3KB7A

Crystal structure of polo-like kinase 1 in complex with a pyrazoloquinazoline inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
290
structure length
289
Chain Sequence
EIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPFSIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of 4,5-dihydro-1H-pyrazolo[4,3-h]quinazoline derivatives as a new class of orally and selective Polo-like kinase 1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK1
total genus 81
structure length 289
sequence length 290
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kb7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kb7A01
3UDBA 3VHKA 2F4JA 4IMYA 4RA4A 4BBMA 4DCAA 2VD5A 2PU8A 1OMWA 3PTGA 3FKLA 3W1FA 2C5YA 3E5AA 4BDIA 3ZUTA 1PF8A 2Z2WA 2XK6A 4O21A 1AGWA 2UVXA 3C0GA 3KXMA 4NKSA 3D5WA 4IH8A 4PL3A 4JQEA 4WO5A 3PZHA 2Z7QA 4UXLA 2VTMA 5AV3A 4IC7A 3FC2A 2W99B 4MCVA 4C62A 1XR1A 3DBEA 5IH5A 3I81A 3DPKA 3R01A 1H27A 2YITA 3BU6A 3IPHA 3Q4UA 4M97A 4P2KA 3DZOA 2GHLA 3IOPA 4EWHA 3KB7A 4O0YA 4OTWA 4EK6A 3VUTA 3NNVA 3OWKA 5E8ZA 4BDBA 3QRKA 4ACMA 4DG3E 2BZKB 5HBHA 3FEGA 2Y6OA 3AMBA 4FSWA 4U5JA 5KUPA 1MP8A 1KE5A 4D4YA 1KE7A 4J1RA 5CSWA 4YJTA 4GK4A 2Q0NA 4RVMA 3FUPA 1HCKA 1R78A 4NM3A 5AP7A 3ZRKA 3LFFA 4PRJA 4YPSA 1NW1A 3PLAE 3R71A 4WD5A 5BVDA 2YIXA 2R3PA 4QMNA 3EQFA 5IDPA 4IJ9A 4FTRA 4FSMA 3IECA 4QTAA 1JWHA 2XRWA 5CSVA 5JMSA 3AC3A 4O6EA 3E93A 2OH0E 4K1BA 1NVRA 4GUEA 3RAKA 3VNTA 5I9XA 5DWRA 1O9UA 4GEOA 2VWBA 3VS3A 4EHZA 3UIUA 4F7JA 2XNOA 4V05A 2W05A 4IFGA 1OKWA 4AE6A 2R3HA 3OEFX 4AGCA 2RF9A 4G6OA 5KX8A 3M42A 1Q61A 3IW7A 3R28A 2YDJA 4FG7A 3U6IA 2JBOA 2R3JA 3R6XA 5K3YA 2QURA 3I6WA 5L8JA 4NCTA 3PJCA 3IK3A 4YGAA 4Z16A 2DYLA 2WMWA 3QWKA 4EEVA 4RZVA 4YTHA 1KV1A 3ZC5A 2VWZA 4C2WA 5JFXA 4LQMA 4R78A 2JDSA 4CD0A 3FSFA 4QP7A 3ETAA 3P9JA 2QC6A 1Q8UA 3LFBA 5I9ZA 1UA2A 1ZOEA 1OPLA 3FMHA 3KRJA 4O22A 2UZTA 3VF8A 4EKKA 3KMUA 4O7LA 2P33A 3WZKA 3F5UA 4MD7E 5A4TA 2R4BA 3H9FA 2G2IA 4HYIA 4YTCA 2WZJA 3NX8A 5CNNA 4ZOGA 2R3QA 1BX6A 1H26A 4M12A 4B4LA 2OO8X 3OXTA 2NPQA 2OF2A 5DGZA 5E8UA 5D41A 2CGUA 3RPVA 2CKEA 3RJCA 3ZM4A 1JKKA 3OBGA 3RMFA 3RP9A 3S2PA 3AQVA 3QL8A 5IQBA 1KUTA 3LCDA 4BL1A 3E62A 3GCSA 3GCUA 4GKIA 2XCHA 3SVVA 2XCKA 2ZV7A 4JS8A 4QPMA 4RIXA 5T3QA 3WYYA 4ENXA 3DXPA 4NYEA 4BWXA 4EHEA 5K0KA 5M09A 3RGFA 3ZC6A 2E9NA 4OUCA 4FZDB 3ZO1A 3VVHA 3FI8A 5EYMA 4EOJA 4QMVA 3BEGA 5CVHA 4ACDA 3P08A 4TL0A 5FUTA 2BZHB 2OJIA 4FV5A 4NIFB 4E1ZA 3ALNA 5IA0A 2W5AA 4I5CA 3EYHA 4QYFA 3TL8A 3VS6A 2EXEA 2UZNA 4XCUA 5HI2A 2LGCA 3HP5A 5IEVA 4C34A 1U5QA 4FKGA 4FEQA 3R7GA 1P4OA 5F20A 3UNZA 3CBLA 3GU4A 3AOXA 3CPCA 4U3YA 1WFCA 3UJGA 4IM2A 2BFYA 3OF0A 2B52A 2OIBA 3L9NA 4HCUA 5GIPE 4V0GB 5AIKA 3UC4A 3C4ZA 3PWYA 4BY9E 2R0UA 4YJUA 4ZTNA 3QZGA 5FQDC 4YTIA 2PMLX 5AV4A 3OG7A 2RFDA 2CCHA 3DDQA 2PVRA 2WMAA 3R7UA 5BUIA 2G2FA 3SG9A 4K33A 2UZWE 3OHTA 2ONLC 1V0OA 2OG8A 5EOLA 2VWYA 1QPEA 3VIDA 4DEDA 4F6UA 1T46A 3UYSA 5KCVA 3IW5A 4D58A 4JT3A 3E87A 3KVWA 3NW5A 4ALUA 2YFXA 5BVFA 5CF8A 3QGYA 4Z9LA 4JXFA 5AR8A 5CSPA 3QQHA 5AUVA 4HCVA 3W2QA 4OTDA 4A9YA 1YXSA 3V5LA 3JR1A 4MTAA 3MJ2A 5I3OA 4O0SA 3NYOA 3AC2A 1CM8A 4YLJA 5J95A 2OH4A 4IJPA 1STCE 1LEWA 3AT2A 3MYGA 3LFAA 4F0IA 5ACBC 5EH0A 3SHEA 3ZBXA 5FRIA 5IISA 1YDRE 4C02A 2V62A 4BKZA 2UW7A 3B8QA 3DLZA 5BX0A 3DBFA 4O1OA 2GHMA 5HG7A 3A4PA 3SW7A 3SOAA 1JSTA 4YZ9A 2C3JA 4RJ4A 2X7FA 5J5SA 3FC1X 1FGIA 1FVTA 2IVTA 2ERKA 5DT3A 4DTAA 5E8TA 4ANQA 2QOLA 3TNIA 3EH9A 5HX8A 2HXQA 3HEGA 2KULA 3P23A 5FTGA 5JRQA 2RFNA 4AS0A 5AUUA 5M44A 5E1SA 2JC6A 4LOPA 4F9CA 1V0BA 4IDTA 5CVGA 4EOSA 2Z7SA 3U9CA 4QRCA 3W8QA 1OI9A 3HLLA 2QONA 4U7ZA 4C57A 3D7TB 4J53A 4BIEA 4ITHA 1KOAA 2UW4A 3FI2A 4PTGA 2R3RA 4J96A 4GT3A 1JSUA 3K2LA 3OCGA 4BRXA 2C5XA 2R5TA 4X6RA 4GW8A 4TXCA 5A4CA 2OFVA 2VUWA 4LL0A 2W1CA 4NEUA 3C5IA 3DJ7A 1REKA 3TDVA 2UZVA 1M2RA 2XP2A 5JRSA 3SQQA 4AW5A 4QQTA 1CTPE 4M66A 4QP1A 3DBCA 5C03A 4AZVA 4KB8A 1JOWB 3QD0A 4S30A 3GI3A 2YDKA 3BELA 5ANJA 3RHKA 2J6MA 3PUPA 5LJJA 1DM2A 1NVQA 1P14A 1WBWA 2PZ5A 2W4KA 3KCKA 3KF4A 4JIKA 3IDPA 4EYJA 4DYMA 2WTWA 3KN6A 4U6RA 5HCXA 5LWMA 3VBVA 2BRHA 2R3LA 2BRNA 3GFEA 4FT0A 2PVLA 3IDBA 4I93A 4MXYA 3PJ2A 2GFSA 4LGDA 3VF9A 5DFPA 2X7GA 4FL1A 5HICA 4LGGA 3MBLA 2OJGA 2WTJA 4LYNA 4DH7A 1ZARA 2YM8A 3D14A 1G8AA 1NT2A 4FTOA 4XP2A 2GNHA 1OL6A 4IZAA 3CKWA 5AFVA 4AN9A 3BPRA 3FPMA 4BWPA 3O7LD 5HO8A 5I9UA 3QAME 4AZEA 3DGKA 4PV0A 4O38A 2ACXA 2FSMX 1XJDA 3NNUA 3PSBA 5BMSA 4C33A 4O86A 1J1CA 3VBYA 3I7BA 4FICA 4CTCA 4NTSA 3W2RA 4L53A 4QP9A 4KUJA 5A54A 1GZOA 2R3MA 1MRUA 3OT3A 4JDHA 2JEDA 3RCDA 3ZXTA 4EC9A 5IMEA 4M7IA 2XF0A 4IX4A 3RHXA 4E7WA 5KZ0A 4R77A 2IZRA 3RZFA 3N4UA 4IANA 3L1SA 3AD6A 3BHUA 4ZTHA 3VO3A 4O7RA 3PG1A 3TACA 2QNJA 3CXWA 1FVRA 4RFYA 1ERKA 4QTCA 2W7XA 2YCQA 4L3LA 5BVNA 5BYLA 3TDWA 4G16A 5LQFA 4I0RA 2NNWB 3ZOSA 3A62A 4TNDA 3LHJA 3VRZA 4CZYB 4DITA 4WBOA 2BZJA 4W4WA 4HVSA 4MNEB 3VS4A 2WEVA 4CYJA 2OSCA 5EI2A 3V8TA 1Q3DA 4FVPA 4A7CA 4G9CA 1WVXA 3LIJA 2WQNA 2HY81 4KIQA 3ROYA 4D4RA 3SA0A 4GCJA 2C3KA 4F09A 5IKWA 5ETIA 3GP0A 3DKFA 3MW1A 4F6SA 3FXZA 3G33A 4NM0A 2W1GA 5CTPA 2UZLA 2JFMA 2I0VA 2VU3A 3HDNA 1GOLA 2XIKA 4JBPA 4AA0A 3E8EA 3ORKA 2J50A 2R3OA 2WMSA 3RNIA 3OROA 1REJA 3G0EA 2C6OA 2GCDA 2XVDA 4H36A 3ZO4A 3EQDA 1LUFA 5ANGA 4B8LA 2YLEA 4I20A 2VX3A 2NRYA 3TTIA 4LOOA 5JFSA 4C38A 5EDQA 4WNOA 2BKZA 3P78A 4BTKA 2OFUA 4DE4A 1IA8A 3HV4A 4RC4A 4FL3A 4QYGA 1DAWA 3BQCA 2IN6A 5TF9A 2V0DA 4O7ZA 5F94A 4HVIA 3FHRA 4X7QA 3ZSIA 4YZCA 5I9WA 1RE8A 2QOIA 2C3IB 5EW9A 4IAYA 3PSDA 3OD6X 3MESA 2BAKA 2PTKA 3R9OA 5IQAA 4HVGA 4IWQA 3EMGA 4AX8A 2OI4X 3GQLA 5L2QA 2VWUA 2RSVA 3F2NA 3MTFA 4I4FA 3IKAA 4M69A 3RWQA 4JR3A 1ZY5A 3EZRA 3NUSA 3LJ0A 5DH3A 4PPAA 3T9TA 5M08A 1PMUA 2IZTA 5IZFA 4YJPA 3R7IA 2IZSA 2VWWA 4IX3A 4RFMA 1FPUA 3QD4A 4MF0A 5A14A 4UALA 4KBAA 4EH9A 2WMBA 5CQUA 3A7FA 3R02A 2YAKA 2EUFB 4M3QA 4USDA 4GT4A 5FM3A 3Q4TA 5M4CA 4QP3A 3PA5A 3DT1A 3CQWA 4BICA 4C0TA 3NVKI 3I6UA 3MA6A 4EWQA 4H58A 4D2RA 1SVHA 4D9TA 4TWPA 5ETCA 3G6HA 4F65A 3PY3A 4IDVA 2PY3A 4WHZA 4U9AA 3UE4A 5IMXA 3UBDA 2RG6A 1H24A 3HV6A 2W4OA 3UVRA 4RX5A 3SXRA 2QO7A 2SRCA 1YWRA 5IA5A 3ZBFA 3QKKA 2JDOA 3CQUA 2GNJA 3ANQA 3GOKA 4S34A 4AF3A 4D9UA 5FP6A 5EI6A 5KE0A 3WE8A 3BYMA 3TNHA 3HMMA 4JL9A 3RPYA 4FSZA 4NH1A 5HE0A 1W8CA 3VULA 3LJ1A 4B8MA 2EXCX 3ZEWA 4C58A 2YCRA 3PA3A 4RIWA 1J7UA 2ZV8A 3ALOA 1H0VA 4ONAA 4XLVA 4QP8A 3AGLA 3WZDA 3DFCB 4JNWA 4GL9A 3RAIA 3ZXZA 3PSCA 4FKJA 1XQZA 4ALVA 1CKJA 4PMSA 4IVDA 2NP8A 3GB2A 1R1WA 2YAAA 5C9CA 4MD8E 3E3BX 2WPAA 4DEAA 2G9XA 4D1ZA 5J1VA 4AA4A 4CNHA 3BHHA 1UKHA 3FL5A 4Y5HA 4UMUA 3A4OX 3PVGA 3QBNA 4JDKA 2VTPA 3UTOA 4DN5A 4L7SA 2JAMA 3MFRA 4RJ7A 4X2GA 3TKHA 3JS2A 2OIQA 3UP2A 5HG5A 5ANKA 1OKVA 3BLQA 3WF8A 4BZDA 3S0OA 2IWIA 2JAVA 3CD8A 5JQ5A 4B9DA 5ACKA 1DI9A 2VTQA 2BTRA 4XV3A 5BUJA 3HYHA 3KA0A 1JKLA 3P86A 2FSLX 2PVHA 4FKWA 5AP6A 3ORPA 1RW8A 3LPBA 3DJ5A 3HRBA 2XA4A 4MH7A 3VS5A 4OBOA 4Z55A 4R5YA 5CF6A 2XNGA 3NUYA 4FT9A 3TZ7A 2IVSA 4ZZMA 4ANBA 4TN6A 4XRJA 2J0IA 4EKLA 4E3CA 4YJRA 4PMMA 4TYHB 1SMHA 2XRUA 1PYEA 4QPSA 3FZPA 3MPAA 5AR7A 5J1WA 5T6KA 1H1PA 1Q41A 5E8WA 4O0RA 2CLQA 2BIKB 3GOPA 3UP7A 2CGXA 3LAUA 3MVJA 5CAVA 1OL7A 5J87A 3R7VA 2BKKA 2W9ZB 4QNYA 3LE6A 4EI4A 2ITXA 4EK8A 5KKRC 1H8FA 5L3AA 4DAWA 3LKMA 5DLSA 3GC8A 3R7YA 4KABA 4C4FA 1R3CA 3A7JA 3BZ3A 3F6XA 4RA5A 4F70A 2V7AA 4K0YA 3CIKA 3PXQA 2XBJA 3BHYA 3Q3BA 4J95A 4LI5A 4HVDA 3DA6A 3HMNA 2QOOA 3BU5A 4ERWA 1PY5A 1SZMA 1U59A 1PKDA 4L52A 3O51A 4EOOA 2VWVA 4ZY4A 4FKQA 2X2MA 4HNIA 3KF7A 4CXAA 2IVUA 2JFLA 3E8NA 4NKAA 3ZFYA 5C27A 1CKIA 4ZSGA 2EU9A 3QTSA 4UMRA 4BGQA 2W1ZA 1ZZLA 3QTWA 2C6LA 4YURA 4E4MA 2CKOA 3H10A 2DQ7X 1F0QA 4MX9A 3SC1A 4QP4A 2JKMA 4UN0C 1W83A 4WRSA 5LVNA 2EXMA 1OUYA 3K54A 2FA2A 3MB6A 3P7BA 3PIZA 5CEOA 4JR7A 4JDIA 1NY3A 3S4QA 4USFA 1Q99A 3O96A 4MK0A 2QO2A 4M69B 5LARA 2PMOX 4TW9A 4OAVB 4Y72A 2UUEA 1HCLA 3TKIA 4CMUA 5L8LA 3BYSA 2BR1A 3E8CA 4C4GA 3COHA 5LWNA 3LFQA 4G34A 1YOJA 1PKGA 3LQ8A 3CTHA 4S32A 5M07A 3CGOA 3QRUA 5AR3A 2OXDA 2VN9A 1URWA 3PXFA 3OWLA 3FQEA 5E8VA 4PDSA 3CJGA 4G3EA 2WTVA 3W32A 3GFWA 4R7HA 2J0LA 3GU7A 2HZ4A 3LW0A 3MVMA 4R3CA 3QRJA 4TT7A 4XG6A 5HCZA 3UGCA 2HWPA 3OWJA 2C6MA 5BYZA 4XNEA 3HAMA 2O3PA 2YWPA 5FBNC 4BI0A 4KNBA 4APPA 1XH8A 3ZRLA 2VO6A 3WI6A 5HQ0A 2WFYA 3AD5A 5EOBA 1W0XC 2OLCA 3OXZA 5AAEA 3G90X 4I21A 4TKSA 4Y5QA 2WOUA 3SV0A 3VUIA 3ZLSA 3BWFA 2YIRA 3BHVA 5GZ9A 4DGLC 3TV7A 3ZS5A 3KRLA 1V1KA 4E5BA 2OW3A 3TEIA 1WZYA 3LFCA 2XNEA 3CPBA 3FLZA 1ZMVA 3OUKA 4W9WA 4DLIA 4HPTE 2BAJA 4IAIA 3D5XA 4PNKA 4RT7A 2YJSA 3DBQA 5D7AA 1LEZA 2WTCA 2BPMA 5CU6A 2RGPA 3H30A 4HJOA 3Q53A 3ZUVA 3ZUUA 2IW9A 2BCJA 1PMEA 2ITOA 3HA8A 4DHFA 4QYYA 5K9IA 2JDRA 4XJ0A 1GIHA 3ZEPA 4FV0A 3WILA 5CEQA 5J7HA 4YPDA 4FV1A 1ZRZA 3VW8A 3FMEA 3VUDA 5IUIA 5L6WL 4C3RA 1QPCA 3BGZA 4BCKA 2J0KA 5CZHA 4YLLA 3FYJX 4UWBA 2PVKA 2ZM1A 3HA6A 1ZYSA 3FL4A 4B99A 4PX6A 4D2SA 4Y46A 3ZU7A 4CMOA 1YDTE 2WQOA 5C8MA 4X3FC 4Z7GA 4I3ZA 2ZV2A 5A4LA 4RIYA 3QA0A 3VS0A 3TNQB 5CXHA 2BHEA 2GNIA 2WQMA 4FMQA 4QP2A 3U6JA 1OB3A 2QU6A 4ANLA 4GIHA 1YOMA 1ZWSA 4LFIA 4FIGA 4FSRA 1OKZA 3TZ9A 5M51A 4DF3A 3C4FA 4JI9A 5CU4A 2W17A 3W16A 4IWPA 1OPKA 5A4EA 3KEXA 1YXUA 2XKCA 2FSOX 5HBJA 4UV0A 3SAYA 3ZSHA 5I9YA 4ENYA 4DA5A 4QO9A 1UWHA 4JQ8A 2C6DA 3S00A 3C0IA 3NIZA 2H6DA 3G51A 1JBPE 4ORKA 2Y9QA 5L6OA 1F5QA 3L9MA 3QTIA 3W10A 2Z7LA 4FBXA 3UNKA 2CPKE 5M57A 5A6OA 3POOA 4RX7A 1JSVA 4U43A 3SW4A 4GYGA 3IW4A 2CNUA 3PRFA 5FD2A 5BVKA 5E9EA 2GS7A 3HX4A 5G6VA 3QCQA 3R1YA 3SG8A 1R39A 4IBMA 3PA4A 4K9YA 5M06A 2J5EA 4E93A 3QHRA 5A9UA 2J7TA 4RC3A 4NT4A 2WGJA 4IWDA 2JIUA 3UYTA 1KWPA 2OBJA 2Y0AA 3U51A 4E4XA 4KD1A 4FL2A 3ZONA 4QT1A 2JBPA 3D2KA 3F5GA 4HPUE 5EK7A 2HW6A 3FZOA 4N4SA 2ETKA 5IF1A 3ERKA 4L3JA 3FLWA 4YP8A 5ITAA 4Z3VA 3NUXA 3MH1A 1Q4LA 2OXXA 1M14A 2OIDA 1SYKA 4I5HA 4XRLA 5A46A 4EH3A 2X2LA 3F61A 4PUZA 5FWKK 2BHHA 5JZNA 4DT8A 2JGZA 4ASXA 1UNHA 2GNGA 2QVSE 4G6LA 1R0PA 3QKLA 1GIIA 5KKRB 4GS6A 2UZUE 1BLXA 5E7RA 3ULZA 4DEBA 3A2CA 3GUBA 2CNQA 2F7EE 4ZTRA 4ZXTA 4RLLA 2RFEA 4AAAA 4CGAA 2Z02A 4NWMA 1VJYA 2YHVA 3D94A 3G9LX 5LCKA 3BCEA 3UZTA 4PPBA 3ZDUA 4B0GA 5G1XA 3E88A 4HVHA 2A27A 2C69A 1OM1A 2GPHA 2UW9A 1GAGA 3D83A 5J9ZA 4YU2A 1VEBA 2C0OA 2JIVA 4FYOA 2PZIA 3R7OA 3THBA 3UVQA 3U9NA 1YW2A 4PDPA 5F9EA 4M0ZA 4HGLA 3R04A 4ANMA 3UZPA 1GZ8A 1G3NA 3ZYAA 3NYXA 1QPDA 3L8PA 4OLIA 5CS6A 5L2WA 1EH4A 2HW7A 4Q2AA 4QMWA 2PE2A 5HLPA 1UNLA 4RVLA 4U40A 2YZAA 2I0YA 3DAJA 4BZNA 3WZUA 1MQ4A 3A61A 4YO6A 4GFOA 3MFUA 3FQSA 4L45A 2ETMA 4WIHA 4JDJA 3C4CA 2Y7JA 4V04A 2YERA 3TKUA 3UODA 4FIEA 3JVSA 2I0HA 4D2WA 5C8NA 5CU0A 1DS5A 2CN8A 4X2FA 1ZOGA 3GC9A 4N0SA 2QOQA 2QLUA 1OBDA 3OW4A 3TIYA 5HIBA 2ITUA 5I0BA 5AUWA 3F2AA 3IO7A 1WBPA 4Z7HA 4FK3A 4NU1A 1RQQA 4R8QA 3C7QA 3FMLA 1YXXA 4BB4A 3G0FA 3N4VA 1U54B 3QTQA 1K2PA 3ODYX 4ZY6A 1YI4A 4FTJA 3KCFA 3OT8A 4N70A 5CQWA 4GJ2A 5HE1A 3W2PA 4YUQA 3OVVA 4ACGA 3QXOA 3WF6A 4BDEA 4ZZNA 4FZ6A 4V0GA 1F3MC 4DFLA 3BYVA 1KE6A 2VX1A 3D5UA 4MBIA 4I23A 4TWCA 4O7VA 2DUVA 4PY1A 2PULA 2H8HA 3I79A 5JFWA 2VTOA 3DB8A 4JX7A 4F0FA 4F99A 4EHGA 3ET7A 4BCOA 2ZMDA 3PPZA 5FDXA 3V51A 3LXNA 3NUAA 5GJFA 5KMOA 1MRYA 3N9XA 4CG9A 3D5VA 5CAQA 5J9LA 2R7IA 5HORA 5KO1A 1M2QA 2R9SA 4YZDA 2O65A 2F57A 5HD4A 3QUEA 4I22A 4UWCA 3UO6A 1WBOA 3JY9A 3NS9A 5ICPA 2DS1A 1UU7A 2E9PA 3VS2A 4AW0A 4TYHA 4OTIA 4BZOA 4ZIMA 3CTJA 2XEYA 4G3DA 4S2ZA 2PVMA 3OTVA 5C4LA 1XH7A 3L9LA 1SVEA 4IM3A 3EKNA 3EQGA 1QMZA 3SRVA 2QG7A 4FEWA 4U45A 2YIYA 3FY0A 4IVBA 4XOYA 4F9WA 3ID6C 4FVQA 3LXKA 4JQ7A 2ITVA 4RG0A 3TTJA 4FKIA 2PZRA 2XUUA 3VUGA 4IHPA 4L7FA 4UY9A 4JG8A 5HESA 4RX8A 3MIYA 3O2MA 4X6QC 4K18A 3PZEA 1YKRA 5C01A 4LG4A 2XMYA 2OZAB 3NWWA 1YHWA 4DG2E 3SKCA 4X3JA 3DZQA 1NVSA 4BGGA 2A4LA 5HE3A 4WBBB 3IONA 3FMDA 1FINA 3EIDA 5H2UA 3KULB 4GVAA 5HG9A 3TUBA 4Q5HA 3ATTA 2ITYA 3Q9WA 5JT2A 4ASEA 2B7AA 3H9OA 3DY7A 3MDYA 4UZHA 4EC8A 4TY1A 5A6NA 4ANSA 3A7IA 5DI1A 5A3XA 5LVPA 4PTCA 4PL5A 4I6BA 4DEHA 3EYGA 3IW6A 2O5KA 1T45A 3ZSGA 2BALA 4FV4A 4ZY5A 5E91A 3KXZA 5DN3A 1ZAOA 2QI8A 4I6QA 4CTBA 2WMTA 5BVOA 1OIUA 1JAMA 3VJNA 1DI8A 2QKRA 4E8AA 3LQ5A 3NYNA 4IB1A 3Q9YA 3WF7A 2PUIA 4CT1A 5JK3A 4XH6A 1Y6AA 4JBVA 4M0YA 4BYJA 3HRCA 4D55A 3DAKA 2ZAZA 2PK9A 1Y8GA 1ZYLA 3FZSA 3R9HA 4DEEA 3WOWA 4JIAA 3IS5A 3E3PA 2QLQA 3GXLA 5L2TA 4Y73A 1WMKA 2REIA 4R7IA 1Q62A 3I0QA 1JLUE 4LUDA 2JITA 4NSTA 4NW5A 4BGHA 1UU9A 3KRRA 2X8DA 4IIRA 3W8LA 4HYUA 4I1ZA 1M52A 4Y83A 2WU6A 2J0JA 3DLSA 1FOTA 4DEIA 3VHEA 3DKCA 4OT6A 2JKOA 4E6DA 3NCGA 3HAVA 4O7TA 4FKSA 4E5AX 2YDIA 4LRKA 2QHMA 3JXWA 4UWYA 4O0VA 3WZEA 4XYFA 3ORTA 4RFZA 4CMTA 3QTRA 2UW6A 4NJ3A 3IGOA 5AP5A 5JEBA 1Y8YA 1S9IA 3AC4A 2PL0A 3FLQA 4FGRA 4WG4A 3F5PA 2VWXA 1ZMWA 3C5UA 5AR2A 2ITWA 5JGAA 1Y91A 2B55A 1OPJA 5BPYA 5E4HA 3CTQA 3PIYA 4FT7A 3V3VA 4MBLA 3QLFA 3LCTA 1VR2A 4FK6A 2XK8A 4ZTSA 4E73A 3QFVA 2W1FA 3OWPA 3R63A 2B9JA 4HNFA 3KRWA 1KOBA 3O8TA 4BDCA 2W96B 4BCHA 1UU8A 4H1MA 2CKQA 4CZTA 4USEA 4CKIA 4O7YA 5DRDA 5HX6A 1YWVA 4L01A 2DWBA 4ACHA 3HMPA 2C3LA 2GTNA 4XOZA 4FR4A 4AGWA 4FI1A 2OF4A 5CX9A 3FWQA 3MVHA 5AUXA 5KMKA 4GUBA 5DEYA 4CYIA 4E4NA 4KKEA 5DIAA 3FLNC 1P5EA 1BL6A 3QRTA 1PXPA 2C47A 5H3QA 3MIAA 5HNGA 3FDNA 5CNOA 5KMNA 3PVBA 3CEKA 1B6CB 4UMPA 5IH6A 1XBAA 4IXPA 4J8NA 3QGWA 3FAAA 4AT5A 3O0GA 1MRVA 1Q97A 5FEEA 3GBZA 4AZWA 2VTHA 3U4UA 3QQUA 4XV1A 2CHLA 4QMTA 4X3FA 5GNKA 4BCGA 3BLRA 2R3KA 3AGMA 4I41A 3OXIA 4YSJA 4Q5EA 4FV2A 3VAPA 1YOLA 4FKRA 3W55A 2C5VA 5D7VA 2PWLA 3RM6A 2GSFA 2CKPA 3LMIA 3ORLA 3HMOA 2P55A 2ZB1A 3A7HA 2B54A 1WBVA 4GG7A 3PE2A 2WB8A 4M8TA 4XG9A 3RALA 5EHOA 2Y4IC 2B9IA 4G6NA 1OGUA 1GY3A 3K5VA 5J7BA 3FBVA 3G9NA 4DFBA 3CKXA 4DTBA 4YJOA 2WTIA 3E63A 4TZRA 5LMAA 3KK8A 4AE9A 2FUMA 2C0IA 4C4IA 4EOLA 3QKMA 2ZM4A 5HVKA 4QMSA 4QQ5A 4GK3A 4U80A 3UNJA 4F0GA 5LMKA 4AT4A 2HAKA 5CU2A 5IQEA 3PP1A 4XMOA 2OZAA 2XNPA 3CLYA 4JAJA 5H8GA 3TNWA 3V5PA 2Z60A 1OIYA 5GHVA 2W06A 5HZNA 4DGGA 3NYVA 3C51A 3L9PA 3FMNA 2QG5A 5LMBA 2Y4IB 4PNIA 4EJNA 5GZAA 3F2RA 4GIIA 4CFFA 3LFDA 3P5KA 3BRBA 2C4GA 4M14A 4EBVA 4XBUA 2RL5A 4P7EA 3VWAA 3HV3A 3EOCA 4FC0A 4KS7A 3VW6A 5AV2A 4EUTA 3OBJA 3Q96A 2GQGA 5D10A 3M11A 5CVFA 5FXQA 5J8IA 1TVOA 2C1BA 2QOKA 3G2FA 1YXVA 5EYKA 4D2PA 2GNFA 4FX3A 5TKDA 4KRDA 2OGVA 2WEIA 4ITIA 2XIYA 4R3PA 5AP1A 3MN3A 4FTUA 4FZAB 1OZ1A 2PMNX 4G17A 2F7ZE 2Q0BA 3D15A 5ANDA 3BBTB 1VYZA 2JDVA 3ZMMA 2E9VA 5LVOA 2LAVA 2B1PA 5FM2A 3UOLA 3BGPA 4GK2A 4F08A 4U41A 3QTZA 3R1NA 4OBPA 2H96A 2ZDUA 3DOGA 3R8PA 5I9VA 5M56A 4L46A 4A9TA 1PYXA 1J91A 4CVAA 2QD9A 1O6LA 3FJQE 4CFMA 3D7TA 2QODA 3KXHA 2YACA 3COMA 5E1EA 4AWIA 3HGKA 1CKPA 5HGIA 3W2SA 5IQIA 1RJBA 2XK7A 5D9HA 3T8OA 4MXCA 3O50A 4NJDA 3TJDA 5LOHA 4YJSA 1J3HA 2CGVA 2RKUA 2XZSA 1OIRA 3EFKA 1FMOE 1Q24A 3NUUA 3O71A 4YR8A 4B6LA 2AYPA 2VTRA 3RVGA 1IRKA 4PP9A 1WAKA 1H01A 4OR5A 4XP3A 4DG0E 4BDDA 1BKXA 4IB3A 4RPVA 3VS1A 2ZB0A 1YHVA 2GMXA 4RWKA 3ZO2A 4OTHA 2WQBA 3FMJA 2A1AB 1U54A 1XH5A 4RVTA 3RCJA 4D5KA 2VTIA 3EN7A 4DGNA 5KHWA 3V8SA 4A07A 3RPOA 4QPAA 2OU7A 2R3GA 3I5NA 4YBKA 4ZS4A 3R8LA 3QX2A 3QU0A 3COKA 3F82A 2R3NA 1AQ1A 2WU7A 4W4XA 4OW8A 2UW3A 5JKGA 4L3PA 4RJ6A 2EB3A 2V5QA 3ENMA 2HZNA 3R2YA 1GNGA 5DR6A 4U97A 2HZ0A 4O1PA 4ZS0A 3TM0A 4ITJA 5EW3A 4AG8A 4IW0A 3UIMA 5ANIA 4O96A 3MY5A 3H4JA 2VX0A 3RK7A 1SVGA 2WIHA 4CQGA 3OCSA 4EZ3A 4JJRA 1BI8A 5K0XA 1CSNA 3HZTA 4H3BA 4HZSA 4I6FA 5AM7A 4MQ1A 3RTPA 3V5JA 5EQEA 3MV5A 1O6YA 3AMAA 3EQBA 3AT4A 1BL7A 4LMNA 4P90A 4QMZA 3S3IA 4DBNA 3MGYA 4EQCA 1OL5A 2AUHA 3OUNB 4I4EA 4O27B 1DAYA 3KMWA 2QOHA 3KVXA 3C1XA 4XX9A 3LXPA 3U54A 3LCKA 4MEDA 3CSVA 4E6CA 4LMUA 2WMQA 3BLHA 4R1VA 3R9NA 5IUHA 5CT7A 4TWNA 4PDYA 4QQCA 3DDPA 2V22A 1ZOHA 2CSNA 3AC1A 1UV5A 3VN9A 2A2AA 4H3QA 5CT0A 5HVYA 1WVWA 3ZFXA 5IQFA 3DKOA 3ZHPC 5HTBA 3KFAA 2P4IA 4WRGA 4AW1A 2A19B 2BRBA 3I60A 4HGTA 1ZYCA 4I0SA 3UMWA 1H08A 4IADA 2HWOA 2XM9A 5CI7A 3MH0A 4LM5A 4Y85A 5AV0A 3RKBA 4C4HA 2BFXA 3IOKA 2YABA 2HYYA 4J52A 3Q52A 4YBJA 2I40A 3NAYA 2XH5A 5DOSA 1WBNA 2WAJA 3U4WA 4ZMEA 4MWIA 3V5WA 3E8DA 5AUZA 4KAOA 3NVMB 3C50A 2PVNA 4MBJA 4X3FB 2ITPA 3FMKA 3F3VA 3IQ7A 2F2UA 3P7CA 4BC6A 5IQCA 2CCIA 4ARKA 3GCQA 2VGOA 2XEZA 1YVJA 3NLBA 4RLKA 1GJOA 4ZEGA 4F7SA 3NW7A 4EJ7A 3AC5A 3Q2JA 3CP9A 2P0CA 1XH4A 4J7BA 3Q32A 4FT3A 3PY0A 3QTXA 3W2CA 4FEXA 5DT0A 2XYNA 5GJDA 3B8RA 2JDTA 3NZ0A 4FTCA 5EM8A 4DLJA 5BUEA 3F69A 5IA2A 5DHJA 2XNNA 4ZMFA 2J51A 3GGFA 3OMVA 3Q9ZA 2WKMA 2VTNA 4L67A 5D11A 4WUNA 5HEZA 4R7BA 3F7ZA 3HDMA 1URCA 3Q6UA 4JRNA 4PTEA 4FSQA 4D4VA 4ZAUA 1GZNA 2WMRA 5KHXA 4C3PA 2X9FA 4BR3A 1YQJA 2C0TA 4RWIA 4DT9A 2W9FB 2E9OA 3FI4A 4KKGA 4TYJA 5D1JA 4L43A 2I1MA 4YLKA 4OTRA 5EM7A 3ZFMA 4XG3A 4ID7A 2WTKB 2BDJA 3WIGA 5CASA 4WSYA 3PJ3A 1PXJA 4K8AA 4FUXA 3DJ6A 2VTJA 4CRSA 5L2IA 5KNJA 1B39A 4J99A 2WTKC 2XKDA 3Q2MA 3MPMA 2C30A 4O2ZA 3R7EA 3PXKA 5FEQA 4CFUA 3WBLA 4DH8A 2WIPA 2ZDTA 5EM5A 5E8YA 4G3GA 1YI6A 3DXNA 4G2FA 2PPQA 1FGKA 4RIYB 1PXKA 1V0PA 3UOJA 5LVLA 4RWJA 3PVUA 3O7LB 4H1JA 4IB5A 4PWNA 1W84A 3FLSA 4IAAA 4YSMA 3FV8A 3KKVA 4F7NA 4BVUA 3HMIA 4AOTA 5IU2A 2VV9A 4FUYA 2XBAA 3AD4A 5B2KA 1QCFA 3KXXA 3MTLA 4YJVA 1RDQE 2C5NA 5AP0A 4PPCA 4BI2A 5CF5A 4U79A 4IFCA 3UG2A 3FI3A 3P7AA 3RM7A 1Z9XA 3CY3A 4G3FA 3ACJA 3CCNA 4LUEA 4V01A 4WG3A 4DFNA 4XV9A 3CJFA 1H0WA 4YNOA 3R22A 3H0ZA 4IE9A 2ZV9A 3BV2A 3CQEA 3QA8A 4I5PA 4ERKA 3QC9A 2QQ7A 3ZO3A 2QO9A 3V6RA 3TZMA 3ORZA 4DH1A 2XKFA 4CG8A 4RRVA 3F3ZA 5AX3A 3V8WA 5BVWA 4FG9A 5IEXA 4JAIA 4JBQA 3NNXA 4AUAA 3E7OA 3LMGA 4J8MA 1BUHA 4TPTA 2JLDA 2XJ1A 4NM5A 3EFJA 3EB0A 5M4IA 2YZLA 4ANOA 4WNKA 4R1YA 1OL1A 5TO8A 1OKYA 2FB8A 4N6YA 1PW2A 4ASDA 3AXWA 3G5DA 4ZLYA 2PZPA 5M4UA 1YXTA 5IUGA 2YEXA 5TE0A 1W82A 1JKSA 4MWHA 5CAPA 5IA1A 3L8SA 4KIOA 4BDGA 4CT2A 4RSSA 4C2VA 2CLXA 3E7VA 3R83A 2QU5A 2W1HA 5H8EA 1OVEA 1OBGA 4BCPA 3KC3A 4FV3A 2J9MA 4F9YA 3FY2A 4N6ZA 4F64A 1K9AA 1E1XA 2F49A 2YIWA 3QWJA 1PXMA 4TYIA 4BTJA 4RJ5A 4CEGA 1I44A 4BBEA 2AC3A 4FKOA 4YC8A 3P79A 1Y6BA 5AAFA 4CV9A 5CF4A 5HO7A 5K5NA 3KRXA 4FNZA 1S9JA 3BKBA 3MWUA 3TJCA 4BFMA 1L3RE 4HGSA 5E8XA 3TUCA 4EHVA 3E64A 1MUOA 2XNBA 4RBLA 4EZ7A 5AEPA 3B2TA 3BI6A 4X0MA 2CJMA 3MJ1A 5DR2A 3UMXA 1PHKA 5EFQA 3WZJA 1H28A 2R3FA 2W1EA 3TWJA 3ZLYA 5F95A 4DBXA 3BX5A 3CS9A 2ESMA 4TRLA 1FVVA 4MXOA 4YC6A 4LV8A 4ZK5A 4OAUC 1XBBA 4H05A 3W2OA 2X6EA 3LVPA 3NCZA 4EH7A 3OFMA 3PPJA 4IZ7A 4C4JA 5ETAA 2GQSA 4CKJA 5FXRA 3R1QA 2FO0A 4GFMA 4WKQA 5BYYA 3EFWA 4RIXB 3EJ1A 5FTOA 2BILB 3RAHA 1A9UA 5AA9A 2OWBA 4D1XA 4KSQA 4YHFA 3TI1A 3HUBA 4C8BA 1WVYA 3ZRMA 1NA7A 1JQHA 2HXLA 3IDCA 4W9XA 3GCVA 4RVKA 1IG1A 4BDHA 4BTFA 4NIFA 2X8EA 3TCPA 3SXFA 1I09A 4CV8A 3P1AA 1J7LA 5B2LA 4IAZA 5E8SA 2G2HA 1ZXEA 5ETFA 2XNMA 3V04A 2FSTX 3RPRA 4MF1A 4QYEA 2X8IA 2GS2A 2YM6A 3FYKX 4UB7A 5CENA 4IM0A 4IACA 2O2UA 2WMVA 1Z57A 3R00A 4M15A 2Y6MA 4A4XA 1PXLA 1M7QA 3K3JA 3EN9A 4PMTA 4O6LA 3U87A 1J7IA 3LLAA 2OZOA 4RX9A 4KKHA 3FSKA 4HCTA 4ZLZA 3C9WA 3N4TA 2VTSA 3VUHA 2WMXA 2EVAA 2BDWA 5GIOE 2C6IA 5J5TA 4BBFA 4R3RA 3VBXA 2XK3A 3JVRA 3OS3A 4WSQA 1IASA 3FXXA 2H34A 4EH5A 4Q9SA 1UNGA 1G5SA 2CGWA 4IEBA 2WELA 4PL4A 3H3CA 2UW0A 1XH9A 3EQCA 4FKLA 2IJMA 4FNYA 4FTTA 4DGOA 3DXQA 3RWPA 4FTKA 3VUMA 1LPUA 5CAOA 2XYUA 2XJ2A 3HV5A 3CC6A 2BROA 3LM0A 4PDOA 3KXGA 5AP4A 3HV7A 3PVWA 4H3PA 3A7GA 2ITZA 2KTYA 5EDPA 4DGMA 1H1QA 2I0EA 4NK9A 3AC8A 3ZDIA 4D4SA 4WT6A 5AUTA 5ANEA 4FIIA 3QZHA 3ZCLA 4CZUA 2CMWA 5F4NA 3W33A 5K5XA 3G6GA 4ZTLA 4TWOA 4QOXA 4AN3A 4FKUA 5K4JA 4ZZOA 3SXSA 4GJ3A 1H25A 2YM5A 4CFNA 4GSBA 3R9DA 4OTQA 2F7XE 5HLWA 2W4JA 1UKIA 2B9FA 4E20A 4EORA 2P3GX 5CEKA 4FZ7A 1XBCA 5D12A 5IEYA 2A0CX 2YCFA 3MS9A 4FVRA 3ZZWA 4IWOA 2VO7A 2OJ9A 5KBQA 2X4FA 3IGGA 2J5FA 2VTLA 3DKGA 5IG1A 3KXNA 2GS6A 4BKYA 3T3UA 4F9AA 4I24A 3EZVA 4F4PA 4EL9A 3QCYA 2IZUA 4CCUA 2HCKA 5AR5A 5HVJA 4RC2A 3TV6A 2VNYA 3TG1A 4CSVA 4EYMA 5LXMA 3ZLXA 2XK4A 4AA5A 3LCSA 3QZFA 4X2NA 4ZSLA 5E92A 3ACKA 4FSNA 3UIXA 3PIXA 3MB7A 3HP2A 3TV4A 3B2WA 3UPXA 4KRCA 1SM2A 3QTUA 4C35A 1IAJA 2WD1A 2UZBA 1AD5A 2JKKA 1FQ1B 3AG9A 3JUHA 5CYIA 5FDPA 2X81A 2J4ZA 3RK5A 2ZJWA 5LMKC 3KY2A 1P2AA 5H9BA 1UWJA 1ZY4A 3N51A 3PLSA 3VC4A 4E26A 1KE8A 4BF2A 2XJ0A 3R21A 5EM6A 3R8MA 5JH6A 4XEYA 2QOCA 1GZKA 4I5MA 4ZSJA 2UZDA 4E6AA 3NEWA 1GIJA 2O0UA 4O2PA 4QD6A 5HE2A 5FEDA 3ANRA 5AR4A 4AOJA 5AADA 3COIA 3BE9A 4XG4A 4GH2A 4EK4A 5IDNA 2Z7RA 3O23A 4IVCA 3M2WA 2CNVA 3V01A 3C0HA 2GFCA 1W7HA 3IW8A 4X2KA 5H8BA 3VBWA 3SD0A 4AT3A 4O84A 4C3FA 1KSWA 3A8WA 3EKKA 4FTIA 5JN2A 2PUPA 5DT4A 1SNXA 3CR0A 3QUPA 4FTAA 1HOWA 4XHKB 1NXKA 3DAEA 4YJQA 3WF5A 5TT7A 2B4SB 3MI9A 2ITTA 5C1QB 4CLJA 3EFLA 3F3UA 3NR9A 4FKVA 3QHWA 4FV7A 3VUKA 5B2MA 3EHAA 3WF9A 4ACCA 1Q3WA 3BGQA 2P2HA 2XIXA 3WIKA 4QTBA 3ROCA 1WCCA 3QD3A 5M55A 4LOQA 3F5XA 3RZBA 4F9BA 5CAUA 3UQCA 2QOFA 3I1AA 3PJ8A 4O83A 4JG6A 1IAHA 4JOAA 4CKRA 1TQMA 3C4WA 1JNKA 3O8UA 4UBAA 4W8EA 3SLSA 5DNRA 1OIQA 4U0IA 4LGHA 4PMPA 3V6SA 5E90A 2R7BA 2YM3A 3I7CA 3MFTA 4P5ZA 3KGAA 4C59A 2ETRA 5HG8A 3DTWA 3FKNA 2FH9A 2BMCA 2PMIA 2JD5A 4F1OA 4UZDA 2EB2A 2XK9A 4XG2A 4XS2A 4FIJA 4JG7A 1G8SA 1YRPA 4D0WA 2I6LA 4YO4A 3KREA 4FSTA 3OEZA 3QX4A 2QR7A 5JGDA 4FSYA 4U42A 5AIRA 1E9HA 2HOGA 4RIWB 3DQXA 5IQGA 4A9SA 1TQPA 3FXWA 3I5ZA 4A06A 4UYNA 4I6HA 3R30A 3S1HA 4EQUA 4JBOA 4U44A 2HZIA 1ZYJA 1WBTA 4I94A 5HTIA 1CDKA 4TNBA 5EHLA 4FOCA 2WXVA 5JQ8A 5KZIA 4DC2A 1QL6A 2G15A 4O0UA 4O91A 2PUNA 2OK1A 4F1MA 3EN6A 4EH6A 2CDZA 5IA4A 4GT5A 4KIKB 3FKOA 3NSZA 2XIZA 3OTUA 4II5A 4A4OA 3GU6A 4S33A 2PHKA 4U3ZA 3ATSA 5FG8A 3QZIA 2X1NA 4UXQA 3GEQA 3TNPC 4AZTA 4WNMA 2I7QA 3C4EA 4E5WA 2X0GA 4GRBA 3FMMA 1A48A 3UO4A 5EHYA 3EL7A 5CU3A 4LRJA 4L6QA 2FGIA 4PF4A 2WO6A 3F3TA 5FLFA 3TXOA 3QQJA 1Q8ZA 2J90A 3EQHA 1Z5MA 2V7OA 4KINA 4B7TA 2NO3A 3Q4CA 2PVFA 3CGFA 4YTFA 3NDMA 1ND4A 1VZOA 4R6VA 3R2BA 4MQ2A 4FGBA 1L8TA 3QQGA 4EH2A 3BEAA 4EQMA 3EN4A 5HU9A 1SNUA 2GDOA 1BYGA 2JIIA 2NRUA 4GYIA 3V5QA 3OC1A 2QKWB 3SOCA 3VJOA 4CFXA 5CEPA 4DINA 5EYCA 5F1ZA 1IEPA 4NFMA 5CI6A 5JZJA 3UC3A 3LJ2A 1PXNA 3NIEA 4YMJA 1BMKA 3TN8A 1M2PA 2ITNA 3BBWA 4XUFA 4FKTA 4O7SA 3MSSA 5CZIA 5DG5A 2J2IB 4M67A 4BCFA 3QD2B 3ITZA 4X21A 3H0YA 4BI1A 4C36A 4EOKA 4IAFA 4G9RA 1J1BA 3KN5A 4KS8A 2OJJA 4L8MA 4K2RA 4AACA 4XV2A 4CLIA 5M53A 1M17A 5HCYA 3BV3A 5FTQA 5IPJA 1ZLTA 4FEVA 2YLFA 3CY2A 3DCVA 3LFNA 4IZYA 3SX9A 3PXYA 1R0EA 2XS0A 2YM4A 1W98A 3HKOA 4MXXA 3IG7A 3LMHA 2RIOA 3R73A 3RPSA 4AW2A 3KMMA 4C4EA 3EQPA 1PXIA 5HBEA 1Q8TA 4G5PA 4O0WA 4CRLA 5CEMA 2YM7A 4OTFA 2O8YA 3F7WA 4EOPA 3UG1A 2IG7A 1PMVA 2CN5A 4BCQA 3BYOA 4QTDA 1TQIA 3U8WA 1FBNA 5J79A 3EN5A 3U6HA 4XG7A 5EDRA 2VO0A 4R5SA 5AUYA 3GT8A 2OXYA 2WNTA 4BCIA 2GNLA 2GHGA 4MXAA 2OICA 2VAGA 3PP0A 3T9IA 2IW8A 3CE3A 5AMNA 5HU3A 1ZMUA 2GU8A 4KA3A 1IR3A 1XO2B 4YZBA 4A4LA 5JGBA 4O7WA 4AZFA 1M7NA 2UVZA 5IQHA 4NW6A 5AX9A 5CY3A 1E1VA 3EL8A 1UVRA 4GMYA 4BDKA 4BDAA 3QCXA 4A9UA 3SRVB 4WNPA 2XKEA 4W4YA 3GVUA 3NGAA 3OW3A 3DFAA 3QCSA 4L9IA 2YIQA 5TR6A 3Q04A 4NZWB 1PRYA 2VO3A 5EQYA 4RGJA 5EYDA 1IA9A 3UOHA 2BVAA 4DFYA 4A9RA 4KIKA 4P5QA 3LLTA 3EWHA 4FNXA 4RJ8A 4ANNA 2C5OA 2PZYA 3R9RA 5LVMA 2BRGA 5DVRA 3RAWA 4HW7A 4LL5A 2PE1A 3DNDA 1H1RA 3NPCA 1ZZ2A 3ODZX 4ZP5A 5HIDA 3UIBA 3ZH8A 4AZSA 4C37A 3PFQA 4ASZA 3FQHA 3GQIA 2HY0A 4EZ5A 3C4XA 3BU3A 1P4FA 4QMLA 4FT5A 1QPJA 3DK6A 2X2KA 4BIBA 4BTMA 1B38A 1JPAA 2HK5A 5DEWA 2BDFA 4M84A 4WG5A 3PY1A 3UPZA 5I4NA 2W5HA 4OTPA 3PJ1A 3OY1A 3WE4A 4O0XA 2VZ6A 4TYEA 5L8KA 5CLPA 4BKJA 2GTMA 4MNFA 2WOTA 3DK7A 3PE1A 3KK9A 5FP5A 2X39A 5B0XA 4GFGA 3QF9A 3ZTXA 4EK5A 4S31A 3P4KA 3OP5A 5I3RA 4IB0A 3KL8A 2ERZE 2BTSA 3F88A 1OITA 3L8VA 4GU6A 4FODA 4EK3A 3DNEA 2YA9A 3FPQA 5HOAA 4BN1A 4YZNA 4IQ6A 3QLGA 4YNEA 3GC7A 4HYSA 4AU8A 3DU8A 3KQ7A 4KBKA 4KIPA 4C61A 2OKRA 4K11A 3F66A 4D1SA 3MA3A 4ZJJA 4XG8A 3KULA 4MNEA 4DTKA 4MXZA 2WMUA 4O7NA 3Q6WA 2GQRA 5KMMA 3PYYA 5DA3A 5GZ8A 4H39A 4MKCA 1O6KA 4BCMA 3QQLA 4BDFA 3SGCA 3OCTA 4GG5A 4ZJIA 4TYGA 2UV2A 5EKOA 4GVJA 4TTHB 1UU3A 1WBSA 1YWNA 4BHNA 5HIEA 5CANA 4ZTQA 3RBWA 4FV8A 4G5JA 2XB7A 3MH2A 2W0JA 3D4QA 3DV3A 4KBCA 4M68A 2X9EA 4F7LA 4O82A 3MH3A 2VWIA 3ORNA 3MY1A 3VQUA 3G15A 1XH6A 3BIZA 3L8XA 3OZ6A 3FZRA 2RG5A 4XLIA 5EKNA 4NCTC 5L4QA 5IQDA 4NUSA 4U81A 3R0TA 4O0TA 1JKTA 1Q8WA 3A8XA 4EOQA 5DMZA 3QUDA 1KE9A 4QP6A 3VBQA 4IC8A 5HHWA 3W18A 3D0EA 3VBTA 5IH4A 4J71A 3U55A 3UQGA 3EQIA 3NNWA 4D28A 4NL0A 3LOKA 3I0OA 3WYXA 2RFSA 1LP4A 4CQEA 4MYGA 1K3AA 4L00A 2WQEA 5KMJA 4E4LA 4Y8DA 4YHJA 3T3VA 4WUAA 4AGDA 2ZVAA 2YWVA 5T68A 3PXZA 4FYNA 4IX6A 3DB6A 4PQNA 4CFWA 5KMIA 1VYWA 2C6KA 3REPA 2IPXA 2QHNA 4AFEA 3PWDA 2Y8OA 1KV2A 5KBRA 4AXAA 2F2CB 2UZOA 5DPVA 2IW6A 3ULIA 4C7TA 3NUPA 4FA2A 4K77A 5CWZA 5GJGA 3PXRA 5EQPA 3DK3A 4EH8A 4EOMA 3LFEA 4D2TA 4G31A 4CFVA 4F6WA 3V5TA 4FTNA 4O81A 4QYHA 2P2IA 2G01A 3GU5A 3PRIA 3Q5ZA 4DFXE 3K5UA 5AWMA 4BDJA 2W1IA 4NFNA 4QMYA 4OTGA 3CD3A 4J97A 4QMUA 2PVJA 3LM5A 2W5BA 2X7OA 1Q5KA 2PSQA 4RIOA 2XM8A 3E92A 4FIHA 3TUDA 3C13A 3FZTA 3BWJA 3HL7A 4FF8A 3VRYA 3NRMA 4MD9E 1BI7A 2C1AA 4BYIA 5GINE 3F9NA 2HELA 5HTCA 2B9HA 2HENA 3FZ1A 5AV1A 3A60A 2C68A 4EUUA 3ORIA 4WA9A 4IX5A 4QMOA 4DH3A 5HO6A 2XIRA 4FTQA 5CXZA 4NM7A 5C4KA 3TIZA 5BVEA 4AQCA 4KSPA 4ZSEA 2VTTA 2VNWA 3K3IA 4IAKA 5L2SA 3POZA 4LV5A 5AM6A 5BMMA 4D2VA 3QQKA 4YC3A 1YHSA 5AA8A 4QMQA 3OOMA 2BIYA 2C6TA 2V55A 2W1DA 4J98A 4EOIA 4N57A 3Q4ZA 4RQVA 5FGKA 1U5RA 5EW8A 1ZYDA 3Q60A 3DS6A 2E2BA 4M13A 4QQJA 4RWLA 3QALE 5C8KA 3MVLA 4QMPA 4XP0A 3UO5A 2ZMCA 3AMYA 3Q5IA 1OUKA 5JSMA 4IZ5A 2UZEA 2BUJA 3HVCA 4UYAA 3GCPA 3LQ3A 2R0IA 2BZIB 3RI1A 3D2IA 4YJNA 5AP2A 5M4FA 2R3IA 1XWSA 2ONLA 3I4BA 4FKPA 5ANOA 3O8PA 1H07A 4ZTMA 5A4QA 5HKMA 3VS7A 3GENA 4L42A 4UMTA 4DFUA 2EWAA 3VQHA 3ENHA 4EBWA 1MQBA 1H00A 3GNIB 3ORXA 3QYZA 4ZSAA 3JPVA 3FLYA 3GU8A 5CSHA 3RNYA 2PYWA 4Q9ZA 3ZZEA 3QYWA 4D0XA 4OT5A 5HNBA 4FZFB 3D7ZA 5C26A 5BNJA 1PJKA 4QTEA 2PUUA 5BQ0A 5EI8A 3JYAA 5L6PA 3UOKA 5AP3A 1XHAA 2YJRA 2FYSA 3MPTA 4QNAA 4FE2A 4FNWA 1PMNA 1H1SA 2Y4PA 5KMLA 4HZRA 2UW8A 3LFSA 3II5A 3SDJA 1TKIA 1X8BA 3PG3A 3QC4A 5FXSA 4JX3A 4E6QA 3FE3A 5CSXA 5HD7A 3BQRA 1ATPE 3UQFA 2HIWA 4LRMA 5I5ZA 4APCA 4FOBA 1LR4A 3BE2A 1U46A 3HNGA 2ZYBA 2J0MB 4FTMA 2PE0A 4NTTA 2YN8A 4BCNA 5AJQA 2B53A 4QMXA 2OJFE 2AC5A 4BIDA 4HOKA 1Y57A 2VRXA 5DR9A 4DH5A 4MAOA 4WOVA 1FMKA 3S95A 4F63A 4OGRA 3KU2A 2G1TA 2O64A 5LCJA 3TT0A 3PDTA 3A99A 3GC0A 4AP7A 4G1WA 3NW6A 4XBRA 4ZLOA 1A06A 3LXLA 4JLCA 3RK9A 3EQRA 4FSUA 1OL2A 4OBQA 3DTCA 3FHIA 3NUNA 2YISA 2C6EA 2QCSA 2R64A 4FV9A 5CALA 4L44A 2WTDA 4JRVA 3QXPA 3MY0A 2ITQA 3NMUF 4FEUA 4RQKA 4EONA 3BYUA 3LZBA 3QRIA 2IO6A 5JFVA 3HRFA 4HGEA 3TZ8A 4F1TA 5DYJA 5DE2A 2WHBA 2YCSA 1APME 3HUCA 4BWKA 3UVPA 4GKHA 3UZRA 3QQFA 4FIFA 3ORMA 3OOGA 4CCBA 4YZMA 1H4LA 5FBOA 4HYHA 5IA3A 5K4IA 4U8ZA 2B0QA 1YDSE 3H9RA 4EH4A 2ZOQA 4W8DA 4RJ3A 4BHZA 2FVDA 3LCOA 4AGUA 4I0TA 4PP7A 4P4CA 3ZLWA 5DRBA 2H9VA 3PPKA 5HLNA 4JVGA 1H1WA 4D5HA 4K6ZA 3R8UA 4ZJVA 5AAGA 4YHTA 4DCEA 4UEUA 2X6DA 2X4ZA 1XKKA 4MVFA 4X2JA 4UMQA 3DBDA 3Q9XA 3R1SA 2QR8A 4G3CA 4BCJA 2BRMA 3ELJA 2Z8CA 2O63A 3D9VA 2R2PA 1JVPP 4AOIA 1OECA 4ALWA 2ZM3A 2IVVA 2VTAA 5J9YA 4RZWA 4UX9A 2QOBA 3OY3A 4FTLA 4AFJA 5DBXA 3O17A 3JY0A 3P0MA 4DFZE 4Y95A 1CMKE 2UVYA 5B7VA 3M1SA 4KWPA 2Q83A 4QMMA 3RINA 3F3WA 3R8ZA 4GU9A 3OCBA 2JKQA 3MFSA 5TOZA 2F9GA 3ZM9A 1PXOA 4MHAA 4DEGA 5CEIA 2VGPA 3WARA 2PVYA 1U4DA 3AT3A 3HECA 4I92A 4IVAA 2BAQA 4W4VA 3BHTA 2E9UA 5HNIX 3NAXA 4RMZA 2UW5A 3DQWA 4FV6A 4GV1A 5EG3A 1YI3A 4FG8A 4AN2A 3R8VA 1Q8YA 4L68A
chains in the Genus database with same CATH superfamily
3UDBA 3VHKA 2F4JA 4IMYA 4RA4A 4BBMA 4DCAA 2VD5A 2PU8A 1OMWA 3PTGA 3FKLA 3W1FA 2C5YA 3E5AA 4BDIA 3ZUTA 1PF8A 2Z2WA 2XK6A 4O21A 1AGWA 2UVXA 3C0GA 3KXMA 4NKSA 3D5WA 4IH8A 4PL3A 4JQEA 4WO5A 3PZHA 2Z7QA 4UXLA 2VTMA 5AV3A 4IC7A 3FC2A 2W99B 4MCVA 4C62A 1XR1A 3DBEA 5IH5A 3I81A 3DPKA 3R01A 1H27A 2YITA 3BU6A 3IPHA 3Q4UA 4M97A 4P2KA 3DZOA 2GHLA 3IOPA 4EWHA 3KB7A 4O0YA 4OTWA 4EK6A 3VUTA 3NNVA 3OWKA 5E8ZA 4BDBA 3QRKA 4ACMA 4DG3E 2BZKB 5HBHA 4O4BB 3FEGA 2Y6OA 3AMBA 1G8JA 4FSWA 4U5JA 5KUPA 1MP8A 1KE5A 4D4YA 1KE7A 4J1RA 5CSWA 4YJTA 4GK4A 2Q0NA 4RVMA 3FUPA 1HCKA 1R78A 4NM3A 5AP7A 3ZRKA 3LFFA 4PRJA 4YPSA 1NW1A 3PLAE 3R71A 4WD5A 5BVDA 2YIXA 2R3PA 4QMNA 3EQFA 5IDPA 4IJ9A 4FTRA 4FSMA 3IECA 4QTAA 1JWHA 2XRWA 5CSVA 5JMSA 3AC3A 4O6EA 3E93A 2OH0E 4K1BA 1NVRA 4GUEA 3RAKA 3VNTA 5I9XA 5DWRA 1O9UA 4GEOA 2VWBA 3VS3A 4EHZA 3UIUA 4F7JA 2XNOA 4V05A 1XMLA 2W05A 4IFGA 1OKWA 4AE6A 2R3HA 3OEFX 4AGCA 2RF9A 4G6OA 5KX8A 3M42A 1Q61A 3IW7A 3R28A 2YDJA 4FG7A 3U6IA 2JBOA 2R3JA 3R6XA 5K3YA 2QURA 3I6WA 5L8JA 4NCTA 3PJCA 3IK3A 4YGAA 4Z16A 2DYLA 2WMWA 3QWKA 4EEVA 4RZVA 4YTHA 1KV1A 3ZC5A 2VWZA 4C2WA 5JFXA 4LQMA 4R78A 2JDSA 4CD0A 3FSFA 4QP7A 3ETAA 3P9JA 2QC6A 1Q8UA 3LFBA 5I9ZA 1UA2A 1ZOEA 1OPLA 3FMHA 3KRJA 4O22A 2UZTA 3VF8A 4EKKA 3KMUA 4O7LA 2P33A 3WZKA 3F5UA 4MD7E 5A4TA 2R4BA 3H9FA 2G2IA 4HYIA 4YTCA 2WZJA 3NX8A 5CNNA 4ZOGA 2R3QA 1BX6A 1H26A 4M12A 4B4LA 2OO8X 3OXTA 2NPQA 2OF2A 5DGZA 5E8UA 5D41A 2CGUA 3RPVA 2CKEA 3RJCA 3ZM4A 1JKKA 3OBGA 3RMFA 3RP9A 3S2PA 3AQVA 3QL8A 5IQBA 1KUTA 3LCDA 4BL1A 3E62A 3GCSA 3GCUA 4GKIA 2XCHA 3SVVA 2XCKA 2ZV7A 4JS8A 4QPMA 4RIXA 5T3QA 3WYYA 4ENXA 3DXPA 4NYEA 4BWXA 4EHEA 5K0KA 5M09A 3RGFA 3ZC6A 2E9NA 4OUCA 4FZDB 3ZO1A 3VVHA 3FI8A 3W0SA 5EYMA 4EOJA 4QMVA 3BEGA 5CVHA 4ACDA 3P08A 4TL0A 5FUTA 2BZHB 2OJIA 4FV5A 4NIFB 4E1ZA 3ALNA 5IA0A 4DDGA 2W5AA 4I5CA 3EYHA 4QYFA 3TL8A 3VS6A 2EXEA 2UZNA 4XCUA 5HI2A 2LGCA 3HP5A 5IEVA 4C34A 1U5QA 4FKGA 4FEQA 3R7GA 1P4OA 5F20A 3UNZA 3CBLA 3GU4A 3AOXA 3CPCA 4U3YA 1WFCA 3UJGA 4IM2A 2BFYA 3OF0A 2B52A 2OIBA 3L9NA 4HCUA 5GIPE 4V0GB 5AIKA 3UC4A 3C4ZA 3PWYA 4BY9E 2R0UA 4YJUA 4ZTNA 3QZGA 5FQDC 4YTIA 2PMLX 5AV4A 3OG7A 2RFDA 2CCHA 3DDQA 3PFYA 2PVRA 2WMAA 3R7UA 5BUIA 2G2FA 3SG9A 4K33A 2UZWE 3OHTA 2ONLC 1V0OA 2OG8A 5EOLA 2VWYA 1QPEA 3VIDA 4DEDA 4F6UA 1T46A 3UYSA 5KCVA 3IW5A 4D58A 4JT3A 3E87A 3KVWA 3NW5A 4ALUA 2YFXA 5BVFA 5CF8A 3QGYA 4Z9LA 4JXFA 5AR8A 5CSPA 3QQHA 5AUVA 4HCVA 3W2QA 4OTDA 4A9YA 1YXSA 3V5LA 3JR1A 4MTAA 3MJ2A 5I3OA 4O0SA 3NYOA 3AC2A 1CM8A 4YLJA 5J95A 2OH4A 4IJPA 1STCE 1LEWA 3AT2A 3MYGA 3LFAA 4F0IA 5ACBC 5EH0A 3SHEA 3ZBXA 5FRIA 5IISA 1YDRE 4C02A 2V62A 4BKZA 2UW7A 3B8QA 3DLZA 5BX0A 3DBFA 4O1OA 2GHMA 5HG7A 3A4PA 3SW7A 3SOAA 1JSTA 4YZ9A 2C3JA 4RJ4A 2X7FA 5J5SA 3FC1X 1FGIA 1FVTA 2IVTA 2ERKA 5DT3A 4DTAA 5E8TA 4ANQA 2QOLA 3TNIA 3EH9A 4DHJA 5HX8A 2HXQA 3HEGA 2KULA 3P23A 5FTGA 5JRQA 2RFNA 4AS0A 1W2FA 5AUUA 5M44A 5E1SA 2JC6A 4LOPA 4F9CA 1V0BA 4IDTA 5CVGA 4EOSA 2Z7SA 3U9CA 4QRCA 3W8QA 3UDZA 1OI9A 3HLLA 2QONA 4U7ZA 4C57A 3D7TB 4J53A 4BIEA 4ITHA 1KOAA 2UW4A 3FI2A 4PTGA 4MUQA 4QEBA 2R3RA 4J96A 4GT3A 1JSUA 3K2LA 3OCGA 4BRXA 2C5XA 2R5TA 4X6RA 4GW8A 4TXCA 5A4CA 2OFVA 2VUWA 4LL0A 2W1CA 4NEUA 3C5IA 3DJ7A 1REKA 3TDVA 2UZVA 1M2RA 2XP2A 5JRSA 3SQQA 4AW5A 4QQTA 1CTPE 4M66A 4QP1A 3DBCA 5C03A 4AZVA 4KB8A 1JOWB 3QD0A 4S30A 3GI3A 2YDKA 3BELA 5ANJA 3RHKA 2J6MA 3PUPA 5LJJA 1DM2A 1NVQA 1P14A 1WBWA 2PZ5A 2W4KA 3KCKA 3KF4A 4JIKA 3IDPA 4EYJA 4DYMA 2WTWA 3KN6A 4U6RA 5HCXA 5LWMA 3VBVA 2BRHA 2R3LA 2BRNA 3GFEA 4FT0A 2PVLA 3IDBA 4I93A 4MXYA 3PJ2A 2GFSA 4LGDA 3VF9A 5DFPA 2X7GA 4FL1A 5HICA 4LGGA 3MBLA 2OJGA 2WTJA 4LYNA 4DH7A 1ZARA 2YM8A 3D14A 1G8AA 1NT2A 4FTOA 4XP2A 2GNHA 1OL6A 4IZAA 3CKWA 5AFVA 4AN9A 3BPRA 3FPMA 4BWPA 3O7LD 5HO8A 5I9UA 3QAME 4AZEA 3DGKA 4PV0A 4O38A 2ACXA 2FSMX 1XJDA 3NNUA 3PSBA 5BMSA 4C33A 4O86A 1W2DA 1J1CA 3VBYA 3I7BA 4FICA 4CTCA 4NTSA 3W2RA 4L53A 4QP9A 4KUJA 5A54A 1GZOA 2R3MA 1MRUA 3OT3A 4JDHA 2JEDA 3RCDA 3ZXTA 4EC9A 5IMEA 4M7IA 2NYAA 2XF0A 4IX4A 3RHXA 4E7WA 5KZ0A 4R77A 2IZRA 3RZFA 3N4UA 4IANA 3L1SA 3AD6A 3BHUA 4ZTHA 3VO3A 4O7RA 3PG1A 3TACA 2QNJA 3CXWA 1FVRA 4RFYA 1ERKA 4QTCA 2W7XA 2YCQA 4L3LA 5BVNA 5BYLA 3TDWA 4G16A 5LQFA 4I0RA 2NNWB 3ZOSA 3A62A 4TNDA 4AXCA 3LHJA 3VRZA 4CZYB 4DITA 4WBOA 2BZJA 4W4WA 4HVSA 4MNEB 3VS4A 2WEVA 4CYJA 2OSCA 5EI2A 3V8TA 1Q3DA 4FVPA 4A7CA 4G9CA 1WVXA 3LIJA 2WQNA 2HY81 4KIQA 3ROYA 4D4RA 3SA0A 2XARA 4GCJA 2C3KA 4F09A 5IKWA 5ETIA 3GP0A 3DKFA 3MW1A 4F6SA 3FXZA 3G33A 4NM0A 2W1GA 5CTPA 2UZLA 2JFMA 2I0VA 2VU3A 3HDNA 1GOLA 2XIKA 4JBPA 4AA0A 3E8EA 3ORKA 2J50A 2R3OA 2WMSA 3RNIA 3OROA 1REJA 3G0EA 4QDVA 2C6OA 2GCDA 2XVDA 4H36A 3ZO4A 3EQDA 1LUFA 5ANGA 4B8LA 2YLEA 4I20A 2VX3A 2NRYA 3TTIA 4LOOA 5JFSA 4C38A 5EDQA 4WNOA 2BKZA 3P78A 4BTKA 2IF8A 2OFUA 1ST0A 4DE4A 1IA8A 3HV4A 4RC4A 4FL3A 2X0OA 4QYGA 1DAWA 3BQCA 2IN6A 5TF9A 2V0DA 4O7ZA 5F94A 4HVIA 3FHRA 4X7QA 3ZSIA 4YZCA 5I9WA 1RE8A 2QOIA 2C3IB 5EW9A 4IAYA 3PSDA 3OD6X 3MESA 2BAKA 2PTKA 3R9OA 5IQAA 4HVGA 4IWQA 3EMGA 4AX8A 2OI4X 3GQLA 5L2QA 2VWUA 2RSVA 3F2NA 3MTFA 4I4FA 3IKAA 4M69A 3RWQA 4JR3A 1ZY5A 3EZRA 3NUSA 3LJ0A 5DH3A 4PPAA 3T9TA 5M08A 1G8KA 1PMUA 2IZTA 5IZFA 4YJPA 3R7IA 2IZSA 2VWWA 4JMQA 4IX3A 4RFMA 1FPUA 3QD4A 4MF0A 5A14A 4UALA 4KBAA 4EH9A 2WMBA 5CQUA 3A7FA 3R02A 2YAKA 2EUFB 4M3QA 4USDA 4GT4A 5FM3A 3Q4TA 5M4CA 4QP3A 3PA5A 3DT1A 3CQWA 4BICA 4C0TA 3NVKI 3I6UA 3MA6A 4EWQA 4H58A 4D2RA 1SVHA 4D9TA 4TWPA 5ETCA 3G6HA 4F65A 3PY3A 4IDVA 2PY3A 4WHZA 4U9AA 3UE4A 5IMXA 3UBDA 2RG6A 1H24A 3HV6A 2W4OA 3UVRA 4RX5A 3SXRA 2QO7A 2SRCA 1YWRA 5IA5A 3ZBFA 3QKKA 2JDOA 3CQUA 2GNJA 3ANQA 3GOKA 4S34A 4AF3A 4D9UA 5FP6A 4O4CA 5EI6A 5KE0A 3BYMA 3WE8A 3TNHA 3HMMA 4JL9A 3RPYA 4FSZA 4NH1A 5HE0A 1W8CA 3VULA 3LJ1A 4B8MA 2EXCX 3ZEWA 4C58A 2YCRA 3PA3A 4RIWA 1J7UA 2ZV8A 3ALOA 1H0VA 4ONAA 4XLVA 4QP8A 3AGLA 3WZDA 3DFCB 4JNWA 4GL9A 3RAIA 3ZXZA 3PSCA 4FKJA 1XQZA 4ALVA 1CKJA 4PMSA 4IVDA 2NP8A 3GB2A 1R1WA 2YAAA 5C9CA 4MD8E 3E3BX 2WPAA 4DEAA 2G9XA 4D1ZA 5J1VA 2XAOA 4AA4A 4CNHA 3BHHA 1UKHA 3FL5A 4Y5HA 4UMUA 3A4OX 3PVGA 3QBNA 4JDKA 2VTPA 3UTOA 4DN5A 4L7SA 2JAMA 3MFRA 4RJ7A 4X2GA 3TKHA 3JS2A 2OIQA 3UP2A 5HG5A 5ANKA 1OKVA 3BLQA 3WF8A 4BZDA 3S0OA 2IWIA 2JAVA 3CD8A 5JQ5A 1ST4A 4B9DA 5ACKA 1DI9A 2VTQA 2BTRA 4XV3A 5BUJA 3HYHA 3KA0A 1JKLA 3P86A 2FSLX 2PVHA 4FKWA 5AP6A 3ORPA 1RW8A 3LPBA 3DJ5A 3HRBA 2XA4A 4MH7A 3VS5A 4OBOA 4Z55A 4R5YA 3W0QA 5CF6A 2XNGA 3NUYA 4FT9A 3TZ7A 2IVSA 4ZZMA 4ANBA 4TN6A 4XRJA 2J0IA 4EKLA 4E3CA 4YJRA 4PMMA 4TYHB 1SMHA 2XRUA 1PYEA 4QPSA 3FZPA 3MPAA 5AR7A 5J1WA 5T6KA 1H1PA 1Q41A 5E8WA 4O0RA 3W0PA 2CLQA 3BL9A 2BIKB 3GOPA 3UP7A 2CGXA 3LAUA 3MVJA 5CAVA 1OL7A 5J87A 3R7VA 2BKKA 2W9ZB 4QNYA 3LE6A 4EI4A 2ITXA 4EK8A 5KKRC 1H8FA 5L3AA 4DAWA 3LKMA 5DLSA 3GC8A 3R7YA 4KABA 4C4FA 1R3CA 3A7JA 3BZ3A 3F6XA 4RA5A 4F70A 2V7AA 4K0YA 3CIKA 3PXQA 2XBJA 3BHYA 3Q3BA 4J95A 4LI5A 4HVDA 3DA6A 3HMNA 2QOOA 3BU5A 4ERWA 1PY5A 1SZMA 1U59A 1PKDA 4L52A 3O51A 4EOOA 2VWVA 4ZY4A 4FKQA 2X2MA 4HNIA 3KF7A 3AKKA 4CXAA 2IVUA 2JFLA 3E8NA 4NKAA 3ZFYA 5C27A 1CKIA 4ZSGA 2EU9A 3QTSA 4UMRA 4BGQA 2W1ZA 1ZZLA 3QTWA 2C6LA 4YURA 4E4MA 2CKOA 3H10A 2DQ7X 1F0QA 4MX9A 3SC1A 4QP4A 2JKMA 4UN0C 1W83A 4WRSA 5LVNA 2EXMA 1OUYA 3K54A 2FA2A 3MB6A 3P7BA 3PIZA 5CEOA 4JR7A 4JDIA 1NY3A 3S4QA 4USFA 1Q99A 3O96A 4MK0A 2QO2A 4M69B 5LARA 2PMOX 4TW9A 4OAVB 4Y72A 2UUEA 1HCLA 3TKIA 4CMUA 5L8LA 3BYSA 2BR1A 3E8CA 4C4GA 3COHA 5LWNA 3LFQA 4G34A 1YOJA 1PKGA 3LQ8A 3CTHA 4S32A 5M07A 3CGOA 3QRUA 5AR3A 2OXDA 2VN9A 1URWA 3PXFA 3OWLA 3FQEA 5E8VA 4PDSA 3CJGA 4G3EA 2WTVA 3W32A 3GFWA 4R7HA 2J0LA 3GU7A 2HZ4A 3LW0A 3MVMA 4R3CA 3QRJA 4TT7A 4XG6A 5HCZA 3UGCA 2HWPA 3OWJA 2C6MA 5BYZA 4XNEA 3HAMA 2O3PA 2YWPA 5FBNC 4BI0A 4KNBA 4APPA 1XH8A 3ZRLA 2VO6A 2X0PA 3WI6A 5HQ0A 2WFYA 3AD5A 5EOBA 1W0XC 2OLCA 3OXZA 5AAEA 3G90X 4I21A 4TKSA 4Y5QA 2WOUA 3SV0A 3VUIA 3ZLSA 3BWFA 2YIRA 3BHVA 5GZ9A 4DGLC 3UDSA 3TV7A 3ZS5A 3KRLA 1V1KA 4E5BA 2OW3A 3TEIA 1WZYA 3LFCA 2XNEA 3CPBA 3FLZA 1ZMVA 3OUKA 4W9WA 4DLIA 4HPTE 2BAJA 4IAIA 3D5XA 4O4FA 4PNKA 4RT7A 2YJSA 3DBQA 5D7AA 1LEZA 4BJJA 2WTCA 2BPMA 5CU6A 2RGPA 3H30A 4HJOA 3Q53A 3ZUVA 3ZUUA 2IW9A 2BCJA 1PMEA 2ITOA 3HA8A 4DHFA 4QYYA 5K9IA 2JDRA 4XJ0A 1GIHA 3ZEPA 4FV0A 3WILA 5CEQA 5J7HA 4YPDA 4FV1A 1ZRZA 3VW8A 3FMEA 3VUDA 5IUIA 5L6WL 4C3RA 1QPCA 3BGZA 4BCKA 2J0KA 5CZHA 4YLLA 3FYJX 4UWBA 2PVKA 2ZM1A 3HA6A 1ZYSA 3FL4A 4B99A 4PX6A 4D2SA 4Y46A 4O4EA 3ZU7A 4CMOA 1YDTE 2WQOA 5C8MA 4X3FC 4Z7GA 4I3ZA 4FJVA 2ZV2A 5A4LA 4RIYA 3QA0A 3VS0A 3TNQB 5CXHA 2BHEA 2GNIA 2WQMA 4FMQA 4QP2A 3U6JA 1OB3A 2QU6A 4ANLA 4GIHA 1YOMA 1ZWSA 4LFIA 4FIGA 4FSRA 1OKZA 3TZ9A 5M51A 4DF3A 3C4FA 4JI9A 5CU4A 2W17A 3W16A 4IWPA 1OPKA 5A4EA 3KEXA 1YXUA 2XKCA 2FSOX 5HBJA 4UV0A 3SAYA 3ZSHA 5I9YA 4ENYA 4DA5A 4QO9A 1UWHA 3AKLA 4JQ8A 2C6DA 3S00A 3C0IA 3NIZA 2H6DA 3G51A 1JBPE 4ORKA 2Y9QA 5L6OA 1F5QA 3L9MA 3QTIA 3W10A 2Z7LA 4FBXA 3UNKA 2CPKE 5M57A 5A6OA 3POOA 4RX7A 1JSVA 4U43A 3SW4A 4GYGA 3IW4A 2CNUA 3PRFA 5FD2A 5BVKA 5E9EA 2GS7A 3HX4A 5G6VA 3QCQA 3R1YA 3SG8A 1R39A 4IBMA 3PA4A 4K9YA 5M06A 2J5EA 4E93A 3QHRA 5A9UA 2J7TA 4RC3A 4NT4A 2WGJA 4IWDA 2JIUA 3UYTA 1KWPA 2OBJA 2Y0AA 3U51A 4E4XA 4KD1A 4FL2A 3ZONA 4QT1A 2JBPA 3D2KA 3F5GA 4HPUE 5EK7A 2HW6A 3FZOA 4N4SA 2ETKA 5IF1A 3ERKA 4L3JA 4O4DA 3FLWA 4YP8A 5ITAA 4Z3VA 3NUXA 3MH1A 1Q4LA 2OXXA 1M14A 2OIDA 1SYKA 4I5HA 4XRLA 5A46A 4EH3A 2X2LA 3F61A 4PUZA 5FWKK 2BHHA 5JZNA 4DT8A 2JGZA 4ASXA 1UNHA 2GNGA 2QVSE 4G6LA 1R0PA 3QKLA 1GIIA 5KKRB 4GS6A 2UZUE 1BLXA 5E7RA 3ULZA 4DEBA 3A2CA 3GUBA 2CNQA 2F7EE 4ZTRA 4I6LA 4ZXTA 4RLLA 2RFEA 4AAAA 4CGAA 2Z02A 4NWMA 1VJYA 2YHVA 3D94A 3G9LX 5LCKA 3BCEA 3UZTA 4PPBA 3ZDUA 4B0GA 5G1XA 3E88A 4HVHA 2A27A 2C69A 1OM1A 2GPHA 2UW9A 1GAGA 3D83A 5J9ZA 4YU2A 1VEBA 2C0OA 2JIVA 4FYOA 2PZIA 3R7OA 3THBA 3UVQA 3U9NA 1YW2A 4PDPA 5F9EA 4M0ZA 4HGLA 3R04A 4ANMA 3UZPA 1GZ8A 1G3NA 3ZYAA 3NYXA 1QPDA 3L8PA 4OLIA 5CS6A 5L2WA 1EH4A 2HW7A 4Q2AA 4QMWA 2PE2A 5HLPA 1UNLA 4RVLA 4U40A 2YZAA 2I0YA 3DAJA 4BZNA 3WZUA 1MQ4A 3A61A 4YO6A 4GFOA 3MFUA 3FQSA 4L45A 2ETMA 4WIHA 4JDJA 3C4CA 2Y7JA 4V04A 2YERA 3TKUA 3UODA 4FIEA 3JVSA 2I0HA 4D2WA 5C8NA 5CU0A 1DS5A 2CN8A 4X2FA 1ZOGA 3GC9A 4N0SA 2QOQA 2QLUA 1OBDA 3OW4A 3TIYA 5HIBA 2ITUA 5I0BA 5AUWA 3F2AA 3IO7A 1WBPA 4Z7HA 4FK3A 4NU1A 1RQQA 4R8QA 3C7QA 3FMLA 1YXXA 4BB4A 3G0FA 3N4VA 1U54B 3QTQA 1K2PA 3ODYX 4ZY6A 1YI4A 4FTJA 3KCFA 3OT8A 4N70A 5CQWA 4GJ2A 5HE1A 3W2PA 4YUQA 3OVVA 4ACGA 3QXOA 3WF6A 4BDEA 1VLRA 4ZZNA 4FZ6A 4V0GA 1F3MC 4DFLA 3BYVA 1KE6A 2VX1A 3D5UA 4MBIA 3W0RA 4I23A 4TWCA 4O7VA 2DUVA 4PY1A 2PULA 2H8HA 3I79A 5JFWA 2VTOA 3DB8A 4JX7A 4F0FA 4F99A 4EHGA 3ET7A 4BCOA 2ZMDA 3PPZA 5FDXA 3V51A 3LXNA 3NUAA 5GJFA 5KMOA 1MRYA 3N9XA 4CG9A 3D5VA 5CAQA 5J9LA 2R7IA 5HORA 5KO1A 1M2QA 2R9SA 4YZDA 2O65A 2F57A 5HD4A 3QUEA 4I22A 4UWCA 3UO6A 2XANA 1WBOA 3JY9A 3NS9A 5ICPA 2DS1A 1UU7A 2E9PA 3VS2A 4AW0A 4TYHA 4OTIA 4BZOA 4ZIMA 3CTJA 2XEYA 4G3DA 1W2CA 4S2ZA 2PVMA 3OTVA 5C4LA 1XH7A 3L9LA 1SVEA 4IM3A 3EKNA 3EQGA 1QMZA 3SRVA 2QG7A 4FEWA 4U45A 2YIYA 3FY0A 4IVBA 4XOYA 4F9WA 3ID6C 4FVQA 3LXKA 4JQ7A 2ITVA 4RG0A 4AXFA 3TTJA 4FKIA 2PZRA 2XUUA 3VUGA 4IHPA 4L7FA 4UY9A 4JG8A 5HESA 4RX8A 3MIYA 3O2MA 4X6QC 4K18A 3PZEA 1YKRA 5C01A 4LG4A 2XMYA 2OZAB 3NWWA 1YHWA 4DG2E 3SKCA 4X3JA 3DZQA 1NVSA 4BGGA 2A4LA 5HE3A 4WBBB 3IONA 3FMDA 1FINA 3EIDA 5H2UA 3KULB 4GVAA 5HG9A 3TUBA 4Q5HA 3ATTA 2ITYA 3Q9WA 5JT2A 4ASEA 2B7AA 3H9OA 3DY7A 3MDYA 4UZHA 4EC8A 4TY1A 5A6NA 4ANSA 3A7IA 5DI1A 5A3XA 5LVPA 4PTCA 4PL5A 4I6BA 4DEHA 3EYGA 3IW6A 2O5KA 1T45A 3ZSGA 2BALA 4FV4A 4ZY5A 5E91A 3KXZA 5DN3A 1ZAOA 2QI8A 4I6QA 4CTBA 2WMTA 5BVOA 1OIUA 1JAMA 3VJNA 1DI8A 2QKRA 4E8AA 3LQ5A 3NYNA 4IB1A 3Q9YA 3WF7A 2PUIA 4CT1A 5JK3A 4XH6A 1Y6AA 4JBVA 4M0YA 4BYJA 3HRCA 4D55A 3DAKA 2ZAZA 2PK9A 1Y8GA 1ZYLA 3FZSA 3R9HA 4DEEA 3WOWA 4JIAA 3IS5A 3E3PA 2QLQA 3GXLA 5L2TA 4Y73A 1WMKA 2REIA 4R7IA 1Q62A 3I0QA 1JLUE 4LUDA 2JITA 4NSTA 4NW5A 4BGHA 1UU9A 3KRRA 2X8DA 4IIRA 3W8LA 4HYUA 4I1ZA 1M52A 4Y83A 2WU6A 2J0JA 3DLSA 1FOTA 4DEIA 3VHEA 3DKCA 4OT6A 2JKOA 4E6DA 3NCGA 3HAVA 4O7TA 4FKSA 4E5AX 2YDIA 4LRKA 2QHMA 3JXWA 4UWYA 4O0VA 3WZEA 4XYFA 3ORTA 4RFZA 4CMTA 3QTRA 2UW6A 4NJ3A 3IGOA 5AP5A 5JEBA 1Y8YA 1S9IA 3AC4A 2PL0A 3FLQA 4FGRA 4WG4A 3F5PA 2VWXA 1ZMWA 3C5UA 5AR2A 2ITWA 5JGAA 1Y91A 2B55A 1OPJA 5BPYA 5E4HA 3CTQA 3PIYA 4FT7A 3V3VA 4MBLA 3QLFA 3LCTA 1VR2A 4FK6A 2XK8A 4ZTSA 4E73A 3QFVA 2W1FA 3OWPA 3R63A 2B9JA 4HNFA 3KRWA 1KOBA 3O8TA 4BDCA 2W96B 4BCHA 1UU8A 4H1MA 2CKQA 4CZTA 4USEA 4CKIA 4O7YA 5DRDA 5HX6A 1YWVA 4L01A 2DWBA 4ACHA 3HMPA 2C3LA 2GTNA 4XOZA 4FR4A 4AGWA 4FI1A 2OF4A 5CX9A 3FWQA 3MVHA 5AUXA 5KMKA 4GUBA 5DEYA 4CYIA 4E4NA 4KKEA 5DIAA 3FLNC 1P5EA 1BL6A 3QRTA 1PXPA 2C47A 5H3QA 3MIAA 5HNGA 3FDNA 5CNOA 5KMNA 3PVBA 3CEKA 1B6CB 4UMPA 5IH6A 1XBAA 4IXPA 4J8NA 3BLAA 3QGWA 3FAAA 4AT5A 3O0GA 1MRVA 1Q97A 5FEEA 3GBZA 4AZWA 2VTHA 3U4UA 3QQUA 4XV1A 2CHLA 4QMTA 4X3FA 5GNKA 4BCGA 3BLRA 2R3KA 3AGMA 4I41A 3OXIA 4YSJA 4Q5EA 4FV2A 3VAPA 1YOLA 4FKRA 3W55A 2C5VA 5D7VA 2PWLA 3RM6A 2GSFA 2CKPA 3LMIA 3ORLA 3HMOA 2P55A 2ZB1A 3A7HA 2B54A 1WBVA 4GG7A 3PE2A 2WB8A 4M8TA 4XG9A 3RALA 5EHOA 2Y4IC 2B9IA 4G6NA 1OGUA 1GY3A 3K5VA 5J7BA 3FBVA 3G9NA 4DFBA 3CKXA 4DTBA 4YJOA 2WTIA 3E63A 4TZRA 5LMAA 3KK8A 4AE9A 2FUMA 2C0IA 4C4IA 4EOLA 3QKMA 2ZM4A 5HVKA 4QMSA 4QQ5A 4GK3A 4U80A 3UNJA 4F0GA 5LMKA 4AT4A 2HAKA 5CU2A 5IQEA 3PP1A 4XMOA 2OZAA 2XNPA 3CLYA 4JAJA 5H8GA 3TNWA 3V5PA 2Z60A 1OIYA 5GHVA 2W06A 5HZNA 4DGGA 3NYVA 3C51A 3L9PA 3FMNA 2QG5A 5LMBA 4DHIB 2Y4IB 4PNIA 4EJNA 5GZAA 3F2RA 4GIIA 4CFFA 3LFDA 3P5KA 3BRBA 2C4GA 4M14A 4EBVA 4XBUA 2RL5A 4P7EA 3VWAA 3HV3A 3EOCA 4FC0A 4KS7A 3VW6A 5AV2A 4EUTA 3OBJA 3Q96A 2GQGA 5D10A 3M11A 5CVFA 5FXQA 5J8IA 1TVOA 2C1BA 2QOKA 3G2FA 1YXVA 5EYKA 4D2PA 2GNFA 4FX3A 5TKDA 4KRDA 2OGVA</