3KB1A

Crystal structure of the nucleotide-binding protein af_226 in complex with adp from archaeoglobus fulgidus, northeast structural genomics consortium target gr157
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
255
structure length
243
Chain Sequence
b'RVTDEDIKERLDKIGFRIAVMSGKGGVGKSTVTALLAVHYAKQGKKVGILDADFLGPSIPHLFGLEKGKVAVSDEGLEPVLTQRLGIKVMSIQFLLLIAGMIREFLGRVAWGELDYLLIDLPPGTGDAPLTVMQDAKPNGAVIVSTPQELTAAVVEKAITMAEQTKTAVLGIVENMAYFECPNCGERTYLFGEGKASELARKYKIEFITEIPIDSDLLKLSDLGRVEEYEPDWFEFFPYLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleotide-binding protein
publication title Northeast Structural Genomics Consortium Target GR157
rcsb
source organism Archaeoglobus fulgidus
molecule tags Nucleotide binding protein
total genus 60
structure length 243
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10609 ParA NUBPL iron-transfer P-loop NTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kb1A01
3QNUA 5LB2A 4BUJA 4OQNA 2YVUA 2IWHA 4CEHA 2BOVA 4V03A 3R7WB 3HP1A 3W5JA 2CNWD 1Q1ZA 1PLJA 3GLIB 3GLFA 1SVKA 4PC6A 4Q4JA 3FDIA 3TE6A 4OHYA 1J2JA 3EZ2A 1K6MA 2NMVA 2Q9AA 2XB2A 1J90A 2IA5A 3UG6A 2ZQ5A 2CVHA 2HYDA 2C9CA 3IO3A 1II9A 5ELXA 4IVQA 4Q7MB 3B2EA 4JKIA 3ZVRA 2QRNA 2N42A 1N2CE 3R7WA 4JL8A 4MYUA 1U0HC 3GLIA 4C9BA 2OBNA 3EC1A 5FPKA 1J70A 2CL0X 2VSXA 1RE0A 3DMDA 4MKGA 3ZS8A 4P32A 1XX6A 2CE7A 2XTNA 2FSGA 2D74A 2RB4A 1S8FA 3HDTA 4ZO4A 2XEXA 4Q02A 1OXUA 2AK2A 5A4JA 1OIWA 1W7AA 2NPFA 1NRJB 1YHNA 4YDSA 3ICEA 4OJQA 1IN5A 2GF9A 1Z0JA 4V02A 4MRVA 4WVFA 4IDQA 2IYRA 3UATA 4NTZA 1DBSA 1VTKA 4IRUB 2PMKA 1A5TA 1G5PA 5J47A 1VIAA 4I4LA 4B3BA 1M7GA 1K5GA 1T8TA 4B35A 2GXSA 1U8AA 2GRJA 2QU8A 4M9ZA 1T5LA 5LDDC 2FE4A 1RYFA 4OHZA 4JSYA 2ZR7A 1E2NA 3K0AB 5JCPA 2RGGA 4HLUC 3T1VA 2PT5A 1OE0A 2AD1A 1Q3HA 3K0CC 4NYIR 3UANA 4XVUA 3BFXA 2DBYA 3C15C 4I1UA 1FUKA 2ZS7A 1NN5A 2AWNA 4UQOA 1G41A 2C5LA 4JLBA 1G17A 3CPJB 1UM8A 3B5JA 3K0AA 4OI1A 5FTMA 2FFAA 4Q5IA 621PA 1HEIA 4B73A 1GRQA 4HDQB 2ZJZA 2OFXA 2R6FA 5FBQB 1JXOA 3IGFA 3WMGA 3BC1A 4Q1AA 4BPBA 3D8BA 3SS8A 3P32A 5A0FA 3IPYA 4NYMR 2O8CB 2NO7A 2WSSD 3GJXC 2DHRA 3VR5A 1S96A 1CR4A 3KX2A 4QBIA 2B8WA 4N1AA 4HUTA 3O8BA 3K8YA 2BBSA 5FTJA 1QHXA 4C4PA 4NDZA 721PA 2WJGA 4IVRA 4LC0A 3TGPA 5UKDA 1ZD1A 1HY3A 2IYSA 1MABB 5ANRB 1OH7A 2XSZA 2O8CA 3OIYA 3U44A 5H8WA 1R0ZA 4LJ8A 3IIJA 4TYPA 2GXUA 4XTRA 3NH6A 6Q21A 2V1UA 1A2KC 2HCBA 4OQMA 3ZGXA 1XXHE 2IEYA 2OEPA 1G5TA 2F1RA 2G9NA 2K5UA 1E9AA 1W4RA 2GWHA 2CCKA 2CLSA 2FSFA 4LDJA 4PC2A 3E2IA 2WICA 5EE1A 5JWHA 1MABA 4FINA 1P60A 4BECA 3E1SA 5L3QB 2A78A 2IF2A 1KO1A 3FVQA 3TK1A 3QG1A 1W4AA 3LBHA 3C41J 4PQFA 3Q9LA 3ZJYA 1NVXQ 2V9PA 4LPKA 2O8DB 4BFWA 3T06B 1U9IA 2QAJA 1ZNZA 3RANA 4OHWA 4AKGA 4P4TA 1ZRHA 2H1LA 3EWAA 3K09A 5L3QA 4C7OB 1Z6AA 3FHTA 3SBDA 5CIQA 1MT0A 4TL7A 1E0AA 1JR3A 2MSEB 2XOKD 2CXXA 3OF5A 1ONBA 2O8DA 3P26A 1EESA 4AWXA 5FPYA 1XZQA 1G1MA 3A37A 1AS3A 3V00A 4L15A 1R2QA 1NN0A 1ODFA 1DE0A 1IXZA 3LXRA 3QXCA 4OI2A 3RSLA 4C7OA 3A58B 4FCWA 5KSYA 1VG8A 1U94A 2IYWA 3IQWA 5CLQA 1G7RA 1SXJB 2ODNA 3K0SA 3UMFA 1U8YA 1E98A 1BS1A 3ZIAD 4KYUA 2FFQA 4M8NE 1W4BA 4CGZA 3KL4A 4RVCA 2VEDA 1R0YA 3VR4A 3UK6A 3CUEF 2QMUA 4LBVA 2VP0A 2KWIA 2VYFA 4F91B 2WPDA 3KXKA 1PUJA 4H1UA 3RRYA 4AD8A 5JLJA 4TZ0A 1SXJA 2QPTA 5CM9C 1OH8A 1CJUC 3D6TB 4LUCA 3FB4A 4WBSA 1WXQA 4C3ZA 2LWIA 3KQHA 3OHMA 2WSMA 3ETLA 4NH0A 1Z28A 2D2FA 4YXWD 1M2OB 4KBGA 3EWSA 2FZLA 3AF1A 4KYIB 4LJAA 3SJAA 4JIMA 1H8ED 4JS0A 5JHHB 2W0SA 1OKKD 3QVVA 4LV5B 4Q1BA 3WP0A 2PLRA 4PPFA 1TQ6A 3BJIC 2MSDB 2XTMA 3U7EB 1FTSA 4DWJA 4PO9A 4BEBA 1NBMA 2RGEA 1E2FA 1ANKA 5J4VA 1HQCA 1OHHA 4QHYA 2CMKA 3OEHA 1NVVQ 1G5RA 4IW3B 5AUPB 3VTKA 2NZJA 4B2PA 1Q1BA 3W5IA 1XPRA 4B3FX 1XFAA 2FFBA 2O8BB 4B2LA 2VRWA 1RVDA 2IYLD 3UIEA 3B1XA 4O2LA 1E2KA 2BBTA 2WMNB 3PEYA 1H8HD 3EIHA 1T3SA 2ZSEA 1NF3A 4MYCA 5F3WB 5JEDA 1XEWY 2WKQA 5KNDA 1U9IC 2A3RA 1AS2A 1W46A 2ATXA 2J87A 3EW9A 5JS7A 5C4MA 2O8BA 1JBKA 5SZHB 2JIZD 4DLXA 2VL7A 1GP2A 3K09C 4KVAA 1SVOA 3GLFE 4F92B 1E2HA 2VP4A 2GF0A 2GZHA 2ZJBA 4BFXA 3R9XA 3NH9A 4HZIA 2EWVA 2O0JA 2HJGA 3DZDA 1E9SA 2GZAA 3LVQE 2WIAA 4CRWB 5F9FA 2KBFA 3RAPR 2Y8EA 5JJIA 3FMFA 4KSBA 4AYXA 4IOKA 4XD7A 5HE9A 3OIWA 2RGXA 1P73A 4LHYA 3HPRA 5GJWC 2KB0A 2QMHA 2GVZC 2QTHA 4FW9A 1G4AE 5EE3A 1DADA 1MO4A 221PA 3J81k 3H84A 1OFHA 1K8RA 2DY1A 2NO0A 3AUXA 3SJBA 4ARZB 1RYHA 2FSIA 4F4JA 1JNYA 3GJ8A 1CEEA 3NBZC 2NPIA 4PPNA 4CF7A 2WJJA 5IRCD 2AN9A 2YJTD 4RFSB 1S3SA 3ADDA 4XOIA 1EXMA 4AYTA 1GUAA 2G77B 3Q7QA 1N5KA 2DWPA 1B0UA 2HUPA 2J7KA 4US1R 3WY9A 2BKEA 2JJ1D 5P21A 4D4LA 5L3SA 4QG7A 2ZE8A 2CCGA 3I61A 2RGNA 5TDHA 2ERXA 4ARZA 4BLSA 5JFGA 2ZE7A 4MDEA 1G4UR 3AH8A 3ASYA 3JZAA 1R8SA 4M1SA 2IYQA 3VHXA 2QQEA 4RFSA 5CYOA 1E6CA 1GITA 2RHDA 1BOFA 4B6FA 1OH5A 1JECA 3I1FA 4NKRA 5EP3A 1W0JD 4NHOA 3U7HB 2XZLA 1IN6A 2CDNA 2QSYA 2ZYTX 3AV0B 1Q20A 3RS4A 3R8FA 4EQ6B 1KDOA 4HAUA 2R6CA 4M22A 1CJTC 3MLEA 3QXXA 4GT1A 1R0XA 1G16A 1S1CA 3ZZ0A 3RC8A 2ZANA 1Q12A 4Z1MA 4BRWA 1NLZA 4TQAA 1VIYA 2UKDA 4DZZA 2IYTA 4LJ7A 2WJIA 3K0FB 2J45A 2ORIA 2IYXA 3QKRB 3W9YA 2P6NA 5AWFC 3WXMA 4IDOA 4LHWA 2GXQA 4C2TA 1ZU4A 2IF0A 3MWLA 4B75A 3U61B 2ORVA 4TLBA 4EQ6A 1A4RA 4GMDA 5BN3A 2CLCX 1US8B 4QM6A 2NGRA 2RGDA 2YNMA 1Z83A 4TSFA 2GHIA 2ZRDA 3MJRA 2W6ID 3NBXX 4IFEA 8OHMA 2GXAA 3K0FA 2CBZA 4MRNA 2AR7A 4Q1DA 1NVUQ 3QKRA 1GFIA 3FMIA 1FP7A 1D5CA 1YJ5A 1JJVA 1RZ3A 3IPXA 2FGKA 4BLPA 1GIAA 2J0UB 1US8A 1FOEB 1ZIOA 2YKGA 1ZINA 1JAIA 2R2AA 2JLYA 1ZC3A 4GBMA 4TMVA 1QDEA 4LHXA 4DLRA 2NZ8A 2VLIA 3I92A 1O87A 3OEED 4Q01A 2ODWA 3SQWA 1UKYA 1E1QD 1YZQA 4Q66C 1XEWX 3DM9B 4NYIQ 2WSSA 5BN5A 1R5OA 2YWEA 3U4QB 4QNRA 4V0LA 4IKEA 3PUXA 4RD0A 4TMTA 4V0ME 2QROA 4LJ6A 2J0UA 3VFDA 3VKGA 1N6HA 1BYIA 3B60A 1XP8A 4HB0A 4NCNA 1Z63A 1SVLA 4OHXA 1X6VA 3F5FA 3L0SA 4A6XA 1TF5A 2RAPA 3HU2A 4ZPXA 2JLSA 2NOAA 4URYR 3U7FB 5FL7D 5CJPA 3GJ7A 3LQQA 1II0A 1W0KD 1ZM9A 2IXGA 4JJKA 3U4QA 3ZD7A 1LVGA 2BDTA 4M1WA 2QG6A 2NO9A 1UKZA 4JL5A 1JR3E 3LY5A 4URVR 1F48A 2ZETA 1HTWA 3OESA 3KJEA 2BJWA 2FN4A 3MUFA 5L3RA 3TNFA 4ASUD 1MO3A 3BIFA 2ZSAA 1WB9A 3M6AA 4ABYA 2VPPA 2ZJ8A 3CR7A 1LS1A 3H4MA 3C8UA 1CR2A 2FFHA 2HT6A 4CT5A 2P2LA 3KFXA 2NTYC 2ONJA 2DPXA 1XEXB 4Q47A 3ADKA 4X8MA 4TWZA 5IDVA 2BEJA 3QE0A 4FMDF 3O8DA 1TTTA 3DPUA 2MMCA 2BMEA 2XOKA 4KAXA 5JRZA 1YR6A 1ZCAA 5AUNB 2IYVA 4A2WA 3T5GA 4QBFA 4TT3A 3UXMA 3WMFA 1XEXA 3BD9A 4TN1A 3OFNA 3FE2A 2YC4C 4PHHA 4IDHA 4X8LA 2C98A 1LW7A 5DN6A 1WCV1 2JJ2A 1QBKC 5CYPA 3ZIAA 4NE2A 2GEDA 3K1JA 2VH5R 5CJ2A 3CRW1 3WHKA 1KDTA 3PJRA 1E2DA 4MYTA 5DGXA 3SU8A 3QPWA 2B21A 1U0LA 2I1QA 1T5IA 5B57C 3RLFA 4ITRC 1J99A 3SE0A 4OYHA 5EZ6B 3X1XA 1ZU5A 2FH5B 1VG1A 1NBME 4Q4HB 3THWB 1IQPA 4EFMA 2JLWA 1IN8A 1XRJA 2AFIE 1FX0B 5KTYA 2Q9BA 3C7KA 4A2PA 1E9FA 5FUVA 4Q7JB 3FFAA 4YXWA 4RZ3A 5FTKA 1KK3A 2V54A 3PQCA 4GFDA 1NNEA 3PENA 2GNOA 1CULC 4OK6A 3RHFA 4Q4HA 3THWA 1H8EA 4FMDB 4URWR 4QHSA 4FD2A 1FX0A 2WJHA 4M9XA 2FOLA 3ZYCA 4DSNA 1F2TB 3U3RA 1L2TA 4QGHA 2Q21A 2VF7A 3L82B 1W36C 3DM5A 5AK0A 2FPLA 4TLCA 3NBFA 1GRNA 2XNDD 4TL6A 5KO2A 3LNCA 3K0EA 3BB3A 1G21E 2HF9A 1FTNA 4Z51A 1KGDA 3V9PA 1DAGA 2ZVPX 3DL0A 4FMCF 4HLDA 3BH6A 4L9WA 1D6JA 1F2TA 4Z8XA 3HYTA 1U81A 3AUYA 2G83A 3KB2A 1DEKA 2WWFA 1NVVR 1R6BX 1CR0A 4TYWA 2QM7A 2ZJYA 3BE4A 3LAWA 4JMPA 2BMFA 2GJ9A 4E09A 3LQRA 4DDUA 2XITA 1WE2A 4IHQA 4Q4AB 4EPVA 2VP2A 1TL7C 2OILA 4WA7A 2NO6A 2Q9CA 2ZS9A 1IN7A 1E79D 2QPOA 4DLSA 2Q0HA 1P72A 3QEJA 1VYTA 4JLDA 1AKEA 4I1SA 3UWOA 3W34A 4E03A 5CK5A 1OV4A 3V4RA 3F8TA 1BMFD 4JZKA 4ESHA 2HT1A 1IM2A 1SVSA 2HYIC 2ODBA 2VHUA 3D31A 4RFVA 2OLJA 3T1TA 5FTLA 1HE1C 5IHPA 1GKUB 4EPTA 2ZRLA 1CF4A 4Q4AA 2IWRA 4AY2A 2EU8A 4JLAA 4MQBA 3GEEA 3SYNA 1YZNA 2O8EB 3ND9A 4B71A 5FTNA 2A7QA 4W5WA 1JAHA 3RDPA 4TL8A 1D2NA 4QOSA 2OBLA 1KAGA 1GRRA 5FFMA 3U3KA 1NLYA 4A36A 3VR2A 1KOFA 2PCJA 4MRPA 2A5DA 4D0NA 5KUTA 1P2UA 1J8YF 5HKKD 4WXPA 4G3XA 4BZXA 2O8EA 1NP6A 1XZPA 1TU3A 2VHCA 2WHXA 2X19A 4RKFA 5FH9A 121PA 4HZUB 1T91A 1MRSA 4FMCB 2WWGA 5AJYA 5DISB 2ZREA 4EPWA 2DFNA 1AA9A 2W58A 1ESNA 3UKDA 1CP2A 5EZ5A 3BERA 4PC7A 4WOPA 1KNQA 2ZR9A 2XGJA 3PEVA 4D4KA 5J4YA 1GKIA 1WQ1R 2Q3MA 4QXAA 2HF8A 1R5BA 4HZUA 3AP3A 3SI7A 2A5GA 5J4KA 2VQSA 5EP2A 3GLHB 3P1JA 1GOTA 1G3MA 2BCJQ 1G6HA 1EFUA 1MV5A 2GTPA 3MGCA 5B64A 4UNQA 5EJEA 3ADBA 3BH7A 4RSGA 5B58C 2ZYUX 1ZIPA 1ZNWA 3DDCA 3HYRA 3K9GA 4OBEA 4RZ2A 1YZTA 1GL6A 3L0OA 3UMRA 1XNJA 1NG9A 2AKAB 2C99A 1AQYA 4C0LA 5CITA 1AN0A 1QG4A 3GLHA 1PLKA 3OE7D 3K70D 2PMDA 2AHOA 2A5FA 3P27A 1LFDB 1ZJ6A 2QP3A 2JDIA 4YMTA 5SZKB 4Z54A 1E32A 5L8VA 4XH9B 4OK3A 1U8ZA 1XMSA 3T61A 3VU9B 3EPJA 1DTSA 5FI0B 2ZRMA 2PL3A 2V4ZA 4JSTA 4R2IA 3KQLA 3AVYA 3RS7A 3ZD6A 1UFQA 4RD3A 5LB4A 3RNLA 3MRSA 3GJ4A 4YMVA 3LDAA 4B6EA 5EE9A 4FXPA 1XTKA 4OQLA 4U00A 2F43B 5KSZA 1Q0UA 1E2PA 4YC7A 3RVBA 4HB2A 4RZXA 4DT1B 3VU9A 4HI0E 4MGIR 1Z06A 1ZAKA 3D3QA 3EAQA 4BFVA 4BLTA 1SVMA 4UXJA 1IY0A 1FQJA 5EXXA 4D0LB 4A9AA 1G8FA 1L4UA 2BV3A 3TSWA 3LBNA 3VR3A 4A8JB 4JVNA 3L8YA 1Z0AA 4F4IA 2F43A 2X77A 2IEZA 4A0HA 4B3DA 4DT1A 2ZI9A 1Q57A 2GJAA 4HB4A 1W47A 1LNZA 2AK3A 1Z08A 4M53A 4NCJA 2C9YA 3VR1A 4M21A 3ND8A 3MD0A 2FPKA 3SZRA 1DG1G 2QP9X 3L8ZA 4UNNA 3DHWC 1KZ7B 3CZQA 4A8JA 1GAJA 1TQ2A 1Z29A 3FFBA 5C1BA 5KPJA 3R9WA 1KK1A 1W0KA 2ZI3A 1E4VA 4AKHA 1NMZA 2QMOA 2GEUA 4PTLA 2ZITA 2IXFA 4PSAA 5DH9A 1G7SA 1P2TA 3Q3JB 3CWQA 3FMPB 4L9SA 1VYVA 4MUBA 3ADCA 2EFGA 2DYKA 2WVJA 3REGA 4RY2A 2RGAA 1P9RA 4JBWA 5FUWA 1CS4C 3L43A 5JZVA 2WWHA 3U2QA 4ASUA 2ZUDA 3EA0A 3ZQJA 4DDWA 4WIAA 2W6JD 4XWOA 1R10A 4F4CA 3IUYA 5BWMA 2HXSA 3KKQA 4TL9A 3CPEA 3I5YA 5DIFA 1ZUNB 1LTQA 2FGJA 1KYIA 2OT3B 2EFCB 3TR5A 3KB1A 2ATVA 1OB5A 1XMJA 2MSCB 3EASA 1FMLA 1RRCA 1E0SA 3PFIA 3R20A 4DUGD 1E69A 3LVRE 5A5GA 3B9QA 1U99A 2BEKA 2P67A 2VO1A 3CRRA 2QAGB 3QKSB 2GCNA 2PEYA 1DAMA 4IVPA 3PIRA 1MKYA 2OBMA 3AQ4A 3PUZA 5HTKA 2QL6A 1I2MA 1DVRA 2H7VA 2IYYA 3ZVMA 5G3YA 1KI9A 1U2RA 3L2OB 1NJGA 1FPMA 1Y3AA 4UXHA 2QT1A 5KSPA 4PQYA 1N6RA 2JA1A 4HAVA 2GILA 2FSHA 2QAGA 2XNSA 1OF1A 3QKSA 4B2IA 4DJTA 1ZD8A 4LZZA 3PVSA 5FR1A 5BXQC 3WMEA 1W1WA 1OFTA 2IUSA 2XXAB 4BEJA 4MGKR 1LV7A 2ZRFA 4LV6A 1CIPA 1EFRD 4WXRA 4AYWA 1WA5A 3QENA 4KFSA 2EFDB 1ZCBA 4N3NA 1CJVC 1W5TA 2N1BA 2DFTA 1R8QA 5CK4A 4KV9A 1FQKA 1XWIA 1DAEA 3RRMA 3QXJA 3TLXA 2XXAA 4B3GA 1NSTA 3R8CA 1COWD 3N5CA 3KQNA 1G8GA 3GP8A 2IS4A 2JLZA 3HPQA 1YU9A 1P61B 3CLVA 1Q1EA 3SN6A 3GEIA 3W8NA 4B44A 2OAQ1 4YLGA 4FWIB 1YR9A 2EFHB 1NY6A 2QGNA 2H18A 1P6XA 4PHFA 3TW4A 2UZIR 3AP2A 4NZYA 2O8FB 4M9SA 1VG9B 3E5HA 2IUUA 2OXRA 1X8LA 3AP1A 4RD6A 5AJVB 5G40A 3RC3A 4A8JC 5KSOA 2QPAA 2XNDA 3NTUA 5BYKA 4F38A 4Q7KA 2ZRNA 3X1YA 3UPUA 4AKIA 4ZCIA 1OW3B 4HSEA 1NG1A 5JHGB 2OFWA 3UMSA 3MSXA 3W8RA 3WBJA 2G1KA 3C4JA 1N0UA 1M74A 2O8FA 4QBGB 4P31A 4RKEA 4ILEA 4G5GA 1Z6XA 4O25A 5L3VA 2BWJA 3BS4A 3KUCA 2GCPA 3C5HA 2I4IA 4B43A 3B82A 2CHQA 3WYGA 4DLWA 1JQLB 4DSOA 3RS5A 1UDWA 4MGZR 521PA 1OH6A 4KU4A 4PQRA 2YINC 1E79A 4M1YA 3AB3A 4UJ3A 1T6NA 1VCOA 3B13B 5GJCA 3TRFA 1IJEA 1S1MA 5SZIA 1BMFA 1IAQA 1N6OA 4HAZA 2OXCA 4M1TA 1G7CA 1OB2A 4N0DA 2B92A 4PC1A 4Q9LA 4JT4A 3W3AA 1N5IA 4BFUA 1XB2A 4DSTA 2GA8A 1AQUA 3ECCA 4A92A 2XJ9A 1P9WA 3FGNA 2V7QD 3LBIA 3VNVA 3HU1A 3B7GA 4V0NA 5F2EA 1XJQA 1N0WA 3QVUA 2A2ZA 1M7HA 1QHIA 2ZI4A 4K81B 4XSHA 5JMTA 1PLLA 1KK2A 2PZEA 4A4DA 1XTSA 1OXXK 2QAGC 1UBEA 5D3QA 1KZGB 5HKKA 2W0MA 3DOEA 4NL4H 5G53C 2UVQA 3RYTC 3O8CA 4C0QC 4B34A 5FBRB 3PV0A 1YZKA 1RPZA 4IOLA 1NIPA 4R7ZA 3KJGA 1VHLA 2W2XA 3U6KA 1DPFA 2L0XA 1KHTA 1RRFA 4LBWA 3NHBA 3KJIA 2QRZA 2X2EA 4H1VA 2FA9A 3GLHE 1AS0A 2CK3D 4BFZA 3AVUA 4QJ5A 3DKPA 3SHWA 4G01B 4P3YA 5LD2B 2QBYB 421PA 2WJVA 3EIQA 3GLIE 1N6KA 4PO8A 1RRPA 4R98A 4DCSA 4PSVA 2ZRCA 1KI4A 3P20A 3B1VA 1E2IA 1SVIA 1T8UA 2AL7A 4JVMA 2ZJOA 1X1RA 2B6HA 2X2FA 2ZU6A 1EK0A 1XJ0A 2W83A 2CNWA 3TBKA 4EPYA 4ZI3A 1GL7A 4AK9A 5H70A 1E2QA 2GVDC 2QBYA 1TUIA 4PHTA 3IIKA 2B8TA 3NC0C 4RCYA 4LBZA 1JXMA 4DLTA 1SXJC 4LV8B 3H2YA 3IO5A 3ZH9B 4FCVA 5KDOA 1TF2A 3A8TA 4LJYA 2ASEA 1MR3F 4RD4A 4H9GA 2YHSA 2JAQA 2JLVA 3CNLA 4K46A 2OM2A 4ACAA 2H5EA 2OE2A 3CIOA 2C96A 2GJSA 3REFA 3W6NA 4BASA 4BLRA 1Z3IX 4CYMA 1S3GA 3FHCB 3GFPA 4Q9IA 1A82A 1F5NA 2VF8A 2J1LA 2PZGA 2AX4A 3LFUA 4F93B 1PVOA 2IS6A 1L4YA 1X1SA 3C16C 2HV8A 1XTQA 3PEUA 4NP6A 2AWOA 4LPSA 3F3YA 1ZYUA 2D4HA 2GK7A 4GOKA 4XWAA 3U6BA 4URZR 5GJBA 4GI7A 1FNNA 1TX4B 4CEJB 4AG5A 2ZXUA 1ETUA 3V4FA 4TTQA 3HU3A 1C1YA 2GAOA 2C95A 3QI2A 1QG2A 2BHRA 4RD2A 4ZCLA 4A1FA 1XPUA 4YMWA 1TU4A 2B7BA 3PG5A 1YE8A 4BZQA 3CH4B 5FPSA 2FU5C 3U3JA 2WOJA 2J7PD 1J8MF 1G3QA 2C9OA 1YRBA 5KDLA 3BGWA 1OIXA 4LX0A 2OLKA 2FMXA 1TF7A 4CEJA 3QKUA 1C4OA 4TQ9A 1JALA 4QHTA 3DVLA 1ELOA 4KBFA 3EZFA 4QRHA 1LF5A 1WDTA 2D62A 2QY9A 1IJFA 1EG7A 4WZ6A 2E9SA 4C0SA 1WBDA 4RJLA 5DSZA 2DCUA 4PFSA 2GK6A 4U02A 4AG6A 1E9CA 3TMKA 2F6RA 3BXZA 4F7WA 1NJFA 4LBYA 5SZJA 3U3OA 4DEYA 4Q1EA 1CBUA 2YOFA 1N3BA 2QI9C 1G3IA 3AF3A 4FMBB 3QBVA 4TYQA 1AKYA 4G0NA 5FOXA 4XWKA 5K8UA 1IXSB 4LJ4A 5K8IA 1JEEA 1XMVA 3MWKA 3KJHA 3I8XA 2VP5A 3AKEA 2BCGY 1SKQA 4FIDA 1T0HB 4JLVA 2NQ2C 4X8HA 3QF4B 2W6JA 1Z0FA 1G291 3IDQA 4D25A 2ANCA 2F55A 1R0WA 3EX7C 2QE7D 1E9DA 2CVFA 3A1WA 3CBQA 5FBWB 3QPVA 3IQXA 2NO1A 4WZBE 1AZSC 1FW6A 4C0JA 4OI4A 5TMPA 5JBQA 4M4SA 4XSGA 4A82A 4D2IA 4DUGA 4GZMA 4QFMA 4KFUA 3DMNA 3QF4A 4YMUA 1AGRA 4UJ5A 3RRZA 3VMFA 5LD2C 1OT3A 3SHFA 2CLDX 4UNPA 3WHLA 4LJ5A 4D80A 4B76A 2RGNC 1SKYB 2QZ4A 5E7MA 2WBLC 3MAAC 2F9LA 4JLNA 1Z2CA 3IILA 1D9XA 1G64A 3BAFA 1XTJA 1Z2AA 3MJHA 2EYUA 3W6PA 2ZUCA 1PJRA 3QPUA 2F1HA 4NMMA 2G0NA 2FNAA 2QN6A 1CXZA 1PUIA 1KTVA 3THYB 1LB1B 3M4YA 2AXPA 1S2MA 5AUQA 2O5VA 2OAP1 1UDXA 2J46A 2I3BA 1KI2A 2FG5A 2QQ0A 4IDNA 3LWNA 5KOYA 4X8OA 1MOZA 2BMDA 4NPHA 1AM4D 1KO7A 3KXIA 5HPYB 4US2R 4NYJQ 3IEUA 4YQFA 4KODA 4L8GA 2FPMA 1SXJE 1COWA 3THYA 4KFRA 2Z0MA 1X3SA 1NL3A 1ZVQA 2CEAA 2WM9B 4FI3C 2MMGA 4Q9JA 1YQTA 4K8OA 1WMSA 1FZQA 1HUQA 4DLUA 5EXPA 1MO6A 5HZKA 5EE0A 2E87A 1LF0A 4YONB 4I1OA 1FP6A 4TLEA 1UBFA 3HWSA 1TAGA 1E4YA 1PZNA 3IIMA 3QEOA 3QKTA 5C46F 3BFVA 4HAWA 3DZ8A 1BKDR 4U7DA 1GSIA 3CB4A 3FOZA 3NVAA 2CE2X 1R4AA 4Q03A 3TKLA 1IN4A 1CRQA 4ZI2A 3GCGA 4E07A 3B1WA 1OYYA 1KI6B 1RKBA 2CL6X 3GPLA 2F7SA 4LI0A 4TQUS 2KE5A 3CPHA 2GBLA 4XVRA 1E2JA 1WRBA 5BN4A 1QHHB 3UG7A 4TMKA 2QM8A 2V6IA 5G3ZA 5EUQB 1XMIA 1VPLA 1M1YE 2ECKA 1Z6TA 1SHZA 3K9NA 4ZCMA 2CL7X 1VCNA 1ZM4A 2C03A 1KI6A 1YR8A 4ZKDA 2P3SA 4NU0A 1FNMA 2IS1A 3X1WA 1R7RA 1OKKA 3RS2A 1DO0A 1Z0IA 4QKQA 1QHHA 4XVQA 4PAMA 1OXSC 2H17A 3L0IB 1P4SA 3L0PA 1JR3D 3CX7A 4LCBA 2VA8A 2Z6VA 1E2EA 3GLGB 4W5HA 2ZM5A 3AVWA 4N0EA 4W5JA 1KI7A 4PX9A 4HYYA 4DLYA 1Z07A 2J0VA 2R8RA 1HE8B 1VG0B 3VX4A 1CLUA 1P3JA 4RD1A 5H68A 2G0TA 4L4UA 4NCHA 4AI6A 1ZBDA 4HAXA 3Q5DA 2V7QA 2ZROA 3FKSD 1XCMA 1P2SA 4IXMA 4TLDA 1EFCA 2OCBA 1MH1A 4ON9A 2GZDA 4D81A 3EZ6A 3FMOB 3GLGA 5TARA 3CRMA 1H8HA 1UKVY 3KDSE 1W48A 1CKEA 5BQ5A 2YOGA 3KXLA 1JJ7A 3KZ1E 1KJZA 1S4QA 3SYKA 4EAQA 5FL3A 2AXNA 2R6AA 2ONKA 4NONA 4A0GA 1M7BA 3H1TA 1YZLA 4GP7A 5EUMA 2JIZA 3AEZA 3I5XA 1KSHA 1OJLA 3EARA 3SOPA 4DCTA 1G7TA 3CH5A 4DKXA 4A6PA 1W2HA 3CX8A 3KKNA 3G0HA 2PT7A 4MKFA 3AKYA 4OJKA 3OIVA 4DBLC 3QG5A 1OXTA 2Q6TA 1ESMA 2W00A 4V0KA 3ZVNA 1GNQA 2EFEB 2HLDD 3ZZTA 2XJ4A 3AVOA 4Q19A 3TJZA 3A4MA 5EXSA 4G5SA 2GESA 2OO7A 1EFTA 1UKEA 3GD7A 4ACBA 1XTIA 3SYLA 2XB4A 3P4YA 2EW1A 3BOSA 3NC1C 1KIMA 2ZIAA 4I1VA 4P0TA 4UNSA 2C78A 1JR6A 4GDFA 3FHOA 3JZMA 4JVSB 1MO5A 2BM0A 2WIBA 1NBMD 3I32A 3CX6A 1VYUA 1N6NA 1SVWA 2WWIA 1OHHD 3THXB 1G19A 3OEHD 5HCIA 2BBOA 4KLNA 4LY6A 4KSCA 2F1JA 3FTQA 1EWRA 1I4DD 2ZE5A 3W6OA 1I4TD 4GMXA 4TTPA 2AFHE 3TH5A 1S9DA 2JJ1A 4LYJA 1Z6GA 2VBCA 3KKPA 3K0CA 4QNMA 3PXGA 5M04A 3U3MA 5HCNA 1W2GA 2ZAOA 3G5UA 1QHYA 4PXAA 2JLXA 4MDFA 1K5DA 2ZRPA 4M2LA 3SNHA 3Q7PA 2HJVA 4Q9KA 5DHFA 1E2GA 2IXEA 4BLQA 2DWOA 1DAFA 2QORA 3QSYA 1W0JA 1D8TA 1SGWA 3TSZA 3MWYW 4B32A 2XZPA 3OAAD 1W4CA 1HURA 3PR1A 4JT2A 3SR0A 2CHVA 1A2BA 1KO4A 5FPTA 1S0UA 5J4LA 1U0JA 4QBHA 4D26A 2ZPTX 4PZYA 4QJ3A 3RRNA 4AURA 2RGBA 5KYKA 1Q1QA 1OSNA 1DELA 1E0JA 3T34A 4XD7D 2ZYWX 3PUWA 5JI2E 4WZAE 4R2HA 1GNRA 2J7PA 3CF0A 4PZLA 2O52A 1I2DA 1M34E 3A36A 2Z83A 3D7MA 4XJXA 3HJNA 3LW7A 1G18A 3ZDQA 1QHSA 5E4FA 1R5NA 3SJCA 3VHLB 2W6IA 5LPNA 3IKJA 5KDDA 2UZ3A 4JBXA 1TADA 3WNBA 4GRAA 4P4UA 1UADA 5GJVC 5AJXA 3CZPA 3O47A 1FUUA 2F9MA 2ZS8A 4TZ6A 1E94E 1F3OA 5HZHA 1T0JB 1AK2A 1KI8A 2KBEA 4C0BA 1XD8A 4Q7LA 2QNRA 2WV9A 4QJ4A 5CDFA 3RSOA 1G8YA 2GAAA 4U5XA 5CB6A 3OEEA 1XU4A 4AKEA 1ZMXA 1BIFA 1E1QA 3O8RA 1KY3A 1W49A 1GKYA 4GNKA 5D3MB 5CIWA 4MRRA 2GETA 2VIIA 5DLQC 2XX3A 1XD9A 4C0KA 5CB8A 2OSBA 2QE7A 5GVSA 1YR7A 1KSGA 4JJZA 1HT2E 3EIEA 3F0TA 4LYFA 1E1RD 3MCAA 3RWMB 5TY0A 2C8VA 4BZPA 4PZZA 3TW8B 2H8KA 3W3ZB 4ZDWA 4RCZA 4Z1MD 5G41A 2GEVA 2P65A 2F3RA 2WJYA 5D3MA 4QGGA 3SEAA 4BFSA 5FL7A 1SKYE 4MH0R 1VECA 4NCKA 4MYHA 4UXIA 4G1UC 1NN3A 1NY5A 1G20E 1OLOA 1U98A 2PX0A 1ZM2A 2RMKA 4R9UC 3MG9A 3TUZC 3ONWA 1E9EA 3NKVA 1Z0KA 3GJ5A 4G5RA 3TSOA 2OZEA 1XF9A 4TSFD 2XZOA 3N2IA 1JPJA 1IHUA 4HEJA 3E70C 4TLAA 1KK0A 3WRYC 4IOMA 4TYNA 2VTKA 3IBGA 1G3RA 2ORWA 2IT1A 2DB3A 5GADl 1A7JA 5DO9A 3A1VA 3IHWA 4A0FA 3RS0A 1CJKC 1OYWA 5K8TA 2V55B 1NIJA 4OQFA 5FOWA 2ZUBA 1N25A 1TQ4A 2OFOA 4B33A 3N70A 5HE8A 3S1AB 4DLVA 4W9MC 4KLZA 1XDBA 2ZTSA 2JGNA 3QXHA 1Z47A 1UBGA 4LYHA 4JLJA 4MKHA 3U44B 1CJMA 1QVAA 3T15A 2ZE6A 4Q21A 5BYJA 3QBTA 1HA3A 1L7VC 3WP1B 2WWWA 4MA4A 3I3SR 2RHMA 2PJRA 2YYZA 1N5JA 1UPTA 1D2MA 2VHTA 3AKDA 4NYJR 4A2QA 5JI3E 5AUOB 2G6BA 3I73A 1JPNA 5F9HA 3S1AA 1NVWQ 3SBEA 1D2EA 4TMZA 3SDZA 1NN1A 2OV2A 1W36D 4TYYA 1IBRA 4JLOA 1AZTA 2HEIA 3PUVA 5FUXA 4JVLA 1YKSA 2QSZA 4BQSA 4DRZA 1YZUA 4EFLA 3GFOA 4HUQB 2ZSBA 2W2TA 2PH1A 1FFHA 1E99A 4C0AC 4V0MA 2FEOA 5K8LA 1KY2A 3ZZUA 2JJ8A 2ANBA 4TTRA 2PLFA 2BC9A 2J41A 3VX3A 3EA5A 2O0HA 4URXR 2FDCA 5JJLA 5TB5A 4DCVA 4LC1A 2OHFA 1ZD9A 2G3YA 1E2LA 1GZSA 4Y0VA 3LO5A 4ZV4A 2ZI7A 4S35A 3NDPA 4DIEA 1NKSA 3K9HA 4A15A 4HUQA 5EP4A 2V1XA 3QOFA 1KMHB 3GLGE 2EVWX 4GPTA 4A0RA 3NBYC 1EGAA 3TR0A 1ZUHA 2FX3A 2IHYA 5C18A 2OCPA 4POAA 2ZRJA 2P5TB 3CONA 2D7CA 1VCIA 1T4GA 2QGZA 5B30A 4DHEA 4GL2A 3M1IA 1YVDA 4BRUA 1SULA 4KI0A 3U60B 1KMHA 1Q3TA 2Z5FA 2R6DA 1AJEA 1X8KA 4TT3D 2YC2C 1DAHA 3CNOA 3CRQA 2KSQA 2B7CA 2F3TA 4ERNA 3OFND 4KVGA 1OFUX 1P7CA 3FKSA 4M1OA 2OCAA 1JI0A 2WAXA 4KXFB 3SQXA 1YRAA 4CW7A 2BBWA 5DN6D 2JJ2D 1KKMA 1WF3A 2BKUA 4QL3A 4D4MA 4TMWA 1UBCA 3KKMA 1XCGB 2BIFA 4DCUA 2YZ2A 5TXGA 3SJZA 4DIDA 2X8AA 3A1UA 4Y0AA 5AR1A 4JL6A 3A6PC 2KJQA 1P9NA 4Q9HA 4TMXA 3QJYA 3AGQA 3X2SA 1QHGA 4LOAA 4P4SB 1SQ5A 1Z5ZA 1W5SA 2O0KA 5DNYB 3H86A 3MFYA 1P5ZB 1A1VA 2H92A 2X1VA 3TAHA 4DDTA 2HDNB 2IK8A 2ZRHA 3NEYA 3TQFA 4HATA 2ODEA 1FMJA 1P62B 1VDZA 2HLDA 2J9RA 4OQXA 1NMXA 3GEHA 4PR0A 2R62A 2REXB 3TQCA 1G6OA 4P4SA 2D7DA 3GJ6A 2QUZA 3N2EA 4DXAA 4HLQB 2WAYA 2G88A 3GFTA 5TV2A 4HAYA 2YV5A 1OFIA 4PAOA 1PV4A 2GKSA 1HT1E 1HH4A 2E1RA 2I1VB 5F98A 1E0KA 2LKCA 3EC2A 1XBTA 1ZUIA 3Q72A 4HLCA 3HR7A 4Q48A 1TMKA 5LBIA 3RWOA 1HV8A 5JCZA 2FJUA 3B8HA 2EQBA 2QA5A 3B9PA 2IUTA 3CKLA 3LW8A 4W7SA 4UKDA 2R9VA 2CHGA 2H16A 2CCJA 1G8PA 1S9HA 2TMKA 5IK2D 2WKPA 4O3MA 2JLQA 2PX3A 2VP6A 2WZQA 2N46A 3WNCA 3T35A 2ZJAA 1GDDA 4KO8A 2J3EA 4B3XA 1TEVA 3BB1A 4OK5A 3WYFA 1OIVA 1CR1A 1Q21A 2YWFA 1ZNXA 3BORA 3CNNA 1UAAA 3K70B 4OL0A 3DO6A 2RH5A 5C2JB 3OAAA 1XEFA 3VKWA 5JJKA 2ZEJA 3CR8A 1UF9A 2Q3HA 2ZSFA 1QF9A 4DB2A 4M1KA 1ZW6A 4B47A 4HDCA 4L16A 2YOHA 2DFKB 1XD2B 2ZYVX 1KKLA 4BGDA 3R9IA 4PHGA 3MWJA 5JECA 1T9HA 4JBYA 3OE7A 1JEDA 5CDFE 3U5ZB 1VKJA 1X86B 1GWNA 5AJZA 3BWDD 5FBVB 3A4LA 3NDBB 2IYZA 5JRJA 3KQUA 3IBYA 3Q5EA 4WW0A 3PCRB 3LLMA 5L3SB 1T3LA 1IOZA 1XD2A 2JEOA 2BJVA 3NIBA 3P4XA 3WRXC 2Q3FA 2P5SA 3JVVA 2ZJ2A 4EPXA 5CLLA 3NEJA 1DARA 1DAIA 1F2UB 1GNPA 1KO8A 1G3UA 4FCTA 1KDPA 4JKYA 4E22A 4D0GA 4Q1FA 5IT5A 5DI3B 4DLZA 4DDVA 4EIWA 1YZGA 1VHTA 3QQ5A 4Q1CA 4C0HA 2OESA 2ZI6A 4KFTA 5FUYA 4EDHA 4I81A 3I62A 1WP9A 3LV8A 1QRAA 1F2UA 1QVRA 4YDHB 1EWQA 1N6LA 2GJ8A 2P0EA 4GOXA 1XPOA 2FWRA 1OXVA 5DI3A 4JYCA 3PUYA 1KI1A 4XTCS 1Z22A 1UJ2A 1I4LD 1E1RA 1RIFA 2LKDA 4S2EA 1ZM3A 2XAUA 1KJWA 3FWYA 3PITA 1KJYA 3AF0A 4EUNA 1RW4A 3QY0A 4BFYA 1JQJC 2QTFA 1OPXA 2J59A 3LH5A 5KU1A 3NHAA 3AF4A 2ZAMA 3CF6R 3CO5A 2JLUA 4I99A 4DVGA 3ZLJA 1LS6A 1VCMA 3EZ9A 3X1DA 3ASZA 3WNDA 2WWYA 2JDID 2YWGA 4BFTA 1BH2A 1GTVA 1VMAA 2R6GA 2H57A 1Z0DA 2AD5A 3G82C 3GMTA 4EPRA 1KMQA 1HQYE 2C04A 1GL9B 3QIAA 4JYBA 3EPHA 1J7KA 5J4HA 3T1QA 3ZQ6A 2PEZA 4L5BA 2J0SA 1TNDA 1IONA 4AC9A 4CDGA 4JLPA 2JLRA 2W2VA 2PJZA 3LX8A 4DB4A 4DEXA 4PSKA 2J0QA 1NLFA 3QUSA 2F1IA 5FPHA 4AIIA 2FV8A 2RKOA 1M8PA 4CVNA 1V43A 5J5CA 4NBSA 4MKIA 4PO1A 4MRSA 1W36B 1E96A 2Z4RA 4C2UA 3K70C 2Z43A 3OZXA 4P33A 2V6JA 2V8OA 3CW2A 5JSZB 3QF7A 3VR6A 5H1YA 4GZLA 4IFBA 1GILA 4G5QA 3CM0A 2IX3A 4IJMA 4IDPA 1N6PA 1Z8FA 2PBRA 5FI1B 2BMJA 1ZP6A 4KITB 5JWRA 3B1YA 5EE5B 1DG3A 2DWQA 3Q8XB 2ZRBA 4JLMA 4JLKA 2IYUA 3A1SA 5FOVA 4B48A 1CTQA 4IXNA 5JSZA 4CEIB 1ZM7A 1DS6A 1D9ZA 2WWXA 1EFRA 1UEJA 2IC5A 2VSFA 2OUKA 2ZR0A 3NWJA 4NYMQ 4QGFA 3TUIC 5HR5A 4QC2A 3AM1A 3TVTA 3BK7A 4B74A 1WBBA 1RFLA 1W44A 2ZRIA 1KI3A 3KUDA 2VSOA 2XTZA 1Y63A 3K9LA 3Q85A 2GJKA 2VP9A 4KCGA 4ZDJA 3AVPA 4UNRA 4CEIA 2JASA 2RCNA 3LD9A 4URUR 4M0LA 3TVDA 2QT0A 2D06A 2IW3A 2R65A 2NG1A 3B78A 3C5CA 1ZNYA 2KI5A 3I72A 3AVTA 1O3YA 4WAUA 3MMPA 2A30A 1EX7A 4V0OA 5E7JA 4CZ2A 1V5WA 2GCOB 3SC3A 1XJCA 3AKCA 4PPGA 5B2ZA 2XSZD 5KNCA 3CF2A 3GQBA 2IS2A 4C30A 2ZSDA 5AJWA 4EJSB 2D2EA 3THOA 1FL9A 2HCJB 2FF7A 3VAAA 1IXRC 2QMEA 2VHQA 1CRPA 1SZPA 1N6IA 1TUEA 3BB4A 4KJZA 3B6EA 821PA 3ZVLA 3KQKA 3BRWD 3SFVA 5TVKA 2IBMA 2P6RA 2GCOA 1TEXA 1JB1A 3TIFA 1ZC4A 2EWWA 2ZU0C 1EFHA 4US0R 2EYQA 3KTAB 2DR3A 5E7IA 3SFZA 1XXHB 5JWOA 3EPKA 3LLUA 2JCSA 3DOFA 1H65A 4DSUA 2QP4A 4FWTA 2V3CC 5EQTA 2QTVB 4LYAA 1Q22A 5FBLB 4EJSA 2FZ4A 4OI0A 4IEEA 3ICQB 2G1JA 3A4NA 2A5JA 4ZDKA 1SHKA 1KAOA 2GDJA 2ZVQX 3T5DA 3LXXA 3T12A 1L8QA 4GSYA 4PANA 2REOA 1GM5A 1KNXA 5FOSA 4CIDA 3EPLA 3FPAA 3KTAA 4G5OA 2ZRKA 1XXHA 4M1MA 4QGAA 2SHKA 1HYQA 4ZIRB 1U90A 4B3CA 3WYAA 4XIGS 5E3HA 3AF2A 3NG1A 3VKHA 4Q18A 3WBKA 5C4GB 3VNUA 2IHBA 2OG2A 5EP1A 3FYHA 4OHVA 1UEIA 2VHJA 3KKOA 3LRPA 4M9QA 5KPDA 4ESVA 4IOJA 4EFNA 4Z8YA 2AKYA 4HDOB 5DYIA 3EG5A 5DYGA 3RABA 4KHZA 4ZIRA 2WKRA 3A1TA 1KO5A 1NMYA 3AVVA 2CJWB 2IL1A 5IF9A 2QEQA 3OIUA 3M0EA 2DFLA 1RJ9B 1E9BA 3I4LA 4LHVA 1MRNA 2ERYA 3LA6A 3H0KA 2PZFA 3LX5A 1B23P 3B1ZA 2C77A 4MGYR 4IEIA 1KSJA 1C9KA 1DAKA 2WPDD 2A9KA 1XTRA 4RZUA 1GG2A 1KSFX 2Z4SA 3C14C 1EX6A 2OCYC 4Q4LA 1DOAA 3VQTA 4LGMA 1SXJD 2HXYA 2WOOA 1NI3A 2ZRGA 1F60A 1NSFA 2CJWA 3GJ0A 4J0QA 5E95A 4D6PA 4HB3A 2CK3A 5IK2A 4D4JA 4MITA 1Q44A 5DI9A 1RJ9A 2LCFA 5GVRA 4LRWA 5KHOC 3GJ3A 2C2HA 1E3MA 3QXSA 4DCNA 2BM1A 2NIPA 3U7GA 4YMSA 1IY1A 3BBPA 3K53A 2RGCA 1IY2A 3IHLA 2BVNA 4OKSA 1AGPA 1GVNB 3I8SA 4LK2A 1QZXA 1G9XA 1F6BA 2WMOB 1TQDA 4PAQA 3UWKA 4CT4B 5JS8A 1T3HA 1P75A 4Q00A 5FR2A 4EKDA 1P2VA 4QM7A 2D3WA 5DHAA 4NCIA 2FEMA 1N0VC 3TAUA 2YWHA 4BWYA 4R71A 1II8B 3B85A 4ZDIA 2WTUA 1BO6A 1X8JA 3HR8A 3NXSA 1E2MA 3FKQA 4HLUA 2GBLC 4BLOA 4BE7B 1DO2A 3BH0A 3X1ZA 3EXAA 3EZ7A 4LJ9A 5BW8A 5FOUA 2PCLA 3DEFA 5FOTA 3KFVA 3THXA 2R44A 4EJSC 4II7A 4E5UA 1XCPA 1G8HA 4GP6A 5EXTA 2ZRAA 1II8A 5DE3A 5CM8B 3W90A 3JVUA 2REBA 3T1OA 1TPZA 4PC3A 2ZJ5A 3RS3A 5JEEA 5KNBA 4MUAA 1LY1A 2A5YB 1RC8A 1M6NA 4LWZA 2JATA 4O0MA 1E9RA 2QENA 1AIPA 3DKVA 4LHZA 4GOJA 4LSGA 2J5XA 5J40A 3TUJC 3AVQA 3ZS9A 3PEWA 1KDRA 1NKTA 4PPQA 4CEHB 1CU1A 1QHNA 2P6UA 1N5LA 3CRVA 3CWZA 3BFKA 3GLFB 4FN5A 4Q4JB 4D82A 2ZI5A 3AVXA 4O2RA 4ZKEA 3AGPA 3IEVA 1BYUA 1Z6YA 1RRGA 4DC9A
chains in the Genus database with same CATH superfamily
3LC1O 3VPBA 4ETWA 3WGTA 3RU2A 4UW9A 1J42A 5ILGA 2YVUA 2IWHA 2WSLA 4B3MB 3W5JA 3LLVA 4K9DA 1Q1ZA 5KX5B 4PC6A 3TE6A 1E18A 4DE5A 3EZ2A 3ZX4A 2J4DA 1V4BA 5TQ0B 4DIBA 4PZCA 5FRDA 1MRZA 1J90A 2IA5A 2ZQ5A 3V7YA 1EGHA 2DT8A 3OCUA 4IRXA 4P4LA 5JD5A 2VZ8A 3UUEA 2C9CA 3IO3A 1II9A 4F5YA 5A02A 2MJLA 4D43A 5ELXA 5BNZA 2VUSA 3BDAA 1KYYA 4IG9A 3R7WA 3U3ZA 4JL8A 4MYUA 3GMIA 1D6SA 4NPAA 5HWSA 1P6QA 2ONCA 2GM4A 1HWYA 2B82A 4GEKA 4LSZA 3R5FA 3W1VA 5J63A 2DRIA 4LXGA 4RVNA 5D6OA 4AWAA 3PKJA 2VF2A 3IUNA 2KMLA 3JR3A 3DMDA 4MKGA 2VK2A 1Q0QA 3OD5A 1E92A 3PC6A 2R4UA 3ZS8A 2CE7A 3EBLA 2D74A 4WADA 5CBPA 4YAKA 4R3UC 3ELDA 1N32B 2AK2A 5A4JA 2FPGB 3KYDA 4HQLA 1NRJB 1YHNA 2WF6A 3GGSA 3MYYA 4MS4A 4YDSA 4OJQA 3BK2A 2WA1A 1ZI8A 5B1SA 3OC0A 2GF9A 5A4IS 4LNUA 2CDRA 1WP4A 4V02A 5A7GA 4PLCA 2IYRA 4NTZA 1KZHA 3WB2A 4GBED 3OT1A 1LPNA 4IRUB 4RPGA 3QPDA 5AK3A 1A5TA 1B26A 1Z4OA 4BMDA 5DNAA 4I4LA 4B3BA 1OROA 1I2CA 2IEBA 1YI0A 3RG2A 3HXMA 1W36C 3ACCA 2X22A 1CVRA 3RJ5A 3KIPA 2QU8A 1MLDA 1O95A 1QYXA 1T5LA 3DDNA 3NRCA 3R0VA 3R74A 3IT3A 5LDDC 3JTEA 3UO8B 3P2YA 3E8XA 4UHBA 1E2NA 3P96A 5JCPA 2X0FA 2RGGA 1I9CA 3NUGA 3NWEA 5EEHA 2PT5A 5A1TA 1OE0A 4CDNA 3OQMA 3B5IA 1ABBA 2CFSA 2RJNA 3PRKE 4IFTA 1OGIA 4DQVA 4I1UA 4GR5A 4GP9A 2BH2A 1FUKA 4UUNA 2NSLA 3KOYA 5ECDA 4ZU3A 5E9JA 4J7UA 5ESWA 2WNHA 4EW2A 2QVLA 1QR2A 4ALNA 2WHPA 5DVZA 4KN6A 5HJ2A 4MWBA 3PGXA 1G41A 1VBFA 5KKAA 2QWXA 5FORA 2AOTB 2XKJE 2PRKA 4FGWA 1E9VA 1P74A 2IZZA 4M6WB 1OASA 2AN1A 3SXPA 3CBGA 4B73A 2IY9A 4FKMA 4HDQB 2ZIXA 2ZJZA 1BCSA 3ZHSA 5GOZA 2OFXA 4MR9A 4OJNA 2PUHA 1QGYA 1NPTO 3FPEA 3RLIA 3K0BA 3OU6A 4DMUB 1ZSNA 2NVOA 3D8BA 3E4CA 4KDEA 3ZDYB 5A0FA 2C0QA 3ZE2B 5F35A 2X6RA 1W94A 2O8CB 3M7IA 2WSSD 3GJXC 5DWQA 4JJ6A 1R6XA 5G0SA 3CCCA 4YAOA 4B9EA 1PTKA 3KX2A 4DIOA 4QBIA 1U0BB 2B8WA 2XE6A 2FZGA 3O8BA 1VIVA 1V11B 2BBSA 4B5LA 3AETB 4V0RA 4NDZA 1JIJA 2WJGA 4HDRB 1MB0A 5AI4A 2RJOA 4W5OA 1ZD1A 3M1YA 4FZVA 4G9BA 4AUNA 1Q2UA 3JQEA 4OQDA 3OIYA 2B8JA 1E3QA 3TIGA 3V2HA 5FWAA 4WKOA 1BGXT 4Z0HO 1A2KC 3A1FA 4M46A 3O74A 1DLJA 1XXHE 1EK2A 3OT4A 4NULA 4XDZA 4RMJA 1WULS 1MBZA 5FF9A 1E9AA 1VE6A 3UHFA 1K63A 2FSFA 1AF7A 2W2PA 3LX4A 4LDJA 3KQVA 1NXTA 1SIWA 1JHXA 1MABA 3D7SA 2A78A 2PU5A 1ENYA 1JIUA 2AFRA 3C8MA 3R5HA 1O6FA 4QQRA 4X94A 3NI2A 3SG0A 3HSSA 3MTEA 1V37A 2UVPB 2V5AA 1GLVA 5DOVA 4F21A 3ZJYA 3U40A 3DW3X 1UJBA 4LPKA 1B0PA 2O8DB 2VA9A 2R8PA 1ZOPA 2DQZA 2FR8A 2Q1YA 4I66A 4KV7A 4XX1A 5IG2A 3PFFA 2W37A 2UZ0A 4HWKA 2IPAB 2D1RA 2M9MA 2Z5VA 1ZRHA 3EWAA 3F97A 2ZFUA 3V8EA 1M0WA 1UM9B 4BO3A 3GH1A 4DG8A 1H1DA 3CRNA 5A06A 1FRVA 1MT0A 3EGOA 4DDMA 4DPKA 3DMRA 2P2GA 2HL6A 3FNQA 1DIGA 3SD7A 4CMHA 4Y6GB 3STTA 4C89A 3P26A 4RZHA 3TOCA 3IHTA 4AWXA 4KAAA 1XZQA 3A37A 4FGUA 2HXGA 3FXAA 5C7IO 2OYSA 4GXQA 3BBLA 4QTTB 2IXDA 1NN0A 1QHFA 1XF1A 2P5YA 3KPUA 2ZBPA 4K9SA 2XPCA 4FCWA 5KSYA 4MLDA 3IQWA 3I5AA 5J2UA 1MFZA 4L50A 1SXJB 3JR7A 3FF1A 4ZHQB 3K0SA 3UMFA 1MGOA 1U8YA 4R8MA 5H80A 3H0EA 3OY2A 1IY8A 2FFQA 3ZGOA 4BN4A 4CGZA 3MERA 1R0YA 1HFWA 1E66A 2EATA 3D59A 2OYRA 3KZXA 3KR0A 3HCAA 4LVNA 1I6WA 1LDMA 1Q50A 1X1QA 2Q7XA 4GLLA 4HQRA 3NV9A 4YUYA 2VYFA 1Z0SA 4F91B 2BGMA 1Y81A 2HA6A 3KXKA 3RRYA 4GPAA 3G7NA 4YR7A 3BGSA 4LUCA 5AVYA 2W8ZA 4WBSA 3NBUA 2PWPA 1WXQA 3P52A 4TRRA 3KQHA 3M89A 1LDEA 2CC2A 3MFQA 4R3WA 3G9XA 3HACA 4E2ZA 1RLIA 5K6AC 2AOVA 3LCMA 2J0EA 3CYFA 5SY4A 1M2OB 1O96B 3BUSA 2NQTA 4HBGA 3OOSA 1JG4A 3M6IA 3AF1A 4LJAA 5F77A 4M7WA 4JIMA 4B5KA 1DXYA 1RBYA 2WWRA 2C4TA 5JHHB 4AMUA 4L8WB 4LV5B 2X5JO 2H51A 3IJPA 3UGTA 4ND8B 4G8CA 3H13A 1GPDG 4HX5A 5SICE 1DHRA 3SBOA 2DKNA 1A9OA 4TLLB 3U7EB 5DLPA 3SPXA 1XLVA 3LYLA 1NBMA 2BMVA 3HXLA 4CTOA 4C29A 4KPGA 5AUPB 3OEHA 1JEAA 2DBRA 1G5RA 1XNQB 3R77A 3NU1A 3VTKA 5ARBA 5ICGA 3ZHVA 2AJ8A 3W4KA 1TVCA 2CKDA 2Q7DA 2WNIA 1CQIA 3QX9A 4HWPA 4S1OA 1VHWA 2II6A 3I9FA 3N0WA 2VRWA 3K96A 5F4BA 5JO0A 1ITZA 5EJGA 4O2LA 1E2KA 1GPLA 2BBTA 2WMNB 1NA5A 4ZOLB 3ONEA 3JQQA 3R9XB 4ZEMA 1PT9A 4BLVA 1T3SA 3ADPA 3ETNA 1FSGA 2HHAA 1GZVA 1IAVA 1W2WB 5B7QA 5C31A 5CB4B 1XEWY 2ID4A 3I2KA 3PFNA 1B74A 5AXCA 1DDOA 1U9IC 2AC7A 4R2JA 1JG3A 5AOBA 4QAJA 2VJNA 4DRXB 1U1GA 1WPGA 5C4MA 4C88A 2O8BA 3EH2A 3DD1A 1UXJA 2VL7A 3PEEA 4G41A 3K09C 5DXFA 3R5JA 4IX9A 4ES6A 3GLFE 2VRCD 1G6KA 3H17A 4BJ1A 1T6ZA 4AS2A 3TNLA 2VYNA 3NYQA 4RIHA 2AR9A 1MPTA 3IEIA 2EWVA 3DE6X 1R16A 3LVQE 4D1YA 4P54A 5D3KA 3KR2A 1GNTA 2IHZA 2KBFA 3O7MA 5HBGA 1IZYA 3RAPR 1T2EA 4KSBA 4MNTA 4ZT6A 1YKGA 4AYXA 4IOKA 4XD7A 1LCIA 2ZXEA 2CLKB 2YFHA 1HETA 5IJ9A 3CKYA 4LHYA 1ZGHA 5IW8A 1IHDA 4D4IA 5LQMA 4DLKA 3MILA 3FVTA 4TQGA 4EYKA 3DZBA 5BNWA 1ZA2A 5EE3A 4UEOA 4DMMA 3C5WP 1MO4A 4G1VA 5SY6A 4L5IA 1QP7A 1KMIY 1T8PA 2DY1A 2ZATA 1D0VA 4Q34A 4F4JA 3CH7A 2VLBA 1RYHA 4P22A 3U56A 4DUYB 2AG8A 4IV5A 3NBZC 2NPIA 4B40A 4H77A 2WJJA 2W8BB 4EY5A 1S3SA 3HDYA 1EXMA 3O2SB 2FLKA 1RPAA 3BWBA 1V26A 3UXHA 4WA8A 2HUPA 2J5QA 1HZZA 1A4IA 3D5QA 5P21A 2BMAA 4D4LA 3HQ4O 5HF9A 5L3SA 3I61A 4ARZA 2ERXA 1ZL0A 1SVNA 2ZE7A 3CMMA 4Y2YA 5EXEA 1BAPA 1C1XA 1HF3A 1TZ2A 1LLDA 1SBNE 2BGKA 4R5MA 2MSWA 4OTZA 4RFSA 5A7FA 2OMKA 4Y2JA 2J3QA 2CV1A 1VA4A 5LU8A 1E3TA 2CXQA 3S8YA 4CM9A 4KRYA 2L42A 1JECA 4B6FA 3BG5A 1YCDA 4NKRA 1Y5LA 5DV9A 2GD2A 2P6PA 4UATA 1PWEA 2CDNA 2Q5OA 4WOBA 3AV0B 3RTBA 2XLBA 3MS2A 2C4UA 4BRSA 5KIAA 1KDOA 1YZYA 2P9EA 4PYOA 1K7CA 4HGOA 1CJTC 4LZJA 1T1EA 3MLEA 1QDUA 3FX2A 3QXXA 4GT1A 1MF7A 4NG5A 2C0PA 4YV2A 4MHTA 2ZANA 1Q12A 3JAWB 4MV9A 1JHYA 3D4NA 3N7AA 4Y1FA 1NLZA 1YR2A 2WU3A 1U80A 2FPPB 3WK5A 2IYTA 2P75A 3DVSX 1B8OA 1A50B 1MN6A 1ZVMA 3KB8A 5AWFC 3PSAA 1IE3A 4IDOA 4TVSA 1ZU4A 5IEBA 2YW9A 3JASA 1ULUA 3E9CA 3HXPA 2UYHA 3L7OA 2YZMA 4WNAB 1KP2A 3KRTA 2EL9A 3L0DA 5IKXA 4G65A 2QRUA 1NUPA 3OQVA 2XQVA 4HF7A 1Z83A 1CEXA 3BMOB 3H2SA 4MPPA 4C4XA 1LV8A 2ZRDA 3D1LA 3MJRA 4PTYA 3HB0A 2GXAA 2WVGA 2PD3A 1EG2A 4NQRA 4Q1DA 1P0PA 2FW1A 1GFIA 1KL7A 1T26A 2OSVA 1PQPA 1FP7A 2QYSA 3FMIA 1HE4A 1TUGA 5BN5B 4BWGA 3LI2A 3W6ZA 4BMOB 1PG5A 1XROA 4BLPA 2J0UB 4G5YA 2VPQA 5GPBA 4YUXA 1EE2A 1ZIOA 4UUMA 1TUBA 4IFIA 2DOKA 4N8EA 3GRRA 3E82A 2JLYA 4GBMA 4JBHA 1QIDA 4OFXA 3AEUA 4F1KA 3T5MA 3ZGXA 3OEED 3AI7A 5LNK6 1L8LA 3JZIA 4WGFA 2Q6KA 3KQSA 4FYXA 3TTTA 3ONFA 4CLDA 5IF3A 1NUSA 3B3AA 2H1FA 3QHAA 4Q66C 4YI3A 4ARSA 2YFQA 1R5OA 2CMGA 4N5NA 2Q0XA 1UBTS 4RD0A 4TMTA 1G4HA 1WD7A 1TTHA 3NEAA 4HN9A 2H4WA 4L7QA 5HKBA 1I3KA 5BRNA 2CEKA 2JGRA 3EVCA 3GDFA 3RFXA 4E12A 9LDBA 1FNBA 2ZDQA 2C58A 1BRMA 3O0DA 4F9EA 1XP8A 3A7DA 5JALA 1E1LA 3OZCA 4IXWA 4OHXA 5MF6A 3A70A 1WHTB 1X6VA 2J6CA 2WSYB 5DEOA 4AMVA 3VKFA 1QX3A 2JBAA 2NX2A 2JLSA 2NOAA 2PVCA 4LDPA 2HDHA 3DF7A 4URYR 5CJPA 3GJ7A 4JJKA 3G9TA 5FL7D 4PVDA 2N47A 3U4QA 3AMVA 5F2KA 1KIAA 3R75A 2BDTA 4M1WA 3T94A 1Q15A 2JPDA 2ZBQA 4JL5A 4JODA 2ABWA 4JHXA 2HLNA 4URVR 2VXCA 2FG7C 2ZWVA 3P9RA 3CEAA 3D1VA 3O3MB 3QVXA 5KCZA 3OO1A 4GO1A 3ZCRA 4XQ0A 4ZWNA 4B6RA 4AX4A 1SWWA 3DXYA 5DW0A 1X80B 1M2HA 3KVOA 1MO3A 3IA2A 4QGBA 1J21A 1V47A 1EXNA 1F0NA 1LS1A 1QHEA 1DINA 2G5PA 3JWEA 4MV1A 3DLIA 3V9AA 4EBBA 2FFHA 5DYYA 2HT6A 4CT5A 2P2LA 3TGLA 3MOIA 3EA4A 2COEA 3WGZA 3AWDA 3ZDEA 3DTNA 4KR3A 4M0FA 2GSDA 1M2NA 3TZHA 1TOAA 1XEXB 4X8MA 5B3LA 2NPFA 4U39A 2I9PA 3TE7A 4BX2A 4QRIA 2MMCA 2WTXA 1PFQA 2LRHA 1T9AA 1WNTA 5T57A 3V34A 1H05A 2XOKA 4R68A 1ZCAA 2GFQA 1TI7A 5CVUA 2IYVA 3IIEA 1CV2A 3Q4GA 4MV4A 1M2VA 4S1TA 2XMRA 2Y0PA 3T5GA 4A2WA 4ER0A 1C2TA 5CUQA 2GH1A 2XF8A 5C9ZA 2JNWA 1N4DA 1HDOA 1GPYA 3HNRA 1Z39A 1XOIA 4GDMA 3EBPA 3I53A 4EP1A 1KH2A 2CXHA 2FSVA 2Y66A 2YNMC 1UJMA 2PO5A 1LW7A 2HA2A 3BRQA 3N7UA 3FKJA 5DOZA 2JJ2A 3AJRA 1ADBA 2C7OA 3K1JA 1DV1A 1E4OA 3AHGA 4Y9SA 5I7AA 3SKXA 1Z12A 3TPZA 1KGSA 3WHKA 3MAGA 5CA1B 4B3IA 5KMGA 3PJRA 3DBLA 3GRKA 4MYTA 2X5XA 3VPGA 1U0LA 1T5IA 1YOVA 4EUHA 2YDXA 1JVBA 2J9XB 2GWRA 5AYVA 5BV7A 3E27A 2FUKA 2HDOA 1EAMA 1UOEA 3I09A 2OGSA 3DDWA 3ZOKA 5GQSA 4Q4HB 2BHNA 3PIDA 1IQPA 1B8PA 4NMWA 1IN8A 3U48A 4DIFA 3QFTA 1WCXA 1ODIA 5E1MA 5FKJA 2UDPA 3ZXIA 3RSFA 5KTYA 5C53B 2E4WA 1HNWB 5HIIA 3C7KA 4ND1A 5A05A 4A2PA 1NFQA 3OBIA 2QSUA 5FUVA 1KEKA 2A0YA 1PJBA 3ACDA 1YBVA 2CJPA 4ZVRA 4DWWA 2MU1A 4D8TA 2M1XA 3FFAA 4NXMB 3PHGA 2FQYA 3R40A 4RZ3A 5FTKA 3TLMA 4OX9B 2ZT5A 4I55A 3AIIA 3ZQUA 3SK0A 3BTVA 2LR0A 4OK6A 1TCVA 3RHFA 3LVFO 3ZE7A 1FDIA 1SU8A 1L5SA 2WT9A 4FD2A 4DSNA 3DZIA 3QHQA 3GFBA 2J9GA 5IARA 1NTOA 1L2TA 4QIHA 4JXKA 2XE4A 1AV6A 3DZHA 2IBSA 1ECGA 4QE3A 1SOWA 2XNDD 1P19A 4NK4A 5ALMA 3K0EA 5H5JA 2NUAA 1CDEA 2D3TA 2FLWA 4ZJPA 3FNRA 1AB6A 4EH1A 2ET6A 4J4HA 3PWZA 4U2FA 3DBVO 3AM3A 1JDBB 2QQ5A 2XGSA 2HRBA 2QHXA 3ET4A 3GB9A 3GEBA 3KKKA 4HR7A 4LYEA 4TPKA 4Z8XA 1U81A 2GLTA 2G83A 3AUYA 3DKKA 1LH0A 3KB2A 3WG9A 2Z3VA 4PLTA 3ZNPA 1EXVA 1CR0A 1U0FA 4KX3A 3GJZA 1GPH1 2BFAA 2ZZKA 4RVGA 4X93A 2BMFA 1SK9A 2FWBA 5CT9A 5DNDA 3HXOA 1F7UA 5B37A 2VNSA 4M54A 1DMRA 3ESZA 4DMHA 2OHVA 1Y48E 5B6IA 4EPVA 2VP2A 3PQ8A 5TS3A 1RWOA 2Q9CA 3CUYA 1IN7A 1GUZA 3GDGA 5DHPA 3ZU2A 3ME5A 3TNJA 1O94A 1Z2NX 3G23A 1L5QA 1P72A 4G97A 3QITA 4IBOA 3W34A 4RIIA 4E03A 3V80A 1OV4A 1FIUA 3UPDA 1QUEA 1L9XA 4BU1A 2VQEB 1H9AA 1SVSA 2VHUA 5H59A 3QLJA 4OH7A 4DCJA 4F5EA 5FTLA 3T1TA 2XF2A 3RAJA 2O4UX 3BE8A 4IP0A 4MUJA 5AI6A 4Q4AA 3TQTA 4DPMA 4YXFA 4AY2A 2X13A 2Q2VA 4OUKX 1YZNA 5KX5F 1RI1A 3R41A 3CSDA 5FO0A 2ROQA 3N5KA 5AW4A 2A7QA 5AXDA 1JAHA 2LGJA 1NFRA 3RYHA 2XXJA 1GQYA 1TM4E 2VDUE 1I0ZA 1KAGA 2XRFA 4QOSA 3ZV3A 4J0HA 3EF1A 5CA0B 1ESDA 1NLYA 2HREA 4WCFB 3BE5A 1D2CA 1JP7A 4KLRA 4B84A 5KYGA 5BQFA 2SKEA 3VR2A 3OQPA 1EE9A 3G0DA 4JX8A 4NR0A 4PNPA 3UCEA 2PKEA 1NGSA 1K0UA 1J0EA 4JI4B 1AK1A 1BU8A 4BZXA 1VIDA 1XZPA 5L6LB 1TU3A 1T2FA 2OOSA 4G37A 2DXIA 2E49A 2XTAA 4HZUB 1A8QA 3IDFA 5H83A 4V1CI 2CXOA 2WWGA 4QDTA 5AJYA 3RVNA 5IDWA 2ON6A 3FYUB 4PQGA 2AQHA 1KVRA 1WKBA 3PDJA 4GOLD 5B6JA 1VXRA 1TAUA 4EG7A 4BFCA 2IHTA 3P2MA 1TZMA 4U0KA 1TEZA 1GD1O 5EZ5A 3E18A 1W19A 1J1UA 4G23A 4IIEA 3T38A 1O54A 5J4YA 3RIHA 1JDTA 1B8NA 4QXAA 3G0HA 2Y0EA 1R5BA 5J4KA 5AMXA 3H9GA 4FHDA 1GUFA 2WUEA 1V8BA 2C8KA 2HLHA 1WQ3A 2FG6C 4H15A 5EP2A 3GLHB 2RKWA 5CFRA 1G3MA 1MG5A 4DTCA 2PUBA 2BCJQ 3AK4A 1EINA 1NM5C 2QVXX 4KE7A 4UNQA 3SF8A 4UTXA 4D3DA 1EFPB 2YJGA 5B64A 3ZLJA 4UEWA 4ZJZA 5B58C 4BQNA 1FEZA 4FDTA 2OBFA 3NHYA 4GD3Q 3NHJA 2WWTA 4G84A 4RZ2A 1IN1A 3L0OA 3OTWA 1XNJA 5K4AA 1YSCA 2C99A 3F7TA 2HKIA 1AQYA 1TJ3A 4OSOA 1QG4A 4AO7A 2XUFA 3TGWA 3HXTA 2UZ4A 2PMDA 1EVJA 1QGUA 2JKYA 3DBHB 3I2HA 4ZCRA 2ZUEA 1Z6PA 1PX0A 2JDIA 3E9ZA 3ECSA 4FQ7A 4JQSA 5SZKB 1RCFA 2NQ8A 1RHRA 1RFGE 1ZN8A 4XH9B 2HMVA 1U8ZA 3VU9B 4RTNA 4FOPA 4XWYA 2PKCA 1CNMA 1WKVA 4R2IA 4JP2A 4RF3A 1JWBB 1UFQA 5FQNA 4CMEC 4RTMA 3D6AA 4RW0A 5LB4A 3RVRA 1DAPA 4Q3DA 1Y33E 1JHVA 5IVHA 1CLEA 1OC4A 3MYRA 4OHCA 4B6EA 1Z5VA 1SHUX 4KJXA 4DR2B 2VXYA 4OQLA 1B00A 1JDBC 2C3OA 3KFLA 4U00A 4BN0A 1BC5A 1KEEB 1E2PA 3CUUA 4HI0E 4WN3A 1DQRA 1JDPA 4R2LA 4ZXPA 2VT2A 4H7IA 1XRQA 4NENA 4JJAA 3QX3A 1FU7A 1SVMA 3RU7A 2Q5QA 4QOFA 1KEUA 2YBEA 1IY0A 4JJ4A 3SZGA 1L1QA 2G7MC 3K73O 3LPLA 3LBNA 4JJFA 5HEKA 1YAHA 4TTSA 4A8JB 2WG0A 1O89A 1Z0AA 3H2JA 2BFCA 4ZT4A 5TMBA 3A9VA 2F43A 1EM8A 2GFHA 2IEZA 3E9YA 3UA4A 4D56A 1ZICA 4DT1A 3HJRA 1DV2A 1Q57A 1IIBA 2VQDA 2ZTMA 1W47A 1FP4B 2H52A 1B76A 1LNZA 1KC1A 1NVAA 2AK3A 4ZV7A 1ILWA 4F71A 2HADA 4E30A 2XD9A 5H81A 4QELA 3EHEA 3TEJA 1X7ZA 1E8NA 5BV1A 4M21A 2OAEA 1DG1G 4JK3A 2F8MA 3OZDA 4NFSA 2ZSUA 3O8OA 4DLAA 4YRCA 4EY7A 2XADA 3DHWC 1KZ7B 3JRWA 3Q7SA 1QK4A 3FFBA 4IS2A 1C0EA 1JAXA 2N0SA 4X6UA 5G4LA 2FW9A 4TV9B 5LZ4A 3B1JA 2P1DA 1N1GA 3KAKA 3EGIA 3KOOA 3LFHA 4QO7A 4Z9AA 3UJAA 3VYWA 4A26A 3I5MA 4JA0A 3V3KA 1QK3A 2ZITA 3LGSA 1N5MA 2FWIA 2O5RA 2AUMA 4BJ3A 4HGNA 1H1LB 4YA6A 4EGAA 1IUPA 4L9SA 4L4XA 1U8TA 4U5QA 1PV2A 4RY2A 1CUUA 1NBHA 2RGAA 2Z2JA 3ANNA 3CZ5A 1EP9A 1L5HB 4I8DA 4RE5A 5IM5A 2I6SA 2VK4A 5JS2A 1HM5A 3HJUA 3QBDA 1XLTA 4JP1A 2IY7A 6ABPA 1H0SA 3ZQJA 4Z49A 4DDWA 4WIAA 4PV7A 1CB0A 1EX9A 2NADA 2ILTA 4KXXA 4XWOA 1NW9B 2O2IA 5BWMA 5FX2A 2IZ7A 1C3OB 3FYUC 1BHSA 2R60A 2I4MA 3UGQA 1LTQA 3FNHA 2EFCB 1KJ8A 2PMEA 2CXUA 3TR5A 4U7WA 3OFSA 1A2OA 5DXJA 3G02A 1KVTA 1ZD4A 1N0IA 2MSCB 4ALLA 5B1EA 3ST7A 4IIJF 5JOQA 1KR2A 1NHGA 4B45A 3FD8A 1QVWA 4DUGD 4ETIA 4U3JA 3ENQA 1R8XA 4J16C 1E69A 3ANLA 3LVRE 3B9QA 3PQFA 5TQVA 2LD4A 2O23A 2P67A 2QAGB 4WZBB 3CF4G 2XDYA 3I1IA 2GCNA 1V8OA 4QA9A 4ENSA 4QICA 4L8FA 1UJNA 2E4UA 1O0SA 1X74A 3SEFA 1T0BA 4P7KA 1HSZA 4MW6A 3RJ9A 3PIRA 3NVKI 4PGHA 4WFJA 5HTKA 4BMPB 1HDYA 1I2MA 2QL6A 4NBVA 3ZVMA 1LK7A 2ODTX 1DX9A 1I1QB 2ZAGA 1U2RA 1PP4A 4CUJA 3IEMA 3L2OB 1NJGA 1Y3AA 3K32A 4RHUA 4BO6A 5HK9A 3R44A 5H4HA 4EZBA 2BE9A 4P4GA 1H2BA 3OF2A 4YAJA 3ZBTA 1WW3A 4B2IA 3F7NA 4LZZA 3PVSA 2PPLA 2XMGA 4JBLA 1OFTA 5I7FA 3V55A 2XXAB 5BVGB 1O77A 3DQQA 1OX4B 1DC7A 5EUCA 4O4JB 5EVJA 1GNLA 1XZCA 1DL5A 2QV7A 3F1LA 3N53A 3KEFA 1GR0A 3LUDA 4WXRA 3UICA 1N36B 4NI5A 1TVKB 1GADO 4MUFA 1PYGA 4FSXA 4N3NA 3FF4A 1XZEA 3VQTA 5LOVF 1ZR2A 4JWKA 3P2JA 2JW5A 1Z2OX 4W82A 1DX4A 1FQKA 3OO0A 4LRUA 4MQFA 1H2HA 4P0PB 3QXJA 4B3GA 1JXQA 4C76A 3DG9A 3C6ZA 4LNAA 2GRAA 3UWPA 2F2TA 2JLZA 1P61B 3CLVA 3T0IA 3QU2A 4HKTA 3DMFA 5COBA 2V7XA 4N5HX 5E3JA 2MR6A 1N2GA 1XZIA 1YR9A 5F5XA 3UHAA 5HXAA 3F7OA 2WI8A 3RI3A 5A9SB 3TW4A 2UZIR 3KEGA 3AP2A 4EA7A 1AHNA 4M9SA 1K8ZB 4K2AA 3W5SA 3E5HA 2IUUA 2P9YA 4FEGA 1YHYA 2O1EA 4YJ2B 2QI9F 4JR0A 4A8JC 2NU8B 4BU0A 3CW8X 2VS1A 2POCA 2FXVA 4RMIA 3PC3A 3N2YA 3Q41A 2I4TA 4UU1A 1G60A 4X0EA 1PQUA 1LBQA 3D6UA 1L6RA 4ZI7B 1X7YA 3ZJTA 3N0XA 3L1UA 4GPD1 3E03A 3MS7A 4DUPA 4HSEA 2EZTA 3WBJA 2HEGA 4DR4B 2G1KA 3C4JA 4L3OA 1FU4A 4EUEA 4HSGA 4QBGB 4JOCA 3VOAA 1RNLA 1PS0A 1E6KA 4G5GA 5AVKA 4C43A 4O25A 4WOJA 1XTVA 1NYQA 2P1ZA 1J0AA 3AR4A 3ACBA 3IP9A 3K5IA 1QTNA 4DLWA 4CM8A 1WDKA 3AUJB 3URMA 1OREA 4PFKA 4ZRNA 5KQRA 3IP3A 1A2QA 4PLHA 4N9QA 3PFWO 3D7RA 2UU9B 3BGDA 4OLJA 4I5IA 3A10A 2PJDA 5CX1A 1HT3A 1P1CA 1S1MA 4MEAA 2N1MA 5SZIA 4CF6A 3NHFA 3R1IA 4A0SA 4HAZA 5EPUA 3N74A 1GTSA 1G7CA 3Q2KA 2G76A 3D6VA 1QX4A 4DIUA 1OB2A 3E4DA 3GPIA 2B92A 1Q5PA 2HTEA 1Q7GA 1P81A 3DEHA 4FC6A 4HNQA 4N0DA 4Q9LA 5JIBA 3IAM1 3DHVA 4ZAZA 1RAIA 2CBGA 5IANA 3J7AC 3IQDB 3TOXA 5HVNA 1NI5A 1NQXA 1EK6A 1E7QA 1PU2A 1TYAE 1M0TA 3DLCA 3H2GA 4QTZA 4TM7A 2BGJA 1NXWA 2BFWA 1Z34A 3P94A 1GUYA 1IDN1 4D8VA 2H11A 3DWIA 13PKA 1DEXA 1I80A 1B15A 3DFUA 2A2ZA 3QVUA 4TWAA 2PKQP 1E6LA 4MV5A 4XSHA 2CV2A 3U7QB 1NW7A 2QAGC 1D2RA 2OL4A 1JTVA 3LRXA 4RQUA 1UBEA 5JFOA 5D3QA 3ZI0A 2G09A 2HCFA 2W0MA 3GT3A 3LZ6A 3ORHA 2FQQA 4BQEA 3FTEA 1PS8A 4Y30A 3BXPA 4LY3A 3AONB 4IH1A 3BKWA 4REMA 3KYCB 1RPZA 5DKFA 4IOLA 3VR6H 3KJGA 5DJ5A 3W9UA 2W2XA 1X7HA 4LVOA 1DPFA 1WZUA 1KHTA 1A95A 1RRFA 4H16A 3NHBA 2OGZA 4NBTA 4KQWA 3MTQA 3HKDA 4LTNA 5C81A 4J7AA 2FA9A 3GLHE 1V3VA 1AS0A 2CK3D 4BFZA 2X6QA 3PSHA 4AUKA 3AVUA 1AH2A 1QLJA 4QJ5A 3KPWA 1RJFA 2RH8A 2G5GX 1O6CA 3PC4A 1X13A 4J8PA 4NOKA 2BGNA 2WUVA 4P3YA 2P78A 1M75A 4MP6A 3MOGA 3ZY2A 4MJ3A 3H65A 4B4DA 1ZH8A 2WJVA 2R5FA 3PX2A 4NCAA 1SA0B 4PO8A 1ZO8A 1LRLA 3N05A 4HN2A 4DCSA 4PN7A 1WVGA 1FTQA 1KI4A 2D54A 1E2IA 3B1VA 3CUKA 1M5TA 3FYSA 4M55A 4TKVB 3SYRA 1X1RA 4CMIA 4E70A 3D2BA 2G0AA 1BDHA 2ZU6A 4NF2A 1EFVA 2B25A 2QUBA 1BZYA 3TBKA 1J9GA 4CHGA 2AUTA 4BFLA 2Y1DA 4W9RA 1KRHA 1K08A 2CKMA 2KLBA 1KE1A 1TUIA 4E6PA 2O7QA 3KOZA 2C2GA 2I6TA 2X9VA 3BSFA 2NU9B 2B8TA 2I4OA 4X90A 4IO0A 1PR4A 1T36B 2DJ5A 1NQVA 2CUTA 3DAYA 4LV8B 4YMGA 1XALA 3A8TA 1F8XA 5K8VA 5AVUA 1CUCA 4LJYA 2YHBA 5JMWA 3E53A 1NUAA 3GGOA 2IZ6A 4K46A 4WDQA 2JFNA 5E8JA 3WK4A 2H5EA 3D4IA 1SOMA 5TF4A 2OE2A 4CI0B 2C96A 4B6SA 4BLRA 4C21A 4CYMA 4Q6WA 4Q9IA 3QE2A 1ZCZA 4AJEA 3LT1A 2WF8A 4O4IA 4EY8A 4P83A 3LFUA 3C16C 3GRAA 3N2ZB 2HV8A 1XTQA 2NV0A 3PEUA 4IGEA 3E6AA 5C8YF 4LPSA 3RSCA 5JNUA 1CS0B 1ZYUA 2D4HA 2GK7A 3F3YA 3KE8A 4GOKA 3H9CA 3OURA 3PK0A 4HH4A 4URZR 1IRXA 3ZWCA 1TX4B 5CVTA 5GJBA 5KNLA 4BTLA 1ETUA 1PIWA 4M3NA 4IVNA 4JCOA 1C1YA 3LL4A 3RQSA 5LQAA 1WXXA 1WY5A 1FTYA 2BRUA 3FFTA 2VNJA 4R40A 4RMNA 5ERXA 2WNSA 2GK4A 1Q0TA 1AN9A 3A9WA 4WRRA 4AO8A 2BTQB 2C1EA 5AVTA 1TM3E 4BZQA 1VCHA 2FU5C 4XGNA 1G3QA 1AKMA 5AM1A 5KDLA 1ECJA 1OIXA 4HXYA 2VDMB 3MJEA 5AKHA 4MW1A 2YHIB 2J85A 2VP3A 1AA6A 1C4OA 2YX1A 4DFDA 3LTEA 4QYMA 4E08A 3NT5A 3KEQA 1TA9A 4N3GA 2VPIA 3WIOA 3EEOA 3DVLA 3HMKA 4KBFA 2CLLB 4RAQA 4F3YA 5BWNA 3FN4A 2IPOA 2GD1O 4O2BA 3REQA 4RJLA 5DSZA 2QXUA 3L1HA 4AG6A 5A6SA 3KDPA 4YJHB 4C7BA 1NJFA 4MDYA 4N5MA 4U8HA 4DCMA 2ZIGA 4QD3A 4DEYA 4Q1EA 2MTBA 3I5UA 4HC4A 3ILVA 2YOFA 4EUFA 1G3IA 2G9QA 2I4RA 4MUKA 1AKYA 4CKBA 3GGPA 1TO1E 5K8IA 2YV4A 1JEEA 5TRTA 1M2WA 1WF6A 1XMVA 3D6HA 3CMCO 4DPLA 2QUHA 3R0IA 2BCGY 2P30A 1SXPA 4JLVA 4D25A 4HYEA 2I87A 1ABEA 1T5BA 5D5QA 2OCIA 1V9CA 3MT7A 4BMZA 1VPEA 3W77A 5ALDA 3K30A 5FBWB 1U7ZA 2DU8A 2CWWA 3G5AA 1SMKA 4WZBE 3BRSA 4V2UA 1PJQA 1VA5A 5E6RA 3CU5A 1DKMA 1H6DA 4M4SA 4KC0A 1H2WA 1YZHA 2WD8A 4XSGA 5AXAA 5FBKA 3WGQA 1SD5A 1WWKA 3THSA 2K2WA 4HH3C 3D7KA 3LHFA 3DMNA 3DHEA 2P8JA 4MOWA 3KSMA 3BJEA 4R01A 4UJ5A 4YJGA 1MFPA 1PSWA 5WRFA 4BQPA 2XCQA 2VTBA 5BOSA 1Z35A 1MAVA 2XOEA 1V9SA 5JQGB 1EIWA 5JCXA 1RLUA 2CLDX 3I4FA 2XUZA 1YQGA 4RACA 3ABIA 2FMKA 4MWCA 4B76A 2DKFA 3FUUA 1PJ2A 2JHAA 4UZSA 2RGNC 1SKYB 2AC4A 2QZ4A 5E7MA 4P7FA 3CVWA 4XARA 3R3WA 1KEZA 3AFIA 4ZYWA 3OPYA 1R1DA 1TE2A 3IILA 1D9XA 2HO5A 1LDYA 1E5XA 1GFSA 1Z2AA 4BBJA 3ONDA 4FS3A 3PPIA 3T7RA 1PJRA 1GAWA 3QPUA 4TVKA 5HRUA 2QN6A 3F73A 3L6OO 5CNIA 3K20A 2Q6IA 2FP3A 1LB1B 1U2TA 1ZJJA 4BHTA 4MS1A 1S2MA 5AUQA 1JYEA 2G7ZA 2O5VA 1G8AA 1VHDA 3EZYA 3WLJA 2J46A 2I3BA 1KI2A 2QQ0A 1G20A 3LT0A 3ZHRA 1D07A 2O7NA 3FUWA 2P4QA 2WFLB 2Q1TA 3KXIA 4NECA 1EP3B 5TNXA 1U28A 1LLQA 1VE5A 3DEJA 4DG9A 2VDQB 5FTWA 3CE6A 3UK2A 3BSYA 2FPMA 1N2HA 2QYTA 3ZGYA 3BK1A 3ZJ5A 3THYA 3WWEA 4OF4A 1CUXA 1GZ7A 4FI3C 1HFEL 3A25A 2ETVA 3NKFA 1J5XA 1BCRB 3U37A 2WQ7A 1FZQA 4C78A 4UC0A 1YJQA 4FILA 1YUMA 5EXPA 3W8FA 3VO8A 1W9MA 3CEHA 3SOZA 4CFSA 2FN7A 2NTNA 4M1EA 1K3TA 3FLMA 4YONB 5JQWA 5JDCA 5E4YA 2G6TA 4TLEA 3HWSA 3ZXSA 1WSDA 1AMNA 5G02A 2OV8A 1FVXA 2HJRA 3M9WA 5BN4B 5CW1A 3LSYA 2QD5A 3FR7A 2EG5A 2I6XA 3L7DA 4H1HA 1TCBA 1GSIA 4HAWA 1FU8A 2EP5A 2XCOA <