3KB1A

Crystal structure of the nucleotide-binding protein af_226 in complex with adp from archaeoglobus fulgidus, northeast structural genomics consortium target gr157
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
255
structure length
243
Chain Sequence
RVTDEDIKERLDKIGFRIAVMSGKGGVGKSTVTALLAVHYAKQGKKVGILDADFLGPSIPHLFGLEKGKVAVSDEGLEPVLTQRLGIKVMSIQFLLLIAGMIREFLGRVAWGELDYLLIDLPPGTGDAPLTVMQDAKPNGAVIVSTPQELTAAVVEKAITMAEQTKTAVLGIVENMAYFECPNCGERTYLFGEGKASELARKYKIEFITEIPIDSDLLKLSDLGRVEEYEPDWFEFFPYLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleotide-binding protein
publication title Northeast Structural Genomics Consortium Target GR157
rcsb
source organism Archaeoglobus fulgidus
molecule tags Nucleotide binding protein
total genus 60
structure length 243
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10609 ParA NUBPL iron-transfer P-loop NTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kb1A01
2B21A 3IPYA 1NLFA 1UPTA 2IUSA 4OK3A 1N2CE 4PHTA 1ZYUA 5G41A 1ZNXA 2V6IA 5LPNA 1GILA 1XMJA 4RD1A 5TVKA 1CJUC 1E2EA 5KO2A 1U0JA 3GFOA 3M4YA 4I1SA 4B6FA 4QGFA 3RRZA 1NJFA 3VR1A 3LH5A 3RSLA 4JIMA 3ZGXA 1PV4A 3D6TB 5C46F 1M2OB 1U8YA 2E9SA 1MT0A 1P2TA 1OW3B 1O3YA 4ZI2A 2CMKA 1W36B 4MUAA 2O8FA 3ZZTA 3BK7A 4BWYA 3PXGA 3RYTC 5KPJA 1OH6A 1IHUA 2O52A 5GVSA 5DYGA 3BE4A 5SZKB 4BEBA 5J4VA 4HAXA 5BN3A 3LVRE 221PA 2Z43A 3FYHA 1LF0A 1ZNZA 3P20A 4S35A 2JLYA 4G1UC 3ZD6A 1JEEA 3MWYW 4NCKA 5G3ZA 1BIFA 4NDZA 4JZKA 2GBLA 5KUTA 1R4AA 3IIJA 2WTUA 1Q44A 1UKZA 1TADA 3B1XA 1KJWA 1L4YA 3GJXC 3TAUA 3TUJC 3X1DA 4BE7B 1ZJ6A 1A2KC 5SZJA 1AGRA 3KDSE 4R2HA 4BASA 3B1WA 5DLQC 5AUNB 2A5GA 2Z83A 4G5RA 2J0VA 2XSZA 1W36D 3I4LA 4TMXA 4A0RA 1EFCA 1SGWA 2Q6TA 1UF9A 4LI0A 4FMCB 2FE4A 2ZJYA 1COWA 4KYUA 2ZRHA 1U8AA 4LJ5A 2ZRJA 4Q1EA 4ABYA 4BFVA 5KYKA 1YHNA 1TUEA 1NL3A 4QBIA 2XOKD 1TF5A 1E0SA 3TW8B 4TMZA 2RGCA 5ANRB 1Z29A 3B2EA 3W6NA 3SC3A 3T5DA 2AWOA 1OIXA 2B92A 2IS6A 3EZ9A 4EDHA 2VHJA 3BFKA 2ONKA 3Q8XB 1XEFA 4HSEA 1XXHE 5TY0A 4OJQA 4I1OA 1D6JA 2XB2A 1G7RA 4GNKA 2CCGA 5J4HA 3TE6A 1GDDA 2R9VA 4UJ5A 1P9RA 1XMVA 3NWJA 2V54A 3CZQA 3THXA 4BLRA 3LW8A 1VMAA 3GLGB 1XEXA 1TNDA 2BM1A 4MKFA 4A2WA 3X1XA 4AWXA 1G3RA 3D7MA 3WYAA 3U44B 4P31A 1NMXA 2I3BA 2EFHB 4M1SA 1TTTA 1UBEA 1P2VA 2PL3A 4Z54A 1UEIA 2IXGA 4F91B 2C8VA 1SVMA 2JAQA 2ZQ5A 3FDIA 2ZRNA 4L9WA 2H17A 1A2BA 1NLYA 1TX4B 1VG1A 1XB2A 2FPLA 3A1VA 3IO3A 4DLUA 3SS8A 3TSOA 2ODWA 4JLDA 5CB8A 1VECA 2VHUA 4WXRA 3SYNA 1T0HB 1FX0B 1BO6A 3AQ4A 3BH6A 2WICA 6Q21A 1WP9A 3KJGA 1KNQA 5FI0B 3X1YA 4Q03A 2KJQA 3LV8A 5GJBA 1KOFA 2NQ2C 1SXJA 3F0TA 3HJNA 2N42A 4KVGA 5JBQA 2HYDA 3EPKA 2NIPA 4BLOA 3AF1A 4LJ8A 2CL0X 1ZNWA 3TUZC 2TMKA 4N1AA 5GJWC 1N5LA 3ZZ0A 2QGZA 3BRWD 3W5IA 2ZIAA 5JJIA 4OQMA 4IXMA 2MMGA 1EFRD 2RGGA 2QI9C 3AVXA 3P1JA 3I73A 3H84A 3K0FB 3P4XA 4EPVA 1T6NA 3G82C 2EYQA 2IHBA 1NBMD 3WP0A 4A9AA 1G6HA 3ZJYA 4MDFA 4DT1B 3FVQA 4YMUA 4TTQA 4UNQA 2R65A 4OI4A 1AS3A 4C9BA 2GCNA 1XFAA 1RJ9A 1CEEA 3RRMA 4L15A 1Z6TA 4PPFA 2DPXA 4Q02A 2AK3A 4D81A 1NG9A 5C2JB 3B85A 3Q5EA 2F9MA 4JLOA 4M4SA 1LB1B 3FE2A 2BCGY 4LV8B 2EVWX 4MRSA 3TMKA 3I61A 2O0KA 3BFXA 4X8MA 3U5ZB 3RC8A 5AR1A 1XP8A 2DYKA 2XNDD 2ZSAA 4HATA 3LX5A 1E0AA 3LO5A 1TU4A 3REFA 4A6PA 3KQNA 2PBRA 3L2OB 4ESVA 3ZD7A 1VPLA 3PIRA 5BQ5A 3GD7A 2AFIE 2GJ9A 2VH5R 2Q21A 2Q9CA 2GK7A 2HT6A 4L9SA 3AP2A 3HU2A 2D4HA 3CWQA 4KCGA 4CW7A 1KKLA 2X19A 1S1MA 2ZJOA 3HU3A 3EG5A 4XD7A 4RZUA 1QVAA 4IRUB 2GF9A 2ODNA 1R5NA 4N0EA 4QC2A 3Q5DA 4OBEA 3TAHA 4CT5A 2G6BA 1OKKD 4L5BA 1UDWA 2WZQA 4XSHA 1ZCBA 3A4LA 4GL2A 3QE0A 1LS1A 3FKSD 1RFLA 2CJWA 2W83A 4EJSC 1Z6AA 3EPHA 4CT4B 4QNMA 4KBGA 4MYHA 3U4QA 4F4IA 4Q9JA 4DB2A 3MWKA 2OCPA 3GCGA 3MWJA 1P2SA 3QF4A 2JASA 4KFRA 4CZ2A 1XTKA 4B33A 2O8BA 1R6BX 3BFVA 1HUQA 1OIWA 3E2IA 4C2TA 2J0UA 2ZI3A 5JZVA 2VP4A 3GQBA 4JLNA 4M9XA 2F43B 4CVNA 4Q7JB 1FNNA 2QU8A 5C4MA 5H70A 2CBZA 3QKRA 2D62A 2GEUA 3SEAA 4HZUB 4URXR 4M1TA 3BERA 1H8HD 3EZ7A 1RW4A 3HPRA 4BFZA 4OK6A 1QHGA 1VYVA 5SZIA 4MQBA 2QBYB 1YZGA 4CYMA 1OHHD 1CU1A 4Q66C 2IS1A 1F60A 2BBWA 1IOZA 3QG1A 5JSZB 5KNBA 5AWFC 4IHQA 2QAGA 1Z8FA 4Q48A 5AJVB 2JGNA 4PZLA 3ND8A 721PA 1U2RA 3QEJA 1Q20A 1XD2B 2RGNA 4C0AC 1F2TA 1I2MA 1UBFA 1G1MA 2VP2A 1EXMA 4HUQB 2NG1A 1PLJA 2JJ1D 3LY5A 4NP6A 4FN5A 3QXSA 3J81k 4HB3A 2XITA 2QNRA 2OAP1 1KAGA 4L8GA 1CXZA 2AD5A 2PMDA 1GKUB 2ZRGA 1JECA 3VQTA 2G0NA 5JHHB 4DHEA 1ZP6A 1ZU5A 1FL9A 1N0VC 3GJ6A 2B7BA 2WMOB 3W3AA 4HAZA 3RRYA 1J8MF 1OE0A 2CK3D 2NZ8A 4PQRA 3W8NA 1EFHA 2XGJA 1E2IA 4P32A 2WPDD 1VYUA 4B48A 1VCMA 4TMWA 3B9QA 2VP5A 3HP1A 1TUIA 4WW0A 5FPKA 1XU4A 1KSGA 2XOKA 2J1LA 4Q5IA 3T1QA 1E9SA 1G19A 3WXMA 1JJVA 5FH9A 5JJLA 4B44A 1KGDA 1QRAA 4URYR 2YWFA 4B34A 3LX8A 5EP4A 3UPUA 3EAQA 3ZQJA 1ANKA 2AFHE 4DJTA 1G291 1GSIA 4Z1MD 2BMDA 1XBTA 2BIFA 3RC3A 3GP8A 3NG1A 1E2KA 1VIYA 4D4MA 2BBTA 4YDHB 5JEEA 4ZDKA 3FFBA 1NIJA 3HU1A 4NU0A 3U6BA 2QQ0A 1AZTA 3LBHA 1XTRA 2R6CA 1Z6XA 1OFHA 3GLIB 5FL3A 4M1KA 2WSSA 3D31A 2V7QA 3RAPR 4LBZA 4KYIB 2EFCB 4B76A 2ZS7A 4RKEA 3TK1A 5J40A 5CDFE 1ZW6A 2AKAB 621PA 3QPWA 4U00A 2ZXUA 1TF2A 2KB0A 1MABA 4Q1BA 3RS7A 5JWRA 3AM1A 4DUGD 4L16A 4MRVA 4Q21A 2WJHA 3VU9A 1NNEA 1DS6A 4TSFD 5DN6A 4LBVA 2P67A 4BRWA 3LDAA 2YOHA 1XPUA 4FMCF 5EE5B 2C96A 4C0KA 4M22A 4M1WA 5IDVA 5DHFA 2HLDA 2ZI7A 2OBLA 4BFYA 4D0NA 2ASEA 2ZI4A 4TL7A 4F93B 3QBVA 4KAXA 4LSGA 4OHXA 4NYMR 2W2VA 1RYFA 2VTKA 4U7DA 2FSFA 3VAAA 1NMZA 2QL6A 1RRCA 2WJJA 4P4SA 1Q1ZA 2VSXA 1Z28A 3QQ5A 4C0HA 1TPZA 4JVSB 4XWOA 1JQLB 5TMPA 3U44A 2BBSA 3IPXA 4MYUA 1K6MA 4Q9KA 4ZCMA 2Q9AA 1KI9A 2ZTSA 3OFNA 2Q3FA 2FPMA 2GWHA 2NZJA 3QXJA 4O0MA 2FA9A 1J7KA 3B6EA 1BKDR 4TLDA 4M8NE 4WZ6A 3BWDD 3JZMA 3PUZA 1T3HA 2ZE7A 1KJZA 1W49A 4AKIA 5DGXA 1W4CA 3A37A 4CDGA 3TIFA 2CXXA 3KJIA 3VHXA 2GJAA 2XX3A 3OEHD 4K46A 4BZQA 4IXNA 1AGPA 3QNUA 4JYBA 5FTMA 4O3MA 2QTFA 4RVCA 4NONA 3OE7A 2F55A 4TL8A 3CRQA 3K53A 2GXUA 2GCOB 3AF2A 4YONB 2F1RA 4B47A 1FTNA 1QG2A 1QHYA 3KTAB 4B73A 4EJSB 1CBUA 4CEHB 4HB2A 3FMPB 1ZU4A 1XD9A 4NHOA 1L7VC 1ZMXA 3WBKA 2GXAA 3GJ7A 1E79D 1VTKA 4TLBA 3TR0A 3DMNA 4JSTA 4PC1A 4DC9A 2RHDA 1IXRC 2JJ2D 2IYRA 3QXXA 1L8QA 4D25A 4RD2A 4DSTA 1KK1A 3UATA 3FOZA 2OXRA 4B32A 4XVQA 2I1QA 1T8UA 1P75A 2O8EA 1NF3A 4ARZB 3MCAA 1OJLA 2ZUCA 4Q4AA 4ASUA 2QP4A 4PC7A 3GLFE 1N5JA 2XTNA 1SULA 4M0LA 5E3HA 2GETA 3AKDA 2CLCX 5KDLA 2IUTA 1TF7A 4IFBA 4UXHA 2F3TA 2QP9X 3DHWC 4YDSA 1GNPA 3MUFA 4OHWA 3BOSA 3H1TA 2NGRA 3KKQA 3PEVA 2OZEA 2XZPA 2IC5A 4W5JA 3LFUA 2CCKA 3AVQA 2D2FA 1KI4A 4XJXA 4LPSA 4JYCA 3ZDQA 1TL7C 3UG6A 1E9EA 3VR2A 4HDOB 1R0WA 3GEHA 5EE3A 3W90A 3TNFA 4RCYA 4MKGA 3U3KA 3AVTA 1IM2A 1JBKA 3TQFA 4U5XA 2I1VB 1CIPA 3UMSA 1NVVQ 1EK0A 2ZYWX 3CKLA 2IEYA 1IBRA 1Z2AA 2ZRKA 1DOAA 2QT0A 3CR8A 2HJGA 2V6JA 3CF2A 3W6PA 3TLXA 2J87A 1U98A 3KKPA 1NKTA 5DIFA 1AZSC 1HE1C 1VHTA 4IVQA 5DI3B 2OFWA 3K0AB 2BEJA 2ZRLA 3AF0A 5EUMA 1WBDA 4KSCA 2BWJA 1F5NA 1OXXK 3SDZA 4R71A 1ZM4A 2D74A 4PC2A 1E9AA 1HTWA 1UKEA 4YLGA 3R9XA 1YRBA 1G8PA 2RKOA 3FWYA 5KU1A 1IY0A 1GNRA 4H1VA 1X1RA 4MGKR 2NPIA 1GRNA 1J8YF 2DHRA 2OLKA 4FMBB 4XVRA 5FOSA 1W4BA 1PUIA 2B8TA 2OFXA 3OAAA 1BMFD 4QOSA 3AVUA 1Z2CA 1JPJA 2QBYA 4AG6A 2VIIA 3SHWA 1HT1E 1N6IA 1XCGB 3QKSB 1OXSC 1CR2A 1GZSA 3BH0A 4NTZA 2GF0A 1E2DA 5DHAA 2B7CA 2REXB 2ZRIA 4QGHA 2J9RA 4R98A 1L4UA 1XD2A 2ZI5A 1AQYA 2V55B 1P4SA 1U94A 1N6PA 3PUVA 2Z4SA 4K8OA 3RWOA 1QF9A 2QE7D 4JLAA 4I4LA 2G88A 4BFTA 3N5CA 3TUIC 2YJTD 3PVSA 3GLHB 3AEZA 1XTJA 3AVOA 3CUEF 4JL6A 5KPDA 2HV8A 4NCJA 1U8ZA 2A9KA 1Z47A 2VO1A 4DEXA 2VP6A 421PA 1HQYE 4XWKA 3C15C 2VP9A 3THWB 2QG6A 4ITRC 3A1TA 5CLLA 2EYUA 3DZ8A 3SR0A 4HAYA 5J4LA 2NO7A 1JR3A 1G4UR 1YR7A 3KX2A 1QZXA 4AD8A 5LD2C 2QMOA 5KSOA 4DLWA 1QHIA 1JAHA 1KMHA 1R10A 2P6RA 4HI0E 4AC9A 1DO0A 2JATA 5FL7D 2FDCA 4MDEA 1CP2A 4A2QA 1W4AA 4EPXA 4F92B 2AXPA 4C30A 2YHSA 4LYFA 2HCJB 3QOFA 1ZM7A 2F3RA 1QBKC 2Q3HA 1KO4A 5CM8B 3EPLA 5FPHA 4F7WA 2IK8A 2GESA 1SVLA 1N6LA 4US1R 3LW7A 4ACAA 3D3QA 1E2HA 2D2EA 4V0LA 2PT7A 4GBMA 5KNDA 1I2DA 4LHZA 1CJVC 3IHWA 4ZCIA 2ZROA 1PZNA 2ZRAA 3FPAA 4JLMA 4Q00A 5FUVA 4XSGA 4JS0A 4GSYA 3OIYA 1UKYA 3MLEA 3PG5A 2J7KA 2GHIA 2IYVA 3TQCA 1W47A 2PCJA 1G3MA 3QXHA 1G5TA 4ACBA 2ZRBA 4Y0VA 1N6KA 3ZVRA 5BN4A 4I81A 2UZIR 4JBWA 5EXSA 4G5GA 4W9MC 2KI5A 1TQ6A 4A2PA 1II8B 1GKYA 3LXRA 1CR1A 3L0PA 4DDWA 4QJ3A 5CLQA 4HAVA 1IQPA 2ZPTX 3ZIAD 4CRWB 2FN4A 1E2GA 1Q1EA 3EIEA 5BN5A 5L3VA 5FTKA 1GM5A 1EX6A 3THYA 2C9CA 3IEUA 2ATXA 3BH7A 4JVNA 4Q4HB 2XAUA 3WHLA 4BUJA 1AS0A 3GPLA 3OEHA 2ZU0C 1BH2A 1OV4A 2YKGA 1E1RD 1YJ5A 4TQUS 2J46A 2NO0A 2R6DA 2PJZA 1MH1A 2JDID 1EGAA 1U0HC 1W0KD 4MRPA 2ZE6A 3QBTA 2OT3B 1OH8A 1TMKA 2RGXA 1CR4A 1M74A 2R6FA 1X6VA 2R6GA 3DVLA 3Q72A 1KSFX 2ZANA 3THOA 3UMFA 1VCOA 3ZS8A 4EFLA 4GFDA 4Q7LA 1H8ED 2P65A 3KB2A 5E7IA 4JBYA 1J99A 3NBYC 4ON9A 1F6BA 3K9GA 1J2JA 3OEED 3IUYA 3QUSA 1UFQA 4I1UA 3AH8A 4QNRA 2HDNB 2Z5FA 3CH4B 3O8DA 2VBCA 2PCLA 4NZYA 4D4LA 1S9DA 2OV2A 4V02A 1VG8A 3B1YA 1ZBDA 2W58A 3KFXA 3WMGA 4A8JB 2PZFA 4X8LA 3W8RA 4MITA 4OQFA 1K5DA 3P4YA 2ZYTX 3CIOA 1NIPA 2CE7A 4LX0A 1XWIA 1RVDA 3OIWA 4TMTA 5BYKA 2G0TA 1RKBA 4OJKA 4PPGA 2AX4A 3L8YA 3A4MA 4B3FX 5A5GA 1MKYA 5FUXA 3CBQA 1X3SA 4O2LA 4JT2A 3NH9A 4WBSA 5EP1A 5FR1A 3ONWA 4CEHA 1NN3A 1GL7A 4PSKA 1JXMA 2GJ8A 2ZRMA 5EZ6B 1XTSA 2ANCA 1AKYA 5KNCA 4DWJA 3VKWA 2DCUA 2GRJA 3CWZA 5GVRA 3WBJA 3CPEA 5TDHA 2OCBA 3CX6A 1XRJA 4FMDB 4QHYA 5DO9A 2B6HA 1W1WA 4M2LA 2ZRDA 5IHPA 1KI6A 1VG0B 4B75A 2QT1A 4BFXA 1ZNYA 2HT1A 5GJVC 4ARZA 1W44A 2WMNB 1X8LA 1NN0A 4D4KA 1HYQA 4AKEA 3LVQE 2MSCB 3PITA 3MSXA 2JIZD 4O25A 4QGGA 2PX3A 2Z6VA 1W2GA 1US8B 3K9LA 2N1BA 1PUJA 3GLHE 1E98A 1X8JA 3CX7A 5HE8A 4PR0A 4P3YA 3I92A 3UWOA 1ZM2A 4JVLA 4MKIA 3BB4A 4PFSA 5HKKA 2UKDA 4KBFA 4MYCA 4RD3A 3RLFA 2BV3A 1ZD9A 1WCV1 2YVUA 4NKRA 2GVDC 3WNCA 1DAFA 3NC0C 2H18A 2QSYA 4HDCA 1QHXA 4M1YA 3T1VA 1AK2A 1KO7A 3CM0A 5G3YA 3S1AA 5HZKA 1XPRA 5H8WA 2JLSA 3NXSA 2BVNA 3EARA 4IJMA 5JHGB 4WZAE 5AJYA 3GJ0A 3K0CA 1LV7A 1PLKA 4LGMA 2VSFA 1R5BA 2BJWA 5LD2B 1Z0DA 2C99A 4LDJA 3K09A 3IQXA 1XZQA 3R20A 2DFKB 4JL5A 4BFWA 2J7PA 3V4RA 1QHNA 5KDDA 3LA6A 2ATVA 4KLZA 4V0NA 3FHTA 1KIMA 2H1LA 1OYWA 2IUUA 4TWZA 3X1ZA 1Z3IX 2K5UA 1U90A 2O8CB 2PZEA 2MSDB 2W6ID 4GP6A 4RFSB 4OHZA 5AK0A 3FGNA 2P2LA 1YKSA 1SQ5A 1NVXQ 4TYWA 1ESMA 3QKUA 2GILA 2OILA 1MOZA 1FTSA 1YZNA 3AKYA 4TT3D 3WY9A 4D6PA 4NYJR 4OQLA 3QY0A 1WF3A 1YZLA 5BW8A 2YOFA 2EU8A 2GTPA 1E0JA 1G3UA 2QM7A 3KXKA 4JL8A 3MGCA 4EAQA 4B71A 2BM0A 1F2UB 3CNNA 3WNBA 5EQTA 1JQJC 1FZQA 1E2NA 1UM8A 2ZAMA 2EFGA 1GOTA 1AIPA 1G3IA 1SVOA 3SNHA 3VX4A 4NYIR 5F9FA 4LHVA 2GCPA 8OHMA 3KQHA 1MRSA 2NO1A 3SFVA 1T5IA 4CF7A 4A15A 5FR2A 3CR7A 3CRW1 1ZVQA 4IKEA 2WWIA 4MA4A 4B2IA 3DZDA 3KUDA 1XXHA 3B13B 1N5KA 4MRNA 3ZLJA 4JLVA 4PO8A 4QGAA 3U6KA 2CNWA 3I8SA 4LC0A 1M8PA 2OXCA 4LWZA 4M53A 4ZKDA 2ZU6A 2HCBA 4HLUA 1KDOA 1QHHB 2Q9BA 1UEJA 1YU9A 5GJCA 4PAOA 1NVUQ 3AVPA 1CJKC 4ERNA 2XXAB 4TMKA 1IONA 1XJQA 4QBFA 4Q9HA 4TTPA 5JWOA 3QKTA 4RFVA 1NJGA 4RZ2A 1VCIA 4KO8A 4JSYA 4B3DA 3AUYA 3NHAA 3OESA 4E22A 2H16A 3Q7QA 3WRXC 3KQKA 3GJ8A 3SHFA 2H8KA 4DSNA 1S3SA 2DFNA 4Q9IA 3KJEA 4TYNA 5L8VA 5BWMA 4XIGS 5JMTA 2NMVA 4OQNA 5JFGA 4DEYA 4PX9A 5BYJA 5L3QB 1CR0A 1XMSA 1AJEA 4FCTA 5FPTA 1HH4A 2PMKA 2DB3A 2REBA 4Y0AA 5HZHA 1S8FA 5F9HA 1J90A 2AHOA 4ZDWA 4DSUA 3EIQA 2QP3A 1SVIA 3U7GA 2GKSA 3ZH9B 1LNZA 5CYOA 2QA5A 1G6OA 1E94E 1QVRA 2WM9B 1MV5A 3IIKA 3PCRB 2FFHA 1CJMA 3O47A 4DIDA 2ZUDA 2GZDA 1IN5A 3LWNA 1T3LA 3DEFA 4RD4A 3NDPA 1H8EA 1OT3A 1LF5A 3NIBA 4LJ7A 2HF9A 3C5CA 4C0JA 1U9IC 1FUKA 4EPTA 1FP6A 1WXQA 1E3MA 1N6NA 1UBGA 3ADDA 1GP2A 4D0GA 4A1FA 4Q4LA 4GPTA 4Z8XA 1EESA 2PEZA 1YR8A 1YRAA 5LB4A 5FI1B 3GLFB 1YR6A 2R6AA 4FINA 1XPOA 4C0QC 1Z06A 2WWYA 4LJ4A 2R2AA 1EFTA 4GZMA 3M1IA 2ZSFA 3QPVA 4XTRA 2X8AA 3GJ4A 1NG1A 2ZITA 1N6OA 1XJ0A 2YOGA 4JJZA 4IDOA 3I62A 1Y3AA 4BLTA 5B30A 4Q9LA 5LDDC 1E96A 3IGFA 5FFMA 3RS0A 3I8XA 3L0SA 5G53C 4URUR 1Q3HA 1KY3A 1HEIA 2QMHA 1R0ZA 2IYUA 4EQ6B 3CONA 4IDNA 3LBNA 5AJXA 2O8DB 1OFIA 3QG5A 1KSJA 3DPUA 5K8TA 3F3YA 1W46A 4JLPA 4A6XA 1HV8A 1VG9B 2IXEA 4LYHA 4AYTA 121PA 4RD6A 4EPYA 3ND9A 4BFUA 5HR5A 3VFDA 1E2PA 4IOMA 1II0A 2EQBA 5HE9A 2JLZA 1E9RA 1WB9A 3VMFA 2D7CA 4OQXA 2FF7A 4QJ5A 5FOVA 3TR5A 1TU3A 3WMFA 4TZ0A 1W0JD 4R2IA 4WOPA 3CF6R 2A7QA 2IYLD 3KQLA 4CEJB 2IS4A 1JAIA 1NSFA 2OBNA 5IF9A 1B0UA 3K1JA 2NOAA 2J45A 3BJIC 3KKNA 4IDQA 1DARA 3ZQ6A 4IOKA 1KK0A 4CEIB 3VKHA 4LJ6A 5FBRB 1ETUA 3GJ3A 4IDHA 4YMSA 4V0MA 1HY3A 2HXYA 3RS2A 1GTVA 5IT5A 2ZM5A 4A82A 4DXAA 1DAGA 1K5GA 4PANA 4PPQA 5E4FA 3T06B 1AN0A 4DLTA 2R8RA 1P73A 3ZYCA 5L3SB 5EUQB 1XCMA 1XMIA 2Q0HA 1WQ1R 4D26A 1N6RA 1E4VA 1X1SA 5IK2D 2C98A 4JLJA 2A5YB 3RS3A 1KJYA 3HWSA 4HB4A 2IYQA 2VHTA 2D3WA 4LHXA 4TL9A 4H9GA 1I4LD 4YXWD 1X8KA 1ZUNB 4DKXA 4DLVA 4QM6A 3GLGA 2ANBA 1M7HA 3IKJA 1T0JB 1XDBA 2F1JA 1D2MA 1KI3A 2WIAA 2BBOA 4US2R 2FMXA 2LWIA 3RNLA 1W5TA 3NHBA 2C77A 4IVPA 4LHWA 3R8CA 2CLDX 1S4QA 3NBZC 4PSAA 4PQFA 4W5WA 2W6JD 3NKVA 5EE1A 3OIVA 1P6XA 3NEYA 2IHYA 3NBXX 2QUZA 5H1YA 1E0KA 1EFRA 3AF3A 3CRVA 1FQKA 2DWQA 3A8TA 3BGWA 3L0IB 1NBMA 4YMTA 3L82B 1FX0A 1AS2A 4KVAA 3U3RA 1FW6A 4YMVA 2QMUA 2ZRCA 1GRQA 3ZVMA 4PHFA 1G8GA 3VR5A 1RRFA 2C04A 3VKGA 3N70A 2BMFA 1G21E 2O8CA 2O8FB 1Q21A 1Z5ZA 3B1VA 3IHLA 1G5PA 4A92A 4DLZA 1C9KA 1G7SA 4H1UA 4LBWA 5FOUA 3NBFA 3SYKA 1E2LA 2QN6A 5EE9A 1R8QA 1ZIOA 2F1IA 5FPSA 2C9YA 2XNDA 5P21A 1EG7A 1G8HA 3E5HA 1EX7A 3TVDA 2WIBA 4U02A 1CJTC 4UNPA 2CHQA 4DLXA 2LKDA 1RC8A 3B82A 1RZ3A 3K0FA 5FOTA 3ETLA 3HPQA 2GNOA 1OFTA 2JLQA 3ADKA 1XX6A 4LC1A 1XZPA 4M21A 4EFMA 4DT1A 1R0YA 4JLKA 5CDFA 2JJ8A 1G9XA 1OKKA 2GJKA 4G5SA 1HT2E 1NRJB 4ZPXA 4DRZA 2HJVA 3FKSA 1UAAA 3UG7A 5CK5A 2FFAA 1T8TA 4J0QA 4PZZA 1E32A 4KXFB 2OM2A 4R9UC 1WDTA 3BAFA 3EA0A 2CL6X 4WZBE 3RS4A 3CO5A 3QENA 1OB5A 3CB4A 1DG3A 5UKDA 3CF0A 5L3RA 2D06A 1NN5A 2ZVPX 2RHMA 4BLPA 2HXSA 2G1JA 3AP3A 3C8UA 4A8JC 4RKFA 1P2UA 4JVMA 4N0DA 2QSZA 3T34A 4P4TA 2ERXA 5FBQB 4NCHA 4HDQB 1KHTA 1H8HA 3CPHA 3BC1A 1ZM3A 4POAA 3VX3A 1YZQA 3A1WA 2KE5A 1ESNA 1P9WA 4QBGB 2XSZD 5J47A 2OCYC 4B6EA 4LZZA 4GOJA 2DWOA 1G18A 1GVNB 5KSYA 1W4RA 2V9PA 1OHHA 2W2TA 4OI2A 3THXB 2PLFA 3R9IA 1COWD 1XEXB 1S1CA 3MG9A 1XTQA 2DFTA 1G8FA 2LKCA 3U3JA 3DL0A 3DDCA 3LXXA 1M34E 2AXNA 4JJKA 4P0TA 4C0LA 1KI1A 4X8HA 2A3RA 3HDTA 2XTZA 3ASZA 3I32A 2FJUA 1DBSA 1YVDA 1KAOA 2JJ1A 4XOIA 1S2MA 4A0HA 2FGKA 3ICEA 4KSBA 2QORA 4PHHA 1L2TA 4B43A 3AKEA 3AGPA 2F43A 4PO1A 3PJRA 1MO4A 3IEVA 2DFLA 3A1UA 3B5JA 3CLVA 2UVQA 3EASA 4HZUA 1E2FA 2ORIA 4C4PA 1MR3F 4HLDA 4GDFA 1CLUA 2CK3A 1ZD1A 2C5LA 4B35A 3F5FA 4GOKA 4MGIR 3PUYA 4P4UA 3R8FA 2WPDA 4LYAA 3F8TA 4LK2A 4Q18A 1S9HA 5TXGA 5JSZA 1A1VA 3DMDA 4Q7MB 1RRPA 3W34A 1SXJB 4N3NA 4WXPA 5AJWA 5KTYA 4FWTA 5AUOB 1Z0JA 4C0SA 3W9YA 2YWHA 2OUKA 2EFDB 3A4NA 4HUQA 1IY1A 5K8IA 1VHLA 3EZ6A 3ZS9A 2GXSA 1E69A 2ZI9A 5M04A 3CW2A 1KYIA 4V03A 4Z1MA 3KXIA 3RHFA 2C03A 3NTUA 4EIWA 5B57C 3GEEA 5J4YA 2Q3MA 2WJVA 2VSOA 2CHVA 1P72A 1TQ2A 2AWNA 2QQEA 3DKVA 4Q1CA 1UADA 5JEDA 1G3QA 1GITA 1RJ9B 4UKDA 1DO2A 3RABA 4Q1DA 1SXJD 5FTNA 3I1FA 1XJCA 5EP2A 3SBDA 3R7WB 3U7HB 1KNXA 1EWQA 3RRNA 2ZJ8A 1MRNA 3E70C 1CTQA 3GMTA 4P33A 1DPFA 5EZ5A 3QSYA 1P5ZB 2OO7A 4HZIA 3AVYA 4BZXA 4MH0R 2AK2A 5CK4A 1AQUA 2P0EA 2WKPA 4E07A 1KSHA 2A5DA 4LV5B 4QKQA 2ZJBA 4DUGA 1NLZA 2ZS8A 4TSFA 4OYHA 1Z63A 2ZJAA 4PSVA 3I5YA 5EXXA 2QGNA 1F48A 1P7CA 5JWHA 2CDNA 4CEJA 2WKQA 4BPBA 4TYQA 3HR7A 2A78A 3H86A 4B3BA 2C9OA 3MWLA 4UJ3A 1U99A 1G4AE 2QRNA 3GLIA 1KI2A 1G41A 1B23P 4D4JA 1A5TA 2CJWB 4PXAA 5A4JA 2ODEA 2NO6A 3OIUA 3PFIA 4US0R 4G01B 3U4QB 1NMYA 5BXQC 3MJRA 4AYWA 4WVFA 4EPRA 5TARA 5L3SA 3QF4B 2XB4A 2C2HA 2JLVA 5F98A 3TKLA 3LRPA 2J0UB 3KZ1E 4QJ4A 5AUPB 4D82A 4LOAA 2RB4A 2BMEA 2OEPA 3BB3A 4XWAA 2QAJA 4FXPA 2IF2A 4L4UA 2VYFA 1W5SA 1KO1A 2ZETA 3QKRB 2V3CC 4M9SA 2PLRA 4ESHA 2ZJ5A 1UJ2A 4XD7D 2BKUA 3MAAC 5E7JA 1XEWY 1CRQA 2J0SA 1WA5A 2OAQ1 2CVFA 3UIEA 2AN9A 1FP7A 1HQCA 3AP1A 5E7MA 3AGQA 4XVUA 2ORVA 2REOA 2O0HA 2PEYA 2QAGB 1JR6A 3TSZA 1IXZA 2P3SA 1KI8A 2XJ9A 3U61B 1E79A 1ZUHA 3C4JA 3AVWA 3I3SR 1LS6A 3EWSA 1F2TB 1G5RA 2JJ2A 4RJLA 2W2XA 3NH6A 2R44A 3Q3JB 4OK5A 2G77B 4DCSA 3UMRA 1UKVY 5TB5A 1VKJA 2H7VA 2QRZA 2WOJA 2AKYA 4AKGA 4EPWA 5GADl 1DAIA 1SVKA 3T1OA 5CB6A 2JLRA 1R2QA 3P26A 5B64A 1XEWX 3R9WA 2N46A 1E1QD 2G83A 4TTRA 2GCOA 1O87A 3WHKA 1FMLA 1XF9A 3X1WA 3T1TA 3ICQB 3VTKA 3WNDA 2OSBA 3KTAA 3V9PA 4EJSA 4Q4JB 4TZ6A 4OI0A 2H5EA 2RGDA 3FHOA 3QPUA 4WIAA 3K9HA 2EWWA 4PO9A 4OHVA 2QTHA 3FMFA 5J4KA 2YWGA 1P9NA 4TYPA 1SXJE 2YYZA 4NYMQ 1ODFA 3B9PA 2JLXA 3CX8A 1E2QA 1WRBA 1Q57A 2C78A 1OXUA 2F1HA 2IYSA 1JNYA 1OIVA 1RIFA 2VEDA 2VHCA 3LBIA 4HLQB 2FSGA 2GVZC 3NEJA 3UANA 4FI3C 3WYGA 5FOXA 3CZPA 1OB2A 2PJRA 1KI7A 1KK2A 3IO5A 4GMXA 3SJBA 2FV8A 5TV2A 5G40A 1U9IA 2I4IA 4FCVA 2JLWA 1JJ7A 2ZRFA 3JVVA 3JVUA 4PHGA 2ONJA 2PX0A 4V0KA 1MO6A 4HB0A 3DM9B 4MGZR 1NN1A 5CYPA 3K0SA 5FTJA 2PT5A 2QROA 3KJHA 3WRYC 5FBWB 3BB1A 1LVGA 4B3CA 1KK3A 5JS7A 5KOYA 1JI0A 1Z0FA 2AD1A 4M9QA 4YC7A 4ZDJA 3K70C 4ZCLA 2XZLA 1TEXA 2O0JA 4OI1A 2QM8A 4KJZA 2GAAA 2CEAA 2ZR0A 2EW1A 1MABB 4Q01A 4MUBA 1DELA 1IJEA 1KDRA 4Q47A 1KDTA 1D9ZA 521PA 3VU9B 4W7SA 4E5UA 2EWVA 4W5HA 5FPYA 1A7JA 1M7GA 4RSGA 1X86B 1ZM9A 1EWRA 4KFTA 3LQQA 1BMFA 1ELOA 1NP6A 5D3MB 1E9BA 3CNLA 3C14C 3HR8A 1OXTA 2ZAOA 1DG1G 1YZKA 4MRRA 5J5CA 5KDOA 2ZE8A 1D2NA 2QMEA 2D7DA 2CLSA 3RSOA 2WSSD 1HURA 2V7QD 2RGEA 1FNMA 5FUWA 4B2LA 4P4SB 5K8UA 3KKMA 2DR3A 5DI3A 4E03A 2FFBA 3K0AA 2WSMA 5LB2A 1J70A 1KKMA 2IL1A 3KB1A 1OF1A 2G3YA 2QZ4A 3L8ZA 5CJ2A 4CIDA 5JRJA 2RMKA 2QE7A 1CKEA 2HEIA 3T35A 3TVTA 4LCBA 2FFQA 4PC3A 3NC1C 4UQOA 2A30A 3G5UA 4DCUA 5FUYA 4DZZA 4Q1AA 4RY2A 2RGBA 1SHZA 5DN6D 1I4TD 3IBYA 3ZVNA 3EPJA 1BS1A 3GFPA 1CRPA 1ZUIA 2OLJA 3Q7PA 2WWWA 3IDQA 4FIDA 4URZR 4BFSA 4G0NA 1I4DD 4HYYA 2HLDD 1GL6A 4KODA 1EFUA 2FG5A 3QKSA 3L0OA 1W48A 4LJYA 5C4GB 4AIIA 1II9A 2QPTA 1DEKA 1SKQA 3QXCA 3KXLA 3AKCA 4PAMA 3T15A 3O8BA 1CF4A 2HF8A 3PV0A 3B60A 1Z08A 3FHCB 1XCPA 1M6NA 2VRWA 5FL7A 4HAWA 3OFND 3N2IA 1E2MA 1G8YA 3QJYA 2H92A 4BGDA 5EJEA 821PA 1Z83A 4A4DA 1GNQA 4IOLA 4IDPA 4MGYR 3GJ5A 4DIEA 1G7TA 1NVVR 1BYUA 1Q3TA 2ZE5A 3GLHA 4GOXA 1Q12A 1XD8A 1T5LA 4PPNA 4V0OA 3PEUA 3UKDA 2O8EB 2PZGA 3LD9A 4HLCA 3AVVA 2NO9A 1PLLA 2RAPA 4QFMA 3WYFA 4BECA 3THWA 2VF8A 3QIAA 4LPKA 4Q4AB 2H57A 4IW3B 1GKIA 1ZAKA 3SU8A 4DLYA 2GEVA 3OE7D 1OPXA 2GZAA 4JMPA 3KUCA 1KDPA 1Z0KA 3HYTA 4M1MA 2WWXA 3OHMA 5F3WB 2KBEA 2BOVA 3RVBA 3SN6A 2XTMA 3R7WA 2SHKA 4F4CA 3OF5A 1RRGA 3A6PC 3SQXA 3BS4A 1S96A 1ZC3A 2KWIA 2G1KA 3Q85A 3ECCA 3DO6A 3W6OA 1A4RA 1Z07A 3GFTA 4CGZA 4DDVA 2WVJA 3TW4A 4DLSA 1DAEA 3ZIAA 1G64A 3P27A 2VP0A 3JZAA 1F3OA 4RZ3A 4QG7A 2IBMA 4LBYA 3QF7A 5JLJA 1XNJA 3FMOB 4K81B 1P62B 2XEXA 1Q1BA 1T91A 2FPKA 3BXZA 4ASUD 4C7OB 1E1RA 2KSQA 2JDIA 2GBLC 3SYLA 1W0KA 3PEYA 1ZC4A 2DWPA 2ZVQX 3PR1A 1E9FA 2IXFA 2P6NA 2V1UA 2JLUA 3U2QA 2ZRPA 4QHTA 1VIAA 3O8CA 2XZOA 2W00A 4A0GA 1R7RA 1II8A 5ELXA 4JLBA 3OEEA 1Q1QA 1D9XA 1NVWQ 1Z6GA 4ZDIA 4RZXA 2X1VA 3REGA 1TQDA 1NY5A 2V4ZA 1G17A 4BRUA 4Q4HA 1ZCAA 3CH5A 4G5QA 1HA3A 1ZD8A 3H4MA 4HAUA 4V0ME 1Q0UA 3SI7A 4DCVA 1LW7A 3EW9A 3B1ZA 1G20E 2CE2X 4NL4H 2F9LA 3AF4A 4AK9A 2P5TB 2CL7X 1JALA 4DBLC 1GAJA 3B8HA 3NVAA 2Z4RA 3SOPA 3DM5A 3M6AA 1E1QA 2WV9A 3FTQA 4TQ9A 1PVOA 1Y63A 1RE0A 1SZPA 1DVRA 3EZ2A 1NKSA 5KSZA 2ZSBA 2FEMA 2X2FA 4TLEA 4D2IA 5EXPA 1TAGA 1KZ7B 2BHRA 4ZIRB 2FOLA 4LJAA 1V43A 4AI6A 2ZYVX 4DCNA 1Z22A 3K0EA 3LQRA 4GMDA 3K70B 2V8OA 1P61B 4HUTA 3C5HA 3GLGE 5CM9C 4URWR 1N0UA 4S2EA 4A8JA 2J0QA 3QI2A 3SBEA 2XNSA 3G0HA 2HUPA 2ZSEA 2JCSA 3T5GA 1OH7A 3PENA 4IVRA 4FW9A 2JIZA 3U7FB 4AYXA 3OAAD 5IRCD 1VCNA 2WBLC 4PZYA 4DB4A 1BYIA 3K0CC 3D8BA 4FWIB 5F2EA 3ASYA 2WWGA 4QBHA 4Q4JA 3TBKA 4E09A 3K09C 3PQCA 3KKOA 1NBME 1M1YE 2IX3A 1KMHB 2RH5A 1OLOA 1IN8A 3W5JA 2JEOA 5JJKA 5AUQA 3BORA 3K70D 2OE2A 1S0UA 4AY2A 1T4GA 3I72A 3FB4A 2YC4C 1GG2A 5HPYB 4ZV4A 2GEDA 2WKRA 2VQSA 1SXJC 4KHZA 5FTLA 2HYIC 3B78A 4UNRA 2WOOA 4FD2A 1LTQA 3H2YA 4M9ZA 5HCIA 5JECA 4OL0A 2W0MA 1JEDA 1US8A 3KFVA 1C4OA 3MRSA 2GK6A 3K9NA 4D0LB 3PUWA 1LFDB 3VNVA 2FZLA 3OZXA 5JI2E 3P32A 1ZRHA 1JR3D 4NE2A 5H68A 4BLQA 4ILEA 4EKDA 5B58C 1SKYB 1V5WA 1KO5A 5KHOC 5JS8A 3EIHA 2BC9A 1IN6A 5CITA 2BCJQ 4FMDF 1N25A 1IY2A 2CHGA 2FWRA 3C16C 2WAXA 3LLMA 3U3OA 5JI3E 3A1SA 3IIMA 2PH1A 3EX7C 1ZINA 3SJZA 5JRZA 2OHFA 2W6IA 1C1YA 4O2RA 5CIQA 2ERYA 5DSZA 4OHYA 1CULC 2IYWA 4TLAA 2MMCA 1SHKA 1SVWA 3THYB 2YV5A 4PTLA 1XTIA 2FSIA 4TT3A 3FKQA 4GI7A 5DNYB 2ZR7A 1Q22A 4DVGA 3EC1A 4Q7KA 2FGJA 2WWFA 5D3MA 2C95A 2QPOA 3CNOA 4DCTA 4HLUC 1OSNA 2ZJZA 4DDTA 3Q9LA 4QM7A 2BKEA 2NTYC 2RCNA 1K8RA 1GUAA 1G7CA 5HTKA 3RANA 1WE2A 2ZREA 4A36A 4KI0A 2Y8EA 2VLIA 1R5OA 4ZI3A 3UXMA 1G16A 1TQ4A 4LRWA 4RFSA 4GRAA 2E1RA 1SVSA 1T9HA 2BJVA 1JPNA 1CS4C 1UBCA 3QVVA 5DI9A 1FQJA 1E9CA 2OCAA 3AV0B 2V1XA 5AJZA 5SZHB 1T3SA 4OKSA 3NDBB 3VNUA 1A82A 4IEEA 2WAYA 3E1SA 2FU5C 3SJCA 1IN7A 4MYTA 3DKPA 4AG5A 1AM4D 3BD9A 3L43A 1BOFA 2IEZA 2EFEB 4C3ZA 2P5SA 2B8WA 2OG2A 4YQFA 4G3XA 3SZRA 4GZLA 3FFAA 4DDUA 2IYXA 4AURA 1NY6A 2A5FA 1F2UA 2ODBA 1Z0AA 4I99A 4NCNA 2ZYUX 4UXJA 1JB1A 4LYJA 1YZUA 3U3MA 2NPFA 4D80A 4F38A 1E4YA 1R0XA 2IWRA 2R62A 3TH5A 2QTVB 1DAHA 3EXAA 1AA9A 2W0SA 2YNMA 3U60B 5FOWA 2AR7A 1H65A 1KTVA 3KL4A 4C2UA 2O5VA 4IEIA 3VR6A 2FZ4A 3O8RA 4JKYA 2MSEB 4KITB 4LUCA 2QAGC 3GEIA 5KSPA 1KI6B 4JBXA 4B2PA 4UNSA 3ADCA 1VYTA 1YZTA 4TLCA 2IYZA 2GJSA 4KFSA 2A2ZA 4IOJA 1W7AA 2ZJ2A 3A36A 2RGNC 1M7BA 1OXVA 2VHQA 1QHHA 2QENA 2XXAA 5K8LA 2XJ4A 2IYYA 1QG4A 2A5JA 4KV9A 5JCPA 1Z0IA 3C7KA 3KQUA 4FCWA 4JKIA 3VR3A 1GRRA 3CRMA 1ZIPA 4G5OA 1GIAA 1DAMA 2X2EA 1FOEB 4GP7A 1YR9A 4Q19A 3ZVLA 1IAQA 4KFUA 4PAQA 4TL6A 2GA8A 2L0XA 4DSOA 4M1OA 4NYJQ 1FFHA 1JR3E 1W36C 1P60A 3H0KA 2J41A 4NMMA 1GFIA 3AB3A 3V4FA 4QHSA 2IWHA 1TEVA 5FBVB 4XH9B 2IW3A 4ZO4A 4JT4A 2IA5A 1OFUX 3U7EB 3S1AB 3LAWA 1QDEA 3IQWA 3MMPA 4LV6A 4X8OA 5L3QA 1IJFA 2DY1A 1OH5A 2F6RA 2IS2A 2WJYA 1W2HA 1KZGB 2CCJA 2FSHA 4C7OA 1OYYA 2E87A 4NYIQ 4Z8YA 1YQTA 3FMIA 4TQAA 2GDJA 3EWAA 4EUNA 1FMJA 2VPPA 2ZEJA 2YZ2A 5E95A 4MKHA 3MD0A 2YC2C 1WBBA 1RPZA 3PEWA 5HKKD 3TJZA 3UK6A 2ZI6A 4NCIA 4BQSA 2BEKA 1N6HA 1SKYE 2ORWA 1DTSA 1R8SA 2WJIA 4B3XA 3EA5A 4ZKEA 3LNCA 5DH9A 3GLIE 3A58B 4LY6A 2ZSDA 1RYHA 4DLRA 2KBFA 1IXSB 3HYRA 2AL7A 1MO3A 2GZHA 4I1VA 4II7A 4XTCS 1S3GA 2G9NA 3QVUA 2J59A 1MO5A 4Z51A 4LJ9A 4B3GA 2VF7A 2X77A 3C41J 5LBIA 4KLNA 3GLFA 1LY1A 1WMSA 5DISB 1DE0A 1E9DA 1HE8B 2YINC 2ECKA 1IN4A 2DBYA 3EC2A 2VL7A 4PC6A 2ZUBA 2IF0A 2FEOA 2J7PD 1YE8A 3CRRA 1NI3A 2F7SA 4QRHA 1P3JA 5EP3A 3SE0A 1W0JA 1Z6YA 4ZIRA 4TYYA 1KO8A 4YMWA 5C1BA 1E99A 3WMEA 3LLUA 5D3QA 4TN1A 3AUXA 4GT1A 2OESA 1E2JA 4EQ6A 3TRFA 5DYIA 2IT1A 3X2SA 4IFEA 4UXIA 2O8DA 3MFYA 3BBPA 3UWKA 5DE3A 4BEJA 2GAOA 2GXQA 1VDZA 1XXHB 2FH5B 4RD0A 4F4JA 3VR4A 3TGPA 1D8TA 3T61A 3ZZUA 3RS5A 5CJPA 5C18A 1D5CA 1D2EA 2UZ3A 2P6UA 4KU4A 5EE0A 3SJAA 3QEOA 4EFNA 4RCZA 5CIWA 4R7ZA 2OFOA 1DADA 1KY2A 1NSTA 5IK2A 4QL3A 3WP1B 3IILA 3K8YA 3CPJB 1U0LA 3PUXA 3TSWA 4PQYA 2FNAA 2QEQA 2BDTA 5HCNA 3SQWA 2OBMA 1N3BA 3BIFA 2CVHA 1FUUA 1GL9B 4NPHA 4UNNA 4YXWA 3RWMB 3SFZA 4WAUA 3V00A 2IYTA 4TMVA 3W3ZB 5EXTA 4AKHA 5FBLB 1UDXA 4CEIA 4NBSA 4BLSA 1ONBA 2J3EA 3I5XA 1N5IA 5A0FA 2ZS9A 2RGAA 4C0BA 4BZPA 1U81A 3IBGA 3EZFA 1DAKA 2W6JA 2CNWD 2QY9A 1KMQA 3VHLB 2O8BB 2WHXA 3RDPA 1N0WA 1FPMA 3M0EA 2JA1A 4WA7A 2J5XA 2WJGA 3T12A 4URVR 3DOEA 2QPAA 3ADBA 3DOFA 2VA8A 4NH0A 2Z0MA 5B2ZA 2WWHA 2BMJA 3MJHA 1AKEA 1PJRA 2ZR9A 3N2EA 2LCFA 4A0FA 4B74A 4QXAA 3B7GA 1JXOA 1GWNA 1QHSA 4LHYA 5JCZA 2FX3A 2YWEA 4HEJA 1E6CA 4Q1FA
chains in the Genus database with same CATH superfamily
1XRPA 4N7MA 4CLOA 1YL5A 1DKMA 2GCIA 1BCSA 1NLFA 3RRFA 4XCVA 3VR6H 5DTQA 4BQIA 5I9IA 2JKZA 1JE0A 1N2CE 1K2WA 2GLTA 2EEZA 1ZWKA 3HEAA 1VKZA 3PQDA 1ZYUA 5ICMA 4WDQA 1JEYB 4YI5A 3L7MA 3R09A 2C00A 1ZNXA 3A0RB 3UK7A 3BCHA 4ZCSA 5LPNA 1GILA 1P74A 1XMJA 4RD1A 1E2EA 4UHJA 4X44A 5E9AA 1NUHA 5KO2A 3TKYA 3M4YA 4I1SA 5HGXA 4KIJA 4I4IA 3RRZA 1YS9A 1JB9A 1N0IA 1Y3FE 4L4SA 1M76A 3DF9A 4JIMA 1JHMA 3ZGXA 2Y4NA 4DIOA 5AESA 2V7WA 4ZO8A 5C46F 1IVNA 2A0UA 2QG9A 5AM1A 3AY7A 2E9SA 1C1XA 3A70A 2IY9A 4YJFA 5DULA 2HFKA 1SURA 2C59A 3OT5A 4BWGA 4M76B 1RBZA 1Z68A 4DLKA 4AZ3A 2BE9A 4XGRA 1W36B 4J7CA 3D1JA 5D3ZA 5ESDA 3L6BA 5B1IA 5GZ6A 3I2HA 4BWYA 3BK7A 3W1VA 1A88A 4XQ0A 4QUEA 3VUEA 1IHUA 1IDN1 1OH6A 1SG0A 4YJ3F 3BE4A 5DYGA 4BEBA 3JALA 5J4VA 2AGVA 4H7HA 3ILXA 2WHYA 4D5EA 1VJRA 4RTRA 4U2DA 4WEQA 3FYHA 5IBRA 4CM8A 3UJPA 4E7OA 1ZNZA 2I7TA 3N8GA 1HRDA 4CKYA 4JD5A 2PUAA 1UK6A 5J5VA 5ERXA 4NDZA 5KAPA 5E9JA 1Y9AA 4F11A 5KX5B 2GBLA 4JYPA 3UMYA 3IIJA 4ZOCA 3NM5A 5T6BA 3JQ8A 1TADA 3GJXC 4C6TB 4AJOA 4BE7B 1JDBB 3F5QA 1A2KC 5SZJA 4DSAA 2D0OB 2WTEA 2HA6A 3BJRA 2AT1A 4J91A 2A5GA 2O7NA 1EFAA 1IEVA 1KMNA 4G5RA 1TD9A 2XSZA 4Z4FA 1W36D 2G76A 4X0EA 1JH8A 4TKUB 5BV2P 1SA0B 3C3YA 2XAAA 4F4DA 3ZE6A 1SGWA 5IM5A 4QQKA 3M4ZA 1UF9A 1GQSA 1DBQA 3ETEA 4LJ5A 2ZRJA 3KK0A 1OB2A 1YHNA 2WF7A 1TF5A 1E0SA 3STXA 3TW8B 4DMFA 2RGCA 4CKWA 3DWFA 3UAVA 1GFWA 4Y2UA 2PZJA 4D43A 3FOAA 4IHJF 1Q0RA 2WZCA 3VC2A 2IU4A 1R0BA 1VJDA 4E6EA 4FN4A 2GD2A 5GONF 3T5DA 2AWOA 4LXQA 2B92A 1FU7A 2JGLA 1FXUA 3ADOA 2VHJA 3BXOA 5G0TA 3VH2A 1L1RA 3BHIA 1S02A 1XJ5A 3AUSA 3DA8A 3GCXA 4I1OA 4OJQA 4F8EA 4ZAVA 2VJQA 1ZMTA 2ZWIA 3STYA 5J4HA 3K20A 5ITVA 3D3KA 1GTL1 3OTIA 4UJ5A 1XFDA 1P9RA 5DVZA 5KB3A 1WAMA 2V54A 3CZQA 1F9AA 1XZ8A 1I1QB 3QMMA 1MT3A 4UU8A 2VCHA 1VMAA 5D85A 2J9GA 1PJ2A 2OZKA 1DIOB 1TNDA 4FZ3A 1DV2A 5EZYF 3PA8A 1PKEA 1L6IA 1IBSA 1LSSA 3K1TA 2CLMB 3QE3A 2DEUA 1K97A 2HV9A 3O4RA 4J0CA 1G38A 1TTTA 1HNNA 2PL3A 3LC7O 4ZD6A 3E5RA 1FF9A 1U8EA 2VH1A 4FQ5A 5TJHA 3F8WA 2QUBA 4B4KA 1Z0ZA 2ZQ5A 3CN7A 3FDIA 4KRGA 1VPVA 2J9XB 4L9WA 2JC3A 2HRZA 2PX8A 4KH1A 3CE9A 4KVZA 3ICCA 2PUBA 3DEHA 2VNJA 3A1VA 2FPLA 2BFDB 3C0KA 4DLUA 5T4EA 5F73A 4CLRB 3KIPA 2KQUA 4JLDA 1E66A 1QX3A 1H1LB 2P2NA 3AL2A 4J4BA 4L02A 4MP6A 5E4JA 3G5MA 1UANA 3ZX5A 2HTFA 3GNSA 1FX0B 3I01M 5JV5A 5AVSA 4ZO9A 2WICA 1W6RA 1WP9A 2OQIA 2P9QA 3AI2A 3KJGA 3MTIA 1H1DA 1WW2A 3LC2O 5FI0B 5IVDA 3X1YA 4KI7A 4Q03A 4ZVPA 5ICGA 5SYMA 5GJBA 1KOFA 4YP1A 1SXJA 3F0TA 4Y30A 3HCAA 4FHEA 4K9KA 4RTOA 1PJZA 3NM6B 5JBQA 1UPXA 3PK0A 3CJQA 5EJ9A 5K8VA 3RK1A 4LJ8A 5FEMA 1NW7A 1MAHA 4D8TA 3HVIA 4V0RA 3TSYA 3ANLA 2FZKA 2VNKA 5DYWA 1I24A 1B8PA 3BRWD 3U9TA 4NIMA 4HPXB 3W5IA 4OQMA 1DQPA 4FYWA 6REQB 4O4LA 4GC9A 3P1JA 1DMSA 1HFEL 1EM8B 1GVHA 1NXVA 1OFUA 3H1EA 3IURA 4LDQA 3WP0A 1YI8A 1G6HA 2VUTA 4AZ0A 2PL9A 3D6NB 1MMFB 2L18A 3FVQA 3IUBA 4NX2A 2QVXX 4TTQA 4UNQA 4OI4A 3HMQA 1XFAA 2RG7A 3VU3A 1CEEA 2G9VA 5MFZA 5LKRA 2FP3A 4MLDA 2AE1A 2HJWA 2WP0A 3WQBA 2DPXA 3FG9A 3RYCB 4O1HA 4L73A 1QFSA 4P4LA 1NG9A 2FWBA 4QUIA 1C29B 1DLJA 2F9MA 4M4SA 1LB1B 2OHHA 3FE2A 4HFNA 4JX9A 1NVTA 1PEDA 4X8MA 4V1CI 3BJMA 1I7QB 1O4VA 5KYTA 5EHZA 3K8ZA 3U5ZB 5A0TA 5D5HA 4EUHA 5GQSA 4DV3B 3MMZA 2ZSUA 2WB2A 1SIOA 1E0AA 1GAQA 2EERA 3REFA 4A6PA 2PBRA 3L2OB 2L69A 4HNVA 1VPLA 3FSJX 3IOMA 1QX4A 4R8LA 1AZWA 2VH5R 2Q21A 3F74A 1X7GA 2NV6A 4PU0A 3HU2A 1BDHA 1KKLA 3QFSA 3S1SA 3N07A 4FGJA 4FSDA 2XUFA 4QBTA 4WKGA 3JU3A 3IFSA 2EV9A 1ZOLA 3C3XA 4XD7A 4X61A 5A3VA 1QVAA 3P5BA 3QE4A 1KEWA 4IRUB 1P7VA 1LC0A 3IKLA 3K31A 4ZGBA 3D8NA 1C3VA 4RBNA 3QPBA 3GBSA 1MU0A 2WZQA 4L85A 4ZYTA 5B2FA 1YI0A 3QE0A 1NQTA 2I65A 3FKSD 1RFLA 1C4KA 1AU9A 1KJNA 2W83A 4B81A 4EJSC 1TQ8A 1YDGA 5CGQB 1PJCA 1GYRA 5G4KB 4CT4B 2OVFA 1O54A 2NYAA 1ILEA 4HF7A 4F4IA 4FLEA 1TOAA 5E3IA 3MWKA 3OUZA 4RULA 4CZ2A 3UK0A 1L7DA 5CFMA 1NUSA 3GLSA 2VDUE 4B33A 1V11A 1R6BX 3BFVA 3K9QO 3GQVA 4C2TA 2J0UA 2Z98A 1N7HA 1XVTA 2TYSB 2VP4A 3D4NA 4WOKA 4FDVA 1RI1A 1I7PA 3GQBA 4M9XA 5JNWA 3V3TA 1HDEA 3FJ1A 2F43B 3OEWA 2QU8A 5H70A 2CBZA 2BSQA 3BF7A 2GEUA 4XGIA 2AC2A 2J6IA 4YGYA 1ZN2A 4DMGA 4BMNA 3EZ7A 3BIJA 4K6FA 1L8XA 1P1RA 2P7HA 4BFZA 5ECGC 4OK6A 3SVTA 3AHFA 2Y6VA 4CDNA 3HLYA 1VYVA 4YTEA 2FSVA 1TMYA 1CYEA 1GNTA 1NQWA 1CU1A 4Q66C 4XASA 1F60A 5L45A 1IOZA 3QG1A 1DIHA 5AWFC 4DIUA 3N0WA 4P7FA 4IHQA 4OJNA 1YCHA 5AJVB 3UJCA 2E2WA 4X1OA 3P2YA 4B4WA 1T9ZA 4PZLA 5HZGA 3KQOA 1NQXA 1R4ZA 2PU7A 1U2RA 2JCYA 3QEJA 4MV8A 1XD2B 4OUDA 3KSDO 3QFHA 4XZ3A 3GX1A 5EIBC 1AKWA 2AVNA 1F2TA 1UBFA 4C0AC 5ICEA 3FFTA 1PLJA 2GX6A 2JJ1D 3FWZA 4KOAA 3VR0A 1PJBA 4RVGA 4E5YA 1JVBA 5CPFA 5JFOA 2FK8A 3E82A 3J81k 1LBQA 4PYNA 1A8QA 1O6ZA 2P2ZA 2RJ3A 2HHAA 2LVBA 4UDXX 1LSJA 1RRKA 1ZQ1A 4L8GA 1M0EA 3AEKA 3DV0B 5FLKA 1GKUB 2IXAA 3OZEA 1U4NA 4GX2A 2RHWA 4IJQA 1L4LA 4LMRA 4Y2JA 4UQPA 4N0MA 2OBYA 2B7BA 2ECOA 1TTPB 2WMOB 4ND4A 4HAZA 3QU4A 1OBVA 3EWIA 3RR2A 3UUFA 3UMGA 2GPYA 3W8NA 5JDIC 4RLQA 3UJNA 1E2IA 3L0DA 1C9NA 2CMDA 4PRKA 1VYUA 4ZYVA 4B48A 1UFOA 5HSGA 1A5ZA 3QKIA 4WASA 4CF3A 3DPSA 1J00A 2YWBA 1IEXA 2VP5A 3TAXA 5JO0A 1TUIA 5KJ1A 4AF8A 1ZGCA 4QDOA 1KSGA 2J1LA 4Q5IA 4P35A 1P6QA 1GA1A 1XLTC 1YUNA 2GZ1A 3L0BA 5GZ1A 1MJFA 4P5EA 2JFQA 2W8ZA 1KGDA 3PYMA 3WI7A 2ZB4A 4K6HA 3P71T 2YWFA 3WL8A 4ZHQF 4B34A 5KKNB 2D5BA 4IJ6A 4YAOA 3EAQA 3ZI7A 5CX4A 1ANKA 5TIIA 4B46A 2C4KA 4MGHA 3KT3A 3V97A 2HIAA 1Z9BA 5DBFA 1A95A 2AG8A 1XBTA 4UZSA 1Y1SA 1X77A 1XRMA 2BIFA 3QTBA 3ZUGA 2BSXA 2QZ9A 1EGMB 5DJ5A 1TAHA 5BXYA 3ILSA 4JNKA 4E46A 4YDHB 4RORA 3GEPA 1J8DA 4IHAA 4PLCA 3T3IA 1BXRB 2VOJA 1YE5A 1Z5GA 4UPDA 3IE1A 4KRFA 3HU1A 3LY7A 4EW1A 2QQ0A 2ZB8A 4MLCA 4NZMA 3RIXA 1AZTA 3Q7SA 4PX5A 4S0XA 3A9UA 1ISGA 1Z6XA 2P9CA 5BMOA 2WSSA 1OU0A 3ONFA 3TPCA 3EDMA 1O0CA 5HDQA 4RF5A 4M0CA 1FDVA 2NXEA 2RAUA 4IDDA 4KYIB 4Y6RA 4RKEA 3AOGA 1EEHA 3GT0A 2G7MC 5CDFE 1ICIA 5DK4A 4ES6A 1ZW6A 3H8WA 4EZBA 1WDWB 5JROA 1DT3A 1G20A 621PA 3SCZA 2WHPB 1Z17A 2HA5A 3QWAA 4YI3A 2JGRA 4DG5A 1JDNA 3KQYA 1QMGA 3PWZA 3ZXUB 4HVLA 5JWRA 1XDUA 3CWCA 4MRVA 2YZMA 1CUWA 1J56A 3VU9A 3DCNA 2JCXA 1Y5MA 2ZOSA 2AX3A 4FMCF 1LBHA 1SRQA 3OA0A 2FJPA 2UZ1B 3CINA 2G80A 4R4JA 5IDVA 5B6IA 5AVTA 3WRWA 1MJ5A 2JLBA 2OBLA 5HJ2A 3MBOA 1AMUA 1BD3A 2BSAA 3M1YA 3JD4A 3K94A 4YUWA 2GHRA 4EW2A 5B2EA 2Z9CA 4NYMR 4OHXA 1QNFA 1G60A 4DIKA 2FXVA 2EXXA 3DL4A 2FSFA 3VAAA 1NMZA 1RRCA 1NUTA 3IJRA 4ZI5A 1Q1ZA 3OFSA 4JHLA 2XXBA 3F78A 2ZGVA 1TPZA 4C0HA 5BMVB 1JG3A 1RQXA 2BBSA 2ZT5A 4QNNA 1K6MA 3IAFA 1KI9A 1QLHA 2R1VA 2Q3FA 3A27A 1BJTA 3F1LA 3OURA 4O0MA 4TLDA 5G0VA 5IPFA 1BKDR 7REQA 4WZ6A 5IJWA 3GGOA 5JISA 3PUZA 3BRWA 1KJZA 3VSAA 4DYDA 5DGXA 3N8IA 4FIZA 4CDGA 3DMTA 4H6VA 5KVCA 1JG7A 3K3PA 3I2JA 2BFDA 3BTUA 5AFSA 4IXNA 4DPMA 1VSQA 4CLRA 4AUNA 2F8MA 3F5MA 3PHHA 1M1YA 1K88A 3FFWA 3DTNA 5FTMA 1KZ4A 1JIKA 2C5BA 4QYTA 1KQOA 3OE7A 5EIEA 1TUBA 4TL8A 4ARBA 1X7HA 3TTSA 4PFJA 2Q5OA 3BX1A 3PD0A 4MR8A 1ML3A 4I9GA 4YONB 3SKXA 4EKIA 5K4GA 2E5LB 4B3SB 1QHYA 4B73A 3H2KA 1D3AA 3E5MA 1GTSA 1ZD5A 1XZMA 3FMPB 1EAMA 1QS0A 1W9MA 3H9BA 3OY7A 4HMOA 4LYYA 3EGOA 4UEOA 2H7CA 2ZWOA 3HJCA 3G2PA 3ZNQA 1Y6JA 3B48A 4TLBA 3X3HA 2YV3A 3WWZA 4KACA 1C7ZA 1T4DA 2F90A 1B16A 1T8WA 3QXXA 3TIGA 4A0HA 2CV0A 3UATA 4DIBA 1EUDB 1TJ4A 3P94A 3FOZA 3WGQA 2OXRA 3AZOA 3JW8A 4WJLA 2H9YA 1P75A 3F3SA 3N3BC 2VBIA 3G2OA 1RHUA 4K0RA 1KFBB 1CG6A 3MCAA 1CUUA 1R50A 1SBCA 4Q4AA 5ES4B 4JXJA 3GLFE 1JHDA 1Z56C 4EP1A 5KYUB 3CG0A 1U7UA 5BY2A 3AKDA 2UV8A 5EIXA 1SR8A 2CLCX 2DLNA 1LPNA 3D0KA 2Q3JA 3DDHA 1PL0A 3O38A 5KDLA 3SDSA 3VDNB 3ZXYA 1TF7A 3ROXA 3OCUA 1H5NA 3CZCA 4JP2A 4U4AA 3KVOA 4XA8A 4YDSA 1AQ6A 1GNPA 1MEOA 3NVDA 1HOTA 3LECA 3PEVA 4JC8A 2H00A 2OYRA 3NAZA 2ZFUA 3AW9A 4I4TB 4W5JA 3IP7A 5KNCD 2CCKA 3C8MA 3H3FA 1GT6A 1KI4A 1NGSA 2HAEA 3O9ZA 5J2UB 3OJXA 3ITEA 2OENG 2HK6A 1HKHA 4NJEB 2ZT7A 4B3IA 2HHLA 4PSUA 1JFFB 3HCDA 5AM3A 3AX6A 4HDOB 2X58A 1R0WA 2D8AA 3ZE1B 5JAOA 3TI7A 3W8DA 3EVNA 3K2BA 5FPQA 2QLJA 1F7UA 5B3JC 2JIDA 2EKQA 5JXHA 3QUAA 3I42A 2P9TA 4MKGA 3U3KA 4CLHA 1JBKA 3DS8A 3WZMA 3NJRA 4WJZA 3FOCA 2QTCA 2L82A 3QVGA 3DFZA 2H52A 2VAVA 1F12A 4ID9A 3HL4A 2NP7A 1JDBC 2IEYA 1DRJA 3UUEA 1Z2AA 1PYGA 3O8QB 3QGMA 2I3DA 2OB2A 2X7HA 1J8FA 3ZCTA 3FTFA 2YQ4A 2LCIA 1JH9A 2C2BA 1U98A 5L51A 3LUAA 3KKPA 4LXYA 4QYMA 2Q0QA 1AZSC 2IP2A 4IVQA 4UCFA 1IEWA 3K0AB 1PIWA 1D6SA 3F8SA 4UU1A 2VUUA 4OV6B 3E9ZA 4BNYA 4KSCA 2BWJA 1F5NA 1OXXK 4BP8A 1I14A 1L5QA 1XQ1A 3NQ41 2D74A 4LC9A 4R71A 4M0PA 3OM9A 1N2JA 2PUDA 1E9AA 2I2DA 4RHUA 1TM2A 4L6AA 3CY6A 1RJDA 3CH6A 2RKOA 1IY0A 2FZVA 1LI5A 2P2CA 4MGKR 2ROQA 1GJRA 1A3CA 1HM5A 2OLKA 4OM8A 1PBNA 4YGXB 4CYMA 3OAAA 2WYHA 5F12A 2VPIA 4O4IF 3QSGA 2EIHA 4YX9A 3D2LA 3ZNOA 1E2UA 2UYGA 2VIIA 3ICVA 2NUPA 3ZJ4A 1HT1E 1TZCA 3QKSB 1OXSC 4JT9A 3IUNA 1PQ4A 4E1BA 1MLDA 3UJAA 4QXPA 2ZRIA 4BQQA 2Z9DA 1M6HA 3QK7A 1M6VA 3U39A 1O89A 2HJSA 3AIMA 1XD2A 2KW5A 1I0IA 2A35A 1WUKS 2V55B 4RUKA 1HOXA 2G17A 3UFXB 5EIOA 1U94A 4E13A 5CB0A 3K1YA 1QF9A 2QE7D 1W1IA 2SKEA 3FVVA 3NJ4A 4I4LA 4JLAA 1Y1LA 2V7XA 3EUFA 1TMOA 4YQEA 2YJTD 3Q88A 3ZQKA 4BFTA 3OOSA 3UB3A 2P1RA 5CVTA 5LU9A 1NMEA 3SLKA 4ZYXA 2A9KA 3EPRA 1X7DA 4TXJA 2OCIA 3DC7A 4XWKA 2VP9A 4FS3A 4WXEA 5DOZA 3ICPA 4UTXA 4ITRC 3A1TA 2EYUA 3DZ8A 4ROTA 4Z7NB 5ADUS 2A0KA 3E61A 3UXEA 3ASVA 1IK4A 4J7XA 2I2BA 4Q3DA 4J9VA 3EVAA 1L1EA 4YJ2B 4A03A 1C30B 5I7WA 1I10A 5ULLA 5IDYA 1YR2A 4DLWA 4I66A 3DUWA 1G2OA 2P6RA 1J22A 3R2JA 2WF9A 3AUAA 4BNVA 4NY1A 5FL7D 3EAGA 4OPMA 3O3MB 5JCJA 4FNGA 4MVJA 2AXPA 3BPSA 1P19A 3KWFA 4B7XA 1IXKA 4LYFA 2HCJB 3QOFA 3L7OA 3AHHA 2V5VA 1M5UA 5B1SA 1U5AA 3SF8B 5AW0A 4B6PA 2B4QA 2JJQA 1IZ7A 3DJFA 3EVBA 2ZBRA 1TKRA 2IK8A 3H4VA 3KL2A 4OJMX 1QONA 1KEZA 4AN1A 2WUWE 2ZYDA 1BXRA 5AK3A 2JHCA 3LUHA 2VJBA 3ROMA 3P9PA 3BG5A 2ZROA 3FPAA 3NIGB 4JLMA 4S12A 3A6DA 4NNPA 4XSGA 3V42A 1IM5A 3ZY4A 1P91A 1NZJA 2IEIA 1UKYA 4QODA 2Z8XA 2GHIA 2IYVA 2C2XA 4Z4GA 4MP8A 4TLMB 3MERA 1G3MA 1QPZA 1FU4A 4R2XA 1V47A 4YDRA 4NECA 4UEKA 4AY3A 2WE7A 5EXSA 5EJIA 5CLHA 2KI5A 2YMPA 1II8B 1GKYA 3LXRA 1R8YA 4LECA 3IRUA 1BAPA 2BFEB 4XR9A 1O95C 3B1KA 4HAVA 3OE5A 5JG7A 3Q5GA 4XQGA 4AJKA 1ISHA 1E2GA 3JASB 4CRWB 1F3LA 3LYHA 4COOA 1V4VA 4JR2A 3H2HA 3THYA 1KU0A 1SO8A 3NHRA 2ATXA 3B3JA 4BUJA 1EQAA 3EPPA 3GPLA 2E4WA 1CY7A 1S3FA 1FBTA 1OV4A 5ESRA 1E1RD 1YJ5A 4QVGA 3DLBA 2NO0A 1LLUA 2MR5A 1NNUA 1M2WA 1MH1A 2PJZA 1LPAB 2JDID 2ZB3A 2VT3A 4MRPA 2CBGA 2OT3B 1ZR2A 2RGXA 1G2PA 2G1AA 1Z5UA 2R25B 2FW0A 3L9WA 4OM7A 1ZAYA 2JFGA 1MUUA 4GBJA 3RG8A 1UODA 2ACKA 3ZS8A 4EFLA 1XYVA 3WLEA 2FI1A 1E3DA 2C3MA 1SBHA 2W6PA 3FF1A 3NV9A 1Z5PA 2AI2A 2CWDA 3KVRA 3BE5A 4MWGA 4NOMA 3RU7A 3UW3A 2YS7A 4B6SA 4AF6A 4ALLA 1Z16A 1TO1E 3QUSA 1BDBA 3RQSA 1JG4A 1RYYA 1UFQA 3AH8A 4I1UA 2NU8B 3G8BA 2VBCA 3GUUA 4E15A 3QWFA 2PWZA 4AJNA 2OV2A 1VG8A 3QHAA 1ZBDA 1JDZA 1FFXB 2JGMA 4KN8A 3L6OO 2PZFA 4OQFA 3AHDA 3TDNA 3UWDA 5AVRA 3P4YA 4D8YA 4HNUA 1NIPA 3VSBA 1W4LA 1XWIA 4NXNB 2Q41A 3ZE7A 3UY4A 4UATA 3OIWA 5JUWA 4J49A 4TMTA 3X2FA 4EO7A 5AQ1A 1BRMA 3IAM1 3T3PB 4PPGA 2BT4A 2Z30A 5HBRA 2W6QA 3GROA 3KCNA 5B3AA 2XKAA 5A5GA 1MKYA 1MB2A 3TEMA 1VJ1A 3NH9A 4WBSA 5FR1A 2INGX 3KD3A 5IM4F 1GL7A 2JHAA 5D1HA 3ODGA 1UZUA 3FPFA 3M5DA 1XTSA 4N5HX 2Y93A 3HI4A 3Q7RA 2CMGA 4L2IB 2PSHA 4QARA 1IHOA 5KNCA 1LXCA 2GRJA 3LBAA 1LU9A 1TGVA 5JNTA 3WBJA 1RBMA 2OCBA 3CX6A 1X7YA 2NO5A 4QHYA 4BTVA 3AKZA 2B6HA 3PKIA 4M2LA 4V1CB 1VG0B 5FF9A 1UK9A 1ZNYA 5GJVC 1K4YA 1SM4A 3BQNB 4D4KA 2QRPA 1HYQA 4D7AA 1IY8A 2C3YA 4O25A 1IQ0A 4KXVA 4X66B 3GLQA 1KAQA 4UE3S 5K05A 2B4KA 3E6AA 3SEZA 2O05A 1PUJA 1X8JA 1QKIA 1ZJJA 4KKXB 1GA4A 4BP1A 1KEEA 4EHIA 5BYBA 1MAVA 1ORWA 4O8ZA 3F6PA 3D2CA 4MW7A 4REQB 2G5TA 4WXHA 4Z0PA 3UWOA 2CY0A 3GT3A 1JMVA 1ZM2A 4JVLA 2JBAA 3BB4A 4MKIA 4PFSA 3W2GA 4EHAA 4ZC1A 1TEZA 4KBFA 2R79A 2JFHA 4MYCA 2HMUA 2IDZA 4JOBA 1MX1A 3RUDA 2ORED 1UUFA 2I66A 3FBGA 4F60A 4J1NA 4WHMA 1PNRA 5E6SB 3DAGA 5AP9A 3H1PA 1U8XX 3NC0C 4UDNA 1JFFA 4GLFA 1QHXA 4FYVA 3T1VA 4JUBA 4L76A 1J2TA 1CQIB 1AK2A 1KO7A 2CGEA 4WWHA 2DT8A 3S1AA 5LDHA 1H2BA 3G79A 4L74A 3WB1A 1K3FA 2ENWA 4BNKA 1ATZA 1C1DB 1U7TA 4IRMA 4AJHA 2GS9A 4O4JA 1FDWA 4RMHA 1YI1A 5GAJA 3GJ0A 1WHTB 5ILQA 4MRAA 3C3PA 4JROA 1NV9A 1V3QE 2FPWA 4LGMA 3U1TA 2DQSA 1ECGA 1JKJB 3T7DA 2BJWA 1U28A 2B9VA 2QL7A 3WDSA 1AZLA 4CKCA 1XWWA 3K09A 3OHPA 2VWPA 1T9CA 3R20A 1YJXA 5BSGA 3S2EA 2ZBFA 6ABPA 1QHNA 3OI7A 2G82A 1W25A 4UHFA 2ATVA 3Q8KA 2XUAA 5I7AA 4X65B 1D5WA 1Y33E 2AMJA 5CVUA 4A16A 2CLOB 2ZJ3A 1Z3IX 4C22A 3TSCA 1SN7A 3T1TA 4RFSB 2MSDB 4GP6A 2V45A 4G0UA 4KX5A 2AFHB 1JAXA 3WHPA 3GRZA 3FGNA 2P2LA 1AHHA 2C4NA 1NVXQ 4M89A 3E22B 1VHWA 4A8HA 3MELA 4MKXA 4NK4A 3CURA 1G5FA 4RL6A 3PNBA 3BMCB 1MOZA 3KDPA 3WY9A 3RO7A 5EJAA 4D6PA 2FFJA 4WKBA 4DQUA 1CZKA 1WF3A 1YZLA 2O1EA 2EU8A 1WDKA 4EX6A 1CNFA 2P30A 3I30X 1LQ2A 4F2HA 1IZ8A 4Z5XA 3S8EA 4NICA 2Y1OA 4RENA 2WU4A 2MT9A 3NOOA 2BM0A 2C7QA 2J31A 5GV8A 1U9CA 1WVIA 1FS4A 1G3IA 2P3OA 2W2QA 4LJSA 3R9KA 1RYZA 4NYIR 4XX0B 5F9FA 4LHVA 2GCPA 8OHMA 2NO1A 4L5CA 2H2GA 4XJTA 2O2YA 3Q3GE 5FR2A 3CRW1 5NLLA 1X80B 5JBNA 1LWNA 3V34A 4IKEA 1DRUA 5K0BA 3L05A 1SC1A 4K9RA 4L9AA 3K32A 4B2IA 1N3YA 1UBJS 1XXHA 1N5KA 3HKDB 3KUDA 3FCYA 4BS9A 3SLGA 3AL0C 4ZTUB 1Q7TA 1Q50A 1WZNA 1U8TA 4OB6A 4BX0A 3PXUA 3EOAI 1GG5A 4HLUA 1KDOA 4NH4A 4LE2A 1E6UA 2JHFA 3BAZA 2RD2A 2XXAB 1NU8A 1DV1A 1QZ3A 3CF4A 3MS4A 3C2QA 5KYYA 4QBFA 4YJ2A 2C9MA 3OOYA 1U0BB 2QVYX 1L7QA 1Q14A 2QTRA 4C4TA 2DH5A 2MYPA 4EY5A 1NJGA 3ZGVA 3S8YA 1FTQA 2C7VA 2DOKA 2XDYA 2I6TA 1YDEA 3PPYA 3CLTD 1TYZA 3P2MA 4KO8A 1XVVA 5HHTA 3NC4A 1RLTA 4IMJB 3PJFA 3Q7QA 1IWOA 2CHUA 5FA6A 3C8DA 4B6QA 2R6ZA 2X7XA 1S3SA 3CT4A 3LQYA 4KGZA 2NXCA 4MS1B 4X45A 4BQPA 4TYNA 5BWMA 4FMBB 2H07A 2NMVA 1N7JA 1U0SY 4OQNA 4UUNA 5JFGA 4DEYA 3AEUA 5DXFA 5BYJA 3F6EX 3UXHA 1QU3A 2E4YA 5K3OA 1CR0A 3CZAA 5L3QB 2JVKA 1Y6RA 1WTCA 4PXYA 1AJEA 1CJSA 4PVCA 5HZHA 2PRZA 3SQLA 1RZVA 1G66A 1YBHA 3OQJA 4HQKA 1KYZA 4LS3A 3AOEC 3EIOA 2GKSA 3MF4A 3ZH9B 2OD9A 1LNZA 5CYOA 5EQFA 2JFVA 3V1MA 1G6OA 3AU9A 1GLVA 1E94E 1MQSA 4O59O 2VRNA 4FVTA 1Y7TA 4C07A 2C2GA 4KZPA 1CJMA 1YVPA 1DWPA 1AGNA 4MARA 4BBAA 3JAKB 1T3LA 1R00A 5IKOA 2CBXA 4BNZA 1N9GB 1ZZEA 2FLKA 4HT3B 4XAQA 4NEGA 2J08A 1TA4A 5JVDB 4CUKA 4LJ7A 3HBNA 1ADCA 4BATA 3T5BA 1B3BA 2XRMA 3G8DA 3HBLA 4NPAA 4QUDA 5LFAA 1U9IC 4EPTA 1NVAA 5NULA 3IVCA 1HX7A 1ZJZA 1WXQA 4M0KA 1E3MA 4GE3A 1V1RB 3EYAA 4IXDA 1IB0A 2O54A 1QZZA 3IHKA 1ORHA 4PGMA 2HSEA 4CM6A 3EXIB 3G23A 4OGGA 2YHUA 3DFMA 1UT5A 3DEIA 3ET5A 3FDJA 4AN4A 1NBWB 5LB4A 4ZMSA 1EPUA 1I4WA 1DIAA 5GGYA 5GM1A 1DUIA 3JWPA 4FFSA 2FRXA 1E3QA 1EFTA 2R2AA 2DETA 4ZZ1A 5C1OA 4KQEA 1TKAA 5CB4A 1Y9ZA 3MCTA 4LA4A 3ZN2A 2W42A 2X8AA 3QMVA 2ZITA 1XJ0A 2HMAA 2QUJA 3RKRA 3OLYA 1QOPB 5AK5A 2D7JA 3IJ5A 3U17A 5E1DA 4Q9LA 4BLTA 2UXBB 3MCVA 4PLVA 4ZT6A 2OQVA 3WLPA 1FCJA 3CLRD 1BOOA 1B6GA 4DLNA 3KAKA 1JLLA 1VI6A 4HEA6 4URUR 3SSAA 4B3TB 2B5WA 1T6XA 1KY3A 1X1BA 2QMHA 4HVAA 1Z25A 2J9ZB 4M1QA 4AX4A 3X1JA 4ZI7F 3JQEA 3L41A 4IDNA 3LBNA 2PHZA 2AFIA 1YVUA 1O5IA 3W7BA 4M36A 1AUOA 3V6LA 2J85A 4D3XA 5TE9A 1ZLYA 5AK4A 4MQFB 1VG9B 2QN8A 1KDVA 4CDRA 3ZEAA 5KSWB 4KPFC 1RU3A 2W2PA 3ROTA 4BFUA 4BNIA 4YV2A 2Z6AA 3H99A 1F38A 4P84A 1IJBA 3F9CA 3VNSA 1WKBA 3HR4A 4G26A 4HYTA 1YA4A 2DF8A 2CYAA 1M1NA 1RYNA 3BHJA 4N5NA 2XQIA 2VAWA 3HO6A 1OWNA 1M34B 2P4EA 5IXYA 2P90A 3SZGA 1HBJA 2QB5A 2EGGA 2VS1A 1T5OA 4HOYA 2NVOA 4IDQA 2A5LA 2YMQA 4V1CA 3B53X 1XQVA 1KK0A 3VKHA 2XF8A 4OUKX 2ATCA 3TX2A 2O7SA 1IQRA 2QRUA 3EN0A 3EW7A 3WDMA 5GIPE 1W581 3GJ3A 3OIFA 1HY3A 2HXYA 5JDCC 3RS2A 4PS0A 1YDHA 5E9WA 5EHGA 4HXFB 4A82A 4Z4IA 2QR5A 1NRXA 4PPQA 5E4FA 4ENRA 3P7MA 1AN0A 5M3BA 4NZNA 4BCBA 1XCMA 2Q0HA 1G8MA 4D26A 5JCXA 5HMMA 5HQ3B 3K0BA 4IIHA 2I7VA 5DX0A 5FJJA 3OD1A 1YMVA 4JP3A 1X3LA 5IK2D 3RS3A 4LSWA 3U9LA 3KSUA 1W36C 4I4CA 4WQMA 1KJYA 2PX2A 2OXIA 4DNPA 1A8SA 1GY8A 3M1LA 1M6EX 5CFNA 2D3WA 4TL9A 3RJTA 1LBSA 1IAVA 2C9BA 4H9GA 2J32A 1N9ZA 3N8KA 2Q9UA 1X8KA 1DDGA 1UBOS 3UCEA 3TFOA 4DLVA 1PTJC 2C3OA 4TM8A 4A27A 2Q62A 2ANBA 5E6UB 3ZH2A 2GD0A 3ZDAA 2F1JA 4UEJA 1D2MA 2JVJA 2EP5A 4WEOA 5CYGA 1ZFNA 2BBOA 1A7AA 1G5IA 1OX4B 4US2R 2BHSA 2BCEA 3ONVA 4IVPA 4LHWA 2R4QA 3R8CA 3ZWQA 4CM1A 1OI2A 2FVXA 1PTKA 2Z95A 1C50A 1HG0A 4I9NA 3TLGB 3HNPA 4L5AA 5D00A 4W5WA 3U19A 4IJUA 3KOUA 1QO0D 2PK3A 3OIVA 5AOAA 4BNTA 5K0ZA 3ZI4A 5ELXA 1P6XA 2OXEA 3D43A 3MUNA 1S7CA 3NEYA 4J2TA 3DYVA 3NBXX 3BEOA 1OTXA 1Y8ZA 3CNBA 1F0PA 2LZ0A 1B3RA 1M2JA 3AHGA 1J9ZA 3CRVA 2VZ8A 4AB1A 1QGUA 3MS7A 4WLFA 4X84A 5BVHB 2XMPA 3MJTA 3OHSX 1ODKA 2QVBA 2YVQA 2BFCB 3L82B 4KVAA 2IZZA 2HHCA 3MN1A 3NEPX 4JBLA 3DDUA 2QMUA 4YMVA 5L4SA 5LQJA 1I3KA 1TM1E 4PHFA 4NRDA 3VR5A 1RRFA 4WPGA 4WNAB 5I51A 2WINI 3N70A 3RROA 1WV0A 4GYJA 3UEOA 2BMVA 1U7WA 3MLBA 1Z5ZA 4EZIA 5K6AA 3IHLA 1KMMA 3EGIA 3OZGA 1N34B 3CLHA 2ZWMA 2HCFA 1IJKA 1O94D 1W5EA 3NBFA 4FT2A 2C2OA 5G02A 1VZ2A 3LF1A 5TPWB 2GF2A 1KVUA 3S7TA 3SBOA 5DW3A 3AZQA 1DTEA 3IBFA 2JAXA 3ZWDA 4WFKA 5J63A 1PDOA 4G86A 1EX7A 3G2IA 5LLDA 3W6UA 2AR9A 1SQSA 2WIBA 4GRIA 1IE3A 1CJTC 2FZ5A 4HDKB 3TX6A 3CCFA 3NIWA 2ICAA 1G9SA 1RZ3A 5FOTA 3ETLA 2YWJA 3UJ3X 3WZLA 3KZCA 3LXUX 4FYXA 1QUEA 1T9GS 4M21A 4NENA 5H3HA 4CCSA 4EFMA 3LTNC 4DT1A 4LRTB 3J7TA 2CC2A 3RU2A 1R0YA 2KLBA 2MINB 2J4FA 3O84A 4JLKA 1JIIA 1NYTA 1NUUA 4PZDA 3MWDB 2AJDA 1OKKA 2GJKA 4RPIA 3PHIA 1V71A 1Z4IA 4GL4A 1UAAA 3FETA 1YU6A 2WSBA 3OQHA 1UMDB 2FFAA 1EIZA 3JYHA 3PC7A 1UXIA 4QJBA 3OM8A 2C94A 1J24A 2GNAA 4KXFB 4XDGA 3B6JA 3HKDA 4MW1A 4QPDA 4QXQA 2BEVA 4DJDC 2ZZMA 1ODIA 2O20A 5TPZD 2NZYA 1WDTA 1YUMA 3EA0A 3HCEA 2CL6X 3NKLA 3ULKA 3UBMA 5KYXB 3CCBA 1XTVA 5CFRA 2PRYA 2D06A 2FCRA 2WFZA 2HXSA 4X7MA 2YRXA 5ABPA 4L4XA 2ZIZA 4RKFA 4NFLA 1P2UA 2QSZA 3T34A 1L5ZA 4P4TA 1KWKA 2O1XA 4NCHA 1C3OB 5IEBA 4L9RA 5ALZA 2HJRA 4Y6OA 1H8HA 1T9AA 1XZGA 4AJEA 3FTPA 4RY8A 4DJAA 2KE5A 3RCBA 4GHWA 1ESNA 4K2AA 4QBGB 1FSPA 2RHBA 3RASA 1IBCA 4QU9A 2HRDA 3DV9A 1GVNB 3GRAA 4HQOA 4R8RA 4ALJA 5KSYA 2V9PA 1V4NA 1AMOA 1OHHA 2SCUA 4FFOA 1RWQA 2LP4Y 5AI6A 3VTFA 3R9IA 2FWPA 4HPWA 4NEQA 4EH1A 1DWQA 5F2NA