3KB1A

Crystal structure of the nucleotide-binding protein af_226 in complex with adp from archaeoglobus fulgidus, northeast structural genomics consortium target gr157
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
255
structure length
243
Chain Sequence
b'RVTDEDIKERLDKIGFRIAVMSGKGGVGKSTVTALLAVHYAKQGKKVGILDADFLGPSIPHLFGLEKGKVAVSDEGLEPVLTQRLGIKVMSIQFLLLIAGMIREFLGRVAWGELDYLLIDLPPGTGDAPLTVMQDAKPNGAVIVSTPQELTAAVVEKAITMAEQTKTAVLGIVENMAYFECPNCGERTYLFGEGKASELARKYKIEFITEIPIDSDLLKLSDLGRVEEYEPDWFEFFPYLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleotide-binding protein
molecule tags Nucleotide binding protein
source organism Archaeoglobus fulgidus
publication title Northeast Structural Genomics Consortium Target GR157
rcsb
total genus 60
structure length 243
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10609 ParA NUBPL iron-transfer P-loop NTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kb1A01
1E1QA 4GOKA 2OFXA 3FMOB 5KSPA 1R5BA 2QMUA 5FUWA 4PZYA 1Q57A 3K53A 2ZS9A 1ONBA 2CMKA 3RRYA 4OQNA 2H92A 4BFUA 4WW0A 1YHNA 2AX4A 4FI3C 5EE0A 5FL3A 3ADDA 3QSYA 1NN0A 2FU5C 4TLAA 4I1OA 1WBDA 3GJ0A 4PHGA 5CK5A 4GP6A 1SULA 1CF4A 3SOPA 3TW8B 4TZ6A 2JLXA 3WYFA 1IJFA 3Q8XB 4Y0VA 4RD2A 3IQWA 3WP0A 4MYCA 1XEWY 2XTZA 1II8B 4EPYA 4AURA 4HAUA 4TYPA 3EC1A 4DLZA 2ZXUA 2PLRA 2YYZA 2NO0A 2V6JA 3ONWA 3VTKA 2YC4C 1E2KA 1VG9B 2IT1A 3BERA 4A82A 4NYMR 4XOIA 4TYYA 3OEHD 2NPIA 3GLFB 1E9RA 4C0QC 1QHXA 4TQUS 1R4AA 3KQUA 2HYIC 1E2GA 1XTIA 3I1FA 3QBTA 4TYNA 2VP0A 1NG9A 2VRWA 4IDHA 3HU2A 2C95A 1VCMA 2WWXA 1ZBDA 4IVPA 3W5IA 2B7CA 3C7KA 2GF9A 3CKLA 3UATA 4C0JA 5L3QA 5CB6A 1PVOA 1P73A 4DT1B 1X8JA 1Y3AA 2YWEA 2HJGA 3NTUA 4JLOA 5FOXA 5FUXA 1SZPA 4JVSB 4G3XA 4TL6A 3K09A 2X2FA 4MKIA 4BUJA 2A30A 2FEMA 1UKVY 1NN5A 4XVUA 1JBKA 4PPFA 4C9BA 3T1TA 5FTMA 4XIGS 4B43A 1Z6YA 1GUAA 1ZUNB 2IWHA 3I3SR 3SU8A 2JLUA 2ZR0A 2DFLA 1CTQA 2P67A 2BBSA 3F8TA 1T8UA 2OZEA 3BIFA 4KSCA 1ZC4A 3LBNA 1TADA 3B2EA 1QHSA 4F7WA 3KTAB 4GSYA 3VR2A 621PA 2AL7A 2GF0A 3LW7A 3UXMA 1JECA 1E79D 2IYLD 3OFNA 3Q9LA 1KMQA 1SHZA 5JI3E 2WV9A 4UNSA 1U9IC 2ODWA 2WJHA 4QGAA 2J3EA 2QPOA 4C4PA 2J0QA 3GLFE 4LOAA 4A1FA 5BXQC 3K70B 2ZSAA 3LWNA 3LO5A 4P4UA 3UKDA 1W49A 3FB4A 3K0SA 4D0NA 4G5QA 3ZVNA 4K81B 2XZOA 4FMDB 1R0ZA 3AKDA 4IOMA 2J7PA 4MQBA 4E5UA 5BW8A 1UF9A 2C77A 2LCFA 1DEKA 5KOYA 4US1R 1IBRA 1EFTA 2BOVA 2WJYA 1YRBA 4QBFA 4HAXA 3GJ6A 2IEYA 5HPYB 2H5EA 2BEJA 1ZUHA 2RAPA 5JWHA 2GAOA 2VL7A 3U44A 4KFUA 5CYPA 2ZS8A 2DYKA 2BCJQ 2Q9CA 3WRYC 1W7AA 5DO9A 1XTJA 1YRAA 2QAGB 1LFDB 4XH9B 1EWQA 2BBTA 2ONKA 4Q4JA 2FDCA 3BGWA 3QF4A 2A5GA 3J81k 2KI5A 4O0MA 2FSGA 4ESVA 3BFXA 5JHGB 2OV2A 4LC0A 1SVLA 3Q7QA 4K46A 3TIFA 2ZJYA 3U6BA 4C7OB 3AVVA 1KIMA 5FI0B 4B6EA 3THXB 2FPKA 3VHXA 5DE3A 2CHQA 2R6GA 3TSOA 4AYTA 2ZJZA 4NCJA 3AF3A 3AVYA 2GCPA 2CVHA 1XZQA 1NSFA 2GZHA 1Z0KA 5H70A 1COWD 3U7HB 2ZRCA 3NVAA 2D74A 2JIZA 4NPHA 4O2LA 1Z0FA 4DBLC 3DO6A 3EZ7A 1EX7A 1YVDA 3RAPR 5B30A 2D06A 2RH5A 3EIQA 2UZIR 4OYHA 2JIZD 1NLZA 4MYUA 3HU3A 2G1KA 4NH0A 1XD8A 5AR1A 1KI6B 1DOAA 4N3NA 3ZS9A 5FH9A 4DCTA 1J7KA 1T3LA 4NCNA 2WIBA 3IHWA 3NG1A 4YMWA 2HCBA 1X8LA 2FEOA 4V03A 1PV4A 1DO2A 2ORIA 2DFTA 1OHHA 4PANA 1CJKC 4L4UA 3UG6A 2G1JA 2QRZA 4OL0A 1AKYA 3B6EA 3THOA 5J47A 1P7CA 1ZCAA 4NBSA 1YR8A 4KO8A 1E9AA 2HLDA 1Z0IA 1ZM7A 3QENA 1D9ZA 2A78A 3UWKA 1TF7A 4OHXA 4DB4A 2D2EA 3LX5A 4M1YA 3I5YA 2VP2A 1FP6A 5F98A 1OT3A 5A5GA 4KYUA 5ANRB 1OJLA 3GLGA 1UEIA 4Q9IA 2WKQA 1RJ9A 3P26A 4MRSA 3T1VA 2JGNA 4XD7A 4Q9JA 3FHOA 1SXJE 1KMHA 4JBYA 1KO1A 1WDTA 5AUQA 1NVVR 1TNDA 2C2HA 2JJ8A 1CLUA 1ZNYA 3ZVLA 1Z83A 4LYJA 5CM9C 3CNOA 4AG5A 2FZ4A 2CL7X 4MUBA 3I4LA 3TAHA 3VHLB 4FXPA 2QN6A 1HUQA 1DAGA 1FUUA 1N6OA 1QHHB 1NKTA 1ZP6A 1CP2A 3NDPA 4JLDA 4Q66C 1H8HA 4C0LA 3A1UA 2FSHA 3OIVA 1P62B 2FZLA 2FV8A 1OF1A 3CLVA 5CM8B 3GJ5A 2KBFA 1KO7A 1JALA 1GKIA 2ZYTX 3A4LA 3E70C 1KI7A 5A0FA 4AYXA 4E07A 1O87A 1G3RA 1YZGA 1HV8A 4H9GA 4HLUA 3K70C 2MSDB 3KJGA 2R6AA 3CNLA 2QAGA 4IVRA 2VP5A 4FMDF 1KK1A 2XSZD 3D8BA 2P6RA 4N0DA 1JEDA 2ZRBA 3ASYA 4LSGA 1TUIA 1Q1QA 2WMNB 5FOUA 1P9NA 4DVGA 2G83A 1HY3A 4G1UC 2W83A 1TMKA 5KSZA 2A3RA 1KZGB 1OLOA 3CRW1 4MITA 5BYKA 1KDTA 1F2UA 4DDVA 4LPSA 1WQ1R 2NPFA 4HI0E 3RVBA 4L8GA 2EYUA 4NYJR 4OHWA 1G19A 4CGZA 3KB1A 2N42A 4PFSA 2QAGC 4GOXA 1FMJA 2C9OA 2GEUA 1ZIOA 3ZS8A 4JZKA 1XTKA 1DAMA 1GAJA 1JXMA 4GP7A 4W5HA 4WAUA 5CDFA 2GVDC 4MUAA 3C8UA 3KQKA 1GVNB 3GJ4A 2PZGA 2P5TB 1SXJD 3WYGA 4TT3D 3RWOA 4LJ9A 5C4GB 2DFNA 2JLSA 4I1VA 2NG1A 5J4HA 4GI7A 4KAXA 3BS4A 4ZIRB 1O3YA 3PEYA 3M0EA 1ZM9A 4M0LA 4P4SB 4DWJA 3GD7A 3FGNA 3THWA 4ILEA 1WMSA 1MO5A 1KI9A 4LJAA 4QBHA 3U7FB 4W5JA 2J46A 4ZO4A 5EP3A 2OBNA 5H68A 2ZREA 3RHFA 3AV0B 5DI9A 3KQLA 1NVXQ 4AG6A 4G01B 2YWHA 2WJVA 1ZM2A 4Q1CA 3D7MA 4UJ5A 3PXGA 4URWR 5JHHB 1CEEA 1E94E 1N3BA 3C14C 4X8LA 4WXPA 3CPJB 1UKEA 5JFGA 1E1RD 1VYTA 4KBFA 4CIDA 3AKCA 2BJWA 4ZV4A 4C2TA 1FFHA 4DZZA 2VH5R 1FQJA 3PQCA 2PCLA 2F1RA 4R2HA 3VMFA 3W34A 5EP2A 1KNQA 2QTFA 3A6PC 2BKEA 2ZJAA 3EZ6A 4H1VA 3FKSD 2CK3D 1KJZA 2D4HA 3K0FB 3MFYA 2IYWA 4A2WA 1U99A 1VCOA 1Z5ZA 2FE4A 4LCBA 1PLJA 4Z1MA 4TMTA 1E9BA 1UPTA 3H86A 1UBEA 4QBGB 1OB5A 2OCYC 3GLFA 1W2GA 1SVOA 3VR3A 4G5GA 3MMPA 5DGXA 4A2QA 5B57C 3BH7A 3CRQA 4B6FA 1XEFA 1US8A 4D6PA 1FL9A 2ZE6A 4U7DA 3FE2A 4KLNA 1IN7A 5J4KA 4Z54A 2PBRA 2IYRA 2YC2C 1XP8A 5FUYA 2XZPA 421PA 2GZDA 4OHVA 2BKUA 1YQTA 2IYXA 3IPYA 1E9DA 1DS6A 2DPXA 3BWDD 1HEIA 1ZC3A 1CR2A 1Z8FA 4C3ZA 1W47A 2VHQA 2ZI5A 3A36A 5EJEA 1ZJ6A 3KKQA 1Z08A 1IM2A 1U94A 5AUOB 4YMSA 4AY2A 2A5DA 2OEPA 5L8VA 2QSYA 4JT4A 2XJ9A 4QG7A 5IF9A 2IWRA 1IONA 3L43A 4Z8XA 3W8NA 2XX3A 2QEQA 2FPLA 2ZPTX 3L0IB 4IEEA 4GNKA 4Q4JB 4TLEA 4DLRA 1XRJA 1G7SA 4QNMA 5IRCD 5KTYA 4OK3A 1H8HD 3B1VA 4GPTA 1OW3B 5D3MA 1SKYE 3QE0A 5EXXA 1X1SA 3GFTA 4N1AA 1HT1E 3BXZA 5FFMA 3WRXC 3QXXA 3ZQ6A 5HE9A 1KK3A 4Q4AA 1CRPA 3IBYA 3KB2A 5G41A 2G9NA 5DYGA 4EDHA 3C5HA 3TR5A 4TSFD 4CT5A 2XXAB 3NDBB 2YVUA 1R2QA 3DKPA 3TK1A 4OQLA 1XTSA 2IA5A 4GMXA 2PLFA 2DB3A 2R6DA 4M8NE 3MWKA 1E2FA 2DBYA 3RRMA 1D8TA 3GCGA 1W5TA 4JJKA 1Z0AA 1G6HA 1T5IA 3L2OB 4LK2A 3RS0A 4QHYA 1XMSA 4BFSA 2UZ3A 1NY6A 1XD2B 1OXSC 1N5LA 1OPXA 4RSGA 4D4LA 5IK2D 1JQJC 1KOFA 2BC9A 3CWZA 4GZMA 3FWYA 5EP1A 2IXEA 4QGFA 1NP6A 2C8VA 4TLCA 1YR9A 4UJ3A 4EFNA 3ZVRA 4MDFA 1CS4C 1E9SA 2C99A 1B0UA 3U5ZB 1KY2A 3KTAA 4D82A 2HDNB 3D3QA 4MKGA 1F2TA 4IEIA 4W5WA 1QZXA 4ARZA 2X19A 5CIQA 3F3YA 1OIXA 1A2BA 3CRMA 5FOWA 3Q5EA 4F4JA 5G3YA 3AVTA 3RANA 2PJZA 4R71A 1XB2A 4JVLA 3GJXC 1J90A 1JR3E 1RIFA 3RRZA 1R8SA 3RC8A 4NDZA 4KI0A 2OLJA 2Q3FA 4BECA 3QXJA 2C78A 3AUYA 2NZ8A 2ANCA 3L0PA 3SJZA 2HLDD 4V0MA 3TAUA 3W3ZB 1UEJA 4JSTA 2O0JA 1OH8A 3LRPA 5K8LA 2QSZA 5K8TA 5J40A 1VTKA 2CBZA 3SJCA 1M8PA 3RLFA 4FCVA 4EAQA 1KI3A 3BJIC 4B76A 1GL7A 4RZ3A 4CVNA 3U60B 3VR4A 4KSBA 4JLKA 4Q7MB 2J59A 3KKNA 2G88A 1F6BA 3K9HA 4LBYA 1JJVA 1Z0DA 2CLCX 1HH4A 4U5XA 5DISB 4ZKDA 4EPTA 1JB1A 3LAWA 1GRNA 1U90A 3SYLA 1Z6AA 4YXWD 4Q1BA 3PCRB 4TZ0A 1I4TD 2PZFA 4HATA 3PUXA 3THYA 3WMFA 2QG6A 4TN1A 4GOJA 4V0ME 3AGPA 4HZUB 3GFOA 4RD3A 5GJBA 5K8UA 4C0BA 1CJTC 3N2IA 1G64A 2CE7A 1VG0B 1VIYA 1YZLA 4IW3B 1F48A 3I5XA 3K0CC 4DCSA 2Q3MA 2R6FA 4DLUA 3ADKA 3EZ9A 3LQRA 3UMSA 5JMTA 4R98A 2WJIA 2QE7A 5LD2C 2PMDA 1NNEA 3DHWC 4FMCB 1SVKA 1XMVA 2RGNA 1NIJA 4RCZA 3HU1A 2IEZA 2WKPA 3A58B 2OLKA 3CIOA 1NLFA 5C4MA 2O0HA 2IUSA 1MR3F 1XD9A 3PR1A 3CF2A 2EFDB 1XCPA 4B3CA 2NOAA 4GZLA 2ZS7A 3B9PA 4R2IA 3V9PA 3AUXA 2VP9A 2WWWA 3BFKA 2VQSA 4XTCS 2BWJA 2QL6A 1N6NA 1VCIA 1N5KA 3ZVMA 1FUKA 2KB0A 1W36C 1UKZA 1AS3A 4YDSA 3SBEA 2ERXA 2IS2A 2V7QD 2ZR9A 4KVAA 2J87A 4I1UA 2C9YA 1EG7A 2AK2A 4MYHA 1FOEB 4LV6A 1CKEA 1TU3A 2O8CB 4KITB 2ZAMA 2ECKA 1SGWA 5EZ6B 2IS1A 2JATA 4AIIA 5HE8A 2QM7A 2YZ2A 1DARA 4X8OA 2EWWA 3SYNA 4PQFA 1YZTA 4URUR 4WVFA 4B2LA 1KI6A 1PUIA 3IQXA 2QQEA 3QKSA 3OIWA 5JRJA 2DR3A 2AWNA 2WKRA 1DTSA 5DH9A 3SS8A 3T5DA 4NYMQ 5JZVA 1C4OA 5GVRA 2FSIA 2OAP1 3Q85A 3PJRA 1KK0A 2ZVQX 5DSZA 3DOFA 4TSFA 4QJ4A 1AGPA 2IC5A 2REBA 2QZ4A 3DDCA 2O8FA 3HP1A 2PZEA 4BQSA 3B82A 5TARA 2YINC 5KO2A 3BORA 5JS8A 2WICA 3OEED 1W0JD 3K9GA 3T06B 2E87A 1BH2A 4YXWA 3IIJA 3GEHA 2ORVA 5D3QA 2IW3A 2BV3A 1QVRA 4DIEA 2QNRA 2YWGA 1OH6A 2QBYA 1Z06A 4CZ2A 1AA9A 3Q3JB 1G7RA 4BRUA 3D31A 4A4DA 5KU1A 2Q9AA 4NCIA 3U44B 4O3MA 3AVUA 2I1VB 2PX0A 2XAUA 2ZE8A 1IY2A 1AK2A 5JJIA 2WJGA 1N6PA 3HR8A 5EXTA 3R7WA 1TQDA 1SXJB 3KFXA 2IK8A 4POAA 4BWYA 4AKGA 4LRWA 3RWMB 2QMEA 4DLTA 1I4DD 2QP4A 2DWQA 4I4LA 4RJLA 4PHFA 4WA7A 3U4QB 2IHYA 3HPQA 3TVTA 4V0OA 2GESA 1VIAA 4EQ6A 3U4QA 3AGQA 2P0EA 2HF9A 4PC2A 4HZIA 5LDDC 4DIDA 1G8PA 4MRNA 3LX8A 1G8YA 3X2SA 2Z43A 4FMBB 5FPTA 2MSCB 4TMZA 1E9CA 3GJ8A 521PA 3WP1B 2O8BB 4KU4A 2BMDA 2Z6VA 4E09A 3JZMA 1E2IA 1PUJA 2JLQA 1BOFA 2J45A 3AEZA 3FHTA 4JVMA 1CR4A 1GNRA 2QT0A 4PC1A 1F5NA 5E4FA 3LA6A 2YOGA 5LD2B 4M1KA 4A9AA 2GJ8A 4RKEA 2CDNA 3NC1C 2R44A 5JCZA 1UDWA 1ZU5A 1W36D 3VNUA 2VLIA 3ICEA 3KQNA 1VPLA 1G8GA 1NMXA 2HJVA 3ZQJA 1M74A 1U0LA 2CHGA 3CZPA 1AN0A 1W46A 3U6KA 1Q12A 2V1UA 3ZYCA 1U0JA 5CJPA 3O47A 1LS1A 1E0JA 2PCJA 3R9WA 4TTQA 5E7JA 3QKRA 1HYQA 4KBGA 1W36B 5FTNA 4BRWA 4CT4B 1L4UA 2A5JA 2XSZA 5EE5B 3ETLA 3TBKA 5CITA 4NL4H 5J4LA 3E1SA 3VNVA 2BBWA 2QE7D 3T61A 4B2PA 3I92A 2XTNA 4LBWA 4LPKA 4AKEA 1R6BX 2ONJA 4C0AC 2KE5A 3SEAA 4V0LA 3KUDA 3CW2A 2XNDA 5CK4A 4B71A 3PEWA 2X8AA 4QL3A 3WBKA 2EQBA 4JL6A 3OFND 1Q20A 2JDIA 1AZSC 5C2JB 4DHEA 2O8FB 2OE2A 4IOLA 2V55B 5A4JA 1Q1ZA 5FTKA 5DI3A 2AXNA 3K9NA 2GJKA 1II8A 3WBJA 1OSNA 1XF9A 4V02A 4BLPA 1R8QA 5H1YA 4YMTA 1D2MA 4PHTA 1XMJA 3AP3A 3VR5A 1X8KA 1G6OA 2W2TA 3Q72A 4DJTA 4X8HA 2BHRA 2FNAA 2R65A 4UNQA 2V4ZA 3R8CA 2V9PA 1PZNA 4QOSA 5JSZB 1IN5A 1E69A 3A1VA 4TL7A 4URXR 4B48A 1OYYA 2VHJA 4DLSA 4DSUA 4PTLA 5AJVB 4KV9A 4N0EA 3SBDA 1T9HA 2J1LA 1VG1A 2AD1A 3AKYA 1JR6A 2P65A 1ZNZA 4Q00A 4CEJA 1HURA 3CZQA 2HUPA 1GKUB 1M2OB 1T4GA 5JRZA 3WNCA 2CL6X 4QHTA 1E2EA 2VTKA 1XDBA 1QVAA 1EFCA 2P3SA 3VQTA 1IN4A 5BN5A 1JAIA 1ZM3A 2BJVA 2XGJA 4IDNA 1SXJC 4IFBA 4WIAA 1RRPA 1BMFA 3S1AB 1XJQA 4HUQB 5LPNA 2XJ4A 3GLHA 1E4VA 3Q7PA 4ABYA 4CYMA 4KHZA 3KXIA 1RPZA 2ZAOA 3K9LA 5SZIA 1L7VC 4NP6A 3BBPA 3IO3A 2ZSFA 4H1UA 3B7GA 3THWB 3TGPA 2VEDA 2B92A 2W6IA 3B1ZA 4B44A 1Z29A 4Z1MD 1ELOA 2P5SA 3B9QA 4PC3A 4ZIRA 5HKKD 1FW6A 1OXUA 4MRVA 4GBMA 5FOSA 3ZH9B 5E7MA 4RD1A 3I8XA 3FTQA 1UM8A 1QRAA 1U8YA 2ATVA 2WSSD 4YONB 4EPWA 1GSIA 3DVLA 3TUJC 4EPRA 1R5OA 4XVQA 3EPJA 1XBTA 1S3SA 3ZJYA 2C98A 2KSQA 1HT2E 1IJEA 2HV8A 3G5UA 1FMLA 1G20E 1MO4A 2F43B 2ZRDA 3K70D 2KJQA 1Y63A 2LKCA 4M22A 5M04A 1UBFA 5GJCA 4QJ5A 1XNJA 4Q9LA 5BQ5A 3EZFA 1FX0A 4XWAA 3TW4A 5EP4A 3B5JA 3CB4A 3U7GA 3X1ZA 3ZLJA 1Q1BA 2PEZA 2B7BA 2AHOA 3X1YA 1AJEA 3QUSA 1WRBA 4S35A 4PPQA 1S0UA 2B6HA 3QEOA 1NKSA 2ZJ2A 4A15A 3NH6A 4D80A 4O2RA 1KI2A 2FGJA 4JLMA 4OHZA 5F9HA 1KO4A 1VMAA 3NBXX 1W0KA 2PT5A 2KWIA 3AQ4A 1KDPA 3QY0A 3AB3A 4UXJA 3I62A 4O25A 1E2DA 1E99A 2HXYA 1PJRA 1XXHA 5FBLB 3W9YA 2ZE5A 3V4FA 2FFQA 1PLKA 1KTVA 4DSNA 1W4AA 3CX6A 3MWJA 2X2EA 2OILA 1ZW6A 4U02A 5AJYA 4D25A 1N25A 2X1VA 4DRZA 5HZKA 5IDVA 3IIKA 3QVUA 4TLBA 1H8ED 4A0HA 4Z8YA 1FNNA 4D2IA 2Q0HA 3B8HA 3M6AA 5JLJA 5JJLA 4QBIA 3TMKA 1T3HA 2K5UA 2RHDA 4HDQB 5DYIA 4TMKA 4TTPA 3C4JA 4LJ7A 4RFSA 3QKTA 1XJ0A 4GDFA 3FYHA 5L3RA 3U7EB 3RSLA 4D0GA 4ESHA 3U3JA 3C15C 1DAFA 1W5SA 1E2LA 2GCOB 2OG2A 3JVUA 4C30A 4B34A 1X6VA 3OEEA 4M1OA 1E96A 3UK6A 2C9CA 3AF1A 4UQOA 2ZSEA 1UBGA 2JJ1A 3LLUA 1T0HB 3I61A 1QF9A 2J5XA 1Q22A 1E0KA 1J8YF 4DLXA 3GLGB 2O5VA 1ESNA 2DWPA 2Z0MA 2H18A 2QP9X 2BCGY 3BB4A 3MG9A 3OAAA 3QG1A 1TQ2A 4G5OA 5J5CA 1U8AA 1AQUA 4WBSA 2NO9A 3QOFA 4OI1A 1NL3A 1AS2A 2ZE7A 1ZYUA 2VSOA 3LDAA 4ZI2A 4B2IA 2ZRFA 3M1IA 3DPUA 4UXHA 1MABA 3PV0A 1TPZA 2QTHA 2QGZA 3CH5A 4IHQA 3PFIA 5FPHA 3BAFA 2OUKA 1K5DA 4GRAA 1ZRHA 2JAQA 3NHAA 3GLIE 4I1SA 4CEJB 4Q4AB 1KI1A 3IKJA 1XZPA 2PT7A 4AYWA 3CRRA 2G77B 4TT3A 2ODEA 4EFMA 2D62A 4URYR 2V6IA 1XCGB 3MWLA 1JPNA 3AM1A 2G0NA 5SZJA 221PA 5CIWA 3GLGE 1G4AE 3TQCA 1DAKA 2ZYVX 1P60A 3FDIA 1D9XA 4M4SA 1TUEA 4QKQA 4HLCA 3HPRA 3G82C 4Q1EA 3CF6R 3QJYA 4A6PA 4YQFA 4NE2A 4A8JB 1GDDA 2CXXA 4EJSA 2J7KA 2OO7A 5LB4A 4HB2A 3OIUA 4ZKEA 1WBBA 4OI2A 4MKHA 1CJVC 4ON9A 3RSOA 1N6RA 4Q4HB 2EFGA 1IQPA 3RDPA 1FTNA 3UG7A 4MGKR 4CEHB 5FPSA 4OI4A 1EFHA 2GJAA 2ZRIA 1X1RA 2Q9BA 4EJSB 1MOZA 4IOJA 2ZRGA 3NBFA 4IVQA 2VPPA 2EFHB 3DOEA 4TLDA 1E9EA 3B60A 4S2EA 1GL6A 3SQXA 4A36A 4JS0A 1CR0A 1P61B 3A1TA 1NRJB 2QT1A 1US8B 2AKYA 3MJHA 4LHYA 4JLNA 4AI6A 3L8YA 1H8EA 3L0SA 3DM9B 3O8DA 4ZDIA 4FWIB 3UPUA 4KFSA 3SC3A 4J0QA 1KK2A 3QKRB 3LVQE 2Z4SA 3BC1A 4L9WA 4BLRA 4JKYA 3VR1A 4JL5A 3U61B 2W6ID 3LNCA 1Q44A 2BMJA 1TEVA 2HT1A 3ICQB 2ANBA 4RD6A 3QG5A 3BH0A 3H4MA 2XEXA 1S8FA 1M6NA 2FMXA 2ZJ5A 1KY3A 4ITRC 1Z3IX 2IYUA 4II7A 2IYZA 4DDWA 1V5WA 2BEKA 4BLQA 3W6PA 1KNXA 1P75A 4Q02A 2RGGA 2OT3B 2XITA 3CBQA 3KXKA 3EAQA 2Z4RA 4UKDA 5JWOA 3QXHA 1E1QD 2P6UA 3R20A 2RGNC 4M9XA 2CHVA 2WZQA 1F3OA 3OF5A 1VYUA 1E1RA 1KSJA 2FJUA 1P2VA 1KI4A 2ZI3A 4LI0A 4IXNA 4LJYA 5F2EA 2D7DA 4HB3A 2BM1A 3RS4A 4A6XA 1YZQA 2ZJBA 2F9MA 4DCNA 2VSXA 2CCJA 3P1JA 3K8YA 3NKVA 2O8EB 2DWOA 3MGCA 1XFAA 3F0TA 1Z6XA 1DAHA 1GKYA 2IX3A 2GILA 3DEFA 1G18A 2XOKD 1TQ6A 1AKEA 2IXFA 3QNUA 3CR8A 3GQBA 3OIYA 4PAMA 2G0TA 1ZD1A 2NTYC 1KJYA 2WIAA 4EUNA 1GNPA 4LC1A 3QXSA 2YOHA 2O8EA 5G3ZA 4JBXA 1KSGA 2LWIA 1C1YA 4BLSA 2ORWA 2XB4A 4PZZA 1SQ5A 3LBIA 1T3SA 2QRNA 3P20A 3EC2A 4G0NA 3PUZA 3R7WB 1YKSA 1WB9A 1CULC 2PX3A 3QBVA 4RKFA 1RRFA 1E32A 5H8WA 3EX7C 4QFMA 4RD4A 3X1DA 1G7CA 4KFRA 4IFEA 4Q48A 2BM0A 2VO1A 1SHKA 3NXSA 1ESMA 2EYQA 3KL4A 4M1MA 2RGEA 4LDJA 4F4CA 3VR6A 2Z83A 1Z63A 2QY9A 4RZUA 3NEJA 2JLWA 1S9DA 2PMKA 4C0KA 1NF3A 2GXQA 1YE8A 3FVQA 4B47A 4EKDA 3K0AB 2YHSA 3ZIAD 5FPKA 2JLVA 3IIMA 3NBZC 2IL1A 2R8RA 5JCPA 3IUYA 5JJKA 1QG2A 4D26A 2VHTA 1DAEA 2GVZC 2IUTA 2F43A 3SR0A 3AKEA 1HQYE 1QHGA 3FKSA 4A8JC 1I4LD 2CCGA 2GKSA 3JVVA 3IGFA 2GWHA 3SZRA 3CRVA 2QPAA 1S9HA 3SFZA 2ZRKA 4PC6A 3MWYW 1IHUA 4IXMA 5FL7A 3QKSB 4KCGA 3R9XA 1CJUC 2ASEA 2QROA 4TMXA 121PA 1Q1EA 2FF7A 3W90A 3GLIB 1XPOA 3EPHA 3EA0A 3SYKA 2CEAA 1E2HA 3RS2A 4EJSC 3QF7A 2OSBA 4FWTA 4LX0A 1RC8A 3PUVA 2FA9A 3BB1A 1FQKA 1JEEA 4P33A 5J4VA 2AXPA 1BIFA 4LHXA 3LQQA 3CF0A 1JR3D 2IYTA 1KMHB 4FIDA 1R7RA 3GPLA 2DFKB 2RB4A 1RJ9B 2JDID 1ANKA 1T5LA 1I2MA 1QBKC 2EFCB 2IBMA 3F5FA 3M4YA 4Q7LA 3TSZA 1E79A 3GJ3A 5EE3A 4TYWA 3EARA 5AUPB 1YZNA 2ZU0C 3L82B 5EXSA 4B33A 2YKGA 1VDZA 5KYKA 1NMZA 4F91B 1ZD8A 1BYIA 2B8WA 4Q7KA 4HSEA 4DUGD 3BB3A 4Q21A 1OKKA 5DN6A 4IDOA 1LV7A 2GDJA 4MRPA 1GP2A 4NU0A 4DUGA 1W4BA 1FZQA 1OFHA 4PO1A 3T12A 4TL8A 1WF3A 2WJJA 4QGGA 1EWRA 1MABB 2A7QA 4P31A 4G5RA 4OQFA 2IYQA 4BFTA 2GXAA 1NN3A 4Z51A 1A2KC 2GETA 1HE1C 3KJHA 4LBZA 5EQTA 3VKWA 2CNWD 3EIEA 3GLIA 2OCBA 1IN6A 2NO6A 2QORA 3N2EA 2O8DA 3FOZA 5CB8A 5GJVC 2CNWA 1G3QA 2A2ZA 2ZU6A 1XEXB 3L0OA 3BK7A 1G5RA 2AKAB 2P2LA 1GNQA 1LVGA 2X77A 2Q21A 5E7IA 4AKIA 5L3SA 5ELXA 2WHXA 4TWZA 5JEDA 3EG5A 1KYIA 4DLVA 4MDEA 5DI3B 3KZ1E 4JT2A 4Q5IA 1VHLA 2HCJB 4BPBA 1G5PA 4Q1AA 2NZJA 3EXAA 3I8SA 1M1YE 2W2XA 1G3MA 3P32A 3I32A 3U3RA 4XWKA 1OFIA 2F3RA 3K0AA 3MJRA 3WXMA 3ZD6A 4M1TA 4RD0A 2VF7A 4XJXA 2J9RA 3MLEA 4TMWA 5JI2E 1KGDA 2NGRA 2XNSA 3DMNA 3WHLA 4DSOA 4QRHA 2WWYA 5LB2A 4NONA 1P4SA 5HCIA 4IDQA 3QI2A 1CIPA 2GAAA 1T8TA 3CX8A 1W48A 1E0AA 3W3AA 4HAZA 3ND8A 5GJWC 4URVR 4NHOA 2UVQA 1WA5A 3W6NA 3LFUA 1EFRA 5K8IA 3O8RA 4Q7JB 1IXZA 1OFUX 4NKRA 2XOKA 2W2VA 2J41A 2WPDA 1E6CA 3TSWA 1W4RA 3B78A 5TXGA 3VU9A 3H0KA 5F9FA 1XXHE 4E03A 1MT0A 3HR7A 5KPDA 1AM4D 4OJKA 2VIIA 3KX2A 5KSOA 5DNYB 1Z47A 4PHHA 1E3MA 3NWJA 4D4MA 2BMFA 1LF5A 2WOOA 2F1IA 1XWIA 1FX0B 1KAGA 1Q3TA 1VYVA 4KXFB 4HB4A 1P2SA 1MO3A 1R0YA 3CPEA 3KJEA 3TVDA 3V00A 4A0FA 2JJ2D 4HDOB 1SKQA 4RVCA 2AN9A 4ZI3A 5DHFA 2W6JA 1Z28A 2GA8A 2C03A 1JNYA 1J8MF 5GADl 1A5TA 4F38A 1XCMA 1MH1A 1N0UA 2P6NA 2V7QA 2XTMA 4XD7D 1P2UA 3VKHA 1A7JA 2OCPA 3IPXA 4M1SA 2FFHA 5CDFE 1Z6GA 4JSYA 3LH5A 4B3GA 1ZMXA 1IAQA 1VG8A 4Q4LA 2FH5B 5KHOC 4PXAA 1WXQA 2ZJ8A 4PQYA 3RS3A 4BZXA 2GK7A 3DL0A 3SDZA 3T15A 4AWXA 1P9RA 2Q3HA 3OE7D 1FP7A 4X8MA 1KSHA 1L4YA 1E98A 3QPVA 1OYWA 4Q47A 1QHYA 2ZUDA 2ATXA 4JBWA 3A37A 1E2MA 4EFLA 2R62A 3T35A 4DEYA 3EPKA 1JI0A 1NI3A 2BIFA 2QPTA 1L2TA 5KNDA 1YJ5A 3HJNA 3PUWA 4WZBE 3VX4A 3TLXA 3NH9A 2D3WA 5D3MB 1KHTA 2F3TA 2GJ9A 3ZDQA 3AVQA 1N6HA 2VF8A 3GLHE 4NCHA 4DLWA 5CLQA 5L3QB 3LVRE 4GFDA 1P9WA 2AK3A 3CONA 1Z6TA 3IHLA 4IJMA 4R9UC 5AK0A 5TY0A 2RMKA 2V54A 2OHFA 2Y8EA 3V4RA 4D4KA 1R0WA 2V8OA 4B3BA 1PLLA 3AF0A 5E3HA 3LW8A 3AF2A 2WOJA 3DMDA 1TF5A 2YNMA 3C41J 4GMDA 2H16A 3SNHA 3AP1A 1EFRD 1W0KD 1V43A 3FFBA 1ETUA 4PSVA 4XSHA 2ZRAA 2R9VA 2MMGA 5FBRB 1EK0A 2CJWB 3PENA 1GIAA 4E22A 3MD0A 5KUTA 3AF4A 3E2IA 6Q21A 2QM8A 2YOFA 4Q9HA 3ZD7A 4BFVA 3KKOA 3QKUA 1CXZA 1SKYB 2FX3A 3QEJA 4BLTA 3PG5A 1J99A 2ZRLA 3IO5A 1NG1A 1E0SA 2MMCA 2C5LA 1K6MA 4F4IA 2H7VA 1G4UR 1NBMD 4UXIA 4MGYR 3TH5A 3DKVA 4FMCF 4A92A 4UNRA 5J4YA 2G3YA 4BZQA 4TMVA 3SE0A 2ZR7A 1WE2A 2ZEJA 2ZROA 2IXGA 3K0FA 4OQMA 3QPWA 2G6BA 4P4TA 3SJAA 4C2UA 1KI8A 2V3CC 4RFVA 3TRFA 1EX6A 2EVWX 2OAQ1 3WMEA 3RABA 4K8OA 4XVRA 3UANA 5FTLA 2GBLC 3LY5A 1CRQA 5FBWB 1TL7C 3QIAA 2JLZA 4P0TA 1A1VA 4A0RA 1E9FA 1IY0A 1IXSB 1LS6A 2O52A 3O8BA 4ZDWA 2OFOA 2ZSDA 2NO1A 1S4QA 4OK5A 5KSYA 1II9A 1E4YA 1D2EA 5FPYA 4OBEA 5TDHA 3D6TB 1GWNA 1NIPA 4DSTA 1E2QA 1DO0A 4XWOA 2GEVA 1CJMA 2IHBA 1ZINA 1DBSA 2IF0A 4L5BA 5FR1A 3SI7A 1DELA 2EU8A 4LYFA 1OIWA 4MA4A 1W1WA 2F6RA 3LLMA 4MYTA 4TQ9A 4RZ2A 1M34E 1QG4A 4DCVA 1JXOA 2I3BA 2QGNA 4TYQA 1RVDA 5BN4A 4B32A 2J0SA 3CO5A 3T34A 1TEXA 1NLYA 2GXUA 1NVUQ 3A8TA 1D5CA 2V1XA 4TL9A 1XTQA 5SZHB 2YV5A 1GRRA 3EZ2A 1JPJA 2WVJA 5E95A 1J2JA 4BLOA 2VBCA 5JWRA 3T1QA 1VKJA 1XMIA 4DEXA 1KKMA 4Q01A 3MCAA 2JCSA 3K0CA 2WPDD 1MO6A 3DZDA 4UNPA 3RNLA 3RYTC 2PH1A 2ZRHA 2FWRA 2C96A 2WWHA 2RGXA 5FOVA 5JEEA 2Q6TA 1EXMA 4PO9A 3C5CA 3PVSA 1VHTA 1S1MA 1GRQA 2TMKA 3R8FA 1B23P 2ZUBA 2DCUA 4M53A 2E9SA 1R0XA 3AVPA 2ZYUX 4Q03A 3EW9A 4Q9KA 2QENA 5B64A 2IS4A 4P32A 4M1WA 1NMYA 4Q18A 2W6JD 2FPMA 2J0VA 2O0KA 3H1TA 1DG1G 2CVFA 1YR7A 2NMVA 3LBHA 3MAAC 3HWSA 5AJXA 1G3UA 3ADBA 2FFAA 1G291 3RS5A 4LJ6A 4LZZA 1DAIA 2ERYA 3A1SA 1G17A 3BE4A 1JJ7A 1OHHD 2EW1A 3GJ7A 3PEUA 3AVOA 1UDXA 1GITA 1AZTA 1CU1A 1G8FA 3HYRA 5DIFA 5FUVA 1GILA 1NBMA 1SVSA 2F7SA 1BO6A 2FGKA 4M21A 2W58A 3SQWA 4GL2A 2CLSA 2IYSA 5TMPA 3KUCA 1EFUA 1IY1A 3K0EA 1U98A 5IHPA 3G0HA 3GMTA 2QA5A 4HYYA 8OHMA 1I2DA 1TF2A 2LKDA 3ASZA 3OEHA 1FTSA 1DE0A 3LXXA 5DLQC 3RRNA 4ARZB 1GM5A 2F1HA 1T0JB 4IDPA 4DDTA 5L3VA 1AGRA 4A2PA 3OZXA 2HYDA 1KKLA 4Q4HA 1KJWA 3AVWA 3EWAA 4BEBA 1IOZA 3WHKA 4RY2A 2VHUA 2BMEA 4D0LB 1JR3A 5L3SB 2R6CA 3T1OA 3WY9A 4DKXA 4MKFA 2RGBA 2H1LA 1R10A 1G21E 4M2LA 4PX9A 4Q1FA 3GP8A 1BKDR 1OE0A 2CL0X 2JEOA 1HA3A 4JLBA 4B35A 1OIVA 3DZ8A 5KDLA 3HDTA 1XTRA 3IILA 3P27A 3U3OA 3ZZUA 4CEIB 3WNBA 2O8DB 3FMPB 2BDTA 4DXAA 5C18A 1QHNA 1QDEA 2OBMA 1LY1A 3TJZA 1P5ZB 4DCUA 1HE8B 4HLQB 4IOKA 5EZ5A 3T5GA 1G9XA 1NVVQ 2ZRMA 3WNDA 3UWOA 4NYIQ 3SN6A 3SHFA 4MRRA 3B13B 1M7BA 1DPFA 4B75A 1TQ4A 3BH6A 1EGAA 4GT1A 1D2NA 1U81A 3SJBA 2WSMA 5IT5A 5KDDA 4PSKA 2RHMA 3U3KA 2CE2X 3EA5A 2VA8A 3VAAA 1Z0JA 2NQ2C 4QNRA 1W4CA 3ADCA 4JLVA 2EFEB 1NVWQ 3IEVA 2Z5FA 4HDCA 3EWSA 2H17A 3MSXA 4FW9A 1T6NA 3GEEA 4C0SA 1YZUA 2JLYA 2ZANA 1OH7A 3VX3A 5FOTA 1P3JA 1ZVQA 4BE7B 1OXXK 1XPUA 1H65A 2ZYWX 5EUMA 4EPXA 2MSEB 1UJ2A 4RCYA 1ZCBA 1ZD9A 4M9SA 4EIWA 2OESA 3LV8A 4RFSB 2QAJA 2ZUCA 4LYHA 1MV5A 3VKGA 1RYHA 2AR7A 1NJFA 2J7PD 3ZZ0A 2I1QA 2BBOA 2GCNA 1AIPA 1P72A 1G7TA 1BYUA 1E2JA 1GL9B 4LUCA 3KXLA 1L8QA 2J0UB 1E2PA 2WWIA 4IRUB 2HT6A 4WOPA 3MUFA 2ZIAA 1RFLA 3QF4B 4NYIR 4JMPA 5FBQB 1XXHB 2F9LA 3OESA 2QQ0A 4QM7A 3GEIA 1OH5A 1RE0A 1TAGA 4LV8B 1IN8A 2ODBA 4KFTA 4AK9A 4MH0R 1RRCA 1UKYA 1OXTA 1XEWX 4B74A 2XZLA 1W44A 4UNNA 4WXRA 1KAOA 1F60A 2QMHA 4PAOA 3FHCB 2JJ1D 4DC9A 2XB2A 5KDOA 1Z2AA 1KO8A 1AS0A 3BOSA 2NIPA 5HCNA 2OBLA 4HB0A 1N5JA 1Q21A 4PZLA 2RKOA 1RKBA 2PEYA 4B3DA 1COWA 2XNDD 4XTRA 3TR0A 3TE6A 2VSFA 3B1YA 4BFZA 3FPAA 1S1CA 4HLUC 4PQRA 4ZCMA 4I81A 3OAAD 4ACAA 1ZAKA 4JL8A 1KDOA 1SVMA 4BGDA 1VECA 2QTVB 3EIHA 2QUZA 2IYYA 2ZI4A 3TUIC 1DADA 4LJ4A 4ERNA 4OK6A 1T91A 3KQHA 1Z07A 4M9ZA 2B21A 3U2QA 1Z2CA 1VCNA 1ZM4A 4NMMA 1LW7A 1K5GA 4P4SA 1YR6A 3ZGXA 5BN3A 1F2TB 1N6LA 2W0MA 3KJIA 3EPLA 1MRNA 3A1WA 4W7SA 1IXRC 2AFHE 3B1WA 1NN1A 3A4MA 5AJWA 5EE9A 1RZ3A 4FN5A 4EQ6B 5GVSA 4DB2A 4PO8A 3TQFA 3WYAA 4BFXA 4NTZA 4W9MC 5EUQB 1GFIA 1N6IA 4JVNA 3GLHB 1G5TA 4JLAA 2SHKA 3IDQA 4PR0A 4BZPA 2OXCA 2QP3A 2GZAA 2W00A 2WBLC 4ZPXA 1R5NA 1LB1B 1XD2A 2RGDA 2ODNA 4FINA 3BD9A 3QQ5A 3S1AA 5B58C 3P4YA 4KLZA 4B3XA 821PA 5SZKB 4QGHA 5HR5A 2YJTD 2D2FA 2ZTSA 1JAHA 2W0SA 4DT1A 1F2UB 1BMFD 3PITA 4JYCA 3W6OA 1U2RA 3TKLA 3C16C 3X1XA 1MKYA 4Q19A 4QXAA 1MRSA 1ZUIA 4L16A 4C0HA 1W0JA 5UKDA 1E2NA 1G16A 4LJ5A 1M7GA 3B1XA 1G8HA 1XX6A 1RW4A 2FSFA 4B73A 3ECCA 1LF0A 3OHMA 4YMVA 2CK3A 4ASUD 3CWQA 2VP4A 4LWZA 1GG2A 1ZU4A 3B85A 1NSTA 4R7ZA 2PL3A 3N70A 3UIEA 3KFVA 3UMFA 4BFWA 1N5IA 3KKMA 3NHBA 5JSZA 2PJRA 1LTQA 1TU4A 2ZI9A 1OFTA 2DY1A 3P4XA 4LHZA 4LV5B 1TTTA 1FPMA 1U8ZA 1CBUA 2ZI6A 2REOA 3FFAA 3NEYA 2AD5A 2CJWA 2J0UA 3MRSA 5KPJA 2HF8A 4Q1DA 5KNBA 1RRGA 3BFVA 3PIRA 4JYBA 1UAAA 1NY5A 2UKDA 4CEHA 4KODA 3TUZC 5IK2A 1QHHA 3N5CA 4QHSA 5HTKA 2OM2A 2YWFA 4MGIR 3K1JA 3CR7A 4JIMA 4FCTA 2ZRNA 5JECA 4OHYA 2O8CA 4AD8A 3I72A 2F55A 3QXCA 3GFPA 4A8JA 5JS7A 1A4RA 2H57A 3W8RA 4JLPA 1N2CE 1D6JA 3H2YA 3KDSE 2L0XA 1OB2A 1AQYA 5EXPA 5FI1B 1UBCA 1SVWA 2N46A 3HYTA 1X3SA 3Q5DA 3AP2A 4V0KA 1JQLB 2BVNA 4PC7A 1ZNXA 3E5HA 5EE1A 4FCWA 2A5FA 2VYFA 3ZIAA 3K09C 1KZ7B 2WAYA 1OV4A 5DHAA 5CLLA 2ZRPA 1QHIA 1RYFA 2GBLA 3A4NA 2N1BA 3CM0A 5TV2A 2IYVA 5G40A 1ZNWA 3QPUA 3NC0C 5C46F 1SVIA 1G3IA 1UFQA 2GK6A 3IBGA 2NO7A 1YU9A 1BS1A 3H84A 4KJZA 2A9KA 5AUNB 2IF2A 2HEIA 3SHWA 4LHWA 4US0R 2GJSA 3FMFA 4D4JA 4LJ8A 4CF7A 4CEIA 2WMOB 2H8KA 1XPRA 1P6XA 2KBEA 2ZETA 2ZJOA 4LHVA 2OFWA 1U0HC 2D7CA 4PSAA 3ND9A 3SFVA 4AKHA 2OXRA 2IUUA 4KVGA 2GCOA 1LNZA 2ZSBA 4HZUA 3O8CA 4CDGA 2HXSA 1GOTA 3THYB 2O8BA 2FOLA 1FNMA 1YZKA 4JLJA 4DLYA 1XJCA 5KNCA 1N0WA 4I99A 3ZZTA 4ASUA 4TTRA 2IS6A 3X1WA 3PEVA 4MGZR 1II0A 2GNOA 2RGCA 1TX4B 4QJ3A 2WM9B 4DDUA 3THXA 3REGA 1N6KA 1X86B 2CLDX 5P21A 3TNFA 4OJQA 4C7OA 5AJZA 2R2AA 3KKPA 2B8TA 3LD9A 4P3YA 2EWVA 1ODFA 2QU8A 1NJGA 1S96A 2QMOA 2WSSA 3EASA 4OKSA 4U00A 2WWGA 4BFYA 3VU9B 1OKKD 1S3GA 5DN6D 2FG5A 4L9SA 2VP6A 1SXJA 2WAXA 2GXSA 2JASA 2E1RA 2QI9C 3CPHA 2GHIA 3CX7A 2WWFA 4HEJA 4AC9A 1GZSA 1Z22A 4PPNA 4OI0A 4NZYA 3QVVA 5F3WB 2CCKA 4V0NA 4URZR 4YDHB 2ZVPX 2C04A 3RS7A 2QBYB 2OCAA 4LY6A 3U3MA 4BEJA 1A82A 4CW7A 1G41A 1Q3HA 4L15A 2ZM5A 1XU4A 4NYJQ 2REXB 4ZCIA 1OXVA 3JZAA 4FD2A 3RC3A 4EPVA 2JJ2A 4LYAA 1WP9A 4WZAE 1HTWA 4QC2A 3CNNA 5FTJA 3LXRA 4NCKA 2DHRA 4YMUA 2JLRA 4JJZA 4KYIB 4TQAA 4CRWB 4HAWA 4BASA 3CUEF 1WCV1 3NBYC 4G5SA 1CR1A 5HZHA 3DM5A 1KO5A 4HUTA 4YLGA 5BYJA 1U9IA 1Q0UA 3NIBA 1HQCA 5AWFC 3IEUA 2ZRJA 3W5JA 5BWMA 4F93B 2FN4A 2I4IA 3L8ZA 1XEXA 2F1JA 2RCNA 5C1BA 1ZIPA 4IKEA 3OE7A 3WMGA 1KSFX 4HAYA 2WTUA 5CJ2A 1DVRA 4OQXA 2FFBA 5HKKA 5TVKA 3FKQA 2AFIE 4XSGA 4HAVA 4US2R 4F92B 1J70A 3I73A 3AH8A 1NBME 1K8RA 4ZDJA 2ZITA 4WZ6A 3AVXA 4PPGA 4HLDA 4PAQA 3REFA 3R9IA 1KDRA 4LBVA 3UMRA 5FL7D 3FMIA 4A0GA 1UADA 1G1MA 1GTVA 3VFDA 1P2TA 2ZI7A 4B3FX 2A5YB 4M9QA 3BRWD 2XXAA 5B2ZA 3CH4B 721PA 1M7HA 4RZXA 5LBIA 2JA1A 4HUQA 4QM6A 1S2MA 4Y0AA 2RGAA 4ZDKA 2GEDA 1EESA 1C9KA 2GRJA 2GTPA 5CYOA 5TB5A 4D81A 5FBVB 1W2HA 4YC7A 3PUYA 4ACBA 2VHCA 5FR2A 1N0VC 1DG3A 2AWOA 5G53C 5JBQA 2ZQ5A 4JKIA 4ZCLA 4LGMA
chains in the Genus database with same CATH superfamily
1E1QA 1U04A 1FQWA 2KMLA 4GX5A 1R5BA 3G6WA 5KJFA 4A5OA 4BO1A 2H65A 3DD1A 4BUCA 3K53A 4OGKA 3ZV3A 4UAUA 5EIBC 2R8YA 1S8AA 5ADWA 3RRYA 1Z4IA 3IOYA 2WIKA 2ODPA 3ZHTA 3D8RA 4IWNA 4P6VF 4OQNA 5AW7A 3FOFC 3OZUA 1J5PA 2H92A 4BFUA 2A0KA 1YHNA 3DWGA 5EE0A 3VUFA 3V9AA 2QD4A 1TLTA 1A97A 4ARAA 4GXRA 1SCBA 1TM5E 1CDDA 3SKXA 5JH7F 4YUZA 1K9VF 3QU5A 2HX1A 2FU5C 3S0JA 5I4BA 4F3CA 3UGJA 4HDSB 3K2EA 1JYFA 1NOIA 3GJ0A 4IQFA 1CUEA 5MGBA 1DDOA 4GP6A 5KAMA 4UCFA 1HSOA 5EHQA 3RPEA 4TZ6A 4EGSA 4UPDA 5DOVA 1F5SA 5LDGA 1YB1A 4KE7A 2IKQA 1RI4A 3L1VA 4UCWA 3WFIA 4AURA 1NVKA 1LTHR 3EC1A 2C1EA 5T5QA 4DLZA 2ZXUA 3HO1A 2I65A 3H5RA 1ZL2A 2YCLA 4YRMA 1ZGZA 4JJFA 3VTKA 5EFZA 1KAQA 2YC4C 1E2KA 4MVJD 4BGVA 5EMHA 2PUTA 2B20A 1USWA 3FXAA 4NYMR 4XOIA 4DV4B 4TYYA 4H4DA 4C0QC 3MTBA 2C2OA 3PQ6A 4TV9F 5EERA 5EZYB 3DD5A 3SHQA 1T2FA 1AGNA 4QARA 1F8GA 2HHLA 3OM0A 4W9RA 4TYNA 4LVOA 3HKBA 5BV7A 3JWIA 1KC1A 3Q2IA 3HU2A 3JPWA 4IDHA 4KQWA 3ZY2A 5B36A 3WKEA 5BXYA 1FFGA 1VCMA 4P5PA 5KQLA 1RQLA 1U2DA 3V1YA 5ICMA 1FBTA 2HD4A 3CKLA 3K5IA 3UATA 4C0JA 3TF5A 1QP7A 3GUCA 3AUTA 4WNCA 1Y3AA 4HTFA 4UCXA 4BBAA 3DE2X 5FOXA 2JJQA 5F77A 4IHAA 2NXNA 2M98A 2X2FA 4BUJA 1UKVY 2YZGA 3MCTA 3RIGA 3WIUA 4M76B 5D86A 4YIHA 3LCMA 4XVUA 1QZ3A 2WF8A 4PPFA 4C9BA 1NDUA 1KYXA 4HHEA 1Z6YA 4RH1A 4B43A 1WHTA 2IY7A 4J03A 3E7PA 1Q0QA 8ADHA 3HXQA 1OZHA 1QHFA 1QQTA 2Q1UA 3NTQA 3QKWA 3UMBA 4FYHA 3I3SR 4UE3S 1AHHA 2ZR0A 7REQB 2AFVA 4N82A 1ZN9A 1JBEA 1FDUA 1WMBA 2P67A 4AWAA 1TMGE 2PAFA 5EIEA 5AKZA 3EISA 1KBQA 3B2EA 4WDRA 3UV3A 2ZG6A 1UFVA 2QMYA 2I2AA 1OBFO 4RZHA 2APJA 3VR2A 3UWSA 1RZRD 4S1NA 5DK6A 5CHEA 5M34A 3WQBA 3TOVA 1RLJA 4L8LA 3NTRA 3HYSA 3UXMA 1JECA 4LI3X 1E79D 4RVGA 2IYLD 4CIBA 1CB0A 2GUWA 1IEVA 3Q9LA 5IHXA 3DUWA 5ED0A 1YB7A 1ODSA 3DA8A 4YGYA 5J5VA 3T9CA 3GRAA 1U9IC 2ODWA 3R77A 3UJNA 2QPOA 4X20A 3GLFE 3FGOA 4IHKA 2VYVD 5HIJA 2ZSAA 1RAGA 4IF4A 3LWNA 4RMIA 4G84A 5CB0A 4P36A 1T15A 3FB4A 5DBGA 3K0SA 1C9NA 3GVXA 1M2HA 1TW3A 2OAGA 3WJ7A 1KJQA 4FMDB 4ZREA 4GXTA 1R0ZA 3AKDA 3N7UA 2BI7A 4KQFA 1DXQA 2J7PA 1DX4A 3KWMA 4WUVA 4UTRA 1P3DA 1L5SA 2OV3A 4MQBA 1A8SA 5TPWA 2LW7A 5DXFA 2H51A 1L5ZA 4OMUA 3L7DA 2X5NA 3NXKA 3RIXA 2BOVA 1YRBA 4XCQA 1I1HA 4ENTA 2IEYA 4RPGA 1XN1A 1THMA 2VL7A 1K8XB 3L8EA 3FHLA 3VI3B 3U44A 1ECCA 1Y3BE 2WP0A 3D64A 3R0VA 1SBTA 1XTTA 3F73A 2C3YA 4QYIB 1EH5A 3ZGVA 5DHSA 3JSXA 3M6FA 2O5RA 3GJRA 1LFDB 1GEGA 4MR7A 4DV3B 1VL2A 3BGWA 2A5GA 4X1OA 3J81k 1EBFA 1WMEA 1Q17A 2VF2A 3R3XA 4Q3DA 2ISSD 4C06A 3SSMA 3U6BA 4C7OB 5DLEA 3CT4A 1M1XB 3PDWA 1CSEE 1ZGAA 3SJUA 3UPDA 2JGDB 3CINA 4DPKA 3AUJB 3IOMA 3AJAA 4M1EA 2F8TA 2YIVX 2ZJZA 4BVEA 2JHGA 2BR3A 4EHJA 1MZVA 4RE6A 4YR7A 3OQOA 2ZRCA 3K9BA 2JIZA 2XLBA 5BR7A 3D3KA 3RAPR 2D06A 2PO7A 3BUSA 2O2SA 4W8GA 3A27A 4AJ4A 4C4ZA 4OYHA 1FK8A 4DV0B 3HU3A 2G1KA 4RLHA 1XD8A 2IE0A 2V59A 4GVPA 4RXMA 3GFQA 4MR9A 4TS4A 2JGFA 4RE5A 2HQBA 3IC5A 3MRVA 5ARBA 1RQ2A 4X60A 5FH9A 4DCTA 5CB4F 3KSDO 2FE1A 1O2DA 4HEHA 4MI1A 4EYKA 5B6JA 4X7MA 1EJBA 2WUGA 5CXXA 5KX5A 4PU0A 4CM4B 3GGCA 3HY3A 3K9CA 4LX8A 3G2IA 3UK1A 1LWOA 1ISGA 1OI3A 1NV9A 1YR3A 1OHHA 3WNZA 4F3RA 3OJWA 1PD1A 3LF2A 1JVSA 4L4UA 4L4SA 3UG6A 2WUWE 3TZKA 3VC7A 8ATCA 5TS2A 1FXSA 5J47A 1QYIA 1RZRA 1P7CA 5IDQA 1ZCAA 5SY9A 5AD1A 2X5KO 3H5TA 4AJLA 3O1IC 3EF3A 1ZM7A 4PLYA 5FUBA 4HG2A 2A78A 1DCKA 4GVXA 2QN7A 3VI4B 3ZBTA 2RHLA 3LGSA 4N39A 5JVDB 3TQQA 4M1YA 3VR5H 4BX2A 1P0QA 5KX5B 1PT9A 1VHJA 2RSLA 1R6UA 5A5GA 2WPNA 5ANRB 1WCWA 3GLGA 5U4QA 4RQBA 2BGWA 3DT8A 4ZGGA 4YY3B 4U0JA 3T1VA 2FSSA 1KMHA 4JBYA 1WDTA 3ASUA 1BMDA 1NVVR 1TNDA 1V11A 2C2HA 1CLUA 1HDRA 2JJ8A 1DJNA 1Z83A 4OSPA 3ZVLA 4E46A 3LQFA 3DONA 3LY8A 2FZ4A 4LYYA 5TT1A 2X58A 3GW8A 2UUAB 1ORVA 1V4VA 2Y1LA 3DL7A 3HWRA 3EGWA 3KHSA 2C0CA 4J9UE 3VHLB 1UDBA 1VL0A 4D9BA 4ML3A 2C7VA 3I2IA 4YI3A 3UA3A 3BZWA 3F46A 1QHHB 1B76A 1B0PA 1RTTA 1ZP6A 3NDPA 4Q66C 1V71A 4U2DA 3A1UA 1P62B 4WD3A 4RV5A 1C4XA 1OF1A 4DS3A 4RC9A 3CLVA 2G06A 4GUAA 4NAHA 1SVUA 5FXMA 1KO7A 2AVNA 5KCMA 1VLMA 3A4LA 3PPIA 4GMHA 5DYNA 4KUHA 3IQDB 3R8XA 3SSOA 1O87A 2C0QA 3A0UA 3D3WB 3ZD9A 1YZGA 1Y4SA 3AO0B 1K4KA 4ND1A 3VPAA 4H9GA 1WW2A 5DTJA 2MSDB 8ABPA 2R6AA 2PRZA 3OM8A 4OLFA 3SJ7A 1ZXXA 3LP8A 4QNNA 1L9XA 1NATA 2P6RA 4N0DA 2ZT5A 5TC4A 1JEDA 4KR3A 5ALIA 4ALNA 3ASYA 3RFTA 3V4OA 4LYGA 4ZZIA 5KWIA 1L5RA 2WMNB 3BXEA 1HY3A 4JEIA 2W83A 1VIDA 4E5PA 3MTAA 4N6NA 4XGNA 3QWFA 3NYWA 3EEFA 3PGKA 5DX0A 3ISVA 1OLOA 4EGCB 3GC6A 5LVAA 3LE8A 4MV8A 5HZGA 4WE3A 3L7NA 4E5NA 2CJFA 2DAPA 3GZ4A 1UPBA 3ASVA 1Y1PA 1WQ1R 5KMGB 4JDPA 1NUQA 2VNIA 4KIFA 3E05A 4XGQA 4L8GA 2NPFA 3RVBA 3DE1X 4YYZA 1V5GA 1QFSA 1VMDA 3IURA 3MCWA 1G19A 2X7JA 3OJLA 3KB1A 2N42A 4MEAA 2QAGC 4PZAA 4RGYA 5T4EA 4F3YA 1X1CA 4GOXA 2QIOA 4FU0A 2C9OA 5DPMA 2VRCD 1SPXA 3TD6A 3WLHA 2GEUA 1Z35A 1ZIOA 2IKSA 1PG2A 2NQTA 4KYVA 5MFPA 1BXGB 5TNXA 5CDFA 4EDFA 3C7AA 4NYIR 1RADA 1D1SA 3FRIA 3GH1A 4TT3D 2B4TO 2OHHA 1C8BA 1VZ3A 3KSUA 1W581 4QA9A 1XVTA 3PYLA 2Z2YA 1V47A 1RWPA 5KTPA 4W7IA 4KPFC 2NO4A 4IXTA 3B38A 5B58T 1HLFA 4KAXA 5DM4A 2I2DA 3PEYA 4LKOA 1UBSB 3MINA 1ZM9A 4A23A 3SHVA 1KMMA 3Q3VA 4R1QA 1UFRA 5LA6F 5HQTA 1D07A 3PHBE 3FPSA 4ILEA 3OEYA 1B74A 4N12A 4QBHA 4YJ2B 3RG8A 3BSFA 5B7GA 3KZVA 4ZO4A 5EP3A 4AU1A 3IERA 2ZREA 3HO6A 5DI9A 3WX0A 3L92A 2JD1A 3H7AA 2VZLA 4QOEA 5EHIA 4KTVE 2HCFA 4AG6A 4G01B 2HFKA 2WT8A 2HIGA 3D7MA 3GXOA 4UJ5A 1PFGA 4URWR 2BFPA 4FYJA 2WM2A 1E94E 4DPLA 1CEEA 2I5PO 1T4CA 1UKEA 2R8ZA 4OO3A 3SDSA 4AS2A 2BJWA 4FZ5A 4N54A 4ZZ2A 5KAPA 1C3LA 2QN1A 2XV1A 3PQCA 1TA9A 1LDEA 4FX5A 4IX1A 4R2HA 5ALOA 5AFSA 1KNQA 3F6RA 5B7QA 3O1LA 4PZPA 1U9JA 2ZJAA 2DHDA 2IH5A 3FW1A 4RK6A 1JIJA 1M2NA 4D97A 3R3YA 1T8PA 3WWDA 2CK3D 1KJZA 2ID8A 3K0FB 4A8PA 1U99A 1VCOA 2L82A 4LCBA 4IG4A 3HRKA 3S3TA 1E9BA 3ZZ1A 4CTNA 1E62A 3BRQA 4QBGB 5CXQA 1OB5A 5IVPA 1H66A 2PPVA 1W2GA 4JELA 3VR3A 4C7BA 1HG0A 2FLKA 1QCYA 1RKQA 1U31A 2PKWA 3MMPA 3O8OA 5B57C 5IWAB 5E6UA 4EL0A 3E6AA 2QF7A 2XVAA 1XEFA 2FSUA 3I1YA 3KQPA 1KEEB 3NW9A 4UAVA 5CT4A 4D6PA 1VKZA 3NHKA 5J4KA 1DC4A 1RQNA 4Z54A 2NZ2A 1ST3A 1A8QA 421PA 4OHVA 4AP5A 1YQTA 3IPYA 4MEJA 2JGRA 3WADA 3UKOA 3RJ5A 5LR6A 4B4DA 1DS6A 4K9KA 3HRHA 2DPXA 3VDXA 4BKPA 4CHGA 3NHSA 5I9IA 5GMOA 5B1SA 4L5JA 1ZC3A 3UOWA 4HDSA 1W47A 2VHQA 2ZI5A 3A36A 1JF8A 3EH2A 4JFAA 5DCWA 4CKBB 5BSFA 3P5SA 1NFRA 5COQA 4DN6A 4R83A 2A5DA 3MS4A 3L1UA 4JT4A 4RHYA 1DXHA 1L4LA 3PQ2A 3E7WA 4YP1A 3L0YA 3L77A 1EA7A 4QG7A 9ABPA 1ADFA 5K8VA 3DVAA 3KB8A 1R4NB 4QQFA 1YQQA 2Q6LA 5AICA 3UFXB 1UXGA 1WL8A 1DQPA 3FROA 2WAAA 2QEQA 2UZAA 4B6SA 4FFLA 3A28A 4Q4JB 5AHOA 4DLRA 4E13A 1G7SA 1HDCA 2JG3A 3HDYA 4TWBA 4XR4A 1FDOA 5CH3A 4OK3A 4CDRA 2ZFUA 5JTTA 1GCOA 5D3MA 5C5EA 1FIUA 1FFEA 3SZGA 5FFMA 1FRFS 2ACKA 3O2NA 1J97A 5HE9A 1LEHA 1HMYA 3H99A 4HLNA 2PL5A 2X9NA 3BGDA 3MS2A 5G41A 1MTOA 2G9NA 1D6MA 1Y6QA 3TR5A 4RFLA 4TSFD 4ZOLF 3TOXA 2XXAB 4ER6A 2MOKA 1CS0B 1GV0A 4CU5A 1VRWA 2RHOA 4TKLA 2PLFA 3LG2A 4UM9B 5EJ5A 2R6DA 4M8NE 1K6EA 4NEHB 1OWNA 1Z4JA 1E2FA 4YAKA 1D8TA 1ORTA 2QRVB 1W5TA 2VAXA 4JJKA 5F5XA 4Z9BA 4UE2A 5FYDA 1JLLA 3NUGA 2ZDHA 1NW9B 1G6HA 3L2OB 3GCXA 3OC0A 1CY6A 1R64A 3RVRA 2UZ3A 1DG9A 1XD2B 4AFNA 1YVRA 4DJEC 1Y80A 1KOFA 1WWKA 2PZMA 1P5FA 2GPWA 2PSSA 1XRPA 2Q4OA 3T5PA 4XEHA 4IS2A 4QGFA 4YDRA 3UGKA 4E5KA 1T3GA 1T5DX 3R3JA 1D1QA 2H6EA 4TLCA 4UJ3A 1N9ZA 2PLNA 3OMWA 3PFNA 4EFNA 3ER9A 3G5AA 1SHJA 1M66A 2KLHA 2X13A 2XPCA 3U5ZB 5CFNA 1BMQA 4N47A 3AEKA 3OBBA 4D82A 4MKRA 4BO9A 3G2JA 3M9LA 1F2TA 4KLAA 1SXHA 1GZDA 3M4JA 4W5WA 2QJTA 2AJLI 2RBKA 1GNTA 2RGUA 2IOYA 3GX1A 3HK2A 4PQEA 1Y1QA 5JCXA 1J07A 1OIXA 2HBYA 4J4BA 2OQIA 5F5NA 1U28C 5IP5A 3CVUA 1I5OA 3AVTA 1BKSB 3H4IA 5REQA 2QGFA 4R71A 4QE3A 1K6XA 2QUHA 2ZPAA 2AFIB 3E82A 3F3KA 1DJMA 1PEYA 3KKZA 3R7DA 3PDUA 4Y1EA 4JR2A 3RRZA 1R8SA 1IB0A 4KI0A 2Q3FA 3GP5A 4DTIA 1AZWA 2QU7A 2O19A 1HC7A 3CLSD 1LBQA 3G2MA 2ANCA 3KCQA 5CPBA 1JWLA 3SJZA 2HLDD 5JSHA 1JG3A 1BFKA 4JSTA 5FV4A 1BH6A 2I76A 4XUGB 2OY0A 2DWCA 3U9TA 4OFBA 5L7TA 3K0KA 2CBZA 4I4TF 2WIJA 1F0PA 1TKCA 3ITEA 1QGYA 2JCBA 3DQZA 2RE8A 3H19A 3HQ4O 3RFXA 1M8PA 3RLFA 5BY2A 2M6KA 4DV7B 4B76A 2LXNA 5THQA 2PGOA 1MQSA 5KTTA 5HXAA 1Q50A 1UJCA 4JLKA 3PE3A 4Q7MB 4C6SA 1UPCA 2J59A 5EHXA 5JXHA 2G88A 1F6BA 3K9HA 1JVNA 4IDBA 2P9TA 2X3UA 2ZIEA 5LP6A 4LF9B 2VUIB 3FTFA 1JB1A 1SJ9A 1PX0A 3SYLA 1GJRA 2W98A 5T57A 3TWOA 1QYCA 1Z6AA 1M6VB 4C7XA 3NJ8A 4CKZA 4KN6A 5LZ8A 1YZYA 1I4TD 1X1DA 1UZMA 1OZFA 1QCDA 2XMBA 3WMFA 2IHNA 4HZUB 3GFOA 3HCAA 2FOIA 4WY5A 4ES6A 4C0BA 1CJTC 3Q87B 2CE7A 2R1VB 4RX1A 2K2QB 4DCJA 4IW3B 1F48A 3I5XA 3FFWA 3COVA 4QELA 4P4GA 3VRHA 4CMGA 4Y2PA 1YZVA 3QUQA 2OGTA 1AX9A 4L76A 3EZ9A 4WVLA 3UMSA 5JMTA 3LF1A 2D1TA 1R0BA 2O54A 3O26A 2QE7A 3TX2A 1HSZA 4PYQA 2R7NA 2PMDA 2QJFA 3GA5A 3LCCA 4BMNA 1NNEA 2WTXA 1XMVA 4AJEA 3PFWO 1H9BA 5EG5A 5FHQA 3E81A 5FEUA 4BO6A 4OKIA 4DEVA 2IEGA 2WKPA 7MDHA 3A58B 5ALYA 2GN2A 1DZ3A 4UE6A 1ZIXA 2RIRA 1MCZA 2Q8PA 1MR3F 1XD9A 1XGKA 1FJGB 5KTOA 3WRYA 1O97C 1P45A 2EFDB 1TCVA 3IQFA 4GZLA 3WGOA 3MWEB 1NBEA 3QELA 2YYSA 5EWLB 2JNWA 4DV2B 1EAYA 1Z6PA 2PXHA 3AC0A 1I2ZA 3C8ZA 4YRCA 5K0BA 3BFKA 5BSHA 3NTOA 2Q0XA 2QL6A 2AX3A 1ZN8A 2Y0BA 3D6NB 3ZNPA 3ZCTA 3LP6A 1BJTA 5HF6A 3ISTA 4W5QA 4DJDC 3CC8A 1X7XB 1EB8A 1XJ5A 5SICE 3SBEA 5ALRA 2FCAA 2XQKA 2O2HA 2ZR9A 3UUEA 4Z7JA 2IS2A 2AG6A 4KVAA 4B8ZA 1UPXA 4HXEB 1U2GC 1Q7CA 4ZVSA 2Y4NA 4YP5A 3AEQA 3I1IA 4GICA 4JITA 3HLYA 1H2XA 5FV7A 4QEKA 1CKEA 3AX6A 4F4UA 5K20A 1X7ZB 3PLRA 2XLCA 4KITB 1XZLA 2BAGA 4JI5B 4AIRA 1EP3B 5EZ6B 2GPJA 3AJEA 1Q1GA 1OX6A 3GA7A 1GLNA 1L4HA 2CXPA 5HE8A 2QM7A 1JX6A 4F0JA 2PZ8A 4WVFA 1LZLA 4Y3UA 5SYAA 1R3DA 3L7OA 4HXFB 1KI6A 5ALEA 1PJLA 2HTFA 2Y93A 3QKSA 3ZI4A 3RVSA 5C8DA 2AZXA 1X2BA 5KHLB 2WZBA 2AWNA 2OR3A 1DTSA 4L4RA 5TLSA 2DSTA 4NYMQ 1H5UA 3QPAA 1M6YA 4AX4A 2FSIA 2OAP1 5IABA 3PJRA 1PZEA 1R5JA 3DOFA 3RAJA 3U7IA 1AV6A 2REBA 3LSTA 4D46A 1BU5A 3RKSA 4Q3BA 3VH2A 3T3EA 1TZKA 4BQSA 2WG0A 3BTVA 4FYMA 3KELA 2HZBA 1HEYA 3QIVA 4REQA 5DEIA 1SUFA 3BORA 2WICA 4JX9A 2CXRA 4OHOA 4AJKA 3K9GA 1C9YA 2E0IA 1ESDA 2WTAA 3JR3A 4X7PA 3PNMA 4XIYA 3PR3A 3I6QA 1WD7A 3GGJA 3K31A 5I51A 5A9SA 3L0DA 1QVRA 4CV2A 3PHJA 2Y4OA 1CZHA 4DIEA 4WBNF 4YV0A 4Q39A 4IMRA 1MPTA 4IXDA 3FUXA 5ILGA 5TQ0B 2OECA 1G7RA 4BRUA 4HPXB 4A4DA 2H63A 2CUZA 3U39A 3FOWA 4ZOEA 4QVIA 2XAUA 1AK2A 1D1PA 3KC2A 3UW3A 3HR8A 3ZEIA 2EL9A 4PAGA 4UMEA 1TQDA 3GDWA 4ZAXA 1SXJB 3KFXA 3ZQUA 1I01A 2IK8A 4F2WA 2W43A 5JS2A 1PGNA 2VK8A 3I4FA 4FJ0A 1EDBA 1TKAA 1UT6A 4HYQA 4IDAA 2IGBA 3B6ZA 5ALVA 4ZVLA 3D4PA 2QP4A 4LJKA 3EIUA 4ABTA 2IHYA 3Q8MA 4ZVQA 3T4EA 3Q10A 1VA5A 1VIAA 3N53A 3GHHA 4RWEA 2P0EA 5LDDC 4HZIA 4M37A 4DIDA 3W2GA 3I34X 5BW6B 1YI0A 2AR0A 1G8PA 3BF7A 1E1NA 1RQGA 4HRYA 2P7IA 4FE3A 4KUEA 2R5WA 3HXKA 5JDIC 5DXJA 2X5XA 4FMBB 5FPTA 3X2SA 1WUIS 3A04A 1K6JA 3GFBA 2MSCB 4Z4QA 1E9CA 2O8BB 1VJGA 2I4OA 3LY7A 4K6KA 521PA 3W6UA 2W6ZA 1HOTA 1KEUA 2Z6VA 3DBVO 1L0BA 4X45A 3WHIA 4CDMA 3OQIB 4KTTE 1PUJA 3L79A 1V7ZA 2AZMA 3JV7A 5IKMA 4O1HA 1BU8A 1CR4A 2MTBA 2OZPA 3W2FA 5EJ2A 5E4FA 1C1XA 3HNOA 4M1KA 2AGVA 2YUTA 4J6EA 4RKEA 3OFKA 1P0MA 4KIGA 4BX3A 3NC1C 2R44A 3HKEA 5JCZA 1IHPA 1CEYA 2G71A 1LQUA 2VJKA 3UC9A 4EKIA 4UOZA 1ZU5A 1Z12A 5EZYF 4TV9B 4GE0A 3RUAA 2C3PA 5AVSA 5HJEA 5B2EA 2VLIA 3ICEA 5JQGA 4BEWA 3CZMA 3CPSA 1G8GA 2J4FA 2JEZA 3KQNA 1NMXA 4BTEA 2QLNA 3ZQJA 1ZD4A 1QC5A 2MSKA 4BRSA 1M74A 1ND5A 2NTJA 1Q3KA 4DLAA 5M7EA 2V1UA 1TVKB 2PY6A 3KAQA 1JKJA 2LUOA 3L0BA 2YXDA 3GPBA 1TT7A 3JTEA 4KBYA 5AKEA 3KQYA 1LS1A 2A1UB 2PCJA 1PZXA 1YZHA 2GHTA 1RMTA 3E8SA 3KQTA 3KYIB 4TTQA 4X24A 4DNOA 1HDIA 1T4MA 3QKRA 2JGIA 3BJMA 1R4MA 4A2CA 4KBGA 5FTNA 2KQUA 3ERCA 4CT4B 3D2LA 5K09A 3UXHA 2WM8A 2XSZA 4FPXA 1EK2A 2GTIA 2C00A 4C78A 3T61A 3V8BA 5K2OA 4LBWA 5BMVB 1PDOA 3PXXA 1RXUA 1QTIA 4PFQA 1U9CA 1PR2A 3ZDXB 1G8SA 5CG1A 3PL5A 4NJEA 4V0LA 1LVUA 1OWLA 2PIAA 1RHJA 4GM0A 1X14A 3E22A 3OCCA 5EQJB 2QR5A 3PEWA 1EBUA 2CEKA 3OSUA 3VKUA 4OP2A 2XZDA 3N2GB 1I2BA 4CXMA 1Q20A 4RDIA 2E48A 4ONEA 4LEIA 2F62A 4PLHA 1XKQA 3SQDA 4IOLA 4YCNA 1Y0BA 1JHAA 3IT3A 4C88A 1Q1ZA 2FDXA 4RZIA 2CXTA 3DTVD 4CCAA 5E38A 1QNFA 5IUKC 3QLUC 2QSUA 2QX8A 3RUIA 4BNDA 4PHTA 3ZPXA 3OUUA 5I4IA 3JYLA 2HJSA 4NJMB 3K73O 3D1VA 1AURA 4UEOA 2WU0A 2NU6A 4HS4A 3TVYA 4QUAA 4UDXX 2KYRA 1IUKA 2BP7A 3E0QA 2FNAA 3LUBA 2OAEA 3G1TA 2V9PA 1MVNA 3G0DA 3QQPA 4KNWA 4QOSA 1QOPB 2V7XA 5AKJA 2A59A 4EHFA 5JSZB 1DFGA 3IP9A 3OZVA 4TL7A 2NPOA 3MMZA 3B1JA 4UAGA 4N7JA 4DIUA 2VHJA 1GU1A 1XFDA 1VI5A 1SHUX 2FEPA 1M1NB 1P80A 1OY1A 1H6DA 2XB8A 2Q5OA 4KV9A 1PJ3A 5AJVB 3ODGA 3H5LA 1SR8A 1Z13A 1T9HA 4N0EA 3EVFA 3FVRA 4ZQCB 5DWVA 4C7MA 2CNDA 2AD1A 3AKYA 4ZEXA 3R5SA 1XR3A 1AKRA 2WT4A 3IE0A 3EMDA 4XQEA 3TSYA 1HGXA 3DP7A 5A5DA 4RESA 4NXMB 4KQ2A 4BP9A 1E2EA 1PEKE 2VTKA 3FFXA 3R5TA 1B0AA 1JIIA 2FUKA 3FJYA 5EY5B 2BF7A 4O4JF 1IN4A 4MVJM 1JAIA 2HF7A 3EXHC 3NLLA 1REQB 5AOCA 2R1TA 1SXJC 3JU3A 3C8MA 1RPTA 4IFBA 4R16A 4ZO6A 1XJQA 4CM9D 5JTUA 1PSWA 3SSAA 4D44A 5JAHA 1RQPA 1GXSB 3TO5A 2B8EA 1S4MA 4B85A 1WXIA 4G89A 3H9GA 2XMQA 2JARA 4AS1A 1ISPA 3L7BA 4EZEA 2OMKA 1L7VC 2CXHA 2X0JA 1C14A 3LT5A 4NP6A 3H9UA 4BWFB 1BXRA 3GG9A 3U09A 3K3PA 3TGPA 3RI3A 2B92A 2Q3JA 2GN8A 4AAYA 1AXEA 3KVRA 3O5AA 3PUKA 5HKKD 4UM8B 3BE6A 4BNLA 3C8HA 2JGJA 3MB8A 4MRVA 3ZH9B 4LDZA 2IZ7A 3DPSA 4RD1A 1SB8A 3FYUB 1UMDB 2YS7A 3I8XA 3NO4A 1QRAA 2I54A 2OQRA 3GRUA 4GDMA 4H3KB 4J90A 1OC2A 3PA8A 2ZIXB 2X0DA 3TUJC 1XHFA 4EPRA 5ED4A 1URPA 3OWHA 2RH8A 3EPJA 4Y9RA 2PE5A 4JXKA 3TZLA 4FBLA 3SZOA 4J7AA 5IC4A 1Q0TA 2PV0A 2F43B 4Y2TA 1JHZA 1EU1A 3ROZA 1Y63A 3GEPA 4Z86A 5KYYA 1Q19A 2JZCA 5CB4B 1QAQA 4OMCA 1R15A 1YOVA 4KPGA 2BFFB 3WV5A 3UTCA 3QLEA 3TW4A 4RHTA 1LI4A 4WJZA 3UAOA 2GOYA 3U7GA 3ZLJA 2AHOA 1JA9A 1LRKA 4AUKA 1O95D 1SC3A 1WRBA 3QUSA 4I66A 1NQTA 4PPQA 5BOVA 3VNAA 4A6EA 5BVGB 2YJZA 4YBZA 5F2OA 4FKBA 3DMTA 2FGJA 4JLMA 2BH9A 1NW4A 2YNMD 1L4MA 2WINI 1QZTA 2NNLD 5KOHB 4RDHA 4Y2JA 5D00A 4BQRA 3RLIA 1AMUA 1LDBA 2AZTA 3E1KA 5E2BA 3RYCA 1M0WA 1I7DA 1BEZA 2GRAA 4GKAA 1Y42X 3MLBA 1E8NA 3A6JA 1E2DA 1E99A 2HXYA 2IZZA 5JXJA 1C9EA 3NYIA 1HO3A 3V4FA 1PLKA 4DSNA 1F0NA 3V2UA 1JLKA 1ZOSA 2X2EA 3JZFA 4KAJA 4U02A 1QQ6A 2NTNA 3EGDB 4H4EA 4DRZA 5HZKA 1JSCA 5A5EA 1C0LA 3GFGA 4DM4A 1LSJA 3DC2A 4FFDA 4V38A 1I2CA 3C0KA 4ZWNA 3QV1A 3VPXA 4CJXA 2A1TR 3DEJA 2RI1A 1HPLA 4LJ7A 3QKTA 3PZBA 2JFZA 2PJDA 4GDFA 4AF7A 3ZHBA 2JLAA 1KYWA 4YJFB 3P9ZA 3WL5A 3B6JA 4D0GA 3O3CA 3U3JA 3IKTA 1XWWA 1W5SA 1E2LA 2OHGA 3F2VA 5E6SB 1Y98A 4C30A 2LTAA 1X6VA 5CFPA 1PNRA 5AI4A 5DMHA 1NQ5A 3AF1A 4M0KA 4UQOA 4N0PA 5L6LB 4O4IA 3P9KA 1Q14A 2JJ1A 1PDWA 3GLUA 1P17A 4IIFA 1E20A 3HB5X 1U2ZA 1YTLA 3Q0EA 4IYRA 1Q22A 3ZEAA 4AKTA 5AIBA 1ESNA 1WX1A 4ND7A 1NJ1A 3OAAA 3LWBA 3ML1A 3QG1A 1TK3A 2PUGA 1TQ2A 2I91A 3UXYA 1AQUA 4WBSA 3RCBA 4GMFA 2J3JA 1I0LA 4ZT4A 1L4NA 1NL3A 2ZE7A 4WACA 4OI1A 2JIBA 3O84A 4B2IA 1VFNA 4YRRA 3DPUA 4BIIA 3CVXA 3IX7A 1TPZA 3WMXA 3TJRA 2DC1A 2WE8A 5BQXA 3PFIA 4AMGA 5FPHA 5K6TA 4XUCA 2JAQA 1LLQA 3LUJA 3JD3A 5ELLA 1IIRA 2WUVA 3N39C 4NMWA 1Q15A 2PZAA 3V7YA 3GLIE 1JEAA 1KI1A 1ZIYA 1XZPA 3U3DA 5JIBA 3ZDCA 1RM4A 3QPBA 3TIIA 2G77B 4TT3A 3CUTA 1PTJC 4RWZA 4DUPA 3GJZA 1XCGB 3MWLA 3DE0X 2G0NA 4PS1A 1IG0A 4DKJA 5CIWA 4KQ1A 4YMHA 4NK5A 1UMBB 1IZZA 1SUPA 2O2GA 4WADA 4EKNB 2FFJA 4GGPA 2G25A 3CZ5A 2GD2A 3L7KA 4Q9DA 2O1SA 4QOFA 3RTGA 2UUPA 1BJKA 1QH0A 1RWBA 1V1MA 3BMCA 1CQWA 2CL5A 3CZ4A 3D4OA 4Q1EA 4QJIA 5HRAA 1MJFA 1LV8A 4CT0A 4UREA 2CXXA 4LJSA 2JKVA 2X23A 2J7KA 5G1NA 4YREA 4EJSA 5LL6P 3CXRA 4K7JA 2VDLB 4OI2A 4MKHA 1U6KA 4UOQA 5EQDA 1PNQA 1M1ZA 3MNFA 2TSYB 4L3WA 4Q4HB 2VWPA 3FYUC 1U2TA 3RUCA 3S2FA 4KZKA 4G0QA 4PYLA 1I6WA 4GOOD 1VRVA 1Z5NA 3ORFA 1J1IA 2ILVA 1SUSA 3M6IA 2O5CA 1X7YA 2PR2A 4B7CA 2DFPA 4GLBA 3MSCA 3ABIA 5TSDA 1YULA 3A3KA 4UTNA 3B60A 4EGQA 4NY1A 1RYDA 2O3TA 4DLNA 2PGLA 5JCJD 2ZZMA 1UJBA 3NOOA 3VO9A 4BU0A 4P81A 1RXWA 4UZSA 3ITKA 4JLNA 3L8YA 4DE5A 3WZLA 3F97A 1Y89A 1NVEA 2XUIA 3JQ7A 1TRKA 2RC6A 2G4LA 4FWIB 4HVAA 1PVDA 2P2CA 4KFSA 5DOZA 2Q2NA 1KK2A 4EA8A 3LVQE 1FUYB 3BC1A 3HEAA 4L9WA 2ZP1A 3GFSA 2WJWA 4M7WA 4XX0B 4Z4HA 2ZIUB 2BMJA 3W8FA 3PVZA 3DZKA 4ZT5A 4FDAA 2P6MA 4NENB 2NV6A 3LC7O 1IVNA 4RD6A 3AINA 1DV2A 5F2KA 2ZJ5A 1KY3A 3OZAA 3WGYA 3WMWA 3ZR4B 2IYZA 4DDWA 2BEKA 1MW8X 3QX3A 1WHSB 3LUAA 4D96A 3HDGA 3L7JA 3N8KA 3FPLA 1GGMA 3QYPA 1W0CA 1P75A 2PUVA 2WSLA 3JRWA 1IQ0A 2O4UX 3G8YA 3MBIA 2OTCA 1MNQA 3V7NA 2H1VA 4GPIB 4RH0A 5JZOA 4UKDA 1LFAA 3QXHA 3AF5A 5HP4A 3GGDA 3K15A 1F3OA 4RPIA 2WYHA 1GA1A 2ISCA 2JBWA 4Z1OA 1MB3A 1KSJA 4H4CA 3WWYA 1KI4A 4OFZA 4N8EA 4IXNA 1R6VA 5F2EA 4YAOA 4LNAA 2BM1A 3RTBA 5AXCA 4FKMA 1ZOIA 4A6XA 4DLPA 4F71A 2DPYA 2VSXA 1YCFA 4BO0A 3K8YA 3NKVA 3MGCA 4NDNE 1JAXA 1KQPA 3F0TA 1I1QB 1MAUA 1GKYA 1YQDA 3CGWA 3PC6A 2AW5A 3UV7A 3U40A 2EKPA 2IX3A 2XOKD 5ENVA 1TQ6A 2HIMA 2WD7A 2KHZA 3FDZB 3TTTA 4C4SA 5JRDS 1QG0A 2OORC 3GDHA 3GQBA 2BL4A 2F3UA 2UVPB 2ZIVB 4J3JA 2QTMA 1KQNA 2G0TA 2NTYC 2WIAA 5GZ6A 3GD5A 3QXSA 2YOHA 1E5TA 5G3ZA 4NESA 1MQ9A 1T9BA 2EJVA 2LWIA 4WXEA 5HFAA 1EINA 1WQ4A 1KSGA 1SXIA 1KIFA 4RPLA 1Y3DE 3TLAA 4NZOA 4EY6A 1N9GB 4NJOA 1ZUD1 1W94A 1MF7A 1C0KA 2A6PA 3ED5A 4HH1A 1F12A 4M98A 2PX3A 1GRVA 4LZOA 1C7ZA 3SG0A 1UJNA 1E32A 1TJNA 4B3IA 4MI9A 2C92A 1M8FA 1EGVB 1G7CA 1CQIB 4UFNA 4Q48A 2Z1DA 1ESMA 2EYQA 5BSWA 5CA1A 4TTAA 2PS0A 1G55A 4L02A 3O2JA 5K1ZA 2YXNA 2GPTA 2Q7DA 3FTNA 2W11A 3EQ9A 3JX9A 4HDKB 5LZ4A 2JLWA 3N6XA 3IP6A 2VAMA 5EKTA 1NF3A 1NXXA 4B47A 3OSZA 4H1TA 2J6HA 3H97A 1ADYA 1VLJA 4KIWA 3QVWA 3TTXA 2JLVA 3IIMA 4HNAA 3NBZC 1YU6A 2R7MA 3PD1A 4D26A 3T7IA 1CRWG 4O8CA 2GVZC 1W88A 4PGMA 3SAJA 3LQ1A 3SR0A 5BVHA 2FLVA 3BK1A 3OTOB 5F9MA 2AQKA 3DE5X 1I4LD 5GGYA 2GKSA 3N2ZB 4KI7A 5J23A 4BV8A 4XB2A 2GWHA 3RSHA 2R3SA 3CRVA 3CLHA 3FPBA 4DDHA 1ZSVA 4S1OA 1NM5C 4OHBA 3NP9A 4ZRMA 2DPMA 1E3DA 2XYPA 1M5TA 5C9ZA 4AP9A 4KCGA 3I83A 4YAUA 1EX9A 1UJ4A 2XMDA 1E3EA 4ZYVA 2BJHA 1ETHA 4TMXA 3GRFA 5F35A 1XPOA 4PVDA 2GO1A 3GLIB 2OV6A 2DG2A 2I66A 3AZQA 2X0IA 3BX1A 3FCYA 4G41A 3R41A 4KLRA 5K05A 4LY0A 3QF7A 1NZJA 4FWTA 4RHXA 5HWSA 1N1EA 3WYEA <