUHA 3RB4A 2D1YA 4G8BA 4J2HA 3UTDA 1Z4PX 5BNZA 2NACA 3K5PA 4PHCA 4D99A 4N6GA 5EHNA 1T5HX 4Q9JA 2M6SA 4DLUA 2VJKA 5CA1B 2PX0A 1TWGA 1WVIA 4IYJA 1E79A 4MA4A 3X0DA 3M3DA 1Z22A 4B3GA 2W48A 3UUFA 1F14A 5TQ2B 1ZN2A 3NONA 1NI3A 1KOJA 1K98A 3T5AA 4DLWA 1RM5A 1I1MA 3FVVA 2RK6A 2CMDA 4NBWA 1SHJA 3L8EA 5IYCG 4PYOA 1DIGA 1G5TA 3P5SA 2ZBFA 2IBTA 2GLUA 2GPAA 4AX4A 3FE2A 1A4XA 1A5BB 4M1KA 4EYHB 2QQFA 4JLDA 5LZ5A 3E3AA 2DY1A 3V46A 4HC4A 3VMMA 3C5CA 1G20B 2IE8A 2R1TA 3SHVA 5IXSA 4XLLA 3QPCA 2PD3A 5HGJA 3IAHA 1WULS 2JBWA 5ARDA 5FPSA 2IW3A 1XALA 3OO0A 2D4AA 2FUNB 1TW2A 5C37A 4NDAA 4MIEA 3OOJA 3VC1A 4WH0A 4F4HA 3HCWA 3DKVA 4IJWA 2C97A 4J0CA 3WLSA 1JIJA 5KU7A 1WD5A 5JS1A 3O1HB 3H3XA 1RYBA 4YCAA 2P69A 3ZK7A 4FM9A 3UA4A 4RKWA 3ORQA 1NMQA 3R9RA 3D6NB 2GBFA 4KGDA 2C2WA 5DN9A 4HDSA 2B3DA 4DR4B 4F21A 4N41A 3DBLB 5DM60 2KBEA 4JI4B 3PHBE 2JCBA 4QQ8A 1NIPA 3QYAA 1BCRA 3PB3A 2K6GA 4Z49A 1YDFA 4G24A 4TKLA 4EYKA 4JZKA 4UTOA 4FS2A 5B37A 4JFRA 3CLSD 3BJRA 1HMPA 3NANA 1RJWA 5T3YA 1RYRA 4F4IA 7MDHA 3L7KA 5K8JB 3ONWA 3C3XA 4RQTA 5FULA 1IZ0A 1OAOA 1HNXB 2LW7A 3BWYA 4C4XA 2A86A 4EPXA 2I99A 4F3NA 1XELA 2VNKA 3A70A 4ER7A 5JAOA 2XCLA 1E3IA 3T9DA 1Q0QA 5ALHA 4UTXA 3HBNA 4DKJA 3TECE 3C41J 1S01A 3CLUC 1Z6ZA 1Z45A 2Q41A 1I2CA 3FWKA 2R82A 4C7XA 2FPIA 3W6ZA 3ZZUA 1BMFD 3DC2A 1IN5A 5G3ZA 1LK7A 1YR1A 4O4HF 5I7HA 4JASB 3GRYA 2I34A 5DK4A 3V2IA 2HLDD 3U49A 4MB2A 1H1LB 4CLXA 2CNOA 3VKHA 3RYHA 5C8YB 3HGMA 1R2QA 2WTEA 3QKIA 3PFFA 2EBUA 1YKFA 1ZQ1A 1LSOA 4HUQA 3G5LA 4PSKA 2MSWA 5CR9A 3OPYI 2H0AA 3IULA 2PJRA 1XJ5A 3ZU5A 1M33A 5DM70 5KFXA 2DTDA 1Y3BE 2JHFA 4YY3H 1NTOA 2AVDA 1SIOA 3TKAA 5AUQA 3DAOA 1B8UA 2QLLA 3RVNA 1XLVA 3KTDA 3E9DA 4PWZA 3E2PA 3H2ZA 4BVLA 3GV7B 1I7DA 1T3ZA 2C2HA 4RTKA 2JHCA 2QNBA 3PJFA 4P7BA 1DLJA 1Y9AA 3K32A 4DAAA 1YCDA 4BBRG 4PRLA 1NJFA 3FUXA 3TEKA 4NPAA 3N2IA 1QKJA 1T5BA 3GP3A 3FHJA 1SU4A 1Y9ZA 1JU9A 2LR0A 1C14A 1MUUA 3GIPA 4CYMA 2XXAB 4K6FA 3OC6A 1Z37A 2FGKA 4MRMA 2ZRJA 3GTOA 3LZCA 2ACVA 1CR4A 2IA6A 1IY1A 3C14C 3QA9A 3UPTA 3ZWNA 4XX0B 4DYVA 4Z4GA 1MU0A 4K6CA 1TVKA 3IOCA 4OHWA 1NHGA 1TMOA 1V5IA 5B58C 1XU4A 1FTNA 2WFMA 3PFHA 5J4LA 2NU9B 4HB3A 1WRBA 1RC8A 2FF5A 2NVBA 1WU7A 1HE4A 5I3ZA 4O83A 4M9ZA 2XKAA 5CFQA 4R41A 3VV3A 3THOA 5CVEA 1B74A 2CL5A 5T4BA 1DG9A 2KPOA 2C58A 2CCKA 4BFLA 3DFFA 1Y9JA 1N0WA 2J48A 1GTG1 4QYMA 3HV0A 2CW8A 3KYDA 4N8EA 1IH8A 4UTVA 1HV8A 3C4QA 1CJBA 2FK8A 1SN7A 3AEQA 4MYTA 1SVUA 5JEDA 4IZ6A 1OY1A 4LKRA 3H9EO 3RTDA 6ADHA 5F3RA 1CZOA 1Y3CE 4RO0A 4XYGA 2DLDA 1CUUA 2Z56A 4D43A 1E4EA 2O2ZA 3CN9A 4OBBA 5DG8A 4EMUA 3ZWXA 4L15A 3KPVA 5JWHA 4DTCA 4YT4A 3BBLA 3ZZMA 5I7AA 1F5SA 5LQKA 1HFWA 3AKDA 1J8FA 3T5JA 2NXNA 3ZDDA 5CDTA 1NOKA 5HDBB 1JTVA 1EWTA 4WZBB 4ZO6A 1AKUA 2OCXA 4MQ4A 4MWCA 4XIGS 3ENKA 1MJGM 4QAQA 3C5HA 4KHPB 4O2BA 4US1R 5CLQA 5F2NA 2HXGA 4PZCA 3NLLA 2C2RA 1KMCA 2E18A 3UA3A 2FCRA 1P1FA 2Y0BA 1OLUA 2YX1A 1ZMXA 1E99A 4G63A 5BMOA 2P62A 3AC0A 1SH7A 3MHPA 3Q9LA 1PCXA 3PKIA 4JZYA 3NRCA 5EJ9A 2P9CA 2ABWA 3M9MB 4YMUA 1J00A 3P26A 2E55A 3WAGA 2VJAA 2AR9A 3IBTA 3OSNA 4N0PA 1KEEB 2Q07A 1MJHA 4EA6A 2NVXA 2ZANA 3CE6A 1NBAA 4PGHA 2GPWA 1UZUA 2HF7A 3G0HA 1QR2A 2IBMA 1IPEA 4LOIA 4P34A 5JQGB 4N39A 3I73A 1CUXA 2O3QA 4MWDA 3DA8A 3UV3A 5LLDA 2O59A 4NX2A 1V7PC 1I6UA 3L0CA 2Q7XA 4OHPA 3V9AA 1OSNA 3H0KA 2ZRMA 3DCNA 1GQ2A 1YVDA 3B1KA 2CVHA 2EFJA 5AXAA 5LLSA 1N92A 2SCUB 4RW0A 2VF2A 2VUGA 4AJOA 4BO9A 1JU4A 2J45A 3SNHA 3TOSA 2GEJA 3R3VA 2ZCUA 1IZ7A 3KHSA 4W82A 3OQNA 3GTGA 2PBRA 3NALA 3N0RA 2GCPA 5K0CA 4V0MA 2QN7A 1T0BA 2AN3A 3VO1A 4EA7A 2G1PA 1V41E 2GFQA 3N2GA 4WV3A 1VCMA 1CQPA 1WD7A 2ZI7A 3ZD7A 2BFDB 3L5KA 4ZI2A 1OTXA 4FILA 3B5EA 5MFZA 4LNAA 1CZKA 4O63O 1NVUQ 5KTTA 3GJ3A 2CNBA 4JP8A 1VHTA 4XIYA 3VR4D 3CN7A 3HOVG 3W5AA 1P81A 4AJLA 2C9DA 1U2ZA 3C97A 4EUSA 1G8JA 1M2EA 3T5TA 1J4AA 4ESEA 1BAPA 4WNAB 1SXJB 3KCQA 2O57A 1MDBA 1O0CA 4IKOA 1MJNA 3RBAA 5LWQA 5DIZA 4I1UA 4KBYA 1H42A 3I61A 4UMEA 3LQ4A 2EXXA 3PYLA 1UXKA 4BC1A 2HA6A 3LC0A 3OJWA 4XTRA 1X80B 3TUZC 1N78A 4H7HA 3MMSA 3Q1LA 1MX5A 3G1TA 3O03A 4QJ3A 4U5XA 3IAM1 1S3GA 3W5BA 3HN2A 1WCMA 1RHJA 3WV4A 5TMPA 3N8HA 5JPDA 1G21E 4R7GA 2GD2A 1EIWA 3LLUA 1J1UA 1WB9A 2R5NA 1PYDA 3T3PB 1V8PA 4E0BA 4DLRA 2IIVA 4NBNA 2VF5X 4NR0A 2QTFA 4HDMB 2E87A 2GJ8A 1P45A 4ED2A 1NJSA 3AKCA 4TRMA 2EW1A 1YZUA 2QT0A 5FQOA 3RVDA 1UMDA 2WJIA 1L7BA 4UU8A 2O0JA 3RD5A 1BVUA 3MFYA 2W6JD 4K0KH 3CEHA 2POQX 4Q05A 4PTYA 3BIXA 1L7RA 5KQPA 3IR6A 1FFBA 3DGFC 3EZ2A 1X7WB 3KT0A 3E9MA 3WK9A 5IYZA 5K6RA 2ASLA 1J5PA 1HQDA 1SA0A 2YZ7A 3OLYA 4KWEA 4PLPA 3L02A 3QZUA 3MS7A 2OBNA 3A27A 3V7NA 1QORA 1FUYB 3M1IA 4JDPA 5DNVA 3VOBA 2AFIE 5C9ZA 4RKFA 3GRVA 4ITVA 3ZQJA 2AYYA 2ACKA 1V16A 3ZD9A 2ASVA 3ET4A 1THZA 4WLUA 2XB8A 3SXUA 2ZBDA 4G0MA 3VR4H 3WRYC 5EIFA 2Q4RA 1X39A 3ZDEA 4X1KA 2P65A 2QORA 3PUWA 2WJWA 5JJLA 5CDFE 3FPFA 3OM9A 3QXJA 3AEKB 1NASA 5T4EA 5BSTA 1FFGA 1VMDA 3PRHA 5GONA 2NO6A 3AOEC 2BP7A 2E4UA 2G36A 4HP8A 3W5UA 2PMWB 3JQFA 3O4GA 2I6UA 5IULC 1FC0A 1NW3A 1ZMBA 3KPWA 1BKYA 1I0ZA 3F6PA 1ECBA 3JV7A 3BH7A 3WIBA 1EKFA 4EJSC 2YY7A 4Q48A 4LZZA 1DI0A 1KP3A 3D59A 4EELA 4ZTZB 2C7GA 5JI2E 4PZLA 5TPWB 1NHWA 4FPXA 4QARA 1W0KA 3QMVA 1LPOA 1E59A 2APJA 4EHAA 1I7QB 4YHHH 4QU8A 2HMTA 4HWGA 3VRHA 1U5CA 3ICQB 2PQMA 1ODCA 2X9NA 4MUEA 1JNYA 3M34A 3RBVA 3HCPA 3BKWA 3SSAA 4URZR 3VJRA 4Y3UA 5ULLA 3HY3A 3U9SA 2Z3WA 5DYWA 2EHJA 1I7SB 2P3QA 1RP7A 1FNNA 5FYQA 4CV2A 1K0FA 1OGIA 4FVTA 2UZAA 4QXPA 3UNXA 5ESRA 1YTUA 2DR2A 2QD3A 1VIYA 4TMKA 4MK4A 4I1PA 3QYFA 4JBGA 4XM0A 3B6JA 2FN3A 4IDFA 3A6JA 3CX3A 3IXMA 5KFVA 1IULA 4MV8A 4G9GA 2WJJA 4OXNA 2FQYA 5TMDA 2B99A 5I8WA 2FEXA 3HSSA 1TU0A 5B36A 1FSPA 3L41A 1XKLA 5ERXA 3D81A 3CLTD 4AJHA 5CCBA 3H5IA 3ZNOA 2UYHA 4Q4AB 2PA3A 1GGMA 3KS9A 4ZZ2A 5IDVA 1G4UR 5EJ4A 4L9WA 4MKIA 1Y3DE 2QU7A 5IZCA 2EG5A 4K9RA 2JD0A 2W2KA 1GVHA 3SFVA 1FIUA 1RZRD 5JZBA 2A5LA 2I6GA 1GZ6A 1K2VN 2Q5QA 5IYBG 3NVDA 1JF8A 4AZ3A 4QTYA 3A6GA 3JW8A 4X64B 3CZCA 2HDOA 3FHTA 2Y1GA 1LDYA 1J0DA 4AJ4A 1SOVA 4GBED 1YNOA 5EJGA 1PG0A 3RT7A 3B3GA 2D6FA 3UG7A 4PLWA 2XCQA 5E7MA 2FWPA 1X7HA 1CIVA 4V38A 3TE7A 4R2LA 3MZ0A 2JAOA 4TZTA 2QX7A 4DM7A 3DEHA 3HY4A 4Q6WA 2TRSB 1YVUA 4HN4B 3NHUA 4K1XA 2WF9A 1J9GA 2IV7A 2JJ8A 2CV0A 3V8VA 3CT4A 5IP5A 5FNVF 4BNVA 3V8PA 1HR0H 4WK4B 2IYPA 2HBZA 2CB9A 2OQ2A 1X7GA 1LXCA 1MGPA 1E18A 1G66A 4YDSA 3P19A 1PEYA 2H4ZA 2RMKA 1MEEA 4Y2QA 1ADGA 4KQ2A 3VAYA 1XLUA 5KYUA 3GEEA 4AKEA 1QIIA 1YE8A 1GU1A 5CVJA 5DLGA 1ZAKA 2DWUA 1EWRA 1KYWA 5AKYA 1YDWA 4UVGA 4ZU1X 2OVBA 3RS9A 3H1GA 4WKNA 2BN4A 3DV9A 4HFRA 2YJGA 3FDZB 4OHKA 5CB4A 5JECA 1NUTA 3TOZA 5BRJA 3COYA 3IJ5A 2RGBA 4ARBA 4CG1A 5DNWA 4O8CA 5K0FA 1J09A 3DDHA 4BKQA 3FPHA 1TZCA 3UK2A 1X1CA 4RB1A 1JHXA 2F55A 4XB1A 4YJKA 4ZT3A 1Q0UA 1CQWA 5D6OA 1JZQA 3RPEA 3VKFA 2R6R1 4O7RA 2C2KA 4NS1A 1N7GA 1XMIA 2H9IA 4LHWA 3QX8A 4BY9E 3AUFA 4P0PB 2ZBQA 5FWXA 1SIBE 2J87A 3JRNA 3PC6A 3HN6A 3S2UA 1GZDA 4BFYA 1L9KA 2N3ZA 3BF8A 5J2TB 1P0QA 2IP4A 5KG1A 1XTIA 4RQBA 1W4BA 3AUKA 2M32A 4OX9Y 1SY7A 2A5FA 1F8GA 2XUKA 2QRJA 4C6TB 5CIYA 3PQCA 4LF4B 5KOJB 4EB6A 4POOA 3UYYA 2E1RA 2W00A 2OBLA 4GFDA 1DT5A 2NUPB 1X9NA 3ENVA 4EHBA 2V4MA 4ECEA 3O9VA 3BFJA 4ANFA 5J1SB 4Q8EA 4MMZB 3JALB 3LQKA 2R0QC 4JHXA 3UAXA 1B0UA 3OKPA 1W0JD 1BQEA 3QHAA 4EZEA 4J91A 3Q0EA 5I4KA 4PV7A 4F8EA 4HNGA 1J6UA 4YQZA 1ZP6A 3UW3A 4E1BA 5CA1A 4D3YA 3LYAA 3P4XA 4IUBS 3GG9A 3FCAA 3OIGA 4CKEB 3DXYA 1JKXA 3OZCA 1XMSA 5TQ2A 4ENVA 1GPDG 4E15A 2D1TA 4AUNA 4G25A 5DI9A 1ORTA 2Y66A 3BRWA 4CRWB 2BZGA 5LMUB 1WPQA 1AB6A 1I51A 2HX1A 1YJQA 1W35A 4KREA 1LZKA 1N6LA 4PO8A 4ZYUA 2I0FA 1QIDA 4DQUA 2PWPA 1NSTA 1ZK1A 4YCNA 1A1SA 2JLCA 3A9CA 2YCBA 4KXMA 4DMUB 5JD3A 3EULA 2R8ZA 1PT6A 1ZIPA 1ZCJA 3CE9A 4WE3A 1G20A 3HMQA 5AKLA 3QKSB 2XE4A 2C83A 3BQ9A 1XEWX 5JD6A 1A72A 2GX6A 3UM9A 4YCBA 1KGSA 2ZAMA 6YASA 5LC1A 3GEHA 1IZ8A 3O31A 4RNMA 4E70A 1FOEB 1I2BA 3ZIDA 2QTRA 3H1EA 2BTQB 5EI5A 3L43A 1YQTA 3AJAA 3VJLA 4TQAA 1CUZA 1THTA 3OTOH 3UCXA 2R8GA 5J5AA 4GC6A 3AM1A 1GILA 4B46A 1GA1A 1MO3A 1I2ZA 3QVKA 2AFHB 1LBSA 1ZRMA 1A3CA 4BOYA 5BXQC 4L5JA 5FTLA 4RD6A 3DPIA 5JSFA 4KNWA 3KP1A 5IN5A 4NU5A 1KYIA 3DBLA 4QGAA 2QM3A 1PJRA 4QOIA 5I51A 4CMKA 2ZPTX 4X61A 1YAHA 4HJRA 4CTOA 1LEHA 4BNNA 1E0DA 4MP6A 1Q5PA 1I01A 4MVJG 2IP1A 1KUTA 1W76A 4HDKB 3PUIA 4ARZB 3GMSA 1ODKA 3CSWA 1VHDA 4MUMA 1UDXA 2ZGVA 1GPYA 1R64A 2XD9A 3J80A 2E5WA 4NCNA 2PY6A 4E5UA 3LDUA 4MRAA 2CXPA 1RKQA 2QZ9A 3C74A 4AYWA 4HLCA 1WMFA 3OPNA 1FXUA 5ITZB 1RHMA 1DQSA 3AP2A 4QJBA 5KFRA 5F1YA 3HLYA 4OI2A 2D5BA 2R62A 3TI7A 2JIQA 1P5HA 4I9NA 2EGHA 3IDZA 4Q9HA 2G04A 3S0JA 2PEYA 4BX2A 4KRXA 4NZOA 1KFKB 2QQEA 3I04A 1S0MA 2Z8YA 3EXG1 3K30A 3Q3VA 3WLMA 2F00A 4CT4B 1HSZA 3L1IA 4KXLA 2ES4A 3E1GA 4GPBA 4IV0A 1GY8A 3MAJA 3WQHA 1X8LA 4TMZA 4RDHA 1CCWA 3RAEC 5FPQA 3C6QA 2BQRA 1H1LA 5TB5A 5C8YA 2FZKA 5BWMA 4G5HA 3HK2A 4OAQA 3FH0A 1NBOA 3HR7A 2PEZA 3D6JA 4LCBA 4GP9A 3AHDA 1SCUB 4NYMR 3WYFA 2AU0A 4QTXA 3UB2A 3OAAD 4GOJA 5CA0B 1IBMB 2O9JA 3AR2A 4DQDA 3R6GA 4J0EA 1A7AA 4QDOA 3TW8B 3X2FA 3Q3GE 4HNSA 3OUTA 2EG9A 2PL3A 4QE3A 1T4DA 2DBZA 3PQ5A 4A26A 4AMZA 4WZ6A 4B6EA 1Y3HA 2DFKB 3RJ5A 5LDHA 3A9VA 3GEDA 4PXAA 1EK2A 2J07A 4N7JA 1X92A 2FMHA 1V8OA 2PMCA 3RB8A 2WFZA 4JITA 5C1PA 3EEFA 1ZM9A 4OM8A 1X8KA 1GTVA 4ECWA 3PYXA 2XSZA 4AULA 2XXAA 2G0TA 3CVOA 3LUCA 3CPEA 2WF7A 1RBZA 4CMFA 3WLPA 3VH2A 4B3DA 3PR1A 3EIXA 4O84A 3LGXA 4OXQA 5FV4A 4ZRNA 1DKNA 3X2SA 2DABA 4TLMB 1P39A 3X1WA 1WXWA 4G36A 3N75A 3PTZA 3TTYA 3AI7A 1M6VB 1M3SA 3ZY2A 2AUTA 1YI8A 1U0LA 1W52X 2D0PB 3U81A 2WSSA 2PZJA 3DBOB 4XB2A 3B5JA 3OJLA 5HF5A 4FSDA 3MTIA 1U9JA 2NU9A 3GLHB 4FDUA 3R0ZA 4P80A 1XNRB 4XPIB 1SUCA 4BMCA 4YAIA 3A1CA 5HILA 1J2UA 3DZKA 5DCLA 1ILEA 4ZJZA 4YVFA 3R9KA 1WB4A 2A3NA 3PLNA 1GL3A 1A96A 1OX6A 4O7LA 4XRGA 1TTHA 4JX9A 4DV1B 4EGAA 4MR9A 4YV1A 2B8WA 1MIHA 5EE0A 1O87A 2OE2A 1H8HA 5BYBA 1A4RA 1W25A 3V5NA 5FUXA 1U28A 2EIYA 521PA 4I2NA 2IYVA 2Z0MA 5IMBA 1UPXA 2J46A 2BZ1A 2QTHA 1ICIA 1SKYE 1WCYA 3H5RA 1BIFA 1HDYA 1BG6A 4QBIA 2G4CA 5E2BA 3D5EA 4MS1B 5C7YA 4LYYA 4R1PA 3KBOA 4YB8B 5DYYA 4D4JA 4EMTA 4HZUB 5IT4A 4WW0A 3TG8A 4KLZA 2C5AA 4WZBA 4RAZA 1RHUA 1YFJA 4X65B 3EWSA 5H83A 1M8KA 3ZCUA 1WUYA 3IUJA 5A0VA 1PD1A 4J1SA 4Z4IA 1G3MA 3IQWA 1NR1A 3ZV7A 4E07A 2B20A 2YC4C 2GR9A 1ZESA 1Z82A 4AJ2A 2Y77A 2Y2UA 2DVMA 1OH7A 2F1IA 3B6MA 1T24A 3DGEC 5TEWA 2FPPB 2FPLA 4O7NA 4Y1RB 3NM6B 9ABPA 2J3EA 3ZU2A 4Q4DA 4REOA 2PX6A 4KYUA 4WFIA 4X00A 4EB8A 4CL8A 1VLLA 1PLLA 1JE0A 4G0PA 1AK9A 4WXPA 2QP3A 4RMJA 5E1DA 3GQBB 1KEEA 1MAWA 2OHGA 2BQUA 1E1KA 2VAWA 2V3VA 2ZSHA 3FUWA 4MO2A 4XGKA 4NATA 2VDLB 2YOGA 2BUAA 3CX4A 3HCBA 3QWAA 2C5BA 1O03A 2VBCA 2ZWMA 2IYQA 1E7RA 3G85A 1PKXA 3LHSA 1XNJA 3P9ZA 1HURA 4C78A 1E5XA 1N2GA 4FE2A 1N5DA 1DAIA 4R7ZA 1SQSA 4Q3LA 3ND8A 1VOTA 4R16A 5HR5A 4NAUA 1LNSA 5IYZB 1JHVA 1OLXB 5GADl 3NIBA 3OSZA 4DLVA 4BATA 1ZRNA 4AF6A 5IBRA 5CBKA 5HA5A 2JA6A 2SCUA 4UHDA 2LCQA 4OA5A 2IEZA 1ZKDA 4X7RA 4CL3A 1KVSA 2CUTA 4U6QA 4LE2A 5DT2A 2NN3C 2AUNA 4HK4A 4JOSA 3V1MA 2DLNA 2C2XA 3U09A 3I64A 4Z9YA 1YZTA 4RF3A 1S2LA 4H3KB 5JNVA 3AKYA 4D3XA 4W99A 2O0KA 5TGDA 5BOSB 1Z6QA 3TNFA 5LB2A 3IS3A 4NS4A 2D8MA 2BFDA 4GC9A 2QRQA 4ZVMA 1AHNA 2Y1DA 3RB0A 3B2NA 2DF8A 4Q3EA 4ZQEA 1W47A 3KZCA 4TXHA 3WV5A 3O2NA 5B4VA 1GKLA 2G6TA 5E1MA 2FOIA 4RK7A 4WASA 1VCNA 2ZYRA 3T9FA 1UM8A 3HKDB 2IYYA 3CRRA 3NTQA 4WNAA 1SXJA 4IY1A 1E7WA 1ZOIA 1Z16A 2QD5A 5DKFA 5EJ8A 4DIEA 4UD6A 3FD8A 5HMLA 4OHBA 1A71A 4P35A 1ZMTA 3TTUA 3B3AA 3OHBA 3DZDA 4LV8B 3KYBA 2ZWVA 3DDOA 1VRWA 4R81A 5ECWA 1CERA 2HF9A 1SKAA 3Q9UA 1X80A 2ZS7A 1Z5PA 2A1UB 1D2GA 4GSYA 1V3TA 1IEQA 2QZJA 4H31A 3L92A 3WLAA 2WJZB 2OFWA 2XKKA 1JECA 1T8RA 4I8IA 2V6GA 1JXQA 4GLXA 4HN9A 5CB6A 1J56A 4WKCA 2W2MA 1DBWA 1T1RA 4ZFNA 3ZIAA 2VJOA 2QE7A 5BV8A 2G0AA 3F2VA 3O7WA 2Z4RA 4XOUA 5I5EA 1W94A 5KWEA 1IQ0A 4P82A 1FXSA 4I9FA 1N36B 4HDMA 1ADBA 3ZHXA 4M0LA 1KBOA 4F96A 3EZ7A 4MQUA 3HV2A 3I2JA 3LFHA 5D3ZA 2HFKA 1U0EA 4V0KA 1DSSG 2H8GA 1X7WA 3AFGA 3MELA 4X45A 3LL4A 3UYLA 2NTYC 4IFIA 5DGIA 4HAYA 4IAJA 3OIUA 3WMEA 1K86A 4GI5A 1UKBA 2PKYX 1QO9A 3AR7A 1ZYUA 3DOFA 2Q50A 2QL9A 1IY8A 1YBFA 2I1WA 1J39A 3U54A 3R6WA 3R5FA 5FUBA 5LA6B 2HU7A 1JKJB 5CP8A 4F46A 4XDGA 2GF9A 3WISA 2CKDA 1MVNA 3EOBI 3PA6A 4MCIA 3ELYA 4HWPA 3UF0A 3IX7A 3D6TB 2WM2A 3QSYA 3ZV6A 1HA3A 2C35B 2G1KA 1UK9A 1VKRA 1SVKA 3KFLA 4YMHA 1MTZA 4KQMA 3ETDA 2WMYA 2ZVDA 1E7SA 1FRVA 1MAUA 1ULHA 3TLGB 2GXSA 1JBQA 3HXPA 5I7FA 4DR6B 1MC8A 2HVSA 2JEIA 3V1NA 1XDBA 4KWCA 4YV0A 1D8TA 5TPWA 2FSFA 3TLEA 2ERXA 1U3VA 4E6EA 4KH0A 1SCKA 1GQYA 2R6FA 1BD3A 1Z9BA 4BASA 1CJVC 3MBKA 3TRIA 4QYWA 3O0TA 4GMKA 5BV0A 5LBUA 4RPIA 1E2UA 2CLHB 2QG6A 1CF9A 3PEVA 4KRFA 3B5IA 3W06A 1AQUA 4A0RA 4CTMA 3K92A 4P4TA 3E5RA 4DUGD 1A7UA 3KPYA 3U37A 1G18A 4LZPA 2XCRB 2XOXA 3G02A 3SSMA 3UWDA 3SI7A 4OPMA 4E5PA 3E1KA 3AM4A 1ZVQA 1VL8A 2VQFH 4FHFA 2IODA 4I66A 4KPEC 3N53A 1WA5A 1CQZA 3VSCA 5HKLA 2FMFA 3FPCA 2VDWB 3L2OB 4DV4B 3BMCB 2Q28A 3DQZA 5HIJA 2I91A 2IU6A 4KQWA 4BU1A 4R5HA 5JUWA 1PK7A 4I55F 4QRIA 3GIWA 1NXVA 3VZDA 2F2TA 1DPFA 2VJLA 5AJZA 4DNFA 3QRWA 3BUSA 4OLJA 3EPJA 3HA2A 4B3MH 3ZLBA 3NBYB 4TLLB 4Q4AA 2WP0A 2GN2A 3DMHA 1KH3A 3O9ZA 4DLZA 3SLKA 1RU3A 4F60A 3R0XA 4BO8A 2UUCB 1GA6A 2FP3A 3TOVA 3UK7A 3HJTA 4CF6A 3Q11A 4QXOA 1YS6A 2NVUB 1ZD3A 3IUMA 4KXVA 5KO2A 3HJNA 3NH9A 3TPFA 4JLMA 1WMAA 1M2VB 1MZVA 3ESDA 1EUQA 5F33A 5C3UA 4KITB 3OEEA 3HMKA 3RVJA 3ACBA 2AXPA 2QMOA 4U1RA 4A3EG 3EC7A 3BILA 1W48A 2A4MA 3FIUA 4L3WA 2GBIA 2PMZE 2P40A 2AMLA 4MO9A 5AJYA 2JA5A 5EXEA 4U4AA 1FP4B 3UFXB 2H1WA 3CUTA 3E1SA 4WKGA 1V5FA 4D46A 8LDHA 2Q3EA 2WWHA 4C7VA 4JXUA 4PLZA 1CUYA 1S68A 2X8WA 5LBIA 3K5IA 4NC9A 3F6RA 3W2FA 1DBIA 2HVQA 3G9TA 4I4NA 3UMGA 4QU9A 3STXA 4IJKA 5A4AA 1EK6A 1XDDA 1X0VA 1MC1A 4A3GG 3CMCO 3OP4A 3KKOA 2C2GA 3DWIA 3IPAA 3RROA 2QLNA 2WD8A 3HKBB 3HOWG 3VDQA 4NHOA 1XKTA 4HYKA 3TXAA 3VX3A 3DOHA 2DPYA 2WF8A 3M1AA 1Y4UA 4ILKA 3SSOA 1EGVB 1WUHS 4KN6A 2EP5A 4DV7B 5FFMA 3M9LA 1TMYA 3O47A 3CPSA 1JDJA 3AMVA 3OE7D 5EQTA 1DTEA 1GG5A 1YQDA 3S1AB 2Y05A 2WMOB 3FDZA 1JIKA 1SC6A 1KJNA 4V1CB 4GSKA 5KTSA 4JV2A 2W93A 2HV9A 5KKCA 1Q44A 5AJXA 4FS1A 4JEIA 1JU3A 3L05A 2ONCA 3JQEA 3C7AA 2PS3A 4HGQA 1UJCA 3CHYA 3W1GA 4OSPA 4NBSA 1Q91A 1YA6A 4FGKA 1U8AA 1XUOA 4ECVA 3GFBA 2X0KA 4E2ZA 4AJPA 4CEHB 3G0GA 4EG5A 4QTUB 2Q5OA 2H48A 4M7RA 2O8FB 2H1RA 1OA0A 3WGYA 3RS2A 1ZBQA 1P6UA 3HVJA 4E09A 2V0NA 1RAIA 3NHSA 4GXRA 5J2TA 4JUDX 2ILTA 4ED3A 5FADA 1EH5A 4F2DA 3E7FA 4ZYXA 1PJ4A 5CVCA 1GM5A 4J76A 4Y2PA 5IDQA 3LCRA 5AVQA 2XVXA 4XJXA 4C6TA 3LXXA 1G98A 5KOJA 4NBLA 3T9BA 2EHDA 1Q1ZA 3DMYA 3CVZA 4QFDA 1RI2A 4UHKA 3OZFA 4PYLA 1ZD5A 2FZEA 3U9LA 1WPRA 2ZVJA 1BRMA 4OXIA 2NUPA 2ZI4A 1QVRA 5HFAA 3T0GA 4GLLA 2WV7A 2YWXA 3K8ZA 1L8XA 3F67A 2Q1TA 3RI3A 3JALA 1YJCA 3BE4A 2BGIA 2Y2VA 2FW7A 2H0RA 1BTOA 4LFAB 2AN1A 4O4HB 3HI4A 1R8YA 3DZBA 4I5GA 3S70A 4PZDA 3ZVRA 3VUEA 4A2BA 4M3NA 1J24A 1O6FA 4AS3A 1Z4JA 5AHRA 4N3CA 1OPRA 4CKEA 4G5GA 5CFOA 3JR7A 1EDOA 3FFBA 1BOOA 1PVVA 3PSAA 1S2NA 3LNTA 1LUAA 4ZXPA 5TXGA 3ONDA 3ETEA 4MH0R 2ZUTA 1Y5LA 2YVQA 4IRUB 3OEWA 4ECAA 2GT1A 3SE0A 2ECQA 5FI3A 2I1VB 2I4IA 2P90A 1RHKA 4FI3F 4OO3A 3PRYA 4NSNA 3BRCA 2HQ1A 2OV1A 4PYJA 3T5GA 2Z09A 1Q7TA 4MS3A 3FWPA 4U2EA 2OFPA 4ZCLA 1GXSB 1RQXA 3QKSA 2W58A 3VV2A 1B26A 3DONA 3T7EA 4GKVA 1G4AE 4UAVA 3IQHX 4EO4A 3CZ4A 1X94A 3L7LA 2PSFA 4TV9F 2BTQA 1GGFA 2VDQB 1E62A 4DLPA 3JQGB 2CXHA 1UMKA 3T6KA 2W98A 1XVIA 2IEDA 5CUQA 1CG6A 4AMGA 1FJGH 4ED9A 1R6DA 2AFHA 5I5GA 4F4WA 1U7WA 5LL6b 5B7GA 1IHXA 4G86A 4G97A 4B0OA 3F6EX 2I22A 2JGKA 1TOAA 1L7AA 4BJ6A 4HXFB 1R5NA 5LM3A 2WNIA 4TMFA 2VJBA 4JSYA 2R2AA 1VL1A 5ETJA 4YMIA 4RFSB 4BP1A 4JD5A 2FCAA 1RQPA 4B43A 4JWTA 2PHZA 1NNLA 4E2YA 4HDKA 1TX4B 4ARZA 1JH8A 5JMPA 3M70A 1JEOA 2C3YA 1Q7BA 1GR0A 1ODTC 4Y9RA 1LJLA 4G1MB 5DW3A 1XL0A 4CLEA 3ML1A 2BGNA 2C07A 2OB1A 4F06A 2HQRA 1VLVA 3FKIG 4MTEA 2ZUUA 5D1HA 1KI1A 3NHLA 3JD4A 3O2JA 4PN7A 3NKLA 4AIRA 2J9XB 5ITZA 1HDEA 2BOVA 4DCOA 4MR9B 4B6PA 3L06A 4P3KA 2O54A 3U3XA 4DUZH 4NNJA 3DVQX 4J2TA 3O2SB 4B09A 4C3UA 3TUJC 3QXGA 1FFWA 4C20A 4M7PA 1WZCA 4QHTA 4Z5XA 3ZE8A 3TMYA 1CR2A 1TZJA 3IEXA 4PC7A 1KC7A 1DMSA 1C8VB 3JVEA 1PI3A 5IVHA 2RSLA 1HT1E 1E66A 3OQOA 4TKUB 2KWIA 1OBCA 1SCUA 3EXIB 1VTKA 5CA0A 2W2PA 1WB5A 4EFNA 1S1MA 3TW8A 1QV6A 2AN9A 3LWBA 2XBMA 3ET5A 3H5AA 1FFSA 1Y4SA 3T94A 1G7RA 2G06A 4NU8X 4BP8A 1VBMA 2VPXA 4ZAWA 3P2EA 3KEQA 4IQGA 2NSHA 3E7DA 2VHXA 4A6PA 1JFLA 1OU0A 2FSSA 3LHKA 4LMYA 2CFCA 2RF4A 3GA7A 5HZKA 4AD8A 2IZ5A 3QE9Y 1PAUA 2Q6OA 4RHYA 1AU9A 1SBZA 5G1OA 1PJ8A 2HY7A 2ID9A 4UM8B 3DEKA 3KAQA 4X9XA 1U81A 4TVOA 2IPMA 4AYTA 3RK4A 4DIMA 3U7JA 1EAYA 3VU0A 1M8PA 4LDJA 4GPTA 2EGGA 4AP5A 3LWZA 2WSBA 3I42A 4DADA 3DDNA 3QEMB 1M6VA 1NUAA 2LDXA 2DHDA 3O4IA 1PF7E 1HPLA 2JFQA 3DTTA 2E2WA 2CD9A 1LX7A 3TLMA 4AQYB 4TX1A 4H6WA 5KHOC 4F9EA 1LVHA 3L93A 2C9CA 3RKUA 4QT0A 4IX9A 2ZUVA 3GLHA 3VH1A 4HZGA 1NPDA 4XPIA 3A7DA 3KBBA 1Z2CA 3KX2A 2HYIC 5EPOA 2Q9CA 3U5TA 3PWZA 1XSEA 3ANNA 4XWOA 4PGAA 1L4BA 3PUHA 2FPRA 3GLRA 4I81A 1O96B 2BM0A 5BN4B 2FQ1A 4RDCA 3GEGA 1UMCB 4BTVA 3PC3A 1DDIA 3UH1A 5FWNA 4G2NA 1Z7YA 5HG0A 4RKQA 3KYCB 3OH8A 3Q7QA 4DABA 4DUYB 3PQ3A 4HAZA 5LOVF 5T8KC 1VBFA 3ZZTA 2TECE 2JARA 4F4JA 4WKBA 4YS6A 4MS1A 3AXSA 1CNEA 1OWLA 4XDZA 1JDSA 3GN2A 2ZJZA 2D2XA 4YB8A 4HZUA 4H17A 4J3NA 5D3KA 1LCIA 3BB1A 3L04A 3HBAA 1N5KA 3STYA 4DCNA 1I94H 4HH1A 1RDFA 5EWFA 2NV2B 5DGAA 1XE3A 3UUWA 1V4BA 4QGFA 3ZY6A 4YGYA 5I4CA 3FTEA 3B3JA 2ZYWX 1UNNC 4FLFA 2FPPA 2RDIA 4Y1RA 5IKMA 4ED8A 5JC1A 2AXQA 4Y6PA 3D7SA 3RS3A 5B4UA 1CIJA 3NIDB 3AUJB 3WK5A 1XMJA 4E4RA 2CXRA 1CFJA 1NAIA 2WLTA 3B1JA 1ZVVA 2CHGA 3GQBA 3GJTA 1BJKA 4HO1X 3GVPA 3P0IA 2IDMA 3J81A 3N0VA 3BQNB 4CDRA 4QAJA 1N5JA 4OX9B 4AMUA 4KRGA 5TT1A 1PBNA 4MLCA 2Q8NA 5J43A 1B15A 1NL3A 4ZODA 1O6CA 3U7RA 3E2MA 1V7CA 4TVBA 5DNCA 1YJXA 4XD7A 2PH5A 1E5TA 4RH1A 5FORA 2OK8A 3K0FB 3E70C 4JLAA 2YRFA 4IKEA 4RH3A 4O4JA 4EHKA 4G09A 1OLXA 4NK4A 5SZJA 4FDVA 3W4JA 3D3JA 1I4LD 1JA1A 1UDCA 3GGCA 3KREA 1HDIA 1R5OA 3JTEA 3AIMA 3Q5EA 1N6HA 3C3BA 3P9YA 4Y67A 4YT8A 1N8TA 4Z4EA 1UK8A 1LK0A 3Q8XB 4PWYA 4U8HA 3MQ4A 2PUVA 1FRNA 3D4PA 4BAUA 2UXCH 5DEOA 4MV9A 4L8YA 5CVUA 1OV4A 5BOSA 5ILOA 1I3NA 3VHRA 1PU2A 1MIOB 3SX4A 2EFEB 3LQ1A 3BL8A 3Q3EA 3KUUA 3NWPA 5EWJB 1ULSA 4HLQB 2D2FA 3PYMA 1HI9A 4EPWA 3SNKA 4LJSA 4A8PA 2ZI3A 4HF7A 3OWHA 3K7EA 5EMMA 4RLFA 2QSUA 3ROKA 1TU3A 3HKDA 5AOVA 1VKZA 4ZCQA 4JLPA 5FPTA 5FRDA 4QM6A 1UOOA 1DBVO 1O6GA 3ZJTA 1QZ3A 1LWNA 2PFKA 4HPWA 4M8SA 4AP9A 2VSOA 5K6TA 4LDZA 2IZ7A 2VRNA 1OMOA 3RR2A 4NZZA 4IH1A 3REOA 1NF3A 1XRNA 4ZV7A 3A11A 4KAFA 2IOFA 1RJPA 4MVWA 3MTQA 1KF0A 2LUOA 2X6TA 5A4DA 1F6WA 2A1UA 3FX2A 3N8DA 2IBSA 2IQIA 3DXZA 3HP4A 4RHTA 5FO0A 4ZVTA 2ZYTX 2XQFA 2WINI 4BFVA 5ALTA 4BIMA 2A0XA 1VKOA 2PX3A 2ZP1A 4N7RA 4XFKA 4FB4A 3QNWA 1NI4B 4OF4A 2C8VA 3ABOB 9GPBA 2PK3A 2OZLA 3B82A 5D6NA 2RDMA 1E4VA 1KFJB 4TMYA 4B48A 5DHTA 3SEZA 1H2AS 1PEKE 2Z08A 1JJFA 5DMHA 1UAGA 3PPIA 1RQLA 2NO4A 4ZHSA 1RK5A 4DQVA 4INAA 1HYBA 4DSZA 4QVKA 4MQBA 5DP1A 2DFPA 5SZIA 2FJPA 4FUQA 3V8RA 2AA3A 4R1LA 2BDUA 2O23A 4Q3OA 4I5EA 3BHMA 3K1AB 4IDNA 4FMDF 1SK9A 4YY3B 1QAQA