3KB1A

Crystal structure of the nucleotide-binding protein af_226 in complex with adp from archaeoglobus fulgidus, northeast structural genomics consortium target gr157
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
255
structure length
243
Chain Sequence
RVTDEDIKERLDKIGFRIAVMSGKGGVGKSTVTALLAVHYAKQGKKVGILDADFLGPSIPHLFGLEKGKVAVSDEGLEPVLTQRLGIKVMSIQFLLLIAGMIREFLGRVAWGELDYLLIDLPPGTGDAPLTVMQDAKPNGAVIVSTPQELTAAVVEKAITMAEQTKTAVLGIVENMAYFECPNCGERTYLFGEGKASELARKYKIEFITEIPIDSDLLKLSDLGRVEEYEPDWFEFFPYLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target GR157
rcsb
source organism Archaeoglobus fulgidus
molecule tags Nucleotide binding protein
molecule keywords Nucleotide-binding protein
total genus 60
structure length 243
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10609 ParA NUBPL iron-transfer P-loop NTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kb1A01
5CLQA 2YC4C 2I4IA 1NLZA 1L8QA 2GESA 4A15A 3AVTA 3K0CA 4B6FA 4YMSA 1XCPA 2QU8A 1A2KC 4OHVA 2GJKA 3CF0A 4C3ZA 1II9A 1AZSC 1J7KA 2WIBA 5JWHA 1GDDA 5TMPA 1P3JA 1D2MA 4NDZA 3TSOA 2ANCA 2WHXA 4NYIR 3NIBA 4Q4LA 3BB3A 4B3DA 4NL4H 1ETUA 1NJGA 3GEEA 1KMHA 4X8OA 2J0SA 3NDPA 3CRRA 2YVUA 4QHSA 3AVVA 3UWOA 5FOTA 1DOAA 2JLRA 1Z47A 1UAAA 5J4KA 4HB0A 2RHDA 3DZDA 2D06A 3T1OA 1KAGA 2ZR0A 2CEAA 3PUWA 4TYPA 3CLVA 4WAUA 4ZKEA 3WMGA 1MO6A 4IW3B 4PSKA 1NN0A 4PSVA 4GOJA 2N1BA 2WWGA 3DZ8A 3H84A 3QQ5A 4JKIA 1FL9A 4A9AA 2CDNA 3TE6A 3U3KA 3W5JA 4B2PA 1JBKA 1GITA 4XOIA 1E1QD 4HLUA 5FL7A 5TVKA 2ZSBA 3RS4A 2XZLA 3X2SA 3B78A 2QAGB 1JXOA 2EWWA 2GZHA 1GOTA 3KUCA 3ICEA 3CZQA 5F3WB 3EXAA 2YNMA 4DLYA 4ESVA 3FVQA 1XD2A 4ZCIA 4AKGA 4HZIA 1NI3A 4NP6A 2CHQA 4XVRA 3HU3A 5FUVA 3V9PA 1LW7A 4CEJB 1UDXA 4PFSA 4JVLA 5J4HA 1CJTC 3NEYA 3SFZA 1FTSA 3LNCA 2AK3A 4MH0R 1B23P 1Z0AA 4JLOA 4BFXA 2OAP1 2PX3A 2R6GA 4DDWA 4TMTA 2JLVA 3GLFB 1EFRA 2WPDD 1NLFA 2IXFA 1G9XA 3CBQA 3KFXA 2IYZA 4BLRA 2DFNA 1E2LA 1XD8A 3Q3JB 1ZC3A 4CEJA 1HQCA 2WSMA 4BLSA 3SE0A 1R6BX 4JSTA 4MKIA 4C0BA 4V03A 3GLGA 4UXJA 3GLHA 1U90A 1SHKA 4V0KA 5DSZA 2F1HA 4JVSB 1NY5A 4IDQA 3FKQA 1DADA 3R8FA 1TF2A 4DLVA 4D0NA 2NPIA 3OE7A 5KPJA 1XPUA 2CNWD 4NCKA 5DNYB 3L82B 5EZ5A 2ONKA 2ZU0C 3ZS8A 2XX3A 1SHZA 4HDQB 5EJEA 2XZPA 4D2IA 4E09A 2VPPA 1S2MA 1XXHB 3DM9B 5IRCD 3ZD7A 2R44A 2RGXA 2CMKA 4UKDA 5CIWA 1N6PA 2HYIC 4TMWA 5P21A 5AJYA 2REXB 4BFZA 1JB1A 1SVLA 4V0OA 2C95A 4UXHA 1ZD8A 2MMCA 1G5PA 3U60B 2OCAA 2G0TA 2LKDA 4M9SA 1MRNA 4URZR 1S3SA 3RS7A 3FTQA 4KYUA 2D4HA 3JZMA 1KO1A 3B6EA 1GWNA 4LJYA 4CGZA 2GWHA 1H8HA 3G82C 1E9BA 2X2EA 3DOEA 5JI2E 1IQPA 4WZBE 4F4IA 3GFTA 3HYTA 1CP2A 1UPTA 4OI0A 4HUTA 2ZUDA 4O2LA 3QSYA 4Q1BA 2JA1A 1A82A 2X1VA 3BERA 3GJ3A 1II8B 2C2HA 1R0XA 3ZIAD 1GFIA 1NIJA 2Z4SA 3AVOA 4HSEA 3WXMA 2DR3A 4MGIR 3ZIAA 3LFUA 2PJRA 1ZNZA 1ZD9A 1UBEA 1HH4A 3BXZA 3ZZUA 3A37A 3I4LA 4NE2A 2IS2A 4PO1A 3AVYA 1H65A 1NG9A 2ZJ8A 1AS3A 3NDBB 5FR1A 1W49A 2QSZA 3P27A 5LBIA 2GK6A 1IOZA 5IF9A 1OKKD 2UKDA 3Q9LA 3QXXA 1KSGA 2HXSA 2W2XA 1LB1B 5KSOA 4G5RA 3T1QA 1BH2A 4ACBA 3EIQA 2ZRAA 4Z8XA 1CBUA 3CR8A 1S9HA 1L2TA 2C9CA 3QXJA 4I1VA 4ZIRB 1N2CE 3PCRB 3KKPA 2CHVA 4QNRA 4HZUA 4QJ4A 4U5XA 2UZIR 2H16A 2ZRKA 3SHFA 2KB0A 4U00A 4B76A 2IUTA 2WV9A 1WCV1 2QY9A 2ZYTX 1VYVA 1QHNA 1LY1A 3EZ6A 4BFSA 4AK9A 3QIAA 1DAKA 2J45A 4P4TA 4W5WA 4Q9IA 1G64A 1TMKA 2BC9A 3QNUA 3DKVA 1W5SA 4M1TA 4RSGA 4V02A 4II7A 1OF1A 3L2OB 4F4JA 1N25A 1FZQA 1OH8A 1HQYE 2X77A 2WSSD 2ZSFA 1G4AE 1KYIA 4LJAA 3IO5A 3SOPA 3CNNA 3PG5A 2BBWA 4KLZA 5HR5A 1YE8A 2O8BB 1E32A 3B1XA 3B1ZA 4TQAA 3ZVNA 4S35A 3FOZA 1N6LA 4MKFA 1NG1A 4OJKA 4OHWA 4NCNA 5TDHA 3UMSA 4G5OA 1F48A 1XBTA 3CPHA 1EFRD 4I1UA 3SNHA 2FMXA 1JPJA 3KJGA 3PVSA 1Q3TA 2IEYA 2ZYVX 3K0EA 4CEHA 1KSFX 4EPRA 1CJUC 3ZVRA 5J4YA 1JNYA 2SHKA 3GLGE 3RRNA 4B3XA 5FTJA 4DLXA 4PQRA 4NYMR 4R9UC 3AEZA 2WKRA 2DYKA 5FOXA 2DHRA 4EJSA 3TW4A 3WBJA 2G6BA 3TAUA 1ZU5A 1G3MA 4DCVA 1U8ZA 2CL6X 3U3JA 2QGNA 1KZGB 2OAQ1 3DO6A 1E94E 3Q5DA 3Q85A 4TZ6A 4LYAA 3EZ9A 1E2MA 3E2IA 4PQFA 2OILA 2QNRA 2QAGA 3WP0A 3VKGA 1M74A 2FNAA 2OBNA 3BE4A 3RLFA 8OHMA 1KMQA 1E4YA 2X19A 3LO5A 2O8EA 4RD3A 4KO8A 1PLJA 2JLZA 2XXAA 2A5DA 4DLZA 5EP1A 5FUXA 3RRYA 5GJWC 4EJSB 5L3RA 2IYRA 2P3SA 2QRZA 2V6JA 2BBSA 4OK6A 2J7PA 2XSZD 3QEOA 2WMNB 3AGQA 4OHXA 4US0R 2FEMA 3VU9A 4B48A 3GJ0A 3U6BA 3VR5A 4KVGA 3U5ZB 1E0KA 1E9AA 1PZNA 1LTQA 2VHCA 3C5CA 2A7QA 3FPAA 4IVRA 1R4AA 1VTKA 1BO6A 4ZCMA 5K8UA 1XP8A 4N3NA 3AVQA 2NO9A 3IEVA 3IHWA 3F5FA 1GKIA 2XTZA 3AGPA 3KXKA 2C96A 1KK2A 5B64A 3OEHA 4FCWA 2ZR7A 3C7KA 4GT1A 4NCIA 2KE5A 1KHTA 3B1WA 4DCNA 5JSZA 3OAAA 3PUVA 3W9YA 2GBLC 4C4PA 3W8NA 2QZ4A 4KODA 4NPHA 1FX0B 4DLUA 1AKEA 3DDCA 1UKEA 5LB4A 5LD2C 1DAIA 4LK2A 2IS4A 4AG6A 1IY2A 4F91B 2PMDA 3UPUA 1U8YA 3RWMB 2W0MA 4ABYA 2YWEA 2Z83A 1FTNA 4A8JC 2PZGA 2NO1A 4B73A 1G291 2BHRA 4JJZA 3MWKA 1KNQA 1LF0A 2J0VA 1G3RA 3BFKA 4QGHA 2VSOA 2Z4RA 3RC3A 3KQHA 2RGNC 5FOSA 3U44A 4QM7A 4AY2A 2D2FA 5FPHA 2GJAA 3W34A 4MGKR 5EE5B 4JS0A 4PZZA 5JS7A 5C4GB 1M7BA 4TQUS 4F93B 6Q21A 2FZLA 1KI9A 5FUYA 4D4MA 2V1UA 3H86A 2O8CB 3FMIA 4EIWA 1G4UR 2NOAA 2FEOA 4M1WA 2ZS9A 2QP3A 2QMOA 2GRJA 1IN6A 5B57C 3DPUA 3GJ8A 4O2RA 4UQOA 3UG7A 4D4KA 1VG1A 2ZE8A 2FPLA 2GCOA 4PPQA 1W44A 2ORIA 3K1JA 3OIYA 4LJ6A 3CH4B 3KDSE 3O8BA 2C03A 1XPRA 3ASYA 1W4BA 2ZRNA 4DUGA 4PZYA 1OV4A 2VP5A 1MO4A 4Q9KA 5C18A 2QQEA 2YV5A 3TQCA 1T5IA 4QBGB 4LHXA 3U7GA 4NONA 2ZSDA 4WXPA 1KDPA 2ZXUA 1AJEA 2XOKA 1MV5A 3GLHB 3AH8A 1G3QA 2WWFA 1SVKA 4UNQA 5HZKA 4ARZB 2EYQA 5IT5A 1OFUX 4JYBA 2O8DB 1NMZA 5FTMA 4XTCS 2V54A 5FOUA 4OHYA 2WAXA 3OE7D 4HAUA 3H2YA 1G20E 1XEXB 4FWIB 4RCYA 5H70A 4IKEA 1F2TB 1SQ5A 4LC0A 1L4UA 2F1RA 2PBRA 2R65A 3SJZA 3L8ZA 2HYDA 1T8UA 4RCZA 3T1VA 5JFGA 4M1SA 3EZFA 2O8DA 4C0JA 5DGXA 1Z6AA 4Q7JB 5CB6A 5BN3A 1W0KA 4F92B 1S3GA 4HAWA 4PAOA 1DO0A 4Q9JA 2MMGA 1P2UA 2REOA 3S1AB 3GLIA 3RS5A 3DM5A 4TL6A 2A78A 2ZANA 1GNQA 4D4LA 4BFUA 4X8HA 3KB2A 3O8CA 4M1MA 3U3MA 221PA 2QUZA 4HAVA 3FKSD 2BV3A 1S1CA 1OB2A 4JJKA 4LWZA 2BOVA 2Q9AA 2DBYA 2Z6VA 3B85A 1Z07A 4IDPA 4MRVA 1E9RA 1Q57A 4HI0E 1MR3F 3SYLA 4E5UA 1F2UA 2NO7A 1SKQA 2WJYA 3FFAA 1NRJB 4FW9A 4P4SB 4URVR 4AG5A 3UMFA 1W36C 3RS2A 2IF0A 5EXXA 4A4DA 2O5VA 4TTRA 3THYA 4LV8B 4CEHB 5J4VA 1YZQA 1QVAA 2ZVPX 1FUKA 1G7TA 1VG8A 1DAHA 2BCJQ 3QOFA 3GD7A 3A1TA 3HPRA 3TLXA 3KL4A 2ZM5A 2CXXA 3TW8B 1GILA 4HLQB 3BOSA 4NYIQ 1XMSA 4C2UA 1XNJA 2GK7A 2GJ8A 2RHMA 3KQLA 2CCJA 1M34E 1MKYA 2NO6A 3N70A 4BFWA 3WHKA 2QRNA 1FPMA 3KB1A 4G0NA 1RRGA 3K0FA 1U0JA 3ZLJA 1SGWA 3FDIA 3U6KA 5HKKA 4L8GA 2BJWA 2J46A 4MRNA 2D7DA 3ND9A 3CB4A 2GA8A 2V6IA 1TF7A 1I4DD 2DPXA 2ORWA 4V0NA 4Q4JA 3I92A 3MJRA 1DO2A 4A8JB 3WYFA 3K9GA 4OQXA 5HZHA 5KU1A 3GP8A 2J41A 5JWRA 3RAPR 3LD9A 3PEYA 1TQ2A 3CWZA 2VBCA 5EUQB 1YZTA 2ZU6A 1AIPA 4C7OB 3BK7A 1Z6XA 3WHLA 2A30A 4FCVA 4IVQA 2QG6A 4DC9A 1NLYA 2ZRDA 1GAJA 2BJVA 1WXQA 3U3OA 1G5TA 4B33A 2JIZA 4ZDIA 5DH9A 1CKEA 4JBWA 5BN5A 4IEEA 4N0EA 1V43A 5EE0A 3SC3A 1WDTA 3ZS9A 2LCFA 2ZRIA 3DEFA 3GLIB 3JVVA 5KDDA 1WA5A 1QG4A 4NCHA 4LYJA 1WBBA 1ZNXA 4DWJA 4RKEA 4GDFA 3QBVA 2ZUBA 4Q7MB 4LCBA 1US8B 2J0UB 4BRUA 4IEIA 2OUKA 2XNDA 4RKFA 2QTFA 2JCSA 2YWGA 1VG0B 4I81A 2IX3A 1CR2A 1N6HA 1R0WA 2XNDD 1SULA 4XWKA 4BE7B 2F1JA 3HJNA 1ZM2A 2PCJA 1MABA 2WPDA 1OFTA 1D5CA 4TMXA 5CJPA 2QPTA 4DDVA 2WJVA 3C15C 5LDDC 3WBKA 3V4FA 3I1FA 3O8RA 3OFND 3OEED 1X6VA 4LJ4A 1P2TA 3TSWA 3A1SA 3DVLA 2HLDA 1ZC4A 1Z6YA 1EWQA 1OHHD 1CJVC 1Q20A 1YZLA 3ETLA 2GDJA 5TXGA 2GILA 1NMXA 3GQBA 1RJ9A 2GKSA 5FPSA 3TUZC 4QHYA 2ZYWX 4JBYA 3OF5A 3X1DA 4Q00A 3LWNA 5GJVC 1VPLA 1ZIPA 1Z6TA 2W2TA 2ZRFA 4TLDA 5G3ZA 3W8RA 4OHZA 4A2WA 3W6OA 4LJ5A 1GRQA 3BFXA 4ZDWA 4Q47A 1BKDR 3GJXC 3LVRE 1NP6A 3P26A 1QVRA 4D6PA 1OIVA 1E2NA 1MO5A 2GHIA 1TL7C 3MG9A 4P4UA 4TSFA 4DLSA 1TEXA 2JLYA 2W83A 4WZAE 3T5DA 5KPDA 2FFQA 2NZ8A 3FGNA 2IS1A 2DFKB 3VAAA 4PHHA 1AGRA 4LPKA 5F9FA 1YKSA 1NVXQ 3ZH9B 1VMAA 4HZUB 1P5ZB 1AZTA 1V5WA 1GRRA 2QTVB 4I4LA 3QENA 2IHYA 2P0EA 1XXHA 5EE3A 3SZRA 5SZHB 3DOFA 3VTKA 2DY1A 1YR7A 1Q1QA 5AJVB 1EXMA 5FTKA 3H4MA 2GXUA 3CX8A 4M53A 3AVWA 1R8QA 1OH7A 3QKSB 3EWAA 4PANA 5FTLA 3GJ5A 1PLKA 3QKUA 2BCGY 1NVWQ 1J99A 3RRMA 3T1TA 1R2QA 4FMBB 2BVNA 1FMJA 2IW3A 2WWWA 3NH6A 2GTPA 4H9GA 4Q48A 1OH6A 1KO7A 1ZU4A 4ZDKA 3B60A 2BMEA 2O0HA 3NWJA 4E07A 4TLEA 2C99A 4A0GA 4BFVA 1TNDA 3Q7PA 1LVGA 1MRSA 3MUFA 5FL3A 3WNBA 1Z63A 5CIQA 3SFVA 4J0QA 1J8MF 3EZ2A 4W5HA 2RGDA 3SN6A 5F98A 1E2JA 1K5DA 1E0JA 1YR9A 5BW8A 2GEDA 4RZXA 1KIMA 2ZJBA 5C2JB 2DWPA 1RW4A 3THXB 1RIFA 3MFYA 4LHVA 2P65A 3CX6A 1EG7A 4IOJA 3CH5A 4LV6A 3K70D 4QM6A 1XTKA 3MCAA 4DBLC 4PO9A 5EUMA 2P5SA 3PR1A 4FWTA 2PL3A 4Y0VA 2YJTD 4UNPA 4PPGA 1SXJC 5CM9C 4ASUA 2F43B 2WJGA 3T61A 2DWOA 4GOKA 4I1OA 2P6NA 3U7FB 4HDOB 1J70A 3CRW1 3EIHA 4NBSA 1N6IA 3NH9A 1OIWA 3QG1A 1JAIA 2GZAA 2HDNB 4MRRA 1WB9A 2VHQA 1TEVA 1HTWA 5BQ5A 2F6RA 2F7SA 2V1XA 3KZ1E 3B13B 2RAPA 4MGZR 2QBYA 1ZRHA 2EVWX 3SDZA 4RD0A 1XEFA 1P9NA 2J5XA 2ZYUX 2XOKD 2QMHA 2FSFA 2CE2X 3B8HA 3F3YA 4EQ6B 2YKGA 1KKMA 4LBWA 3UMRA 2NTYC 3CIOA 3LBHA 5SZKB 1OFHA 4JLPA 5DI3B 4DDUA 1UBCA 4GMDA 1DG3A 1FMLA 1A1VA 4IDOA 3QE0A 5G40A 1NJFA 3B1VA 1ZVQA 1VCIA 1GIAA 3EPJA 3LY5A 1IM2A 2GF9A 3B9QA 4OJQA 3GJ7A 3ONWA 5CK5A 3MWJA 1TQ4A 1Z06A 3PITA 3PEWA 2AL7A 4ASUD 1OKKA 1E0AA 1ZD1A 1E9FA 2VF8A 1AS0A 2D62A 2C9YA 2DWQA 4G1UC 1KSJA 2FU5C 3HWSA 3BH0A 4PXAA 2N42A 2HXYA 4BFYA 1G7RA 3AP3A 3A1VA 4PC3A 3I32A 1F2UB 4JYCA 4BGDA 1W7AA 3UXMA 4WZ6A 4A2PA 4XVQA 1GNRA 5L8VA 1KI7A 4MDFA 4PPNA 1FQJA 2LKCA 2FOLA 2EQBA 2ZJ2A 3EPLA 1N5JA 1P73A 3QEJA 1KK1A 3SI7A 1X1SA 1KJYA 1ZAKA 3AQ4A 4MRSA 1ZMXA 4LYHA 3QY0A 1E69A 3P1JA 3H0KA 1IN5A 4Q4HB 3BD9A 4ZDJA 5BYJA 3CW2A 4G5QA 2EFEB 1JJVA 2RMKA 4UNNA 3WRXC 4XWOA 2G3YA 2F43A 1PUJA 1KZ7B 1NMYA 2ZI7A 4GMXA 4JVMA 3EPKA 2ZI5A 4B6EA 2UZ3A 4L9SA 1NSFA 2I3BA 2HEIA 1G8PA 1QHGA 5L3QA 4NTZA 4DEYA 3RNLA 3AV0B 2NMVA 4YDSA 3C41J 1U98A 3CX7A 2X2FA 4BZPA 5E7JA 4LUCA 2Q3HA 2BKEA 3WNCA 4DZZA 2VHUA 4JL5A 2B6HA 4WBSA 2ZUCA 2EFCB 5DI9A 2WWIA 4PAMA 4DSOA 4KITB 1XTIA 3R8CA 1I4LD 1NBME 3PENA 5FPTA 2A2ZA 3X1ZA 1HURA 2KWIA 2XXAB 2QROA 1NSTA 2VEDA 3RVBA 4LBZA 1AM4D 3UIEA 3Q5EA 3Q8XB 5CDFA 4B3GA 4TN1A 2ZRCA 4G01B 4QHTA 1C9KA 2IXEA 3IIKA 1COWD 1JJ7A 2KI5A 3DKPA 4Z54A 5SZIA 1BOFA 2JASA 3ADCA 2A5FA 4JZKA 3A6PC 3R20A 2HT6A 2J9RA 2Z0MA 1HUQA 1HY3A 1OYYA 2BEJA 1N6RA 4Q18A 4Q7KA 3QF4A 3LLMA 1AS2A 1TAGA 1UM8A 4KSBA 3LXRA 1P7CA 1UEJA 1N0WA 4DSTA 1XXHE 2Z5FA 3NTUA 4Q5IA 4AD8A 3VQTA 2R62A 2W6ID 421PA 1SKYE 2IYQA 4R98A 2DCUA 1UF9A 4MYHA 2ZJZA 4GZMA 3IHLA 2BMJA 2OCPA 4KVAA 1VHLA 3IBGA 3GFPA 4D26A 1G19A 1DARA 1SXJA 2ZIAA 2VYFA 5JRZA 4MKHA 5CYPA 4D0GA 2CCGA 1S4QA 1EWRA 3OFNA 2QP4A 3P32A 3PFIA 4N0DA 2Q3FA 4KJZA 4KYIB 5J47A 4PC6A 1T0HB 4RD1A 2ZRPA 4O0MA 1KKLA 1RJ9B 3CM0A 2OFOA 1MT0A 4QJ3A 5JZVA 1X8LA 2QSYA 3VR3A 4LI0A 3RDPA 3C16C 3H1TA 2IBMA 1II8A 3REFA 1KI6B 5JHGB 4JLDA 1TU4A 4ARZA 4M2LA 1KJWA 1W2HA 3VFDA 4D25A 1GL7A 4DEXA 4ZPXA 1ONBA 3K9LA 3TR0A 1M6NA 4KFTA 5HE8A 4ZI3A 1P72A 2FPKA 3CUEF 3LA6A 2V55B 1LS1A 1ZCAA 3SJAA 3D6TB 5DYIA 1XTJA 5C4MA 3KKQA 3OESA 4LYFA 1G8FA 1RRFA 2W6JD 5L3SA 1HV8A 3K9NA 2B92A 3EA0A 2GCOB 2N46A 4P3YA 4M0LA 3LH5A 2CHGA 2J7PD 1KDRA 1DAEA 1YVDA 3W6NA 2OXCA 1FNMA 4HEJA 4L5BA 4A8JA 2HF8A 1CXZA 4TTPA 3QUSA 2P6UA 2CVFA 1W5TA 4PHTA 3TK1A 5L3VA 1VECA 1CR1A 2H7VA 1Z3IX 2Q6TA 3REGA 4Q03A 4TQ9A 1NY6A 3QF7A 4CDGA 5B58C 1E9SA 1CRPA 1OIXA 1U2RA 1CULC 5SZJA 2ZROA 1SZPA 4URXR 1KOFA 1KO4A 2F9MA 4HLCA 4WW0A 3G0HA 1FX0A 3K09C 1Y63A 1R5BA 3TJZA 3NHAA 5F9HA 4UNSA 1E98A 1X8JA 3AVUA 2OT3B 3C14C 2MSEB 3I5XA 4D82A 4LHYA 1E1RA 1P9WA 1Z0KA 5ANRB 5LB2A 4MDEA 1G21E 3HPQA 4RFVA 1M8PA 2CLCX 2W0SA 2FDCA 4DVGA 2XNSA 2FJUA 3THXA 4KBFA 2O52A 2OESA 3EC1A 4DLWA 2GAAA 4NH0A 2FZ4A 1XTRA 1I4TD 3NBYC 1KK0A 2W6JA 3NXSA 2B8TA 2ZI4A 1E2DA 1X8KA 1JR3D 2ZS7A 4YLGA 2C04A 1M2OB 1PJRA 2QORA 4HUQA 5GJBA 4L16A 4UXIA 2CNWA 2NPFA 1WF3A 1IXZA 4B3CA 1D6JA 1G17A 1VDZA 2IUSA 2IWRA 3LAWA 3TQFA 5KYKA 5AWFC 4M1KA 1T5LA 4LX0A 1ZUHA 4MYTA 1BYUA 2BDTA 4F7WA 1O87A 4C0SA 4BEBA 1NN3A 3CO5A 1Z2AA 4DRZA 1KK3A 3SEAA 4PC2A 2XTNA 2P2LA 4GI7A 4TWZA 4A0HA 1S96A 1ODFA 1T9HA 3HR7A 2JDID 4QGAA 5JCZA 3FMPB 4KFSA 1H8HD 2FFAA 3D8BA 3OZXA 4US2R 1MOZA 3PEUA 2TMKA 2FFHA 3A58B 1D9XA 4YMWA 3QXSA 3VHLB 4JBXA 5EE1A 3T34A 1F60A 3CRQA 4HDCA 2V7QA 3R7WA 2XGJA 1NKSA 5JBQA 1E2QA 4YMTA 2I1VB 4TL7A 3JVUA 4QL3A 1WE2A 1GL9B 2CL7X 4LY6A 2BMDA 3RS3A 1NNEA 2Q9BA 4BZQA 3ZDQA 1W36D 1ZIOA 3VX4A 1O3YA 3A1WA 3L0SA 1VYTA 4A0RA 2YYZA 1GVNB 2JJ1A 2V8OA 1ESMA 3AKCA 4ON9A 1UJ2A 4PHFA 2VTKA 4Q1EA 2K5UA 1COWA 4RD6A 4CT4B 4QGGA 4XD7A 3I73A 2JGNA 3ZQ6A 3R9XA 4Q4HA 1VCNA 5CM8B 2Z43A 1W2GA 2AWNA 2ATVA 3UANA 3K09A 1G3UA 5ELXA 1W4AA 2AR7A 4CVNA 4TMVA 2E1RA 5A4JA 4Q19A 1OXVA 4URUR 2FN4A 3TGPA 1R10A 4HYYA 4R2IA 4HUQB 4DB4A 1A7JA 4GFDA 3U44B 1SVWA 1E2GA 1NKTA 5DE3A 1OYWA 2NGRA 3V00A 4NCJA 4KFRA 4CEIB 4I99A 5D3QA 4AKEA 1C1YA 5H68A 5A0FA 2O0KA 4PHGA 4DB2A 2JJ8A 4FXPA 4PC1A 3KJEA 2CBZA 4NYJQ 1KI2A 2YZ2A 4R7ZA 2NIPA 1KI8A 4IVPA 4HB3A 4TYQA 2ZRHA 4IXMA 1ANKA 5TARA 2HF9A 4YONB 5JMTA 4QRHA 1Y3AA 1YU9A 2YWFA 4OKSA 1AGPA 3HP1A 4NZYA 4UJ5A 3RANA 3U7EB 4A0FA 3GLGB 4JLVA 2JLXA 3A1UA 4BZXA 3QBTA 4E03A 3BRWD 4FI3C 4QG7A 1A5TA 1IY0A 1P2VA 4R2HA 5G53C 2HCJB 1CR0A 2CE7A 2X8AA 4EPVA 3MLEA 1DELA 2WIAA 5KNBA 2WOJA 4AYXA 3I61A 3LRPA 3TMKA 4C0QC 3EIEA 5DI3A 1X1RA 1XRJA 1D8TA 3GEIA 3KKOA 1VHTA 1T3HA 4A6PA 2IA5A 1LFDB 4RFSA 2V9PA 2R2AA 1WBDA 1JR6A 1I2MA 1CF4A 1OHHA 1E9EA 2AXNA 4F38A 3QF4B 5IHPA 3WP1B 3MSXA 3EC2A 4W5JA 2WWYA 1IONA 2XJ9A 4M9ZA 1KDTA 5AUNB 4EFLA 2BM1A 3NC0C 2J1LA 4C0LA 3NKVA 3SHWA 3SS8A 4M1OA 1FNNA 4IHQA 3U7HB 1T8TA 2WSSA 1E1QA 4KBGA 1E99A 1PLLA 2PZFA 5UKDA 4XH9B 1ZNYA 3B7GA 1KI3A 3WMFA 4BECA 2F9LA 3ADKA 3L0PA 4V0LA 3NEJA 2VQSA 1NBMA 2XJ4A 2AFHE 2QMEA 2JLSA 2ZJ5A 1S9DA 3U3RA 5JEEA 3TNFA 3IDQA 4EPXA 4MYUA 4M21A 2H5EA 2PEYA 4JSYA 3SYKA 1T6NA 3NC1C 1CEEA 4QOSA 2HV8A 1R5OA 4TMKA 4U02A 3WY9A 4X8MA 3U4QB 5JRJA 2AK2A 2JATA 3B9PA 4GL2A 5LD2B 4NHOA 3FMFA 3QVUA 4MUBA 5E7MA 3PUYA 4QBIA 2D3WA 2CL0X 2BEKA 3KFVA 3SBEA 3I3SR 3GEHA 4KAXA 1GUAA 1MH1A 2QQ0A 3IQWA 2D7CA 4HAXA 3VMFA 4JT2A 3IPXA 1JECA 1NN1A 1OJLA 4LBVA 3HDTA 2CLDX 3LBNA 4GP6A 1CS4C 1FP7A 2CVHA 2YOFA 3CNOA 5HKKD 1Q1ZA 2REBA 4TYWA 2V3CC 1EX7A 2H57A 5E95A 4YQFA 2IT1A 4FMDB 2E87A 2ODBA 4LSGA 4QBFA 2VP4A 3CKLA 2GEVA 1L4YA 1CTQA 4M8NE 4I1SA 1Z0JA 3A4MA 2O8FA 2YOGA 1WP9A 1XJCA 4XIGS 3QXHA 2F1IA 4LC1A 4DT1A 4LOAA 3SJCA 1QBKC 2VP0A 3GMTA 4JLJA 4JLKA 3THOA 1G7SA 1W48A 4DHEA 1SVOA 3MAAC 2PH1A 4JVNA 1RYHA 1TF5A 4PAQA 4DUGD 4TL8A 1DG1G 3TKLA 4IFBA 1TTTA 1XTQA 1RRCA 2OG2A 4FMDF 4LPSA 5CK4A 4IFEA 1E2HA 3CF2A 3OEHD 1B0UA 2V7QD 1G6OA 2GCPA 4GNKA 5FBWB 1ZM9A 3RSLA 1XMJA 2PX0A 5KOYA 3DL0A 4LJ7A 1HA3A 2IYXA 2ASEA 5GJCA 1W47A 2ODWA 3PV0A 4O25A 3WNDA 3G5UA 5FUWA 4B74A 1E3MA 1SXJB 3QPVA 1US8A 5J5CA 1N3BA 2FA9A 2IK8A 1P6XA 1XEWX 1KJZA 2FGKA 2YC2C 2QT0A 4UNRA 1UBGA 3HYRA 3I72A 4OI2A 3QG5A 1LS6A 3QPWA 2F3RA 1R0YA 2OFWA 3MWLA 5FPKA 1YR8A 1G8GA 2QAJA 1CJMA 1TU3A 1EFHA 1YZUA 2WWHA 1BMFA 3D7MA 1Z29A 3FMOB 2C77A 5C46F 1JAHA 3K0FB 1P2SA 1JR3E 1YZGA 1E79D 5J4LA 4B3FX 2IL1A 1OLOA 1IXRC 5DYGA 4ZCLA 3LX5A 3IIJA 3MD0A 2H18A 3KXIA 3BC1A 4RVCA 1R8SA 1N5IA 4P31A 4WVFA 4C9BA 521PA 5EZ6B 4OYHA 3UG6A 2OCBA 1U9IC 4JIMA 3ZVMA 2J0QA 3TAHA 1EFUA 4G5SA 1HEIA 1OSNA 5FI1B 3ZD6A 4H1VA 2WOOA 4C0KA 4EPYA 2B8WA 2J7KA 3IQXA 1NBMD 4Z1MA 1A4RA 1SKYB 3EASA 1P61B 3LQQA 4TSFD 5KNDA 1DE0A 3SU8A 2OHFA 2RKOA 1U81A 1RRPA 3VR1A 3T5GA 4JL8A 1ZM3A 1JI0A 1XX6A 3JZAA 3C5HA 3GPLA 1LF5A 4O3MA 1TADA 4TYYA 3KTAB 4PZLA 1CLUA 3FHOA 4DCSA 4B47A 4GBMA 1W46A 2W58A 2C98A 1CJKC 2ZI6A 2OSBA 2J0UA 1FQKA 4URWR 5CITA 4PTLA 2RGBA 5DHAA 2J3EA 2ZRGA 2ZITA 4Q4AA 5AUOB 3KKMA 3EAQA 4W9MC 4WIAA 5H8WA 4LGMA 3AF0A 3X1WA 3ZVLA 1BMFD 1JEDA 3K0SA 2R9VA 1Z28A 3QJYA 3OIWA 5AUQA 1K5GA 3UK6A 2O8CA 4Q21A 3Q72A 1LV7A 3AP2A 1P9RA 3NVAA 2IYWA 3BH6A 1IN8A 5FBRB 2FF7A 4B34A 1OXTA 2G77B 1VG9B 2ANBA 3BH7A 1J2JA 2R6AA 2XB4A 3ECCA 3MJHA 1M7HA 121PA 1YHNA 3P4YA 2G9NA 3VR4A 2A5GA 4P0TA 1RVDA 2UVQA 4FINA 2VHTA 1TUIA 3ZQJA 2AXPA 2WJIA 4NYJR 4PPFA 1Z08A 1RYFA 1VCOA 4A2QA 1VYUA 1KGDA 3SJBA 2AD1A 3EW9A 1N5KA 1GRNA 2ZRMA 1L7VC 2IYTA 2ZPTX 3PUXA 1QHYA 4CW7A 1N0UA 3K70B 1ZBDA 1FW6A 5IDVA 1SXJD 1M7GA 2ZS8A 3X1XA 3GLIE 4KHZA 2IS6A 2JJ2D 3BWDD 3RRZA 3VR6A 3K0AA 1E2FA 1HYQA 4ACAA 2QGZA 2H17A 2NQ2C 3BGWA 3RYTC 4DCTA 1QDEA 1S1MA 5K8TA 2FG5A 3LDAA 4EPTA 2WTUA 2CCKA 2GCNA 2IYYA 3A36A 2ZI3A 4S2EA 3T06B 2ATXA 2IEZA 3B1YA 4M1YA 1NIPA 3CONA 3FYHA 3BFVA 4KFUA 2FSHA 5KNCA 4L15A 3THWB 4G3XA 2RGGA 1PV4A 3IEUA 1ZM4A 1XWIA 1G1MA 2GJ9A 1X86B 4FMCB 4EKDA 5EXTA 2WBLC 2WM9B 3MRSA 1NF3A 4AYWA 1EX6A 1AQYA 1G8HA 1W0KD 1XJ0A 3L0IB 2ZRBA 1CU1A 3B82A 4Y0AA 2GVZC 4DXAA 1GNPA 4BASA 2CJWB 2GF0A 2GETA 2QM8A 4P4SA 2WVJA 2RGCA 4M9XA 1CIPA 4TT3D 2EYUA 5KHOC 1QHHB 5FH9A 1GSIA 2WKPA 3RS0A 4TLBA 5KSZA 4KI0A 3Q7QA 2EW1A 1OXXK 3R9WA 1E0SA 3OIVA 4RJLA 2AKAB 1ZNWA 4QBHA 3AUYA 1GM5A 2OM2A 2IYUA 5FOVA 1U99A 5EE9A 3ZJYA 2ZSEA 4MITA 1G16A 5FTNA 4DIEA 4BLQA 4QNMA 1XCGB 1Z2CA 2V4ZA 2XSZA 4KXFB 4Q1CA 3T15A 3N2EA 4LHZA 3TUJC 3IIMA 4Q9HA 5KO2A 2ORVA 1VKJA 3EARA 4C0AC 3PXGA 1KI6A 2WMOB 4E22A 2H1LA 1W4RA 1XFAA 2EFDB 5H1YA 2RGNA 1Q3HA 2XEXA 1OB5A 4KCGA 4L9WA 4JMPA 1XF9A 4ERNA 2GXQA 2AWOA 1E6CA 2XZOA 1ZUIA 4NYMQ 1G6HA 1EESA 3OEEA 4P33A 3PQCA 4ZV4A 4IOMA 3R7WB 4YMUA 4AIIA 2JJ1D 2PLRA 3F8TA 4ESHA 3A4LA 5JS8A 5TB5A 1FUUA 1XMIA 3IPYA 3O47A 1X3SA 2ZQ5A 4NMMA 3BIFA 4Q9LA 2VSXA 4BFTA 4C30A 2AD5A 2HCBA 4LDJA 4OQLA 1UFQA 1FP6A 1JXMA 1T4GA 5KSPA 1HT1E 3P4XA 2ZVQX 3KJIA 3ICQB 3VU9B 4Q1AA 4Z8YA 1KY2A 1SXJE 3WRYC 4YC7A 4B2LA 3NG1A 1Q44A 5EXSA 3NBZC 3VKHA 3ZZTA 1FOEB 3EX7C 4Q4JB 2YOHA 3FB4A 2ZAMA 1GL6A 3B2EA 2KJQA 3LW7A 5GADl 1OXUA 2P6RA 2CJWA 1LNZA 5KDLA 3J81k 2VRWA 1G8YA 4TL9A 2PMKA 4C7OA 3SBDA 1IJEA 3KTAA 3T35A 2FPMA 4MYCA 5EP3A 1JQLB 3AF4A 5JHHB 2QM7A 1QF9A 2FGJA 1ZJ6A 2ZJYA 3IILA 3GJ4A 1D9ZA 1YR6A 4YDHB 5AUPB 2FFBA 2GXSA 1E96A 1JQJC 1YJ5A 1IY1A 3HU1A 4U7DA 3E70C 4IDNA 4W7SA 4BLTA 3SQXA 4XWAA 2IYLD 1T3SA 5G41A 1T3LA 2ZE7A 4PQYA 2GXAA 2RCNA 2Y8EA 4RZ3A 3MGCA 2Q21A 5C1BA 1OXSC 1KMHB 1EK0A 5BWMA 4YMVA 1W4CA 2GEUA 4Q01A 2GAOA 3AVXA 1E79A 1YRBA 2HJVA 2R6CA 3MMPA 1XJQA 3AUXA 1KSHA 4TLCA 3K9HA 5DN6A 3PUZA 3IO3A 3U4QA 1XPOA 3HU2A 3QXCA 4OK5A 1ZCBA 4BRWA 621PA 2YHSA 4QXAA 2VSFA 2JLWA 1YQTA 3GCGA 4N1AA 2EFHB 1CR4A 2JAQA 5HE9A 3ZYCA 3CRVA 1XEWY 3W90A 1R0ZA 4CZ2A 1ZYUA 2GVDC 3LLUA 5TV2A 2OEPA 2GZDA 3TR5A 1Q22A 2J59A 5AR1A 3WMEA 2ZREA 3VR2A 3TUIC 5M04A 3IKJA 4FCTA 1RKBA 2G1JA 5DIFA 2BMFA 2C9OA 3W3AA 3AF2A 3DMNA 4HLDA 2A5YB 5D3MB 4YXWA 4TZ0A 4BPBA 4HB4A 3RC8A 1VIAA 5FBQB 3ZGXA 4MUAA 4LJ9A 4OQFA 2QTHA 4WA7A 4LHWA 2VF7A 3UKDA 1Z22A 4PX9A 2W6IA 1XZQA 2FWRA 2VP9A 1TUEA 2PT5A 1DAFA 4PR0A 3GLFA 1Q12A 5FR2A 1JPNA 3N5CA 1DEKA 1DPFA 1SVIA 2VP6A 5K8LA 3KUDA 1WRBA 3PJRA 1W36B 1XEXA 4M9QA 4PSAA 4Q1FA 4D80A 2AFIE 4EDHA 5CDFE 3OAAD 3VKWA 4Q4AB 5FFMA 3LW8A 1EGAA 1ZUNB 3OHMA 1P4SA 1R5NA 1U0HC 1GTVA 2KBEA 5DN6D 4TYNA 3GLFE 2F55A 1Q1EA 3KQKA 3EZ7A 2ONJA 3SYNA 5GVSA 1KTVA 2O8BA 4AKIA 1W0JD 2QN6A 3BJIC 2IYSA 2NZJA 3K0CC 3PIRA 5E4FA 4AURA 5DO9A 4ZKDA 2OLKA 1D2NA 2ZE6A 3NBXX 2GNOA 1KAOA 3QKSA 3VNVA 1AN0A 4XSGA 1EFCA 1ELOA 5JJLA 3QVVA 4EUNA 1E2KA 4NU0A 1KY3A 4GSYA 4B32A 4ITRC 4QGFA 2FSGA 2XAUA 3CWQA 4EFMA 721PA 1QHHA 5IK2A 4PO8A 3U61B 4AC9A 4LZZA 4B35A 1IAQA 1U9IA 2ZRLA 3OIUA 4OBEA 2RGEA 1JR3A 1G7CA 5JJKA 3LVQE 4XSHA 1Z0IA 4WOPA 1BIFA 2H92A 4CIDA 2F3TA 3ND8A 2RH5A 2D2EA 1UADA 1NN5A 3AVPA 3A8TA 1XDBA 4A1FA 1S0UA 2B7CA 1TQ6A 3THYB 1RE0A 2OBLA 3EWSA 4M22A 4B75A 1OT3A 2R6DA 3AF3A 3AKDA 4HATA 4ILEA 1P60A 4Q7LA 4JLBA 5DLQC 2ERXA 3M4YA 3MWYW 5G3YA 3TBKA 4RD4A 1U0LA 1WQ1R 1RFLA 2OFXA 2PLFA 2HJGA 2Q3MA 2QEQA 3AKEA 3BBPA 5L3SB 5JI3E 2I1QA 4G5GA 1IXSB 2ODEA 4RY2A 3I8SA 1YRAA 1NVVQ 1BS1A 4GOXA 1RZ3A 5FPYA 1NVVR 1KDOA 1F2TA 2VIIA 2ZETA 3BAFA 3U2QA 3M0EA 3KXLA 2A9KA 4IXNA 3FWYA 3ZZ0A 4Z51A 4A92A 2VH5R 5E3HA 3AB3A 4EJSC 2IYVA 3THWA 5BYKA 1KO8A 2EWVA 2OXRA 3GFOA 2GJSA 3NHBA 2JDIA 1E1RD 4CRWB 2HT1A 3W6PA 1KI4A 1N6KA 1XCMA 1P62B 3CPEA 1DAMA 4F4CA 5JEDA 3SQWA 4OQMA 5DISB 3P20A 4K46A 2Q9CA 1W1WA 2BIFA 5IK2D 2VHJA 4ZO4A 1E2IA 4CF7A 5JWOA 2OV2A 3QKRB 1ZM7A 3BB1A 1N5LA 3BS4A 1D2EA 5E7IA 3X1YA 4AWXA 2KBFA 2WJHA 4TMZA 4IRUB 3KQUA 3QI2A 3T12A 1OW3B 1XB2A 2ZJOA 3TSZA 2YINC 4B71A 3AKYA 4H1UA 3A4NA 5JCPA 4BLPA 2EFGA 1Q21A 3CNLA 3LBIA 3NBFA 2MSCB 2DB3A 3IGFA 4DLRA 2LWIA 4B43A 4B44A 4QC2A 1GP2A 2R8RA 1A2BA 5CYOA 4BQSA 5AJWA 4XJXA 4AKHA 1XU4A 4K8OA 3AM1A 1AA9A 3W5IA 1Z83A 4OQNA 2VL7A 5CB8A 5EP2A 5HPYB 4D81A 2B21A 5FBVB 2O0JA 2CK3A 2GBLA 2QPAA 2O8EB 2IUUA 1OE0A 4Q02A 1VCMA 1N0VC 1IN7A 4XVUA 5AK0A 4LV5B 3KKNA 5AJZA 1CRQA 1K8RA 4DSUA 4PC7A 4MRPA 2G0NA 1AQUA 4OK3A 4NKRA 4EAQA 2W00A 2QENA 5KDOA 5HCIA 1Z0FA 3VX3A 1TX4B 2E9SA 2FH5B 4DIDA 4C2TA 2H8KA 2OBMA 3RABA 4BEJA 3AP1A 5FBLB 1XD2B 1F5NA 2QBYB 2JJ2A 2XITA 1E9DA 2ZTSA 1KNXA 3KQNA 3M1IA 1QZXA 4JLMA 1YZKA 1H8EA 2OLJA 1TQDA 3K0AB 3D31A 5L3QB 3I5YA 1DAGA 2J87A 4MKGA 5JSZB 2OE2A 1GZSA 3EG5A 4EFNA 3L43A 3DMDA 1J8YF 4RZ2A 1XZPA 4OI4A 5F2EA 1OH5A 1QHXA 4CT5A 4V0MA 1DS6A 4LJ8A 4POAA 4DCUA 3F0TA 1EFTA 2P5TB 2FX3A 4KSCA 2BKUA 4A82A 2A5JA 4B3BA 2PZEA 2IWHA 2G88A 2CK3D 3FKSA 5EQTA 4A36A 2QL6A 4JKYA 4DSNA 4ZI2A 1KI1A 3TVDA 1N6OA 1XTSA 4B2IA 2JLQA 3ADBA 1MO3A 2B7BA 3O8DA 2BBTA 2C8VA 2WICA 2PCLA 4QFMA 4WXRA 3S1AA 3TRFA 2JLUA 2IXGA 3GJ6A 4TLAA 1JALA 3L0OA 1VIYA 2QA5A 1K6MA 4MGYR 5KUTA 2D74A 3N2IA 3CRMA 3SR0A 1I2DA 4Z1MD 2ZRJA 4IOLA 2BWJA 1UDWA 4FMCF 4JT4A 1ESNA 2OO7A 1GKYA 4L4UA 2R6FA 3M6AA 2DFTA 2FE4A 4MQBA 3R9IA 1P75A 3EPHA 2C78A 4JLAA 1OFIA 2KSQA 4Q1DA 3CF6R 2HUPA 1J90A 2PT7A 4K81B 1UKYA 3BB4A 2ZE5A 3C4JA 4CEIA 1SVSA 2ZR9A 1WMSA 2AHOA 1ZP6A 1IN4A 5B2ZA 1NL3A 4XTRA 2QMUA 2IF2A 2RGAA 3TVTA 1U94A 4FD2A 1H8ED 2NO0A 3UWKA 5JLJA 3LQRA 2ODNA 2ECKA 2IHBA 1PVOA 3E5HA 1UBFA 2PJZA 1GKUB 3RSOA 4DDTA 1HE1C 2XTMA 1Z0DA 4A6XA 1QG2A 2WAYA 1UKZA 3D3QA 1ZINA 5LPNA 4US1R 4HAZA 4DKXA 2HLDD 3LXXA 5DHFA 3V4RA 3UATA 4OL0A 4GP7A 5EP4A 3FHTA 3K53A 4MA4A 4CYMA 2P67A 4LBYA 4YXWD 4TT3A 3FE2A 3IUYA 5CLLA 2C5LA 3RHFA 2A3RA 1T0JB 4OI1A 2MSDB 2ZSAA 5K8IA 1G41A 1E2PA 1IHUA 4Q66C 1QRAA 1UEIA 1AK2A 2AX4A 5BN4A 4RFSB 2WJJA 1F3OA 2WZQA 4AI6A 2QAGC 1N6NA 3ASZA 4HB2A 4HAYA 3CR7A 3FFBA 4EQ6A 4IDHA 2QE7D 2VLIA 4ZIRA 2JIZD 1RPZA 1G18A 1GG2A 1C4OA 2VO1A 3QPUA 4DT1B 1F6BA 5EXPA 3KJHA 2O8FB 4GPTA 1DTSA 1M1YE 3IBYA 3K8YA 3KX2A 3I8XA 1BYIA 1E9CA 2XB2A 4IOKA 1S8FA 2CLSA 2WWXA 4URYR 4BWYA 3B5JA 2FV8A 4KU4A 1NVUQ 5JJIA 1AKYA 2W2VA 3W3ZB 1IJFA 2QPOA 4D4JA 3QKRA 2VA8A 3PEVA 2ZAOA 4JLNA 4BUJA 5BXQC 4FIDA 1R7RA 2JEOA 5J40A 1U8AA 1PUIA 4V0ME 3WYAA 4GZLA 5FI0B 4KV9A 3QKTA 1KO5A 2BM0A 2RB4A 2QP9X 4R71A 3ADDA 3TIFA 821PA 5AJXA 2ERYA 1W0JA 2G83A 1FFHA 3GLHE 4QJ5A 1TPZA 2OCYC 5JECA 1MABB 3I62A 4RZUA 1XMVA 4C0HA 5B30A 3DHWC 1HT2E 2AN9A 5CJ2A 4D0LB 3RWOA 4EPWA 5A5GA 1Z6GA 5TY0A 3WYGA 1SVMA 1RC8A 3LV8A 2NG1A 3LX8A 1E2EA 1DBSA 2AKYA 5KSYA 5GVRA 4GRAA 1IBRA 1XD9A 5KTYA 4XD7D 1II0A 2BBOA 2ZEJA 4X8LA 1Z8FA 3CZPA 2VP2A 1Q1BA 1ZW6A 4BLOA 3K70C 4M4SA 1JEEA 2G1KA 3VHXA 3AF1A 4DLTA 5FL7D 4JL6A 5HCNA 4DJTA 2DFLA 2L0XA 2PEZA 1G5RA 4QKQA 2QE7A 2ZI9A 1UKVY 4TTQA 3BORA 2Q0HA 5HTKA 2YWHA 1DVRA 1T91A 3HR8A 3L8YA 4UJ3A 1E4VA 3CPJB 4RD2A 1OPXA 3TH5A 4P32A 3EA5A 2EU8A 4FN5A 1Q0UA 1QHIA 1HE8B 2QI9C 4LRWA 4KLNA 4IJMA 3C8UA 1YZNA 2ZJAA 1Z5ZA 2IC5A 3E1SA 4HLUC 3FHCB 5D3MA 5FOWA 3VNUA 2QT1A 2FSIA 2OZEA 2WKQA 4AYTA 1G3IA 1QHSA
chains in the Genus database with same CATH superfamily
5CLQA 3A4IA 5EHGA 3CVJA 3Q10A 1NLZA 4BCCA 4HN4B 4DNXA 3AVTA 1T34A 3HBNA 1GZ4A 2PUBA 3PYMA 3KR0A 4YMSA 2QU8A 4E15A 4OHVA 2GJKA 3CF0A 4DUPA 3TQOA 4DC1A 1C3VA 4YIKA 1J21A 3V1LA 5HKBA 5JE8A 3IAUA 1TYAE 2IHUA 4B0OA 5TT1A 4LKRA 2O1WA 1DQSA 3F47A 3OPYA 2H9YA 1IBKB 3L0BA 3N0XA 2FPSA 4IZIA 1MP0A 1ONNA 2BN4A 2ZDHA 3H42B 4NYIR 1OBOA 3A2LA 1LW6E 2JH9A 3PWZA 2DJ5A 4TRJA 3RH0A 3EUAA 3IUEA 3BB3A 3VC3A 3GEEA 1WHSB 3K9QO 1JG4A 1QKKA 1YCGA 5EQJB 3UWOA 1K9VF 1RXUA 2FSPA 3N7UA 4HRYA 5KJFA 1QM5A 1WHTA 3QSGA 2K4MA 4UARA 3RAGA 4P83A 1JFVA 2QQGA 3WYCA 5J4KA 3T1OA 1M76A 1GZ7A 3WWPA 2L18A 5C5DA 2ZR0A 3KE9A 1NTRA 1FF9A 4MWDA 3HCFA 2QD1A 4TYPA 1SO8A 2ATIA 1MO6A 1VE7A 1W9HA 4O08A 2JF0A 3MQFA 3QBDA 4PSKA 1SQSA 3HU5A 4GOJA 3BN3A 4GD3Q 3QQ5A 1CZNA 3H84A 2I6TA 2LNDA 4Z3DA 3TE6A 1GITA 2NU6B 3K6SB 1F2DA 1E7MA 4RPLA 5BT8A 3TFOA 1YFLA 3AL3A 3NI2A 4MVJA 2REQB 4WZZA 3RS4A 1Z8DA 3X2SA 2GM5A 1FSSA 2YBDA 4UM8B 3U81A 4C89A 5SV2A 2AMLA 3LVFO 3C8DA 3ECAA 5F3WB 4JOCA 5JSFA 4ESVA 4K9MA 4N5DA 4NDNE 2Z57A 1Y9EA 3DBOB 4QLOA 4CCAA 4AKGA 4HTFA 5H9VA 1WUTA 4ZJUA 2H6EA 3HU3A 4Y2UA 1LW7A 1P1JA 2BHLA 2ORYA 3RNOA 3W8FA 4R6XA 4JVLA 4WKNA 3SFZA 2GSDA 4RLFA 1XRNA 3WICA 4G5HA 3LNCA 1VPTA 5AW1A 1B23P 1Z0AA 1RYNA 2HKIA 4JLOA 3MB8A 4MWEA 2R6GA 4HCJA 3Q8MA 5FWYB 1UZMA 1NQTA 2R66A 4PX5A 1SU6A 5IDQA 1I36A 1U5BB 5HHTA 1ZO8A 2WPDD 1QAOA 1NLFA 3B12A 2AYYA 4XDGA 4QBTA 5TC4A 4AKTA 1YOVB 1NWCA 5F23A 1FRVA 1M2KA 2DJIA 2PNFA 1OAOC 1P2GA 2AJDA 4B3TB 3WAKA 5HKLA 1ZUNA 3SR4A 4B46A 1T2VA 4BLSA 3HJCA 3NVKI 3O1LA 1AKQA 1V11A 2OECA 4MKIA 1J7JA 3W7BA 4UXJA 2QAIA 4V0KA 1QIGA 4BJHB 3Q8KA 5AM5A 1ZOLA 2R8YA 2Y9MB 2VDWB 1ZJ4A 1DADA 2EARA 2XNHA 5IBPA 3OLQA 3KL2A 2GM4A 1MUUA 3GXBA 2JZCA 4N9WA 4YYEA 2ALJA 3OE7A 2PMBA 4Y2XA 3CSUA 4G0WA 4CMIB 3W5UA 5DNYB 1BHJA 4AJPA 2PJUA 2OCIA 4I3FA 1JWBB 2H4HA 3B8EA 1Y1KE 3IR5A 3OU6A 2ONKA 2ZU0C 2XUDA 1GUYA 2DQKA 2XX3A 3ZWYA 5EJEA 1N9GA 2NUTB 4MS3A 1U8EA 2W42A 3ER6A 2R44A 1HE2A 3LX6A 2FOXA 2HYIC 3RSCA 5P21A 1DRUA 4Y2GA 3UT5A 5AW7A 3NMUF 1RSZA 4IHAA 3KV1A 4XIIA 4ZZ1A 3U60B 2JBWA 2LKDA 2NU7B 2V59A 3LC1O 3M3HA 3NTOA 4JUCA 4LF5B 3FUXA 2W43A 3RS7A 4KYUA 2P8SA 4O1MA 3U17A 3C7DB 3CBGA 4JI7B 1Z16A 2Y1GA 3JZMA 2WB4A 3O2JA 4E1BA 1FTYA 2GWHA 4YCDA 1S2LA 2PS3A 3MOIA 1FVOA 2X6RA 5JSQA 2X2EA 4FS8A 5CDTA 1RWMA 2HMSA 1JV2B 5JI2E 4H27A 2Q2VA 1MAWA 3GFTA 2X86A 4UCWA 1UPTA 3MGKA 4JX8A 7ADHA 2XE8A 3ZY2A 2J6CA 2KLBA 2X5XA 1A82A 2FPWA 5LP6C 2GTHA 1BDMA 3CZAA 2VDMB 1II8B 3GYBA 3ND5A 5KQSA 2C2HA 5EOVA 1NIJA 3Q7RA 3AVOA 1KRXA 3MGAA 1AY0A 3WXMA 4FW8A 1C4KA 3CE6A 2DR3A 3PRKE 1CCWA 3ODPA 2WT9A 3AR4A 1ZD9A 1UBJS 1J5PA 3ABQB 4CMEC 1KAHA 2NM0A 3ROTA 5DXFA 2PBLA 1RLJA 4XB1A 3OCXA 1NG9A 4O5AA 4LTMA 4ANFA 1C9YA 1W49A 5LBIA 1E3SA 4B17A 3LUJA 1KZHA 5B12A 1Z6QA 5IF9A 3Q9LA 1KSGA 2B0CA 2HXSA 1J42A 2OTCA 1AQ6A 2W2XA 3GPIA 4ZOCA 4EEXA 5JATA 5KSOA 4DNQA 3HZZA 1FDUA 4TV9B 2GUWA 1A04A 4GPIB 2ZRAA 3VJMA 3JWHA 1CBUA 4H3SA 3O93A 4RYDA 4WXEA 4XX0A 2C9CA 3KU4A 4GMFA 3RVJA 3KKPA 2CHVA 3OFKA 4QJ4A 4U5XA 3PEFA 1KYZA 4U00A 2OUIA 2JIPA 1AHIA 4D8UA 5HW0A 5HUQA 2K7FA 2I7TA 4RMIA 1E5TA 1VL2A 3QIAA 3RKSA 1GCGA 4JYPA 1Y8QA 1WXHA 1Z5VA 3LCUA 4W5WA 2PS1A 3D8HA 4Q9IA 2WZDA 1CY7A 5DXJA 3L2OB 4JUFA 1TJYA 2JI8A 3HP7A 3TI9A 2XWJI 1PEDA 3LY7A 1Z26A 1L5FA 3MSCA 4X90A 3LIPA 1K7EB 4J0DA 3W7VA 1H2WA 3IVAA 5A7FA 3G88A 4B79A 5IH7A 2I8AA 2XF2A 4O2BB 1PGOA 3OLXA 4K6FA 3VPAA 3QP9A 4BN5A 3W5AA 1TYEB 2CDRA 5EWJB 2XE6A 4PYIA 1XRQA 3LY8A 5G0SA 3SXJA 2JPDA 1YFZA 1TUGA 4NCNA 1OWOA 3KAJA 3UMSA 1JMVA 3UC5A 4DY4A 2HDWA 3ZU6A 4WOJA 2CXPA 4H16A 4WD3A 1YQQA 5D85A 3SNHA 1U6KA 3AR6A 2HSDA 5AT1A 1TEZA 1DRKA 3HA7A 3KJGA 1UKAA 3U4AA 2Q1XA 2Q4BA 3M6FA 5M7EA 1Q3TA 4HDMA 4UE2A 1JJBA 1CJUC 2HRBA 2IPNA 4IQFA 4KXYA 3FPKA 4RVDA 3HYSA 1NATA 4MTCA 5FYDA 3RRNA 4ETMA 1JU3A 1S5PA 1C2YA 3GCWA 3KFLA 3K5PA 4R1LA 3U31A 4G5FA 2DYKA 3RF7A 1B16A 1ULUA 5F2OA 1PFYA 3X43A 4B3RB 1ZU5A 3NJ4A 3QYPA 2QGNA 3DO6A 1L5RA 3ZUGA 1E94E 3ETJA 3Q85A 4MW4A 5B4TA 1DTWA 3EXIB 2XMRA 4MVWA 1H4QA 1Z0ZA 5IVPA 4IFTA 3R0IA 2OILA 1GGKA 3KHKA 3WP0A 3ROZA 1M74A 1WY7A 2FNAA 2O2DA 3EZLA 3STHA 4EW6A 3D0QA 5E4JA 1RIIA 4IP0A 5KKAA 4EFDA 1LEHA 2O8EA 4LIPD 1FMFA 3ZPXA 3JQQA 3OQMA 2XXAA 4K9LA 4Q37A 3LZ6A 3UJAA 3E9RA 3RRYA 2RBGA 3UYLA 2P3SA 5TMBA 1JEQB 2VRCD 1C81A 2QRZA 2V6JA 3FMGA 4J7AA 3P2YA 4DLNA 4YAKA 3ICCA 4DM7A 3IMFA 5CA0F 3IMKA 1O4VA 1OX6A 4OHXA 4O4IF 5BV1A 5FWNA 3VR5A 3KQWA 3NDJA 1CQJB 3C5CA 3AI7A 4C4AA 2UZ1B 4NBUA 1I4OA 1VTKA 1CT9A 2YXBA 3K7EA 5L45A 5K8UA 4N3NA 2VA9A 2FPXA 2JFNA 2XUKA 1DJLA 2PBZA 4PLCA 4Y6SA 1PJBA 1UP4A 1IVSA 1JEYA 3AGPA 4PS1A 4OLAA 4DRZA 1PJAA 2W4IA 3IRUA 2GBGA 4EUEA 3C7KA 2XVYA 5IH3A 2RH4A 1I6KA 1VHWA 2D0OB 4OQ4A 4DMUB 3I2YX 1X38A 2KX7A 4DIMA 3UXEA 3PPWA 1Y4SA 4X9XA 2R96A 4B3IA 1V4VA 2QZ4A 1FX0B 4ENTA 4DAOA 1KVRA 2FN9A 3VR5H 2YMMA 2XMBA 3TLZA 3SP1A 2YZNA 2AW3A 5LB4A 3H13A 1MA0A 3NW9A 1IY2A 3CGGA 3UPUA 1W73A 5AK6A 5H3CA 3RWMB 4HBZA 3FRIA 4ZPJA 2RC5A 1T4MA 1AKVA 2Z83A 3NKLA 3OI7A 2P3QA 4U2FA 2I22A 4BS9A 2XUHA 1NW9B 3AI1A 1KP9A 2BHRA 4HMPA 4MXDA 4HRXA 3EZNA 4V2IA 3WJ7A 4B73A 2GX6A 3CPSA 4KUHA 3UNXA 4QGHA 2Z4RA 5ENZA 4AY2A 1H05A 2FN3A 3KS9A 3U44A 1P0CA 1H2HA 4ZI7B 4QM7A 4JQCA 1U2GC 4BWFB 4JUAA 1J6UA 3W34A 4MGKR 3W0LB 3JR3A 5EE5B 4X7RA 3L7NA 2MSNA 1M10A 4Q15A 1XCLA 2FZLA 2CXHA 1GN9A 5FUYA 1M1NA 1UFOA 3L8MA 4U2CA 3JVDA 2H85A 1N4DA 2LBPA 1G4UR 3MJTA 2NU8B 3UN1A 2NOAA 4EIWA 4L2IA 4YH1A 2EKDA 1VGVA 3ECSA 1Y5MA 2O7VA 4UHFA 2DSTA 2YNMD 3M70A 5B57C 2AC2A 3DPUA 2I5PO 3KAQA 4MUXA 5DBIA 4P3PA 1OGJA 2ZE8A 2FPLA 2GCOA 4PPQA 3OIYA 3OD1A 1J2TA 1LVUA 1SD2A 3OZUA 1W4BA 2MTBA 5IEBA 4LRTB 3F9IA 4PYJA 3L1IA 1OV4A 2O0MA 2VP5A 5AXAA 4YROA 4QBGB 2X8BA 1JHOA 2ECQA 2IDMA 4LHXA 4LVCA 2BGTA 1IU9A 2P35A 1T2AA 1B6GA 1KDPA 1V11B 2AZMA 2B3DA 2IODA 2XOKA 3GLHB 4MUMA 2WWFA 1PWYE 1SVKA 2I99A 4JYBA 5FTMA 3UK7A 2NZUG 3M4JA 5FCDA 1TMGE 3ZIUA 3AY6A 1SZDA 1BXRB 2WAXA 2VPXA 4HAUA 3WHPA 4E5KA 1XEXB 4FWIB 4GC9A 4RCYA 2B5WA 1G0NA 3NIFB 4FB5A 2QTRA 4MQ4A 2HADA 1JKJA 1SQ5A 1NJ8A 2PKXA 4FDVA 2AXQA 3CS3A 1MTOA 4M54A 4KLAA 4N8SA 3SJZA 4QOEA 1JJAA 3L8ZA 3DEIA 5H59A 1U2GA 3TMAA 3WQBA 3ZEAA 4EGCB 5JFGA 3EXG1 1COZA 3LC0A 1KARA 5ELLA 3TIIA 1BOOA 1Z6AA 1NRXA 5CB6A 1ZHOA 4FZ3A 3GA7A 5BPHA 4F92B 4Z9YA 4I3GA 4R1SA 2KYRA 1EE2A 4GX1A 1TCCA 4LC9A 4PAOA 4WJZA 4JGIA 4XGRA 4Q9JA 3ZE9A 4LDZA 3DM5A 4G8CA 5HJEA 4O02B 4TL6A 1SJ9A 2A78A 1H2YA 3DPSA 3V80A 3IHKA 3H2IA 3E15A 1LSSA 1IZZA 1S02A 4X8HA 2ECOA 4HXGA 3KB2A 4XYLA 3U3MA 3O8CA 2UZ4A 4HAVA 1UK9A 5EUBA 2WEKA 1NW6A 1YNSA 2G25A 4JJKA 2DBYA 3RC9A 3KT6A 3UKJA 3ZV6A 1KP3A 1E9RA 3RYFB 3ZGYA 1T8SA 4HI0E 3I39X 2Z9DA 1F2UA 3FFAA 4E5UA 4DUYB 3PWSA 5JO9A 4FW9A 3ZVKA 4EY3A 4ER0A 3RWBA 1FXWF 5B2FA 4GX0A 2YN2A 3M4ZA 4Q12A 3RS2A 5EKUA 4BP8A 5EXXA 4TTRA 4HDMB 3PL5A 5J4VA 3R3SA 4B6SA 1QVAA 3CVVA 4FR0A 3U9TA 1JIQA 1ZH6A 2JNWA 1YQWA 2OO3A 2ZVPX 4O8ZA 5E8JA 5A3QA 1DAHA 3A14A 3QRWA 4QTYA 1VSUA 3PRYA 1WAMA 4QYTA 5KVSA 1OA1A 2CZQA 2WAAA 5EJFA 2YS7A 4UBJA 5K0EA 4EG1A 1QQAA 1XMSA 1JDTA 2O05A 3T4UA 4ARIA 1JQKA 4M1ZA 3TXAA 3KQLA 4RULA 1M34E 2EKLA 1K97A 1N2SA 1TB4A 3C3JA 4FEYA 1AH2A 8GPBA 2CSUA 2AJTA 2OV8A 4G0NA 1E89A 3RUHA 4DM3A 4DOMA 1U1FA 5ALLA 4RO0A 3ZE6A 4KQ1A 2E4XA 3R2JA 1KIAA 2XHZA 3UZUA 4MRNA 4ABTA 2XCTB 2NP6A 1YQEA 1F14A 1RQPA 2CF5A 2CYAA 3Q5GA 3A05A 5CX1B 4M87A 4ZQIA 1IUPA 3GR6A 3HO1A 1PYDA 5EZQA 4UHKA 4O63O 2Y2UA 2PR7A 4KX3A 4CLOA 3EQ7A 2A86A 3G9ZA 1ZESA 3MJRA 2FPGB 1ODJA 3E2MA 4GMHA 4X00A 1F38A 3WMRA 5HZHA 1DZ3A 5JWRA 1THTA 1W35A 2Q9UA 3NBQA 3WLNA 4O5OA 2VBCA 1CUYA 2XT0A 1YZTA 2GYYA 3OCCA 4YBRA 1WKBA 4KQKA 5KS2A 1FJ2A 4C7OB 3L0DA 1WSWA 1DWOA 3N05A 4FCVA 4D46A 3H2HA 1NLYA 3U3OA 2B78A 4B33A 4R16A 3OZBA 4ZDIA 4QATA 2QJWA 3G8AA 4JBWA 4N7RA 3S8YA 3TF5A 1AN9A 2BFCB 4QDTA 3SC3A 3WSTA 4EF4A 2PUAA 4I0WB 4GICA 2LCFA 2ZRIA 4I46A 1QYIA 3FPFA 2ES4A 4NCHA 4DWJA 4NJMB 1UMDA 2UUOA 5DSXA 2B83A 2VZ0A 2PVPA 4RKWA 4LISA 1DUIA 1ICIA 2G40A 2I54A 3PJDA 4LWPA 2O2IA 1AA6A 1PTKA 4BRUA 1EG2A 3D6NB 5KOIA 3UGQA 3U16A 3QY9A 2QTFA 4AQ7A 2YWGA 3GCXA 3MS2A 1K7CA 1SN7A 4K86A 4MV7A 4BRZA 3JARB 2NSJA 3SHFA 3HJGA 3OM0A 3O1IC 1R0WA 2WY2D 4BTVA 4EHBA 5B3KA 5M3BA 1MRZA 5ICCA 3VM6A 3GAAA 2PCJA 3TZHA 4TMXA 3I9MA 4DDVA 4OXYA 3GVCA 4AP6A 4Y7CA 1USGA 1CHDA 4ZQGA 3HB1A 1DAOA 3I1FA 2V3VA 2CLIB 2EP7A 2EZ9A 3TSWA 1APBA 1ZC4A 4FI3F 3WB1A 3FAKA 5ES4B 2RG1A 2ZUEA 3AJAA 4LTNA 5BVHB 2FWNA 1Q20A 4QZVA 1YZLA 2AOUA 2C61A 3R3ZA 3CX4A 4C1BA 1UQTA 1LLCA 4OP1A 2WA2A 5TXGA 4I50F 1RJ9A 2GKSA 4BLVA 2L17A 4HDNB 3TUZC 4CQMD 3C1TA 4RIIA 3M5PA 4WBNF 3WGTA 5I9SA 3HZRA 5EQFA 2WHQA 3K31A 3MBKA 4YRJA 1ZIPA 5G3ZA 1Z6TA 1ODKA 3PPYA 4BO4A 5HGXA 4H2DA 4LJ5A 2E89A 4IUDS 4AS2A 2OGWA 3GJXC 2A4KA 3P26A 3HKEA 1E2NA 1WSAA 3DBLB 2GHIA 5IUJC 3OTGA 1CF9A 2PGAA 1B76A 3P9CA 4BUZA 4GW3A 2W83A 2AUTA 3KLNA 3H5OA 4IDFA 4XLZA 3DH0A 2IS1A 3HUUA 3WKBA 4PHHA 3LYHA 4OAQA 1YKFA 3C3MA 3W05A 4ZO9A 3DW3X 5AI9A 2EXXA 1NVXQ 4BB6A 1X1CA 1DRWA 1VMAA 1UKBA 2O4UX 3GH3A 3WLHA 4CHGA 1GRRA 1XFDA 3KJNA 5EL0A 5J23A 4NABA 1R3DA 1MPTA 2ZYGA 1Z73A 1XXHA 4OM8A 1JE0A 1Y9DA 2I76A 1UWLA 1RRVA 3A2NA 3NT5A 5EE3A 1NVMB 5BSTA 3BHJA 2ZUTA 3SZRA 3MT0A 3VTKA 4B48A 1OZHA 1NI5A 2K6GA 1JR2A 3R44A 4E11A 3KHUA 4B4DA 3M6LA 2HWWA 2O3RA 3I2HA 2WNHA 2Q5LA 2GXUA 5DLDA 1KBZA 1R8QA 1Q6ZA 1U1DA 4M60A 1OH7A 3D4LA 1V3TA 3GJ5A 1PLKA 2PRKA 1W5EA 1NV8A 2YH2A 2Z9BA 4XRRA 3TLYA 3ER8A 1J99A 3Q4GA 4HNGA 3JRXA 4WCVA 2V7VA 4I50A 3RRMA 4FBMA 3T1TA 1R2QA 2RE8A 4JFAA 1K2VN 1PN3A 2HIAA 3F67A 3HEBA 1Z7GA 3NH6A 4Q48A 2D5LA 1KO7A 5LMZA 2ZGVA 2R7KA 2O0HA 3NWJA 5L53A 2R86A 1FVFA 3CRNA 5FL3A 3WSWA 2AJCA 1PR5A 1GPWB 3SFVA 1J8MF 1Z3CA 1BJKA 3EMBA 4IR7A 3EZ2A 3HZHA 4B3MB 4F71A 3SN6A 4AECA 4I2NA 3C8HA 5F98A 1K5DA 1E0JA 3EDOA 3UAXA 3RSGA 2GEDA 4RZXA 4R5HA 5C2JB 4HWGA 4E21A 3RG2A 3MFYA 3QVMA 4CF5A 2NTEA 3CX6A 3NOVA 4REOA 2JVJA 2XUIA 3OPNA 2VT6A 1E5LA 1XTKA 4TM7A 2W2KB 4DBLC 3V7FA 5EUMA 3CLSD 2P5SA 1NW4A 3GGSA 2WI8A 5DBGA 4KQXA 1T3ZA 2PL3A 3FHLA 4Y0VA 1XHEA 2QI9F 3H5IA 5J2UF 2H52A 2ZAIA 2DPYA 3FGOA 4MDYA 3KKZA 4AUMA 1YDFA 1BE1A 4GOKA 2V6MA 4I1OA 4NZMA 1JHPA 4OHRA 2QJRA 4XIYA 3U7FB 1BCSA 5JAQA 1J70A 3CRW1 2HHJA 1RBYA 5LXTB 4ZWNA 5BUCA 4JYAB 4S1VA 4NV1A 3SX0A 3X2FA 5AOBA 3NH9A 3GFVA 3H11B 1OIWA 2FZ5A 2VK4A 1C9DB 1I9CA 2P2YA 3ETGA 3QZUA 4JDPA 2P9QA 4AJKA 4BIIA 2P2DA 1G38A 2QK4A 5FLEX 5C1DA 3HKBB 1SCUB 2F7SA 2GSWA 3KZ1E 3WLIA 3G7SA 3ILVA 4MGZR 2QBYA 2HPHA 4WBNB 5A4MS 3GPDG 1XEFA 4J6EA 2WWVD 2XOKD 5EMKA 3L6BA 5HFAA 1VA4A 5J3JA 2C4KA 3B8HA 3O4FA 4DTCA 3PQ2A 2PWAA 1KKMA 1PVDA 2POCA 4BLWA 4BO8A 1Y7IA 1ZICA 2NTYC 3LBHA 2VTBB 2OCDA 2COKA 3EUWA 5DI3B 2I67A 1TKCA 3AR3A 3KLBA 3U4DA 2OV1A 1DG3A 4GI3A 1HT3A 4MR9B 3A3KA 5A04A 5TPZA 5L6MB 1N5OX 4JXZA 4LDPA 3QE0A 1FTGA 1MC4A 3L7BA 2D5CA 1GLVA 4YCLA 5HSGA 3I52A 3RJMA 1LDBA 1NJFA 4BQRA 5L3SB 4KR3A 2H2AA 3PL1A 5DHUA 1A4IA 3LY5A 3EPJA 1IM2A 4D1YA 4OJQA 3GJ7A 2QTWB 4HFNA 5CK5A 3MWJA 1ISSA 1Z06A 2DXIA 3PEWA 2WVHA 2W9XA 4PX2A 3O84A 2II6A 4KQ2A 4WI1A 1MZPA 3OLVA 3E5NA 5GV7A 1MFZA 4AZWA 3ZHBA 2HDOA 3L79A 1A8HA 1B00A 3BH0A 3PGKA 4WDRA 4PXAA 4RXTA 2CBGA 2N42A 4NFYA 4Q3AA 3T3IA 4BFYA 1JH8A 2LD4A 2A9JA 2BE9A 1HEUA 4JYCA 1F2UB 4KWEA 5H3LA 4KDRA 3KT3A 3SC4A 3D4NA 1U7ZA 4AXXA 5JH7B 1AMNA 5HIMA 3K6JA 1MJGM 5DCWA 4CV2A 1PQYA 1H2RS 5U4XA 3GELA 3KZKA 3UUWA 1EXWA 2ZJ2A 1OXBB 1W96A 1XF1A 3FPLA 3N39C 3PDCA 4MV6A 3QEJA 3VNSA 1N1DA 4XQCA 4RQUA 3AQ4A 3OOJA 2WJAA 4YRLA 5GWXA 3QY0A 1HRDA 2DHCA 3NLLA 3H0KA 1IN5A 2QTNA 2WHRA 3BD9A 1KFKB 5BYJA 4G5QA 5CU7A 1WDLA 5LA6F 4UNNA 1QO7A 2CMGA 2F43A 2O23A 3NTLA 2CZCA 3NTQA 2W2QA 1ETHA 1C9NA 3C70A 3FGZA 4XVHA 2XNCA 2ZBVA 4NG4A 4JVMA 4D9IA 1Y9AA 3TLGA 4ECEA 5KJEA 3OTOB 1VRCA 1NTOA 3VC7A 2I3BA 3EBLA 2ECPA 3UJCA 2YX1A 5KX5F 2ERCA 1L3IA 3BRWA 4JQZA 3ROGA 3OZRA 3JALA 1VI2A 1BMTA 4L02A 5TPZD 4DM4A 5IUNC 5CA1B 3SHOA 5EYPB 3W9UA 3UB4A 1UWVA 3ZDXB 1XTBA 2CKMA 5CFRA 5AI4A 2BUAA 1E3EA 1R6AA 3P0EA 2B6HA 2NV0A 2LV8A 2QKYA 4UAUA 2AEEA 4PAMA 4QNNA 3IP8A 4FEGA 3EGXA 4JX9A 4U7GA 1I4LD 5F1YA 5C3UA 4PAGA 1JTEA 3U37A 1PL0A 4C06A 1LXCA 4DJJA 4LYYA 4IDDA 5FPTA 4AW9A 1HURA 4EHFA 1T2FA 4N5NA 5EINA 4EG7A 4YDRA 2CHUA 4K5QA 4BZZA 2QROA 3FNHA 5LLDA 5A7GA 1X15A 4WESA 4LECA 4ZVMA 3Q5EA 3DMGA 1QNLA 3K2EA 4G01B 2VWHA 4DRXA 4BKRA 1E3WB 2GRAA 5CB4F 4MJXA 3KOYA 4MJLA 1EVIA 2QUBA 3WHIA 2GUGA 3F5QA 1EBBA 4Z54A 4YQYA 3R77A 4KMOA 5SZIA 2JASA 2A5FA 5CDYA 2GHQA 3NTXA 3R20A 2GHTA 3LUFA 5FDFA 2J9RA 4IIHA 5IKEA 1DAPA 1PQUA 4D3FA 1CERA 4DG5A 4YI3A 5CVUA 2J3KA 2BEJA 1N6RA 4F06A 2V4UA 2CFIA 4D43A 3QF4A 3GVIA 1C8VB 1TAGA 2DFPA 1UM8A 1G2IA 1PNQA 1VCHA 3LXRA 4CMIA 1P7CA 2XCIA 4QFDA 1B74A 1PG0A 4DSTA 1XXHE 4AD8A 1VPVA 3B3FA 3DYBA 1EVKA 2W6ID 1IEQA 3DWFA 2H06A 2IYQA 4MYHA 4EDFA 1NNLA 4D8VA 4Q7QA 3IBGA 2ZIFA 1H5UA 1G19A 3RJTA 4IV5A 1DARA 1SXJA 1QCCA 2I80A 5JRZA 4GZ6A 1AHHA 1ZIDA 1GQOA 2G09A 3OFNA 2BW0A 1AKUA 3IUSA 3OO0A 4PLWA 3AU8A 5U1PA 2GAIA 4FHEA 4RD1A 1I5OA 4IYRA 1RJ9B 1OX4B 2OFOA 3ASUA 1WCYA 1DKUA 1DU4A 1O58A 1GPAA 2JD0A 3H3FA 3M3PA 3QE2A 3VR3A 3ANXA 3BMCA 5M34A 3RDPA 1DUVG 3QITA 2IBMA 3UK2A 3FNFA 4ZTZB 4ESOA 4QXOA 4ZVKA 3ID6C 1KI6B 5BSWA 4RA6A 4MLCA 1ZD5A 2GN9A 5E7QA 3LOQA 3VFDA 2HB6A 5LU9A 3ZWAA 5HDQA 1GL7A 4D9MA 4DEXA 1NXWA 4QXQA 4WXHA 4OPMA 4C78A 2YS6A 2W11A 2C7QA 3D2LA 3HV0A 4B7ZA 3SS9X 3K9LA 2YIDA 4D3XA 1YJ8A 4PFJA 4KFTA 4ZI3A 3JQ8A 3QWIA 5AVOA 2OGSA 2PWPA 4PZCA 1DJMA 1YJBA 3LY9A 1OGIA 3NIDB 1A96A 4IBOA 5F78A 1HLGA 3K9NA 3AINA 3EA0A 2D59A 4LXUA 4M0CA 3OMXA 4KL8S 4P3YA 4ZVTA 3DCIA 1J0EA 2J7PD 1KDRA 2Q2NA 3BIOA 3ANNA 4DQLA 5CBPB 1HE4A 2OXCA 3DVQX 1ISIA 5A6SB 3CNQS 5JU6A 2FETA 4EG8A 1UH5A 3M8KA 1DBWA 2AG8A 1XWFA 3KQMA 3PDWA 1W5TA 4KWHA 5CEFA 1ZOIA 1TO1E 4CL2A 1GV0A 2C2XA 2Q6TA 4YI5A 1YBVA 3REGA 3IC5A 3EVNA 2VDVE 2X8JB 1CRPA 4EG6A 1U2RA 1FDRA 3AIOA 1CULC 5ALPA 1W1UA 2DKNA 3HHPA 1PR3A 4URXR 2F9MA 4KAAA 4UQPA 1SA0B 2D1FA 2JANA 3PQFA 3KEQA 3BIWA 3G9QA 1GG9A 4QFCA 1DP4A 5ERGB 1FFCA 3VZSA 4UNSA 5F9HA 1E98A 3FX2A 2PIDA 4E1AA 1HXHA 2YXNA 5T41A 4KO2S 3ZLTA 4GAEA 4BNGA 2BT4A 2Z08A 4V24A 3I5UA 4RELA 1Z0KA 3T1HB 4CCYA 2NX2A 1EWTA 4MDEA 1G21E 1ZUWA 3HPQA 4RFVA 3L6UA 5D2CA 4ZJYA 2CLCX 1CQXA 1EU1A 2W0SA 3D4OA 3TTVA 3AERA 2WD7B 2XNSA 2W4MA 4DVGA 3K73O 4YV1A 2NVUB 1J0XO 4OH1A 5CJJA 4ZOBA 3V1MA 4AZSA 4DLWA 3ZI7A 1F0YA 2M6SA 1XGKA 2FZ4A 3T1NA 3FDFA 5LYJB 2YXDA 3PC6A 1ADCA 2QR3A 1JP7A 4JQYA 4AMYA 4UUAA 1NFRA 1SNYA 4BBJA 4OHFA 1JR3D 1U8CB 3C24A 4YLGA 3RVSA 7REQB 4HUQA 5GJBA 4L16A 3BA1A 3E4CA 4WEQA 1V16B 2RKWA 1KEKA 5ALVA 1GUBA 3V1UA 3BMNA 4ZYWA 1I94B 2COUA 5C52B 1IXZA 1D6JA 3BK2A 2PMCA 2V7UA 2IUSA 2ZRQA 2PPVA 3H11A 3IQZA 3LAWA 4MS1A 4RL6A 3ZWPA 1YB1A 3DMPA 4WV3A 4DGSA 4DNPA 4IXWA 3V97A 1SZJG 4NOJA 1UJ4A 2EG5A 3O4RA 3PQ6A 5EHIA 2BDTA 3GLQA 1JKFA 4INAA 5I7WA 2B1RA 4GOMD 1LLFA 2Y77A 3GL9A 1Z2AA 2Q3BA 2CT8A 4FZRA 4E94A 1NVEA 4QEDA 1B0ZA 1JLSA 4QOHA 3HR7A 2A0YA 5T5QA 4QGAA 1Z6ZA 2JARA 4WY5A 4J29A 4FILA 2WU4A 4KFSA 5A71A 2ECFA 2FFAA 4U7JA 3HFGA 3RSQA 3AWDA 3ESXA 1T5DX 2EBFX 4MP8A 2HJ9A 1FXUA 2OPBA 3WJ1A 4MR9A 3Q2IA 4Z9XA 4A1OA 3O8NA 4RH3A 2BYTA 1WZIA 2FFHA 4BVFA 1POXA 5E6SA 4JBXA 4Z0TA 1YQUA 1ZN9A 3EIFA 1QO0A 2BR3A 1F60A 2FMTA 3MUOA 5JR3A 4XYEA 4EENA 2V7QA 1IG3A 3KE8A 4FJ2A 4GLOA 4REMA 3ZV4A 2GBCA 5CFLA 2O19A 2FQYA 3PNMA 1C9JA 1XKQA 1BMQA 2IH2A 4BNHA 4TL7A 1VKNA 3A3PA 3QU9A 4D8TA 2H1WA 3PLNA 2BMDA 2DZDA 3GBPA 1W85B 3AUSA 4OA8A 1I51A 3ZTTA 4BP1A 1QPZA 3QA3E 1JDZA 1SBYA 3VX4A 4MW1A 1O3YA 2ACWA 2Q49A 2QVLA 4HX5A 4W5NA 1UOPA 4LMPA 1A2OA 4RHCA 4EJFA 3L5OA 2XVXA 3DJYA 4JEMA 4RHEA 4MK4A 4XIJA 2A84A 4A0RA 3FZEA 2TECE 2JJ1A 2YZ7A 1ESMA 4GRIA 1ZI6A 3GX1A 5BSRA 4EEKA 1O94D 1ZX1A 5H81A 3E27A 3ENQA 4Q1EA 4Y6QA 2M2IA 3AL0C 4AQYB 3TEMA 3MWEA 4CT4B 2GPJA 5L40A 1UJMA 3ZQ6A 4Q4HA 5T3YA 3MAGA 4C4OA 2BTOA 2RHGB 3P5SA 2QVCA 1W2GA 3F7OA 3E48A 3P9YA 4MEJA 3LGXA 4D3YA 4TLBA 4BAZA 4E5NA 2AR7A 3PXDA 2HA4A 2E1RA 4OGGA 5CNJA 2H7CA 4Q19A 1OXVA 3OQVA 1R4ZA 3DW1X 2FN4A 1MX1A 4HYYA 1ZN7A 4R2IA 4N3BA 4OKIA 3ZCVA 4DSAA 3NEPX 4U9UA 3U44B 1NKTA 3CY6A 2OP0A 1JMYA 5DE3A 4C7VA 3OSUA 1UPFA 1OLSB 2C57A 4NCJA 5AI6A 3V00A 4I99A 5KYYA 1NM5C 4IGAA 1MN6A 4IMPA 4OXNA 3WGHA 5ITSA 1MOQA 4AJLA 1AC5A 4DB2A 4HHEA 3U1BA 3G0BA 1PGQA 3ORFA 1P7ZA 3BGIA 2YZ2A 1DX9A 3OUUA 2FEXA 1KI8A 2CNKA 2QXTA 2H5JA 3RF6A 3ZHVA 4S3MA 5JCOA 2QRLA 1JLLA 3OURA 3VOAA 3G79A 4WJKB 2YIVX 4WN9B 4OFBA 2AZDA 3FOCA 2XUPA 2D7JA 4IVNA 1BVHA 1NUHA 3QBTA 2AW5A 1Q7CA 1CUHA 1U8TA 4DIKA 4E03A 1XVIA 1P2VA 3DG9A 3MJDA 2DHQA 5G53C 1BW9B 2X8AA 3MLEA 1ARZA 3IPRA 2QUKA 2WOJA 4QVGA 1GPH1 1H42A 1PG5A 4CN9A 4EHKA 3B1FA 3ZNOA 1D8TA 1R9JA 1UPAA 3GEIA 3KKOA 4EECA 2BR4A 1TVCA 1RYEA 5C9ZA 1LU9A 1JH9A 4CKWA 3U1TA 1QYXA 3IX7A 3F8SA 3MRXA 5CLIA 3UMBA 1KF0A 2Z56A 4EFKA 4F60A 1O95C 1WXFA 4JJGA 1RYYA 3JS5A 4OLHA 3WLJA 4F38A 5JCXA 1RXVA 2PKEA 3DLHA 2PH7A 2EJVA 4HX9A 5FO0A 5J2UA 4KE7A 3VO8A 4LFCB 3IEKA 3F7TA 4NPCA 3DBVO 1F9EA 1EGHA 1KDTA 2AYXA 2G67A 3B53X 3DOUA 2H4FA 3MOGA 4MUEA 3JQDA 2BM1A 3AIIA 5I7RA 2Q3EA 3NRJA 1DFGA 2BEWB 2J1LA 4JEIA 4J2TA 3SHWA 1THZA 3I23A 5BNFA 1Q0ZA 4IHQA 4R7TA 3WGOA 3P9ZA 1MNAA 2QYHA 2R7MA 4DQUA 1E7SA 1ULZA 4CKCB 1E1QA 2C5FA 3FIJA 2XIQA 3OOSA 3QMVA 1Q0TA 1AUOA 2PZFA 3CYFA 3G7UA 3GLVA 3OZDA 3A4YA 1HMPA 2VP3A 5HFJA 1L5HA 1JSLA 4LSWA 2IBSA 2F9LA 3ADKA 2ZWPA 1Z5UA 3L0PA 5F12A 2AVNA 1LSUA 4P3OA 3A6ZA 2IEDA 2QW8A 5CHEA 3ST7A 5BNZA 3GI1A 1ESZA 4ALLA 4JUIA 1SCIA 2IEAA 1RXCA 2ZJ5A 4WINA 3TNFA 3IDQA 1SBQA 4OCZA 4RV9A 3LQ2A 2G7ZA 5FNVA 4CT0A 4EPXA 5AVWA 4WLFA 3DVRX 3TCKA 1DRVA 1M67A 5BQFA 4X1KB 4S1TA 4JSYA 1S3FA 3M9XA 1JAYA 5I9NA 3VXKA 4LNAA 4XUEA 3FPHA 3DQPA 3RVKA 4MSUA 4W1PA 3WY9A 3U4QB 1IUNA 4GL2A 5IXSA 2DQSA 4OHOA 3INNA 1NXSA 4Z0NA 3STWA 1Q7GA 4HDRB 2IY7A 2ZB3A 3OTWA 3FZYA 2WABA 3CTPA 4O4JB 3KFVA 3SBEA 3X1MA 2J9FA 3D0RA 2QXUA 4KAXA 3IQWA 1ECBA 5IVDA 2D7CA 4EA8A 4HAOA 4NDAA 3IPXA 4QYSA 3VJRA 1ZY2A 4B81A 4GMKA 3NHWA 4ENPA 3HDTA 5ISMA 1JSXA 4V0SA 4BMOB 3HB0A 4B09A 2QG9A 1P0FA 2CVHA 2YOFA 3CNOA 2AFHB 3WL3A 2C1EA 5HKKD 3OICA