3KB1A

Crystal structure of the nucleotide-binding protein af_226 in complex with adp from archaeoglobus fulgidus, northeast structural genomics consortium target gr157
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
255
structure length
243
Chain Sequence
RVTDEDIKERLDKIGFRIAVMSGKGGVGKSTVTALLAVHYAKQGKKVGILDADFLGPSIPHLFGLEKGKVAVSDEGLEPVLTQRLGIKVMSIQFLLLIAGMIREFLGRVAWGELDYLLIDLPPGTGDAPLTVMQDAKPNGAVIVSTPQELTAAVVEKAITMAEQTKTAVLGIVENMAYFECPNCGERTYLFGEGKASELARKYKIEFITEIPIDSDLLKLSDLGRVEEYEPDWFEFFPYLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target GR157
rcsb
source organism Archaeoglobus fulgidus
molecule tags Nucleotide binding protein
molecule keywords Nucleotide-binding protein
total genus 60
structure length 243
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10609 ParA NUBPL iron-transfer P-loop NTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kb1A01
3QF7A 5LBIA 4H9GA 2GJAA 3LVQE 1WP9A 5EE3A 4AG5A 3I73A 1DELA 1I4TD 1GL7A 1G8PA 2PEYA 4OI1A 3X1YA 3KXIA 4G5QA 4TLEA 4TL8A 1WQ1R 3IBYA 4C0QC 1DTSA 1YKSA 3FTQA 1KK3A 3PEVA 2YOGA 1QZXA 3WY9A 1YZTA 1AJEA 2VHUA 1XD2A 4HEJA 4XVUA 2AL7A 4XSGA 1KNXA 2DHRA 2IL1A 4BRUA 1G7TA 4LBZA 3T1OA 3ADCA 1GNRA 3QKTA 4EPTA 4DT1A 2O8FB 4BFTA 3UG7A 2ZU0C 4DSOA 1W2GA 3QKRB 4URUR 4LCBA 3QE0A 1P60A 3KJIA 1MOZA 2V7QD 1XX6A 4OBEA 1X8JA 4K46A 4M9ZA 1UBEA 3D7MA 1ZCAA 3BIFA 3B9PA 3U4QA 1KGDA 2OG2A 1E6CA 3GJ3A 2HXSA 1VYUA 2R6DA 2QY9A 3K0EA 3EARA 2XZOA 1G21E 5BYKA 3PEYA 4RD3A 1E2MA 3HYTA 3SZRA 4BLRA 3SHFA 2B92A 4DIDA 3LBNA 5M04A 2FSIA 3CNNA 4Q4AA 1W0JA 2VIIA 1AIPA 4A15A 1KMHA 2GXUA 2GF0A 2YYZA 2JDIA 2ZETA 2LKCA 1SQ5A 3DKPA 4XD7D 3DHWC 1VIAA 3FPAA 1CEEA 2W6JA 4DC9A 5C18A 3E1SA 2YHSA 2OT3B 3KFXA 4A36A 2O0JA 2JLYA 5JHHB 1RJ9B 2PL3A 4JIMA 1XNJA 2KSQA 4NE2A 2V6JA 2G6BA 3LNCA 2A2ZA 2BJWA 2QROA 2ZU6A 1TQ4A 4LY6A 4A0FA 1KO1A 4Z54A 1P61B 3D8BA 4A2WA 2WMNB 1OXUA 4UNQA 1G64A 4HDCA 5SZKB 4B73A 4C0JA 4FWTA 3QVVA 1N6PA 5FBQB 5FTKA 5C2JB 1KZ7B 5L3QB 1E2IA 4TMWA 3AP3A 2Q3HA 3TJZA 3LLMA 2WJHA 5ELXA 4F4IA 2RGNC 3TSOA 5JHGB 1GNQA 3K0FA 1G7SA 1RVDA 2WWYA 2G88A 2N42A 1G3RA 2XX3A 2YWHA 4BZQA 1II0A 3W3AA 4Q1AA 2EFCB 3O8BA 2HF9A 4FN5A 4KU4A 5C4MA 4HB3A 1M74A 2PX0A 4PQYA 4D6PA 3AVUA 4JLAA 3ZJYA 2ZR7A 1UF9A 4Q47A 4Q1CA 4XIGS 2YNMA 3DOEA 1OPXA 5FL3A 4RSGA 3I32A 5FI0B 4CF7A 5K8IA 4YDSA 5HE9A 1A1VA 1R7RA 5JI2E 4D26A 3QY0A 5GJWC 2RCNA 3GJXC 1G3IA 3K09A 1GIAA 1D2EA 3WNCA 1KK1A 3EAQA 1ZC3A 2DYKA 1OIVA 2RGXA 3RDPA 2FF7A 2JLWA 4QBHA 3PVSA 1AS2A 5KHOC 2HJGA 4GL2A 3DVLA 1OV4A 3VX3A 4CEIA 4HI0E 1XCMA 2N46A 4EPWA 2P2LA 1ETUA 5EP2A 3UIEA 4TYQA 1OB2A 3KJGA 2IT1A 4JL5A 2GAAA 2F1JA 1XXHB 4DIEA 4Q7LA 4HUQB 5JWOA 1DAGA 3UMRA 4ARZA 1S9DA 4A4DA 4FW9A 2CL6X 3DPUA 3KUCA 3OEED 3VTKA 3VR3A 4HUTA 3VFDA 2C5LA 1RYHA 5FUXA 2R62A 3THXA 1E1RD 3QKSB 4B3CA 2QRZA 1NVXQ 4PHFA 3KQNA 2ZJ2A 3K9LA 2PLRA 2D3WA 2IUSA 4M22A 3EZ2A 2ZVQX 4RFSA 3E2IA 2ANCA 5BQ5A 4UNRA 1MO5A 3EWAA 1JJVA 2QQEA 1WRBA 4MDEA 5KYKA 1Q1EA 4RKEA 1V43A 3MJRA 1DEKA 2O8EA 3GLGB 1M6NA 2EYQA 1NSFA 2ZSBA 3EIQA 4XWOA 2C04A 2QI9C 3RVBA 4DDWA 4LX0A 2QT1A 2DWOA 3T06B 4AYWA 1MABA 4OI4A 2NGRA 4YONB 1XFAA 3EA5A 4NYMR 4URWR 3NIBA 1W48A 1GL6A 3IGFA 5AJYA 1N6HA 4KITB 1AKEA 1XB2A 2FH5B 1CR1A 3I4LA 3CO5A 5IK2D 4QBIA 3W6PA 1B23P 3L0SA 3T35A 1EK0A 1QDEA 4XWAA 5HKKD 4IOMA 4P3YA 2J5XA 4YMSA 1XMSA 3NG1A 1EFHA 5GVSA 5HZKA 1X86B 5C1BA 3B1WA 4ZO4A 1P2TA 3FVQA 1E3MA 4AY2A 1L2TA 2BEKA 4KFTA 1CJUC 3RC3A 3D31A 4GOJA 3RSLA 2IYXA 4C2UA 3OIYA 5FL7A 3X1ZA 4IJMA 1T6NA 1XMJA 3U3JA 3U7EB 5AJWA 1VCNA 2ZE5A 3QSYA 4IXMA 3WHKA 4A6XA 2BBTA 4QBGB 3LY5A 1XEXB 1M7HA 3OESA 2IC5A 2IUUA 3AB3A 3AVYA 1ZW6A 3QI2A 3DO6A 1UADA 1CJVC 2NTYC 1SXJB 2IYTA 5G3YA 2VHTA 5TVKA 1FFHA 1JPJA 3DL0A 2ZRFA 5FBRB 1EX6A 2P6UA 1NLYA 1OYWA 3W3ZB 2C96A 4PR0A 4TSFA 4TQ9A 4L5BA 3QJYA 2GA8A 1G3QA 2Q9CA 3P27A 1OXVA 1J90A 1S1MA 2AFHE 1NY6A 1Z83A 4GBMA 2QGZA 3M1IA 1KDTA 1GRRA 1ONBA 3C41J 3CONA 2NO7A 2FZLA 5CITA 2F1HA 2QAJA 4DB4A 1XTJA 2P5TB 1H65A 1E4VA 4DLTA 1Y3AA 4U5XA 2O8BB 4BASA 3GLHB 1F60A 2HJVA 5FOUA 1KAOA 4PO8A 3LW8A 2MSDB 5BN4A 1WMSA 1II9A 1Z63A 2EFDB 4Q21A 3A4MA 2GF9A 1JALA 1H8HD 3PR1A 1W49A 2D4HA 4RCZA 1E0AA 1P2UA 2ECKA 2Q3FA 3AM1A 3CRVA 5EQTA 3Q5DA 3QPWA 2WMOB 4Q9IA 3K09C 1NKTA 1T3HA 4M1MA 2WOOA 5H68A 3LX8A 2V3CC 1SHZA 3NEJA 2EFHB 3U3RA 2V1XA 3TQCA 2ZJYA 2ZI4A 3SE0A 3L8YA 4CT4B 2GNOA 1VCOA 1G8HA 1GUAA 2ZTSA 5J4VA 5KDOA 1GITA 3GLIA 4FMCB 2RAPA 3LA6A 1UDWA 5TV2A 2ZUCA 4Q9KA 4MYCA 4D4MA 1S96A 2JJ1D 2NQ2C 3A8TA 4NPHA 4O2LA 3HU3A 4A0GA 3TSZA 1F48A 1E2LA 3G82C 1JB1A 2GCOA 4AYXA 2FSFA 3NBXX 4JVNA 5IDVA 5DI9A 5J40A 1Z6XA 5DN6D 5IF9A 2QE7A 4DWJA 2GRJA 1XCPA 5EXTA 2ODNA 3BH0A 3ZD7A 5DI3A 4TTPA 3CUEF 2XJ4A 2I1QA 2ZI3A 1SVSA 3LD9A 4OQMA 5KPJA 2PX3A 4Q4JA 3WMGA 2A5DA 4Q4HB 3TAHA 2AFIE 1XPRA 5F9FA 3H1TA 2OAP1 3KQKA 1WDTA 1QHXA 2RGDA 2OBMA 1U81A 2Q21A 3HJNA 4GSYA 3GLFA 1E79D 2ONKA 2ZRHA 3LXRA 4JBXA 1M1YE 4TQUS 1OW3B 3L8ZA 1TL7C 2JAQA 2PJZA 2C9OA 3WYFA 4CVNA 3PEWA 1M7GA 5HE8A 2ATVA 3JVUA 1WB9A 3QXSA 2EU8A 4CIDA 3AV0B 4Q1BA 4G01B 2QMOA 4Q1EA 821PA 2G9NA 5J4KA 2R44A 2EWWA 4URXR 4JLBA 1DAEA 2D7CA 1HYQA 3GFOA 4YQFA 5CYPA 2WAXA 3DMNA 3DKVA 2ZS9A 3IPYA 1P72A 2J46A 4A8JB 4A1FA 4FXPA 2ZRIA 3I5YA 4HLDA 2R2AA 1UBFA 2B7CA 4DLRA 4P4TA 4HB2A 4NZYA 4X8MA 1FNMA 4QGAA 1TTTA 2QMUA 4G5OA 1IJEA 1XD2B 3C16C 3DM5A 3UWOA 2Q3MA 3VKGA 1QHNA 2GKSA 2QRNA 3FFAA 4HDOB 4RZXA 3UATA 1CS4C 4AK9A 4DT1B 2O8FA 1KO4A 3SNHA 4I1SA 3TW4A 1Z22A 1T91A 1E9EA 2F6RA 4EFMA 2XSZA 2ZUDA 4JL8A 2IS6A 2HDNB 3IDQA 5L3SA 2ZRCA 3SHWA 4PHTA 1R6BX 1W46A 2IXGA 2Y8EA 4HAYA 5J4LA 1S3GA 3B7GA 3ADBA 5CK4A 4IRUB 4D80A 4RD6A 3C5HA 1US8A 4Y0VA 1NVUQ 4JSYA 1FQJA 2CDNA 2NPFA 1T5IA 1RRGA 3L0OA 1EGAA 4LHVA 3VQTA 4HLCA 3X1WA 4B6EA 1ZM4A 4X8LA 2JASA 4ITRC 1ESMA 4V0NA 2CCGA 5DN6A 3GMTA 1YZLA 2BMDA 1HURA 3KJEA 1Z5ZA 4BE7B 1GILA 1OHHA 3U3OA 4HZUB 2G1JA 5E7IA 5JRJA 4NTZA 3T1QA 1COWA 1H8EA 4IEEA 1FUKA 1XMVA 2LWIA 4CDGA 4BEBA 2VP4A 1VMAA 2W6JD 1X8KA 3WYAA 1YR7A 4IVQA 1CR0A 3TVTA 2ZRNA 2O52A 1XDBA 2CHGA 2IWHA 1PUJA 1BH2A 3GJ8A 2OXRA 5KSOA 3BOSA 4BZPA 4NONA 4YMVA 5KNDA 3Q5EA 1TUIA 2QN6A 2FOLA 421PA 2R9VA 1G8YA 1FTSA 4XTRA 2HT6A 3KXKA 4V0MA 1J8MF 2RGEA 2B21A 2ZRDA 4QGHA 1KI6A 3TR5A 1R8QA 4N3NA 2WJIA 4M4SA 3SJAA 1G20E 4B3GA 3THYB 4AKHA 4DB2A 2QEQA 3WRXC 1DBSA 1Q57A 1GAJA 2FE4A 5CDFA 2V8OA 4MUBA 1G7RA 4I1UA 3KQHA 2JJ8A 1KDPA 2ZE8A 1F2TB 3TUZC 1KOFA 5KU1A 1DE0A 3BAFA 3HPQA 2JLUA 1KKLA 4TSFD 2R8RA 1SVOA 1HV8A 2QM8A 3B13B 4G3XA 2REBA 1NIPA 1JEDA 2VHCA 4M0LA 1KZGB 5FI1B 1HUQA 4R98A 1FNNA 1Q22A 2VP0A 5TARA 4O0MA 4ZCMA 3LBHA 4BGDA 3QUSA 1RJ9A 1K5GA 1YHNA 1KMQA 3KKQA 4B3DA 1SXJA 1OXXK 2EFEB 3AF4A 1JQJC 3K9NA 4Y0AA 2WWHA 4NCJA 5EE0A 2OFWA 1ZM9A 2ZR0A 1GSIA 1ZUNB 2J9RA 5D3MA 3VR6A 4ZCLA 1KI3A 5JJKA 1NSTA 1AQYA 2FN4A 3CIOA 3A4LA 4JJKA 1UJ2A 3KB2A 3BRWD 1AKYA 4P4UA 4D2IA 3CLVA 4PC1A 3IUYA 2DCUA 4NCHA 5AK0A 1F3OA 3AF3A 2VO1A 1GKYA 4AWXA 2CCJA 3E70C 2Q9AA 1NIJA 3AEZA 3PENA 4P0TA 3A1WA 4Q1DA 4CT5A 5HKKA 4N1AA 1XPUA 3R7WA 2WBLC 4F38A 4IFEA 1X1RA 3TMKA 5C46F 3U7GA 1N6RA 3NTUA 3U60B 3K0SA 4JYBA 2YJTD 2OZEA 2G0TA 4IDNA 1MO4A 5CK5A 3HDTA 3NHBA 3I1FA 1NN5A 4B2IA 2NZ8A 4ON9A 3U7FB 4DKXA 2WPDA 1XZQA 3NWJA 1ELOA 1N0WA 3CRW1 2IYSA 2NPIA 3GLFB 2BKEA 2XJ9A 2GZHA 3KXLA 5G41A 4ERNA 2DPXA 2MMGA 1OB5A 1U90A 4URYR 5BN5A 2KBEA 3JZAA 4BFSA 2PT5A 4KYIB 4HSEA 3K70C 2XB2A 4OHVA 3BFXA 1D9ZA 2OLJA 3WBKA 2CMKA 4Q7JB 3X2SA 4OHWA 4Q7MB 3R8FA 3BXZA 1J7KA 2W83A 3SI7A 2XGJA 4M2LA 2XXAB 3QVUA 1ZNZA 4E09A 1UKVY 3RNLA 5JZVA 1NMYA 4CEIB 4FD2A 3THWB 4M1KA 2FG5A 2N1BA 1Z06A 3L0PA 2F7SA 3BB4A 4NYIR 1JXMA 2GK7A 3VHLB 2XXAA 4LBWA 4IXNA 2PCJA 2QMEA 1U94A 1NY5A 5JS8A 2VP9A 3F3YA 2GEUA 4IHQA 3FB4A 3FE2A 4MYUA 2ZRPA 3OAAA 3C15C 2I1VB 1OIXA 3NXSA 4Q9JA 4BLSA 3Q3JB 3O8CA 2Q9BA 4D0GA 2PT7A 3R9IA 4I4LA 2IA5A 3OF5A 1M8PA 3VR4A 2Z4SA 3QEOA 4DXAA 3U3MA 3LQRA 2JJ2D 4DCUA 4P33A 3NBYC 1R0YA 4HATA 4TLCA 4KFRA 4BRWA 3IIJA 1E0SA 1ZM3A 2ZEJA 3AP1A 4D82A 1KI8A 2CHQA 4LPKA 4GRAA 4ZI3A 1A7JA 4DZZA 5E4FA 3UPUA 4HZUA 5BN3A 2GXAA 4QXAA 1U8YA 5EXXA 1IN5A 2REOA 3WHLA 2ASEA 3AQ4A 3QKRA 2OUKA 4ASUD 2H5EA 4RJLA 4DUGD 4DBLC 2VP6A 2AK3A 4KI0A 1E2GA 3OEHA 1D2NA 3SC3A 5EXSA 1JR6A 1DARA 1W47A 4HLQB 1GRQA 2OEPA 2VF7A 2GDJA 4QGFA 3A1UA 2K5UA 1VKJA 3ADKA 3CF2A 3NBFA 2FU5C 4LDJA 2C95A 2PZFA 3CH4B 3EPKA 2BMFA 2FPMA 2O8BA 3ETLA 5KTYA 2TMKA 3BFVA 4MH0R 2F43B 3H4MA 3KZ1E 3ZQ6A 2FFBA 2BEJA 2GCNA 3K0FB 2G83A 1UBGA 1Z8FA 1SVIA 3FKSD 3FMFA 5DO9A 5FOVA 4KSCA 5BYJA 4X8OA 1VYVA 1YR6A 4DCSA 1IN4A 3SFZA 3BE4A 3MAAC 3A1VA 2FEMA 3V00A 3X1DA 1T8UA 3L82B 1GP2A 3CH5A 2CL0X 3I72A 2EFGA 3HR8A 4QGGA 3G5UA 4JBYA 1KSGA 3V4FA 3GLIB 2HYIC 1XBTA 1NN1A 4TYNA 4CRWB 2IHBA 1T0HB 3GPLA 3BH6A 2RHMA 3CB4A 1FPMA 2R6FA 1P3JA 5AUPB 2JLRA 3ZDQA 1N6LA 1OH7A 4MDFA 1VPLA 1YJ5A 1KIMA 2OCBA 2HEIA 3PCRB 5SZHB 3RRZA 3TE6A 3MWJA 3HPRA 3TQFA 1WE2A 3BD9A 3GJ7A 4V03A 2WJVA 3SR0A 4Q01A 5B64A 4BFVA 2ANBA 5HZHA 1TX4B 2BHRA 1FMJA 1SVMA 1CU1A 3T1VA 5BW8A 3KUDA 1OYYA 2ERXA 3LX5A 4B43A 4IVRA 1Q3HA 4K81B 4RD1A 4YMUA 2R65A 1NP6A 1O87A 2XOKA 5LDDC 4WW0A 4L9WA 5JJIA 2VQSA 2XEXA 1E69A 1F5NA 1M34E 2GESA 4R2IA 2DFNA 3SU8A 3TSWA 5CB8A 3B60A 5KUTA 2J45A 1UBCA 2H7VA 2AR7A 2IX3A 1QG2A 2F3RA 1KK0A 2RH5A 2PZEA 1FOEB 1FTNA 1UM8A 3CPHA 1NLFA 1SVWA 2IEZA 4CEHB 4NCIA 2EQBA 3LRPA 3GJ4A 4PAQA 1W1WA 2ZPTX 4GZLA 4QJ5A 4C0KA 2NO1A 2RMKA 3FMPB 1IHUA 4MKHA 4PZZA 1KJYA 2ZSEA 4URVR 1Z47A 1QHYA 2WWXA 1RRPA 3CWZA 5TB5A 2BBWA 4ASUA 4TZ0A 4HYYA 1VG1A 2WZQA 4JL6A 2UZIR 1PV4A 3ASYA 4AKGA 1A2KC 1XU4A 2FNAA 1NRJB 3SEAA 3FHTA 1OXTA 5EE1A 2VEDA 4ZIRA 4PXAA 2WKRA 1K8RA 3N2IA 4HDQB 3QENA 4R71A 3ADDA 4NCNA 5D3QA 3UWKA 5CDFE 4LZZA 4Q00A 4PZLA 4EJSB 4JLKA 4MRVA 2BJVA 3AKDA 3CKLA 4NYJQ 1XPOA 1LFDB 3KTAA 1FX0A 3U4QB 1SVKA 4P31A 3WNDA 1KDOA 3LDAA 1PLKA 3W8RA 4B6FA 4LJ9A 4PFSA 1XMIA 2HLDD 4C0HA 5EXPA 3EZ9A 3VKHA 2LKDA 4GPTA 1GTVA 1L4YA 2BKUA 4LSGA 4LOAA 4ZV4A 1YU9A 2H16A 3ND9A 1JAHA 3RYTC 1G18A 3MG9A 5F2EA 1Z6AA 1KMHB 3BFKA 5B2ZA 2W2XA 1TNDA 2YC4C 3K70D 2REXB 1JXOA 1XJQA 2YWEA 4W5WA 3H2YA 5DSZA 2QENA 4S2EA 2C78A 5G40A 4OK3A 4JZKA 1ZAKA 4KLNA 5FR1A 1E1RA 5TY0A 4FINA 2EYUA 1V5WA 1CRPA 2P3SA 2JIZD 3V4RA 5CIQA 4PC2A 3EXAA 1G3MA 4JLPA 1CKEA 1RYFA 2WAYA 4GOXA 4EKDA 5DGXA 1ZCBA 2HCBA 4WBSA 5F9HA 4OHXA 1TPZA 1PUIA 2F9MA 2DFKB 4DSTA 4A92A 1LB1B 1S8FA 3AKEA 4TLDA 1YZUA 5SZIA 6Q21A 2WSSA 3A1SA 4HB4A 1XCGB 1MRSA 1DOAA 1N5KA 1FW6A 3U61B 2V4ZA 1JEEA 3K0AB 1W5SA 4GNKA 4DLWA 1EFUA 4M1TA 4PSAA 5J4YA 3B1ZA 1GRNA 1GL9B 1GG2A 1Q1BA 4S35A 2PLFA 4WIAA 4H1UA 4LJ7A 3SBDA 1ZRHA 1CJKC 1GFIA 1ZD8A 1QHHB 4JLVA 1U9IC 2O0KA 3TIFA 2BM0A 4CZ2A 3U6KA 3QNUA 4IDPA 1ZUHA 2P6RA 3VMFA 2RGGA 5EE9A 4DCVA 4KVGA 2ZAMA 1E1QD 4W9MC 5E7MA 2E87A 5AJXA 2IWRA 1BMFD 3K70B 1II8B 2YOFA 4AI6A 2YC2C 3SYNA 3AVOA 1FQKA 2AHOA 4KLZA 2VF8A 4EPYA 1NL3A 2QBYA 1Q44A 2CK3A 4A8JC 1KO5A 2MMCA 5B58C 1MO6A 3K9GA 5D3MB 5ANRB 1DAIA 1HE1C 3ZVMA 4PHGA 4YC7A 1Q20A 3BK7A 1NMXA 4KFUA 2CE2X 3O8DA 4DLSA 5JMTA 4HLUC 1Z3IX 1LY1A 4XOIA 2NMVA 3C5CA 3PUYA 1JQLB 2B6HA 3W6OA 3SN6A 2JLZA 1F2UA 4UQOA 4MKIA 4NDZA 2C9YA 1E2FA 4XVQA 2NO6A 5LB4A 3UK6A 1N0VC 4N0DA 3P4YA 4MRNA 1E94E 2ZRLA 4YXWD 4HUQA 4XH9B 1NBMD 1J8YF 4C0AC 1U99A 2F43A 3MCAA 1LF5A 3PUXA 5KSYA 2Z43A 3C7KA 3EIHA 4IOLA 4LC1A 3RRNA 1Z0FA 4G5SA 2RB4A 1W0KD 1DG1G 4LV8B 3NDPA 4BLPA 4FMCF 3CRRA 1SVLA 4PAOA 4BEJA 5DISB 4M9SA 2AWNA 2VRWA 1XTSA 3RRYA 3W6NA 3SBEA 5FPYA 5L3QA 1Z2AA 2W00A 3FKQA 2BM1A 2OBNA 4EIWA 4ZI2A 4NHOA 4YXWA 1HT1E 2QSZA 4UKDA 1ZM2A 1N0UA 2QP4A 2C9CA 4BQSA 1X8LA 4F4JA 2Q6TA 3PQCA 4B74A 4A0RA 3P1JA 3GLIE 4FMDF 4B32A 4D25A 1VG0B 3Q85A 4I1VA 2GJ9A 2JLQA 1N6IA 4KYUA 5DLQC 2IYYA 3N2EA 3CNOA 1K5DA 4D0LB 1KSHA 1QVAA 2ONJA 1U98A 1ZYUA 4II7A 5JWHA 1JR3E 5FPHA 3AVPA 2EW1A 3LLUA 1OJLA 5JLJA 1YZGA 3EWSA 4H1VA 1R0ZA 2GAOA 5KOYA 1VCMA 4G1UC 4O3MA 2X1VA 1GDDA 2FX3A 1XEFA 3B9QA 2A78A 4C9BA 4TYWA 5JSZA 4FCVA 1Z6TA 2Z5FA 2QMHA 2O5VA 1UEJA 3OZXA 3TUIC 1NJFA 1DO0A 2YINC 4MYTA 4NP6A 3RS2A 3FDIA 5K8LA 1OHHD 2BOVA 3QEJA 4WXRA 4PPFA 2VTKA 1CRQA 1JPNA 2BBOA 2HF8A 2XTMA 2IYWA 5CB6A 1NVWQ 2XITA 1IY1A 1OSNA 3PV0A 1OH8A 4DCTA 1ZNYA 4W7SA 2XNDA 3OE7A 3TVDA 1FX0B 4QHTA 2ORIA 4NYJR 3TR0A 4LUCA 3VX4A 3REFA 1AA9A 1G4UR 1BIFA 2J7PD 1PLLA 1ZU4A 4TQAA 3WMFA 3CPEA 2DY1A 3MD0A 2ZJBA 3I3SR 1G5RA 3PITA 4B2PA 3AVQA 2ZS8A 4Q5IA 4C2TA 1RIFA 5J47A 2ZM5A 3QIAA 4NCKA 5H1YA 1BS1A 3WP0A 5AR1A 2IS2A 3RS7A 3KQUA 2BC9A 5DHAA 4CEJA 1AZTA 2QE7D 2X2FA 4U02A 3F5FA 4B3XA 3TRFA 4IVPA 2VLIA 4QBFA 2ORWA 3AF0A 3GJ0A 2HUPA 1G7CA 4PO9A 1HQCA 2JLSA 4WXPA 1WBBA 5TXGA 3UMFA 4NYMQ 2O8CB 4IKEA 2FPKA 4TMVA 4B71A 4JLDA 4MRPA 3KKMA 4WZ6A 1Q3TA 2OSBA 1IN8A 3I8SA 3FHCB 4WZAE 2CXXA 5GJCA 1ODFA 3AGQA 1EWRA 3NDBB 3ZVRA 1AN0A 5DIFA 1TAGA 3GFTA 1XJ0A 1A82A 4JBWA 2PZGA 4LYJA 3Q8XB 1P4SA 1Q21A 3A6PC 4KCGA 1XEWY 2R6CA 4TYPA 4F7WA 2V1UA 2H18A 3ICEA 2EVWX 2GBLC 3ND8A 2HLDA 3PEUA 2QSYA 3NHAA 4TMXA 3VNUA 2ZI5A 3ZIAD 1W44A 4XVRA 3MRSA 2XZPA 1TADA 2QM7A 1KI7A 1UKYA 2RHDA 2FDCA 5TDHA 4EPRA 4B44A 5LD2C 1P6XA 1E2HA 1XTIA 3L43A 1MT0A 2I3BA 3RSOA 1ZNXA 3R20A 4MQBA 1AK2A 2ZJOA 3LBIA 2NO0A 2P6NA 1BO6A 2KB0A 3QF4A 2Z0MA 3GEHA 1GOTA 2O0HA 3GEIA 4FCTA 3UG6A 5JCZA 3PG5A 3RS4A 4B35A 4IDQA 2AN9A 4WAUA 4DDVA 1T8TA 3AUYA 3FMIA 4A0HA 4EFNA 2CVFA 4FI3C 4GFDA 1QRAA 3Q7QA 4UNSA 4F91B 3W5JA 3EIEA 2ZSFA 2J59A 4D4KA 1E96A 5JEDA 3MUFA 3FHOA 1D6JA 3ZZUA 1SZPA 1QHIA 5FL7D 1F2TA 1T3SA 1IXRC 4PC3A 1VECA 3IKJA 2LCFA 1LF0A 4DHEA 1VIYA 3RS0A 3B1VA 4D4JA 2AXNA 4I1OA 4OK6A 2QTFA 1LV7A 2ODEA 3F8TA 1LS1A 5GJVC 4DLXA 2G77B 1FP7A 3IQXA 2H17A 2DB3A 4ESHA 3EZFA 1U8ZA 2IF0A 2XZLA 1N5LA 1CJTC 4X8HA 1IM2A 2ERYA 4BECA 3CF6R 4P32A 4E5UA 3BBPA 3T1TA 1TF5A 1NN0A 2AD1A 1EX7A 1EXMA 4TT3A 1JNYA 1XTQA 3P26A 5IK2A 1VTKA 2E9SA 1E2EA 3QXHA 2BVNA 4TL6A 3UMSA 4LJAA 4WZBE 3W90A 4LJ5A 1KSJA 3QF4B 1NMZA 1ZBDA 3C4JA 2QAGA 4D0NA 1G16A 1E2JA 2HV8A 1ZU5A 4A82A 3EC1A 2XNDD 3OE7D 2BV3A 3T61A 1R5NA 2DFLA 4WOPA 5EUMA 1OF1A 4UNNA 2VPPA 3RS5A 3REGA 5J5CA 1S9HA 1BYIA 2J41A 4CYMA 1S2MA 3LVRE 2XOKD 4Q48A 3QPUA 1G19A 2YZ2A 1TU4A 1DAHA 4IOKA 4KVAA 1BKDR 3ZS9A 2FFQA 4TL7A 3WXMA 5JWRA 3DMDA 1U2RA 1P9RA 3AUXA 1CULC 2PMKA 1X1SA 1FUUA 4US0R 3A1TA 4LJ4A 3DDCA 4RD2A 1KK2A 1SHKA 2J3EA 2GVZC 4TTQA 2CHVA 3N70A 2PMDA 1G17A 2XAUA 4TMKA 1FP6A 4L8GA 1N5JA 1HT2E 1MKYA 2AXPA 2P0EA 4B3BA 3D6TB 3RWOA 3FFBA 2KWIA 3AVVA 1W4RA 4DVGA 2NOAA 1D2MA 1SKYB 1TEXA 2IS4A 1CP2A 2OFOA 2AD5A 4QHSA 3DZ8A 4JVMA 2H8KA 3ZS8A 4XWKA 3ZIAA 1NNEA 2WKQA 2X8AA 3U44A 1HY3A 2WWGA 2V54A 4ZKDA 5BWMA 5CLLA 4LWZA 4TZ6A 3K9HA 4GOKA 4ZIRB 3GQBA 2BDTA 3FMOB 4LPSA 1P2SA 2V7QA 4Z51A 3WBJA 1QVRA 2ATXA 4PPQA 2PBRA 1ZVQA 5FOXA 4BFXA 1U0LA 1L4UA 2RGAA 5KDDA 3H84A 3KB1A 5JSZB 1D9XA 1N6OA 4US1R 5H8WA 1JAIA 4I99A 1Z6YA 5SZJA 3U44B 3EPLA 2I4IA 2KI5A 5AUNB 521PA 4OJKA 4R9UC 4F4CA 5L8VA 2DFTA 4YMWA 3N5CA 2VP5A 5FBWB 1GZSA 1AM4D 3ZZTA 2PJRA 3FKSA 4D81A 4DCNA 3QG1A 4Q19A 5EJEA 2GXSA 1YZNA 3NH6A 4V0KA 1TQ2A 5HCNA 3B78A 1IJFA 3EA0A 4XD7A 3IEVA 1LNZA 5JCPA 4RY2A 4OI0A 4MKFA 3IILA 1XD9A 1E2QA 4QHYA 2QNRA 3TGPA 4JKYA 1G291 2RGCA 4MGKR 1JJ7A 1G4AE 1N6NA 1LVGA 1VHLA 3W9YA 1WBDA 1Z0DA 2GCPA 4QC2A 2ZJAA 2AK2A 3BGWA 2ZSDA 1DG3A 1HTWA 2J0VA 1B0UA 1E9FA 1CF4A 4PANA 5DH9A 3CWQA 3EW9A 4ACAA 4QM6A 2VH5R 3GD7A 2ZITA 3LH5A 5DYIA 2UKDA 4Z1MD 1WCV1 2ZQ5A 4KAXA 1W4CA 3U2QA 2J0SA 1I4DD 3GEEA 2FMXA 2FPLA 1G1MA 3B85A 4M1YA 3VHXA 4Q1FA 1NJGA 2WJYA 3TW8B 2CNWA 2FEOA 2IYLD 3M0EA 4K8OA 2V6IA 2GXQA 2JGNA 3DOFA 2JJ2A 2ZYWX 4RZUA 4BFWA 5KDLA 4M53A 3F0TA 1Q1ZA 3A37A 4M21A 3TBKA 3CRQA 4LJ8A 2DBYA 3MWYW 5EE5B 1UFQA 3Q9LA 4KO8A 1I4LD 3GCGA 1T3LA 4HLUA 3MGCA 2GEVA 2GTPA 4L9SA 2WTUA 3THYA 1GVNB 3IEUA 5LPNA 4OHZA 4EPVA 1KY2A 3HP1A 2F1IA 2ZAOA 4KSBA 3ZVNA 5DI3B 2JCSA 5G3ZA 1G6HA 2IW3A 1HQYE 1W36D 3GP8A 3ONWA 1P75A 2W6ID 2A5GA 3EX7C 4YMTA 2RGNA 2ZJ8A 4NU0A 3PUVA 5LB2A 2ZVPX 3GLHE 4IDHA 2QPOA 3QXXA 1Y63A 4B2LA 3CF0A 3RC8A 4GP7A 4TN1A 3IHWA 5TMPA 1NLZA 2ZXUA 3ZLJA 1E9AA 1N25A 3BWDD 5FUYA 2J7KA 3K53A 3U6BA 4JVLA 1R4AA 3HYRA 2HYDA 4QM7A 1NVVQ 1XZPA 3ZVLA 1P73A 1E2NA 1E2PA 1U8AA 4B48A 5IT5A 2HCJB 1E0JA 1GKIA 4POAA 4V0LA 1R5BA 2QAGB 1Q1QA 4P4SB 1AGPA 1P7CA 1Z07A 3X1XA 2FSGA 1W0JD 4GP6A 4KBGA 4M1SA 2NG1A 4NBSA 1G5TA 3CZPA 4OI2A 1ZMXA 1EG7A 1ZP6A 2O8EB 5E3HA 3CX7A 4J0QA 4AG6A 4EAQA 3MWKA 2BMEA 1SGWA 1JBKA 2IYVA 3EASA 3RHFA 1T5LA 5HPYB 2J0UB 2WWFA 2J0QA 1UPTA 2ZYTX 4O25A 2IHYA 3ZGXA 3PJRA 3R9XA 1U0JA 1A2BA 1XXHE 2XTNA 3Q7PA 4RCYA 4WA7A 1E9BA 3LXXA 1KY3A 3EC2A 5DHFA 3QXJA 1E32A 2CJWB 2QP3A 4R2HA 3R8CA 3S1AB 3WP1B 2XTZA 4B75A 4HAVA 4FMDB 5FFMA 1BMFA 1NG9A 2A5YB 4ZPXA 5FTLA 1PZNA 4MRSA 1C9KA 4B47A 4I81A 5JBQA 4Q7KA 3AVTA 3NKVA 4YLGA 5KPDA 1OFUX 1HA3A 2WJJA 5CM8B 3PUWA 3IPXA 3FGNA 1CTQA 5AJVB 4MGZR 3RABA 5L3VA 2W2VA 3QQ5A 4PAMA 3SQXA 1OFTA 3CRMA 2B8TA 2G0NA 1XP8A 3RRMA 3I8XA 4A2QA 4PQRA 1YRBA 2OLKA 4G5GA 1OXSC 4CW7A 4DSUA 2C2HA 2VL7A 2CE7A 4QFMA 2AKAB 2ZYVX 4PZYA 2CLSA 4QRHA 4W5JA 4ARZB 1IY0A 2F3TA 1KI6B 1UEIA 3QPVA 3I92A 4DLYA 1COWD 1H8ED 1XD8A 2OO7A 1R8SA 5FOWA 721PA 5JJLA 4O2RA 4RZ2A 3ZQJA 2DR3A 4EJSC 3QBVA 4PC7A 3MJHA 4Q9LA 3H0KA 4OK5A 3TNFA 3VNVA 4JVSB 1RRCA 1MO3A 3P4XA 1RC8A 2GHIA 4RFSB 4JLOA 2FWRA 3BC1A 2XNSA 3IO3A 3OIVA 4KXFB 4PC6A 2QT0A 5EP4A 2W6IA 3B8HA 1MH1A 2BCJQ 1ZD9A 2RKOA 3NVAA 1D5CA 1A4RA 1NVVR 3WMEA 3W34A 2QPTA 1N3BA 4GI7A 1OFHA 1RRFA 1D8TA 1TF2A 3BB1A 4B76A 1II8A 1E9RA 3B1YA 3B6EA 5A0FA 2A7QA 2C99A 3QKUA 4MITA 2OFXA 2IYRA 1C1YA 2SHKA 3HU1A 2PH1A 1E98A 2AWOA 4TLBA 2ZUBA 5KNBA 4WVFA 4AYTA 2FJUA 2CEAA 2GEDA 2YKGA 3LQQA 3GJ5A 2O8CA 1IXZA 3VKWA 1S1CA 2PEZA 4LGMA 4PHHA 3LV8A 4DJTA 1YRAA 2KE5A 3CNLA 1F2UB 1CIPA 2BMJA 4LHYA 4M9XA 3I5XA 4DEXA 4OQXA 1SKQA 1Z6GA 3TUJC 1CBUA 1ZD1A 4Z1MA 2ZI6A 4QG7A 1OKKA 3UXMA 5GADl 2D74A 2RGBA 1NBME 1YZKA 3T15A 1S3SA 2GJSA 2UZ3A 1CLUA 2OAQ1 2ZR9A 3R9WA 1BOFA 4DUGA 4TLAA 4F92B 1YVDA 2FV8A 1T4GA 4GZMA 2ZJ5A 4KBFA 1E0KA 4U7DA 5LD2B 3THOA 1E9DA 1M7BA 2IBMA 2WICA 2CCKA 2QTHA 5CJPA 1TQDA 2A9KA 4C7OA 2A3RA 4RD4A 3ICQB 4AC9A 3SYLA 3IIMA 4ESVA 1AS0A 3R7WB 2VBCA 4PTLA 4URZR 1OKKD 5L3RA 1TU3A 2OESA 1R2QA 2QU8A 5AUQA 4NH0A 2FFHA 4UXIA 1ZUIA 4LRWA 3EZ7A 2ZANA 4M1WA 4OQLA 5G53C 3MSXA 4MKGA 3KFVA 2YOHA 4HAZA 4IEIA 3AVWA 4C3ZA 1S4QA 3B2EA 3QG5A 4TMZA 3UKDA 2GCOB 4HAXA 1IN7A 4XJXA 2IS1A 2ODBA 3OIUA 4Q18A 4EJSA 4L15A 3AKYA 1OIWA 3SDZA 2V9PA 1Q12A 1JR3A 1E79A 5EUQB 4BPBA 5CM9C 3C14C 4Q4JB 5FBLB 4MGIR 1EWQA 3IBGA 3P20A 3JZMA 4LYHA 2QGNA 2W0SA 2QBYB 1L8QA 2GK6A 3K0CA 4LI0A 4E22A 2IYUA 4IFBA 2L0XA 5KO2A 8OHMA 1F6BA 3ASZA 5CLQA 1UKEA 4BFZA 5FH9A 4LHWA 1W5TA 2EWVA 4UJ3A 1W36C 2A30A 1ZC4A 5FUWA 4ZKEA 1OFIA 3TKLA 1SULA 1DVRA 1KAGA 4FMBB 2ZE6A 4KFSA 2WWWA 3THXB 1QBKC 1EFCA 3PIRA 4LBYA 5JFGA 4LC0A 1RKBA 2QL6A 4TTRA 5FPTA 4CEHA 2GETA 4QNMA 3PFIA 4FWIB 1W0KA 4KJZA 4UNPA 3I62A 4B34A 1QHGA 3EZ6A 121PA 1FL9A 3M6AA 1G5PA 1NBMA 2JLVA 4JLNA 2HT1A 4M1OA 1XXHA 4DDUA 4AKIA 1QG4A 3A4NA 2NO9A 3KJHA 3FYHA 3SJBA 1SKYE 2WKPA 3BJIC 1K6MA 2XB4A 2Z83A 3VR5A 3MMPA 1U9IA 1MABB 3V9PA 5KNCA 4A2PA 2CL7X 1IBRA 1VCIA 2WSMA 1R0WA 2OV2A 3LW7A 2GWHA 5K8UA 5HCIA 1H8HA 2QP9X 4V0ME 4TMTA 2OHFA 2KJQA 4G0NA 5FOSA 4AKEA 3M4YA 1NF3A 1Z2CA 4LJYA 1TMKA 2BWJA 4Q4LA 5A4JA 3SFVA 4JT2A 2ZROA 3CX8A 2CJWA 2G1KA 3A36A 4KHZA 3S1AA 2ZRMA 1EFRA 1RPZA 2ZI7A 2P67A 1YR8A 3I61A 1ZM7A 1PJRA 1ESNA 1SXJC 1OT3A 4RZ3A 3RWMB 3DZDA 3DEFA 4L4UA 2OXCA 2IK8A 1WA5A 2W0MA 3T12A 1ZIOA 4DSNA 1KYIA 1E4YA 3AGPA 5DNYB 3OFND 2VSFA 5B30A 3SOPA 4JKIA 1E2DA 4OQFA 4YDHB 4TYYA 2VP2A 4A9AA 3THWA 1EESA 3LAWA 3K1JA 3NBZC 2IXEA 3NEYA 4FCWA 4V0OA 2GZAA 2ZI9A 3T34A 3GJ6A 4N0EA 3SJZA 4RKFA 4GDFA 2IXFA 1W4AA 2E1RA 4E03A 2C98A 4AURA 2DWQA 4V02A 1RZ3A 3U3KA 1Z0IA 2JEOA 4BUJA 5F3WB 4PO1A 3K0CC 4OYHA 1WXQA 3CZQA 1I2MA 5CIWA 2P5SA 1KI2A 4LYAA 5KSZA 1BYUA 2ZRBA 1T9HA 1LTQA 4EPXA 5CYOA 1N6KA 2WM9B 4QL3A 3RAPR 4AIIA 4BWYA 1TEVA 1Z0AA 3RS3A 1KTVA 4BLOA 4BZXA 2VYFA 1GNPA 4UXHA 5FPSA 1IQPA 4EFLA 2X19A 4HAWA 3VU9B 4UXJA 3WYGA 3SS8A 1OE0A 2V55B 2YWFA 1LS6A 1GKUB 2H92A 2HXYA 2ZRAA 3HU2A 1UAAA 3BS4A 3PUZA 2NIPA 3GLGE 1L7VC 3TLXA 2WVJA 2Z4RA 5JEEA 3U5ZB 2C03A 2D7DA 1YE8A 5B57C 4C0BA 1MRNA 1KO8A 2GJ8A 1NG1A 1OH6A 1FZQA 1RFLA 1C4OA 3FWYA 3VU9A 4R7ZA 2D06A 3LFUA 4RVCA 2W58A 3OFNA 3UANA 2CNWD 4JMPA 4JJZA 5EP3A 4C7OB 2NZJA 1NI3A 4KODA 2O8DA 4IW3B 4RFVA 5FPKA 3WRYC 4US2R 2CLCX 4F93B 5GJBA 1WF3A 1N5IA 1AZSC 1VYTA 4M9QA 2IF2A 4OKSA 1E2KA 1P62B 1J2JA 1E9CA 2GVDC 3SJCA 5FOTA 1NKSA 1DAMA 2ORVA 2P65A 1DADA 2FFAA 3IIKA 2YWGA 4ZDJA 3OEHD 4ABYA 3RLFA 3OEEA 1IONA 4B3FX 5FUVA 1KI1A 5E95A 3AVXA 2CVHA 1A5TA 4GT1A 1Z0KA 4MA4A 5HR5A 221PA 1G3UA 4L16A 4C0LA 1X6VA 4C4PA 5CJ2A 4Q66C 4ZDIA 1SXJD 5FTNA 4EQ6A 4LBVA 3VAAA 2OM2A 4PQFA 3TAUA 4DRZA 1KI4A 1G8FA 4LYFA 4NYIQ 1G9XA 3TH5A 2AKYA 1JECA 1SXJE 2J7PA 2WHXA 1NN3A 3FOZA 2MSCB 1KDRA 4MRRA 1AGRA 2WOJA 3QXCA 2DWPA 1XEWX 1T0JB 1N2CE 1RE0A 5KSPA 4CGZA 2QPAA 1W4BA 2B8WA 1HE8B 1R5OA 4OQNA 4A8JA 4Q4HA 4ZDWA 2QTVB 2BIFA 4JSTA 3B82A 1P2VA 4NMMA 1YR9A 3DM9B 4RD0A 1ZNWA 2CBZA 1Z29A 3AF2A 4PSVA 2J1LA 2YV5A 2PCLA 3B1XA 1G6OA 3ECCA 4FIDA 2VHJA 1EFRD 2QAGC 2OCYC 2R6AA 1P9NA 1ZIPA 4C0SA 3KL4A 3P32A 1G8GA 2F1RA 2OCPA 2F9LA 1R0XA 2ZREA 2ZRGA 3CR8A 2JDID 4QOSA 5DYGA 4GMDA 2BCGY 2C8VA 3CPJB 1PLJA 2AX4A 2A5FA 4Q9HA 3QKSA 4EDHA 3KX2A 3GLGA 3ZYCA 2F55A 5HTKA 4ZCIA 5L3SB 3GLFE 4BFYA 2QUZA 2BBSA 3E5HA 4LV6A 2OBLA 4C30A 4Q4AB 2R6GA 4LK2A 1M2OB 2ODWA 4CEJB 4HZIA 1US8B 3WNBA 5K8TA 1Q0UA 2FGKA 3ZZ0A 1CXZA 1Z28A 4UJ5A 1YZQA 2IYQA 3T5GA 2FA9A 2JJ1A 1X3SA 2WIAA 3BORA 4NKRA 4QKQA 2WJGA 5FR2A 2WIBA 2QG6A 3LO5A 1W36B 1LW7A 4MUAA 2H57A 3CR7A 5UKDA 1P5ZB 2GJKA 5EP1A 3MLEA 1UKZA 1Z0JA 4B33A 4E07A 3LWNA 2FZ4A 2ZYUX 4TL9A 1GM5A 3CW2A 5F98A 5IRCD 1FMLA 4LV5B 5EZ5A 2FGJA 4PPGA 3MFYA 1CR2A 2ZE7A 1RW4A 1QHHA 3BH7A 1KJWA 3G0HA 4DLZA 2GILA 5H70A 1U0HC 3HWSA 4M8NE 5AWFC 1ANKA 3L0IB 2VA8A 2XSZD 2CK3D 4KV9A 2VHQA 4Z8YA 2UVQA 3MWLA 1XJCA 3GLHA 2WV9A 1XEXA 2QA5A 1O3YA 3ZH9B 3KQLA 2ZRKA 5C4GB 5J4HA 5GVRA 5JRZA 3NC1C 3AH8A 1VG9B 1JR3D 3EG5A 3KKOA 4PPNA 3W5IA 1YQTA 4TT3D 1EFTA 3Q72A 1UDXA 3K0AA 4ACBA 4ILEA 2FSHA 3OIWA 3VR2A 3J81k 1XTRA 3C8UA 4HB0A 1XWIA 4QJ3A 3O8RA 1E1QA 2X2EA 3BB3A 1KI9A 1DAFA 2GBLA 1XTKA 4U00A 1IY2A 2JA1A 3K8YA 4MYHA 2X77A 2H1LA 3ZD6A 5AJZA 3IHLA 2D62A 1R10A 1HEIA 2J87A 2WWIA 4XTCS 1VG8A 4QNRA 1VHTA 5JS7A 3KDSE 2JATA 2CLDX 2QQ0A 5A5GA 3OAAD 3HR7A 5IHPA 1S0UA 4IOJA 5JI3E 3SQWA 1TQ6A 4Q02A 4JYCA 2VSOA 2QZ4A 1J99A 1AS3A 1KKMA 3H86A 3KKPA 4PX9A 1G41A 2YVUA 1PVOA 2ZRJA 4A6PA 3A58B 3L2OB 4Z8XA 3AKCA 4QJ4A 5DE3A 5FTMA 4DEYA 621PA 3GFPA 4LJ6A 4EQ6B 2D2FA 2GZDA 4LHZA 4BFUA 5FBVB 2IYZA 1P9WA 3EPHA 3AP2A 1DS6A 3PXGA 2MSEB 4LHXA 5EZ6B 1IN6A 1GWNA 2VSXA 2O8DB 1VDZA 3KKNA 1IAQA 3NH9A 3T5DA 2Z6VA 1KSFX 2KBFA 3QBTA 1ZJ6A 1JI0A 3IQWA 2W2TA 3QOFA 5AUOB 4NL4H 1ZINA 1W2HA 4GMXA 4OJQA 1IXSB 3AF1A 1QHSA 3CX6A 1W7AA 1AQUA 2Q0HA 3D3QA 1CR4A 2OILA 2OE2A 1E99A 1DO2A 1KO7A 1XF9A 2ZS7A 3OHMA 4PSKA 4Q03A 2WSSD 5E7JA 5P21A 4BLQA 4TWZA 4ZDKA 4JS0A 3CBQA 4JLJA 1TUEA 3W8NA 1E9SA 2WPDD 3KTAB 5FTJA 1OLOA 1CJMA 2ZJZA 1MV5A 4EUNA 1KHTA 3NC0C 1XRJA 4JLMA 1KJZA 4W5HA 1J70A 2JLXA 1TF7A 4MGYR 2D2EA 4IDOA 4DLVA 1HH4A 4BLTA 1KNQA 2JIZA 4D4LA 3B5JA 4G5RA 4DLUA 1DAKA 1QF9A 2J0UA 3SYKA 4P4SA 1Z08A 1DPFA 2A5JA 5JECA 1MR3F 3EPJA 1I2DA 2OCAA 4DDTA 4JT4A 4XSHA 4OL0A 5BXQC 4AD8A 3U7HB 3TK1A 3O47A 3IO5A 2IEYA 2B7BA 3BERA 2QORA 2G3YA 2ZIAA 3RANA 3VR1A 1OH5A 1IOZA 2ZSAA 2C77A 3JVVA 4HAUA 2IUTA 4OHYA 3CM0A
chains in the Genus database with same CATH superfamily
2QRJA 3BSWA 1WP9A 5EE3A 4AG5A 3OCYA 3I73A 1V41E 1TQ8A 1I4TD 3CEAA 3E9YA 3S0JA 3T9FA 4DHWA 4EHKA 3KXIA 4G5QA 4TLEA 2VXBA 2JIOA 4GXNA 1UODA 1F9EA 3ZV5A 1CG6A 4C0QC 1AKUA 4D9KA 1YKSA 2I33A 1E3QA 1KK3A 4FFNA 4OLJA 2YOGA 5AHKA 3OZCA 3S8EA 3S29A 4AB1A 5F5XA 3HNRA 3T94A 4U3JB 3P9XA 1KYQA 1Z3CA 1T0PA 4XVUA 3GNSA 2CVZA 1RPNA 3E2PA 1HZZA 3NRCA 1T1SA 4ZQFA 3ZY3A 2AEEA 4G67A 4XPZA 3FTEA 4AAYA 4BQNA 1F4VA 2UVPA 1V7CA 2VLBA 3IUPA 4L4RA 3T1OA 3DVQX 4X92A 3IJPA 4EPTA 4LZLA 1P1BA 1T2VA 2O8FB 4BFTA 3P9QA 1THGA 2X1HA 5LZ7A 3H3JA 4EY8A 4R16A 4URUR 4XYEA 2XQJA 4LCBA 5T6BA 1CY4A 2XZDA 2QRLA 4DUYB 4OBEA 1XX6A 1EUZA 4CTNA 7REQB 4M9ZA 1UBEA 4BWVA 2G04A 2Y1WA 1B6RA 5B6IA 1T1GA 2XWSA 3T4PA 4E1BA 2VATA 3IXMA 3UV7A 4GM4A 1UOOA 3HBFA 1PFGA 2R6DA 1XNHA 1F0NA 4RXTA 4UDXX 5HJ7A 1JG2A 1HDGO 3HBAA 3QITA 1M1YB 1E3EA 1VJ5A 2I7VA 4RV4A 4YP5A 2XZOA 1VZ3A 2ZB8A 3F6CA 3GZNA 2NM0A 2PBLA 3R3HA 1JEQB 3HYTA 4B8YA 2OK7A 4I9UA 2J5RA 3CLSD 2WM3A 2XA2A 1HL3A 1WZCA 5M04A 4H59A 3HM2A 3CNNA 5J9FA 2VIIA 1EDZA 1KMHA 2GF0A 4MA0A 4D9BA 1X7DA 5CXSA 3SZGA 4B7ZA 4RORA 1LXCA 2C5HA 4F3KA 1IN1A 4G63A 1X19A 2W6JA 1YMUA 4ZK2A 1NULA 1NXWA 5LMNB 1NMEA 1O5IA 2IRWA 3PDHA 4A36A 3H65A 5JHHB 1RJ9B 3LM8A 1TZBA 2AN4A 2FWPA 5DLPA 3LWZA 4NEQA 2BUCA 3OBBA 1XUOA 2E37A 2AQKA 1EIZA 1RHJA 2J9FA 4O4JA 1IUNA 2G6BA 3RFTA 2A2ZA 2XYVA 3SSAA 3IEIA 1DQPA 2EHJA 2NU9A 2BRUC 2CDCA 2IYAA 1EHIA 1SC1A 2DPHA 2H48A 1PP4A 2CFSA 4Z54A 4ZOLA 3D1LA 3D8BA 2L17A 1DRUA 2OD2A 1O96B 5FWXB 4FR0A 2FP4A 2B0JA 1T4CB 1XZ8A 4ARAA 4UNQA 1G64A 2P35A 3LIPA 4HDCA 5SZKB 4CHTA 1P3DA 3C4VA 2YWCA 1IPFA 3QVVA 3S7TA 4F2HA 3NHZA 4HG2A 2XYPA 3HA3A 1JHDA 1SHLA 5AHWA 2BKVA 3AJEA 2BM9A 3KEMA 5FBQB 4F71A 5EZSA 3TQRA 2RCYA 3E3MA 3SX0A 2JIMA 1UM9A 4Z6KA 3HXKA 2EEZA 3UC5A 1UP6A 2WJHA 4ZO6A 4F4IA 5A2QA 2RGNC 3DOOA 1G7SA 1B6TA 1G3RA 2YWHA 3MC1A 4BZQA 3WMRA 1K8XB 3UK7A 2CXTA 4E6PA 5LZ2A 4H3KB 4C5AA 3FNBA 3H17A 4TVKA 5C4MA 4NBWA 2PS3A 3R76A 5KOJB 2PX0A 5JDIC 3OCJA 2O8VA 4NARA 2RHWA 5M5BA 1UOEA 1DC8A 1O95C 2G40A 3GAAA 3JARB 4XWYA 3TQSA 2IU4A 2Y05A 4Q1CA 5CTJA 3ERCA 1MA0A 3N0TA 2HBRA 2ZLBA 3I32A 3OPNA 5HE9A 2UDPA 1R7RA 4CTOA 4D26A 1AGNA 3QY0A 3H11A 3J7TA 4ETIA 5BYBA 5LA6F 1PGPA 1YFKA 1TZMA 2RCNA 4BNIA 3OQ1A 1P18A 1D2EA 1FVHA 3G49A 5CXUA 1BN7A 3ZW8A 1PDOA 1WXGA 3H87A 4MW6A 3L77A 1OIVA 3PQEA 5TPZD 3RDPA 3ZUGA 4D3ZA 1JHUA 1SXGA 1KS9A 1P0MA 3DVLA 1OV4A 1ZGGA 3NYRA 5M2QA 1NX6A 3BIJA 1P5RA 3O7MA 3F1LA 4TYQA 1JZTA 4R8MA 2IT1A 3IAS1 4BC0A 1WMEA 3FPLA 4AULA 4DIEA 2ZBFA 1TA4A 4AJLA 4WLUA 4L72A 4DEVA 2YS6A 2X1MA 4NXNB 2RHHA 1JHZA 3A6FA 1S9DA 2E4WA 3W4KA 4Z4QA 1DAPA 1CFZA 1PSWA 2VK1A 3JYQA 1QQTA 1YZHA 1BU5A 1XTBA 4YGXB 2GKOA 4FBLA 4HEHA 4JZYA 3RSFA 3B3JA 3ZQKA 1RYHA 2R62A 3MJCA 3SXUA 2QRUA 2Y0PA 3THXA 4ZTZB 1AB5A 1YU6A 4B3CA 1PQYA 2B25A 1W75A 4CQMD 4EQZA 3ABIA 3CXUA 3VXKA 1XZKA 2IUSA 4M22A 3BMOA 4RIFA 5F4BA 2A14A 2CNLA 3K96A 4NCBA 1XAJA 3I76A 2I7XA 2QQEA 3BZUA 1SURA 4C21A 3QLEA 1V43A 3L8GA 3I05A 1W85A 1B16A 3P5BA 7GPBA 2O8EA 3GIDA 1TXGA 3IV7A 4KG7A 4N54A 4NZPA 1YFZA 4G0QA 3EIQA 4GDMA 4XWOA 1RWMA 2C04A 3WAJA 1I4EB 1REQA 2HIGA 2B2CA 3IBTA 3NANA 5BWNA 1N2HA 1PK7A 5HOEA 3PX7A 4LF6B 2EX4A 4RM3A 3T06B 4ODIA 1MABA 4AJ4A 2NGRA 1T15A 1XFAA 2Y1CA 4G37A 2ZB2A 4RA9B 4WK4B 3L7BA 3UT5A 3NIBA 3LFHA 4J1TC 4ZAGA 1I30A 1NUAA 4G84A 4YLYA 5JNLA 4ZA2A 4KITB 1ZVMA 2OL4A 3I4LA 3CO5A 2ZIWB 3TOVA 1F1BA 1B23P 4A10A 1QDEA 1RQ2A 4GQAA 4QUKA 4X00A 3STHA 2PZLA 4YMSA 1WSBA 2XCOA 1O9BA 4QOHA 3NG1A 1NAHA 1Y37A 1ENPA 3K9WA 4BN4A 3AR8A 4AO7A 1X86B 2B5WA 3A6JA 4CIWA 3L7NA 4A6EA 5I01A 3B1WA 1OBFO 2XUZA 1P2TA 3FVQA 3QZUA 4ZO4A 4AX4A 4JC5A 4UQPA 4AY2A 1QO9A 2HA5A 3L5KA 4KFTA 4RHXA 3RC3A 3D31A 1CE8A 4YJ2F 4JLSA 4LY3A 4GOJA 1E1DA 1LGYA 4KW7A 5FL7A 4IJMA 1XMJA 4O6VA 3U7EB 3ZJVA 3PC8C 1Z4MA 5AJWA 4PWZA 2B61A 4IXMA 4A6XA 1L5YA 2WV7A 2CVQA 3ZTTA 3T7RA 3UCFA 1IIRA 1OTHA 1XEXB 3COJA 4MHSA 4ZOLF 3FTDA 1LUAA 3L9XA 3IQDB 2YIVX 1E1CB 3CINA 2VHTA 3FZNA 2RGWA 4XSVA 4KO2S 4OFXA 1KVQA 1XZFA 4TKMA 1RQNA 3BMCB 4FUTA 2QRVB 5FUMA 3TW8A 1CEQA 2H4ZA 2BGTA 2I5PO 3OE1A 4TQ9A 3SLKA 3ZXSA 3QJYA 4EGFA 4XUEA 3EMKA 5FYQA 2JI6A 2C3YA 2BFFA 1MQSA 5H3CA 3P27A 5B1YA 3BGSA 5CURA 5H83A 1J90A 5BN4B 4E5PA 1O1YA 1O2DA 1S8NA 1FYXA 4EGSA 2GBCA 2R7NA 4ZGGA 5IF3A 1JIIA 2NO7A 2XDAA 1YB5A 3VPXA 1VMEA 1T9AA 4E08A 1XVUA 5AIAA 2F1HA 2QAJA 1YDWA 1XTJA 1Z35A 2CLMB 1H65A 3CC8A 2HEGA 3H42B 1JS1X 3I9NA 3PRJA 4U5XA 5KNCD 3ER8A 5G0UA 5F64A 3GLHB 2QSUA 2JKZA 1KAOA 1EP2B 1EVIA 3OX4A 1D1PA 1T4CA 3PHBE 4Q4CA 4QQRA 5JH7F 2P78A 1VYHA 4Q21A 2P4EA 6NULA 1JALA 5KSZA 1W49A 2D4HA 1CDOA 1OZFA 4YRDA 2FSVC 5ADVA 4MINA 2PUFA 3EULA 4MQFA 3VDXA 5EQTA 4LXQA 5SV2A 4H7JA 4CPDA 4Y1RA 5BSWA 5HKAA 2WOOA 2XNHA 1L3CA 1ZUD1 1OX5A 2YDYA 3G7NA 3LX8A 3N2NA 4FDUA 3NEJA 3ZNPA 4HSGA 2V3CC 4Z5XA 2YWBA 3JYOA 2ZJYA 4FU0A 4WDRA 1W73A 3L8YA 1LW6E 3TQCA 4CT4B 5MFZA 4N76A 3A6HA 3ANMA 2JEZA 4K88A 4LF5B 4J76A 2D1FA 2HV9A 4M0UA 3EQ9A 4FMCB 2RAPA 4OQZA 2ZUCA 4D4MA 1S96A 2JJ1D 1Z2DA 2BISA 3VZSA 3HU3A 1TD1A 4F56A 3DUFB 4LDAA 3BD8A 3NBXX 4JVNA 3A70A 3NDIA 3SQOA 3O94A 4QUBA 5CYFA 2R751 2DY0A 3T9EA 4MEJA 5IF9A 2Z6UA 2QE7A 4DWJA 3UC9A 2C5FA 1D2CA 2GRJA 1XCPA 2ODNA 1CUDA 2ZJ7A 2QJFA 4YRFA 3CUEF 2XJ4A 2ZI3A 4HDSB 2QVBA 1SVSA 4OQMA 4ZEXA 4RY8A 4Q4JA 3WMGA 2I03A 1EI9A 2L42A 4P81A 1XPRA 3WV4A 5F9FA 1F38A 3JQ6A 5G4LA 2XCTB 2RGDA 1QOPB 3OT5A 4BRSA 3RBVA 4GX5A 1U2DA 1EVYA 2QDXA 4IQGA 1LK7A 4DXHA 2XYHA 3LXRA 4JBXA 3PTZA 4KRYA 1BHO1 5BW6B 3W8EA 4IICA 2PUJA 3ZQ4A 3L05A 3F74A 4KUHA 2ATVA 3JVUA 3T9DA 1DL5A 5HIIA 1PJCA 2M6SA 2EFYA 2B2NA 4NCAA 1HNXB 3G9QA 4QVIA 1O77A 2CHFA 4Y1RB 4Q1BA 3R6GA 5KBYA 1FJ2A 2FRDC 2PDAA 4BECA 3G2PA 3OQNA 1A2QA 3JPWA 5H9VA 3ZGVA 4LXTA 2C7VA 2D7CA 4YDRA 1HYQA 3OM0A 1KOJA 5CYPA 1KBZA 4NEHB 2Y9PB 1BVRA 1W93A 2PKWA 3HGTA 1QFMA 4NDAA 2J46A 2O1XA 4D9NA 4A1FA 2QTVA 3CVVA 3ECAA 2DH6A 4D3DA 5MHTA 2R2AA 1UBFA 2XBUA 4GC5A 4L27A 2D0PB 2IW1A 2QMUA 2GM4A 4DMUB 2O0MA 1IJEA 3CWCA 4KB5A 3R6TA 2JCVA 1RHMA 2PVCA 3QVGA 5KSYA 5IM4A 1N2OA 5K9ZA 4K05A 4UAVA 1P0FA 4TS9A 3GRZA 2W43A 4X62B 2BFDB 5LOVF 1CS4C 2OECA 1RBYA 4AK9A 4D9EA 4DT1B 2O8FA 5I7SA 1JKMA 1SG9A 3L40A 1Z22A 2VRCA 4F85A 2D1SA 3GWGA 2XSZA 3ME5A 4JL8A 2F8LA 2LDBA 4YJGA 5D5QA 1U3FA 2G1UA 4YUYA 4Y30A 2ZRCA 2V96A 3NASA 2JNWA 3FI0A 2IXGA 2P90A 2Y8EA 2ZYGA 3LECA 4NQRA 4RH3A 5CK4A 1TZ2A 5IFKA 1OCEA 4J0GA 4NX2A 3A0UA 3DLIA 1PR1A 4XWGA 3WLJA 1RRGA 1AHNA 1FK8A 2P2NA 3CE6A 1ND5A 3RIXA 3WLPA 1SK9A 3HFSA 2QV0A 1BDMA 2X9QA 3QVXA 4HDNA 4XB2A 4JR0A 1C8KA 1TC2A 1KAEA 1KOGA 4PTYA 1H22A 2QG9A 5DN6A 2E48A 4NMLA 1SUAA 2F3PA 2XTAA 1WF6A 2BMDA 1SBNE 3WGZA 1FY2A 1Z5ZA 2D5AA 1BZYA 1OHHA 3BL5A 4WKGA 4HZUB 4RUKA 3U3OA 3HMQA 4PZDA 1I5OA 2CHEA 1K8YB 2POQX 1CRLA 2MSLA 2RH4A 5JQWA 1COWA 3D2AA 2HSEA 2WY2D 1OBHA 2B7LA 2ARKA 1X8KA 1RWXA 2W6JD 1EZ4A 1CUZA 2VNJA 2WD7B 4IVQA 1G2IA 1V47A 2FKAA 5EIBD 3ZTYA 3QWAA 4L5CA 3FDXA 3OT4A 3WISA 4Y6PA 2O52A 4EYQA 1FZTA 3C3XA 4INOA 1PQUA 3ZU5A 3BOSA 2A6PA 3Q5EA 4P7FA 7YASA 1TUIA 3R5SA 4TX1A 1B2RA 4KPUB 4PRKA 1VKZA 5HWSA 5I4BA 1DRWA 1M2VB 2V74B 3KXKA 5DBFA 4U9HS 3W79A 4KQ1A 1MJFA 4H7KA 1Q92A 4EZIA 3WGVA 3OCCA 3P0FA 2ZB7A 4E30A 1KI6A 1NBOA 3TR5A 4H18A 1SUWA 2VZEA 4UATA 2MT9A 2VTDA 4BQEA 2V6BA 5JXJA 1UPXA 1GYPA 2P4HX 4F5ZA 5K4HA 1Q57A 1AHPA 4XDHA 4P3PA 1G7RA 2DSTA 1JQKA 1RXVA 1EQAA 1KDPA 2JGMA 3G7UA 2IDJA 3A6LA 3NAZA 4R84A 3UWDA 5KU1A 2Y1LA 3BGDA 3HPQA 4ER7A 2JLUA 1KKLA 4K2AA 4TSFD 3N28A 3V55A 3THRA 2QM8A 4DA6A 2ETVA 3G0IA 4FYJA 3CH7A 4JOBA 4FYPA 4Y18A 4ZYYA 1KZGB 4OH7A 3S1SA 1HUQA 3G79A 4QDUA 4ZI7A 2VP0A 3KRTA 3DEJA 5TARA 4E46A 3L07A 4P8RA 3OCXA 4PZPA 4ZCMA 4AUKA 5JR3A 2BUBA 1C3OB 3X44A 4AMUA 4ZCSA 1ZZGA 3OZEA 4J2HA 4CN9A 1RJ9A 4C6TA 4CFYA 1UPFA 3IP3A 1C9NA 1KMQA 1T3GA 1R0RE 1CZUA 1DWQA 1YVEI 2QNBA 4QO8A 2B4KA 1X2EA 1T43A 2EFEB 2RHOA 1JQJC 1E5QA 1Z7EA 2XPCA 3GDOA 3C70A 3K9NA 4NCJA 5LDGA 4G1CA 4GSKA 4OCZA 1ZM9A 2CXNA 2ZJFA 4LNUB 4OFZA 3LS2A 2PL1A 2QAIA 3CIOA 4JJKA 3A4LA 4AMBA 1UJ2A 5DM60 3NYIA 3F6BX 1AKYA 1MC5A 1F06A 2VBGA 2WE7A 3AF3A 2VO1A 3FVRA 3IESA 1GKYA 2XUQA 5EWJB 1X1EA 3E70C 3KAPA 4RKRA 3CLUD 5AVSA 2NUPA 3GLVA 4LDZA 4LRXA 2M2IA 3DNMA 4Q1DA 4YUAA 3EAGA 4LSMA 5L9AA 2O6LA 1T5DX 1N2EA 2HWKA 2QN2A 2Z09A 2JS7A 3EIOA 1NYLA 4JJ4A 4RH0A 2WBLC 4F38A 3U4DA 5C7OO 3KSRA 2F8SA 3LRXA 2O6HA 5J23A 4M38A 4UAUA 2XWJI 3PVCA 2PG3A 2Q1TA 3U7FB 2GBFA 4RELA 2G1PA 3EEOA 1E1LA 4KN6A 3NWJA 1R9NA 3EDRA 1BHSA 3NTVA 2BR3A 3PYXA 1ELOA 2QVCA 4ALKA 2IYSA 4D0RA 2OOKA 3LT5A 2ZYAA 5G41A 2AI1A 3F5QA 5EFOA 4ERNA 3LXMA 5COAA 2XUHA 2W42A 4YRRA 3I34X 5THXA 3KETA 5LMZA 4URYR 3IT0A 1H2AS 2KBEA 1W0CA 4MMXB 5IM4F 3DBLA 1E61A 3HC7A 1ZXLA 3IVXA 4HSEA 4KYIB 4TV9A 4ZVUA 4BFSA 5HG0A 4OHVA 3K70C 1H4QA 2OGZA 3WBKA 3UHJA 3HA5A 4HYEA 3HVKA 1NOJA 4OHWA 2GEFA 2WNHA 3ER9A 3R8FA 3QY9A 2XGJA 3COYA 3DLAA 3QVUA 1K1EA 2VN8A 4E09A 5IC6A 3W6UA 3T1NA 5DRYA 3RNLA 1B6GA 2G17A 3HLTA 5FRDA 5TX7A 3LPCA 3VZRA 4M6WB 3FUTA 5DTJA 4ZYWA 2WYVA 4WKOA 4A91A 4L3VA 4C78A 1MDBA 2FG5A 2N1BA 1BDHA 3MXOA 2R84A 3L0PA 3FHLA 1KZ9A 3LE8A 1QS0B 3PR2B 1V16A 2GK7A 1W76A 3T7SA 2P3OA 4BO5A 2QMEA 1VB5A 1F0KA 1U94A 1NZDA 1YZ3A 3VKFA 5D3KA 1LPAB 4IHQA 5FFFA 4DGQA 2FW1A 3LUCA 3AJDA 4Y2RA 2ZRPA 2QM3A 3LT4A 3UAYA 4FEGA 4KQMA 5BQ3A 4BLSA 4MCHA 2H2DA 1OVMA 3HYLA 1MENA 1H1DA 2PRYA 1UH5A 3ROFA 1PJTA 3OF5A 3VSEA 3QEOA 3ER6A 4DXAA 3PUKA 1XGKA 2EP7A 2K7ZA 3KBBA 2JJ2D 4J2TA 4P33A 4I55A 3PWSA 3IQIX 1BGWA 4HATA 3EQ7A 5ER9A 1WETA 2PBZA 1E0SA 4UC0A 4TMYA 4UTVA 4Y9TA 4XLZA 4B4DA 3GU3A 3IOYA 3ZNNA 1SBTA 4W6ZA 2Q6LA 3IL2A 1OT5A 1DDGA 3OPYB 1NW8A 4UVDA 4UCFA 3NONA 4X3PA 3NVDA 3DFZA 4N7MA 1EK2A 1ZJ4A 3RODA 5EJFA 4BP3A 3QV1A 5CHEA 8GPBA 1A7JA 3DDOA 4LMRA 4NJMA 4DZZA 4F3RA 4ZVVA 1N4AA 1FTQA 4JB8A 1BD4A 1W581 1ADBA 1H0KA 1UZLA 1HSZA 3JD2A 4ENTA 4HZUA 3ZWWA 2QUHA 3TQHA 3HWX1 3QYAA 2PTHA 1U8YA 1XVIA 1YS6A 2REOA 3JWEA 4GOLD 4CNBA 5ILGA 2ASEA 3L7IA 3F5SA 3IRUA 2OUKA 3RCBA 2A0FA 3W2IA 4ASUD 5TF0A 1SC3A 5EGSA 4G1EB 1P9OA 3E7PA 4XUDA 1D2NA 1RTTA 1FFCA 3TX6A 3VM6A 1TYAE 3R3YA 2X5NA 3SJ7A 5EIEA 4JEMA 5TPZA 1YIOA 1ZO8A 4UCWA 1V1MA 3ICOA 4OH1A 1PTJA 1CF2O 1Z0UA 1VKJA 1VL2A 2K5UA 2QW1A 3ADKA 3CF2A 5DNDA 2Q07A 2FU5C 4D9CA 2C95A 3L6EA 3MTEA 1E6MA 2C2GA 1H42A 1BU8A 2FW8A 3AFHA 5KTYA 4IMRA 5ERYA 5I5GA 2CB0A 3I2IA 1TW3A 2B78A 1WXDA 4Q9AA 1U3TA 4NJEB 4JQYA 3K0FB 1Z8FA 1TVMA 1W1IA 3FNQA 1E6EA 2Q2OA 3KDPA 1BEEA 1UAGA 3C3WA 3LL7A 1WW3A 2QL5A 1YS9A 4YJFA 1YR3A 3ABRB 3R7FA 3SFZA 4BB0A 5JAMA 2FEMA 4XGKA 5A7FA 3CH5A 3OCWA 2CL0X 2FZ5A 3IMGA 2IIPA 3RH0A 4IJ5A 3HR8A 5K6RA 3KB6A 3KR2A 3Q9NA 4QGGA 1M33A 4CL0A 4E5SA 4JBYA 4YCSA 1LH0A 1YR2A 1XBTA 1XALA 1Y1KE 2BW0A 4K0RA 1HKHA 4G5YA 5TQ0A 2WG0A 3SZLA 3VVBA 4UBOA 1CUHA 1G5FA 2RHMA 1FPMA 3PC7A 3ZDBA 1QV9A 3BA6A 4OXNA 1IZ7A 2C4KA 2HEIA 2W4QA 3PCRB 4KZKA 4ZO8A 1POWA 1UXOA 3MWJA 4GZ3A 5SZHB 2XB9A 2V6FA 4RZHA 1EINA 3UJ3X 1NPDA 1EBFA 3BD9A 2WJVA 5KYNA 3HVIA 2VDMB 4BFVA 2Z2IA 4URFA 2J3LA 2WIDA 3A6ZA 4CGYA 4E4TA 5F77A 2Q2VA 1SVMA 1TVEA 4G8DA 5A6SB 1F5SA 4ZCTA 3C1AA 4NY1A 1OYYA 2ERXA 1BFUA 2PRJA 2G8LA 3LX5A 4B43A 5HCUA 4RD1A 4ZWNA 1J8DA 3V7WA 1NP6A 4EKEA 2XOKA 1P0CA 1A8QA 1QQ7A 3AY6A 4ZHQB 4HTFA 5IKOA 2YQZA 1M2KA 2RH9B 4U9IS 1M34E 2GESA 5B1DA 4F8YA 1ZK3A 1NONA 1SPXA 3VPFA 2Q3CA 3RRJA 1DXQA 2CC2A 1V8OA 2PX8A 2RH5A 4Z4HA 5HHTA 2EGUA 3L1JA 4MKXA 1UM8A 4N5IX 3A9UA 3GJ4A 4Y1GA 2ZPTX 4GZLA 1QE5A 2O48X 1WUKS 3QYJA 4EUEA 4MKHA 4RMGA 3PJFA 1VBNA 2RGRA 3BTVA 3C3AA 3PQ4A 2FX5A 4URVR 1UMKA 3RTAA 2P9TA 5JAHA 2Y2VA 1SMKA 4MLDA 1RRPA 4BNGA 2RHGB 4IX9A 3RTEA 3PHJA 4DWOA 4EL5A 3BT7A 2OHGA 4MS4B 4MMYB 3DWEX 3NT5A 1ODKA 3OZ7A 3ON5A 1GQQA 2X9VA 1IDN1 3OPMA 1SXHA 3QFHA 4B6QA 3R24A 4Z9XA 3LUHA 3F5MA 1XU4A 3QVSA 3FHTA 1NRJB 3R3XA 1PEKE 3ETEA 5KVSA 4N39A 4YR9A 1EGMB 3ZWAA 1EB8A 4DAEA 4PXAA 3BRWA 4EKIA 4R71A 2FPIA 2QX4A 2W4MA 2C54A 3G2JA 4IHAA 4LZZA 3PLRA 1NR1A 4UVHA 1IL0A 4PZUA 3AKDA 4X95A 1XPOA 1FX0A 3AHCA 1SVKA 4P31A 2QV7A 3WNDA 3EGXA 2A9JA 3G2OA 1J42A 1J9EA 4XVCA 1E1NA 4G81A 4LJ9A 2HLDD 4WKBA 2LKDA 3NTXA 4QXOA 5HJ5A 1L4YA 1WD7A 4YAUA 3H05A 4R01A 3I9FA 1Y4AE 3KJXA 4LSGA 1YUMA 2E0IA 3KOWA 4UZFA 3RUAA 3SEZA 4R05A 2H16A 3ND9A 5DP2A 1IK4A 3RYTC 4ARVA 1ZXBA 1J23A 4KGXA 1NOKA 4PS1A 5IZ4A 1KMHB 3BFKA 1I7DA 1BKYA 2X3FA 1JFRA 1WPXA 4RHYA 2YCLA 1COZA 3K70D 1GR0A 4N3AA 2DLCX 4CIAA 5PNTA 4Z49A 4BB6A 4KLCA 5DSZA 2AZDA 3I9KA 4S2EA 3UPDA 1PS8A 4GPZA 2VK8A 3EUFA 5T4HA 4NOKA 3PKZA 2JA2A 1L5FA 2E4ZA 3Q2IA 4P93A 1N8TA 3LHDA 1VE3A 2C1EA 2J9FB 3TECE 3V4RA 2JIZD 1JYFA 1N2BA 1SD1A 4JOSA 3WGLA 2R5WA 4OJYA 3HS3A 4QBTA 1G1AA 5BMVB 1C7FA 4TUYB 4ZV9A 4PM4A 4DR7B 2XHZA 2WAYA 1T4BA 3BWEA 1T1EA 1Z7BA 2FDXA 5JDCC 4YRCA 5KQSA 3DMGA 3E9RA 4OQ4A 1P1IA 2IODA 4KDCA 4NWIA 4EJ0A 1LB1B 2CV2A 3ZKAA 3GJRA 3N8DA 4TLDA 3G13A 4D9JA 3K71B 2WSSA 1I1QB 2CD7A 3ONFA 3QPBA 4HDRB 1XCGB 3AZPA 4BVLA 1QV7A 1OX4A 2P9YA 1MRSA 1DOAA 1N5KA 1FW6A 2V4ZA 3CKMA 2P7IA 3DXXA 4G1BA 4ZVRA 1HF3A 1LDBA 1SA0A 5FEUA 2KLBA 1NHGA 3B8EA 4DSAA 3P52A 5BRAA 4L76A 1R9GA 1V26A 5A3VA 4WIAA 4LJ7A 3ZHTA 2Q1UA 1CZRA 3OTQA 1ZN2A 4RZSA 3IVAA 4S1WA 1CC1S 3W8DA 4JX9A 5GZ6A 4B09A 3GZJA 3E81A 3OKAA 3UJ7A 1Y6GA 2N0SA 5IH3A 3OZWA 5EMKA 4UM9B 3BF8A 4AJHA 4CZ2A 2BM0A 4L5AA 3JWJA 3LFTA 3N9IA 4X45A 4IDPA 4E5YA 1E2UA 2P6RA 1LK0A 1VLJA 5T8KC 1GG9A 3I83A 2O7NA 2C2XA 1Q77A 2NADA 1TFUA 3JQ9C 5LLTA 5AW8A 1DPGA 3EXFA 3CE9A 4D8XA 5AJXA 3K70B 2YBDA 3T6KA 1T5OA 5PGMA 3CJQA 1KAMA 2O3QA 3LC7O 4K9LA 2WWRA 1VRVA 1F8GA 1NL3A 3K94A 1Q44A 1L1FA 4N0PA 3WLMA 1Z8HA 2HHAA 3IELA 5DKFA 3S5UA 4DNFA 2C7QA 4ZT2A 2EKPA 3K9GA 4BMZA 2Q6VA 2WPNA 2O5RA 1ISRA 2E21A 2UUOA 4GUDA 4IDEA 3G6WA 4PHGA 3WYCA 4BFCA 1NMXA 4KFUA 4OEHA 3RB8A 4DLSA 1FDVA 1B73A 4HLUC 1ZGBA 4C2BA 4UTNA 3UYLA 1SRRA 3G7SA 3UAWA 1SQFA 2FETA 3C5CA 4MK4A 2QTZA 2ZUVA 3FM9A 3SN6A 3UTCA 4Q6WA 3CISA 4GWKA 4INPA 1E2FA 1IXYA 3WLLA 1NW3A 1N0VC 1KJQA 3H6HA 1DB3A 1UC8A 2O2JA 1E94E 3D8TA 1F3LA 4N0DA 3EEYA 4NICA 3T0IA 4AZSA 3EZXA 1J8YF 2JGKA 1AKQA 3AEKB 1Z68A 5KHLB 1YDMA 1JLMA 1T1JA 2F43A 4B7CA 3MA0A 3EIHA 1YVRA 4HDMA 4L02A 4AO8A 1PNRA 1ESEA 1E3JA 4QVGA 1HLFA 1W0KD 1DG1G 1D4ZA 4FNMA 4FMCF 1OBCA 1DIBA 3ETDA 1T8WA 2D3TA 3RU9A 1SVLA 4M9SA 3O8QA 5BQOA 4BNYA 4UTXA 4FNOA 3H9QA 3W6NA 4F96A 3SBEA 5FPYA 5L3QA 5AW4A 1YL5A 1XRLA 2IXDA 2W00A 1X7ZB 2ZJ4A 3FKQA 2HRZA 1Z7YA 2I54A 4ENVA 3RYCA 4F1WA 3WFIA 4S1PA 3EISA 3PGJA 4QRDA 4RGQA 4UKDA 4WCFC 2QP4A 1ACJA 1L4BA 4ML3A 5FQNA 4HXEB 1H3EA 3F9RA 3VVLA 1HDXA 3PIIA 3GLIE 1RR6A 4FMDF 1WPQA 4Y0NA 4B32A 4BZZA 2QX9A 4I1VA 4OHRA 1QKJA 2OBXA 4Y6RA 3Q0EA 2JLQA 2NUTB 2WB4A 5DLQC 2NU8B 3ZGLA 3GMIA 2VH1A 5JH7B 3CNOA 1WABA 1KSHA 1QVAA 4CLOA 1U98A 2VDOB 1ZYUA 2C4HA 2E18A 4II7A 5AVJA 5JWHA 4RBNA 1C4WA 3AVPA 1LNSA 2FR8A 2JAPA 5H0IA 1T5SA 2VG8A 4Z9YA 1E5XA 3CX3A 2Z2KA 4OYRA 5JLJA 1PUXA 3EWSA 4RJTA 2QRGA 4D5GA 3J80A 3DV2A 2M98A 2GK4A 2F67A 3E27A 2A9PA 4V1CB 2J5BA 1ZZEA 2FX3A 5EIXA 4C9BA 3O3NB 4CXMA 2HJHA 3DSRA 1WV1A 5ITVA 4WCDA 5HQ3B 2O7RA 1N32B 5DJ5A 2A1UA 1C0EA 1M1ZA 1VBMA 4O4LF 5BO5A 5KI6A 2XXBA 5P8WA 1W34A 1ADCA 1XE3A 3TXXA 4EHHA 5K8LA 2Q3BA 2J9GA 3QEJA 5LLDA 1H6AA 4GLJA 1UBMS 2XTMA 3CGWA 2BBOA 2XIQA 3DOUA 2IYWA 4LHEA 4OXIA 3FUUA 1AQ6A 2C2BA 4PYRA 3H7IA 1IUPA 4MICA 3KR0A 1OSNA 4G2TA 2OV1A 4RV5A 2X9GA 4PZ9A 3KUXA 2INGX 4PG8A 2PUCA 3H6GA 2XNDA 4XQ9A 3AETB 4AKTA 2ORIA 1TM3E 4G85A 3REFA 2H1CA 1AA9A 1YRWA 4FLEA 3H5WA 4DOMA 2ADMA 2JZNA 1EFPA 1PLLA 2W8BB 3ZIDA 5JCJD 1SBYA 2UU9B 2TS1A 2G09A 4J1TA 3VO2A 5HJEA 3ZHCA 1QJCA 2ZIUB 5G0WA 3UB2A 4C2TA 1RRVA 4GEGA 4ND1A 3ETHA 5IC5A 2JFBA 3QIAA 3V2UA 3WK9A 4PX2A 2PX2A 3OH8A 3OOHA 1EP9A 1FSSA 2HA7A 4MS1A 1J39A 5EPOA 1P33A 4CEJA 4IKOA 5HS4A 4OX9Y 1Y3CE 2UXDB 3TJRA 2I4MA 3O3MB 1NVGA 3HCWA 4J1QA 1R66A 5DTMA 3WGHA 4LVOA 4CLXA 4DR6B 2ORWA 3AF0A 4FEYA 2NX2A 2HUPA 1IJBA 2ACKA 3QQPA 1NQAO 1QTIA 3T52A 3W04A 1C7IA 1QYXA 4B82A 4WXPA 2JLSA 1HE3A 1U1EA 3FVVA 3HY6A 1XTVA 2HPVA 5LBUA 2RC5A 2O8CB 4QPDA 4TMVA 5KVQA 4URHA 3KKMA 4FGKA 1E18A 5THKA 5GV7A 2O2IA 1PZGA 1VFPA 4G26A 4WZAE 4EOGA 2G9QA 4YROA 1ODFA 2FB9A 3AGQA 3SIXA 4IEFB 4A27A 3UHOA 5LU8A 1WP4A 3D6VA 5BNZA 2JJQA 2J6IA 4MIOA 2HIMA 2XBLA 2B4RO 3FYSA 3PVZA 5G1PA 1KR2A 4IMPA 2W2LD 4CCYA 4DKJA 4JASB 3N2KB 5I7FA 2Z98A 1L5OA 5IMBA 2XV1A 3J7AC 4FR2A 3K20A 2OCGA 4BNZA 4Z2AA 3PEUA 2NAFA 2QSYA 5AI8A 4A73A 3LWDA 1X1AA 5K3BA 1SCAA 1W44A 3C8MA 1ORIA 4CQLB 5HOQA 2GGSA 4B46A 1UKYA 4QOEA 4E1VA 1VIDA 2FDCA 4NLLA 2JKYA 4EPRA 2JPDA 4GD3Q 5MGNA 2ZSJA 4M87A 3RBAA 3ENKA 3GR6A 1J5PA 5BUQA 1USVA 1JU3A 1MT0A 1RAEA 1Z15A 2H52A 2H3EA 1WZEA 2I3BA 3GLTA 3IIIA 3ITEA 3L0ZA 2L69A 2HDOA 3N59A 2ZJOA 3F7OA 4K6OA 3DEZA 1FRQA 2W70A 5ICSA 3LBIA 2ZUUA 1V5EA 2NO0A 3I4FA 4WSOA 2E49A 3F9IA 1O8BA 4K8RB 1V5FA 4JI8B 4H0CA 2I76A 2OHVA 2Q6OA 4EVQA 1SCDA 5IX8A 2OHHA 3GEIA 2XEDA 4FCTA 4ZAYA 4CU2A 4B35A 3RS4A 1I51A 4IDQA 2WFMA 3GRAA 4WAUA 1C50A 2W2QA 3FMIA 1AURA 3B9BA 3MCUA 3AKZA 1D09A 1QRAA 4UNSA 4F91B 2GZ3A 4JKOA 4HYTA 3W4IA 4QUEA 3IODA 3F3MA 1ZOPA 4D4KA 5IBPA 2AOWA 3WKEA 2Z30A 2VJNA 4HGQA 3TQTA 3FHOA 4EENA 3PPXA 1A9ZA 2JGRA 3LI2A 1PFUA 2FTKE 1F2TA 3K5PA 3SQNA 3PNQA 3IQGX 4LKOA 2OAEA 1U28A 2GYUA 4AS1A 1VIYA 2ZT6A 4JHLA 3E22B 1P5JA 3SSOA 2AXNA 3BYZA 4B79A 2ODEA 3F8TA 5GJVC 4L6AA 2ZDQA 4DLXA 1M9NA 2P6OA 5ESRA 4RPIA 1FP7A 2H17A 3OPYI 2XZLA 1QV6A 3C8ZA 3DD5A 5FPQA 1RHUA 3M8KA 1NA5A 3K6SB 2E4AA 3TNYA 4DQXA 5KVCA 4WASA 5D7NA 1L5MA 1EX7A 1G2PA 3HACA 1JNYA 1H4SA 2BCEA 4FLMA 2E9SA 4N7BA 1WSDA 1E2EA 3QXHA 2J3MA 3KPUA 2IOFA 1XG5A 4LJAA 1RRKA 5DNUA 1DJLA 2JF0A 1IUOA 1MW9X 3AYXB 3W90A 1TEZA 1R3UA 3RUCA 4FFWA 1RD4A 1U80A 4X64B 4GZ6A 1ZU5A 2R79A 3HYCA 4ITUA 1R5NA 4ERXA 1QRTA 4KR7A 2Y27A 3D43A 3K3PA 4O2BA 1RTKA 1OF1A 4FDAA 4UNNA 1H2BA 5U1PA 3SC2A 1FCJA 2ACEA 4LDRA 1BYIA 4J7XA 5KTNA 4CYMA 3BD7A 4UHKA 2F8TA 4KE7A 5ER6A 1DAHA 4EVRA 4M0FA 1BKDR 1BOOA 1SBIA 3NFRA 1THMA 4MUIA 4RVFA 3WXMA 5ABPA 1P5FA 1HORA 3AF6A 3C6YA 2Q4TA 1P9RA 5FKJA 3V8NA 4H3HB 3H1PA 1LQUA 4US0R 4QRIA 5HFJA 3DDCA 4RD2A 4RAOA 4XD2A 1NVBA 1SHKA 2J3EA 2CF6A 1QVWA 5B3JC 3RQIA