3KB1A

Crystal structure of the nucleotide-binding protein af_226 in complex with adp from archaeoglobus fulgidus, northeast structural genomics consortium target gr157
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
255
structure length
243
Chain Sequence
RVTDEDIKERLDKIGFRIAVMSGKGGVGKSTVTALLAVHYAKQGKKVGILDADFLGPSIPHLFGLEKGKVAVSDEGLEPVLTQRLGIKVMSIQFLLLIAGMIREFLGRVAWGELDYLLIDLPPGTGDAPLTVMQDAKPNGAVIVSTPQELTAAVVEKAITMAEQTKTAVLGIVENMAYFECPNCGERTYLFGEGKASELARKYKIEFITEIPIDSDLLKLSDLGRVEEYEPDWFEFFPYLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target GR157
rcsb
source organism Archaeoglobus fulgidus
molecule tags Nucleotide binding protein
molecule keywords Nucleotide-binding protein
total genus 60
structure length 243
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10609 ParA NUBPL iron-transfer P-loop NTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kb1A01
4B32A 3G5UA 1E9EA 2QQEA 4C0KA 3LY5A 1MRSA 1SHKA 4FMDF 3KKPA 4JKIA 1FQJA 1GUAA 4KLZA 5TB5A 3T06B 4KJZA 3NDBB 2QRZA 4Q1EA 4JSYA 4BUJA 3T5DA 1FP6A 2YWFA 4LJ4A 1DAKA 2NGRA 4J0QA 2WJHA 5JMTA 2CLDX 1G5PA 3KKMA 1P62B 3ETLA 1EWQA 3W6NA 4B35A 4BFUA 3OEHA 1CR4A 1HEIA 5DIFA 2ZS9A 2UZIR 4X8OA 3FHTA 4I1VA 3BRWD 1QVAA 2RGDA 4E5UA 3EARA 1N25A 4QNRA 3AGQA 1HQCA 1JI0A 2DCUA 2P3SA 3E1SA 3G82C 3THXB 1CBUA 3LLUA 2QRNA 3N2IA 4LK2A 2ORWA 4NYMQ 1A2BA 2YYZA 5G41A 1GL9B 1ZNZA 4B33A 4AURA 4EPXA 4Q7MB 1C4OA 1XBTA 1X8KA 1XD2A 1KK0A 4PO8A 5LPNA 2ZYUX 4LRWA 2Q6TA 2D4HA 3KQHA 4ASUD 1GKYA 5FTKA 1W0JA 4EDHA 4DT1A 2PEYA 3NXSA 2RGAA 3KUDA 4NONA 4DBLC 4UJ5A 2CL6X 3MLEA 4MGKR 5FTMA 1YZKA 1E9AA 1ZIPA 3ICEA 1XD2B 2I3BA 4AYXA 2G6BA 4HB2A 4NCIA 3SC3A 3CNOA 2EFGA 1ZAKA 2VF8A 1ODFA 4NYJQ 4E07A 1ZBDA 5KPJA 3THYB 5CLQA 2NPIA 4EUNA 2RGNC 1TNDA 4PZLA 3SYNA 2NOAA 3C5HA 4MYHA 3RC3A 2G0TA 1KO4A 4D2IA 3VNVA 3T35A 1Q3TA 4JJZA 4D26A 2VP2A 3I3SR 3CIOA 2BBWA 3SR0A 1G3IA 3VR5A 1D5CA 3B6EA 2GBLC 2HLDA 2VL7A 3GJXC 3GEEA 3T5GA 4LJ5A 4KFUA 3B1VA 3FKSD 2ZS7A 1N0VC 3OEHD 4UXHA 4JLKA 1R4AA 1J8MF 3EIQA 1CKEA 1G7CA 3TQFA 5JI2E 2GDJA 1Z08A 2P6RA 2W6IA 3T1TA 3K0AB 4ZI3A 3FFBA 4V02A 3LLMA 2FWRA 5DH9A 2JA1A 3BE4A 3UWOA 3X1ZA 5CIWA 1G3UA 1E2DA 2PZFA 4GMXA 3OZXA 1UF9A 1MO3A 4FMCF 1FUKA 2GAOA 4DCUA 3QG5A 3WBJA 3VAAA 5TV2A 4NCKA 4TMXA 1OKKD 3W8NA 3MJRA 1A5TA 2CK3D 3GJ8A 5CB8A 1J70A 2BBTA 2P6UA 1A1VA 2O8BA 4NBSA 1PLJA 1ZNXA 2V55B 2W2TA 3B1YA 1D2NA 4II7A 1SVIA 3RHFA 2ZEJA 2IS6A 5FPHA 4BLRA 4OQLA 1P2VA 1Q22A 4N1AA 2ZI6A 1N3BA 3G0HA 2QAGB 1G41A 2LCFA 3K09A 4D0GA 1KJWA 1MO4A 1YQTA 2IF0A 2W6ID 3BK7A 3K53A 3B9PA 4C2TA 3U3JA 1N5JA 2FZLA 3PIRA 4G0NA 5CJPA 4PSKA 3U3RA 2BDTA 3VR6A 1W2GA 2BIFA 2ZYVX 5B30A 1FX0A 4Q1FA 4R98A 2CE7A 2I1VB 2O8CA 821PA 2QGZA 4XVRA 3QKRA 1CR2A 3FOZA 1XEXA 5KSZA 2NO6A 3LAWA 1Z63A 1DELA 1PLKA 4EAQA 3CO5A 5IDVA 4UNRA 4DB4A 3O8CA 1Z47A 2GA8A 3PFIA 5HKKD 4M1MA 1UEIA 2ZRAA 4KBFA 4LJ6A 3AP2A 4JLPA 3GPLA 3EZ7A 3CONA 1OXVA 5JI3E 2QL6A 2CE2X 4GPTA 2QTHA 2ZRGA 4TMKA 5G3YA 2OBMA 2E9SA 2H5EA 5A5GA 3NH6A 1XRJA 1G6HA 4DLZA 2A7QA 5LD2B 4UQOA 4R2HA 5JS7A 3E2IA 4JVMA 1N6KA 4UKDA 4GP7A 4IVQA 2JIZD 4QL3A 3CNNA 4TTQA 2D2FA 5FI1B 5KTYA 3ADKA 3FMIA 1E79D 4TMTA 5TARA 1EK0A 4CRWB 3IO3A 3EZ9A 3VQTA 3QKTA 1KJZA 3RANA 5F98A 3Q8XB 1NVWQ 3QI2A 2QBYB 2LKCA 4L9SA 4IOMA 3CPHA 4QBIA 4RCZA 3RRNA 4PZYA 5JZVA 2Y8EA 1I2MA 1SXJB 3V4RA 3KJHA 3OFNA 1COWA 1G5TA 1RRFA 4L4UA 1SQ5A 1VG8A 1E9BA 1HH4A 1R10A 2GCOB 2OBNA 2IYUA 4FWTA 3KUCA 4PAOA 2KJQA 4URWR 3ZQ6A 4KYIB 1DE0A 1U0LA 4DVGA 4C0AC 1CR1A 5DI3A 1KSFX 4U5XA 4ZCIA 3KFXA 2DFNA 5FR2A 4Q47A 1RKBA 5JECA 2HYIC 1P2SA 1YJ5A 3LH5A 1ZUNB 2ONJA 2RHDA 1Z0DA 1KNXA 1VDZA 1EWRA 1YE8A 3QEOA 3VR3A 1TU3A 1U8AA 2W0SA 4KVAA 3OAAA 2AWNA 1DOAA 2EYUA 4M1SA 1SHZA 3WYAA 4L8GA 4M9ZA 1E4VA 5FUVA 2J1LA 4HATA 1G1MA 2OEPA 4Q9LA 4B34A 4AK9A 2D7CA 1LF5A 4N0EA 1XU4A 2AX4A 5EZ5A 5JWHA 4KSCA 2G0NA 2EWVA 4QGGA 4LJ9A 1E0SA 3B5JA 4ZIRA 5JCPA 3W6PA 4JT4A 3NBFA 2A5DA 1OHHD 1UAAA 1W46A 1KMHB 4TSFD 4A0FA 1DAGA 1UPTA 4QBFA 5UKDA 2K5UA 3QQ5A 1KOFA 1P9NA 1XP8A 2JJ1A 3M0EA 4NZYA 2CJWA 1XXHB 4QXAA 4GI7A 1OLOA 4A2QA 1YR8A 3HWSA 3NBYC 4ARZB 5F2EA 4WOPA 2F1IA 1E2PA 3CW2A 4Q4JA 1X8LA 2UKDA 3C7KA 2QU8A 2VSXA 3MFYA 1XJQA 5IT5A 4Z51A 1KI6A 3Q7PA 4TWZA 5D3QA 4B74A 3EAQA 1E0KA 4U02A 1E32A 3BORA 1P5ZB 4DCVA 2ZJ2A 2QMUA 4B6EA 2RB4A 1Z6TA 2IHYA 2DHRA 1GVNB 3TAHA 4V0NA 3Q9LA 3V00A 3LBNA 4CIDA 5DYIA 3TSZA 5CJ2A 1JJ7A 3PUVA 4IHQA 3GFOA 5G3ZA 1KI2A 2GHIA 2JDIA 3REFA 4OI1A 1RPZA 1T9HA 4CF7A 2NTYC 2ZYTX 2PX3A 3CRRA 4M9SA 4OQXA 1M7BA 3DOFA 3X1XA 4BLTA 4NU0A 4PC2A 2PMDA 4D0LB 2JJ2A 4YDSA 4C7OA 4MKIA 3QPUA 1DS6A 1LB1B 2ZE5A 1R5NA 3K70D 4AKEA 4IW3B 1ZRHA 4LPKA 1PJRA 5AUQA 2OHFA 5JHHB 2IEZA 1WMSA 1XDBA 1SVLA 2GXQA 1U98A 3FB4A 4A92A 4AKIA 4PPGA 2FPMA 4QHYA 1SGWA 3PR1A 4A8JA 4PHFA 1RYFA 4AG6A 3LQQA 1DAFA 3QXXA 5AJZA 3SJZA 2NO7A 2JDID 5HZKA 1AM4D 4DLWA 1CLUA 3D31A 4MGIR 5B64A 3CX6A 2W0MA 3EPHA 4TZ0A 1JBKA 4Q19A 1C9KA 5H70A 4W9MC 3AB3A 1TF2A 2ERYA 3QKSA 5AJYA 4URUR 5H68A 1S1CA 1QHGA 3K70C 3AGPA 1VCIA 5CIQA 5JRZA 2O0KA 4OQNA 2P5TB 4MGZR 3ADDA 2KI5A 1OIVA 2CDNA 2REOA 5TXGA 1G6OA 2OCBA 3Q7QA 4A0RA 2V9PA 4ZDWA 1BS1A 1DAHA 1VPLA 3GJ4A 3BB1A 4LC1A 3T15A 2ZI3A 4O3MA 1P75A 2JLQA 3PEYA 1II0A 1PLLA 2XGJA 3BB4A 3O47A 4LJAA 1XFAA 4RD4A 2CK3A 4Q1CA 1M1YE 3LW7A 4Q4AA 2R65A 4YMSA 3DZ8A 3PVSA 3GD7A 2YKGA 1TADA 3SU8A 4Q5IA 2O8DA 2B8WA 1E94E 3AQ4A 5JFGA 2KE5A 5CDFA 2ZU6A 4DSOA 1UEJA 4BZQA 1KI3A 4A0GA 4AG5A 4OHWA 3QXCA 2HF9A 1QHHA 2PJZA 1VMAA 2OE2A 2JLWA 1MH1A 3U4QB 1KY3A 3KQUA 2NO0A 4KFSA 3ZH9B 4M1OA 3VHLB 2Q21A 1E2QA 2Z43A 4C0JA 4EPYA 1SKYE 2ZRMA 3SJBA 4BWYA 1UKVY 4B71A 4UNSA 2C03A 2WHXA 3VX4A 1NNEA 2C95A 4ILEA 2FOLA 3QXJA 3FKSA 3U4QA 1MABA 1E2JA 2Q3MA 1ZIOA 2D74A 3L2OB 1KGDA 4MRSA 6Q21A 4PSVA 2F3RA 5L3QA 3FVQA 4P4SB 3QNUA 4QGHA 3UWKA 3M6AA 1QRAA 1II8A 2IYVA 2VTKA 2CHGA 4WZBE 1Z6XA 3W6OA 3GEHA 1BYIA 4EQ6A 4LV8B 2GJ8A 1E99A 1KIMA 2IBMA 3RSLA 1W4CA 5B2ZA 1TX4B 2VHJA 3K9NA 4EFNA 4BPBA 1RZ3A 1U94A 4PAMA 3CH5A 1F2TA 2KBFA 1W4RA 2IYLD 2OBLA 3FMOB 2ZIAA 2IS1A 4ACBA 4WZAE 1CS4C 5J4VA 3UMFA 2EVWX 3TVTA 3CZQA 1KDPA 5SZJA 1U9IA 5H8WA 4HSEA 2HEIA 4PPNA 3U2QA 1CXZA 1HV8A 2FU5C 3I1FA 3ZIAD 1X6VA 2QUZA 4BE7B 2EYQA 3NEJA 1GNQA 2DR3A 2VSFA 3ZJYA 3M1IA 2E1RA 1XEWX 2REBA 4CVNA 1Z8FA 4B2IA 3KKQA 2DWPA 2XXAB 4JZKA 1NVVQ 1E79A 4TN1A 2J0VA 2WIAA 3NG1A 3DVLA 3GLIE 1G64A 3L43A 1JECA 4IOLA 3AUXA 4QOSA 4LBWA 3WNBA 1XMVA 3BAFA 3RWMB 2D06A 1XPUA 4G5SA 4CW7A 2AFIE 4ASUA 3A4LA 1TQ6A 2ZJOA 2CBZA 3BD9A 1XD8A 3KXLA 4DLRA 3GJ0A 3UMSA 2J87A 3ZZ0A 1ZD9A 3WRXC 2BJWA 2J45A 2OXRA 1D9XA 3QKRB 1T5IA 4POAA 4NTZA 4QHTA 4LHYA 1G16A 2OZEA 5JHGB 1KSGA 3R8CA 3A1WA 1NN5A 1KAGA 1NN0A 3F8TA 1FMLA 2BM0A 4LPSA 2BJVA 2V6JA 3VKGA 1LVGA 4DCSA 3GQBA 4DDWA 4BEJA 4YQFA 3L82B 3WMEA 1KNQA 3A1SA 3IDQA 2G88A 8OHMA 2ZRDA 2J0QA 1F5NA 4WAUA 1G8PA 1XZQA 4BECA 4HLQB 2IS4A 1X3SA 2FSGA 2IXGA 1TTTA 4HLUA 1VIYA 1KKLA 2OM2A 4QM7A 3SN6A 4BZXA 3DM9B 1YR9A 2ZR0A 1D8TA 4QJ3A 4US0R 1KK3A 4LOAA 2HLDD 2IYQA 4EFLA 3I5YA 4DSNA 1AA9A 4C0BA 3K09C 4LV5B 4O0MA 5EP2A 4EPWA 1JR6A 3WNDA 3K0FB 1CJMA 1H8HA 2FJUA 2ZM5A 1JB1A 2OAQ1 3NBXX 1Z0KA 1RRPA 4QBGB 1JQJC 2O5VA 5AK0A 4CYMA 2VHQA 2QPTA 4M2LA 1NKTA 2RAPA 3AVYA 5DSZA 4F4IA 4PANA 1ESNA 3BH0A 2KSQA 4IXMA 2O0HA 4B3FX 3QF7A 2CLSA 4LHVA 2WBLC 4LBVA 2NO1A 1XTSA 2IUTA 5FUXA 3PUXA 4FCWA 1DG1G 2IK8A 2P2LA 1OPXA 2WJVA 4PPFA 5LB4A 2C77A 2MSEB 3TE6A 5FL7A 4V0OA 5FUWA 4Y0AA 1R7RA 4US2R 3L0OA 3NHAA 1WBDA 2PLRA 1Z6YA 4OYHA 4X8LA 4ZPXA 2P6NA 1LS1A 2FEMA 1SVWA 1G8HA 2WWWA 1H65A 2ZI7A 3QJYA 4KSBA 5EXXA 1CRQA 1YU9A 4AD8A 3JZAA 5HCIA 2PLFA 3BH6A 3IIMA 2CCJA 3B85A 1JAHA 1FTSA 2GK7A 1EG7A 5L8VA 1F2UB 3B7GA 2DY1A 2OT3B 3EIEA 3OIVA 2QPAA 1PUJA 4TL7A 5CM8B 5HKKA 2VF7A 3WXMA 3QG1A 2XEXA 1OIWA 5FOWA 3TLXA 1W0JD 1ZM7A 3BH7A 4WIAA 2WAYA 2RGXA 4HDQB 5FL7D 4OK6A 2WMNB 1XXHA 2I1QA 2WOJA 2OCYC 3CR7A 3EPKA 2LKDA 2J7KA 2BEJA 2OAP1 2ZITA 3D6TB 4HB3A 3CUEF 1XTRA 5HR5A 2XJ9A 2F43B 1HE1C 2PZEA 3A1TA 1KY2A 1XTIA 1B0UA 3QIAA 4M4SA 4TT3A 3ZZUA 2BBSA 4FN5A 4TQ9A 5C4MA 2XX3A 3U3MA 4D4JA 2XAUA 3GFTA 2GEUA 3EWSA 3K0CA 4IKEA 3HPQA 4LJYA 5JJIA 2FH5B 2GZAA 1AIPA 3RNLA 3RRYA 2VP9A 4CEHA 2OCAA 2WIBA 5GJBA 3AF1A 1D6JA 3BBPA 4C0HA 2YOFA 2C78A 2VSOA 4D6PA 3V9PA 4Q1DA 5L3QB 4DKXA 2H16A 3U3OA 3CPJB 1KI9A 4RD2A 2X19A 4A9AA 2VHUA 3JZMA 3F5FA 2WKPA 2AK3A 4W5WA 5DLQC 5AJXA 3THYA 1EESA 4CGZA 3TNFA 1GDDA 1PVOA 4D0NA 1NMXA 4KU4A 2NIPA 2OCPA 3AVOA 5L3SB 3FGNA 4Q7JB 4YMWA 3IBGA 4A82A 2BMEA 1W5TA 3UPUA 3QPWA 4F7WA 3NBZC 3AKCA 2IXFA 3RAPR 5FTJA 4TT3D 1Z6AA 5FI0B 2Q3HA 3IHLA 2ZI4A 3A4NA 4MYUA 2ZUDA 3ZVLA 2W58A 3I8SA 521PA 1Q44A 2AXNA 1MRNA 2F6RA 2IWRA 3TK1A 2IL1A 4FINA 1JR3D 4FIDA 5EE5B 4PO1A 5E7MA 1Z22A 2ZSDA 3HU1A 1OSNA 1ZD8A 1XCMA 3X1DA 3RSOA 3LRPA 2ZUCA 5HTKA 2GZDA 4RJLA 1EFHA 5E7JA 3UKDA 2SHKA 1I4LD 2D3WA 4QHSA 4WA7A 5EE0A 1TF5A 1F2UA 2Z6VA 1HT1E 1SZPA 4Q18A 1SKYB 2C5LA 4I1SA 1SVKA 1DO2A 2ZRJA 3THWB 1P2UA 4PO9A 4DWJA 3ASZA 2PEZA 2YWEA 1BH2A 4MQBA 1N5IA 2C99A 1TU4A 4YXWA 4BGDA 1OH5A 1WA5A 2V1UA 4EPRA 1TMKA 3BS4A 3OFND 3ZD6A 2GVZC 1QHHB 4B3CA 2F9MA 1G7TA 3F3YA 1NBMA 5GVRA 4OHYA 5KNBA 2PL3A 2WM9B 2Z83A 4BFYA 1RJ9A 3AF3A 3B1ZA 3H2YA 2ZQ5A 5C18A 5GJCA 5DI3B 1JEEA 4OI4A 3ZLJA 1OXTA 2R62A 1LFDB 2VA8A 3AVVA 1X1RA 2OESA 4G3XA 1H8ED 1KZGB 3RC8A 1X8JA 4E09A 1M34E 1Q57A 2X77A 5JJLA 2JJ2D 1DEKA 2RGCA 1ZU5A 1HE8B 2PX0A 3SNHA 4PC1A 4D25A 4IDOA 1YZTA 4PPQA 2CCGA 1Z0IA 3BJIC 2CNWA 3I72A 3VTKA 4BFVA 1OB5A 3GLGB 1XCGB 5KOYA 2JGNA 1E1QD 3KDSE 4XSHA 4Z8XA 2Q3FA 4L9WA 4Q03A 1QZXA 3FYHA 4Q4AB 4X8HA 1IJFA 2YC2C 3TUZC 4JKYA 2BMDA 2C04A 2RHMA 3VKHA 2ZAMA 4BFTA 1E69A 4DRZA 3DEFA 3IBYA 5KO2A 4HAYA 1B23P 5E7IA 2VIIA 4DT1B 4W7SA 4IJMA 3CRQA 4LY6A 4PHGA 1Z2AA 3ZQJA 5TVKA 2E87A 3AVWA 2IT1A 1T3HA 4R9UC 2XZPA 1Z06A 1Y3AA 1OFHA 4IEEA 5JSZB 3EZ2A 2NPFA 2ERXA 1TF7A 3SEAA 5CK5A 1W49A 3NWJA 1SULA 4Q48A 4BFWA 1CJVC 2F3TA 2QORA 2YOGA 3L0PA 3O8DA 1FQKA 2ORVA 1R2QA 3H1TA 3CRW1 2QNRA 1NBME 3OIUA 4TMZA 3TQCA 4B3DA 1ZUHA 1VYUA 2MMCA 1E2MA 2QN6A 3R20A 2XZLA 2RGEA 3AEZA 1G9XA 1N0WA 4NYJR 3C15C 3AVUA 2VO1A 5BYJA 1LS6A 3GLHB 2EWWA 4A8JC 2C2HA 4URYR 4AYWA 4JJKA 3MMPA 2V4ZA 2YWHA 3FMFA 1EGAA 4G5OA 1VG0B 2ZI5A 5KNCA 2WVJA 4D80A 1EFRA 1T5LA 4EQ6B 3QKUA 4I1OA 2HDNB 2ZSAA 1Z83A 4KHZA 4D4KA 4M53A 3U7EB 2G9NA 1ESMA 1N2CE 2IA5A 2MSCB 1BIFA 1KDOA 5C2JB 4LZZA 1G17A 3EC1A 3AKEA 4UNPA 5FUYA 5EJEA 1NN3A 5EE1A 1TUEA 1ETUA 3GEIA 5IHPA 2CVHA 3QSYA 5ANRB 3CNLA 4C0SA 5JEDA 3L0SA 5B57C 3MSXA 1DAEA 2C98A 3GFPA 1ZMXA 2GF0A 3NKVA 2J7PA 3GJ5A 4FXPA 4GOKA 4XTRA 5DGXA 4DLTA 3QVUA 1U9IC 2WWYA 1PUIA 4P32A 4URZR 4QJ4A 4C9BA 1R0WA 5IK2D 3K70B 4URVR 3GLGE 1AZTA 2EFEB 4PQFA 3RS5A 3SJAA 3Q5DA 1UKZA 3W34A 1LV7A 2MMGA 5DHAA 3QF4A 4YMTA 5J4HA 3AVXA 4Q4HB 4FCTA 5FBQB 4JLDA 2GCPA 4B6FA 2C8VA 4QJ5A 2IHBA 5A0FA 4KI0A 4Q9JA 2XXAA 1G7SA 1R0YA 1BKDR 2ZVPX 4PTLA 5KU1A 2G3YA 2JJ8A 3FWYA 1NVXQ 1XEFA 1YRBA 1GOTA 3DM5A 2J3EA 2WPDA 3H86A 1NMZA 3FKQA 1PV4A 3RS7A 2FSIA 3I8XA 4ESHA 1N0UA 3H4MA 4PX9A 2JJ1D 3MWYW 2VP4A 5TY0A 5JRJA 3B13B 2WZQA 4YC7A 3TBKA 2P67A 3TSWA 4WBSA 2ZJBA 1IQPA 3NTUA 2OG2A 4M1WA 4LGMA 3AF4A 4LYAA 2Z4RA 1E1QA 4K8OA 3QOFA 2AXPA 4BFSA 2IS2A 5EE3A 5J40A 3ZGXA 3ZS9A 1W4AA 2KBEA 3PXGA 4RZ2A 3PEUA 3VMFA 5KDOA 3U6KA 1IBRA 1UBFA 2XITA 4LHWA 1GL7A 1UKEA 3I4LA 1XTJA 1VYVA 1TEVA 4M1YA 5ELXA 1J2JA 2DFTA 4XWAA 4JLMA 1G4AE 2H18A 4R7ZA 1NIJA 2DBYA 3WNCA 4ZCLA 2GXUA 4BRWA 1Q1BA 4FMBB 4HUQB 2G83A 5BN4A 2HV8A 1K5DA 2OXCA 3LBHA 4JVLA 2FFBA 2VYFA 2ZR7A 5LD2C 1S0UA 2JLUA 2WV9A 4P31A 1E2GA 2ZSBA 3DKPA 1N6IA 5KDLA 3TJZA 2DFKB 3L0IB 1GNPA 4XTCS 2QSYA 1CRPA 3GMTA 1E0JA 4D4LA 3T1VA 2F1HA 5FBRB 4DB2A 4IFEA 3EW9A 3B78A 3X2SA 4AIIA 3KQLA 3ZS8A 3TR0A 4K46A 3DMNA 2O8FB 3P1JA 3CR8A 3J81k 3R7WB 1HTWA 5DI9A 4RD0A 4FW9A 4HAXA 3A8TA 1FPMA 1S8FA 2GZHA 4H9GA 4Q1BA 4V03A 1SVSA 1YZGA 4WW0A 3LQRA 1EFRD 4KXFB 1RE0A 1XMIA 2ZR9A 5DN6A 2GETA 1I2DA 3LFUA 1Z6GA 3KQNA 2ODWA 3GCGA 4KFTA 3O8BA 4DLYA 4A2WA 4C0QC 2H8KA 4HLUC 4YDHB 1QHNA 2J59A 4OK3A 2GJSA 1GP2A 2BM1A 4IOJA 3ECCA 3TMKA 5D3MB 4C2UA 2IYWA 3CLVA 5DHFA 1CEEA 4JLVA 3NC0C 2BOVA 1TEXA 4KODA 4TL6A 3LXXA 2B21A 4D82A 1VG1A 1CIPA 2FGKA 3D3QA 1NY5A 3OIYA 1P72A 5LBIA 2QP9X 3R8FA 1OH6A 1RW4A 2Q9AA 2QE7D 1VHLA 2IYRA 1NI3A 4CT5A 5EUMA 2AHOA 4BFXA 4DDVA 1J90A 5DYGA 2VP0A 3OESA 3HPRA 2IF2A 5CYOA 1T3SA 2DWQA 1ZINA 1LY1A 1TAGA 2FNAA 1G8GA 3TR5A 3LD9A 1VCMA 4A8JB 1OT3A 1G5RA 1GL6A 3GJ6A 3W5JA 4Q4LA 3W8RA 4A6XA 2D2EA 2HCJB 1NJFA 1U90A 1ZC3A 3SQWA 4OL0A 2RGBA 5K8TA 3L8YA 1RVDA 3NDPA 1G21E 3A36A 3GLGA 2C9CA 3R9IA 1T8UA 5JBQA 1P61B 1U8YA 3T12A 3U44A 5C1BA 2ECKA 4ZCMA 2CVFA 3RYTC 1S9DA 1HYQA 5KHOC 4CEIA 1ONBA 4EKDA 1OH7A 1GRRA 2ODNA 4JL6A 4DLSA 2IEYA 3X1YA 3B2EA 1WCV1 4QGFA 1Z0AA 3CZPA 3IHWA 1E1RA 3B82A 4RCYA 4ZV4A 2BEKA 4NH0A 4DUGA 2CHVA 4PC6A 4JL5A 1W1WA 2R6CA 5FL3A 4CEJB 2QP3A 1L7VC 4YXWD 3M4YA 3ZIAA 3K0FA 2JCSA 3CB4A 4FI3C 421PA 1J7KA 1VCNA 4DIEA 3MWKA 5EZ6B 1IXSB 1W0KA 1XTKA 1US8A 1F3OA 2CL0X 1MO6A 4PC7A 3CF0A 4OKSA 3QE0A 3SQXA 4MGYR 2VBCA 1A4RA 3VHXA 1KO1A 3ND8A 3VR1A 3AV0B 1WBBA 1KK2A 4L15A 3REGA 2ODBA 1Z28A 3SI7A 3W9YA 4ERNA 2GEDA 4Q9KA 1N5KA 4XIGS 1V43A 3SJCA 2EW1A 3K0CC 5DNYB 4H1UA 1AZSC 4BFZA 1Q12A 3UG6A 3SDZA 3SYKA 1S2MA 3HU2A 4A36A 3KTAA 2BVNA 1MV5A 4Q7LA 1W2HA 3GLIA 1YZLA 4TYWA 1V5WA 4ACAA 2NQ2C 2XB4A 3FPAA 1WB9A 3IPYA 3C41J 1BMFA 1FZQA 3K8YA 4DUGD 1EFCA 1KZ7B 5A4JA 4B76A 2O52A 5BN3A 2BWJA 3Q72A 1MO5A 3U3KA 1N6PA 2CEAA 3SZRA 2ZRBA 4DSTA 3C14C 3WY9A 4PSAA 3OHMA 5DO9A 4KFRA 2GK6A 4OBEA 1JXMA 1NSFA 1SXJD 3BGWA 1WQ1R 5E3HA 2YZ2A 1WF3A 2ZRFA 2FG5A 5G40A 2Q9CA 1OYYA 4LJ8A 3ZVRA 4Q1AA 2AR7A 3PCRB 1FOEB 3N70A 2ZJ8A 2H7VA 5FBWB 2NZ8A 1K6MA 1TUIA 5E4FA 4DCTA 3ONWA 4Q9IA 1N5LA 1R8QA 3SOPA 2GWHA 1JXOA 4C7OB 4B44A 4DEYA 4DCNA 3I61A 1OKKA 3EZFA 2VLIA 1DO0A 2IXEA 2RMKA 4RY2A 2OFOA 4CZ2A 2HCBA 2HJGA 3PITA 2EU8A 3JVUA 1NN1A 3P20A 1W4BA 4W5JA 2DPXA 3ZVMA 1IAQA 1OFIA 1IM2A 2WSSD 4QGAA 3SHWA 1VIAA 1GZSA 1ZJ6A 1ZW6A 1OE0A 2ZRNA 3ND9A 3TW4A 1GTVA 2VEDA 1JAIA 1M74A 4M0LA 1IN8A 1U0HC 4KV9A 2WKRA 2G1JA 2ZSEA 2CCKA 4GZLA 4LJ7A 2A9KA 2C96A 4ZDJA 3ADBA 3R7WA 1NLFA 1L8QA 4N0DA 1KI8A 3I32A 4TMVA 3VR4A 1DADA 3QF4B 1N6RA 1OXUA 2EFCB 2FDCA 4HI0E 2QTVB 4EJSB 1OXSC 4HYYA 1XPOA 2ZSFA 2NZJA 4XD7A 1ZC4A 1D2MA 2EFHB 3QVVA 2ZRCA 1NG1A 3RS3A 3K9LA 3VU9B 2VHCA 4LHXA 2J0UA 4BRUA 4XWKA 4AY2A 4I99A 2OILA 4LYJA 3TRFA 2HJVA 1JJVA 5GADl 4B3BA 2OFWA 4AKHA 5CM9C 1E1RD 1QHXA 2QPOA 3DPUA 3QXHA 5FPSA 2GNOA 1IJEA 1NBMD 1J8YF 1JPJA 4MKHA 4ARZA 4YMUA 2HT1A 2OLJA 3KX2A 2H92A 3PENA 1RRGA 3MCAA 4MH0R 3A6PC 4GOXA 3LX8A 1D2EA 2YOHA 4GNKA 1E98A 2Z0MA 4JLBA 4KBGA 4CEHB 3LNCA 1U99A 1EXMA 2X8AA 2JLXA 2IYTA 2XTNA 3IGFA 4DLXA 1VCOA 4BLOA 1N6NA 2UVQA 4JBYA 3HDTA 2JLZA 1R5OA 2V1XA 5TMPA 3WP0A 4I4LA 2R6DA 2XOKA 1J99A 1KI7A 4HDCA 1E2NA 1TQ2A 2QMEA 4HZIA 4AWXA 1S96A 3LWNA 3HJNA 4JS0A 2HYDA 3D8BA 4TLAA 4Q00A 2ZJAA 4P33A 2IYSA 4Z1MA 2LWIA 2X1VA 1W36C 2CXXA 4B3XA 3HR7A 4RKEA 5HE8A 2NMVA 1BOFA 5J4LA 4CEJA 4F91B 3GJ7A 3LW8A 1SXJA 1OIXA 1W5SA 1XMJA 2ZRHA 1N6LA 1P9WA 4URXR 4XJXA 3IEUA 2V7QA 5FOSA 1VG9B 5HE9A 1GRNA 3W3AA 4N3NA 4JVNA 3IIKA 2ANBA 1FUUA 2L0XA 4IDNA 2H1LA 1YHNA 3UK6A 5AR1A 1SXJC 2JLRA 3U61B 4KAXA 4LBZA 2HXYA 3TKLA 4ZKDA 4YMVA 5IRCD 2J41A 2O8CB 1YR7A 2GRJA 1KK1A 2WPDD 2ZAOA 3PEVA 1UADA 1FL9A 1TL7C 1GNRA 1YRAA 3CH4B 5DISB 2PCJA 1T4GA 2A5GA 2GF9A 2RGGA 2F1RA 3DKVA 3QUSA 4B48A 4CT4B 1M2OB 2FGJA 4A0HA 1NLYA 2V3CC 1JEDA 2W00A 3GLIB 1G291 1XTQA 4G01B 1W47A 4F92B 4ZKEA 5FOUA 1S3GA 1TQ4A 2GAAA 3B8HA 4RSGA 4WVFA 1CP2A 4KYUA 2FPKA 2N46A 2FMXA 2OO7A 1G18A 2DWOA 2YHSA 4PR0A 4U7DA 1LNZA 4OJKA 1NSTA 1UBEA 5AJVB 5DN6D 4M9XA 3QEJA 1XD9A 2WWGA 2R6FA 1G4UR 1II9A 3WMFA 1O3YA 4GMDA 4GBMA 1T8TA 4O2LA 1FP7A 3A58B 2J7PD 2WOOA 3EIHA 1SVOA 4OK5A 3FMPB 3U7FB 2FFQA 1RYHA 4YONB 2JLVA 1BO6A 5E95A 3MWLA 4RFSA 4JLOA 1DBSA 2ZE7A 4IDHA 2ATVA 3BXZA 1Q21A 4B47A 1ZNYA 2VRWA 1M8PA 1ELOA 5K8LA 4XWOA 3RWOA 4LDJA 2ZPTX 1RFLA 3VX3A 4CDGA 1KDTA 1NF3A 2P5SA 4FWIB 1XMSA 2GJKA 5CLLA 3PQCA 3IEVA 4QNMA 2O8FA 3Q3JB 1KO5A 4YLGA 4LI0A 2XSZD 4MITA 1VECA 2WWFA 1EX6A 4UXJA 3AM1A 1CTQA 2EFDB 1GILA 1IXRC 3B60A 3LA6A 2X2EA 4KCGA 1WDTA 3PEWA 3UMRA 3EASA 1Y63A 3LBIA 2BMFA 4Q7KA 1YZUA 2IUUA 1N6OA 3MWJA 1KTVA 2QROA 3AP3A 5FBLB 5CITA 1IY2A 5BWMA 2YINC 4C30A 3UANA 2W2XA 4Q4HA 4PZZA 4A1FA 1UKYA 1E2EA 1ZM9A 2WSMA 3KTAB 1E6CA 4MKGA 3LO5A 2VPPA 4NYIQ 2ASEA 4UNQA 3NHBA 4MRPA 1S1MA 1TQDA 3P26A 4A6PA 1W44A 3MRSA 3R9WA 3ZVNA 1WRBA 3E5HA 5P21A 5DE3A 5B58C 3IO5A 2HF8A 1OJLA 1P9RA 4TLDA 5HCNA 2J0SA 5KNDA 2MSDB 3KQKA 4B3GA 3KXKA 4ZDIA 1HUQA 4IFBA 1IONA 3FE2A 2A5FA 3HYTA 2IWHA 5CB6A 2J0UB 3NVAA 2ATXA 4M8NE 2ZI9A 3KXIA 3SFZA 2B92A 3TGPA 4F93B 1R8SA 1QG4A 3NH9A 4FMCB 1QHYA 4LUCA 1UFQA 5EQTA 2YVUA 3DDCA 1T3LA 2QZ4A 2QE7A 1CF4A 3CPEA 2N42A 1L4UA 2C9YA 2P65A 1P2TA 2WJIA 4U00A 4Z8YA 4PHTA 1N6HA 1NVUQ 2XNDD 3WMGA 1S4QA 5EP3A 1FMJA 2GJAA 2Z4SA 2CNWD 1L4YA 3VKWA 5JEEA 1UDWA 4F4CA 4MRVA 1G20E 1VTKA 3BWDD 3CX8A 1RIFA 1HQYE 2W83A 3JVVA 3AF0A 4R71A 1JR3E 2FFHA 1R6BX 1ANKA 4ZIRB 4IXNA 3EG5A 4MYTA 3GP8A 3AVTA 4AYTA 4NCJA 4PHHA 4NCNA 4WZ6A 5EXPA 3TH5A 4DC9A 1E2HA 1XCPA 4M1TA 4NE2A 1ZCBA 2GVDC 2YC4C 2ZANA 3I62A 3RRMA 5HZHA 1P4SA 1NLZA 2GKSA 4NPHA 5JSZA 2ZROA 3QKSB 4TMWA 1AGPA 2J9RA 3PUZA 3Q85A 3A1VA 3K0SA 2FF7A 3A37A 3VU9A 2QG6A 1OW3B 2GJ9A 2CMKA 4EIWA 4MRNA 4LCBA 4Q01A 3EX7C 1DPFA 1NJGA 2QT0A 4JT2A 5F3WB 3NEYA 2YNMA 1ZM4A 3CF6R 3GLFE 1FFHA 4LYFA 1X1SA 4NYIR 1VHTA 2F43A 4XD7D 4JIMA 4S35A 4KITB 2FPLA 4Q9HA 4GL2A 4M22A 2ZRLA 2G77B 3EC2A 5FBVB 2FN4A 3B9QA 1U8ZA 5EE9A 3EPLA 4E03A 3ICQB 3WYGA 2B6HA 4A2PA 3W90A 4OHZA 2ZUBA 1XXHE 2RH5A 1UBGA 4G5QA 3OF5A 5FPTA 1GM5A 4DDUA 4EJSC 2J5XA 1GG2A 4HAUA 4DSUA 4TLEA 3WRYC 3KL4A 1S9HA 3ZZTA 1JNYA 1UJ2A 3I92A 1AN0A 4RZUA 4B2PA 2WAXA 1GAJA 3C16C 2QI9C 2AWOA 4EJSA 1R0XA 5J4YA 3QY0A 2QEQA 1KO7A 5F9FA 3OEED 2CLCX 2PCLA 3S1AB 121PA 1YVDA 4I81A 2IX3A 1MR3F 5BXQC 4TZ6A 1K5GA 3CWQA 1OHHA 3QBVA 4P4SA 2B7CA 2PH1A 3DOEA 1MOZA 4RD1A 3DHWC 2J46A 2QM8A 4R2IA 3SFVA 2XTMA 2ZRKA 4TYNA 1Z3IX 4CEIB 1UBCA 1I4TD 1QF9A 3BERA 4OI2A 4C0LA 1AJEA 1NMYA 1OFTA 2R9VA 3DMDA 2VP6A 4WXPA 4NP6A 3OAAD 3H84A 2WJYA 1YZNA 1AGRA 2QY9A 3MG9A 1IXZA 3P32A 4HZUB 1E9DA 1P60A 4JL8A 4TYPA 4JYCA 2XTZA 5H1YA 1W0KD 1IY0A 5L3RA 3MAAC 1NY6A 2R44A 2BCGY 3KKNA 3EA5A 3HU3A 3UXMA 2C9OA 2WWIA 1JQLB 1DAIA 4MRRA 5FOTA 3E70C 4DLUA 4RKFA 2ODEA 3U7HB 4X8MA 5CK4A 1QHSA 4PXAA 1IOZA 2QBYA 2QAJA 3P4YA 4US1R 4HAWA 2QM7A 5TDHA 4BLQA 2VHTA 3C4JA 1Q0UA 5LB2A 3KJGA 2JATA 3EXAA 2QAGA 1G7RA 1NP6A 2TMKA 4F4JA 4G1UC 4OQFA 4QRHA 3BFKA 5BN5A 2JLSA 3WBKA 3WP1B 2Q9BA 3A1UA 5BQ5A 3X1WA 1C1YA 2HUPA 1XPRA 1R5BA 1E2IA 1PZNA 2AK2A 2FA9A 1U2RA 5J4KA 5JLJA 1ZVQA 1ZP6A 1P6XA 2BBOA 4HB4A 1GWNA 1KO8A 3OE7D 4HLDA 1W7AA 1I4DD 4BLPA 2FZ4A 2AKYA 2BMJA 1TPZA 4Q66C 1SXJE 3ZYCA 1IN5A 2RKOA 1T0HB 4XSGA 1RJ9B 3RABA 3ZDQA 2GESA 3GLFB 2O8EB 4GRAA 4M9QA 4DJTA 4B43A 4H1VA 4B2LA 2REXB 4EPTA 4QFMA 3QPVA 3B1XA 4WXRA 3K1JA 1WXQA 4KLNA 1AKYA 1G8YA 2F7SA 3LDAA 5SZKB 2OUKA 5KSYA 5JWRA 2GEVA 4TQUS 1F2TB 1XF9A 1UM8A 2ZXUA 4IVRA 3UIEA 1A7JA 2V54A 3CRVA 1X86B 1XZPA 2AFHE 1QBKC 1T0JB 2H57A 3AVPA 4TSFA 3F0TA 4HUQA 4PQYA 2AN9A 2PMKA 3BFVA 4NYMR 2IYXA 2GBLA 2B8TA 4IRUB 4NCHA 2AKAB 4ZDKA 3CX7A 1KMQA 4JBXA 1ZYUA 3KJEA 4TTRA 3U6BA 3FHCB 5EP1A 2FSFA 4D4MA 5K8UA 2F9LA 3IKJA 3N5CA 4TLBA 4DLVA 1OH8A 3DZDA 3T61A 1GFIA 4BLSA 1KAOA 5FTLA 3LV8A 3T1QA 3ASYA 1DTSA 5GJWC 3TIFA 4GT1A 3TUIC 1CR0A 4MYCA 1E2KA 4MDFA 2QT1A 3I5XA 2ZS8A 3FHOA 1ZNWA 4HB0A 2QENA 3EZ6A 3SHFA 4B75A 4TLCA 1DARA 2BHRA 3NIBA 4IEIA 5FPYA 4F38A 3K9HA 2KB0A 4G5RA 4DEXA 3IILA 3OIWA 5SZIA 1M6NA 4KO8A 1XWIA 3AKYA 2WWXA 4UNNA 5BYKA 5C46F 4HDOB 4QM6A 5GVSA 1R0ZA 4G5GA 4IDQA 1QDEA 1Z5ZA 4HAVA 2V6IA 3GLHA 4UXIA 2X2FA 1NIPA 3RLFA 1RRCA 2V8OA 4FD2A 1XJ0A 1P73A 3AP1A 1LW7A 5KSOA 1KSJA 3DL0A 1EX7A 4GSYA 1KI4A 4ESVA 1KMHA 3P4XA 3SBEA 1XEWY 1GSIA 4JYBA 3V4FA 3TW8B 4L5BA 3GLFA 2O8EA 5J5CA 1NRJB 1KI6B 2RGNA 2YV5A 2IC5A 2VP5A 3RRZA 1KKMA 3W5IA 2DB3A 1G3MA 1VKJA 2QSZA 1F60A 3K0AA 1JPNA 3MD0A 4FMDB 1F6BA 4A15A 1CJKC 2XNSA 3U7GA 5JCZA 1HY3A 4ITRC 4A4DA 1XB2A 4DIDA 5IF9A 2ZTSA 4XOIA 1NVVR 4RVCA 4TTPA 3QENA 5J47A 1GKUB 4LYHA 3KZ1E 4MUBA 3R9XA 3PUYA 5FFMA 1OFUX 4OHXA 5GJVC 1KI1A 2FX3A 3EPJA 2KWIA 5FPKA 1OXXK 2FEOA 2VH5R 1M7HA 3KB2A 4NDZA 2QGNA 4JBWA 2WJGA 3MUFA 4XVQA 4W5HA 2FSHA 5FH9A 4TQAA 4QBHA 1E9CA 1JALA 2ZJ5A 3OEEA 3TSOA 2O8DB 1JR3A 4FCVA 4KVGA 1AK2A 2BC9A 2BKEA 2PT7A 3IIJA 4GFDA 4Q4JB 3SYLA 4E22A 4QKQA 3QBTA 1OB2A 2DFLA 2IUSA 4LWZA 3CBQA 1US8B 1XX6A 2O0JA 2Q0HA 4K81B 1Z29A 2WSSA 4V0MA 5KSPA 3WYFA 4LX0A 2A3RA 4NHOA 3FTQA 3THXA 1XJCA 1FW6A 1U81A 3D7MA 4NKRA 1M7GA 2GCNA 3CKLA 2ONKA 1EFUA 1ZCAA 3BC1A 3LVRE 3RVBA 4HZUA 1G8FA 2XJ4A 3T1OA 1NG9A 1O87A 2V7QD 5L3VA 4LSGA 1QVRA 2R6GA 3SS8A 5AWFC 3RS2A 2XOKD 1MKYA 1FNMA 4AC9A 2UZ3A 3EA0A 1AQYA 2WKQA 3HP1A 3P27A 4AI6A 1AS2A 2JEOA 2B7BA 3FDIA 3PUWA 2QMOA 1YZQA 3U44B 1GITA 2ZYWX 5D3MA 3U60B 1Z2CA 5K8IA 1COWD 5LDDC 3T34A 4TL9A 1KYIA 5AUOB 2ZETA 3VNUA 1L2TA 3CM0A 5AUNB 1D9ZA 1DG3A 3CWZA 1AS3A 1WP9A 5CDFE 4RD6A 1A82A 2GXAA 3TAUA 3AF2A 1KJYA 4JLNA 3DO6A 3KB1A 4XVUA 4V0ME 1G3QA 1E2FA 3SE0A 1GRQA 2GTPA 4P0TA 3EWAA 4ZI2A 2GCOA 1Q1ZA 3ZD7A 1T91A 4V0KA 1CJUC 1IN6A 1DAMA 2O8BB 2I4IA 3LXRA 2ORIA 2JAQA 4O2RA 1DVRA 2D62A 2ZE8A 1Q1QA 1G3RA 3N2EA 1E9FA 4Q02A 4MKFA 2QA5A 4P4TA 4BQSA 4EPVA 2BV3A 1FX0B 4C4PA 4MUAA 4GDFA 1A2KC 2ZRPA 1YR6A 3RS0A 5C4GB 1CJTC 4OI0A 4JSTA 3THWA 4UJ3A 4XH9B 3O8RA 4AKGA 2A5JA 3C5CA 3IQWA 2N1BA 1E9SA 2CL7X 5FOVA 1K8RA 1GIAA 5M04A 1VYTA 2BKUA 4I1UA 4NL4H 4BEBA 4P3YA 2ZVQX 5KUTA 1P7CA 4JLAA 4JMPA 4M21A 4C3ZA 3UATA 2JIZA 2BCJQ 4PQRA 3THOA 5AUPB 1ZU4A 3RS4A 4S2EA 4PC3A 1ZM3A 3S1AA 3MGCA 3BFXA 3IUYA 1U0JA 1Z0FA 3IQXA 1W36B 1UDXA 4JLJA 4OJQA 1II8B 5EXTA 1OYWA 2ZJYA 3PJRA 2ZREA 2XZOA 4V0LA 2IYYA 2RCNA 1KHTA 5JWOA 4MA4A 3FFAA 4LC0A 3AH8A 3KJIA 3HYRA 2OSBA 4RZXA 4HUTA 2R6AA 3QXSA 1NKSA 5KDDA 5FOXA 2ZE6A 4DDTA 3BB3A 4QG7A 3K9GA 1E2LA 4Q21A 1ZM2A 5F9HA 1LTQA 2A78A 2QMHA 2ZU0C 2OV2A 3AVQA 3KKOA 3LX5A 1IN7A 1QG2A 2PT5A 2R8RA 5HPYB 1IHUA 1Q1EA 2G1KA 3GLHE 1BYUA 1XNJA 1FNNA 1MT0A 3W3ZB 4Z1MD 1LF0A 1F48A 4NMMA 2CJWB 1Q3HA 1CU1A 3SBDA 1NL3A 1XEXB 2OFXA 2R2AA 4LHZA 4LV6A 1IN4A 3KFVA 3IPXA 4GOJA 2H17A 4QC2A 3NC1C 4IDPA 3PG5A 4RD3A 2WWHA 2XSZA 2P0EA 2PZGA 3K0EA 2F1JA 5SZHB 2JASA 1T6NA 2A5YB 2DYKA 4OHVA 1EFTA 1OF1A 2WICA 1E3MA 3MJHA 4HAZA 1GKIA 4D81A 1IY1A 2HXSA 3RDPA 3I73A 1HURA 4RZ3A 1BMFD 4O25A 4BASA 4P4UA 1MABB 3B1WA 3TUJC 1HT2E 4RFVA 4L16A 4LBYA 5AJWA 1Q20A 1ZUIA 3BOSA 3L8ZA 3ADCA 5G53C 1S3SA 1Z07A 2AD5A 2XB2A 1SVMA 5CYPA 3TVDA 5EP4A 4BZPA 1AKEA 2PBRA 621PA 1KSHA 2FE4A 2WJJA 2ZRIA 5KPDA 4TYQA 1HA3A 3PV0A 2JLYA 2VQSA 2ANCA 1H8EA 1SKQA 2AL7A 2WTUA 1OV4A 4B73A 5FR1A 2W6JD 2ZJZA 4HEJA 3CRMA 1Z0JA 2D7DA 1CULC 2NO9A 1AS0A 3AUYA 2QQ0A 4Y0VA 5L3SA 4M1KA 3WHKA 2GILA 2IW3A 5KYKA 2QTFA 2HT6A 3UG7A 4IVPA 3OE7A 4Z54A 4JVSB 3HR8A 1E9RA 1P3JA 2Z5FA 2WMOB 5JS8A 3Q5EA 4MDEA 2IYZA 2EQBA 1ZD1A 4PFSA 5IK2A 4TYYA 721PA 5JJKA 4HLCA 4TL8A 3VFDA 2XNDA 2QAGC 3WHLA 2A2ZA 4RFSB 4DXAA 3VR2A 2CHQA 2W6JA 1E96A 4ABYA 1FTNA 4PAQA 4IOKA 2FFAA 4DHEA 5FTNA 4GP6A 2F55A 3CF2A 1YKSA 2GXSA 4DZZA 2PJRA 5BW8A 3BIFA 1G19A 3AKDA 3U5ZB 4ON9A 1W48A 1WE2A 2YJTD 2OLKA 1QHIA 2W2VA 3GJ3A 1RC8A 5EUQB 3H0KA 4GZMA 221PA 2QP4A 1AQUA 2A30A 5EXSA 2YWGA 2FV8A 4EFMA 2AD1A 3C8UA 4OQMA 3LVQE 1W36D 1H8HD 4ZO4A 3A4MA 2NG1A 1E4YA 1KDRA 1E0AA
chains in the Genus database with same CATH superfamily
4B32A 3NNNA 2YV4A 4YECA 2F00A 3HJBA 2OSVA 4PZEA 3KKPA 4MUNA 2H1OA 1IHOA 2SNIE 2YIDA 3W2EA 5TB5A 2PLNA 3R7BA 3GFRA 3GMDA 1QTNA 4P4GA 3T5DA 4LJ4A 2NGRA 1KY5A 1Q0SA 1ZOPA 1EVIA 1G5PA 3HKDB 3N6XA 4LYDA 4C7VA 2Q5LA 3BDVA 3CF4A 4BFUA 1EWQA 4R1QA 1CR4A 1LPBB 3UB3A 1P4AA 3TGWA 1HX7A 4DM7A 3ZDDA 3F6RA 4DLBA 3BRWD 5A4DA 1QH1A 3HLYA 2M32A 2D5IA 4MPJA 1U5BA 4OP3A 2W2KB 3EVZA 3V34A 4DA6A 2B61A 5LUAA 1IZ8A 4QNRA 1IVYA 3F7NA 1CRZA 3RG2A 2Y66A 2DCUA 2P3SA 2VZLA 3G82C 1VHDA 4L22A 5C31A 3U80A 3N2IA 2R8XA 1QTQA 2MDTA 4JZYA 4BTVA 1TK2A 4NYMQ 3H2GA 3MTAA 3IE1A 1QIEA 3DV2A 3T5TA 1C1HA 4YV7A 3MTIA 2Q0SA 5LPNA 4LHSA 1T5TA 3DOJA 1QUEA 4UCXA 2C4MA 2ZPUA 4UBMA 4YJ3F 1GKYA 2YYYA 3EUAA 4YCAA 4ZVQA 3SC6A 3VZRA 4ETNA 3SSOA 1V3TA 4LYEA 4R1UA 4A6XA 1U2SA 4DT1A 5A4FS 2QJTA 1Z2EA 4NONA 4RE5A 5FTMA 1LI4A 3MLEA 1E9AA 4YUYA 1ZIPA 3ICEA 5HVNA 1JHUA 3LXUX 4PCVA 3FROA 4TWJA 2O1XA 2PGXA 1DDOA 4HB2A 4MPDA 4NCIA 5TPWA 4IDDA 1KXZA 3K35A 4NOMA 4OIFA 3RT7A 2VJKA 2Z1NA 4ID9A 4K0KB 2Z56A 3DDNA 2WD7A 1ZH2A 2MJLA 1ZBDA 3E9ZA 4LZOA 4E07A 2NPIA 3GYGA 4KXNA 5ALHA 4C29A 2I8CA 1WKCA 2BZ1A 2WA1A 4MP8A 4CM4A 3L18A 3L1UA 3BULA 3N9IA 4JHXA 3FZYA 3F9IA 4L5CA 1CG6A 1FUEA 3RF6A 3RC3A 1LXCA 2G0TA 1OLUB 4D2IA 4Q37A 1KBZA 3FRHA 3KSUA 4JJZA 1R12A 2O2IA 2VP2A 3AJEA 3ZJ5A 5C3MA 3DNFA 3P2MA 4QQKA 4Z3OA 3B6EA 3C6QA 1XJ5A 5AHRA 1P7ZA 3GJXC 4Y1RB 1D04A 4A5SA 1L4MA 2X0DA 4O1HA 1BHJA 4LJ5A 2G63A 5T67A 2NU9B 2B4YA 3OEHD 3WZLA 5HJ2A 4E46A 2PA3A 1UPBA 1MW9X 2GDJA 4LEIA 2GBIA 1WAMA 2V9CA 2BKXA 1Q50A 1S02A 2ABWA 2P4SA 4NDAA 1DEOA 2XT0A 3NGMA 3R8XA 4ZI3A 4PAGA 4DR6B 2ZUTA 5T6BA 2GYWA 2Q7XA 4EFDA 1JEAA 1NU6A 2GAOA 3H1PA 3WBJA 4FFVA 4V38A 3KZCA 2Z9DA 1G20A 2H5IA 4N9WA 4GLOA 3CZ9A 4EB3A 2JHFA 4U2DA 2CLMB 4EY5A 1A5TA 2CK3D 1U8TA 3OQIB 5JZOA 3OLZA 1P1FA 3G5AA 1L4HA 4OEHA 4DLAA 1W4LA 4BWVA 1L5FA 4MIOA 2ZEJA 4KDFA 4MO9A 4BLRA 1X42A 4KEAA 2R79A 1RHMA 1VJ5A 1ID8A 3EGVA 5IU6A 5KJEA 1N3BA 1V6SA 3G0HA 4BC0A 2LCFA 3K09A 3ZC3A 1NDQA 2G0AA 1Z2PX 2X8JA 1MO4A 1CQJB 4I4NA 5DXAA 4DAEA 1M5TA 2IF0A 3TTXA 3L7DA 5A0VA 1RWNA 3U3JA 5TGZA 3G9XA 1WBBA 1GLGA 2R48A 3IAHA 2NLOA 2ZYVX 3ZTYA 1T3GA 1FX0A 1XEAA 5DBHX 3ZR4B 2QGZA 4XVRA 2ILTA 4C7XA 1DEXA 3D59A 5BNWA 5ICCA 1XEXA 2NO6A 3LAWA 1WSDA 3SICE 4J0FA 4KPYA 1YB5A 3CO5A 1ZI8A 5AW5A 4O1MA 4WCVA 1H5UA 3AUJB 2L18A 4JA0A 5IDVA 1KTIA 3G5TA 3M1LA 3K9QO 1OILA 3MJTA 5B1YA 2POQX 3ZWMA 3GPLA 1CDEA 1Q19A 2FZEA 2XBLA 3CONA 5IT4A 5JI3E 4UU1A 2CE2X 1YB2A 2QTHA 3QEMB 2VJPA 3IBCA 1TUBB 4N49A 3RFUA 4L95C 2PZMA 5LLTA 3DONA 2VK1A 1YK0A 1G2OA 1TCVA 3EA4A 2A7QA 4K6HA 3V4SA 1DKRA 4ZPJA 5JS7A 3DT9A 3GYBA 3CNNA 4TTQA 2IEAA 2WEKA 4MV5A 4ZZ3A 4FCCA 3FMIA 2ZKLA 4WLOA 2X7HA 1W1IA 5EVJA 2I5PO 1S89A 5K0LA 4C43A 2XMBA 2ZYRA 4RWZA 2I2WA 3RANA 3KE9A 1E4EA 5IARA 4JJFA 4Q9AA 2C2OA 3CLSC 4FEEA 3CPHA 3FVWA 3L93A 3MSCA 4QBIA 4RCZA 2ZJ7A 4PZYA 3ZVKA 3O8OB 3S44A 1I2MA 1RHRA 3V4RA 3VZCA 2IEIA 5JCJA 1KVUA 4BQRA 1AMUA 1JXQA 2AMLA 1ISIA 1BMTA 1COWA 3OFNA 4RUKA 5F7XA 1SU8A 2FP3A 4MS3B 4BVGA 5F5NA 2II6A 4FHFA 3FWZA 1XRPA 1E9BA 1HH4A 1YONA 2OBNA 2PXHA 1EVEA 4BAZA 5LP6A 4FWTA 3DHNA 3ZQ6A 1Z25A 3C5WP 3SK0A 1QGZA 4DVGA 2ET6A 3PC2A 4OMUA 2HEGA 2V7GA 3LUJA 4U5XA 4L5YA 4WLVA 1WXEA 4ZEMA 4Q47A 4FX2A 4RL6A 5CHYA 5JECA 2DY0A 3JRWA 1U7DA 3GG9A 3EF1A 4QOIA 1PFGA 2RHDA 4RX1A 3SE7A 3ELWA 3ZU6A 3IEXA 1U8AA 2W0SA 1ZGCA 3WYAA 5CXQA 1DOAA 4GWLA 3NIWA 4M1SA 1IZZA 1NUAA 3HA7A 1E4VA 4M9ZA 2D1SA 4OH7A 4RNDB 4EGCB 1ZJWA 1G1MA 4WSOA 4Q9LA 3I04M 3NOXA 4B34A 3GBPA 4BCBA 2E5LB 5G1NA 5G4LA 3WKEA 4BLUA 2QXUA 1UMDA 3IAAA 1QLHA 4PRYA 3AW8A 5BSWA 3TNYA 4LJ9A 2CKMA 2D5CA 1AK9A 3DXZA 3PK0A 3SDSA 4UHJA 4ZIRA 1NR5A 3W6PA 5AVTA 3JQAB 1W46A 2QI9F 4TSFD 4NAHA 3T9AA 5TQ0A 4S24A 5J4KA 2WDZA 3T4EA 2K5UA 3KYCA 4L9RA 3T94A 5K6RA 1P9NA 4U2BA 4EFKA 5LN1A 2MSKA 3ZJUA 1RADA 2WU8A 3CZRA 4NZYA 4TKUA 1ORRA 1NW4A 1R8JA 1M34B 2I7XA 3KCQA 4QNNA 1E1MA 3PWKA 1YR8A 1NQTA 4L02A 3NBYC 3MFQA 3NR2A 4NV0A 3ES9A 1RIIA 3JXEA 4P3NA 1HQKA 5LKAA 1GADO 4CFSA 4IIJF 2F1IA 3RBXA 1X8LA 3MILA 4MLCA 2VDJA 5AI4A 5IT5A 2ZIZA 1OC4A 5D3QA 2BFAA 1E0KA 1SRQA 1U2EA 3K31A 4QYXA 1ZAYA 4Y6OA 2AUNA 3KSDO 5HIAA 4EKEA 1IEWA 2FXIA 1W75A 4DCVA 1KFBB 2C4KA 4WN9A 2QD1A 2C2YA 4EHDA 3BCSA 4V0NA 1BAPA 1D2CA 1N92A 3HLTA 3LBNA 4LZNA 2C57A 3VH2A 2QN7A 5DYIA 4E7PA 5ED4A 3TSZA 5AFSA 1JJ7A 1T0PA 1HZZA 5G3ZA 5A3JA 2CVPA 2E6KA 2NAFA 4I7EA 1ORVA 4OI1A 2BH9A 2HX1A 4MJ3A 1HYHA 1RPZA 4G0QA 1QHFA 3ILYA 5AICA 4NG5A 2JCGA 4M9SA 5BMOA 1OLUA 3NBMA 4G0MA 3REQA 3X1XA 4NU0A 3PHIA 1AO3A 2F3PA 3I5AA 4PC2A 3ZXUB 4OFZA 4D0LB 3ZKWA 3QJ5A 4FBMA 3QPUA 4P2GA 4Q3NA 1KQGA 1LB1B 1QZTA 5JROA 5SYNA 4KE9A 3X1KA 3AR2A 4IW3B 3NV7A 2XYPA 4TV9F 5IWCA 4H15A 4B6SA 1XDBA 2ZP1A 1FYWA 1LEHA 2WYOA 4MVCA 2Q3JA 4UASA 3ENQA 4BJ6A 2PTGA 2P2SA 1YE5A 4HUJA 2NW6A 2FPMA 4EMBA 2PE5A 4ZAFA 3F6PA 1H2EA 4PHFA 4AG6A 2YQ5A 3QXXA 2XDWA 1BXKA 2JZOA 2A0UA 1N1GA 3C43A 3VKUA 3PUIA 3VVBA 2RK6A 4MGIR 3TOSA 2OB2A 3RKSA 2W0MA 1U4OA 4FHGA 4G1CA 1DTWB 4GICA 5PNTA 1C9KA 2YY7A 1M54A 4ZOLB 3AB3A 5DT2A 4ZHQB 1MGPA 5AJYA 2EEZA 2FSVA 4LNAA 5CFNA 1O8CA 2D5BA 2AB0A 3KRTA 3L9XA 5H68A 2H51A 5FI5A 2A6PA 1VCIA 3QVWA 2PX8A 4KFCA 1E3EA 6CHYA 4KR7A 1VKNA 5TXGA 3FOWA 1XZKA 2BFCA 3LKVA 5HF9A 5IVHA 5TQ0B 3L0BA 2DHQA 1WX1A 2ZI3A 4KWCA 1E1LA 4UD2A 4R2MA 3UUEA 1YCFA 2B2NA 4NDNE 4KR6A 1II0A 4N18A 3ZLVA 3BEOA 4P86A 2XGJA 3MGKA 1E5QA 4QBKA 5HEKA 4ADSG 4PBSA 3TG2A 5F77A 4RD4A 1GHTA 2W6NA 1SBCA 3AIIA 3LIIA 3LBFA 3MN1A 2HJ9A 5KOHB 3CF4G 3DZ8A 5LA6A 3K2EA 1TADA 4S1OA 4Y1RA 1K8YB 1SG0A 4R3NA 1T15A 4KXVA 2VTBB 1J1UA 3HP7A 3GB9A 3S5JA 3NIGB 1AB6A 1YKFA 4BZQA 3K1YA 1AE1A 2H4JA 1VI5A 2VF5X 3RQSA 1UBTS 3QXCA 1GXSA 4FZVA 2HF9A 1QHHA 2F2TA 3HKEB 3M83A 3O93A 4EW2A 1K66A 2NU6A 1VMAA 1WQ4A 4TV8F 2JLWA 1MH1A 1QFXA 3W4KA 1KY3A 1RMYA 1YNOA 1FDOA 3CU5A 5KYXB 3KQUA 4KFSA 4M1OA 4MKRA 4CM8A 2Z43A 2OP0A 1SKAA 2X0IA 4J16A 5TLSA 2GB4A 2PKXA 2BLLA 2OBXA 2XUPA 2H1VA 3TD6A 2DZDA 3IT1A 2V74B 1SH7A 3H5RA 4MHSA 3D64A 4UNSA 2HBQA 3TJRA 1I3OA 4L8FA 1CUSA 3VX4A 1J25A 3Q8MA 3QXJA 4NECA 1MABA 2Q3MA 4BGEA 1ZUD1 3L2OB 1FSGA 1KGDA 3DPIA 3Q9UA 5CBPA 1P8JA 3FVQA 4MO2A 1KRHA 3FSEA 1Y4AE 4QGHA 3U3DA 4ETWA 2VDWB 5K3BA 1QRAA 1JQ5A 2HFJA 2BFOA 2VTKA 3HFGA 3M5PA 4YN3A 1Z6XA 3SSAA 4NV1A 4OMDA 1XQ9A 3DZCA 3EIWA 1YHYA 1DLIA 2V0NA 5DRYA 2ZUFA 3HN6A 1W4CA 5B2ZA 3K9NA 1JTEA 2JJYA 4V0QA 3G8YA 1V41E 1Q0PA 4JT9A 1L5NA 4OXIA 3IR7A 1SIBE 1V7QA 2IDZA 3FMOB 2EJVA 3OY7A 3UJNA 2IS1A 4ACBA 4XRRA 1VL1A 5CIYA 4J4BA 2Q28A 2WZBA 4Q4DA 4QD3A 1JVSA 2XYVA 5J4VA 2RHGB 2RI6A 4JN6B 3UAGA 3AJAA 1Q1GA 3MT9A 3VPSA 1U9CA 1M0TA 1U9IA 2YJ6A 3CRNA 4HSEA 1ND5A 1GR0A 1HV8A 4K6FA 4PS1A 3MJSA 2QUZA 3V48A 2EYQA 4AN0A 1S7CA 2DR3A 2VSFA 4YUZA 1ULUA 4X60A 2FZKA 1TT7A 4RVFA 5A06A 3LY7A 1GU1A 2E1RA 2HA7A 1C3VA 1H22A 2REBA 1AD2A 4FHDA 4NI5A 2R47A 1PDOA 2QUAA 5T8KC 1KQOA 1YUMA 4JZKA 1BXGA 4FYMA 3ROGA 3U9LA 3T1HB 3S28A 5JANA 3NG1A 3GLIE 1G64A 2WHEA 4QOSA 3E27A 3QU4A 1PV1A 3ZHSA 3B1FA 2HFKA 1XLTA 2PXXA 2VPQA 3M6XA 1XMVA 4LBWA 4UFOA 2D06A 4UE6A 4YUWA 1EGVB 1GYPA 1OCEA 1J2UA 1X7GA 3E8SA 3PI6A 2AFIE 4F45A 2HY7A 4ENSA 1UT8A 4JXJA 1ECBA 2FFJA 2ZJOA 5DNVA 2CBZA 3WB2A 5HKAA 3CZ4A 1AHHA 1T6ZA 4N7JA 3UMSA 3LX6A 4AKSA 5L45A 1ZD9A 2HMVA 2R68A 2A59A 1GGFA 3EHDA 4C08A 3TOZA 4DGQA 2BJWA 2OXRA 3OPNA 4G65A 3U26A 2HMSA 4ZA2A 3VDNB 1VPVA 4G8CA 4WMLA 4EO9A 2CVOA 4CBVA 4DMFA 1UOQA 5AVVA 4E94A 4CMIA 1NAHA 1OFGA 2I6SA 3GH1A 3CLTD 5J59A 5CBKA 5IJ9A 3CVVA 4LISA 3B6ZA 3H2HA 1MPTA 2BJVA 3E9DA 2PD4A 1LVGA 3DMYA 5FBKA 5IF3A 1GZ6A 1L5VA 1P17A 4BEJA 3L82B 1PUXA 2IUEA 3A1SA 8OHMA 3F8WA 2ZRDA 2IS4A 2JLCA 4JJ8A 3DMRA 5DJ5A 1W76A 2PRSA 4BECA 2BP7B 1N8TA 1AUQA 1POXA 5KYUB 2FSGA 3NU1A 4HLUA 3NEPX 2QIPA 2FRDA 2GMWA 3CXRA 1SD5A 1K4YA 1SG6A 3C3AA 3DTNA 1AHPA 3KAPA 3SN6A 4KXUA 1GZ7A 3TZBA 4BZXA 3R5JA 5KKAA 5BWOA 4R01A 1VKZA 4NIMA 1R6AA 4P0QB 4IGAA 1SPBS 2Z04A 4US0R 4LOAA 1MEEA 3RT9A 4H7HA 3KZXA 2PV7A 4O8ZA 3RSHA 4F06A 3I5YA 2CV0A 3LSYA 2BR5A 3L0YA 3EXFA 3LFTA 3FFWA 1V71A 3RVLA 3MTGA 4FM9A 2WT4A 4QVIA 3KU4A 5EP2A 2XW6A 3E7XA 2VA9A 4HXFB 4N6GA 5EPEA 3T4UA 2FKAA 3AJ8A 3UT6A 2GN9A 4LX8A 3RTGA 1D1TA 2ZM5A 2FMHA 5MGBA 2COEA 3EMKA 4JP3A 5DBGA 5BNTA 1HETA 3T4XA 2FLKA 2UUBB 1NKTA 4UQPA 2YXEA 3D3WA 4PANA 2R5WA 4IXMA 5JR3A 1LK7A 1FC0A 5B37A 4FGLA 2FMIA 1ZGHA 3GDOA 3QF7A 3W3AH 2CLSA 2W4QA 2FMFA 4LHVA 3A0UA 3QX9A 1TT5A 3A3OA 2TECE 3I1YA 1WKBA 4KXMA 1XCJA 1J0DA 4BRSA 2IUTA 5FUXA 3NUGA 3OQOA 1DG1G 3K6SA 5BV1A 4PCAA 4WADA 4Q15A 2GM5A 4YJDA 4DM3A 4LZLA 1U28A 1YDFA 2WC1A 3H9UA 4X1OA 1N7HA 4V0OA 5FL7A 5FAXA 4YRBA 3L0OA 1Z6YA 3JALB 1IJBA 1EK5A 2ZATA 3UY4A 3VUEA 1LS1A 3G6WA 1E63A 3JS5A 3FNEA 3MYRA 3SM3A 5EXXA 2QV7A 1DOZA 1U28C 4AO6A 3JZAA 4KV7A 4MGEA 3TLGB 3ZWDA 3HS3A 1G0OA 5MF6A 1IBMB 1EP3B 2PQMA 4NAVA 1G5FA 3L6RA 1MVNA 3IOMA 1RYZA 4FDAA 4EM6A 3JARB 3V2UA 3W2HA 1K7EB 1JU3A 2QPAA 4CKYA 2DUWA 4OSPA 2VF7A 5HKKA 4DMCA 2XEXA 1OIWA 1TE2A 4YNBA 1NV9A 3WB1A 1ZN9A 2SICE 4EWLA 1W0JD 1ZM7A 2J3LA 3BH7A 5JSQA 4YYZA 1S8OA 1ZPDA 2ESRA 2WAYA 3B5IA 3FETA 4K05A 2RGXA 3RVPA 4HDQB 4HDSA 4OK6A 2VH1A 1KYVA 1XXHA 4YQZA 3KK0A 3HGQA 1RE1A 3IA7A 4XEHA 4WY2A 3K4PA 3AF6A 1XO1A 1YU6A 2BMWA 4GIBA 4OHCA 4D42A 2PNFA 2ZITA 3H3XA 3ZOZA 5LQAA 2XJ9A 2C2WA 2EQ5A 3AB7A 4PS0A 3FYTA 3QEAZ 3FVRA 4BCDA 4Q16A 3N8HA 2CNOA 4TT3A 4DABA 2BBSA 5C3UA 2FZCA 3HB9A 5BORA 2P4EA 2B1RA 2ZT5A 3TPFA 1Z4LA 2AOXA 1O0SA 3K0CA 4IKEA 1B76A 3HPQA 1KVRA 1W34A 1SUPA 2VCEA 4IH4A 4MVJA 4UHKA 4A03A 4AXXA 4EF4A 2G5PA 2OCAA 1C1DA 2V59A 4AZ0A 1R9MA 3BBPA 4LE0A 4XM0A 2YOFA 1WXGA 1PEAA 3D3KA 5C81A 3LC2O 3GUVA 1KYTA 1OBVA 1MAVA 2J9YB 1FFYA 2H4XA 5C1OA 1M6VA 2FCRA 1KI9A 2Q3LA 3H5LA 4RD2A 3JZMA 4G1MB 5FBZA 2WKPA 1TCBA 1RJEA 5DLQC 2E4UA 3ODPA 4ECEA 5AJXA 5AW1A 1A5SB 5KREA 3IMGA 4Y0NA 4CGZA 1Y82A 2H5LA 3OE5A 5JC1A 1GZHB 2DXIA 3ABIA 1NMXA 2JIPA 1WJGA 4KU4A 5AJHA 4D41A 4UAVA 2OCPA 5TC4A 4N5IX 3NASA 4QJIA 2CFOA 5D7NA 1BG6A 3IBGA 4ZANA 1D0IA 4A82A 4EB6A 2E55A 4F7WA 1URPA 2H08A 3BHMA 3IP6A 1AQ6A 4RVGA 2NU6B 1J0CA 5FTJA 4I3HA 4EG7A 3DTVA 1RXEA 4DADA 4PVDA 2ZUDA 3ZVLA 1RTTA 1RTKA 521PA 2AXNA 5AOVA 1K88A 2GEBA 3GA7A 4MQFB 5EE5B 4PO1A 3EGXA 5HF6A 5K3FA 1A9PA 4WNCA 4COOA 1SXIA 1Z6QA 1LPPA 1QKIA 1FXUA 1EFHA 3HXMA 2A0XA 1JJFA 2OGWA 2HGSA 4WA7A 5E7JA 3UKDA 1K7YA 4H3KB 4HAOA 1YQGA 3ETDA 5IBQA 3T9EA 4UFPA 4OGLA 2GAJA 2Z6VA 2HIMA 3DR3A 1SZPA 2FOXA 3ESYA 3W2GA 1NRIA 4I1SA 1ULSA 2A58A 3GC6A 3ZV4A 1Z4IA 4BX0A 2JFNA 3H11B 3S2UA 4ZTBA 2COKA 2ZRJA 1PF7E 1RXWA 2UUOA 1JDVA 4HXEB 4PO9A 3V4VB 3H13A 5BN4B 3GD5A 3ER8A 4GYJA 4DMRA 3ASZA 2H2DA 2PEZA 1LRKA 3FYDA 3RRBA 4MAFA 1JFFA 3KQSA 1TU4A 3FCYA 4IGFA 2NYRA 1X8XA 1OH5A 2BEWB 4EPRA 2Y1KA 4PVCA 4FI3F 1ULAA 3FTCA 3FY4A 3OFND 4ITVA 3U4HA 5F7JA 4IIHA 3DE5X 2F9MA 1G7TA 3OQMA 1I94B 5AK3A 5KNBA 4OHYA 1C3JA 3F4LA 2VSYA 3AF3A 3AI1A 4UTXA 4CMCA 2GZRA 2O7SA 4EZIA 4MB2A 3KOYA 5AKIA 1J4AA 4MWCA 2ZCUA 4FQ8A 4RFLA 5GJCA 4U3JB 4Z4HA 3JATA 2PY6A 3TI9A 1OGIA 1T35A 2OMEA 4Y6LA 3IXLA 5A5VA 1H8ED 4TTTS 5BRNA 1M34E 3WA6A 1TM7E 2X77A 4IQ4A 2YN4A 2RGCA 2PX0A 3GQVA 3SNHA 4C03A 3WSVA 5BVGB 3IMEA 4DE5A 1HE2A 1YZTA 2DHEA 2W6CX 4YT5A 5LQNA 1PN3A 2ZJ4A 3I72A 4PPQA 3W7AA 3KQOA 4ER5A 2HQBA 3AWIA 3BWCA 4LA4A 5DYNA 3GLGB 5KOYA 3AUTA 3NIDB 3EIXA 3GPCA 1QR2A 2IW1A 5AI9A 5EPUA 4C6RA 2A33A 2A14A 4YAEA 4OLAA 3O9ZA 2R8PA 1X1QA 4L9WA 3GT4A 4X8HA 3RBAA 4O59O 5M29A 3WLPA 4QX6A 2BMDA 5HRAA 2RHMA 5A5EA 1QPZA 1G5QA 1IPFA 1P5HA 1XWFA 4PYNA 4YHBA 5AJTA 4CN9A 5HUHA 1IPHA 3Q3VA 2MSNA 3T3NA 1WV0A 1B23P 4RJJA 2BYTA 3RFTA 1J5PA 5E7IA 1XZHA 4H7JA 1X13A 4NJMA 1Q74A 4PHGA 5G1OA 4KB5A 3VHRA 3ZQJA 3P5BA 1EFPB 2EWMA 4E7OA 5A9TA 1QANA 2W37A 3WTCA 2IT1A 3FTNA 1TD9A 4R9UC 4PNEA 2XZPA 1VKHA 4IEEA 1NJ2A 1PSDA 1SELA 2Y9MB 3HJTA 1NF9A 5CK5A 3NWJA 1Z36A 4JI1B 1JIXA 3IKVA 3NJRA 2Q1UA 1V8BA 3LG2A 2ZT6A 2AFRA 1CY8A 2D1RA 1RZUA 3OCUA 1R2QA 3D7LA 3CSDA 2E49A 1AV7A 3OSZA 2QG9A 5TR9A 1VYUA 4RGBA 2MMCA 4GKBA 1J24A 2QN6A 3R20A 2B5VA 2RGEA 5FQNA 3AJDA 3N2LA 1FNBA 3MUNA 4QELA 4AMUA 1N0WA 1SWWA 4NYJR 4F6CA 4AS2A 1IZ9A 5K0FA 1LPNA 2JH3A 3GLHB 4E4TA 1X19A 2SECE 3NMUF 3SNKA 5CNJA 3RB8A 4OXKA 3FMFA 1EGAA 2ARKA 3DT6A 2ZBEA 3H4VA 2ZI5A 3L0CA 3QU2A 2FETA 2IPAB 3G0CA 2FE1A 4WTOA 1T5LA 1Z62A 2E21A 3HEBA 5FHQA 4TN5A 4WASA 3T41A 1GCOA 4CF5A 2HDNB 5JIBA 3RUAA 3OQPA 4D4KA 2G9NA 1ESMA 2BM9A 1A04A 3W0LB 1ISMA 2QRHA 3C1OA 3EC1A 3S6JA 3AI2A 2JFPA 3AKEA 1R74A 2F9FA 1WCXA 1YVUA 5FUYA 4XR9A 2CXSA 4HC4A 5TMDA 2Z2XA 1T8YA 3KT8A 4RHTA 5EE1A 3UW3A 2QU7A 3R0QA 4GDMA 1ETUA 2E5FA 1GG9A 1FTQA 2X9NA 5DB4A 5IHPA 3VBCA 4PX5A 3O3MB 3P2JA 4RK7A 3L0SA 1J23A 5B7GA 2H0AA 1DAEA 4N82A 3QA9A 1XL1A 2J7PA 4XTRA 3CW8X 4FXPA 3WB0A 2UAGA 4IJ6A 5DGXA 2OV4A 2OBYA 5C4IA 2IXAA 4UM8B 1M34A 4LXUA 1Y9ZA 1N1EA 2PD6A 3MA0A 1D1PA 1IHPA 1R0WA 1U3GA 4NXMB 2GAIA 4URVR 1Z4PX 3CLHA 4GR4A 2R1VA 4PQFA 4UAGA 1WPRA 4AAYA 1A77A 1BE6A 3HFJA 4ZV7A 4F2DA 4ZYVA 1FNCA 2I3DA 3B36A 1OVGA 4CCWA 2GN6A 1DX4A 1ODLA 2BCEA 2G17A 2GJ4A 2MMGA 3TM5A 4XI9A 1C1DB 4JUAA 1W73A 2HRBA 3E15A 4QUIA 5FBQB 2X9VA 4GZ5A 4JLDA 2QRMA 1OROA 2HLHA 2XUDA 4PYQA 5CYFA 3MWFA 1G7SA 1IFXA 1NE7A 1YSCA 2R6R1 4WH0A 5KU1A 4I5GA 2BGGA 1U3TA 3WL4A 3EGEA 4NCXA 3D3JA 1SC4A 3NJ8A 2J8ZA 1HOXA 1Z7YA 2EV9A 3NQ41 1U3WA 4JJAA 3SIRA 1NV8A 4NMLA 3RTBA 2J3EA 2AVDA 2I78A 2O3RA 2WPDA 3FKQA 3GRYA 4R2KA 2H2WA 5EZYF 2CF6A 5K0TA 1RYBA 2YZKA 2XVAA 3L7YA 4ESHA 1TEHA 4D3YA 2WF9A 5L3ZA 2HSEA 2WYUA 3KKZA 4G0ZA 4BBPA 4I55A 1TM3E 3KD3A 3B13B 2OFFA 1UBLS 3GJTA 1CJSA 3JYHA 3TSWA 2Z5GA 2ZJBA 5ICSA 1IQPA 4MRMA 5IMSA 1QYDA 2YVLA 4H7DA 3WDSA 1T5DX 3SSMA 4JENA 3QMWA 3SQXA 1M6EX 1NUUA 3UZUA 3OLCX 4L0MA 2HU2A 3IKLA 1Y6ZA 2Z4RA 1E1QA 3RFVA 4EY4A 1FSPA 5AM5A 3INGA 1T1IA 4LF5B 4UPDA 3QOFA 2PX5A 3HUDA 3DFFA 2D4AA 3OX3A 1R50A 4FJ0A 1F5SA 3ZS9A 1C7IA 3BMNB 4IXDA 2D5AA 3EXG2 4PGAA 3PXGA 1M2HA 1C7JA 4XYMA 1JGTA 3VMFA 3U6KA 1UBFA 4N3BA 2XITA 4LHWA 3PYXA 1GL7A 4PYRA 3DW1X 4JI4B 4ALLA 4GGPA 2C9ZA 4NWIA 4RXTA 1DIOB 2PJDA 4BQEA 4M1YA 2PMEA 2DQKA 2O2ZA 2WTXA 4LRTB 2A5LA 4YT8A 2DBYA 3CKYA 1GG8A 2ENWA 3WNCA 2GXUA 3IP8A 4HTFB 1QMPA 3NHYA 4OU5A 4HUQB 2G83A 4WKBA 5BN4A 1YFLA 2WG0A 2OXCA 4O4IA 3AESA 2ZR7A 2LW7A 1QYRA 5LD2C 2RIRA 2RHJA 4TMYA 2V0GA 2WV9A 2PH7A 1HMYA 4UHFA 4IIUA 3DKPA 3F7TA 3TJZA 2DFKB 1GQYA 1H4QA 5ALEA 1P9OA 5FCDA 1A5BB 3FCSB 4K9NA 2WYWA 4D3ZA 4D4LA 2CXOA 2VZ8A 3T1VA 3IEKA 4O4LF 3C6KA 3L41A 4IFEA 3T7RA 4P58A 3HNPA 3QLUC 5BO5A 3BTSA 3P0FA 4FR0A 1QTRA 3LQKA 5AVJA 2IHZA 4K9QA 3ITDA 1HK7A 3OX2A 3DMNA 2Y27A 1GPBA 4H59A 4TV8B 3CR8A 4C2BA 4JYPA 1THZA 5CJJA 3R7WB 3BGIA 3TXYA 2XNJA 2GR9A 3FGZA 1U1GA 4IKPA 4J1TA 1NAIA 1WZIA 2I80A 3LPLA 4Q1BA 2E48A 4WW0A 4XCXA 2NWQA 3R5HA 4BS9A 3GP3A 2OBFA 3GVHA 1NT4A 2IDJA 1P6QA 3LPCA 4C1NA 4KXXA 4HNTA 2GETA 4G26A 1GGNA 4ND3A 2QL5A 1ZKDA 4GECA 3KQNA 1T2UA 2ZJ3A 5I6DA 2P78A 3FPLA 4QPNA 3JQAA 3ZGOA 1QRRA 2H2HA 1H6DA 4GZ3A 4DLYA 2V0CA 4O2AF 1JI3A 4KBYA 1NFFA 4QXQA 2EHDA 4IHJB 4KLRA 4BMSA 5CFZA 3PGLA 1W35A 4I4TF 1PR2A 3NANA 2ETXA 2GJSA 2GCEA 3DOHA 3KWFA 1K8QA 4G2NA 2LUOA 3BSFA 1J97A 2IYWA 4C2UA 1T0BA 1ZITA 2BGLA 4WOCA 3VJKA 5LM3A 2ZM6B 4QUBA 2B21A 1NLMA 2AEJA 2X4GA 5AI0A 3V7UA 5K01A 3V3KA 3D3QA 1CIPA 1FDWA 2ZW9A 3KQWA 4G97A 1NY5A 1PT9A 3OIYA 3O26A 1H94A 1LBSA 1OJ7A 1CQIA 2BTOA 1OWMA 2QP9X 3LQYA 5HF8A 2C5AA 4GC5A 3T9FA 3R1IA 5AVZA 1XRLA 4YP5A 3WJ2A 3EDQA 3RYFA 3UOWA 1B2LA 2X6TA 3LF1A 2IYRA 5CFQA 4OKNA 2JK0A 4W9NA 2AHOA 3P9CA 2C7BA 4I4IA 3MQ4A 1KEEA 3BIWA 4BKUA 1T1JA 4F1JA 4FFWA 1T3SA 1SKMA 1ZINA 1NQOA 2GF2A 3L84A 4WXYB 3Q98A 3TOCA 3A6EA 2AKEA 3K5WA 3L1KA 4E14A 2VNJA 1EHCA 1HLDA 4P0PB 2W6MA 1JHQA 1TUGA 3Q0EA 3PGJA 2RH8A 1U90A 3QYPA 3SQWA 2RGBA 2X0EA 4ZJYA 1WCIA 5AIAA 1IY9A 3L8YA 4UVGA 3SHVA 5IFKA 4MIYA 3AOGA 3ZEIA 2WJZB 3EXHC 1KAQA 2O7RA 2ECFA 3FLAA 4JQOA 4DMUB 1OBOA 3W9UA 3WC4A 5JBQA 1P61B 1U8YA 4L7VA 5JVDF 4BZWA 2P91A 4O4JA 5B4VA 3WYDA 3U44A 1O6BA 1OR8A 2ECKA 4O33A 4REOA 3RYTC 1CVRA 4ZCMA 4TTIA 5KHOC 3EXHA 1EJ2A 1JU4A 2EL9A 4PWYA 3TZEA 3BWEA 2BF4A 4G0WA 2IEYA 2QX7A 2RK3A 4XAQA 3TB6A 3FCXA 4TV9A 3B2EA 1CS0A 2VG8A 1IL0A 3DL4A 3IVGA 4F5DA 1AKWA 1U63A 2A1TS 4WBNF 3FAZA 4GG1A 3I6ZA 3LCMA 4LE1A 3I2FA 1J1IA 4GPBA 4BGIA 3SVLA 2ID7A 2YFHA 5FB3A 4NH0A 4DY6A 4JL5A 1DTWA 1PL8A 1QGYA 4QWWA 2G76A 4ZHQA 3N0WA 1LQTA 4X63A 1L7VC 4MVJM 3DL7A 2AR0A 2J9ZB 3LX4A 3ZIAA 2I34A 1V7PC 3CB4A 2Y6VA 4V24A 1TT5B 2WUWE 5CFRA 3OLQA 3S3TA 4PC7A 1F3OA 1Y3BE 4OKSA 1TO1E 5THXA 5FNZA 1G55A 1FJ2A 2Z58A 3PRKE 5CXXA 2IPXA 3HB1A 5FI3A 3IUBA 1A4RA 4L5AA 4WZBA 3ND8A 3VR1A 4F86A 4KH0A 4WCFA 4UOQA 1AC5A 1KK2A 2OYCA 3REGA 3HCDA 4OJNA 1TGVA 1K3UB 4Y2GA 5BY2A 5K8VA 1O0BA 1NM5A 2NAPA 4MPRA 3O9VA 3P2EA 1V43A 2ADOA 3SJCA 3JZIA 2IY8A 2CFCA 2OCKA 4GNRA 4WFKA 1U2GA 4DW8A 5DNYB 4H1UA 1E1NA 5IDWA 3W78A 1EHIA 2YNMC 1GAWA 3GWGA 4LJKA 3MB5A 1Q0RA 4CG1A 1AZLA 3L77A 2EIHA 3NAGA 2BVNA 3E1GA 3O31A 5DCYA 3BRQA 1QH8B 2XUZA 3OU6A 5FUBA 4B1FA 1I0LA 2YJ3A 4ZQEA 3T7AA 1YZLA 2IBTA 3NLLA 1MT3A 3T7DA 4M7OA 3FPAA 4HNGA 4OHPA 3AQIA 3C41J 1C1XB 5KJCA 1FZQA 1IEVA 4ZOCA 2GPNA 1EVQA 2LIVA 1KZ7B 3E3NA 3IUMA 3LGXA 5J5AA 2O52A 3I6BA 4G9BA 4X20A 1OPRA 3UGKA 5D00A 3VOTA 3Q72A 4QEZA 2AZMA 4EMUA 3MOGA 4FFSA 7MHTA 4EYKA 3U3KA 1N6PA 1KPHA 1SC1A 5AVUA 4QE3A 4DMGA 1UT5A 4PSAA 3V6LA 4DPMA 4XR4A 1AUXA 5EJ2A 1JXMA 1UJ6A 3BGWA 4FGZA 1WQ1R 3ZBPA 1WF3A 3R0XA 2MR6A 3B9BA 4RY8A 2Q9CA 4LWOA 5MN5A 2V5UA 4Q1AA 4J4HA 3A9UA 1JIVA 2DTEA 3PCRB 1XZ8A 3Q3HA 2ISQA 1ZH4A 4ME6A 1E6WA 1WBJB 5LUBA 4Q9IA 2ZTLA 4LG1A 1GPNA 4Q1VA 5B4UA 3DEYX 2WWVD 4QPJC 3WR5A 4U7PB 1UK7A 4E33A 2B5WA 3Q87B 4JBIA 4OLJA 4LMPA 2J9XB 4Y2YA 2Q7DA 1QP4A 2IXEA 5KWIA 3DUFB 3CH6A 3FUCA 2G04A 1OI7A 1U9YA 3C6BA 3KB8A 1OX4A 1ZCZA 2VJMB 2EU8A 3R4VA 1SCJA 3AL3A 3UKOA 4YMGA 1W4BA 3ASUA 1DRVA 2ZVJA 3H7IA 3MMNA 3UNXA 3ZHQA 1OFIA 4DARA 4ER7A 1HR0B 2WSSD 2QX8A 3SHWA 4FK8A 1VIAA 1ZW6A 2ZSJA 3QFFA 4X90A 4N41A 1LDGA 3WL3A 3UGTA 2NVUA 1OE0A 3CE6A 1GTVA 5G4KA 3UHOA 1Z4OA 3KIPA 4XD2A 3S99A 1GLVA 4CCYA 5DNAA 2OZLA 1Q15A 4KRFA 2FLWA 4TOIA 1ST3A 5JSUA 1HGXA 1U0HC 1TMGE 3S1LA 3WOVA