3KB1A

Crystal structure of the nucleotide-binding protein af_226 in complex with adp from archaeoglobus fulgidus, northeast structural genomics consortium target gr157
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
255
structure length
243
Chain Sequence
RVTDEDIKERLDKIGFRIAVMSGKGGVGKSTVTALLAVHYAKQGKKVGILDADFLGPSIPHLFGLEKGKVAVSDEGLEPVLTQRLGIKVMSIQFLLLIAGMIREFLGRVAWGELDYLLIDLPPGTGDAPLTVMQDAKPNGAVIVSTPQELTAAVVEKAITMAEQTKTAVLGIVENMAYFECPNCGERTYLFGEGKASELARKYKIEFITEIPIDSDLLKLSDLGRVEEYEPDWFEFFPYLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target GR157
rcsb
molecule keywords Nucleotide-binding protein
source organism Archaeoglobus fulgidus
molecule tags Nucleotide binding protein
total genus 60
structure length 243
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10609 ParA NUBPL iron-transfer P-loop NTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kb1A01
2GJAA 4HLDA 2ZJ5A 3ZVRA 2GBLA 4D0LB 1R0XA 4M1TA 5H70A 1Z29A 5GJWC 2CL7X 1KJWA 2VEDA 3QKRB 4N1AA 1P62B 4C7OB 3KB1A 3HJNA 2HJGA 2I1VB 1ETUA 1E2NA 3FKSA 3LO5A 4LC0A 4LHXA 2IX3A 1G4UR 1F6BA 2JCSA 4BLOA 2PZFA 1NSTA 3GPLA 1RPZA 1WP9A 2FV8A 2PZGA 2FGJA 1M7BA 1YQTA 1NIJA 1SHKA 2V1UA 3W5JA 2OFWA 4KODA 2PJZA 5L3VA 1WF3A 4JLOA 4B44A 1GITA 1XZQA 3KKQA 4IDQA 4C0AC 3PCRB 1FW6A 4BRUA 2ZRMA 4NONA 3TE6A 2C98A 4DDWA 2WMNB 2GCNA 2HXYA 3K8YA 3RANA 2ZRBA 2ZVQX 3G5UA 3ADKA 2IYLD 1JAIA 3LBHA 1TEVA 5JSZA 5FTNA 2KB0A 1MO4A 1E0JA 1Z5ZA 3CNOA 4R9UC 4FMDF 3OEEA 4N0EA 1LW7A 2BBOA 2MSDB 3LVQE 1Q20A 4MRRA 1AN0A 1E79D 2LWIA 2QL6A 4B6FA 1FMJA 5JCZA 1X8KA 5SZHB 3K0CC 3IQXA 4OK5A 1XEXB 1M7GA 5P21A 3T1VA 4DIDA 5EP3A 3SJCA 5AK0A 3TH5A 2VSOA 2G83A 3BGWA 3W3AA 1XCMA 5FBVB 4B74A 3PIRA 2EWVA 2H5EA 1R5BA 3KKNA 5EE1A 2CLDX 1LY1A 3QENA 4M53A 4DLXA 4GZLA 2QY9A 1UBEA 4BWYA 2R2AA 5FBLB 4RKEA 3QPVA 3ADBA 4MYTA 1GKYA 2GCPA 4EQ6A 4CVNA 2ZRLA 3QUSA 1R6BX 2F9LA 4I4LA 4ARZB 1TF7A 4ZCMA 2XOKD 2RB4A 2XITA 1IXZA 2QBYA 4NHOA 1G8HA 2QN6A 4LYJA 3PUYA 3L82B 3QPUA 4JMPA 4KFRA 1D9XA 4DJTA 2G1JA 2JA1A 1KI6B 4PSAA 4BLQA 1DAHA 4M1YA 1E9RA 3ZD6A 1P60A 2H8KA 4IJMA 4KYUA 2QAGC 1P9RA 1G6HA 3QF4A 2DYKA 2J46A 4IOMA 4GFDA 4QGFA 5KYKA 3SQXA 1E2KA 1GL6A 4HB2A 4D4JA 5KTYA 2GHIA 5DNYB 2N42A 3NHAA 3M6AA 4YMVA 1JB1A 1TUEA 1NJGA 2FDCA 3SN6A 2BJVA 1XPUA 2AK3A 5KOYA 1Q22A 4EJSC 3Q7QA 2VHQA 4HUQB 4B76A 4EPXA 4EPWA 4OK6A 3WRXC 3HPRA 2IYQA 2NIPA 1E2QA 2QMHA 4OHVA 3BD9A 3MGCA 4RD3A 4TMTA 1CF4A 2C04A 3KJIA 3CPEA 1E1RD 3TVTA 2A5DA 3T1OA 4D2IA 2WSSA 1GRQA 5B58C 1QHHA 3AF3A 1KY2A 2WM9B 4PPFA 4TZ0A 1Z0KA 3U7HB 1A5TA 1OFUX 3EAQA 2AD1A 3X1WA 1TL7C 5DI3A 4CEJA 2KBFA 1DADA 1IY1A 2JJ1A 4BQSA 2O0JA 1T8TA 3FB4A 4RD4A 1KO7A 4BFTA 1KK1A 4FW9A 2YWEA 1SVOA 1J7KA 2D4HA 1II8B 3DOFA 3PUZA 1BKDR 3WP1B 5C1BA 3RRNA 5EXXA 2ZE5A 3SC3A 4PO8A 4JBYA 4BFXA 4A0HA 2NGRA 2OESA 4TT3A 4PO1A 2B7CA 1PVOA 1I4TD 3NBFA 3ZYCA 3D31A 3MD0A 5ELXA 4IW3B 1RW4A 1W5TA 4QJ4A 4EFLA 4TTPA 3GLGA 1JPNA 1DE0A 1KY3A 1TNDA 4B35A 1E0AA 4ZI2A 2P0EA 2PL3A 1JXOA 1CBUA 3ETLA 3NC0C 2QPOA 3BIFA 3I62A 2QORA 1E9CA 3GEIA 4P4SB 3GLFE 2C9YA 3CIOA 5CK5A 2A5JA 1UM8A 2OE2A 4AYXA 3L8YA 4M9XA 1XDBA 3M4YA 1RC8A 4IHQA 3MRSA 1HTWA 4F4IA 2NZ8A 4HATA 4BEBA 3CB4A 1XD8A 2RGCA 4RCZA 2CVHA 2HT1A 4Q4LA 1SVMA 2PMDA 3OF5A 5HTKA 1VCNA 1NP6A 1GOTA 2QP4A 2ZU6A 1GTVA 1J90A 2G1KA 3PEUA 3LVRE 4L9WA 5EQTA 5FFMA 5H1YA 4OQXA 3QXXA 3V00A 3PEYA 2BWJA 5JJLA 2GVDC 3FMOB 2FSGA 3A1WA 3A4MA 2JLRA 4Q1BA 4U02A 1TPZA 1QBKC 1CTQA 5K8TA 3AVUA 4MRSA 4TMWA 1J8YF 2JLQA 1VECA 2O8EA 1JQLB 1KI8A 2O5VA 3C5CA 3NKVA 5LB2A 4Q02A 3HU1A 4QGAA 4RVCA 1IM2A 1IXSB 4DT1B 5BN5A 4QBFA 4GNKA 3HPQA 2QQ0A 5JS7A 3FKSD 2BDTA 4Q1DA 2O52A 1WXQA 3BE4A 1XBTA 3KX2A 3QKTA 4JLKA 1VHTA 1A7JA 2ZS9A 4OQFA 3GLFA 5LD2B 2OLKA 4B3BA 3AVTA 2ZROA 1IONA 5FOUA 3H86A 3KDSE 5FI1B 4RD2A 2QQEA 4R98A 3VU9B 3K70D 2JLSA 2GJ9A 3E1SA 5FOVA 3J81k 1EGAA 3ZJYA 2GKSA 1NY6A 1SZPA 1DAFA 1FUUA 4ACBA 3GFPA 3IO5A 4II7A 4LC1A 2WPDA 2GWHA 3P32A 3PENA 2QRNA 2ZYWX 3QOFA 3CH4B 4AKHA 4IFBA 5BQ5A 5KNBA 1XTRA 4EAQA 4MH0R 4Q9LA 3A36A 3OEED 3SR0A 1ZIOA 1ZVQA 1R4AA 2VP2A 2PZEA 4DCTA 3ICQB 5JECA 2I3BA 1JQJC 2VP9A 3U3OA 1I2MA 4GDFA 4K81B 1KO1A 1Z6GA 2HLDA 1UKYA 5AJZA 4Q4AA 1DAMA 1KKLA 2VHTA 4TTRA 4U00A 3KQNA 1CR2A 1G3UA 2GZAA 1T3HA 3U7EB 3AUYA 4MUBA 2C78A 2ZI3A 4M21A 5F98A 2DFLA 4WZBE 1N2CE 1RKBA 4AWXA 3VR5A 2E87A 5TXGA 5CLQA 4F4CA 1VYTA 2QMUA 1S96A 4B48A 5JJIA 4ZDJA 5EP2A 4CEIB 2FPKA 4E5UA 1FX0A 4YONB 2VO1A 3U2QA 5CB6A 4HAWA 4KYIB 4BECA 3SS8A 1D8TA 4DLRA 5AUPB 1X3SA 4TYWA 1AQUA 2JATA 2IYVA 3AH8A 1FP7A 4GPTA 5A4JA 2GAAA 2RGEA 3MMPA 3NBZC 4PPQA 4DUGA 5FR1A 4IDNA 4GRAA 4MKHA 1XEWY 1L7VC 2NTYC 3EZ6A 1Z8FA 5G3ZA 2QU8A 4A0GA 1SXJA 3SFZA 1VIYA 3OIWA 2NO6A 1C9KA 5J4VA 3G0HA 2XTNA 5DSZA 3Q3JB 4A36A 4Z8YA 5LB4A 2VYFA 2FU5C 3T06B 1GRRA 3R7WB 4YMSA 1KIMA 3CWZA 4JLDA 4MYCA 3ADDA 1CULC 1WRBA 1TQ4A 3AP3A 3TK1A 1S2MA 1US8B 1N6LA 4QBIA 2A2ZA 2IYZA 5C2JB 4Q1FA 1YR7A 3NH6A 1YZUA 1VDZA 4IVPA 4OL0A 4V03A 5L3QA 2QNRA 2D2FA 1G64A 1SHZA 1GNQA 3A1TA 5IF9A 1I2DA 1KYIA 3CLVA 1NKTA 2DY1A 1MOZA 4Z1MA 4RFSB 1BMFA 5AUOB 1Z6AA 2FOLA 3FFBA 3QXSA 1ZM4A 3WP0A 1E2IA 1HURA 3DO6A 3W3ZB 1F3OA 1NF3A 2OBNA 4NYIQ 1KZ7B 3LQQA 3AGQA 5TV2A 3T35A 1G8GA 3WBKA 3PV0A 3TQCA 3RRYA 2NOAA 2WSSD 2EWWA 2XX3A 1YRBA 2V6IA 4NL4H 1G7TA 3KXIA 4FIDA 2K5UA 1F2UB 5HPYB 2YKGA 3TR5A 4GP6A 2IUUA 2JJ1D 5JEDA 4YQFA 2R62A 1LS1A 4Q19A 3LFUA 1SKQA 4ERNA 4V0LA 5FBQB 4DCVA 1E2JA 4ESHA 3BRWD 5JEEA 1IY2A 5E4FA 2C2HA 4Q9HA 5FTLA 4DLVA 2YINC 1OH5A 1KNQA 4LHZA 1R7RA 2QAGB 3QG1A 4TT3D 1P7CA 2W6IA 4V0KA 2PT7A 3LAWA 1TTTA 1W4BA 2V8OA 1W7AA 4RZUA 3I4LA 1QF9A 3QY0A 4E09A 4HLUC 5E3HA 5J4HA 4PAQA 3TUIC 3GLHE 4LK2A 2F43A 2JLXA 4DSUA 1JEEA 5JZVA 3TGPA 4EJSB 2ZRCA 1G7RA 2J0UB 1OV4A 3NG1A 3QKSA 2BMEA 4LYHA 2WIBA 2RGNC 2YWGA 5G3YA 4D82A 4TLBA 5AUNB 2FWRA 3U4QB 2GILA 3RC8A 2VP5A 5EP4A 1UBGA 2P5TB 4DWJA 4LBWA 1KK0A 2XAUA 4JLVA 1E94E 1FTSA 1ZUIA 4B3GA 2FFQA 1NSFA 2R8RA 4CIDA 3KXKA 2MSEB 4TLEA 5G53C 2QSYA 4C30A 3KKPA 1XWIA 1HT1E 1A2BA 5FTJA 1HH4A 2GEDA 4C9BA 1L4UA 3CRMA 2CJWB 3CF2A 1GKUB 2C9CA 1NLYA 3DKVA 4WVFA 2GJKA 1U0HC 1CKEA 4PC1A 4LPSA 1NMXA 1KTVA 2IF2A 4BFUA 1P5ZB 4TYYA 2JJ8A 2VF7A 1QRAA 4RFVA 2GF0A 4URUR 3EZFA 4PANA 4CF7A 5JRZA 3NHBA 3THXA 1Q3HA 1I4DD 2ZR0A 4LCBA 1XPOA 2J59A 2IYXA 3GLHA 2O8BB 4C7OA 1KSGA 5HR5A 3OIUA 3FVQA 3N70A 4PX9A 4URYR 4HDQB 2XNSA 2WKQA 4JBXA 3VMFA 3TVDA 4IOKA 4G1UC 3WYGA 1D9ZA 1JALA 3UXMA 4A2PA 2N1BA 2W0SA 1AS0A 1E6CA 3KJEA 5CM9C 4QKQA 3AVYA 1G20E 4EUNA 5BYJA 2E1RA 4LOAA 4V0OA 2FEMA 521PA 5JI2E 2XTZA 1ZD8A 3RS7A 2ANCA 2WPDD 1PUJA 4LJYA 3EPHA 2WWGA 3VHXA 4LHYA 4A4DA 2FFHA 1DELA 3B13B 3UPUA 4X8HA 5IDVA 4B6EA 3PVSA 1XMJA 3FFAA 721PA 1ZC3A 3KL4A 4HAXA 1E4VA 2Z4SA 1YU9A 3EPKA 2BIFA 2EFEB 5CDFE 3N2EA 1TEXA 2F3RA 3AKEA 1UADA 1N5JA 2GZHA 2HLDD 2ZJBA 5HE8A 1UFQA 4G3XA 4S2EA 2DFTA 2L0XA 5SZIA 2JIZA 2FA9A 4OQMA 4Q1CA 1XEXA 2J5XA 4D4KA 1AZTA 1SGWA 3GFTA 5CJPA 1Z2CA 4NYIR 2KJQA 5DH9A 1SVSA 1VPLA 2X2FA 2J7KA 1T3LA 3SYNA 2PX0A 2IS4A 2A30A 2JLWA 2C77A 3ZD7A 4B32A 3HYTA 4ZKDA 1WB9A 1NJFA 2ZS8A 3ND9A 4V0MA 3RWMB 3B78A 2IYTA 2F1IA 1KGDA 4DUGD 3E70C 4G5SA 4RD6A 1W36D 3WHKA 1VCMA 4ARZA 2BMDA 1N3BA 2HV8A 4LHWA 2NO9A 1HA3A 1YZQA 4I1SA 1SXJD 1YE8A 3RDPA 1DAGA 1KAOA 3DL0A 4C0SA 5J4LA 3MJRA 1RRFA 3B85A 1WBDA 2QZ4A 2BM1A 5C4MA 1KI6A 2QPAA 4XVRA 1DBSA 2J9RA 2QMEA 2F6RA 1RJ9B 4FMBB 4PPGA 2NO7A 2BBWA 3F3YA 3TBKA 4NE2A 2ZI5A 4D81A 1OFTA 3HYRA 2IYSA 2PCLA 5EXTA 3EASA 1E4YA 2WBLC 2G77B 4I1VA 3RHFA 2JJ2A 4LI0A 2XJ4A 4C2TA 1SQ5A 4A1FA 3K1JA 3C8UA 3NC1C 3CR8A 2QT0A 2CBZA 1GWNA 3L2OB 2EFGA 4Z1MD 2VHUA 1BMFD 3K0EA 4HUQA 4R7ZA 3CRVA 3UWKA 2XZOA 4DC9A 4FMCB 2CE7A 4PHGA 2HJVA 3B1VA 2OAP1 2ZM5A 4WBSA 4LPKA 1OXXK 2WJVA 1KOFA 3NWJA 3ZQJA 2OV2A 3DMDA 3CWQA 4HAZA 4UXHA 2GK6A 5HZKA 3R8FA 4AY2A 1G21E 2GBLC 1Z2AA 3EA0A 5EZ6B 2BCGY 1EX6A 5FBRB 5H68A 3FHTA 2Q3MA 5J4KA 1T91A 4OHXA 5TMPA 2XJ9A 2I1QA 3VKHA 2HDNB 4M1OA 4B2PA 3KJGA 2HF8A 1W0KA 3I8SA 3SBEA 2ZRDA 4UJ3A 1ZU5A 2QSZA 1U9IA 3BFVA 5M04A 4TZ6A 1P6XA 1T9HA 3SYKA 1II8A 4AD8A 4DIEA 3N2IA 3OFNA 4TL6A 3PG5A 1IN5A 3DZ8A 2DWOA 2W6ID 4HDCA 1Z6XA 3GJ3A 1RFLA 4RZ3A 4DVGA 1T0HB 1CXZA 4D26A 4LV5B 2CEAA 4PSKA 2KBEA 1NBMA 3X1YA 3EARA 1MR3F 1QZXA 1U8AA 1G3RA 4BZXA 2ZIAA 2YNMA 2J87A 1Z83A 4WOPA 3W8RA 2F55A 2YHSA 1X8LA 3OIYA 2XGJA 1DPFA 4P4TA 1LNZA 3DOEA 1KJZA 1P73A 2XB2A 4P4SA 4PZZA 2ZU0C 2BKUA 3OIVA 3REFA 3ZQ6A 3U7FB 3LA6A 2EU8A 4P33A 4DLWA 1N0WA 3WMFA 1FPMA 2OCPA 1VHLA 5GJCA 3UG6A 5AUQA 1ZM3A 1OKKA 1IXRC 3U3KA 3U3MA 4M1SA 1KI3A 2YOGA 1JXMA 4TL8A 4Q21A 3ZGXA 4AYWA 2W2VA 1X6VA 4UXJA 4GOXA 5CM8B 2QMOA 4QGHA 2WTUA 1R5NA 1YR8A 2ZSFA 3AKYA 5AJXA 3JVUA 2OFXA 2REBA 2QGNA 2R44A 1N6KA 5SZKB 1ZBDA 2OAQ1 1AA9A 4Q9JA 3RAPR 2FSFA 3CRQA 1GFIA 2ZYUX 4JVLA 1FNNA 4QHYA 3X1XA 4OHZA 2V3CC 4IDOA 4Q4HB 3HDTA 3IKJA 1BYIA 3MLEA 1XZPA 5KNCA 4O2RA 1GL7A 1V43A 2Q9AA 3I1FA 4DT1A 1DAIA 3W6PA 5FUXA 4TN1A 5LPNA 1YRAA 2KI5A 4KVGA 1IN8A 2O0KA 2WHXA 3KUDA 2X8AA 3LX8A 3PEVA 4YC7A 2AX4A 3KZ1E 1QHXA 2WOOA 2BC9A 2BOVA 2F1HA 2HCBA 1LV7A 4LJ9A 3VR2A 4A82A 3I5XA 2VP0A 1YJ5A 5C4GB 2ATVA 5DHAA 3MUFA 2GJSA 3VU9A 3V4RA 4LBZA 3AKCA 3IEVA 3Q5DA 221PA 2ORWA 1KDPA 2D06A 1YVDA 1VCIA 2VA8A 4PSVA 2ONKA 4JIMA 2OXCA 2CE2X 4CGZA 4XTCS 1E0KA 421PA 3DHWC 4JKIA 4BFZA 4NPHA 5JRJA 4HEJA 1ESNA 1RIFA 1XTJA 2QA5A 2H57A 3TIFA 4AG5A 1IN4A 2GRJA 5UKDA 3CNLA 2RH5A 2OG2A 4BRWA 4XIGS 1JJ7A 1SKYE 3K9NA 4ITRC 4KSCA 1Q1BA 4HB0A 2O8DB 2UVQA 1GILA 2JIZD 2PEZA 5KO2A 1UKVY 4Q01A 1GAJA 4LJAA 4EPRA 4TYQA 3VQTA 2IXFA 3EC1A 2Z6VA 4FMDB 1RZ3A 5GJBA 1U8YA 4BASA 2BKEA 1OSNA 2N46A 4A8JB 4B3XA 1D5CA 3TSOA 4HI0E 1XEWX 1R8QA 3B1XA 4CEIA 2HXSA 1E2FA 3GJ8A 2NG1A 1LB1B 1WDTA 2R6CA 4HUTA 4AKIA 2WJJA 4KITB 3AVOA 3H2YA 5L8VA 1DVRA 2CVFA 1PV4A 1OFHA 4EIWA 2FMXA 2QI9C 1UKZA 2H18A 1CR1A 1MO6A 4JL5A 4KJZA 1TU4A 4WW0A 1G5PA 2AD5A 3MAAC 1E2EA 1U81A 5G40A 2PH1A 3UK6A 4QBHA 1Q57A 3IBGA 1G6OA 2A7QA 4LUCA 5FUWA 3PFIA 3CNNA 2G88A 3SJBA 4A2QA 1R2QA 3P26A 3PUVA 3TSWA 2RKOA 3GLGE 3LW8A 3R7WA 1KO5A 4TYPA 2ZSDA 3EW9A 3CUEF 1US8A 2CHQA 1XTKA 3THYB 1EFTA 4TQ9A 1EFHA 4GZMA 5EXSA 4B3CA 3K0CA 5KDOA 4DCUA 2JJ2D 4QM7A 3LH5A 4US1R 2DWPA 1OYYA 3B1YA 4PAMA 3QBTA 1KDOA 1M7HA 3GQBA 2FH5B 4XTRA 1BIFA 2HEIA 3L0PA 1PLKA 1NN3A 1N25A 2EW1A 1G17A 3FWYA 4IVQA 5KDLA 3FOZA 1ZINA 2W6JA 4PQYA 1FZQA 4L8GA 1HY3A 3WYFA 4BFVA 2HT6A 3W8NA 4R2IA 5EE3A 1HYQA 2ODEA 4H9GA 4M22A 4OI2A 1TX4B 2QGZA 4XJXA 5KPDA 4JKYA 1W46A 5F2EA 4MDFA 1IN6A 1N6HA 1W4RA 4QC2A 2REXB 4JT2A 4JLBA 3SOPA 4AKEA 2VF8A 1F2UA 3KQUA 4BEJA 3EG5A 1HEIA 1MO3A 3DZDA 5EE5B 1E2DA 1EFUA 1N0VC 1W0KD 4XWOA 4I99A 1XXHB 3BS4A 3RS4A 4D6PA 2EYUA 5JJKA 4HLQB 3JVVA 1XTSA 3OFND 1KK3A 3LDAA 1JBKA 2CLCX 3TAHA 1OW3B 2GCOB 3B1ZA 3ECCA 3JZAA 5FPSA 2HCJB 1P2UA 2ZVPX 2JLYA 1ONBA 4Y0AA 4HDOB 1NBMD 5TB5A 2W0MA 4A0RA 1TF2A 1OIXA 3E5HA 3VKWA 3RRZA 1XD2B 2GA8A 5AJVB 4F7WA 1W47A 4EJSA 2ORVA 1T6NA 2J0UA 1LVGA 1AKYA 4JYCA 2IUTA 2Q3HA 3O8CA 1QDEA 3GJ7A 2DCUA 4L4UA 4NYMQ 2FEOA 3BAFA 1G9XA 2Z83A 1OKKD 1SVLA 3U4QA 1OF1A 1OB2A 4IDHA 3KQKA 3KB2A 3D8BA 1KKMA 4J0QA 1PZNA 5F9FA 1QVRA 1S0UA 2OCBA 3B82A 4BLPA 4XSGA 4OHWA 1WMSA 3AP2A 1NVVQ 1CR0A 1OPXA 3QXCA 4FXPA 2CJWA 2AKAB 4NCNA 1EX7A 4PZYA 2W2TA 1FTNA 2H92A 4BE7B 1LF5A 1FMLA 2NZJA 1VTKA 3V9PA 2EFHB 3ONWA 2QTVB 2RAPA 4BUJA 6Q21A 2GZDA 4Q03A 1OXVA 3PR1A 4QM6A 2PT5A 1KMQA 1NG9A 3CONA 3WHLA 1N0UA 3AEZA 3KFVA 2ZJOA 4FINA 4I81A 1NVWQ 4EDHA 1W36C 2O8BA 3P20A 2LCFA 4A6PA 2OILA 2RGGA 3QBVA 1SXJC 4TMZA 4KAXA 4O25A 4PC3A 1KSFX 2F7SA 1KO4A 2WJHA 3MWYW 5BWMA 2FJUA 4Q18A 1FUKA 4C0JA 4Z8XA 1SXJE 1Z3IX 3WMGA 2W00A 2MMCA 4UKDA 2GJ8A 1CEEA 4Q66C 1T4GA 4QJ5A 1CRPA 3BWDD 3U60B 2WOJA 2LKCA 4PHTA 4V0NA 3CZQA 1Z47A 1M8PA 2EYQA 4D80A 1IN7A 4IOJA 3P1JA 4O3MA 5J40A 1AM4D 3NDBB 5E7MA 1QG2A 1TADA 4GP7A 5DI9A 1SVIA 3ZH9B 3S1AB 4LYFA 1J99A 4TLCA 2WKPA 4L9SA 2CCKA 2UKDA 5K8IA 3UMRA 5KPJA 4ZDKA 1W48A 1NN1A 4F38A 3RS0A 1KDTA 5FUVA 3PUWA 1WQ1R 3WMEA 2CMKA 1XEFA 1EFCA 1TF5A 3KKOA 1K5DA 4QG7A 5FPKA 5J5CA 1RYHA 4C0HA 4EQ6B 4DKXA 1Q3TA 1ZRHA 5CB8A 5E7JA 1W44A 3GJXC 4A6XA 2QBYB 3H84A 1NKSA 1N6RA 4URXR 1W2HA 3SU8A 2AHOA 2QAJA 2ZITA 2ZQ5A 2VH5R 4OHYA 3BJIC 1DO2A 1J8MF 3RS5A 3KKMA 1JAHA 2QE7D 5H8WA 2ONJA 3KTAB 2WMOB 1V5WA 5K8LA 1Q1EA 1H8EA 1Q0UA 2ANBA 3QF4B 4M8NE 3GEHA 3TQFA 2A78A 1KO8A 2ZI7A 4D0NA 4EPTA 4RSGA 2FFBA 2SHKA 3AF4A 5HCNA 1OXUA 4KBGA 2RMKA 3WNDA 1BH2A 4DDUA 2RGDA 4FN5A 4JJKA 2XNDA 3WNCA 4DBLC 5TY0A 4A0FA 3H4MA 4TL7A 3ZZUA 3IHLA 2GESA 4MRVA 4NCKA 5EE9A 2ODWA 2JAQA 1RJ9A 4BGDA 1RVDA 2CNWA 4RZXA 5FL7A 4ACAA 3FDIA 1XJQA 4AYTA 1KMHB 4KI0A 1Z28A 1WE2A 5CK4A 5D3QA 3VX3A 4JS0A 4V02A 4L16A 4F91B 4NH0A 3IIMA 2CLSA 4NYMR 3TRFA 3T12A 1ZNZA 3K9HA 1RRGA 1VIAA 3VFDA 2J0VA 2W6JD 4NMMA 3LD9A 2WWIA 3NH9A 2ZR7A 2V6JA 3G82C 1F2TA 4OBEA 4LDJA 4LJ8A 3A6PC 1D2MA 5A0FA 2ZREA 4RD1A 621PA 1NN5A 1XTQA 1G41A 3Q8XB 5DHFA 1ZNXA 4A2WA 1NVVR 2C5LA 3K0AB 5BN4A 4YLGA 3CF6R 3UMFA 2GETA 3IQWA 1AIPA 3RYTC 2WWYA 1H8HA 4NZYA 2YV5A 3B60A 5HCIA 3LWNA 2P3SA 4P0TA 3C41J 2IW3A 1GNPA 4GOJA 3KFXA 4CYMA 1X1RA 3RC3A 2VHCA 2YOFA 1P4SA 1XMIA 2ZJYA 3V4FA 1N5KA 5HZHA 1ZCAA 3U3JA 4HZUB 4CZ2A 1HUQA 1JEDA 3FHCB 2OM2A 4JLPA 1Z0AA 1L8QA 2WAXA 2WWHA 3ZDQA 1K6MA 2E9SA 2R6FA 1QVAA 2XZLA 4IOLA 2B92A 4HLCA 2OFOA 1MRNA 4LY6A 3TKLA 1KI7A 2WVJA 3T1TA 3QQ5A 3VNVA 4GMXA 2J1LA 4B43A 4LJ6A 1A2KC 3T61A 4YDSA 4IDPA 3SNHA 5FOWA 4G01B 3A58B 4YXWA 4JLJA 2B7BA 1OIWA 3OAAA 2QRZA 4NCIA 3UANA 1N6NA 2QG6A 4Q1EA 1UDWA 3HU3A 4NBSA 4BPBA 1S9HA 5BXQC 4M1KA 3IILA 1ZNYA 2OO7A 5HKKA 4W9MC 5KU1A 4H1UA 1XPRA 2G6BA 2NQ2C 4O2LA 4OQNA 2R6AA 2MSCB 5DLQC 1T0JB 5AWFC 4QJ3A 2ECKA 1ZM7A 3QKRA 5FI0B 1JNYA 3WNBA 1GSIA 4OK3A 1XNJA 2QP3A 2BEJA 3GLFB 4DB2A 2EVWX 1IJEA 3SHWA 1XJ0A 2ZUDA 2CDNA 2IS2A 3H1TA 4C2UA 4DXAA 3U6KA 3LQRA 2VP4A 1JR3A 4LBYA 3SZRA 3CPHA 1C1YA 5KDDA 1HE8B 4Q4HA 3EXAA 4MA4A 1NLFA 1W0JA 2IUSA 4PAOA 4V0ME 4TSFA 1S9DA 4DZZA 2QUZA 3BH7A 4IEEA 3HP1A 3CM0A 4I1UA 5HE9A 1P3JA 2WIAA 2NPFA 5K8UA 3KQLA 1S3GA 3C4JA 1NN0A 4UJ5A 2WKRA 2YC2C 1G1MA 5EUMA 4RD0A 1NMYA 1T5LA 2ZSBA 3CPJB 1OB5A 3U5ZB 4PHFA 3AKDA 4ABYA 2QPTA 1COWA 4PQRA 3AV0B 5FTMA 1Q12A 1YZLA 4OKSA 4YMWA 1MRSA 4CT5A 3LRPA 1VYUA 3Q7PA 2RGNA 3FHOA 2NO0A 1UBCA 2ZJ8A 3TR0A 2NMVA 2HF9A 1AS3A 3B8HA 1IOZA 4QHSA 2ZI6A 3GMTA 4W5JA 3GD7A 1W4CA 3LLMA 2P67A 1QHSA 2J3EA 3HU2A 1E98A 1VG1A 3EIQA 4X8LA 4QGGA 2R65A 1E99A 3CF0A 5DN6A 5IK2A 1NVUQ 1MH1A 3BB1A 3L8ZA 2IYWA 5CIWA 4MRNA 2RHMA 821PA 2GAOA 4BFSA 3FKQA 2IS6A 2OXRA 2GK7A 4Q5IA 5DYGA 1S1MA 1E2LA 4JVNA 2O8DA 1CJTC 3KXLA 2GF9A 4I1OA 1HT2E 1P72A 3B6EA 4TWZA 4BLTA 4C0BA 5JCPA 1YZTA 1F60A 1R0ZA 1VYVA 3AVVA 4YMTA 2H16A 2ZRJA 2H17A 4RY2A 4IEIA 2ZRGA 2VRWA 1Z6YA 3LNCA 4NCJA 3RS2A 3GEEA 4B75A 3GLIB 4A8JA 4W5WA 2MMGA 5JLJA 2XXAB 1U9IC 2X77A 4M9ZA 4AG6A 4KLZA 3O8DA 1MT0A 1H8ED 1PLJA 4Q7JB 4L5BA 2O0HA 4OJQA 2ZRHA 4G5RA 3BFKA 1IJFA 4P4UA 4DCSA 1VMAA 2R9VA 3FMPB 2AXPA 2ZYVX 5EP1A 3SJAA 3W9YA 1U99A 3CR7A 2C03A 1XCGB 2G9NA 1E9SA 2P5SA 2YWFA 3QVUA 3AVWA 1ZU4A 3I32A 1G7CA 2XNDD 3U61B 1OXTA 1IHUA 4KLNA 3U3RA 1IY0A 2ZR9A 3UG7A 1NBME 3QIAA 2Q9CA 4ILEA 1HQCA 3MWLA 4G5QA 3F8TA 4RKFA 3SYLA 1ZIPA 2ZETA 2CNWD 5FL7D 2BCJQ 1XXHE 4NCHA 3OE7A 4KBFA 4E03A 3LV8A 1IAQA 1QHIA 4Q7KA 3THYA 4HAVA 2FZ4A 4XVUA 4Q00A 4URWR 5IT5A 3AVXA 3A1UA 5GADl 2RGXA 2G0NA 1TUIA 1VKJA 4H1VA 1HV8A 3QI2A 3EWSA 1G5TA 2Z5FA 1S8FA 2J41A 5FBWB 3X2SA 4XOIA 3PITA 1G3QA 5J4YA 1E32A 1R10A 3FYHA 1NVXQ 1KI1A 3T5DA 4C0LA 3ASZA 3BBPA 1GP2A 4DDTA 3PXGA 3MWJA 4GOKA 4KO8A 4M1WA 1GDDA 3DEFA 1ZUNB 2GVZC 3X1ZA 4DLTA 5JWOA 1GUAA 3K70C 1DG3A 3B5JA 3DM9B 3LXRA 3VTKA 2UZ3A 3Q85A 2IA5A 4TMKA 3EA5A 3N5CA 4PHHA 4PZLA 3QF7A 3SQWA 1H8HD 4MQBA 4D25A 1CS4C 3VR3A 3AGPA 1BYUA 1LF0A 3IIKA 5L3SB 3RS3A 1XXHA 2VP6A 4LJ4A 3K09A 3IDQA 1N6OA 2PJRA 3W90A 1AK2A 4B73A 4HB3A 3ND8A 3LW7A 3U6BA 1G8YA 2DFNA 2GCOA 4DHEA 2OBMA 4A9AA 3U44B 2X19A 4QBGB 2DWQA 1CRQA 2WAYA 1P61B 3I72A 4B47A 2JGNA 4LJ5A 4UNRA 2O8CB 4O0MA 4FWTA 3B9PA 1EWRA 1XD2A 1DAKA 4CDGA 2IT1A 4YXWD 1A1VA 2IBMA 1N5LA 4UNNA 5FUYA 3NEYA 3OAAD 3ZVLA 3C16C 3TUJC 3TMKA 2D7DA 5CLLA 4F93B 1OH7A 2IHYA 5FOTA 2CCGA 2FNAA 2QT1A 4IFEA 4MGKR 1JECA 3BK7A 2QM7A 1B23P 1G4AE 4ZCLA 1XFAA 4LSGA 5TARA 3M1IA 5HKKD 2I4IA 2GXQA 5JMTA 1ZD9A 2FN4A 3RNLA 1Y3AA 2C99A 3A8TA 3THXB 4XVQA 3F5FA 3EX7C 2XEXA 3GLHB 1E0SA 2CXXA 1EFRA 1M34E 2ZAMA 3T34A 2JASA 2WICA 3TLXA 3WYAA 4M9SA 2GEVA 1E96A 1P9NA 1XMVA 2YJTD 4MUAA 2O8FB 1G5RA 2CK3A 3OHMA 1E9FA 2ATXA 1JR3D 1NY5A 2AK2A 3MWKA 2A5FA 1CJKC 1UPTA 1W0JD 2VSXA 4TSFD 3GJ6A 5TVKA 5JWHA 4M0LA 3EWAA 2WSMA 1VG0B 4ZI3A 2AKYA 3UKDA 3KUCA 3UWOA 1DAEA 4CEHB 3GJ5A 1C4OA 2KSQA 1H65A 3H0KA 4MGIR 2OSBA 1WA5A 3VHLB 1COWD 4PTLA 2IYUA 4IRUB 4Q4JB 3K0SA 3QEOA 1Z0IA 3TJZA 3U7GA 3DMNA 5LDDC 2F1RA 1AZSC 3AF1A 3BORA 4US0R 4D4MA 1NI3A 2GNOA 3FE2A 3Q5EA 4EFNA 1LTQA 4C0KA 2EFDB 3A37A 1GVNB 3OZXA 4P3YA 5LBIA 1G8PA 5BN3A 5DN6D 2YVUA 4G0NA 5F3WB 1U8ZA 2J45A 4W7SA 5IK2D 2BV3A 2KWIA 3Q72A 1UEIA 1D6JA 1FL9A 3B1WA 3C14C 3K9LA 2ZRAA 1WBBA 1ESMA 2ZAOA 3S1AA 1JPJA 2CHVA 1SULA 1ZM9A 4Z51A 5FR2A 2ZE8A 3CX7A 4E07A 1W1WA 3B9QA 2ZRPA 2D3WA 1RRPA 2QE7A 3P4YA 3LBIA 4N3NA 2H7VA 2ODBA 3TAUA 1KDRA 1JJVA 1ZMXA 2ZJ2A 5CYOA 3E2IA 5D3MB 4DB4A 4QL3A 3TW8B 2CL0X 3I92A 2AXNA 2OZEA 3K0FB 2OUKA 1XF9A 2RGBA 4ZDWA 3LY5A 2WJIA 3QXJA 3RRMA 1DOAA 4ZIRB 1B0UA 1LS6A 1FP6A 3UATA 1ZD1A 1MABB 3KTAA 5CYPA 2JLZA 2YOHA 2ZI9A 4ESVA 3ZS8A 3ZZ0A 4NTZA 4MYHA 1X1SA 4PQFA 1II9A 3QKUA 4NDZA 2AWNA 3BOSA 3R8CA 5FPTA 2IWHA 5J47A 3RLFA 3VAAA 3L43A 4L15A 4LGMA 4R71A 5B64A 2ZUBA 3PUXA 4IKEA 2BBSA 1O3YA 1X86B 1XCPA 2BMJA 3AF0A 5AJWA 4TQAA 5IRCD 4KV9A 3O8BA 3FGNA 2V54A 1MV5A 4DLUA 4NYJQ 2J7PD 3A4LA 3QVVA 2XB4A 4GMDA 4ZO4A 3QG5A 1OXSC 4RFSA 3QJYA 2R6DA 3OE7D 3CZPA 4MRPA 1IQPA 2Q21A 2CCJA 3DDCA 2C96A 5CJ2A 2P6NA 3CH5A 4GL2A 1XU4A 1N5IA 1FOEB 3RSOA 4AK9A 4LV6A 1KMHA 4DEYA 2LKDA 3WY9A 1UAAA 1ELOA 2B8TA 4WA7A 1M2OB 5JFGA 2V4ZA 3GP8A 4XWKA 2WJYA 4PO9A 4TYNA 3BERA 3PQCA 5EXPA 1XD9A 1NMZA 1AQYA 1G3MA 4KVAA 1KHTA 2PEYA 3AF2A 3BFXA 1UEJA 3VKGA 5EJEA 4BZQA 4DDVA 1OHHA 2ZSAA 4ZV4A 3THWB 2QAGA 3K0AA 1UKEA 3ZS9A 3D7MA 4XD7A 4KFUA 4QNRA 2BM0A 3ADCA 4LRWA 4JL8A 1Z06A 1R5OA 1F48A 4MGZR 2ZRIA 4W5HA 4TMXA 1XRJA 2FFAA 1Z0FA 2A5GA 2JEOA 3EPJA 1W4AA 5CITA 3PJRA 1E9DA 3ICEA 1QG4A 1NL3A 2ZRKA 4Q9KA 5DYIA 4CRWB 5FPYA 4UNPA 2Y8EA 1N6IA 4LWZA 1LFDB 2IHBA 1YR9A 4FCWA 5FOXA 2HYIC 1A4RA 3I5YA 1VG9B 3L0IB 2D2EA 3AUXA 4U7DA 3QEJA 1TQ2A 2OBLA 4AC9A 1SVKA 3CRRA 4HZUA 3CBQA 4TLDA 1S3SA 3HWSA 4MGYR 3IPYA 2PMKA 1L2TA 4LZZA 3C5HA 1J2JA 2HYDA 1Z63A 4Q1AA 2XZPA 2YWHA 4URZR 1HE1C 2QTHA 3EIHA 3O8RA 1N6PA 4HAUA 4D0GA 5JS8A 2IYYA 3Q9LA 2ZSEA 5C18A 1J70A 3F0TA 3RABA 2IEYA 3WXMA 3TNFA 5GJVC 2F3TA 3SBDA 1E9EA 2JDIA 1G18A 3C15C 4FCVA 3K70B 4DLSA 2ZANA 3M0EA 5BW8A 2Q9BA 4WIAA 4URVR 4QFMA 2V7QA 4AI6A 4NKRA 3KQHA 1ZNWA 1AGRA 3NTUA 1EFRD 1R0YA 5DE3A 1P2VA 4FCTA 3QPWA 4GT1A 2ZUCA 2ZI4A 2CK3D 1ZP6A 2G0TA 4JLAA 3SJZA 5FOSA 2FE4A 2VSFA 3HR7A 4ON9A 1ZC4A 4OI1A 5JSZB 1OH8A 4JLNA 4XH9B 2P6RA 2ZEJA 4FD2A 4Q7LA 2V9PA 2PBRA 1YZGA 5C46F 1U0JA 3B2EA 5F9HA 4DSOA 1K8RA 5E7IA 1NLZA 2XTMA 1TU3A 1QHNA 2EFCB 4QHTA 1NIPA 2DB3A 1K5GA 3LLUA 4WAUA 2QP9X 4KFTA 2IL1A 2B21A 4K8OA 4MDEA 3ZVNA 4IXMA 5DO9A 4DRZA 1AJEA 1CP2A 2QTFA 3EZ7A 3THOA 2ZXUA 3GLIE 1DG1G 3BB4A 2IF0A 1AKEA 1E9AA 3I73A 2OCAA 4G5GA 5CIQA 2A9KA 4NU0A 1T5IA 1HQYE 4IXNA 2QROA 2ZRFA 3SE0A 4NYJR 4TMVA 5KSOA 2GXSA 3HR8A 2YC4C 3LX5A 2QENA 3IHWA 3ZVMA 1U0LA 3OEHA 121PA 3R20A 2BHRA 1VCOA 2VHJA 4M4SA 4ZPXA 4BFYA 2C9OA 4JT4A 4D4LA 3I3SR 1FQKA 1OIVA 1UBFA 4WXRA 4BLRA 2PCJA 4BFWA 3W6OA 1F5NA 3AM1A 3VNUA 3I61A 2ERXA 1RE0A 2ERYA 4WZ6A 3VR1A 4EFMA 2G3YA 2C8VA 4HB4A 1E2GA 1YKSA 2ZYTX 3CKLA 1TAGA 1TQDA 3MFYA 2Q3FA 3SHFA 4Q9IA 1GIAA 2OT3B 4IVRA 1Z08A 1G291 2XSZA 2FX3A 1QHYA 2NO1A 2DBYA 4MYUA 5FTKA 1G3IA 3GLIA 2BMFA 4DCNA 4FWIB 2WWXA 4N0DA 2V1XA 2IWRA 1SKYB 2XXAA 1WCV1 1KSHA 2BJWA 1OE0A 2Q6TA 1W5SA 3BH0A 3T1QA 2AFHE 3MJHA 1II0A 1T8UA 1Z22A 2TMKA 1EK0A 2VLIA 3AVPA 5KHOC 4AIIA 1W49A 1VG8A 2OEPA 1OYWA 2CL6X 4HZIA 4DLZA 4KFSA 2GTPA 4A92A 2VL7A 3B7GA 4PC6A 1QHHB 1U94A 5JHGB 4JJZA 1T3SA 2Q0HA 4CW7A 3QXHA 4UQOA 5DI3B 1NRJB 1R0WA 2ZRNA 2ZPTX 4CEJB 1GM5A 1Q44A 3P4XA 4MITA 2ORIA 2AR7A 1PLLA 3LBNA 2ZE7A 3R9XA 3GJ4A 5EUQB 1CIPA 3AQ4A 4EKDA 3ZLJA 2B8WA 2X1VA 3VR6A 5GVRA 1GNRA 1KSJA 1E3MA 5JHHB 1P2TA 5KSYA 3W5IA 4QOSA 1ZUHA 5AR1A 1GG2A 2GDJA 2PLFA 2Z43A 4OI0A 3BB3A 3GLGB 1KZGB 2BEKA 4LJ7A 4EPVA 3BC1A 4PR0A 1A82A 4JVSB 1OHHD 4DLYA 2WZQA 3NIBA 1GKIA 3FMFA 4LBVA 1Q1QA 1KK2A 4XD7D 5EE0A 1D2EA 2BVNA 3IEUA 4MKFA 2UZIR 5DISB 3REGA 1E2HA 3IBYA 4F4JA 2DR3A 1JR3E 1R8SA 1X8JA 3W6NA 5B57C 1YR6A 1OT3A 4RZ2A 4CT4B 2VBCA 3FMIA 4U5XA 1E2PA 4OYHA 1KAGA 2IC5A 2PLRA 3AB3A 3P27A 4JSTA 4JZKA 3AP1A 5L3SA 1OH6A 4LHVA 3K9GA 4MKIA 4B2LA 2ZS7A 2F1JA 3MG9A 3GCGA 1ANKA 2KE5A 4PXAA 3QE0A 3K53A 1CR4A 3FPAA 3DVLA 1L4YA 3GJ0A 3NXSA 3ZIAA 4HSEA 4K46A 2DHRA 2O8EB 3U44A 1XB2A 4JYBA 5BYKA 2RHDA 1JI0A 1RRCA 1MKYA 2GEUA 1E1QA 2AN9A 4LYAA 2JLUA 1KI4A 1XJCA 3IGFA 4GBMA 3VR4A 4ASUA 1CJMA 2H1LA 3LXXA 5E95A 5KNDA 2O8CA 3SDZA 1G7SA 1M1YE 1ZCBA 3QNUA 1OLOA 1XMSA 2W2XA 3O47A 2AL7A 5SZJA 2JDID 2ZJZA 1DEKA 1Z0JA 3T15A 1TQ6A 4G5OA 1G8FA 4BLSA 1E2MA 2C95A 2WWWA 1GL9B 2V7QD 3EZ2A 4DSTA 1KI9A 4JL6A 3W34A 2W83A 4LX0A 1ZW6A 1ZM2A 3OESA 4HYYA 3SFVA 3ZZTA 4DEXA 1D2NA 2ODNA 1EESA 3MSXA 3D6TB 3DM5A 4RJLA 1BOFA 1OFIA 3A1VA 4HLUA 1I4LD 4C4PA 4WZAE 4Q47A 4EPYA 4TLAA 3WBJA 1BS1A 2IK8A 3IIJA 4A8JC 2O8FA 2VIIA 4YMUA 1QHGA 2DPXA 2REOA 4POAA 4OJKA 5DGXA 3WRYC 1DS6A 3MCAA 1P2SA 3NBXX 3TSZA 2NPIA 1EG7A 2R6GA 1E79A 2P6UA 4Z54A 4OQLA 4CEHA 4Q4AB 5JI3E 1Y63A 2J0QA 3DPUA 4ZCIA 5IHPA 2D7CA 1E9BA 5A5GA 2IXEA 2DFKB 2WJGA 4Q4JA 2QM8A 3C7KA 4UNQA 2CHGA 2HUPA 4NP6A 1EXMA 1S1CA 1U90A 4B2IA 1AS2A 5KUTA 4JVMA 4M2LA 4MKGA 1FX0B 5DIFA 3L0OA 4LV8B 2IS1A 2RCNA 1ODFA 3OEHD 4QXAA 3EIEA 4XSHA 3ASYA 4B33A 1IBRA 3NEJA 3RVBA 4KHZA 1W36B 3CRW1 1O87A 2D74A 1PJRA 2XOKA 3D3QA 4ZKEA 4M1MA 2P65A 3UIEA 1XP8A 3CW2A 1SXJB 2IYRA 4PC2A 1RYFA 2VTKA 2OCYC 2EQBA 3CO5A 4UXIA 3R9WA 4X8MA 1YHNA 4RCYA 4F92B 2IEZA 1Q21A 3L0SA 4US2R 4BZPA 1UJ2A 1FFHA 3IO3A 5KSPA 4TTQA 1Z6TA 4B3DA 4HAYA 3TUZC 5D3MA 1P9WA 3A1SA 1Z0DA 5GVSA 4PPNA 2XSZD 1U98A 2FPMA 4FI3C 2RGAA 3TW4A 4FMCF 1M74A 3GFOA 3CX8A 2OHFA 2A5YB 1ZAKA 2YZ2A 2ZJAA 3K0FA 1NNEA 2JLVA 5L3QB 1ZYUA 2J0SA 1XTIA 2FSIA 3VX4A 4ZIRA 5B30A 4QRHA 3NBYC 4KXFB 5CDFA 4XWAA 1MABA 3K09C 4ZDIA 2PX3A 5FPHA 2VQSA 3KJHA 3X1DA 2J7PA 1GZSA 3CX6A 2BBTA 1U2RA 1YZKA 4GSYA 1W2GA 4P32A 3SI7A 4KU4A 2F9MA 4JBWA 5KSZA 4Q7MB 4A15A 8OHMA 1TMKA 2FPLA 2AFIE 1DO0A 1M6NA 5G41A 1E1RA 1GRNA 1JR6A 1DARA 5JWRA 2GXUA 4B34A 2D62A 5FH9A 3DKPA 4UNSA 1KNXA 1F2TB 1CJUC 1KJYA 2FZLA 1UF9A 1E69A 2WV9A 3I8XA 2AWOA 4GI7A 4C3ZA 4B3FX 1CU1A 4DSNA 1NG1A 1G16A 2QEQA 3PEWA 2IXGA 2FGKA 3FTQA 1Z07A 4TL9A 1G19A 4X8OA 2B6HA 4KCGA 1BO6A 3NDPA 1CLUA 4P31A 3SEAA 1FQJA 2ASEA 3BH6A 5B2ZA 2VPPA 3JZMA 3RWOA 4AURA 1XX6A 1Q1ZA 4JSYA 5AJYA 4Y0VA 3UMSA 4PC7A 5JBQA 5LD2C 2F43B 2GXAA 3IPXA 1ZJ6A 3QSYA 1S4QA 2FG5A 3QKSB 4TQUS 3A4NA 3THWA 2YYZA 1CJVC 3EZ9A 4B71A 3NVAA 3RSLA 1SVWA 5EZ5A 4JLMA 1AGPA 2WWFA 4E22A 2X2EA 4Q48A 4S35A 1FNMA 4M9QA 2ZTSA 1P75A 5TDHA 2W58A 1MO5A 2Z4RA 4KSBA 3IUYA 4YDHB 3AVQA 4R2HA 1EWQA 2P2LA 1UDXA 5ANRB 1OJLA 4WXPA 3T5GA 2Z0MA 4QNMA 2FSHA 4C0QC 5L3RA 4OI4A 4AKGA 2FF7A 3EC2A 3ZIAD 2V55B 2ZE6A 2OLJA 1KI2A 4PFSA 3R9IA 1YZNA 3EPLA 1E1QD 2A3RA 3BXZA 5FL3A 4ASUD 1PUIA 1DTSA
chains in the Genus database with same CATH superfamily
4KR2A 3Q6NA 2ZJ5A 3ZVRA 4BNLA 4NS4A 4G4GA 4I6GA 1U0FA 2D8AA 1KJWA 3T4EA 1XI2A 2FW7A 3HTXA 5FX2A 1V0JA 4O4HF 2HA7A 1GEGA 5TQ0A 1L5MA 2HJGA 4LHXA 4BNHA 1Z4JA 4LC0A 4EY8A 4QBKA 1G4UR 3D02A 4QUGA 1NP3A 1U1IA 1VL8A 3VRHA 2PZFA 4F3YA 1DLJA 1J5PA 3BULA 3DBLB 4P98A 3GPLA 5LMNB 1RPZA 2XADA 3MT0A 1TJYA 1WP9A 2FV8A 2M1ZA 1PD0A 1YQTA 4UARA 3VZPA 4HVLA 1CLEA 1LLUA 1O89A 3EG9A 4ER0A 2E4WA 3KKZA 1MGOA 2VZ8A 4X92A 5FWXB 2B5OA 4RDIA 4ZQFA 2MSWA 1GITA 1XZQA 3KKQA 1DUIA 1T0UA 4BRUA 2ZRMA 5B2FA 3I1IA 3TE6A 3ZDDA 2PH5A 4CQMA 2ZYDA 3ORQA 3EMKA 4NOJA 5DSXA 1IWBB 1PKXA 3O4FA 4ALLA 4PLWA 2VRBA 3COSA 1KZYC 4TTAA 4X0EA 4YQYA 4MUFA 3ADKA 2QTWB 2I54A 3B3QA 3CH6A 4BNXA 4R5HA 2HSDA 5DHQA 4YLEA 2C2GA 2B25A 2KB0A 3WLEA 4XIIA 3B1JA 4R9UC 2XGSA 4FMDF 1LTKA 3OEEA 4ZOLA 3SAJA 5IYZA 2X7HA 1I33A 3PHCA 4OFXA 4ESEA 5HNKA 1CY6A 3THRA 1E79D 5SYMA 2P35A 5H82A 4OVKA 2JH9A 3NHUA 4KIJA 4TRJA 2DE0X 1ZXLA 2FB9A 1QDLB 5SZHB 3T0GA 5F4ZA 2EKLA 2BGLA 2PS9A 4F8JA 3B36A 1EGVB 2XD4A 3NETA 1QMGA 2X40A 4RLQA 4UHFA 4C3VA 2VSOA 4DE5A 4E1AA 1TEZA 2ZJFA 2G83A 2VH2A 3O95A 3W3AA 4KPGA 5CAEB 5FBVB 5IDWA 2XIQA 1QQTA 4COOA 4B74A 3VAZA 3PIRA 1PJ3A 2EWVA 2O59A 1R5BA 3KKNA 4IG9A 1MB2A 5COBA 4L4ZA 4EMSA 4F12A 1CFJA 4MARA 5AW5A 3PQDA 3O4RA 4NBLA 2JFHA 4UMDA 4DLXA 2R2AA 3M4JA 2B4YA 3PRYA 2R00A 3ZWNA 3SZUA 2GZSA 4MYTA 4U7GA 5ELLA 3M9WA 4EQ6A 3F6PA 3H5AA 3WO1A 4ZCMA 5L4SA 2FQYA 2PG3A 5CA1A 2E3JA 4QWMA 4ZT4A 2CBGA 3LUAA 2CFOA 2QBYA 4DA7A 1VKNA 3LSYA 4NHOA 4EEKA 1VRCA 1MJHA 4IQ4A 4NQRA 1P6UA 3P2OA 4KDEA 1Z74A 2YASA 4F06A 1L5OA 4RDHA 3QJGA 3QPUA 4H3VA 3HYLA 3NRBA 3L1UA 4CL8A 2R8ZA 5IC6A 3H4TA 4GLFA 3ZD6A 2J6BA 4CMHA 1RTTA 4QVIA 4BDSA 4ZV9A 3L06A 3WIDA 2UYHA 3JQ7A 1J8QA 2NTNA 3MILA 3VR5H 1MNAA 1AUVA 4DQXA 1YMVA 2DYKA 2X4GA 4EHJA 4JHLA 1JJIA 4U2FA 3V46A 3WSVA 4QGFA 1QPBA 4HB2A 1Z3CA 2NADA 4FMPA 5K4AA 2GHIA 5KTYA 2QLMA 1LBSA 2TS1A 3C97A 4LZLA 1EFVA 1S2IA 3DEZA 2BGIA 1NJGA 4BMPB 4HY3A 2AK3A 4FGLA 1K92A 5DYTA 5KOYA 3UC9A 4J8PA 5K9ZA 4CCWA 3BICA 2QYHA 1V6SA 5K0SA 4KPEC 1KWGA 2NIPA 3QLUA 4ANFA 3RB8A 3RIGA 5DM0A 1QIJA 2QMHA 3BD9A 3MGCA 4RD3A 2ARKA 5IJWA 1QYDA 1WX1A 4R1TA 4XJSA 1CF4A 2C04A 2B1GA 3KJIA 2I4NA 3EFEA 1F8YA 3QV2A 4P6VF 4RPHA 3RSQA 4AJ1A 2WSSA 1KQGA 3DT8A 1OI3A 5CHEA 2UVDA 4TZ0A 1KY2A 1GYPA 1QIHA 3BWEA 3CZ9A 3M5DA 3Q11A 4TXLA 1XA3A 4JH0A 4D41A 4UEKA 1IEXA 5JQGF 3HA5A 5GP1A 4BQSA 1V47A 3C4QA 3FW1A 1MEJA 5JAMA 5F5NA 1HOXA 2FDRA 1VC2A 1YSCA 1A95A 4BFTA 1G38A 3ZG6A 3OMLA 1PNRA 1YU6A 4M8SA 5AKGA 3JYQA 5A0TA 3PPIA 5H16A 5FPPA 1G6Q1 2HWXA 2Y76A 3O4HA 4PO8A 4PYMA 4G86A 4E1BA 4DXHA 5ISMA 1E5QA 2JKYA 3SWWA 5HOEA 5E6RB 3AJDA 4MUGA 4TT3A 5SICE 5JXIA 1E2BA 3INTA 1ODSA 3F6CA 4ALKA 4KYTA 3D31A 3PXCX 3MD0A 1YZVA 3B53X 1W5TA 4IW3B 1PP4A 2G6TA 1VFNA 1WDMA 2Q2WA 1GZUA 4IV8A 1CBUA 5K20A 3JXEA 2X23A 2QPOA 5EY5B 1UQUA 4P4SB 3PNBA 5AK3A 4LXIA 3S4YA 3GLFE 1XZBA 4ZARA 1TCAA 4U8GA 3T38A 2VYVA 3DQZA 1L4FA 4KGVA 4M9XA 3E9YA 5G0SA 3LWBA 1IM5A 1Q0LA 3EH1A 4IHQA 4EJFA 3PTAA 4BJ1A 4X1IA 2VYND 4F5YA 3OQIB 3IB6A 1YOVA 3RUEA 2HO5A 4PS1A 2QB5A 1BVYF 2XBLA 4M0FA 4DEVA 2JI6A 5FWNA 1SVMA 3GRYA 3CLRD 3I04A 5MFPA 1PEYA 4IIJA 4BCBA 2WF5A 5CFOA 1CETA 3G0BA 3LVRE 5FFMA 3ANSA 1AKUA 3QXXA 2Y27A 4RXUA 4X1KB 3PEYA 1P33A 4KG7A 4BNUA 4PYOA 4DIOA 3A1WA 3A4MA 2IE8A 3OPNA 2BFFB 4OUDB 3FH0A 4U02A 3UFXA 5AM2A 1O9GA 4MAFA 5LQUA 4FJ0A 4MO9A 1QBKC 3O8QA 4NX2A 4C01A 3ZI4A 3HC7A 1P7VA 3E8MA 4ENQA 2JLQA 2PVCA 3DMFA 1AZWA 5JR3A 5LB2A 4Q02A 1Z62A 2I03A 3OQ1A 4X7PA 1HMPA 1YQEA 2IUEA 3HU1A 5HWSA 1JH9A 3SIRA 1PR6A 5BN5A 3HDGA 3GEPA 2O07A 3F4LA 5D84A 5JLAA 2WTBA 1RLUA 4OD0A 5J3JA 1WXQA 3KX2A 1XBTA 3QKTA 4JLKA 4N01A 1VHTA 1WCYA 4N7RA 3VO9A 1BRMA 4MIKA 4KKVA 1MMFB 2H2HA 2DM6A 2Z4TA 3W8DA 5BP7A 2IH4A 4YV7A 4UMEA 1C9JA 3SYRA 4PG4A 5JZBA 1ZL2A 1CUWA 1D2AA 1GLNA 2GNAA 2SKDA 2YVQA 1B41A 1OU4A 3LRXA 2JGFA 4X3PA 1EGAA 3EDCA 2GKSA 2IZ5A 2WU0A 4HYTA 3IQHX 2A1UA 1SZPA 1DAFA 2CLHB 4GBGA 4RDXA 1ADJA 4TVKA 1T8SA 2WJZB 4MMYB 2WPDA 4ZU6X 2J9FA 2YBEA 4NSNA 1RLJA 4CQMD 2GWHA 1APBA 2QRNA 2AYXA 1XTBA 2SECE 4YHHB 1W35A 2VCEA 2XQFA 3CH4B 3W5SA 1HE3A 5KNBA 3R44A 1A96A 4Q3NA 1C2TA 3QXGA 4MZXA 3WWDA 4EAQA 3FYTA 2EG9A 3OEED 1PF7E 1ZIOA 3SR0A 2VP2A 1GTJ1 1NC3A 1PR9A 3PGKA 1TVKA 5JECA 2VP9A 5FLEX 4ND8B 4L8LA 1A8IA 2VAWA 1JTFA 2F48A 3PJRA 2VQDA 4GDFA 4CNBA 1U8FO 2E37A 2O1WA 1WULS 1UKYA 4IDFA 1KFEB 4XIJA 5KYWB 2GN9A 1C0EA 4TTRA 4U00A 2EZ9A 2OYSA 4ESOA 5TJ9A 4ZQEA 4M88A 5K2MA 3W3AD 3U7EB 1NXVA 5F98A 4N3GA 3A0RB 3SX0A 1DWQA 1E7MA 1N2CE 2ZSIA 2DULA 2E87A 1Y4AE 5TXGA 3REOA 4QDUA 4X1YA 2CVOA 4HEHA 2JFGA 3WNQA 3PFGA 3EIOA 3AILA 4FJ1A 1PVVA 2OO3A 2R8OA 1JE1A 4JLSA 1QWSA 5B53A 3UAWA 4B48A 1S2DA 1J33A 1HZZA 3D2AA 4JJEA 3DAYA 4IDAA 1YS9A 4ZDJA 1Z82A 3S2FA 1I14A 5HTOA 2BDUA 3OO0A 5A03A 5JBNA 5J58A 2DG2A 2WE8A 5EYPA 3GCDA 1AQUA 1AXGA 1GXSA 2JATA 2N1MA 3AH8A 3BD7A 4LJSA 3P4UA 2GAAA 4D8WA 2ZQYA 1DWOA 2C29D 3CURA 2NTYC 1REQB 5C1PA 5L4NA 1C2YA 2R8PA 1YOBA 3GHYA 3IQGX 1JEQB 3OCJA 4REOA 3C6MA 3T9AA 1PZEA 5B1DA 4F97A 2HSGA 1GPMA 1Z56C 4GRDA 4W9NC 2FU5C 5DYYA 3HK2A 4C88A 5JATA 3CWZA 3ZXSA 4BNJA 2E18A 4XGIA 1RIIA 2C0QA 1VPDA 1T9AA 1MFZA 2FW6A 2OQ2A 1N6LA 2E89A 4DABA 1E66A 1F1BA 4HYQA 1U5BB 1SUIA 2ZTHA 4AQ7A 1D4FA 3WJ1A 3OIGA 1IYZA 2IZZA 4IVPA 4WZBA 5J2TF 4YVFA 2QNRA 3A1TA 3VM6A 3GLQA 1I2DA 1HEUA 1NKTA 3DONA 3Q3IA 4Z1MA 4EKGA 2YHAA 2FPOA 3OZTA 2IDZA 1EH5A 1KYQA 1ZM4A 3GQVA 1E2IA 1VRWA 4UDNA 3W3ZB 1ZICA 3HDHA 5H9VA 5IW8A 1NXQA 2P3LA 3T35A 2VXCA 2HLNA 3AGQA 2C5BA 1TUBB 3F78A 3KS9A 3PV0A 4YCLA 3DAGA 2XUKA 1C3VA 3PD1A 3BA6A 4YJGB 4ZO6A 3RRYA 1H3FA 3HWRA 2WSSD 1Z2DA 3JQGA 1W94A 1F8UA 2B20A 2V6IA 4KE8A 2GD1O 1IC6A 3E4CA 5HPYB 5JS6A 1F2UB 1E1CA 2YKGA 1OGJA 3FZNA 4L8VA 1XCBA 5JEDA 2X7XA 1EGHA 1LS1A 1CWUA 3DOHA 4UU7A 4ZU1X 1BROA 3PDIA 3OPYA 4CLOB 4ERNA 2HIGA 4V0LA 4P34A 4TLLB 4REQB 1MF7A 2QRVA 1V3VA 2C2HA 4Q9HA 1EJ6A 4M98A 1JDUA 3G8AA 5AM4A 2I6FA 1KNQA 4LHZA 2QYOA 2WJWA 3DBRA 2QAGB 3H2SA 1OH5A 1YDEA 4OHMA 3PC2A 1R4NB 4TT3D 1P7CA 1NV8A 3EQ9A 2IXBA 4GKBA 2R1UA 1G8JA 2IEDA 3NIDB 1L3BA 1N9KA 2GERA 3LAWA 2V8OA 2PBFA 3AUFA 4YTEA 1CIVA 4R1PA 3BSFA 4HLUC 3T5BA 1Q84A 4S0ZA 2PU7A 3NAMA 2BFPA 5FJIA 5KU7A 4E08A 4AJ4A 4E32A 3TGPA 1ECCA 3NJ4A 3VH1A 2ZRCA 1DBIA 1G7RA 1XIVA 3VNQA 2VYVD 2H07A 3PDWA 4BNDA 2YWGA 4MKXA 2L42A 2Q07A 3NNNA 4TLBA 4OGKA 3STHA 4GL4A 1GDHA 1Q0HA 2O0LA 5AYVA 5A1JA 5AUNB 3HY3A 4TM8A 5I47A 3U4QB 1JWLA 5CT6A 5EP4A 3PS9A 2P5TB 3G5MA 4DWJA 4LBWA 2ET6A 1E94E 1FTSA 1GCAA 5C7OO 5JT1A 3L9XA 1A1SA 3BHIA 4A2CA 4DYHA 5G1PA 1HRKA 2B34A 2QSYA 4MS1A 2WUFA 4MXDA 5LLSA 4DR4B 1XWIA 3JASB 1HH4A 2BR4A 2GEDA 4UVEA 1AOXA 1GGFA 1P18A 2J3DA 3T7CA 5KYUA 2XDYA 2ZYSA 3AY3A 4WVFA 1U0HC 2AQIA 2EWMA 2GPJA 2J3LA 1D6SA 1NE2A 3N6RA 3IR7A 4LPSA 3UJPA 1NMXA 2I3GA 1DTEA 2RC5A 4BXOB 3T0IA 4IH1A 5ALPA 2VXYA 1QRAA 3NEPX 3EZFA 1RPAA 3G2PA 5JRZA 5LKAA 3A9RA 2OECA 4HXYA 5AI0A 3DTVB 1NLUA 1YB1A 1I4DD 2ZR0A 1PDWA 2JIBA 4FX5A 4LCBA 3GEBA 3Q5GA 3GLHA 3SC6A 4NEHB 3D2LA 1WF6A 2CMFA 4L0DA 5IJ0B 4C7OA 5EFZA 2ZAIA 1NM5A 3DMTA 1EFKA 1O5IA 4KAAA 4FZ3A 4HVCA 1LTHR 4ZOQI 5KBYA 1BXRB 1C8VB 4PX9A 5LN1A 5LYJB 4BMXA 2Z2JA 1GUFA 3I0ZA 1Z5VA 5DDIP 5JJ5A 2AEMA 3VVCA 4G63A 1NVTA 3WLQA 1VIDA 2CNNA 1MX3A 2WKQA 3C3DA 3H5LA 4IJ6A 1CZNA 4G1UC 1QLJA 4YB8A 3O3CA 4MQ5A 1JALA 2IY9A 5JSYA 3WYGA 4ALNA 4O6VA 1NASA 1G20E 2B69A 3NS7A 2BEWA 4AJKA 3DGEC 2FEMA 5DYNA 1R37A 4S0XA 4MHSA 2XTZA 3C3JA 3HE3A 4QDJA 3ITEA 521PA 2WPDD 3RVDA 1JDTA 1PUJA 2JBAA 3RS7A 1IHXA 5AP9A 1GZ6A 3O8OA 4J6EA 3UQYS 1J25A 2VJLA 2ACKA 4LHYA 3AESB 1DBRA 2X0EA 5BSHA 4CM8B 4NE9A 3UPUA 5KJCA 3OM1A 4AT1A 3FFAA 4IPTA 3ND5A 3HY6A 4LN1A 3ZDRA 2Z4SA 1YU9A 3HXKA 4GECA 2COKA 2EFEB 3LO8A 5CDFE 4L5AA 3EGWA 3AKEA 4QQFA 1N5JA 1MTZA 4CG0A 2DQZA 2O2ZA 1A50B 2XQJA 1L4BA 2ZJBA 3O91A 4XQ9A 4G4SO 4Z0PA 5HE8A 2EJCA 1IG0A 4IQFA 3AINA 4HQ0A 3IE0A 2JIZA 2QTMA 4KQWA 5KTRA 1XEXA 2O1XA 4D4KA 4RF5A 1WOMA 3SLRA 4I9UA 1PWEA 1Z2CA 4NYIR 5H7XA 4XGNA 2B78A 1RSZA 2KJQA 2GRUA 1U2TA 1VPLA 1VLVA 3EW7A 3M4XA 2PX0A 2BY4A 2F8MA 2BEUA 2GAFA 2IYAA 3RM3A 2JLWA 3AFHA 4QOGA 3BBLA 5EZYF 3SZ3A 3AI3A 1USGA 1Z35A 1AN9A 1R18A 1Y1QA 3ND9A 4V0MA 4BVFA 1SB8A 5IZCA 3AQIA 3B78A 4FE3A 1MOQA 1YO6A 3OG9A 1K7CA 2E21A 3E70C 4G5SA 1W36D 1HYHA 4YRNA 1UMCB 4QULA 4FGUA 2BMDA 1ADGA 2NO9A 4LFAB 4IO0A 3AEUB 3RDPA 1A5SB 3VDMA 1R12A 1DAGA 2FPIB 5IBPA 5I01A 1D6MA 4HNSA 5G1OA 1ML3A 4F4DA 2PIAA 3LPMA 3TG8A 3FDFA 2X9NA 1K63A 3AR5A 1DZ3A 1SVNA 3G2IA 3O4JA 1L5VA 2IIBA 3ZWYA 1DBSA 1JHRA 4KX3A 2F6RA 3D8NA 3PNPA 2NAPA 3ZTYA 2FCAA 4Z6KA 5K6RA 4PPGA 2YWXA 2ZI5A 2PQ2A 1UK7A 3TNJA 5EXTA 1TYZA 2WBLC 3O0DA 3O1IC 3TTYA 4CDMA 2VK2A 2VVTA 4GRIA 3L0BA 3PDHA 5FEUA 3RHFA 2OBXA 3BCHA 3R3VA 2W4IA 4I6EA 4ZMRA 1EQ2A 1U0NA 4WTOA 1SQ5A 3LPAA 3NC1C 1JKJA 2CBZA 4Z1MD 3L2OB 5I9TA 3TPFA 3K0EA 2E6UX 3VAYA 4EG8A 4AZWA 3CRVA 4OMUA 5CVTA 4R2MA 3VNAA 4QTTB 1HO3A 2H9IA 4NHEA 1M0EA 3HJCA 4ETMA 3PUKA 4PHGA 4FYKA 2ZM5A 1R0CA 2A0XA 3G7UA 4WBSA 1RHRA 3FYUC 3HL4A 5AK4A 4A27A 4AY4A 2FX2A 1MQSA 1WSDA 4A23A 3C48A 1P19A 2PLWA 5H68A 3KCNA 5FBRB 2AG5A 3W4KA 2Q3MA 4H1HA 3CNQS 4N6GA 4OHXA 2VBGA 4M1OA 4NCXA 4B2PA 1FEZA 3KJGA 4ZOAA 4WOKA 3W5UA 4RS3A 2AFHB 5DLDA 3LUJA 4AX4A 1W29A 2GARA 4CFYA 2QSZA 1Q0ZA 2OC4A 1ESZA 1OV6A 4D6YA 1P6XA 2CN1A 4MWDA 5M04A 1C8KA 4LMPA 2UVPB 1I7QB 2OCDA 3PEEA 4JB3A 4KACA 4OUKX 2I34A 5H3LA 4DIEA 1EVQA 4EF6A 2XQKA 1UFVA 2GPNA 3FB1A 2VFAA 2XAAA 4IXDA 1HDEA 1RAIA 2G9RA 4DVGA 4RANA 3ISJA 4I55B 1Z4KA 1TO2E 1Y37A 1OA0A 2CEAA 1C1XA 3X1YA 1B15A 5JTTA 3EARA 1TCVA 2GB4A 5AKIA 1X92A 1YB7A 2YNMA 3SJUA 4BZXA 3TNYA 3W8RA 1VHJA 1SH7A 2YHSA 2YV3A 3U13A 1P9OA 2IP2A 4PG8A 2ZFUA 4EA7A 3AM4A 5CEJA 4G4SP 2XGJA 3AT1A 1LNZA 3WV5A 4J1NA 2XB2A 4RZIA 5H80A 1DIAA 5JJCA 1LW6E 3PQ3A 3ZQ6A 3OIVA 5ALJA 1Z8HA 4ETWA 3UC5A 2E6KA 2JIMA 1ZO8A 1XPJA 2GEBA 2VUUA 5TX7A 2FMTA 1CZRA 1VHLA 3RYHA 3WR5A 4TOIA 4B6SA 1RXWA 1G21A 1ZM3A 4LNUB 1VSUA 1BQ4A 3FDXA 4JBNA 1G55A 1GNVA 3HCAA 1H2XA 3H4IA 1JXMA 1WV1A 3HN7A 3MC1A 3P2YA 5CT8A 2FFRA 3RYCA 3N7TA 5JAQA 1R27A 2CZCA 3O74A 1YK1A 1R6AA 4L7VA 3MGBA 5CM8B 4PF1A 5TEWA 1H4TA 3LX4A 1R5NA 3E3AA 2ZSFA 5E1BA 1OC4A 3JVUA 4RWEA 4YRMA 2GI4A 2I4RA 2VOEA 2R44A 3OPQA 3V2GA 2AN4A 1ZBDA 1DFIA 5E6SB 1W2WB 2YJ4A 1GFIA 3ISTA 1YB2A 1UINA 4GKJB 3KEGA 4P4GA 1C1DA 3AM3A 1PN3A 3X1XA 3PC7A 2QTGA 4HPXB 3LCCA 1EQAA 5I4BA 4IDOA 4Q4HB 3HDTA 2CFIA 4AJOA 1BYIA 3C6QA 2NXNA 2YYAA 4QFDA 2R00C 2V9CA 4O2RA 2QN2A 2J9YB 3IQIX 1E3JA 3RGGA 1V43A 2Q9AA 3STVA 3GG9A 4DT1A 4PRKA 4YPOA 4KE6A 4TN1A 5LPNA 2KI5A 1QO7A 4KVGA 4BKPA 5B5SA 5K01A 3PX7A 2Y1KA 1V4NA 2O0KA 3PEVA 4NLLA 3I2IA 4YC7A 1XZHA 1R15A 1YMQA 1G42A 3DMYA 1OBVA 4AN0A 2F1HA 5J2UB 1BQ3A 1ZMOA 4OATA 4FVTA 4RY8A 5J1TB 1NYQA 1UANA 2QTLA 3KR9A 3G6WA 5C4GB 4C0LA 3D5QA 4EUKA 4W5RA 2PMWB 3AETB 3C1OA 3SSNA 1BMQA 2C4UA 2HJRA 4OYLA 2YTZA 4XAQA 2PD6A 4KH0A 4F4HA 1XZGA 2YMMA 4ITUA 2RB5A 4R05A 3T7JA 2V65A 4HQNA 3MS2A 1JJAA 4F3NA 3QVKA 4Y2JA 2CD7A 3IP3A 2CNOA 2GYWA 3N76A 1GUYA 3V6MA 2VWHA 4QD3A 2JLCA 2OXCA 2RJNA 3PQEA 4GKVA 5IP5A 3TZEA 4J76A 4CGZA 4XTCS 1E0KA 1GCGA 4BVHA 3PKIA 4NFLA 5AO9A 3OOJA 3P5SA 1YR3A 3RSGA 5IF3A 3OP4A 4PLHA 1H5UA 2QA5A 1A76A 1WZUA 3KYCA 1L4EA 2OV4A 1E3DA 5AI5A 5DHUA 4CLDA 1ZMBA 2GRJA 3KOZA 3B3GA 3GA0A 2HF7A 3PNLA 3V2HA 4XIGS 1EDEA 1SFRA 3OZSA 1Z7YA 3QFFA 3GN1A 3QLUC 4HB0A 2UZ4A 4HNGA 4L22A 2JIZD 2OY0A 5CM2Z 2PGLA 1XRNA 5K5EA 1PT6A 1M34A 1QAQA 1UKVY 4LJLA 1GGKA 1GAJA 2OB1A 2ZDQA 3OKPA 2P68A 4EPRA 3UJ9A 3A6LA 1H0KA 1TZBA 2L19A 3PA6A 3CUYA 2Z6VA 3RTDA 1QRUA 3HFRA 3P2MA 3RPEA 3LUBA 2AT1A 3LP8A 3CMMA 3U9SA 4XJTA 5AKXA 4TUYF 4IUYA 1T1RA 4A8JB 2W4MA 5CFRA 1GFZA 3DQQA 4JUIA 3IT1A 4EF4A 5TT0A 1L1RA 3BCSA 4HI0E 4IP0A 1C0LA 2JGJA 2NSHA 1DP4A 1E2FA 4BUCA 3KBOA 2WSLA 4B45A 1LB1B 1WDTA 2EJTA 2PZLA 2R6CA 3U09A 3AVOA 3H2YA 1A7AA 5GTDA 2A9VA 3E22B 3STTA 3OLXA 4BMNA 3BGIA 1E7SA 4JT8A 4EIWA 2DHEA 1TM4E 2VJMA 3I23A 3IAS1 4QPJC 1JRLA 4EGSA 2Q28A 1LSOA 1NE7A 3IAAA 3MAAC 1E2EA 3MAJA 3MZ0A 4EG6A 2HI0A 3SC2B 1EJ0A 3QU5A 3UK6A 2XVYA 4P81A 4AQYB 4RK7A 3G2LA 4CI0B 2E4VA 4LVUA 1KEUA 4BLUA 2QXYA 3ZBPA 4LGYA 1X70A 3LI2A 4ED9A 3LW8A 1A3CA 4KL8S 3R7WA 3KD2A 4XB1A 1XZDA 1KO5A 1GVHA 2ZSDA 3O2SB 4TYPA 2B3TA 4Z86A 1EFDN 3MJVA 5AM3A 3JU3A 3BRSA 3NAGA 3H1PA 2CHQA 5BORA 4GKKB 4DC0A 1B76A 4FSDA 1Q17A 3ICPA 4UU1A 4B3CA 2SKCA 8MHTA 1RCFA 2IXDA 4S24A 3A32A 2I3DA 1Z45A 4QM7A 3HG7A 1QPZA 4US1R 3B1YA 4PAMA 4XYGA 1K7EB 5ALYA 2NTEA 1E7RA 3D6VA 2X8LA 3GQBA 1JWBB 2HEIA 3ZXXA 4BV2A 1FU4A 4EW3A 1NN3A 5J1SB 5KDLA 1F3LA 4L1KA 4QYWA 3FOZA 2ZB4A 4IS2A 5BMVA 5LZ9A 4L8GA 3GU3A 3NANA 3WKAA 3WYFA 3A1EA 1JDSA 1NXPA 3KLBA 2ZKLA 4H7HA 4IG4A 5ALVA 2WIKA 4OBXA 4XDHA 5EE3A 3R5HA 4LYEA 4RHYA 1HYQA 1LRKA 5I8PA 1DPGA 3K6SB 4OI2A 1TX4B 3P97A 4JKYA 1TJ5A 1K4YA 3GD5A 4FLFA 3VV3A 1G4HA 3LZCA 1NWCA 2JGDB 3QLTA 4QC2A 2IOYA 2REXB 1EWKA 4KQCA 2J9XB 3OJOA 2AOTA 2W6QA 1ITZA 3FIUA 4R0VA 1XRPA 2FN7A 2OG1A 4WT7A 5IJAA 5LQMA 4I99A 2HNKA 4TSRA 4AMVA 3V7NA 1AGXA 1NRXA 3IT3A 4H17A 3QOWA 2WP0A 4D4IA 1EJ2A 1PD1A 4JI6B 1D4OA 4FLEA 4W99A 4W1QA 1SD5A 1F2DA 2ZTMA 3V7YA 4YO8A 1MJ5A 2HCJB 1HKHA 1R6VA 5KB3A 2B2CA 4Y0AA 5HS6A 5TB5A 3D6FA 3JS5A 2I9PA 1FXWA 2YNMD 3CH7A 4RMIA 5CVVA 2QOEA 1ZD5A 1YGYA 3UBMA 5I7RA 4D9MA 5KYXB 2BD0A 2PKEA 3J81A 3S29A 2GA8A 5AJVB 1CUUA 3V8PA 2ISSD 2P9GA 3MJDA 1U8TA 1JIIA 1PK7A 3PUIA 4JYCA 1EXVA 2Q3HA 4UUAA 4Y1FA 1W59A 3OQHA 2X6TA 3QWBA 1L4HA 1CZOA 3H16A 4TTTS 3VNBA 2Q4BA 3BAFA 1YBAA 3CTMA 3L8CA 3T3EA 3UW3A 4FBGA 2Z83A 3ZZ1A 1AO0A 1SVLA 1UT6A 4L4XA 3AX6A 4WKBA 4OGFA 3L0YA 2H11A 1Y5MA 3C5EA 3IXLA 3T7IA 3KQKA 1OBOA 3D8BA 3ZXUB 2HK9A 4JELA 3BL8A 3LUKA 3E0QA 4WFQA 3UKOA 3WFJA 2CWWA 2CUNA 1NUTA 4PY2A 2M98A 1OAOC 5EERA 5ERXA 3OSZA 1WMSA 4IHJF 3LC7O 5CUQA 3O84A 4ZJUA 4ZU3A 4FXPA 1WLYA 4QUAA 4NCNA 3ZK7A 4YRGA 4NBRA 4AL4A 2H92A 1LVHA 4ISBA 3JQPA 1QQBA 5I5EA 5H9WA 3V9PA 2R8EA 1HZZC 1EP3B 1UPCA 1D7AA 2EFHB 2PT9A 4I5IA 1HRDA 5KNCD 4BUJA 1ZVVA 6Q21A 3KVRA 1F6WA 1DBWA 2C3MA 2JGKA 3FSJX 3NX4A 4B85A 1YZHA 5JV5A 4QM6A 1KMQA 3G5TA 4MUEA 3LVBA 1S4MA 3TL2A 3UMYA 3CONA 1ZHOA 3AEZA 1FA9A 2JC3A 4OFZA 4EDHA 1W36C 5EKDA 3R4CA 3PZRA 1F7UA 2OV3A 3CLSD 2LCFA 2D13A 4A6PA 2CVPA 3B6IA 2VCHA 2WVAA 4NARA 4EL0A 4NCBA 3I5AA 4G5YA 2FQ1A 2FHSA 1FTYA 1YJXA 5T3UA 4C5BA 5B7NA 2F7SA 5BWMA 3RAEC 2FJUA 1FUKA 2FQWA 5JXHA 1SXJE 4KAFA 5DXFA 3GK3A 2MMCA 4P3KA 4Q66C 3KAKA 4PVDA 2QN7A 3DBHB 1HF3A 3D7SA 3UXHA 1GQRA 3FJYA 2NU9B 4PHTA 4X20A 3RK1A 3BSWA 1T5DX 3CZQA 5M5BA 3WAJA 2ODAA 1PQ4A 4OP1A 4B6QA 2DQ4A 2Y0PA 3C6ZA 1IN7A 2FHPA 4IOJA 4ZCSA 3P1JA 2JK0A 3QX7A 3WLLA 5J40A 5BN3B 2OM6A 2I67A 3FPSA 4O5AA 2PGIA 3DOOA 5I7EA 3IC5A 3ZH9B 3EWNA 3OPYI 1ENPA 2QD1A 1J99A 3RJ9A 3C43A 2UKDA 4MS4A 2FP3A 2PUHA 4HNHA 1Q15A 3UMRA 1DU4A 1T5BA 4BQEA 5LMCA 4OJYA 1R66A 5DSTA 3LPLA 4CWAA 2B4QA 4IICA 5FUVA 2ZBVA 4Q3OA 4XPIB 3PYXA 4S05A 1WQ1R 2WUEA 2P5YA 4FW8A 4FFDA 3IEIA 1K5DA 2WHYA 1Z5UA 3JARA 5EPUA 2FEPA 5FPKA 1X0XA 2NX2A 5CJJA 1THZA 4DKXA 7REQA 1ZRHA 4OLHA 5E6UB 1R9NA 4IRXA 4PX2A 1E59A 3PZBA 4WBNF 3EULA 4UOZA 3GH1A 3EVZA 1Z5WA 3H84A 1O58A 1JUDA 4YYZA 3EDQA 3WLMA 1RE1A 3IV6A 2FPWA 3EEBA 2QAJA 2DETA 1FF9A 3BJIC 1TTQB 4UHDA 3DB1A 2Q45A 8GPBA 2QE7D 2WABA 1TM3E 4OLAA 5KOIA 1TJPB 2ZWVA 4XIFA 1RAHA 5AIBA 5HIAA 1DKOA 2XR1A 3G7NA 1Q1EA 2BFDB 3EZGA 1IL0A 1LSUA 2ANBA 4ODIA 3NALA 1U5CA 3M3DA 2VTBB 2ZI7A 4MDYA 1RM4A 3G2KA 1NVKA 5JS1A 2PAAA 4RSGA 3USZA 1J21A 1HLFA 2Y9MB 3IQZA 3R5SA 4UVHA 4GI2A 5AOVA 1Q0TA 4BNTA 4R6WA 3R5KA 4FN5A 1I3CA 3EISA 1CY7A 1D2RA 4JJKA 4LE0A 3WNCA 3LUGA 5TY0A 1NQXA 4A0FA 2X76A 4TL7A 1CB7A 4E88A 1BS9A 2Z3ZA 4NU6A 2AC4A 4WJKB 1OJ7A 3G49A 2G63A 4JI1B 3ZHVA 2AA3A 2CNWA 1TGYA 1SHUX 2PANA 3C3WA 1JKIA 3E18A 1BFDA 4JYMA 1Y9DA 5DNAA 3ZOKA 2O4UX 1CUXA 1KMHB 2GM5A 4Y8VA 1P6QA 3AERB 1KR2A 2FI1A 4V02A 1SIBE 4C21A 3OCUA 4F91B 1RABA 2OZVA 5TJHA 5CB4F 4IHKA 2DC1A 2QMYA 1H42A 2BFCB 3FGZA 3GARA 4O8CA 1CUHA 4CCSA 1TRKA 3K9HA 2LCQA 4NMMA 2PX6A 2ZIFA 5KCMA 1WUIS 2JFZA 2OAEA 1HLGA 4FFOA 4BTEA 4IUDS 1FP4B 2K4MA 1UC8A 4Q3BA 3O8NA 4LDJA 5MGBA 1I0LA 3A6PC 1D2MA 1MEOA 2IVZA 1LDNA 3KPJA 4JV5B 1G8SA 1B16A 1NN5A 2QHXA 3Q8XB 5DHFA 1N32B 3LC0A 3UOGA 1YL7A 1NVVR 5TF4A 5L9AA 1U1DA 4RW0A 1QTQA 4CUZA 3JQ8B 2F1OA 3IVAA 5ALQA 4ZAZA 4GM1A 2OO5C 3HCDA 3IQWA 5REQA 1AIPA 3VDNB 5DWDA 2QE6A 5K3SA 4F6CA 1MPXA 3ZWPA 1NM5C 3DMTC 4NZYA 5HCIA 5HGJA 3V33A 3C41J 1DIBA 2IW3A 4K9QA 1GNPA 1RI3A 1U1FA 1D6NA 1K8ZB 2PKQP 1X1RA 2G07A 3OTWA 1L4MA 1XMIA 4GF5A 4R5MA 1FDSA 4CLEA 4CKEA 2ZJYA 2QUKA 1ZCZA 3QI7A 4NXNB 3V8NA 4M7WA 4D9JA 3U3JA 4HDRA 2WA2A 1XLVA 1GQYA 3KHUA 3N28A 1I6KA 3FHCB 2XTAA 3OKFA 4R9NA 2HFJA 3WL8A 4JLPA 1PFGA 4V3CA 4QAJA 1K6MA 3LUFA 3DKIA 4QODA 4ND7A 1XQ6A 3D6JA 1MD9A 2XZLA 1O6CA 3I6MA 4GX0A 3H5WA 1Z6QA 4HLCA 4DADA 2W5UA 4HKTA 3TKLA 3TX6A 5ECYA 2WVJA 2H5IA 2H0RA 3M49A 1SXIA 1ZRNA 3L9WA 4HNAA 4FHCA 3TAXA 5EOVA 2ZSUA 4B43A 4LJ6A 1A2KC 3T61A 3VYVA 1K27A 1TXGA 2Q3EA 4YDSA 2W2MA 5EGNA 3SNHA 3TZQA 3WBFA 3ZY6A 4YXWA 3H2ZA 4JLJA 3L8HA 1U2DC 4BY9E 1KYWA 2QRZA 4RGBA 1K6JA 3L79A 2Y4NA 5TSDA 3S70A 2QG6A 1U0SY 1UDWA 1TJ3A 1IHYA 3HU3A 4NBSA 3ZR4B 5JS2A 4BFLA 1TYCA 3JAKA 3AUTA 5HKKA 4W9MC 3KELA 2G6BA 4UZEA 4NNJA 2B4AA 1SUFA 2R79A 3H83A 1U1CA 1UZUA 2R6AA 4IYRA 4FFVA 2ECKA 3RKRA 4C7XA 3BWCA 2Q2VA 2H06A 4QJ3A 2ZXEA 2I91A 3WNBA 4DQUA 2JGLA 2QP3A 2QTCA 3QVLA 3TXAA 3UBTA 3MB8A 2EVWX 2OOSA 3PXXA 2CYAA 4FOPA 4YY3B 3UGQA 3KM0A 4I2VA 1KPGA 2WSYB 4MGHA 3H1TA 2HIAA 2XYQA 1F14A 3NBAA 4YCDA 3WJ7A 4DDMA 1JR3A 3D7KA 3U6KA 3CPHA 4ZC1A 1C1YA 1W581 2H1VA 4HXEB 5H0IA 1V7CA 1E1MA 4GU5A 4MPRA 1W0JA 2IUSA 4TSFA 4YS6A 2DTEA 1TC1A 2G17A 4IEEA 2VSQA 4QNNA 2Z8YM 1JS1X 2Z6UA 1P3JA 2AJCA 4CM6A 4RVNA 2ZCJA 1S3GA 3E7FA 3R7BA 3WLSA 5KCZA 4PYIA 1Q5PA 1G1MA 2YC2C 3OT5A 4MWBA 1NMYA 4RD0A 4ZOCA 5EUMA 4E13A 1JHXA 7ADHA 1IBKB 9MHTA 1A4UA 5T64A 1XHLA 1DXYA 3EMBA 5DYWA 5KNCH 5FTMA 1YZLA 3UNXA 3BD6A 4QLBA 3LRPA 4YJDA 4MUKA 3TR0A 2NMVA 2NO0A 1QIMA 1YVRA 2PRKA 1ZS9A 3GMTA 3MERA 4PTYA 1J22A 2J31A 2P67A 2WHQA 1IY9A 4HQFA 4HRXA 2HZBA 3HU2A