3KAZA

Crystal structure of abscisic acid receptor pyl2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
175
structure length
175
Chain Sequence
SEQKTLEPVIKTYHQFEPDPTTCTSLITQRIHAPASVVWPLIRRFDNPERYKHFVKRCRLISGDGDVGSVREVTVISGLPASTSTERLEFVDDDHRVLSFRVVGGEHRLKNYKSVTSVNEFLNQDSGKVYTVVLESYTVDIPEGNTEEDTKMFVDTVVKLNLQKLGVAATSAPMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein At2g26040
publication title Agate-latch-lock mechanism for hormone signalling by abscisic acid receptors
rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 45
structure length 175
sequence length 175
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3kazA00
4A8GA 3E85A 4A86A 4A80A 5JO2A 3TVQA 3C0VA 2L9PA 4WVOA 4A81A 1QMRA 3IJTA 1VJHA 2RERA 3KDHA 5E4MA 2I9YA 3KDJA 2VQ5A 5I9JA 3NEFA 3PU2A 2R55A 4IGVA 3Q63A 3KLXA 3UQHA 3OQUA 1LLTA 2E3MA 2LIOA 2FFSA 3KB3A 1JSSA 2E3PA 4QIPA 5E4DA 3H3TA 3KAYA 3NS2A 2KF2A 4GY9A 4IGYA 4A88A 3TFZA 3H3QA 3NJ1A 4JHIA 1FSKA 2D4RA 2A1LA 1LN3A 3RT0C 5JO1A 3Q64A 1LN1A 2LGHA 2Z9ZA 3K3KA 3KDIA 2KCZA 4IGWA 4LG5A 4C9IA 2NN5A 1EM2A 2LDKA 2IL5A 4LGBA 1XFSA 2LCGA 4DSBA 2WQLA 3IE5A 3UIDA 3W9KA 1UW5A 3WG8A 4MAPA 1XN6A 5BRLA 3TL1A 3NEGA 3TVRA 1TXCA 2LPXA 2LEQA 3NR4A 2M47A 4RYVA 4DS8A 1E09A 2LUZA 1XUVA 4REIA 1B6FA 1T27A 1Z94A 3KL1A 3NMNA 2Q3QA 3RD6A 4BKCA 4JDLA 4A85A 1BTVA 1IFVA 3NMTA 3QSZA 4DSCA 2REZA 1KCMA 4R7KA 3OH8A 3CNWA 2BK0A 3GGNA 3H3SA 4OICA 3NI8A 4A8UA 3NMPA 2L65A 4LGAA 2K5GA 4LA7A 4MA6A 3W9RA 4A8VA 5JNNA 2Z9YA 2L8OA 2NS9A 3P0LA 5I8FA 4PSBA 5AMWA 2KTEA 5C9YA 3NJOA 2E3NA 2RESA 4XRTA 2GKDA 2MOUA 2N4AA 4JHGA 4Q0KA 4BKDA 4REJA 4N0GC 2N4BA 3OJIA 4C94A 2LE1A 2QPVA 4A84A 4JDAA 1X53A 3KAZA 4FPWA 1ZXFA 3P9VA 4A83A 2EJXA 4IH0A 1H2OA 2E3SA 4M9BA 4REHA 4XRWA 4BK7A 4A87A 1LN2A 3ELIA 2E3QA 2PCSA 2QIMA 4Z3LA 1T17A 3UJLA 3NMHA 2FLHA 3K90A 2E3RA 3FO5A 3QN1A 3ZVUA 1BV1A 3F08A 3JRQB 3JRSA 3NJ0A 3R6PA 5E46A 2VNEA 1ICXA 2M89A 4M9WA 3NMVA 4N3EA 2LF2A 1XDFA 3KB0A 3PUTA 4IHRA 4IH2A 3P51A 4Y31A 5E4BA 3RT2A 4BTZA 2LAKA 4IGXA 1FM4A 4BK6A 1TW0A 2K7HA 4MNSA 2KEWA 3Q6AA 2PSOA 2E3OA 4C9CA 3OTLA 4JHHA 3H3RA 4B9RA 1XN5A
chains in the Genus database with same CATH superfamily
4A8GA 3E85A 4KPYA 3HK2A 4A86A 4A80A 5JO2A 3TVQA 3C0VA 3GB4A 2L9PA 4WVOA 4A81A 1QMRA 3GTEA 3IJTA 1VJHA 2RERA 4N47A 3KDHA 5E4MA 2I9YA 3KDJA 2VQ5A 5I9JA 3HM9A 3NEFA 3PU2A 2R55A 4IGVA 3HXMA 3Q63A 3KLXA 3UQHA 3OQUA 1LLTA 2E3MA 2LIOA 2FFSA 3KB3A 1JSSA 2E3PA 4QIPA 5E4DA 3H3TA 3HO1A 3KAYA 3NS2A 4QCKA 2KF2A 4GY9A 4IGYA 3F73A 4A88A 3TFZA 3H3QA 3HJFA 3NJ1A 4JHIA 1FSKA 2D4RA 3GKEA 2A1LA 1LN3A 3RT0C 5JO1A 3Q64A 1LN1A 2LGHA 2Z9ZA 2LAFA 3K3KA 2KCZA 3KDIA 4IGWA 4LG5A 4C9IA 2NN5A 1EM2A 2LDKA 2IL5A 3DLBA 4LGBA 1XFSA 2LCGA 4DSBA 3GL2A 2WQLA 3IE5A 3UIDA 3W9KA 1UW5A 3WG8A 4MAPA 1XN6A 5BRLA 3TL1A 3NEGA 4QDCA 3TVRA 1TXCA 2LPXA 2LEQA 3NR4A 2M47A 4RYVA 4DS8A 1E09A 2LUZA 1XUVA 4REIA 3GOBA 1B6FA 1T27A 1Z94A 3KL1A 3NMNA 2Q3QA 3RD6A 4BKCA 4JDLA 4A85A 5EKQC 1BTVA 1IFVA 3NMTA 3QSZA 4DSCA 3NQNA 2REZA 1KCMA 4R7KA 3OH8A 4N41A 3TGOC 3CNWA 2BK0A 3GGNA 3H3SA 4OICA 3NI8A 4A8UA 4QDFA 3DLHA 3NMPA 2L65A 4LGAA 2K5GA 4LA7A 4MA6A 3W9RA 4A8VA 5JNNA 2Z9YA 2L8OA 2NS9A 3P0LA 5I8FA 4PSBA 5AMWA 2KTEA 5C9YA 3NJOA 2E3NA 2RESA 4XRTA 2GKDA 3HVRA 2MOUA 2N4AA 4JHGA 4Q0KA 4BKDA 4REJA 4N0GC 4QDFB 2N4BA 3OJIA 4C94A 4E6FA 2LE1A 2QPVA 4A84A 4JDAA 1X53A 3KAZA 4FPWA 1ZXFA 3P9VA 4A83A 4NCAA 2EJXA 4IH0A 1H2OA 2E3SA 4M9BA 4REHA 2YH6A 4XRWA 4A87A 1LN2A 4BK7A 3ELIA 2E3QA 2PCSA 2QIMA 4Z3LA 1T17A 3UJLA 3NMHA 2FLHA 3K90A 2E3RA 3FO5A 3QN1A 3ZVUA 1BV1A 3F08A 3JRQB 3JRSA 3NJ0A 3R6PA 5E46A 2VNEA 1ICXA 2M89A 3GTSA 4M9WA 3NMVA 4N3EA 4NCBA 2LF2A 4QDDA 1XDFA 3KB0A 3PUTA 4IHRA 4IH2A 3P51A 4Y31A 5E4BA 3RT2A 4BTZA 2LAKA 4IGXA 1FM4A 4BK6A 1TW0A 2K7HA 4MNSA 4N76A 2KEWA 3GL0A 3Q6AA 2PSOA 2ZYLA 2E3OA 4C9CA 3OTLA 4JHHA 3H3RA 4JHYA 4B9RA 1XN5A
chains in the Genus database with same CATH topology
4A8GA 3E85A 4KPYA 3HK2A 4A86A 4A80A 5JO2A 3TVQA 3C0VA 3GB4A 2L9PA 4WVOA 4A81A 1QMRA 3GTEA 3IJTA 1VJHA 2RERA 4N47A 3KDHA 5E4MA 2I9YA 3KDJA 2VQ5A 5I9JA 3HM9A 3NEFA 3PU2A 2R55A 4IGVA 3HXMA 3Q63A 3KLXA 3UQHA 3OQUA 1LLTA 2E3MA 2LIOA 2FFSA 3KB3A 1JSSA 2E3PA 4QIPA 5E4DA 3H3TA 3HO1A 3KAYA 3NS2A 4QCKA 2KF2A 4GY9A 4IGYA 3F73A 4A88A 3TFZA 3H3QA 3HJFA 3NJ1A 4JHIA 1FSKA 2D4RA 3GKEA 2A1LA 1LN3A 3RT0C 5JO1A 3Q64A 1LN1A 2LGHA 2Z9ZA 2LAFA 3K3KA 2KCZA 3KDIA 4IGWA 4LG5A 4C9IA 2NN5A 1EM2A 2LDKA 2IL5A 3DLBA 4LGBA 1XFSA 2LCGA 4DSBA 3GL2A 2WQLA 3IE5A 3UIDA 3W9KA 1UW5A 3WG8A 4MAPA 1XN6A 5BRLA 3TL1A 3NEGA 4QDCA 3TVRA 1TXCA 2LPXA 2LEQA 3NR4A 2M47A 4RYVA 4DS8A 1E09A 2LUZA 1XUVA 4REIA 3GOBA 1B6FA 1T27A 1Z94A 3KL1A 3NMNA 2Q3QA 3RD6A 4BKCA 4JDLA 4A85A 5EKQC 1BTVA 1IFVA 3NMTA 3QSZA 4DSCA 3NQNA 2REZA 1KCMA 4R7KA 3OH8A 4N41A 3TGOC 3CNWA 2BK0A 3GGNA 3H3SA 4OICA 3NI8A 4A8UA 4QDFA 3DLHA 3NMPA 2L65A 4LGAA 2K5GA 4LA7A 4MA6A 3W9RA 4A8VA 5JNNA 2Z9YA 2L8OA 2NS9A 3P0LA 5I8FA 4PSBA 5AMWA 2KTEA 5C9YA 3NJOA 2E3NA 2RESA 4XRTA 2GKDA 3HVRA 2MOUA 2N4AA 4JHGA 4Q0KA 4BKDA 4REJA 4N0GC 4QDFB 2N4BA 3OJIA 4C94A 4E6FA 2LE1A 2QPVA 4A84A 4JDAA 1X53A 3KAZA 4FPWA 1ZXFA 3P9VA 4A83A 4NCAA 2EJXA 4IH0A 1H2OA 2E3SA 4M9BA 4REHA 2YH6A 4XRWA 4A87A 1LN2A 4BK7A 3ELIA 2E3QA 2PCSA 2QIMA 4Z3LA 1T17A 3UJLA 3NMHA 2FLHA 3K90A 2E3RA 3FO5A 3QN1A 3ZVUA 1BV1A 3F08A 3JRQB 3JRSA 3NJ0A 3R6PA 5E46A 2VNEA 1ICXA 2M89A 3GTSA 4M9WA 3NMVA 4N3EA 4NCBA 2LF2A 4QDDA 1XDFA 3KB0A 3PUTA 4IHRA 4IH2A 3P51A 4Y31A 5E4BA 3RT2A 4BTZA 2LAKA 4IGXA 1FM4A 4BK6A 1TW0A 2K7HA 4MNSA 4N76A 2KEWA 3GL0A 3Q6AA 2PSOA 2ZYLA 2E3OA 4C9CA 3OTLA 4JHHA 3H3RA 4JHYA 4B9RA 1XN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A8G A;  3E85 A;  4A86 A;  4A80 A;  5JO2 A;  3TVQ A;  3C0V A;  2L9P A;  4WVO A;  4A81 A;  1QMR A;  3IJT A;  1VJH A;  2RER A;  3KDH A;  5E4M A;  2I9Y A;  3KDJ A;  2VQ5 A;  5I9J A;  3NEF A;  3PU2 A;  2R55 A;  4IGV A;  3Q63 A;  3KLX A;  3UQH A;  3OQU A;  1LLT A;  2E3M A;  2LIO A;  2FFS A;  3KB3 A;  1JSS A;  2E3P A;  4QIP A;  5E4D A;  3H3T A;  3KAY A;  3NS2 A;  2KF2 A;  4GY9 A;  4IGY A;  4A88 A;  3TFZ A;  3H3Q A;  3NJ1 A;  4JHI A;  1FSK A;  2D4R A;  2A1L A;  1LN3 A;  3RT0 C;  5JO1 A;  3Q64 A;  1LN1 A;  2LGH A;  2Z9Z A;  3K3K A;  3KDI A;  2KCZ A;  4IGW A;  4LG5 A;  4C9I A;  2NN5 A;  1EM2 A;  2LDK A;  2IL5 A;  4LGB A;  1XFS A;  2LCG A;  4DSB A;  2WQL A;  3IE5 A;  3UID A;  3W9K A;  1UW5 A;  3WG8 A;  4MAP A;  1XN6 A;  5BRL A;  3TL1 A;  3NEG A;  3TVR A;  1TXC A;  2LPX A;  2LEQ A;  3NR4 A;  2M47 A;  4RYV A;  4DS8 A;  1E09 A;  2LUZ A;  1XUV A;  4REI A;  1B6F A;  1T27 A;  1Z94 A;  3KL1 A;  3NMN A;  2Q3Q A;  3RD6 A;  4BKC A;  4JDL A;  4A85 A;  1BTV A;  1IFV A;  3NMT A;  3QSZ A;  4DSC A;  2REZ A;  1KCM A;  4R7K A;  3OH8 A;  3CNW A;  2BK0 A;  3GGN A;  3H3S A;  4OIC A;  3NI8 A;  4A8U A;  3NMP A;  2L65 A;  4LGA A;  2K5G A;  4LA7 A;  4MA6 A;  3W9R A;  4A8V A;  5JNN A;  2Z9Y A;  2L8O A;  2NS9 A;  3P0L A;  5I8F A;  4PSB A;  5AMW A;  2KTE A;  5C9Y A;  3NJO A;  2E3N A;  2RES A;  4XRT A;  2GKD A;  2MOU A;  2N4A A;  4JHG A;  4Q0K A;  4BKD A;  4REJ A;  4N0G C;  2N4B A;  3OJI A;  4C94 A;  2LE1 A;  2QPV A;  4A84 A;  4JDA A;  1X53 A;  3KAZ A;  4FPW A;  1ZXF A;  3P9V A;  4A83 A;  2EJX A;  4IH0 A;  1H2O A;  2E3S A;  4M9B A;  4REH A;  4XRW A;  4BK7 A;  4A87 A;  1LN2 A;  3ELI A;  2E3Q A;  2PCS A;  2QIM A;  4Z3L A;  1T17 A;  3UJL A;  3NMH A;  2FLH A;  3K90 A;  2E3R A;  3FO5 A;  3QN1 A;  3ZVU A;  1BV1 A;  3F08 A;  3JRQ B;  3JRS A;  3NJ0 A;  3R6P A;  5E46 A;  2VNE A;  1ICX A;  2M89 A;  4M9W A;  3NMV A;  4N3E A;  2LF2 A;  1XDF A;  3KB0 A;  3PUT A;  4IHR A;  4IH2 A;  3P51 A;  4Y31 A;  5E4B A;  3RT2 A;  4BTZ A;  2LAK A;  4IGX A;  1FM4 A;  4BK6 A;  1TW0 A;  2K7H A;  4MNS A;  2KEW A;  3Q6A A;  2PSO A;  2E3O A;  4C9C A;  3OTL A;  4JHH A;  3H3R A;  4B9R A;  1XN5 A; 
#chains in the Genus database with same CATH topology
 4A8G A;  3E85 A;  4KPY A;  3HK2 A;  4A86 A;  4A80 A;  5JO2 A;  3TVQ A;  3C0V A;  3GB4 A;  2L9P A;  4WVO A;  4A81 A;  1QMR A;  3GTE A;  3IJT A;  1VJH A;  2RER A;  4N47 A;  3KDH A;  5E4M A;  2I9Y A;  3KDJ A;  2VQ5 A;  5I9J A;  3HM9 A;  3NEF A;  3PU2 A;  2R55 A;  4IGV A;  3HXM A;  3Q63 A;  3KLX A;  3UQH A;  3OQU A;  1LLT A;  2E3M A;  2LIO A;  2FFS A;  3KB3 A;  1JSS A;  2E3P A;  4QIP A;  5E4D A;  3H3T A;  3HO1 A;  3KAY A;  3NS2 A;  4QCK A;  2KF2 A;  4GY9 A;  4IGY A;  3F73 A;  4A88 A;  3TFZ A;  3H3Q A;  3HJF A;  3NJ1 A;  4JHI A;  1FSK A;  2D4R A;  3GKE A;  2A1L A;  1LN3 A;  3RT0 C;  5JO1 A;  3Q64 A;  1LN1 A;  2LGH A;  2Z9Z A;  2LAF A;  3K3K A;  2KCZ A;  3KDI A;  4IGW A;  4LG5 A;  4C9I A;  2NN5 A;  1EM2 A;  2LDK A;  2IL5 A;  3DLB A;  4LGB A;  1XFS A;  2LCG A;  4DSB A;  3GL2 A;  2WQL A;  3IE5 A;  3UID A;  3W9K A;  1UW5 A;  3WG8 A;  4MAP A;  1XN6 A;  5BRL A;  3TL1 A;  3NEG A;  4QDC A;  3TVR A;  1TXC A;  2LPX A;  2LEQ A;  3NR4 A;  2M47 A;  4RYV A;  4DS8 A;  1E09 A;  2LUZ A;  1XUV A;  4REI A;  3GOB A;  1B6F A;  1T27 A;  1Z94 A;  3KL1 A;  3NMN A;  2Q3Q A;  3RD6 A;  4BKC A;  4JDL A;  4A85 A;  5EKQ C;  1BTV A;  1IFV A;  3NMT A;  3QSZ A;  4DSC A;  3NQN A;  2REZ A;  1KCM A;  4R7K A;  3OH8 A;  4N41 A;  3TGO C;  3CNW A;  2BK0 A;  3GGN A;  3H3S A;  4OIC A;  3NI8 A;  4A8U A;  4QDF A;  3DLH A;  3NMP A;  2L65 A;  4LGA A;  2K5G A;  4LA7 A;  4MA6 A;  3W9R A;  4A8V A;  5JNN A;  2Z9Y A;  2L8O A;  2NS9 A;  3P0L A;  5I8F A;  4PSB A;  5AMW A;  2KTE A;  5C9Y A;  3NJO A;  2E3N A;  2RES A;  4XRT A;  2GKD A;  3HVR A;  2MOU A;  2N4A A;  4JHG A;  4Q0K A;  4BKD A;  4REJ A;  4N0G C;  4QDF B;  2N4B A;  3OJI A;  4C94 A;  4E6F A;  2LE1 A;  2QPV A;  4A84 A;  4JDA A;  1X53 A;  3KAZ A;  4FPW A;  1ZXF A;  3P9V A;  4A83 A;  4NCA A;  2EJX A;  4IH0 A;  1H2O A;  2E3S A;  4M9B A;  4REH A;  2YH6 A;  4XRW A;  4A87 A;  1LN2 A;  4BK7 A;  3ELI A;  2E3Q A;  2PCS A;  2QIM A;  4Z3L A;  1T17 A;  3UJL A;  3NMH A;  2FLH A;  3K90 A;  2E3R A;  3FO5 A;  3QN1 A;  3ZVU A;  1BV1 A;  3F08 A;  3JRQ B;  3JRS A;  3NJ0 A;  3R6P A;  5E46 A;  2VNE A;  1ICX A;  2M89 A;  3GTS A;  4M9W A;  3NMV A;  4N3E A;  4NCB A;  2LF2 A;  4QDD A;  1XDF A;  3KB0 A;  3PUT A;  4IHR A;  4IH2 A;  3P51 A;  4Y31 A;  5E4B A;  3RT2 A;  4BTZ A;  2LAK A;  4IGX A;  1FM4 A;  4BK6 A;  1TW0 A;  2K7H A;  4MNS A;  4N76 A;  2KEW A;  3GL0 A;  3Q6A A;  2PSO A;  2ZYL A;  2E3O A;  4C9C A;  3OTL A;  4JHH A;  3H3R A;  4JHY A;  4B9R A;  1XN5 A; 
#chains in the Genus database with same CATH homology
 4A8G A;  3E85 A;  4KPY A;  3HK2 A;  4A86 A;  4A80 A;  5JO2 A;  3TVQ A;  3C0V A;  3GB4 A;  2L9P A;  4WVO A;  4A81 A;  1QMR A;  3GTE A;  3IJT A;  1VJH A;  2RER A;  4N47 A;  3KDH A;  5E4M A;  2I9Y A;  3KDJ A;  2VQ5 A;  5I9J A;  3HM9 A;  3NEF A;  3PU2 A;  2R55 A;  4IGV A;  3HXM A;  3Q63 A;  3KLX A;  3UQH A;  3OQU A;  1LLT A;  2E3M A;  2LIO A;  2FFS A;  3KB3 A;  1JSS A;  2E3P A;  4QIP A;  5E4D A;  3H3T A;  3HO1 A;  3KAY A;  3NS2 A;  4QCK A;  2KF2 A;  4GY9 A;  4IGY A;  3F73 A;  4A88 A;  3TFZ A;  3H3Q A;  3HJF A;  3NJ1 A;  4JHI A;  1FSK A;  2D4R A;  3GKE A;  2A1L A;  1LN3 A;  3RT0 C;  5JO1 A;  3Q64 A;  1LN1 A;  2LGH A;  2Z9Z A;  2LAF A;  3K3K A;  2KCZ A;  3KDI A;  4IGW A;  4LG5 A;  4C9I A;  2NN5 A;  1EM2 A;  2LDK A;  2IL5 A;  3DLB A;  4LGB A;  1XFS A;  2LCG A;  4DSB A;  3GL2 A;  2WQL A;  3IE5 A;  3UID A;  3W9K A;  1UW5 A;  3WG8 A;  4MAP A;  1XN6 A;  5BRL A;  3TL1 A;  3NEG A;  4QDC A;  3TVR A;  1TXC A;  2LPX A;  2LEQ A;  3NR4 A;  2M47 A;  4RYV A;  4DS8 A;  1E09 A;  2LUZ A;  1XUV A;  4REI A;  3GOB A;  1B6F A;  1T27 A;  1Z94 A;  3KL1 A;  3NMN A;  2Q3Q A;  3RD6 A;  4BKC A;  4JDL A;  4A85 A;  5EKQ C;  1BTV A;  1IFV A;  3NMT A;  3QSZ A;  4DSC A;  3NQN A;  2REZ A;  1KCM A;  4R7K A;  3OH8 A;  4N41 A;  3TGO C;  3CNW A;  2BK0 A;  3GGN A;  3H3S A;  4OIC A;  3NI8 A;  4A8U A;  4QDF A;  3DLH A;  3NMP A;  2L65 A;  4LGA A;  2K5G A;  4LA7 A;  4MA6 A;  3W9R A;  4A8V A;  5JNN A;  2Z9Y A;  2L8O A;  2NS9 A;  3P0L A;  5I8F A;  4PSB A;  5AMW A;  2KTE A;  5C9Y A;  3NJO A;  2E3N A;  2RES A;  4XRT A;  2GKD A;  3HVR A;  2MOU A;  2N4A A;  4JHG A;  4Q0K A;  4BKD A;  4REJ A;  4N0G C;  4QDF B;  2N4B A;  3OJI A;  4C94 A;  4E6F A;  2LE1 A;  2QPV A;  4A84 A;  4JDA A;  1X53 A;  3KAZ A;  4FPW A;  1ZXF A;  3P9V A;  4A83 A;  4NCA A;  2EJX A;  4IH0 A;  1H2O A;  2E3S A;  4M9B A;  4REH A;  2YH6 A;  4XRW A;  4A87 A;  1LN2 A;  4BK7 A;  3ELI A;  2E3Q A;  2PCS A;  2QIM A;  4Z3L A;  1T17 A;  3UJL A;  3NMH A;  2FLH A;  3K90 A;  2E3R A;  3FO5 A;  3QN1 A;  3ZVU A;  1BV1 A;  3F08 A;  3JRQ B;  3JRS A;  3NJ0 A;  3R6P A;  5E46 A;  2VNE A;  1ICX A;  2M89 A;  3GTS A;  4M9W A;  3NMV A;  4N3E A;  4NCB A;  2LF2 A;  4QDD A;  1XDF A;  3KB0 A;  3PUT A;  4IHR A;  4IH2 A;  3P51 A;  4Y31 A;  5E4B A;  3RT2 A;  4BTZ A;  2LAK A;  4IGX A;  1FM4 A;  4BK6 A;  1TW0 A;  2K7H A;  4MNS A;  4N76 A;  2KEW A;  3GL0 A;  3Q6A A;  2PSO A;  2ZYL A;  2E3O A;  4C9C A;  3OTL A;  4JHH A;  3H3R A;  4JHY A;  4B9R A;  1XN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...