3KBEA

Metal-free c. elegans cu,zn superoxide dismutase
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
157
structure length
140
Chain Sequence
b'SNRAVAVLRGETVTGTIWITQKSENDQAVIEGEIKGLTPGLHGFHVHQYGDSTNGCISAGPHFNPFGKTHGGPKSEIRHVGDLGNVEAGADGVAKIKLTDTLVTLYGPNTVVGRSMVVHAGTGNAGARAACGVIALAAPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
molecule tags Oxidoreductase
source organism Caenorhabditis elegans
publication title X-ray Crystal Structure of C. elegans Cu,Zn Superoxide Dismutase
rcsb
total genus 33
structure length 140
sequence length 157
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3kbeA00
1UXLA 1EQWA 2ZKWA 1HL4A 2Z7YA 2E47A 2K4WA 2VR7A 2Z7WA 1HL5A 2WKOF 5CU9A 3PU7A 2E46A 1SOSA 3MNDA 1IB5A 1YAIA 1OZTG 3LTVA 1OZUA 4OJAA 1TO5A 1BA9A 2WWNA 2C9UA 3HFFA 4MCMA 4B3EA 5KBMA 1E9PA 3KM1A 2AF2A 3ECVA 1SXBA 4OH2A 1N18A 1IBDA 1PTZA 1E9PB 4MCNA 3CQPA 4BD4A 2NNXA 1QUPA 1SXZA 2R27A 1EJ8A 3GZQA 3SODB 4A7TA 1IBBA 3F7KA 2AQTA 1RK7A 1DO5A 2AQNA 2C9SA 2WZ5A 2AQSA 3ECWA 2ZKYA 3F7LA 3HOGA 3RE0A 1OALA 4A7GF 1SXSA 1SXNA 2VR8A 1F1DA 3S0PA 4BCZA 1E9QB 1E9QA 1YSOA 3L9EA 5KBLA 3ECUA 1B4LA 1E9OA 3GQFA 4BCYA 2VR6A 2XJKA 1JK9A 1YAZA 1UXMA 3QQDA 1OAJA 1SPDA 1F1AA 2Q2LA 1CB4A 1U3NA 1JCVA 3GZPA 1N19A 3H2PA 3KBFA 2WYTA 2ZKXA 1L3NA 2GBTA 2ZOWA 1SRDA 1IBFA 3KH4A 1B4TA 1CBJA 1E9OB 3GTVA 1Z9NA 1FUNA 4N3UA 3T5WA 1XTLA 3H2QA 2GBUA 3GZOA 1TO4A 2AQPA 1Z9PA 3K91A 1SDYA 2AEOA 1PZSA 3GTTA 2JLPA 3CE1A 1F18A 1BZOA 4FF9A 1F1GA 1SXCA 2WYZA 3CQQA 3KM2A 1PU0A 2WZ6A 4N3TA 2V0AA 1KMGA 3QQDB 2LU5A 5KBKA 1JK9B 2WWOA 1S4IA 3KBEA 1SDAB 2AQQA 2JCWA 2C9VA 1SXAA 2AQRA 4A7GA 1DSWA 1XTMA 1P1VA 4A7SA 1OEZW 4L05A 2GBVA 1XSOA 1COBA 1MFMA 1Q0EA 2WKOA 3KH3A 2Z7ZA 4A7UA 4A7QA 2Z7UA 2WZ0A 2XJLA 2APSA 1ESOA 2SODB 4A7VA 3L9YA 4U4IA 1AZVA 3MKGA 1IBHA 3HW7A
chains in the Genus database with same CATH superfamily
4DKAA 4NYLA 1OAZL 3D0LA 2YC1B 4KHXL 2YPLD 3IMBA 1JZFA 3PAUA 2LAAA 4MMXC 5LQBH 1I1AD 2WIIB 3RX7A 3C08L 2VE6A 3U6XA 5EOTA 4M7JL 2DYPD 3MLZL 3K2MC 1AXIB 32C2B 3HC0A 1MHHA 5HGBA 3D50A 3E1F1 3TT1L 3TZVB 2NY4D 5DD1H 4PJHF 4JAMA 4WY7H 2VLRE 5L2KA 2J6EA 1NGYB 2P1YA 3STLA 5FO9B 1QG3A 1Q9KA 2ZSWB 4JFQB 1MI5B 4JFUA 4O58H 4XWOD 4Y88A 3VSTA 2EYTA 3VUAA 5JW4N 2ADFH 3QI9A 1SMOA 3UTSD 2FD6H 1VB9A 3R0MA 2WBJD 2TAAA 1JTOA 1D5MA 1I85A 4V1DE 3DX0A 1CZ8H 2BP5M 3GMNA 3GSWB 3TOPA 1E2WA 2F19L 5I73B 3DHMA 4PSRA 1A7RL 1LYQA 1OO2A 4TMPA 1G9MC 3RQ3A 5KYWB 4UV4H 5AVWB 5AW9B 2NX5E 4G71B 4DKEL 4F80A 1YC8A 2WVTA 2I07B 2A6IB 2HFFB 3CXHK 1QUNA 3I84A 4L48A 4N87A 4HF5L 1W8OA 4MCYB 1MCHA 4P2CG 2LTQB 5F9OL 3DX8A 4MJIB 2QVFB 3G6AB 3ILQC 4UDTB 2Y6TE 4L8DB 5ACMA 1NOLA 2OMWB 4FEIA 4OZFH 5DJ6B 1WZ1H 3S36L 1DBKL 3EOBA 2YMXL 4G7RB 1I82A 4WI7A 2BDNL 3MRNB 3P30H 4JFXB 5DWUL 4N6QA 4ODHH 3SEPA 5I1HL 5FHBL 2CKBL 3FUNA 4FC3E 2J73A 3V7MA 4Z23A 2VXQL 4JFYA 3PJSA 2FX8L 1L9QA 2WLKA 2Z0UA 2Z34A 3IJEA 2XRAH 4TTDD 4BH8B 2APTA 3BKMH 3RAJH 4TULL 1WFMA 1ZANH 1Z9SA 3CFEA 3LPFA 3MLXH 3PGCB 4MJID 4NRZA 2Y1AA 5EZIH 4IBQA 1QHOA 1PNDA 3MJ7B 4G6FB 4U1SB 5IIEA 3BLBA 4HS8L 2CUMA 2OK0L 1PEWA 1U8PB 1M6OA 1A6ZA 3RZCC 3SPIA 2DQGL 1CC3A 3HE7C 1K72A 3H9SE 4WKXA 4QTHA 1I8IB 2BNQE 1UD2A 3H8NA 4FQHA 3HJ0A 4Z7WE 1DDHB 3WN5B 5I0VA 3T65A 3TZVC 1YC7A 2LLGA 1XSJA 2YWZA 4EUPA 1VEMA 4B7IA 5BRQA 3TT3H 2XNAB 2CJSA 4UT9A 1N6QH 5J89A 3L9YA 4WUKL 1XCTA 2V2WA 4NHUB 5JHDE 2WMPA 3B9KC 3ME0A 1OP9A 1JXKA 2J2ZB 3LEXA 4M6OL 1B0IA 1WS7A 4IDLA 2X70A 4R5VA 3RWIB 1YEFH 2WQWA 1DQJA 3WXWL 3E8UL 4I3GA 4FGMA 3KBPA 1ZT4A 1BAFH 4HJJL 1TO5A 2I25N 3EFFB 3D51A 4LQFH 5C70A 2EUWA 5C07E 3CHRA 4LAJH 5AW6B 4ANKA 1KJ3H 3WFDL 4OH2A 5C0EB 2MMXA 5E0FA 1JGIA 3K2KA 4X9FA 5DEGB 1RH8A 1DJHA 3V0DA 4CN1A 1QUPA 4F8PA 3BUDA 3U0TA 1VEPA 1DLHA 2QKIA 4O51B 3C5ZB 3BSGA 1WBYB 1EIBA 2WAQA 4RNRA 4DKDC 4LKCA 4U6YA 5A2AA 5JHDD 5JNYA 5DD6A 2R2CA 4NQDB 2FB4L 2XWJB 5F0JB 3QWOA 3O11A 4R0LA 2NUPB 3OXSA 1E5YA 1ITBB 2W9DL 4PCSA 5DJAA 3CU7A 1MFCL 1J9QA 1G6VK 1U8MB 1LGVA 5C0AE 3WI9A 4WHTA 2OMYA 4ANVA 1IFGA 2JKSA 5L8JB 5C0BB 1IGYB 1TQSA 4MQTB 3RVXD 3GSOA 1IGIH 3AT0A 1NAML 1DFBH 1VFAA 3GT6A 4O02L 2YKKA 1EUTA 1OAQH 3L54A 4LPUA 3ABKB 3MYZA 4AZUA 2YSTA 2H6UA 2CLRA 3TNNA 4L8CB 3SOTA 1P84K 2G5RA 4J27A 1XF4A 3AMLA 5TQ2H 3S3BB 3INUH 1FNGA 3BUYA 3ETSA 3JWNE 3PE9A 5FLUA 4LZKA 1U0QA 2JSFA 3BGAA 4G5ZL 4MJ4A 2PPCA 5JNYB 3EO9H 4JFOB 2OZNA 3MNZA 1O9WA 5ADOH 4X4XA 5EU6E 3QUZB 3P4NA 4YXHL 2PLTA 4KK8C 4G8GA 1XWVA 4M9OA 2K7QA 3X13A 1MPAH 5I16B 4ZUSA 2CU9A 3MRRA 4P2OD 2JKLA 1R46A 1YJDL 3V95A 2HT4D 1BQ5A 1GAFL 1QTPA 4R0LC 4UIKH 3WMQA 4HLJA 4I5BB 5E4IA 5KSAA 2VT0A 3K2UH 4JFSA 3IRCA 4QRQB 43CAB 1IT9H 4A7SA 2QMKA 4CADB 1VADB 4ZMXA 5FW6A 1A0QH 1S7QB 4IRZA 4AQZA 4QGYA 1OF2A 4XVTL 4B5ZA 5A16B 2NNAA 4TTDC 3KLQA 4NQSB 1EJOL 4GI9A 2CQVA 2CA3A 1NGPH 1RJZB 1E43A 2QPDB 3P9LB 1PL3A 4LCIL 1T1ZB 2DWDA 4G1MA 4OLVL 2UUDH 4LIQH 4BDVB 2EDNA 5I66B 2IH3B 1BREA 4HKJB 1ACYH 1AGFB 1F4AA 2H1PH 4JFFD 4JO4H 5DJ2A 4NFCA 3Q05A 4JFVA 4PJFA 4XO3A 1UT9A 3KPOB 4W9CC 5HYQB 4WI8A 1AQDA 4XBMA 1KPVA 4ONFH 5HDBB 4LVNB 1KPUB 5E8DL 4X9IA 4UOZA 3VRJB 1LL1A 3WTWA 4QXVA 1LP9F 2V2TB 4MQ7B 1LQSR 5FS5A 1RJZA 2KYIA 4NQVA 1MEXH 1YZZA 1MFEH 3WCYA 5EBMA 1EEZA 1RZJH 3L3OC 3NFNB 1M7IB 2VRKA 4LCCA 1P1ZA 2VL5A 3D09A 2VABA 4Q0XH 1CFNA 3GIZH 3KR3H 1BF2A 3N40F 2L4OA 4Q7DA 4Z5RA 4B3VA 4LHUD 5IJVA 4JFQA 1OP5K 2DTSA 2ZT9C 1R19A 1R47A 2GK2A 3H4HA 4FQ1L 5J3HD 2Y0SA 5AUMB 2FEDC 1WWCA 5IG7A 2FO4B 4KHTH 2GT9A 2ZOUA 4BZYA 2XA8L 1T0MA 1OAJA 1V54B 1BQHB 3FO1B 3QC5X 3IDXL 2DYRB 3FT1A 2WLIB 1I7RA 1YCSA 4J4PA 2Y2TA 1MWAA 1RZKL 4LSQL 4AIEA 1AI1H 2OTUB 3REVA 4A38A 1A3ZA 3BVXA 1CTOA 5D2NC 1I9IL 4HVBA 4ODBD 5JOPE 1E5AA 4XNXL 1H9VA 2UY6B 5IK3A 3OQRA 3D2UB 1WBYA 4FCHA 2WYIA 4B5EA 1PPIA 4BFKA 5EBWA 3K8MA 5EV7A 3US0A 1YDPA 1Z9PA 2EE3A 3SDAB 2NPLX 5DZPA 2CIKA 4WK0B 3MGOB 3OXRA 5H2BB 3C60B 4MB1A 4FZ8L 4F7EA 2YAPA 2BZ7A 3JT0A 3WSQL 5KYNA 5JDJA 1G1KA 2DQHL 4AL8H 3EYUH 4GY4A 1X7SA 1CR9L 3RKDD 3FUEA 5C07A 2G60H 2QELA 3E2HC 3FMGH 2VERN 2LVCA 3G08B 2XN9B 3SZKC 4IU3A 2YGVA 1WFJA 3UAJA 1MCJA 3AJ7A 1CWVA 1KIRB 4DZBB 3ARBA 3NFSL 3ZTCC 1FH2A 2XNAA 3FQNB 3LH2H 4AJVA 1AANA 4MX7B 4K5MA 2WZ0A 4PGCA 5D4IA 1HEJC 5DURD 3C5ZA 3L3OB 3KDMA 1WK0A 4RSYA 1EO8H 2CWRA 2A9NH 4R83A 4U33A 3GTNA 5T3XD 3HZKA 5L2JB 4K7FA 3C08H 4J8RB 4EIUA 1KULA 4E41B 4XO8A 3U6RB 4URKA 2K3TA 4PCTA 1A66A 3GSXA 4B9ZA 2XPGA 5J6GA 4KTDH 5SWSD 5ICUA 2XG5A 1BXXA 1ZV5A 2BWQA 1ZT4B 4QD2E 2OSLA 5D7EA 2IEPA 1AC0A 1AGCA 1ILSA 4KO6A 1B3IA 5T1KB 4N2FA 4YK4B 3KLKA 3HAEA 2V37A 1PYWB 3MOAL 3NCEB 4CADA 3MLRH 5HHOD 4ERSH 5EDSA 1I1YB 3AZUA 4PJ5B 3IDNA 4JFFB 2A9CA 4P3DB 6FABH 3GSXB 4XZUB 5CSBA 4HWZA 2CNZA 3MA7A 1GW0A 4G59C 5I1EH 2FIKA 4OIBA 2R4SH 4A7GF 2HJFB 2RMNA 4AYGA 5DK0B 5JR1H 2LVEA 2XQBL 4RZKA 1ZA3A 2RBLA 1SHMA 1UGNA 3KVPA 1KXTA 5AAWC 5KYXA 1G9EA 2YA1A 1IV8A 4DOHB 4L4JA 2J1YA 5F9OH 3D08A 3FOLB 2JIXB 3KLAA 4HFUH 3S34L 3IE4A 4OFPA 1A1MB 2YMXH 2QQLL 3BUIA 4DAGH 1KFGA 2O1AA 1UXWA 4O9HH 4Q74A 4NQQA 3LB6D 3UABA 1OL0A 1X5YA 4ZTPH 4R2GD 3WDIA 2BJMH 5I6OA 4E9XA 1H6EA 1MCDA 1VCBC 1WD8A 3P77A 5JMOC 5CEXA 3MV7D 2VGLM 2EKJA 5JQ6L 3X11A 2WXHA 2Z8VC 3QORB 2L7QA 3KEHA 3TC9A 3MLXL 2JI1A 2HWZH 4PRHB 4G6KL 5IMLA 4WQOA 5L88H 2A7BA 4KV5E 1INEL 4M8QB 3O8XA 3QDMD 2D31A 4LDLB 4JGJA 5CN3A 2CBPA 4OZHE 3HHRB 1TLMA 1FGNH 4OI8A 3EH2A 4KI1A 5DZNA 3SZ6A 2IAND 2AJZB 3MLSH 3NZHH 4KZEL 2J1KA 2R0WH 4LKCB 4UBDC 1HCZA 2UXTA 2XUWA 2VZ1A 5DWPA 3FT9A 1N6QL 2ADGA 4DP4X 3U2SB 2F18A 4AGNA 4DN4L 4EZJA 4XBEH 1FJ1B 1X5IA 1HYRC 4KWUA 1JZ7A 2GYSA 4KDTA 3FCTA 3SDCB 5LBVA 3SQOL 3E8UH 4BK5A 2D0HA 4KO9A 3V0GA 8FABA 5I8OL 1WWWX 1QLFB 2NY6D 3PDOA 4F5CA 2Z7YA 3TBTB 2EVIA 2IWEA 5T33L 4PCYA 2FJGB 3HCVA 3RKDC 5J1AA 4DP6X 4N2DA 4N2BA 2BSDA 5CILH 4ONHB 1OSPH 2YXVA 4PJ8D 1XVSA 1KGXA 2X2JA 3QQXA 4KO5A 4M48L 1HILB 1D5ZA 5EULV 2CAKA 5DQDH 3H4FA 4PJHA 1AQDB 3CPLA 3NA9H 1FYTD 1TFHA 3BN9D 4NRYB 4ZMLA 2X4QB 4MA1C 1R24A 1XZ0A 4JDVA 4DUXA 3RRQA 2FB4H 3EW3B 4HUCA 3HZYA 1AQKH 1X7QA 4PGBB 1HQRA 3L5IA 1JRHL 2EYRA 2WQUA 3ATDA 4PY8I 1E8XA 3VD0A 1U91B 5LKNA 5ILTL 4P2RA 3L3KB 2EE0A 3HI5L 4Y4KD 4YDVB 1Q4NX 5IP4A 4E9QA 3BEVB 4JDZB 4LEBA 4YSPA 2NY0C 1A6WL 3IDMB 3SPHA 4L1DA 3ZL1A 1CFVL 4Q9QH 3L2LA 4ZX6A 4FMVA 3SJVE 4WI3A 2DL9A 2BFGA 2W81C 4AYFA 4O02H 5TF1L 4JFXA 1X4ZA 1U3NA 4Q9BA 3UC0L 3S5ZA 1ETA1 1VFUA 2GC7C 3DX1A 1KOAA 3GBMH 4J3OF 1S9YA 2Z0BA 3DETC 5TQ2L 2CK2A 4UQAA 1MI5E 4I1NB 4K5NA 2JTYA 2CO2A 1ET8A 3KPQA 3TFKD 2QZ5A 4N8VA 1LE5B 3M07A 5TDPB 1JZEA 4Z7AA 4EXKA 5ADOL 1XIWA 4XP6H 1CN4A 1EGJA 2QV2A 4QRUA 1F18A 4N4YB 4OV6F 2AS5M 1NUGA 3KLDA 3ZDXB 2XKNA 4WHCA 4UI2A 3QH3B 4OJFH 1PKQA 3SGJC 2CE6A 1GAFH 1J11A 3B5HA 5KWYC 5CIPB 4G6JH 3PV7A 4AWJC 1ROWA 4H8PA 2VSMB 3WIAA 2O4EA 2ZOOA 1A7QH 2OSWA 3CIQA 4ZD3H 4N2AA 1KC5H 1DQIA 4BH7A 2IANE 3NIGB 2WQAA 3LZLA 4PPTA 2BLFA 4UM8A 1AC6A 4Q9CA 5E9NA 3SE3C 2DQTL 1OM9A 2VXVH 4OIFA 4X6FA 5FW8A 5DHYA 2OMYB 3KYNB 1EJOH 4XGZA 3IFOA 2W07A 2HKFL 4GXUN 3QW9A 4OLVH 3SDYL 1J1XL 2Y1ZA 3DJRA 3LEYL 4NQEB 5LBSL 1DLFL 2YPKB 4RDQF 1BPLB 3RUGE 5EDXA 5AYTA 3S88H 3F6LA 5HGAA 4QLWA 1VENA 3OZ9L 5I6LA 2JI2A 4HT1L 4U3SB 4RQQA 2H1XA 3WJLC 1J1PH 1PD6A 2NY0B 4UTBA 5I5MA 1IKNA 1ZV9A 2H45A 1SJMA 3VFWB 3VGAB 3U0TB 2MCMA 4UAHA 1QABA 5IFJA 4H26B 3CZNA 2DQEH 4I0PB 1ZLUH 5KJRL 1CO1A 1P6WA 2J8UB 3NCXA 4LO9A 4WU7B 3SBWC 1TQTA 4IJ3C 2E6QA 4BKLA 1IBDA 3VTMA 1YRKA 5IROD 3LX9A 1U21A 1RZJL 4HK0B 5FYKU 4BHUI 4Q0XL 5IB1B 5KTEH 3QIUA 1N59B 2VLLA 4LVOB 1S9VA 1INQB 3AWFA 1KLGB 2I60H 2FWOB 3U0WH 3AREC 4XN8A 1A6VL 4IGBB 5G4OA 3ECWA 4KNUA 1IKFH 2XIIA 5KSUA 3VFPA 3B3IB 1SXSA 1J9RA 5DUMH 5FM4A 4I77L 2ZXEB 2VR5A 2AZUA 2WXFA 1JHLL 1OTTD 2XA8H 3O0RH 4EN3D 1YSOA 4BGLA 2NQDA 1T5XB 3KPLA 4NCC1 4NUMA 4OZHA 3L2NA 1A25A 3W11D 1BMWA 5LNGA 4G8IB 1EPFA 4B50A 1I85C 4LSQH 1TSRA 3WFZA 4LLYB 2CO7B 1F1AA 1I9IH 2VUKA 3NPSB 5DTFA 2XV2A 3PJLA 2WB7A 2NR6D 4CGUB 3ZZLA 2JKTM 3WNPA 2DKSA 3ZR6A 2GBTA 5K9JH 4IMLB 5DU7A 3DYOA 1E40A 3MRDB 2G4EA 4JJ5B 2J20A 1SLXA 3W0WD 3MRMA 1YMMA 1QACA 1IAKA 4KVCL 4HOWA 1NCHA 5FGBA 2PR9A 4F5CE 1WSST 3BIKB 3L4TA 4YHYB 1F00I 3SJVB 3TA3C 2ZPKL 4WI4A 1K4DB 4K94C 2VUYA 3I74A 3QZWB 1G7JB 3P3UA 5BVJA 2QQQA 1J8HE 3Q5YA 2A74B 2K7PA 3DTDA 4JY5H 4MNHB 4IOSA 5L8LB 3DIFB 1KNOB 4BZ1A 3H55A 2QPUA 3IPFA 2E7BA 3NACH 4I0PC 3WEXA 2IMNA 2VKXA 2RD0A 3SCMB 3PWUB 1DSWA 3CLWA 4PBWD 5I23A 1THCA 5KSBE 1CT8A 4N8CH 1KDJA 1KCSH 1G7LB 4IQHA 4OCMC 4IMLA 4K7FB 4LVOC 5GGVH 3P02A 3U2SA 1Q9OB 1NCBH 3QVAA 4FERA 3BKJH 3LS5H 1OAKL 4Q2ZB 5C0ND 1YEKL 3MR9A 2HMIC 3LHAA 2AV1B 2BCKA 1H8SA 1TJMA 2NSQA 2VR7A 3X3GL 4QPEA 3ZU8A 3OR7A 3D87B 2E7MA 5LUMA 2J55A 5I1LB 3N04A 4JG0H 1UB5A 2JJSC 2XWEA 3O9WC 5HI4C 1MQKL 2XN9A 2HH0H 5T5NG 2TRYA 1TQBC 2DEXX 4BWTA 4NIKB 3V9EA 4TVPH 5EPMA 2YAOA 1KEGL 3MRHB 3HC0B 1FO0L 3QORA 4P3WA 5E00B 3SE8H 1FGVH 1MFBH 2ZNWA 4LPVA 5GSRB 2X6UA 4N90D 5I1EL 5AVQB 5EF0A 2VWEC 4YS4A 3AAZA 3N42F 4GUCA 4MMZB 2FX9H 1MRDH 1G94A 4L8BB 2X1WL 3B9KB 1CICB 4MXVE 5G4NA 4FYTA 3LVEA 5AD0B 2BIIA 3U9PH 4N2CA 4PLJD 2WTRB 4P5TB 1R17A 1WAPA 4XB7A 2IMMA 3IT8D 4WLCA 2DWTA 2JIXA 1MHPH 3MSPA 3U82B 1F86A 3HG0A 3ARYA 4GBXA 4RGMB 5D7JC 2EC9T 5GJTH 5IK3B 4EVNB 3FUMA 3RPKA 1ZV2A 4PJXB 5DVKA 5F93C 3VRIA 2EC9U 5ID0A 2Y3AA 3QQDA 2QQLH 4DAGL 1ZLSH 4O02A 1GC1H 3DBSA 1C5BH 5CJBA 4HWEL 3PY9A 4TVPE 3CQFA 2P8PB 3MA9H 4X80H 4JQIL 3I2CL 3SCMC 1P5UC 2HRHA 1F6AB 1OM3H 3DIFA 2R4RH 3LXAA 3KLHD 3B7YA 2QQNH 2EZ0D 2F1AA 4XXDB 4D0CB 4MA3B 1WH0A 2HWZL 4TSBL 4OGXH 2X4UB 4LMQI 5EU6B 3QZBA 3TONA 4KK6D 4PJ5D 2MEJB 4OFYA 4K55A 3FFOA 4F20A 2VDPL 1NFDB 1FGNL 2ZYRA 4H8QA 2R0ZL 2WB1A 4OTXH 3ARQA 1J9CT 4WUUD 4I4WB 4TNEA 2YAHA 4MMXB 4HUUA 1CQKA 2UVFA 3P4MB 1J9TA 5JW4R 3D07A 1AZUA 2APVA 3N50A 1B9ZA 4UIMB 4UILH 3WDJA 1WCBB 2YJQA 3FFCA 5FA4A 4DN4H 3EDFA 3S48A 5KANI 1EAJA 4L5FH 3A47A 2B59B 4YDLC 1DBJH 5D1XC 2YHGA 2OXGA 4N8VG 2EDWA 3RWGB 2VLRD 3FTVA 2DI8A 1WGOA 5C0AB 5IQ9B 4CN4A 2F8IA 1SF3A 4PWGA 3L5WB 3OG6B 3P0YL 4U05A 2B1AH 2CO3A 2L7EA 4A67A 1QWUA 1S3RA 1GGBH 5DUBA 3U25A 1AGCB 2UXVA 3QT2A 2AK4A 3ESPA 1A6AB 2C9UA 1X5KA 3U2IA 1RHHA 3VXUD 3HVDA 4DESA 4Y19B 4Y2NA 3K6SA 2VR4A 2VITB 4WTWA 1KB5L 2BVUA 4YDJB 3ILDA 1JGVH 2XWXA 3TIDB 1P2CA 5CM1A 5IOKA 4BD4A 2LTQC 4I9WE 4F2MB 1P5UB 3PABA 5JYLA 4NO2A 5FYLD 2NNRA 4I0KA 4QF1B 4WI0B 2RFXB 3L3GB 4BZ2A 3QA3A 4RISL 3FULA 4KH2A 2FWLB 2YD6A 3ARGB 1A6WH 4JNXA 1Z9LA 2C34A 1QW9A 1XF4B 2Z92A 1RIHH 5AVUB 1J5CA 2A4CA 3QJQB 1T1YA 3DK0A 3GQFA 4JRYA 5TF1H 3S35L 1PD1A 5D7HA 5K1NA 4WFED 2DM2A 3QORD 3HBPA 3BHBA 5J6SA 2HJKB 5EF1A 3O6FB 3IU4H 4HQQL 2H2SD 1I3GL 4HBCL 2ZJSH 3QS2A 1JYVA 1RSFA 4CNIA 3DUSA 5KSBA 3PWLA 1NDMA 1M9WA 1OSZB 2VJ8A 4A55A 4HMDA 3B6SA 2PO6D 4KAQL 3PL6B 4UMGA 3BVUA 4D7BA 2CKNA 2EP6A 4OFYD 5EZOL 4Z95H 2JF1A 4X5QA 1CGXA 3L9RA 1CL7I 2ZAIA 5D7JD 2AABL 5I9QC 5HYSG 4OJYA 1CFMA 5HDBE 1BQKA 5DQJA 2FQEA 4JFDA 4ZT1A 5IB5B 1IM9B 4EEEA 1I9JH 2W59A 1KV7A 1UT2A 3E3QE 3UTZA 3OR6B 3X1NA 2XN9E 4PRNB 5EOCL 1AKPA 3BH8A 1S4IA 4J28A 4M3KB 4MAUH 1LWJA 5AL8A 4OZFA 5CCGE 5IMKB 3CFMA 3JWDH 4PUBL 4RFNB 5HHNA 3VG0L 2R9HD 2JKNA 3PWNB 4BE5A 2HKFH 3SDYH 1L7IH 3PWJB 3RGVD 4G9FB 5EORL 4FFZH 4KK6C 4P23A 1KB5B 3W9DB 5E2UH 2FGWH 2XV3A 3S88L 3C5ZC 2OSLB 1BG9A 1HIMH 4G1EB 1GGIH 1KGUA 1AZVA 3OKNA 1J10A 3VFMB 5ES4B 4NO0A 5E08L 2WXPA 4ALAL 1MG2C 1IM3B 1O5DT 1V3JA 2G75A 3RILA 1OIOA 3T04D 2GHWB 5KS9E 1QRND 4JKNA 4NQXA 4OD1H 4ZAKD 5H94A 4TOYH 4PTUB 3GMLA 4TUJA 1ZLEA 1IC0A 4GKZA 1XR9A 2XKUA 2PCYA 1U41A 3PHOA 3JTSA 3O6FC 2P8LB 4Z76B 2FSEB 3ATFA 3F12B 3U0WL 4BV1A 1I8UA 3N5AA 5AENA 5F3BA 1E5ZA 5IEKA 1GYCA 1Q1PA 3M17B 4HDIB 4MKTA 3ARDD 5B3SB 1UKSA 4CSPA 5DUML 4JFPA 1FE8L 2DS4A 3PL6C 2I24N 5FV2A 4I89A 4DGYH 4ZMQA 4QMEA 4QO1B 4HZAA 1Q9WB 3ZZ1A 4WEMB 1ZLVK 1WVZA 1OCZB 2XWRA 3VWJD 5I9QB 5JQHC 5F9WC 5T1DH 4PJFE 3HS0B 3LKRA 4P9MH 3TPUA 4ZZFA 1IBGL 2PO6B 3HUJA 3ZDXE 3QZWG 4W9HC 4AYSA 5HGDA 3WO4B 5C8JB 5JO5A 1AE6H 4FQ2H 4MJIA 4UZGA 4XHQA 1TNNA 1IFHH 4X6EA 4O4YL 5I1GH 3D0VB 2VSKB 1X9QA 4AJYV 3KBFA 5IB5A 1K85A 3O11B 4R0LB 2KLTA 2LR4A 4FXLA 1ZIBA 5HD8D 1E6OL 5KYWA 4LSPL 3E8VA 3UEQA 4BYHA 1BM3L 3L9BA 5JIPA 3B2DC 1RUAL 4LGPB 3ARFA 3QAZB 1OP3K 2OR8A 4FQCH 4PJFF 3A21A 1CBVL 2WJ7A 4EI6A 3FSAA 4LSDA 4BUHA 4TSCL 3V0HA 2HTKC 4G9FA 1KENH 3L7FA 5HGGS 3W9EB 1SYVA 5AZUA 2FO4A 1UJ3C 3LN5A 5L2KB 1IO4C 4OCXL 1UOLA 1N5YL 3EZJB 1S8DB 3E3QC 5F97E 3OAUL 3V0VB 2G4GA 2YD3A 4PHXA 4FL4B 4AQ1B 5EPMB 4LEXH 2BOBB 4MA7H 1YLBB 2NW2B 4OZGE 4WU5A 1EEZB 1FPTH 1OGPA 1JMZA 2C3HA 1G7HB 1C1EL 3DJTA 3IAPA 2JJTC 4P23D 1UFGA 1XCTB 4I8DA 4ZTOL 5B7FA 1TZOA 3ZKMC 2A0LD 3EJJX 3VD2A 2BOLA 3SDXE 3JWOC 2BVEA 2FSEA 3FF7A 1KGIA 2UZXA 3LNFA 4E42B 5I5RA 3OLIA 2N1KA 1G5AA 1SLVA 3LMJL 4YC2C 4PB0H 2BWDA 3MGAA 4JFEE 2VM3A 3FB8B 3P3TA 5ID1A 2ZYIA 1IGTB 4LASL 5DJ0B 1X5FA 5ELIA 1MRCH 3GK8H 4FABH 4BQCA 4WCYH 3LIUA 5T1LA 2A73A 1ZWIB 3NSJA 3HAEG 4S1SL 1LO3H 1O0VA 1RHHB 3C75A 4J3OH 4GAJH 1FO0H 3VFMA 2GW5A 1RPKA 2CRYA 3MOBL 2G0KA 3SE8L 5IMOB 1G0YR 4DKFH 3CZUB 3TYFA 3TS8A 2H32H 4GRWE 3T3ME 1F2XK 1J0IA 2D8KA 4WV1A 1GA2A 2FR4B 1W91A 2AV7A 2PCFB 3D18A 3PWNA 2W65A 3T0WA 4KXZH 4P59H 5BV7B 2Z1PA 3FONB 1IEHA 1Q94B 2LU4A 4NJAL 1G4RA 1ZWIA 3B56A 1CF8L 2ED7A 2EKSB 2JJTA 3D4CA 5DGQA 3ESUF 2BSSB 1DVXA 2XFXA 1XD1A 3L3GA 5GJTL 3FT4A 1JVOA 3APDA 3RVUD 4XMLL 2CCLA 4IIZA 4JRYD 3C60C 3T3MF 4W6WB 3C8KB 3QCVH 4AQ8A 1AO7E 1G9MH 3MACH 1AMXA 4N2GA 1TTCA 2GAZB 5KBPA 3AQYA 3M8OH 3SDDA 2M1KA 2NSMA 2DTMH 4AQ1C 2QQNL 2OL3H 1FA4A 3MZTA 1GZPB 4AW7A 4U0QB 1CGSH 4BKTC 5I19H 4W4NA 3GB7B 4MA1B 3HUJF 4GMSL 4R8WH 2O72A 4YPGA 5B1CA 4XNBA 1IC7L 1GYAA 4BK4A 2G5BA 1UZGA 1VZGA 4U0RC 4K94L 4XMUA 3ETTA 2VDNL 3WNOA 1HHGB 5C7XL 5E6ZA 4PD4J 3JWOH 1YEJH 3C87A 4J3TA 4L2YA 2DJSA 4YC2B 3LNHA 2F6AA 4OLXH 4HIIA 1BVKB 3UTZB 4Y4FA 3RTQA 4O02B 1UURA 3OJDB 2KQMA 1DUZA 2KL6A 2XWJA 3CSTA 2JLLA 2IBZX 3V55A 4JFOA 1JK9B 1UACH 4NOBA 4JRXE 4IRSD 4KX9A 4HUNB 3EYOA 2VN6A 5EF3A 2HKHL 2AFNA 2F58H 4D2NA 1Q90A 3CHQA 5KOVC 4CVZB 1T0OA 3K6DA 3WDHA 1IVTA 3F8UB 1C16A 2G2RB 3VDCA 5TQ0L 3FOMB 2MKWA 5TE6L 4D3CH 5F2FA 5FM5O 2F54E 3VD9A 4Z3JA 1UA6L 3CU1A 1CXHA 1HXMB 3BZEB 1GPOL 1A6AA 3CBJB 5FECA 3W9EA 4DZ8B 1F6AA 2XN2A 1PZ5A 5DJDA 1R5WB 5EO0B 3HE7A 3LIZL 3JUZA 2A77H 3M1CA 4G8EB 5EOTB 4XVOA 4KZDH 2X28A 1I7TA 5CJXA 1UQSA 3AACA 4NQVB 3EADA 3CN4A 2Y2YA 3HNSH 3ZKMD 4NQED 3BWAA 4QTFA 4WWKC 2VR3A 1UCBH 5BZDA 1WA0X 2DI9A 3KPTA 4LSSH 4XVSL 5BNXD 1AAJA 1YNTF 1WAAE 1NIFA 3U2JA 5IHUL 1UT1A 4QHNA 2WXKA 2OAAA 2Z31A 2AQNA 4ZK8A 5FFLA 3G5XB 3GNMH 4QXGL 2OZ4A 1SYSA 3S0PA 4Y0GA 3T8VA 3S35H 2IFFL 2WBJA 3MBEA 1PLGH 4LL9A 3I9GL 1WUZA 2IANB 3NIGE 4HKXB 3AS3A 5A16A 5DHXB 4FYQA 4N0UA 4XWGH 1KFAH 3QDGB 5KYYA 2B7DT 3S4SB 4L1BA 3A4EA 1KWKA 3RWIA 3PWJA 1PZBA 3LNGA 2JQMA 4OQTL 3TWCL 3H6AA 2V17L 5B1JC 5EIIA 1L9OA 3DI2B 3MLUH 4LLMA 3BXNB 3FU9A 5B38G 3UROR 5JPNB 4N2MA 5EC1A 2DN7A 1CG9B 2VDQB 3RA7H 3WY3A 4N9GB 5B7MA 3AREB 3PUCA 1Y07A 3BKCL 4AVJA 1YMMB 4EUPG 3FNKA 5GHWL 1S7XA 1TDQA 5F21B 2VM9A 2BS9A 3L3KA 3MN8A 3QUMA 1PLAA 4LLUA 1ZXQA 1RK1A 4X6BA 2XZCH 1P4BL 5A2CA 3P54A 5I15H 3K71A 1NL0L 5F6HI 5EOCH 1N0LB 3RIFK 3GSWA 3DVNB 2PXYC 1GYVA 4OQTA 3ISWA 2ZKHH 3NP4A 4FFWC 4FNRA 5AB1A 5B39B 1ZVSB 5K9OA 4HD5A 1OGTA 3W5NA 3DRQB 4PUBH 3NPSC 2ZAGA 3S3PA 4HJ1A 5KSBB 1ACZA 1HILA 1MI5A 1L7IL 4WHYG 1A4JA 2FQDA 3S5LG 3VYOA 2MQCA 2O5NA 4WJ5B 3O6LL 4QRRD 3DX9B 1NCDH 4EIZC 4MDRA 5GZNC 2CGYA 4OM0L 4HGWA 5IEHA 1XSOA 1COBA 1XMWA 1A3QA 5EO1B 4D9LL 5E08H 2FBJH 4CU8A 5DD0H 1T2XA 1NCWL 2VLLB 2Z91A 5DURB 3WIFB 4ZOCA 4TUKH 1OGAD 3GS0A 4ZNEE 1CU4L 3OAYH 5E1IA 3ROOA 4C4KO 2BSCA 1CI3M 2A5UA 3CN2A 5GSVB 1LDPH 4P49A 2JMRA 1ZGLM 1TTGA 2IPTL 1HU8A 2YXFA 3ROLA 1P5UA 3PABB 5I74C 4HX1A 3EJZD 2D7TH 2QLVB 3L4YA 3MROB 1OWRM 5CZRA 2F5BL 1JL8A 5KG9A 1A6UL 2EADA 4Z8FL 1R5IA 4QRSA 3GMRA 1NC4D 1Q9KB 2ZSWA 3ARTA 1FFNB 4FHKA 4P2OB 4ABWA 5CEZL 2Z31D 3GLZA 3MRGA 5JPNC 4OU3A 5JHAA 1WC7B 3RUGA 1MJJB 1KACB 2PWFA 1EGJH 1DL7H 4IHBA 5F0MB 2Q6WA 3S3JA 4XAKE 3RE0A 1QSEB 2DEWX 2FLMA 4YSQA 3HE7D 4LSVL 4PRAA 2B77A 3SKOA 4NQCE 1FWXA 3N43B 3P3SA 4NENB 1JI1A 3BQVA 2X09A 4ABUA 3FKUS 3B34A 3VFNA 1LP9B 3NCMA 4YWGL 3SY0A 4Z3GA 4GYBA 4TNFA 3VYNA 2OXHA 4IBWA 4FP8L 2RCSH 2YEZA 4UUJB 1A1OA 1RUAH 3V4PA 1HCYA 1SY6A 5DYOB 4C47A 5A2IH 3MGTA 1BQLL 1VIWA 1KWGA 3FO9B 1FAIL 2XN1A 1JPST 1I53A 1NBZA 1ND0B 4I18B 2JJVA 5F8RC 1CICC 4TSCH 2ERJC 3T4YA 1QQDB 3OPUA 4QAWA 1D6VL 1Y18B 4N0FB 2GIMA 4OCXH 4F15C 2NUTA 5C0GB 4GP4B 4UT7L 4RGMC 1ZRUA 4Y4HB 4KZ0A 3RL2B 4JO3L 4PJ5A 4UNVA 4POZC 3DSFL 3DTXB 3MRLB 1G0XA 2HFEA 3IWVA 2BVQB 3AU1B 1Q0XH 2DMHA 3M6DA 1R3JA 5H8DA 1MCOL 3IJ8A 4F57H 5ADPH 2H41A 3ARUA 3BVWA 4CSZA 1INQA 5IBTL 1EVUA 4ZOBA 5GS3A 5ECJE 2BHZA 4IJ3B 1YMME 2XZAH 1AOHA 5AW7B 2LFGA 1CXEA 3MV8B 1DQQB 2QHRH 4ZUVA 2WKOA 4OUUA 1KBGL 4Q4EA 4JX0A 4B0MB 4HIXL 1KYAA 3VXUB 1S7XB 3GK8L 1IC4L 4FABL 3ZLQC 4WCYL 5AWNH 1J8HA 1JTTA 1W0VA 4FNSA 4JPSA 4FFWD 3SDCD 1S3KL 1V5JA 2PCPA 2Z8RA 4EI5D 1TZHA 2PXYA 3OGOE 4K71C 1TYRA 4UINH 5FA3A 1S9YB 2EYTB 3QUXA 5IFAL 3KPLB 2J72A 1UD5A 5EC2A 4JFZL 2CHZA 1PLBA 4NP9A 4QCIA 4CN6A 2RQEA 1QPPA 3SKOB 1KCBA 3HE7B 1QNIA 5DT1L 2HVKA 1J0HA 3QIUD 4YDLB 1JHKH 3FJTA 2X1OA 2A4ZA 2MNJB 5BQ7A 1JFHA 1CF8H 3NIDB 4FS0A 2DDQL 3IGFA 3W3BA 5DZAA 3RNKA 4GXUM 4M4RA 1M71B 4W9DC 3ARDA 3N41B 3QFDB 5KG9B 1R0AH 4RLDA 5D7KD 1E67A 4NS0A 4G80A 3OC5A 3QCVL 3ILPB 4JG5A 3BE1H 5KVFL 2AGJH 5F7LB 2YR3A 2ALAA 4WY7L 3RIFF 1IGCH 1AG0A 2IDFA 3T2OA 2GI7A 2X3BA 4ZAKA 4HJIA 1JK9A 2QPFA 1AGEA 4YZWA 5EBLB 1O9ZA 3GSQA 3VD7A 2YXWA 5HHME 5I1CL 5DJXA 2Z31C 4BQ6A 1EAPB 3F83A 3G3LA 4OM1H 3RGVA 3OHXB 5I1DB 1L3NA 5C09D 5FCUL 4KI5D 4LNRA 3DRTB 3P4LA 5GS0D 3K0YA 2AMUA 5C7XH 4Y19D 1HE8A 2WCSA 1ZSDB 3JWOL 3I9IA 3VGDA 2XXGA 3A67H 2EDFA 1CXFA 4UQDA 1UCTA 4BFBD 2D7QA 1YY9D 3U1SL 3UC2A 4OLXL 4GW4A 3WUZA 3LRKA 2V5MA 5DJZA 2HFGL 2NNFA 5BQDA 3QIBD 4N6RB 3S36H 2GTZB 3DX7A 4J6RH 1L9SA 2APFA 3WIIH 3PAZA 4X5WB 3U30C 1U91A 4MKMA 3A4DA 2R23B 3BVDB 1HKLL 4X9YA 5JHMA 3RDTD 5CBEA 1CD8A 3DVIA 1IGJB 1NDTA 1EDQA 4IBUA 1B4RA 2DJUA 5GXBB 4JFED 1RZIA 4TULH 3MYJB 3MLPA 3BD3A 2FJSA 1V7NH 2VJXA 5FUOH 3IDYC 1OCWL 3ARBD 4JPKH 4EO5A 3SGJA 3MLYL 3OWRA 1TKWB 1S2EA 4HS8H 5IEHB 5DFAA 1UD3A 3K0WA 4W1TA 1OGAB 5IUSA 3ZE0B 4HKZA 5EWIH 4L3CB 3LIZH 4RRPM 3QUZC 3UTPD 5C0GA 5J11C 4P5TC 5ETUA 3V5DA 2WSPA 4GAFB 3ARWA 3ELQA 1NGXB 1TJXA 1TTBA 1VCAA 4GKLA 4RRPA 3HG1A 5B1AB 3ARSA 2KZKA 3TT3L 3K8KA 2I9TA 4NB7A 2QZQA 4XP1L 4KOBA 3BZDA 3F7PC 3F7YB 5TPWL 3L17A 1U8HB 4RFNC 4UV7L 1B0WA 1CDIA 2Z31B 1YEFL 3MRPA 3MROA 2R69H 1X4YA 3CQPA 4GQQA 1NEPA 5CD5D 5IFJB 5F70A 4ODTH 5EHFA 3LQAL 3OG4B 3MRCA 4HJJH 1KTKE 3VNZA 4APXA 4S11A 4V1DB 3NMEA 4HC1A 2ZCKL 3IAGC 1B4JH 2HT2C 1E27A 1H5BA 4UOQA 4HPOH 4RAUB 2WXLA 4H8VA 3ZJAA 3D3VE 5HYJE 1E2VA 3WFHA 3FCSA 4M3JA 2YD7A 5HJ3A 1UYWL 3TNNB 3EHBC 4PRAB 4NCC2 1FVEA 1DQLH 4NUGH 4F2FA 3B3IA 2DBLL 5I17A 3LKOA 3LS4L 4PP1C 3CVHA 4F33A 2HX8A 3AXIA 4JANB 3GI8L 4KV5F 4O2CB 1PFCA 3K5RA 4QRPB 4YSDA 3QWRD 5HJGA 5E1AA 3QEQE 4N86A 3ARXA 2B1HH 4YSUA 4FE9A 1QLRA 3NIDE 1BZEA 4LRNL 4NT6A 3RA7L 2BVYA 3TXAA 4KKLC 2WYTA 4XNQA 1G0DA 5D55A 1UB6A 3FQTB 4HYTB 2Y7LA 1RERA 4PGEA 1Z9NA 4OCLC 3SDAA 3C5JB 4ODXA 4JO5A 5D1XB 1WS8A 4IRJD 3LDBB 4AC2A 1C8QA 3PV6A 3WNNA 1F02I 5IMMA 2WNXA 1NL0H 1QLEB 4NZRL 1CVSC 1DANU 1SFHA 2MOQA 5F9WB 4BQBA 2J4WH 1DFBL 1QNZL 1O7SA 5JUEL 1NANH 1VHPA 3EG9B 4XAKD 3WO4C 5C2BL 3BO8A 3QDJD 1K8IA 2IDUA 3N6YA 4LLDB 2F7OA 3IFOB 3INUL 1NBYA 3RTQD 3VXOA 3KBEA 3O6LH 3D05A 4ZX5A 3WS6A 1NCDL 1UZ8B 1PX4A 5EO1A 5BCAA 5IM7A 2XWCA 3CBRA 3VO0A 5FECB 3QNYA 1F11A 4G6MH 1HH9A 1JF1B 3UPCA 4BSVB 3QAZC 1X5GA 2AJYH 3NA4A 1NCWH 4M3HA 3GM0A 5KYYB 5BUGA 1QYGH 2ZXCA 1RMFH 1A2YA 4TUKL 5L4JA 3ULUH 1IAII 1CU4H 3Q01A 2AJXL 1NBCA 4JFDE 4RAHA 4AYMC 1BF5A 5D2NE 1IIKA 2GJZB 2ZSVA 4ZDHB 4J12A 1UJ3B 3U83A 4ZMNA 4RBPH 5DC9B 3GMQA 3LRMA 2JE8A 5BVPL 3MNDA 5B39G 2Y22A 3RDTC 1A7OL 5DR5H 3B2UD 1XF1A 3FQUB 1BA9A 4XVTH 3CWGA 3E2HB 1YPZA 5DEFB 5H94B 4F37K 5MEQA 4IRZL 1IUZA 2YOAA 2WYHA 3FT4B 3PXLA 3UIYA 3C8HA 1Z6JT 4HIQA 5I66A 1IJNA 5AG8A 4BGDA 1BD2D 2WTOA 4LIQL 1NCTA 2W0KA 2X9YA 3MJ7A 4GT7A 1EAQA 3HC4L 4M43L 1N10A 1TZIA 2VSDA 5AOMA 5ITBH 5ENWB 3QUZD 3LZPA 1DJWA 1SVBA 3QEHB 2WUBH 4WKZB 3TF7C 1MNUL 4N26A 4NAMA 2CIIA 3VSUA 1I3RA 1AD0B 4NZUH 5CN1A 3TEZA 1WCQA 3KWWA 1TVHB 4KGJA 5CP7B 2NDGA 4I3RL 2MCG1 2NLJA 4MS8D 1GW6A 2B4CH 1MLCB 3GLDA 3FSZA 5E4OA 4GUQA 1JTPA 4E9RA 3K6IA 1R3LA 1SHXA 4CBPA 3UBXB 4ELDA 3GYRA 4LCWB 1HK6A 3G9AB 4K9EH 2XWDA 3ZTNL 3GXIA 3S36X 2HFFA 4FLOA 5JHDB 3Q13A 5J6HA 3TBYB 3WD5L 1OSEA 2OTPA 5BV7C 1NKOA 3MBXH 2OP4H 1FDLH 1XT5A 5AZ2H 4P46C 2BNRE 4OZIE 2VDMB 5E2WL 1MFDH 2VXSH 2ED9A 1P84J 2X6CA 1Y1DA 5EFIB 4LARL 5GGSB 1MUJA 4R90H 2YZ8A 5IMLB 2DQDL 4A1RA 2CMRL 4CVWA 3CZSA 3MBED 3ZMNA 4Q58C 1AI1L 4DN3L 2FSDA 1A9BB 3GI9H 3E0GA 2VQ4A 5CJ5A 2FO8A 2ZG2A 1UM5L 3UAFA 1E28B 3GHEH 3KPPA 4YDZA 2UV3A 2Z35B 3BJ91 3QDHA 5LNEA 4H44C 4FZEL 4NQDE 3V4UL 4PJBE 2NCEA 4ICWA 5E4AA 4PS3A 5HHQA 1ACXA 2E6JA 4FYSA 4UOW0 2EXTA 2BC4A 4ZMOA 1WHOA 4IYKA 3WOVA 1ZE3C 1ECZA 4E42A 1NCAH 2DJMA 1ADWA 2V3EA 3M7OA 3QXDB 3M45A 5GISL 4G3YH 3O3DB 5AWNL 3TCLA 3FMGL 4PAZA 1N8ZB 1WD9A 2KS0A 2YFNA 4UINL 4N9OB 2A9BA 3QUHA 4Z7VE 2G9HA 3D3VA 4AH2B 5LXGL 3ML9A 4LOEA 3TBBA 4X6EB 2WZAA 4K23H 2CHDA 3HG1D 2WBJC 5AW3B 4HWZB 4TLKA 3WXVL 4L4VD 4IU2B 1I1YA 3K6OA 2QGDA 4MXWL 3S4SG 1BZ9A 2MIZA 1K2DB 3CFTA 4QRPA 3TZVD 5IUCA 3VFUA 1MCWM 1K4CA 1TJHH 4O58L 2HVJA 5J6GB 2QMJA 4P46B 3HHMA 1E3XA 1W72H 2HG5B 3VGHA 1XF2A 4LFHG 3F6IA 3PHAA 2B4CC 2X4NA 5DK3A 3UAJC 4F27A 3EH5B 1H0DA 3QJFA 1A7RH 4IRSA 4ZUUB 5I8CA 2B59A 2BSTA 1SDDB 2V7HB 2YAQA 3VSQA 5I5JA 2CRZA 5JLZA 2CJTA 1AXSA 2YRZA 2FBOJ 3KNBB 1XGYH 4NN6C 2YOCA 3FTYA 2XTJC 2FCBA 4FL4C 5C6PB 1TYJA 3CUPB 2AV7B 5AYQA 3GO1L 3DV4B 1CFSB 3BYYA 3P30L 4LCUB 5SWZD 4F9LA 4X83A 3VFUB 5C3LD 4WRLA 4YSRA 2NXZD 4J6IA 4WTXA 5CINH 2IPUG 2FX8H 1OGAA 1RQ5A 1P7QA 2DD8H 2X89A 3BKML 4MS8C 3RAJL 2GEQA 5CMAB 4F8TA 4HFUL 3QIBB 2YQ2A 4WJG3 1OQOA 4O9HL 4PIRF 1YY8A 1EZUA 5H37H 1RJCA 3FAXA 2OK0H 4P99A 1FRGH 5HI5C 2WQVA 4ORZC 3DX6B 5I0DA 1QBML 4RBPK 4FG4A 3DX4A 3WTSA 2ICWI 5DJ8A 4D0BA 1TMCB 1KG0A 4NXSA 2YKLH 4E9VA 3LPOA 4LEEA 1WYJA 4WWID 2E27L 4A2DA 5C0IA 4YLBA 5FO2A 1UWXK 1V7NL 4IIQA 1E3FA 2XKSA 4HIEB 3V7AG 1OCWH 2H3KA 4GPVA 2D03L 3UTTE 1S7SA 1BEXA 3UZEA 5L88L 1INEH 4KKCC 1D5MB 1UUNA 3G08A 4BBWA 3KD4A 4RVBA 3IJEB 2P52A 2OX5A 3FSWA 1TETH 3V0VA 2APSA 1MG3C 2J6EL 3BAEL 3WXWH 2FJFA 3BCFA 4MRBA 4KK8D 4NWUH 2E7CA 1BAFL 4KKBC 1JZ5A 3DRTA 3PIQA 4L0PB 4P4KA 4L23A 5I17B 3WKYA 3KWTA 1LEGA 3T77A 3N40P 4OJAA 1YN6A 5AB9A 4UV7H 1GC1C 4OKVB 5IEKB 2PTTB 3JTBA 4MCMA 4AZ8B 1BQRA 2I5YH 3JZYA 1BAGA 3C6SB 2WSKA 4DCQA 3FB6A 2C9RA 1PLCA 2R56H 2XV6B 1CS6A 4PTUA 4JQXA 4TUJB 3O2VL 5ANMB 5IB4B 3VXUE 5D7SH 3OQ3B 2BCMA 3IKCA 1WFUA 4MJ6A 3PCYA 3PHSA 5GJSH 2VO8A 1IQDA 2W9DH 1CICA 2JB6B 3HUJB 4WFHE 3MRFB 3ZK0A 1T3FA 1KGCE 2WQRA 35C8L 4PEEA 2BY1A 5KVDH 4PJIA 4X7TA 4LRNH 4QXTA 2JKJA 1CGVA 2HX9A 1V3MA 4GAGH 5E0QA 3D85A 5C0NC 1WAAA 2OULB 4QRTB 3HC3H 3FS9A 1MNNA 3B9EA 2OMVA 2VL4A 4P2OC 5CGBA 5IZ7A 2PYEE 3Q5OA 5EO9A 5EU4B 1CBJA 2CCVA 3K81A 4NZRH 2XXCB 1BMZA 5AOIA 1YNKH 3OR6A 4GRLD 1SQ2N 1JWUA 1I1CA 4B95C 5JUEH 1KLFB 4Z0BL 5CBEB 3CFDB 4DNLA 2J1ZA 4WK4B 5CLWA 1MIEH 3GMMA 2A6KB 3II3A 4M7KH 4N0UE 1EHLL 1HEZB 3BMWA 1FFPB 1NC2D 5K39B 4X5LA 3FXIC 1F4XL 1QI4A 2DV6A 4I4WA 4J5VA 3OKOA 1YJDH 2GCYB 1M1XA 2V2XB 3CH1A 3DXAE 5DHEA 3ZR5A 3F2LA 4WF7A 2XTJD 3K2UL 1R3KB 2LU5A 3GXNA 4HU8A 1N67A 2COQA 3VI4E 2FECI 1DJXA 4XP6L 1SXAA 3OTTA 1IL1A 3NCYP 4L3CA 3CSYA 5CO1A 2FZ3A 4HKZB 4JO2H 1X6LA 1D9KB 3F64A 2XN9D 1NC2B 2AJXH 2GTWA 1GMIA 5BRZA 3UBFA 2QFPA 2E9GA 5GGRY 4DF9A 1MHHB 5HGBB 2BSRB 3TNMA 3DIDA 3G6AA 4LCIH 2NZ9C 2YD0A 4TNVF 4N5ED 1QUNB 1T04A 4F15B 2ZXBA 5BVPH 9CGTA 1IBYA 4RGOL 1ZIAA 4NFBA 4Y9CA 1A7OH 1T1XA 1D5XB 2OS7A 3HB3B 4L5FE 5DR5L 3JXAA 4IOFD 5IW6B 4H8HA 3WGUB 3RVTC 2EZ0C 3VFVB 3VDBA 3PV6B 1CDJA 3OLDA 3Q1SH 3ZE1E 4QEGA 4C4KT 4XHJD 1J1XH 3CSGA 3ZHLA 1KTCA 3TESA 3HRPA 3V9CA 4YDJA 5KSVB 1LP9A 5E51A 3ECBA 3HC4H 3PAVA 1R3JB 3OZ9H 1NZRA 1MAML 3NFPB 1J12A 3RWDB 4R26H 1K5WA 4A2GA 3GIZL 3KR3L 2HX7A 1NFKA 2OMTB 1OGAE 2YA0A 3BP5A 2Q3AA 4ZNEA 1FO0A 1UZ8A 4FQ1H 32C2A 1TTUA 2ZX5A 4KHTL 4AGOA 4ZFZA 1JGLH 4K71B 4Y1SA 3T4YB 5KJ7E 3QIUB 4BH7B 1LXMA 4NHUA 4KX8A 4K3EL 3DNKA 5DLLA 4X7SL 3TH2T 3IDXH 1ZCRA 3BUQA 3FU3A 4YBQD 4C4BA 1FL6B 2PXYB 1O75A 2PTVA 5E94B 5F1IB 4ZRGA 3WD5H 1I7ZA 1RZKH 4L29B 2IJ0C 1NUDA 2V3DA 2DQMA 2YEZB 5A1AA 2UX6A 4JLRB 4RX4A 1QTSA 3OLEA 3UTTA 3KXFE 1T7XA 4XMXA 3O0RL 1A6ZB 3KH4A 4LARH 5D4QA 5EN3A 5HPOA 3F7YA 2R1XB 3KEDA 1TO4A 1BGXL 3MO1B 4FTVB 5J13C 4FCAA 1SBSL 2X44D 1AKJA 5FGBC 4DN3H 3O4OC 4JANA 3TVMC 1CYGA 3N44B 3NPZB 2JLPA 5K9JL 3GHEL 3LCYA 5HSFA 5DRNB 1S5HB 3FB7B 2D4FA 3BP7A 4XN7A 1H3WM 2YD9A 2X4OA 3VD4A 3F62A 4E9WA 3CN1A 2DIJA 3MRKA 2QLYA 1R5IB 4QRSB 5FK9A 3ZIYA 4OLYL 1DSFH 5I74B 1T03H 3UBXI 2OYLA 5BJTB 4UT6A 1DEDA 3OM3B 4DGIL 4OI7A 3LKNB 2WXQA 4G3YL 1FORL 2E9BA 2W95A 2YPLB 3CH1B 4P2QD 1JUFB 1CLOL 3CXDH 3JWNC 1N0LA 3FN9A 4HALA 3VXUA 1AFVH 3FYEB 3P0GB 4YJZL 2PW1A 2A2QT 3VFSB 4NN7B 1HQRB 4M8UA 4I48B 5KN5A 4NPYA 3QFJE 1PZDA 2LU3A 4Z7UF 2YAEA 2JV6A 2PN5A 3GIVB 3NACL 1E8ZA 4PJ5E 3EUUA 4JHUA 4PJ9D 1MLBA 1S7RB 2K0RA 2ZUYA 4JHWL 2KMWA 4JN2A 4KTDL 2PWGA 2R29H 5DMGC 4GW5A 1GJWA 4KKPA 3MXWH 5C71A 3EGXB 3K4ZA 5GGVL 2KLRA 1VACA 2OV0A 5ICYA 4AYFB 1MFAH 4MD5B 3FZUC 3O3EA 4DKTA 3DLQR 1GS8A 2YEVB 1VFBA 2Y9RT 1UM4L 3V8CA 4Z7UE 6FABL 1RUQL 1S7RA 1CFQB 1XH0A 2NZ9D 1M7UA 3TCXA 1BXAA 3GBNL 5E8EA 3VXSD 4G83A 1H3VA 1AQHA 5KVEE 2H1LM 2FYYB 3C2SA 5A2KH 2WGXA 2E74C 4I18C 4JZNB 3ZX1A 5CKGA 4FQPA 3SGEH 2EJ1A 3IKCB 4MJ6B 1I8KB 5JHLH 5J11B 4ILDA 3TJPA 4ZS7H 3E6HB 1PVHA 2X2YA 4YHOL 5DC0A 1Z0NA 5F3FA 1FLRH 4WO4D 1ROCA 5ICXA 1QFOA 1G7LA 1MRDL 1YAZA 2VXUH 3D48R 3QXAA 4BQ9A 4H1LA 3FU5A 3A22A 4AM0B 3QDGD 4ZTPL 4HKBA 4IGBD 1A22B 3H2PA 4Y5XC 3QNXB 4AQ8C 2DMGA 4I3SH 4RDBA 2RH0A 5EO0A 3U46A 5L4MA 3HZVB 1MHPL 3HN3A 3CK0L 1LJMA 5DHYB 1RJLA 1RUKH 2F9BT 5KSAD 1QLFA 3PDOB 3BVVA 2D7PA 2Q76B 3PLYA 3OKLB 3C5SA 5E6UB 4LCVA 3WLBA 5BZWA 3FRUB 1NMBH 3UJTH 3ZIMA 1BFTA 1NFIA 3MRQA 1BP3B 2K6ZA 2FL5A 2UYLA 4EZKA 4X4ME 3EHBB 1UXWB 2F2HA 2AEQH 1MVUB 2EE2A 3ESOA 4Z7VF 1V05A 2E27H 1HI6A 4KZEH 3QXUA 3QH3A 1ANUA 2DKMA 2R2HB 2EDYA 5KBKA 4OGXL 1ML0A 1MF2H 3FTWA 2C3VA 3CDGB 4LAQH 3MRBB 1MHEB 4U3XA 5I30H 1TETL 1ES0B 1SN0A 3VMPA 3DSNA 2VXTL 2N0KA 2HJFA 2X1XR 3WIHL 1QEWB 2BNQD 2WGNB 3SQOH 1VFBB 2YWYA 5AALA 1ZLWH 5I8OH 4XC1L 3J07A 3PGFH 5HDRA 4F2EA 3BXNA 3V6OE 2QADB 4D9QD 3Q2LA 3QEQB 1EA9C 4GSRA 1NBQA 2AW2A 1PYWA 3ESVF 5CILL 3BQUA 3VXRD 4F58H 2X4RA 3PU7A 5HYFA 3HG2A 5AOKA 4M48H 1WTLA 1S7WB 4LHUA 2KERA 3N06B 4QY8B 1W72A 3CV5A 1ZHNB 2AQ3A 4HEMA 4E9SA 1HOCA 5FYKL 2R56L 3U7AA 1EO7A 3GSVA 4PRPD 3L3JA 1F3DJ 5IKCB 4YDMA 3C5XA 4WU7A 5KYXB 3L95B 3A6OA 3VTAA 4DUVA 1DBBH 3UAEA 1JGEA 4TSAH 3BWUC 4G7YL 5DK0A 5C08A 3FTSA 4CC4A 4ZPVB 1LMKA 3MQIA 2A4EA 3X2QB 1TIUA 4QWWC 2MPAH 1IC5L 4GQRA 2WV3A 4UU9B 4C4UA 3QQ3B 3VMNA 4OCWH 3D85B 1KB9J 3ZRCC 1HHIA 1BM7A 4WWPA 4PJ9A 1U8CA 2NXYB 5F1NA 3HC3L 2XXMB 1VERA 4PJXF 3UTSE 4HJGA 4JGMA 4UM8B 1J5OL 4ZG1A 2ZD0A 1NKGA 3ORJA 3JV4B 5TE7H 3SDDB 2Z93B 4LLAA 1WZMA 1RIHL 3ZQ9A 1HHKB 1BJ1H 4PJ6A 4A6YL 1QO3A 4DP9X 3L1FA 3B2VL 3AS0A 3B9DA 1SDDA 4UUJA 1MIEL 2VAJA 3N42B 4Y7MA 1EHLH 4HOXA 1EK3A 4WI6A 4W9EC 3GD1C 1JWSA 2I85A 4PREA 3WFBL 3UPAA 4AMKL 3BZ4B 2BSSA 4MX7A 2YJLA 1NGQH 2E7DA 4N0CC 3HS0C 3MNWB 2HG5A 3R06B 2V5SA 3NAAH 4G6JL 4NEHB 1QBLH 3LZOA 4KMTL 5LG1A 2BHYA 4JDEA 5FO8B 3IFNH 1N3NA 5DFVC 1ZGLP 3ASWA 2JNZA 1KV3A 4KAQH 4QKXB 4EXPX 1A7QL 2PWHA 2PCFA 3D18B 2NR6C 3ESMA 1E5UI 3D6GA 4ZD3L 3KYAA 2HUHA 4R4FH 4YXKL 2FR4A 4JO2L 2YGOA 4G7VL 2DQTH 2O5XH 1CFBA 4Z7UA 1Y6KR 3DX2A 1XF5A 4M1DL 3MFGB 4WWKA 4WEUD 2VCOA 2WVVB 4Y2DB 4EI5A 2O26U 4WFGE 2GC4C 2IQ9L 3FOMA 3HPJB 5CJXC 4XMPL 1WA2X 1GY1A 1R1CA 3CBKB 3O4LE 2CUIA 3D69B 5AKTA 1OV8A 3TBVA 5KBNC 4U4IA 1MUJB 4HT1H 3VXRA 2Y7QA 2VLJA 4PGZA 1C08A 1MVFA 2R0KH 1E7UA 2WVSA 3VG0H 4DCQB 2K4WA 1S7TB 1KIQA 4KKNA 5BV7H 4LOUC 2E46A 1MY5A 3HZYB 2IALA 3CSFA 3MV7A 5HPMB 3LSOB 1NGWB 4QXUH 5C09B 5KVEH 2GI0A 1CQYA 1CXLA 1MJUL 1JBJA 1GTNA 3OF6A 3IN0A 2BVPB 3EKCA 2VC2L 3DJ9A 5HHOE 3N41F 4HJTA 5L4FA 2OMUB 4ALAH 2I60L 1YJDC 3BAWA 3O41B 4TV3A 4WW2B 4XCCL 4LT7A 4K4KA 1LWRA 1F3RB 1S9XA 1IKFL 2EDTA 3EJYC 5D2NA 2H6OA 1KB3A 3CFCH 1SJEB 3KL3A 4OD1L 5GZOA 1X9UA 3QIWC 2NMSA 3Q2WA 1S5IL 2CIIB 2QDVA 4I77H 3C6LC 3GS4A 1JHLH 5L7XL 3NCJH 3C9NA 5E5MA 3TTYA 2MHAB 4X4MA 5IMOA 5B8CA 1EHXA 4KOCA 4HDIA 2WBJB 4EOWH 2V9UA 2Y23A 3P2TA 4XVUC 2ATPB 2WWKT 5HI4D 3HPLB 4IOIB 4R3SB 1FVCB 4TQHA 3VRJA 4L3EA 1UXMA 5HHXL 4PS8A 5E4EB 4BXVA 1ZA3B 2Z1KA 1G6RL 3FF8A 1TEGA 3KWXA 3BI9X 5D2LA 2OMZB 4NZTH 4MVBC 5D7IE 1GJUA 5DFWH 5JO5B 3T6WA 1RZPA 3DURA 1IBGH 5IR1A 5T1LD 4GAYB 4YHLH 5F88A 4Z7WB 1TEFA 4JE4B 1Q0YH 4M6MH 4FQ2L 2XBDA 4U1JB 3TO4C 5GGVY 5DO2D 3GKWL 5I1GL 3QQ9D 5KVGE 3LEVL 1E4HA 4WWKD 2VN7A 4JS7A 4ESKA 1CGYA 4UQ2A 4K3DL 1U8QA 1UWEL 5E9DB 1EVTC 2EIZA 1QASA 4LSPH 4BFOA 1G7MA 2PTUA 4OZ4A 1BM3H 1TXKA 5D7LA 4AQOA 1DSFL 5ISZA 4HEME 2XPGB 2NX5B 2XETA 1DO6A 3QRBA 3RDTB 4NN6B 3O8XD 3QDMA 4OLZH 1X5XA 1FORH 2XTJB 3WKML 1AXSB 5CLTA 4POYA 5DJ0A 4G8FA 3SDAD 1HZLA 4RMRA 3QJTB 3COOA 4HV8A 4Y4KA 3AB0C 5T1MA 2I9LB 1N70A 5B1BB 3NCYS 2VDOB 3ERXA 4HHAA 2EXYD 5D4JA 2H32B 3O3BB 4U6HA 3MNZB 3VW3H 2P5EA 2W8CA 4P06A 3QDGE 1FL6A 5E94A 3O3DA 3WYRA 4MD4A 2VN3A 4XN2A 1FC1A 3KWUA 1M4KA 4LLQB 2B08A 3L4CA 4JG1H 4M9PA 5DS1A 3IGKA 1FZOA 1MHCB 2KPNA 1QKZH 1EUUA 1H3GA 3RPIA 3W9DA 2Z7WA 1AR2A 4HSAC 4XOCA 4AQEA 2DWXA 1E6JL 3OHMB 4KU1A 4C56A 4JB9L 3PWVA 4PJBA 2XVLA 1CLCA 5A43C 5K9QI 1N8OE 1VGKA 4JFDD 1U6AH 3HRZA 3NCFB 1BZ8A 2ZXWB 3IDUA 4XI5C 1QFWL 5PCYA 1FGVL 1MFBL 2BP8B 3EDEA 5E7BA 4AIZA 5E4EC 4PB0L 3I6LD 1UTDA 4L1SA 3GBNH 2B14A 3MLTB 5DS8A 2X9ZA 3DDFA 4BWWA 1U8MA 1NANI 1TZAA 3U4AA 4XBGB 4I7ZC 1OOAA 2FX9L 3D06A 1L0QA 3P0VH 1KN2L 3VI3E 1L9TA 2XSKA 3EG9A 5GRWA 1DJIA 1CD9B 5JHLL 3S98A 5SWSB 4IEFB 4IRJA 2J88H 5GIRB 2F68X 1A6TA 2VR8A 1AP2B 4YHOH 4FTVE 3MRCB 3BUBA 1E9OA 2WXOA 1ZA6A 2D73A 1T80A 2EKSA 3WKPA 2ZCLH 4U1LB 4I3SL 2N0MA 3MA9L 4X80L 3CK0H 3QZOA 3NIFF 1WBXB 2K9FB 4WFFE 2HJKA 4BIKA 1NGXA 3AB0B 2F7QA 2HLAA 3C6LD 2YD4A 3KYKL 4G5AA 2XVKA 4KK5D 5DZVA 4ZXBD 1AD9B 1XH3A 1G9ML 3TV8A 5FDWA 3PQYA 1NDGA 4GSDL 5D9SB 3UJTL 5AW0B 1MELA 4GSXA 3V5HA 3NJJA 4R7DB 3WY1A 4F93B 4NNXB 4L9LB 2ZCHL 1RIVL 1MRFL 4I5BA 1JNLL 2N4IA 3O0LA 3Q8EA 4PJAF 1KIPA 5DJ6A 4U2ZA 4Z7QE 1TUPA 1SF5A 3QB7C 2EDDA 1PY9A 2GSIB 1M7XA 3WTYA 4LAQL 4Z6AT 3MCYA 4KVNL 4GMTL 4P5KB 4L5FL 1A3RH 1CLYL 3GSVB 4NPJA 5ITFB 2HA1A 4UWQB 1WZLA 5JPMB 4YHIB 2QV4A 1JPEA 2DKUA 4YVNA 3RVWD 1PX3A 1J88A 3IU3B 5A6LA 5FHAH 2PP9A 1TVHA 4PY7A 3H42L 2P24A 2BXYA 2HVJB 2NW2A 4WU5B 3PPEA 3EOAB 5D1QD 4XVJH 3MLTA 1KB5A 3DHUA 5DS8B 3QHZL 3MMEA 1MCFA 2Z35A 1VFAB 1UACL 2XQYK 3TBSB 1GGBL 4J2QA 3ISRA 4BSVA 3R4RA 1LO4L 5M94B 4I13B 2EH8H 5JTWA 2F08A 1OHZA 1RZKC 3RWHB 2WKOF 4Y16A 3WFEL 5GGTL 1ASOA 2P8PA 4N20A 4NPKA 5TQ0H 4FA7B 1FZJB 3LPPA 2OL3B 2OJZL 3FUIA 1RIUL 2EXYC 3QUZA 2XQYA 9PCYA 5D4HA 3QIWA 1HQ4B 1Q72H 5EUKA 3CVIL 3CSPA 1E50A 1F56A 1DBBL 1FI8C 4MAYA 4Y2LA 2BK8A 5D7IA 5F0PB 3IGAA 1KN4H 4X5WA 1JWSB 4PREB 3C5ZD 4NQCD 1I3UA 3TA3A 2ESVD 4WNQB 2DAVA 3I02B 3MJ9H 4U6VL 3QFJB 3NJIA 3HR6A 3GJEA 4N0YH 2MPAL 1HJCA 1T0MB 5AZEH 4H2CA 1JZDC 3QFDA 3PP3H 3TIEB 5JOFB 3LQZA 3HB3C 3PPSA 3ZVVA 1U8NA 1D7CA 1KB9K 3D33A 4PP2A 1JF1A 1X3DA 4G43B 4PVMA 1XEUA 3GSNA 3QRLA 1NC4B 4XI5D 3FYIB 4AK1A 4NM4L 1J5OH 4HC1H 4C56B 3LQMA 5ISZE 3I50H 1H6FA 2CDEB 4NNYA 1I3GH 4HBCH 4D0DA 3SDXB 3G6DL 5I6KA 4XNUH 2VQ1B 2Z4QA 43C9B 1EAPA 3GNML 4QXGH 5GS1C 3VI3B 4FQXA 5SWZA 5DJXB 1HINH 4CDGC 4Q9RL 4YO0A 2H47C 5HHPA 4YSTA 4JVWA 1U33A 5B3JF 1AYRA 2P5EE 3BZ4A 1M53A 1WZKA 1OWWA 2OMZA 1RURH 4B41A 3NIGF 1XTLA 4FQHB 1E3ZA 3GZOA 1Q9LA 1DDTA 3H9HB 3TWCH 1HH6B 4XHJC 1DN0A 1H3PH 3NZ8B 1DJGA 4GQZA 2R1YA 3UGEA 3QIUC 3EZ8A 1A1NA 1EXUA 5DJCA 5FXCH 2PCXA 1WTGT 4HU2A 4DETA 4U1SA 4XTRC 5IIEB 2VDQL 2OW7A 4I9WD 4AENA 1M2OA 1TR7A 2IQAA 3HHSA 4R7DA 3KCWA 1QTYT 2ADJA 5DSCA 4Z7NB 1OT2A 2O5XL 3NRPA 1N12A 2OCJA 3EIFA 4M1DH 5GHWH 4HBQA 2PYEA 3QUYD 2H4EA 1OT1A 2JKRM 3WJLA 4PLNC 5I15L 4FFZL 3L81A 2DQ6A 3QNYB 3QXTA 5HY9B 4GW5B 1FFOA 1HIML 5J5EA 3VWKD 1ASPA 1J05A 3WAJA 4QHMA 2ERJB 4HH9A 5CIPH 1RHFA 4PRNA 5F71A 2E7HA 4JFFE 1ESOA 1T20B 3MV8E 4KRNA 3ULVE 5BV7L 1AS7A 3QI9C 1NGWA 3GXUB 1GGCH 4Y4HC 5BMFH 2Q7AA 2C3VB 4L0YA 3L3JB 2OI9C 5IKCA 4TOYL 1KEML 1SOSA 4GRMA 5LAXA 3VI4A 4UTBH 3DHPA 5A7BA 1GZHA 3LZRA 25C8L 1KELL 1GY2A 2P8MA 5FKPA 3UJIH 2R7EA 5JIDA 2O6CA 4LLYA 3B6SB 4XCCH 5TGBB 2CRIA 2EDEA 1BZ7A 3WEXB 3ZDWA 5BRZE 3TH3T 2ICWJ 1OD9A 4M4PA 3SDXF 3HPJA 4LVHC 4CJ1A 1S5IH 2BP8A 4PG2A 3DOIA 2NNXA 3PQYE 3GSOB 4K15A 3NCJL 4MA8L 2FK9A 4L4TD 3SYCA 2UWEA 5ECGA 3BHBB 3SE9H 4IMKC 2OR9L 4EOWL 2F5BH 1QEWA 2FWOA 4AMXA 2EXWD 5E8NB 1IAKB 3QEGH 3U0PB 2CDFB 4HXAL 2A6IA 4JRFA 2J8HA 5IW1A 3KYOB 4ANUA 4AKPA 4KXAA 4AEEA 4K8RH 5K9QG 3DV6B 4L2LA 3ATAA 1BQUA 1EGJL 2OMBA 3UDWC 3X3FL 2VW7A 2NXYD 5INCA 3DOSB 1JPSH 4JPIA 3H6JA 2I9LA 4PJ9C 4YHLL 4M6ML 2C4FT 2AJVL 2ICCA 3ZT7A 4EN3B 1ITCA 1XGPB 1ZT7A 5JXED 1CBVH 1YUKB 1CGTA 2OM5A 1M71A 3JV5A 1D9KC 4CKQA 4EE2A 2DBJA 5IW1B 1GOHA 4DERA 5GS2D 1YNLL 1Z9SB 4NBYB 3N9GH 1AG6A 3OKLA 4AYEC 2Q8BH 3NEXA 3TEWA 1YN7A 1MCEA 3SQBB 2Z4TA 3IFLL 3S3CB 4E68A 2ZP0T 4R5TA 1L9RA 1FNHA 4NFDA 4ZSOE 4KK9D 3VXSB 3L16A 1OGSA 3T8XA 2X70B 3JUYA 3FL7A 2DB8A 3OHXA 1G6RB 3I3BA 3G5VB 5HJ3B 4ZOAA 3WKMH 3EBIA 4HHGA 2HSIA 1K4DA 1L6XA 4DP2X 1NLBL 1TSHA 2W1NA 3KXFA 3OR7B 3FQWB 1HT6A 3KYMB 2WXIA 2V6HA 4JKPH 4ZBJA 2AANA 2HT2D 4Z7OB 1U8OB 3OHXC 4APXB 2OMNA 2DH3A 4FG0A 2Y2WA 4X0KA 2CJUH 2JB5L 3VW3L 4PJCF 4UM9B 2Q86B 4NPYB 2XKNB 3LH8A 3TU6A 3TTSA 1I1AB 4L3EB 2VITA 2FH8A 3MFFB 3BPOB 1QKZL 5TJWK 3L1EA 4F57L 3QQ4A 4NRZB 3WJJA 3GMNB 1IBHA 4N8PA 5E8EB 1BD2B 4KKLD 5FC9A 1NMAL 3N0AA 4PJGB 3ZTEA 4JB9H 1LK2B 4UQBA 2GBAA 4U1GB 3V52H 1QHPA 4LHJB 2X4RB 1WIOA 1USQA 2X42A 2I7OA 2QHRL 1G9HA 3U30B 2X5PA 1SJVA 3FBQA 3VXME 1GYUA 4FXGA 4OAWA 4GBXC 5D7JA 2YQGA 5MEOA 4M7ZC 5DMKB 2OMWA 1RK0B 4GIOA 5FA3B 1S3KH 2HG0A 3EDJA 4KHXH 3FK3A 5FYLE 3CGTA 3EJUA 4NJAH 3S6CA 4KJQC 1LK2A 2HJLB 3IDYB 1N59A 4DFHA 3MVSA 1OLZA 4Q6IC 3DYMA 1PAMA 4XMLH 2VRQA 3MLZH 1UA3A 5EZLB 1PG7W 1NKRA 3LN4A 2CR6A 3EBAA 2WO4A 3LRSB 1HDMA 5DD1L 4NRYA 3TBVB 4JEGB 3SGDH 5F44A 1JDAA 3QEQD 1YG9A 2A9AA 4RFOL 2JXMA 3DTXA 3MV8D 2FD6L 1R0AL 3KYKH 1HXYA 4OW6A 1TJIH 3K6FA 4OGYL 1BW8A 1BZDA 5AAWA 1CZ8L 1GH7A 3OV6A 2Q10A 4QXTB 3F04A 1IGCL 3IETB 5IBUG 4Q89A 2BSED 4OT1H 5IROA 1ZE3H 1I1AC 1NGZB 3DSNB 4U1HB 3V4VB 4NN7C 4DKEH 1NCCL 3GMRB 5F7WC 3D39B 3BC9A 3OKMA 2JTDA 1ZT7B 2X12A 3QWQB 4RWHA 3QBTB 4S0SD 5FCUH 3JTTA 4IDJL 2NXYC 4G9FD 5ANMA 5IB4A 3DUUB 1CLYH 2FRGP 1HJBC 2EVJA 2ENJA 3A67L 4N24A 5DWUH 2XY1A 2HKHH 5I1HH 2YRLA 5FHAL 2WZPA 2LW3A 1QI3A 2HT3C 1I9EA 1PEZA 3SO5A 3SYQA 4W9LC 1SN2A 1BVKA 4ONGH 1MCQA 1DQML 1AOZA 12E8H 3S5YA 5KANG 4D7PA 3LDBC 4Y9EA 3ABZA 3I75B 4JR9H 5F7DA 1TZ8A 4F91B 4G8GD 2E75C 5JIHA 4MNHA 1YN7B 3SQBA 2UWEB 1O7DC 3OX8A 1ORSB 5J9PB 1I8LC 5C0CA 5J12C 3VB9A 4HWNA 3I9PA 4GUPA 2ZYHA 4O2EA 3KXFD 2P9RA 2A77L 4XODA 1AKJD 2BNRB 4P46D 1HOEA 1Z7JA 3ZDZB 4GG6F 2BWIA 5A2JH 1Y18A 4NBZB 3OKDB 1JPFA 1G7PB 5L6YH 3ROLB 4WUKH 3L95A 2QL1A 4FULA 5K39A 3Q7JA 4LPXA 2AJZA 5EN2B 3R7RA 3SHSA 1TPXB 1EZVX 1P7KB 2Y36L 2ID5A 3NSFA 4Y5XB 1KG0B 4HSQA 5CLXA 3VB8A 1CPUA 3TBWA 5E2VH 3KCPA 3SN6N 2LLNA 2X4QA 4A04A 5JXEA 1EJ8A 4HOMA 1W9XA 5CGMA 5D6DC 2AXJA 2WLLA 3X12A 1PLGL 2ZNXA 3BFQG 3M7FB 3RZCD 1QD0A 2W91A 4NM4H 5DRWA 1AZBA 4M93C 1TFPA 3KPRA 4F7CB 5T5FA 4XWGL 1KFAL 2AKRA 3OX8B 3SBWA 5FAAA 3IGUA 2CKBB 4ZO7A 3CCHA 1B0RB 1EX0A 2NY5H 2QT6A 2WSDA 3VFRB 2ZWYA 1HINL 3GB7A 2P44B 3EFDL 4FG2A 3KJ4C 4YSAA 4ZMZA 5LGKA 1B4JL 1NLDH 4A2EA 3ZYOA 4DFIA 2ZWNA 5ESVA 2C1OA 3WUWA 1A7PH 2G30A 3ES6A 3GRWL 4HETA 5I1IH 5D71H 2ZOLB 1IM9D 4YX2H 5DRZB 5EN2A 2R1YB 1RZFH 1DQLL 3MGTB 4LOUD 2J8UA 2DBLH 4NUGL 2Q7YB 2MTAA 3C6LB 1QR1A 4F37F 1GR7A 2RQ8A 4V11A 5JIMA 1P4BH 4XCEB 1B2YA 2CO7A 3L4UA 3S37X 4AUUA 2C7FA 1RZGA 5DUJA 3BDXA 4MSWB 2XIBA 3QXVA 5F89A 5J12B 1JZ2A 2WK2A 4B60A 3UTSA 3LPWA 2WYZA 1Q94A 1PFOA 4U1HA 2MH4A 3EJYD 43C9A 2MQ3A 5G5DA 4ZFZB 1TCRB 3DKHA 1XR8A 4GS7B 3BZFB 2V9RA 1GCFA 4U1IB 3EO9L 5I26A 4D9LH 3BSZH 3RWJA 5IBUB 3BAXA 4PJBB 1XIWC 5I2IB 3OXRB 1O9VA 4Y9GA 4AYID 1A14H 1DZBA 1L9NA 3TO4B 5CAYB 2E8ZA 4Q14A 1WF5A 4Q4IA 3A4FA 3T09A 5BMFL 1XDTT 4LSTL 3T2NL 2YZ1A 4UIKL 4XXWC 1FN4A 4R2GB 2EICA 2XICA 1AHWA 4LIQE 2IPTH 4BEIA 2BS8A 1Z5LA 4J3WA 4GIAA 1KELH 2H9GB 5D7IB 4QUOA 2WCPA 2AERT 3LTVA 3L4WA 1KIRA 1RMFL 2X4PB 4H0HB 1A6UH 2WBWB 4W9ZA 3NSYA 1WAAF 5H37G 3IAQA 3TO4D 4WFEE 4MDJB 4DWHA 3KJ4B 2IF7A 4AITA 2ZUWA 1UATA 3SDDC 1KSRA 3O4LA 4XAWL 4KXZI 1NCGA 1X6NA 2GT9B 2JKWA 2IH1B 1DL7L 2HZHA 4MD5A 1O7VA 3MCLH 3V4PL 2VLJE 4F7TA 3P77B 3ARGD 4E9TA 4QJ4B 3O8XC 3EYSH 3GFUA 2RR3A 3GHBL 3KE0A 3EOAA 3PREA 1OGTB 2AK4D 3IDMA 1F1DA 3FQ4A 3PQYD 5DDHA 1CICD 3MV7E 2XG5B 4LQ1A 1AO7D 1DJSA 4UNTA 4FNPA 2XTSA 3GBDA 1A4BA 1NFAA 4N2OA 2D3LA 1MEXL 1P7QD 2X89D 4IIQB 3P4OB 3IGAB 4X4ZA 1JPSL 3HRZC 3N1PC 5HHOA 3PHOB 4MQXC 4Z76A 1NUFA 3SB3A 5IREA 1O5PA 5MENA 1HH6A 3JVFC 3WE6B 4AGPA 5T3ZD 2AC0A 3IRZA 2ZXQA 3UEZA 2SEBB 3E9UA 3ZE0E 5MERA 2ZKXA 4CMHB 1RSYA 4I3RH 5D5ME 3BWAB 1JPTL 1MAKA 4M1CD 3V6FB 1XF2B 1A47A 5FUCC 4XCNA 2XPZA 5DCCA 4Q97A 1WWBX 3H2QA 5CZXD 2HRGA 3G5VA 4UT7H 2EEFA 4LRIA 3A24A 2NUTB 3KHOA 3R1GL 3QS3A 1M7IA 4LCCB 1S7QA 3TPKA 1BZOA 3TBTA 1ETZA 4KJYB 3UERA 4XNXH 3ZE0F 4N28A 3CD4A 1MCOH 1P6FA 3G6JA 1SVCP 1YMHA 1ND0A 2WZ6A 4I18A 1FL3A 4TVUA 5H35B 5JDSA 5T1LB 3CZJA 4HWBH 3V0JA 2C7UB 2NY2B 4P5KA 2DQDH 3PWPD 1YYMH 3MRRB 3T2QA 5SWSE 4BKSC 1YDPB 5B1KA 3H9HA 1F41A 2YSSB 1DUYA 1G7QB 4YPJA 2CM5A 4JFDB 4BZ1H 4W9JC 3DGDA 2DQHH 4AL8L 3CDYA 1HNFA 1CR9H 4MD0A 5TK2A 1P69B 5F7EH 3QIWB 5D8JH 1MWAB 2ED8A 2AHIA 4KBPA 4DGWC 3QIBC 2Q20A 4DO5A 2I27N 5FYJL 3O8XB 3NT0A 2WQXA 2H8PA 2ARJQ 1G1CA 3BUPA 1A4AA 4OGAC 3NFSH 5C9JB 1NCAL 1GZHC 3LH2L 2K9UA 4IIQC 4YDNA 3HRZB 1IQWH 2HFTA 5D1XE 3SY6A 3WKNA 4KJPD 3D2TA 4F7EB 1TMQA 3IYLW 4OUOA 1EO8L 5GRXG 3T0ED 5A2FA 5LXGH 1ULVA 4S1QL 5LGHH 2G3XA 4HAGA 4KKAD 4DVBB 3W1ZA 4H1LG 1MCLA 2Y4SA 4LLDA 4N2HA 4CMHC 5HHMB 4PY7B 3WXVH 4DPAX 1KLUB 2Y1YA 3P2BA 5HJBA 3L1OH 4HCIA 5HDLA 5IVNA 1HKFA 2UVEA 1WISA 1AP2A 2ZF9A 4LDEB 4ZFGH 2ATAA 1WIPA 3MOQA 3VI4B 2XN0A 2B9BA 4IEFA 2WP3O 2X10A 3DIVA 3TBCA 2OTUA 4UBDD 5GRZA 1EFXB 2H3NB 3NJKA 4PJDB 4ABQA 4C56E 4Y8AA 1BYNA 4WK2B 4DTGL 5HHQB 1OCCB 3RWEA 3SE6A 2ICEC 4LCWE 2EUZA 3IPBA 1DVFC 1PIFA 4HIIB 1T83A 4G8FB 5HGDB 5C8JA 3NJLA 3RWHA 4AY0A 4BELD 1NC2A 2GTWB 4JGUA 5BRZB 1SPDA 4P3DA 3DO3A 3O6KL 3G6JB 3GZPA 4PJCA 3CHPA 2P42B 2OW6A 1YQ2A 5JR1L 3PQYB 3HMWH 4Z7OE 1Q38A 2IH8A 4J4PC 4ENZA 5DHDA 5SV4A 3S2AA 3OPZL 1N6UA 4MQSB 5HVWA 1BZ7B 1KCWA 1SHSA 3P9WB 4YHMH 2NOYA 5JORA 3PAYA 2CO6B 2ZXGA 3HBGA 3IDIA 3RUGF 3WEOA 3WGVB 2G3NA 1AGDB 5BW7A 7CGTA 5LCVA 3S34H 3UBHA 2BRRL 3D9AH 1OP3H 3QA3B 1RCYA 2X0WA 5C08B 1CDCA 3BVNA 5C2UB 3W2DH 3QFGA 4WNJA 5CEZE 5JIKA 3HNTL 4NX0A 1DQKA 4F2MA 1I8IA 3L3OA 4TNVK 4QAMB 3RDJA 5JQ6H 1AGFA 3EGDA 3JWNH 1U8JA 2X4NB 4KUCD 1DQMH 4M1CC 4LHUG 4LLMB 1X9LA 1AJ7L 4DQAA 3B1TA 3MLYH 5CZXC 1FRGL 1RY7B 1Z0MA 4JKLA