3KBEA

Metal-free c. elegans cu,zn superoxide dismutase
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
157
structure length
140
Chain Sequence
SNRAVAVLRGETVTGTIWITQKSENDQAVIEGEIKGLTPGLHGFHVHQYGDSTNGCISAGPHFNPFGKTHGGPKSEIRHVGDLGNVEAGADGVAKIKLTDTLVTLYGPNTVVGRSMVVHAGTGNAGARAACGVIALAAPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title X-ray Crystal Structure of C. elegans Cu,Zn Superoxide Dismutase
rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
total genus 33
structure length 140
sequence length 157
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3kbeA00
4A7UA 1XTLA 1COBA 1UXMA 2VR7A 1SOSA 1B4LA 3LTVA 3GZPA 1OEZW 3GZQA 1E9OB 1E9OA 1SDYA 1SXBA 4B3EA 4N3TA 1E9QA 2XJKA 2Z7WA 2LU5A 3HOGA 1Q0EA 1SXCA 3CQPA 1PZSA 2GBVA 1FUNA 1IBFA 1UXLA 2AQSA 2GBUA 4A7GF 3GTTA 3KM1A 3ECUA 2ZKXA 1BA9A 2VR6A 4MCNA 1SPDA 4OJAA 1JK9B 2AQRA 1ESOA 1TO5A 4L05A 2V0AA 1F1GA 1EQWA 1SDAB 2WYTA 3KH4A 2WWOA 2WWNA 2Z7ZA 4U4IA 1IBHA 5KBKA 1SXSA 1AZVA 3T5WA 4FF9A 1OAJA 2WZ5A 3K91A 4BD4A 3KM2A 4A7TA 1CBJA 2AQQA 1PU0A 2AQPA 1SXNA 3SODB 1YSOA 4N3UA 3CE1A 2XJLA 3HFFA 2AEOA 2R27A 2AQTA 2WKOF 2Z7YA 2AF2A 2E47A 1XSOA 2WZ6A 3MNDA 2APSA 2ZKWA 2C9UA 2JLPA 1JK9A 1BZOA 1P1VA 3GQFA 1EJ8A 1PTZA 1SXAA 4A7VA 1B4TA 1U3NA 5KBLA 2ZKYA 2AQNA 2K4WA 1KMGA 1TO4A 2JCWA 1DSWA 3HW7A 2Z7UA 2ZOWA 3GTVA 4A7GA 3MKGA 3KBFA 3QQDB 3KH3A 4MCMA 1QUPA 2NNXA 1IBDA 3L9EA 3S0PA 1YAIA 2VR8A 1E9PB 1SRDA 5KBMA 1IBBA 1N18A 2WZ0A 5CU9A 4A7SA 1L3NA 3ECVA 1F1AA 3ECWA 1F18A 2C9VA 1JCVA 3RE0A 1Z9PA 1MFMA 1RK7A 3PU7A 4BCZA 4A7QA 1OZTG 4BCYA 1HL5A 3KBEA 1XTMA 4OH2A 1F1DA 1E9QB 1HL4A 1IB5A 2WKOA 3L9YA 3CQQA 1Z9NA 2Q2LA 1OALA 3H2QA 1DO5A 1OZUA 3F7KA 3QQDA 3F7LA 1S4IA 2E46A 2SODB 3GZOA 2C9SA 1YAZA 1N19A 2GBTA 1E9PA 1SXZA 1CB4A 2WYZA 3H2PA
chains in the Genus database with same CATH superfamily
5C0BB 3STBA 4YX2H 3WS6A 4IOFC 4IRSD 3LRMA 1IKOP 4CDHA 5EUOE 3P4LA 3NRQA 3E7JA 1QAWA 2PUQT 5E8OB 4YFDB 2V9RA 3P9LA 2VLJA 2IAMA 1SXBA 3KPQA 4KJPC 5GRUL 4XNZC 3HN3A 4KVNH 5F7LB 1Q90A 4NQXA 4C4KO 3T0EB 1DBKL 4D0BB 5DD1H 3J07A 3KM1A 3MUZ1 5CZVH 2ZE0A 4HWNA 4JREB 1M9WA 1YPZE 3UP1A 1QFUH 4KKCD 5JXEC 1HHHA 2JQMA 2Z1KA 3RGVD 4M4RA 1ZEAL 5CEZL 5GS2H 1FH5H 5C7XL 3EH2A 5F9JA 5IF0B 2R69H 2PN5A 1DZ0A 2BFVH 4FXKB 4Y0GA 3K91A 4UT7L 5C08D 4BZ1A 4XP9H 4L8SA 1WEJH 2HT2D 1EJ6A 5CCHE 3SODB 2CGRH 3ARBB 4PD4K 1OCWH 4PP1C 5D7IE 3FT3B 3L4ZA 3MREA 3RVUC 3ZYOA 2EE3A 2B7DT 5J8OA 2E9BA 3JV6A 5A6IA 1M7IA 2DQHH 3N41F 4N4YB 5GGRY 2D0HA 4IKJA 3KJ6L 3O2WH 2KBGA 2B1HL 4K2UL 4PU2A 4HDIA 4BA8A 4ZMYA 1YNLL 3RDJA 4U1HB 4AJ0A 4OCYH 1TQVA 3GXFA 2DI9A 1ZANL 3HMXA 1DQLH 3NZHL 3CGTA 2DDQL 2FE0A 3MOAH 3UZEA 4MYWB 5IFAH 5KYWB 1ZLEA 1F8TL 2OMUB 3L9EA 2DTSA 2VDOH 3PUCA 5C08A 1NIEA 2D0GA 2WJ5A 3ECWA 4KTGA 4RRPA 3Q13A 2IXQB 3H3PL 3LRSB 3MACL 5MEQB 4EDXB 4OGYL 5D5ME 1F2XK 1V05A 1MEXL 3ZTNH 4IKKA 2K9UA 1H5BC 3FUDA 2X87A 5E6ID 3P40A 4NKOA 3D34A 3U6RA 1TTCA 4U1KB 3UG3A 4XPTL 3REWB 2VABB 3VH8G 1CBVH 2IH3B 4I48B 2JB5H 2B1AL 1ND0A 3P77B 3QAZB 2VDLL 3EYUH 2P5EE 2KZ1B 1KXTA 3H85A 3FXIC 4PG9B 4GXVH 1UB5A 3VFSA 4I77H 1NC2D 3FN0H 2FJSA 4TL5A 2X4QB 2R0ZL 1OPGH 4FZ8H 2VMFA 3W11D 4PWKA 3GZQA 1F3JA 2D9CA 3OWRA 3Q1SH 1PY9A 2LTQB 1P9MA 5IJVA 3BP4B 3EJCA 3W1ZA 1QWNA 1S5IL 5DZ9A 4Y4HA 2DMGA 5DRWA 4JPVL 3V6ZA 5IOPA 3IVKA 2G3XA 3HG4A 3P11H 3TYFB 3VQLA 5E6IA 1A9EA 5HDBE 2CHNA 4KKBD 1U8LB 3QQ3B 4H8UA 5IBTL 1DBBL 1DLFH 2W0PA 3HHRB 4HWEH 4FXTA 4I18C 2VSMB 2ADJA 2XU9A 1H8LA 2K4AA 4XPFH 4L29B 3LSOB 5JA8B 2VKXA 1I1AC 1A1MB 4TULL 3H55A 2NW3B 4FZEH 4HIXH 4M5SA 3VSQA 1BEXA 1NC2A 2DPKA 4JQXC 4HJJH 2R2HB 2DBLH 2NY0B 3FB7B 5HI4D 3QZOA 4P3DA 5CWSA 3VFUA 3FU7B 4NAMA 5J13C 1G43A 1BAGA 1WDAA 2WNGA 2Q7YB 3GBLA 1OB1B 2VMDA 3M6DA 2APSA 4XR8C 4JN1L 3BIAX 4AIZA 4X7SL 1KBBA 5DTFA 2X4TA 4P48A 1MCPL 5EUOB 2R4RH 1OAZL 5T5FL 5IHHA 2IADB 2JKTM 2K4WA 1S9YA 5TFSL 1KGUA 2YQGA 2DQTH 3MRPB 3R06A 3PABA 4WK2B 5I1LB 5IMLA 2AJUH 4DAGL 1BQLL 2ZTBA 3LEVL 2YGNA 4AQ1A 4X8CA 1I8LC 4ZDHB 4W9DC 3DI3B 5FECA 1HI6A 2ZYIA 3PL6B 4FJ6A 4OAWB 4L0YA 1JJUA 1VADA 4M1DL 4CKQA 2A9DA 4EDWL 4ZMLA 2L7UA 3K6OA 1TQCC 1BOYA 3SDDB 3EXLA 1IGJB 1ZV9A 1ZIBA 2EEAA 1TU2A 5DK2A 4HU2A 2YSTA 3EBAA 3K3QA 3ASNB 4GO6B 3V8CA 4P4KC 5D7IB 2I9TA 3QR1A 1DBAL 3S4SB 3VB9A 5A7EA 2E56A 1N8ZA 5HHPB 4HFUL 5TE6H 1JFQL 2IQ9L 4MJ2A 1NCOA 2AMUA 2D9QB 3U2SA 5HSFA 5EIIG 1QABA 4WIQA 2YWZA 3H4HA 3RKDC 2VZ1A 5F3HB 3W37A 2YPLD 3X1GA 5DFAA 4MWFA 3TBSB 2IGTA 1XGPA 2V2XA 3GEWB 2ZKMX 2NUTB 3ZKMD 5J1AA 4AEIH 1GJWA 2VERN 1LEIB 5EFIA 3A3YB 3VRIB 3AG3B 1RPUA 3AY4A 3ARFD 4MQTB 3DTXA 4OUUB 1EHAA 5L7XL 4OLYL 1EHKB 1UD2A 3QUZD 5AENA 5T3XL 5IB3A 3IGKA 4AC2A 3KPOA 1JF1B 2D03H 5AW8B 1LEGA 4KI5E 4PG2A 3ZK0A 4MA7H 1OSYA 4N25A 4KKZA 4QD2E 5C09B 1F4XL 4DVRL 2XETA 1E2WA 2ZIDA 1TVDA 1XT5A 3GEFA 4MNGB 4NM8L 4OIFA 2G3ZA 2AK4D 5JIPA 2X88A 4G9DA 5LGJA 2YPLA 4MB1A 4EIGB 4MTMA 1KLGB 2JKXA 2N59A 3VWKC 2CE6A 1FWXA 4HH9A 3QQXA 4ZD3H 2FIKA 5DMKA 5IZ7A 4FNLH 3AU1B 4PJDF 5C0JA 3S36H 2YQ3A 4FQXB 4EUPB 2P5EB 3ARFA 3U30B 3NFNA 1EUTA 4Y5VB 6PCYA 2APXA 2L7JA 5ICXB 4DPCX 3LKRA 5DA4A 3KDMA 3QUZA 5CUSH 5F1SA 3VGEA 5A2BA 1YEFL 3K71A 2VIRA 3DIDA 5EPMA 1MCOH 2VWEE 2Q6WA 2ZX6A 3BT2L 2IVFC 2OMXA 1KBGL 2CPCA 1RZFL 4UILH 2VN5A 4J3VA 1AH1A 2UXTA 4HC1L 1FRGL 2BZCA 4XRCA 4Y16B 4HBCL 4XXCC 4NWUH 1GYWA 5HVHC 4ODVL 1UUNA 1AGBA 2XWZA 3ISYA 1T6WA 2AK4A 3S0PA 2CHWA 2FECL 2W5PA 3LMJH 3BLBA 1OOAA 3I9AA 1KYOJ 5HDBB 4B95C 3D0LA 2UX6A 3MA9L 2NY6B 3BYYA 3LIZA 4FNUA 1D5IL 4RA0C 3SDAC 5D7KE 2JF1A 1C08B 4NGHL 1GSKA 3FT2B 3AB0B 2BHFA 4PJ8D 4F37F 1X5LA 4NUJB 3BJLA 4JZNA 4P5MA 1ZA6B 4YDZA 1IGIL 4LKCA 4LCWB 4WTZG 4WRLA 4PRPB 3EDEA 5DS2A 1E9QB 5CD3A 1J0HA 3TPKA 4PRIB 4PJDA 4PVBA 2X38A 2NNAB 2QV2A 1KGXA 4HD9A 3MV9E 3BDXA 4AGMA 1SHSA 3OKOA 4GAAA 4ILDA 1T83C 3D69A 1I9RH 2QR0A 1Z5YD 4S1DC 3VXUB 4EBQL 4NKQB 3MCYA 4NQED 4YPJA 4HJGA 5B8CB 4K94H 1T1WA 1WZMA 4HXBL 4WJ5A 3V9CA 1TUPA 4MB5A 1TZAA 1GW6A 1IBZA 6FABH 2KH2B 4OLVL 1JZEA 2UYLA 1TPXB 1U8JA 3KW8A 1GC1C 1A7OH 1G6RL 2F1EA 5D6CA 1OM3H 5DR5L 3DHPA 4R3SB 3T8XB 3LEXA 4QWWD 3ILEA 1XMEB 5E5RB 1J5OH 1QWUA 5J6SA 4WEEA 4WHDA 1DTUA 3WKQA 2OTUA 1PLBA 2YEZA 3B43A 4J8RA 3X12A 4DCQB 3QXAA 3ARVA 4M48L 5HYSB 1DSFL 2G2RB 2EXYD 4E42B 3WKML 4ELMF 4ICXA 4O00A 4QRFA 1MRFL 3CHPA 4LSUL 1JK8B 5I1CH 5KVGE 1EA9C 4U1IB 2EDRA 2I07B 4MJID 4JVPA 2VITB 5BJTA 4YXHL 4KJYB 3IDGA 4ZUVA 1NMAH 5ALBH 5GRWA 2CH8A 4BK5C 3E6HA 1A7RL 4BD4A 5AKRA 2BLFA 3CFTA 2EEDA 4OT1H 1J0ZA 4YX2L 5AVSB 4LAJH 2A4EA 1FJ1B 4KROC 2Q20A 1WITA 3QXDB 1DL7H 3NA9L 1QNZH 4Q4EA 5EU6E 3Q7JA 5FKAB 3BPCB 4CSSA 1QZNA 3X13A 3GSOA 5HPMA 3SBWC 3F84A 3NQKA 4KVCH 4KVNL 4AZ8B 1B6UA 3N1PC 5IVXE 3MRKA 5DD1L 5CZVL 3N1FC 3WTVA 5F9AC 5E94A 1QFUL 2WSKA 3K7UA 1U4EA 3K6SA 3DRQA 2H3KA 2VDKB 1A9VA 1LMIA 2FJFA 4MJIA 2YEQA 4LNRA 3NFPA 1JAEA 1FH5L 1LO3H 1RZ8A 2P8PB 4Y5XA 4Q8BA 3MRBB 1ADQH 2AC0A 4ELMA 3NZ8A 4NCC2 3D0AA 2BFVL 2NY3D 1E5YA 3MV7D 4Z7UE 4BZ2H 1RULL 2NRDA 4LAQL 3OHXC 1P7QD 4XP9L 4XNMB 1OP4A 4ZFZB 2CGRL 2X70A 2DKMA 1OCWL 2XKSA 4PH8A 2YOCA 1BWWA 3BKMH 4JFVA 1VLXA 5CJQH 4N0CD 4P5TC 1EO7A 2Y7QB 2DQHL 5JPMB 2KT6A 2GJZB 3O2WL 5HDQH 1GGIH 3DX7A 3VG0H 2V9UA 3IKKA 4LVHB 3F7VB 2ADIA 3BGMA 3AFLA 4OCYL 4OZHB 1JZ6A 1W15A 3DGGB 5F8RC 1KIRB 4PLJD 5DURB 1DQLL 2HX9A 3U1PA 1BVKA 2G0LA 2HRHA 1T7XA 3MOAL 1AANA 4Y2NA 5IFAL 1G4MA 3IDXL 3T8MA 1B88A 3VDCA 4KUCF 1LDPH 5SV4A 4O2FB 3FO9B 3MV7A 3CVDA 4D0CB 2VLLA 3PJSA 1P7QA 3ARGC 4KGLA 4DUVA 2PWFA 3KPSA 1UCBL 3CN4A 1I8KB 1IEBA 1J9RA 3AXHA 3FTGA 3QIUD 5GGSY 1A1NA 4KUCD 7CGTA 2E7MA 5BRZD 2MKLC 2MJWA 5B1AB 4LHUG 4MRBA 3KPRD 3C5XA 3SY0A 4C54A 2AEPH 3H9SB 2MNWA 2DN7A 1J0JA 4JN2A 3UZQB 1ILUA 1CBVL 3NQIA 2WLHA 1V55B 5BO1H 1RSYA 2A83A 2JB5L 4JMNA 2APWA 3D09A 1KJ2H 4DZ8B 2R9HC 2YS4A 1X4ZA 4H1LB 1LM8V 5LLIC 4Z3JA 3EYUL 3Q2LA 4UDTB 1SHWA 4FLRA 4L4TD 4EIUA 4JPWH 3ULUH 4XO5A 4I77L 3MV9B 2X05A 1Q4NX 1OD9A 3D51A 4GSDH 1OPGL 3JV4B 1SYVA 4FZ8L 1FNGB 1T5KA 2ED9A 2FYYA 4LCVA 5CP3A 3Q1SL 4UQEA 1F45A 5BRZA 1U8OB 1TVBA 2JLPA 2BSSA 3KPRA 3IDJA 4GBXD 1A6AA 1U8NB 2I9LB 2WSPA 5JXAH 2WCGA 3CV5A 3EDKA 5INDB 2PO6C 2X1WL 3EKCA 3P11L 1JG9A 4DSYA 2Z35A 2D7NA 4YWGH 2VGLM 5KVFE 4HJEA 5D6DC 3AU0A 3BZ4B 2X4NA 1E43A 3TCLB 5KUMA 4HJUA 1T5WB 4U3XA 5IEHA 4HWEL 2DLFL 4XVTH 1ZVSA 1E9PB 4K8RL 3I50H 4LLYB 1CIUA 3QZWG 4DP7X 3CFJB 1G7QB 4Q4IA 1ZLWK 4JL1A 1K6QH 2Z8VC 2H2SC 3CVIH 4FZEL 2PCFB 2ZICA 4HIXL 4UOW0 3TJEL 4BBWA 1WGOA 3Q9PA 4HJJL 2DBLL 2JELH 3GSNB 4M1CC 4KGJA 4AQEB 5CM1A 1JGEB 2R59A 1G9NC 1NFDE 5F1NB 2V6HA 5K1VA 5A40E 1B2WH 1XBDA 3EGDA 4OH2A 3C8KB 1MUJB 1UA6H 3MLTB 3SO3B 2H1PH 3BDBA 4YR6B 5F7WC 5AVVB 4EUPH 3QCTH 2VXTH 3IXAA 3KLQA 1XZ0A 1NBVL 1OTUC 4HJ1A 1J9TA 1PBYA 1TYJA 2R4RL 3QRLA 4NX0A 4TUJA 3FCSA 1GGBL 3WG7B 4P46B 4HFWB 5B38G 2DQTL 3C60C 4NYLA 4YBQC 1Y7VA 2VAAB 2AJUL 5GS1A 4G5ZH 4E9VA 1KCVH 5I71B 2JI2A 2JIXB 3TIDB 5IVXB 3T65A 4GJTB 2O61B 5DFVD 2HVKA 3BGFC 3O2DL 4QYOB 1M7DB 5FO8B 2QQLH 3QB7C 3SDCB 4CA4A 5GS0D 4Q52A 2F8XC 4CW1B 2OW6A 4QF1A 4F15C 1OP3H 2LLLA 1QBMH 3DX1A 3LH9A 1FDLH 1ZA3B 3EUDA 5FW8A 3W56A 3GLZA 3MBEA 4N8VG 2DYPB 4N8PA 5DSCB 1L0QA 2EDEA 2P5WE 3EOAA 5E5MA 1JHKH 2DIEA 3PPSA 4MJ6A 4YSEA 4K7PH 2XTJD 5F7EH 4Y19B 3RGHA 5KYNA 5DHDA 2YZ1A 4XOAA 1IAKB 4CJ0A 3QJUB 1JPGA 3M7FB 4KJQD 4NOBA 2W59A 5TE6L 3TO2B 5ADOH 3F5WA 4JM2F 4FG0A 5FIEA 1XAUA 1TSRA 2PW1B 5HYQA 3IKCB 1WP6A 4NN5B 2HFFA 4FFWD 5J9PB 4NZJA 3S96B 2WBJA 3K1DA 4HCFA 1EBPA 2JXMA 1O6TA 2YPKA 2WW8A 4YHYC 3WNJA 1VDGA 3ATBA 4LCUB 2F19L 5HYJE 5LNDA 4I2XA 4LARL 2VLKA 3GZKA 5EG6C 1EERB 2FVNA 1R3LA 1WJ3A 3TEZA 1IAIH 3EYVA 1X5FA 3MCLH 3K6NA 4F3FB 3DURA 3ZE0B 4QHUB 2V7NA 1LO5B 3JT0A 2B08A 3M88A 5KJ7E 1KCUL 5AOKA 3UPAA 4LRIC 4PRHB 4YSTA 3WXWH 1F4YH 4MZ2A 3F58L 1QFWM 4MA7L 3CBRA 1TZHA 2OKMA 3AC0A 3GMLB 2UVFA 3L2MA 4I0PD 4RFEA 1R3KA 5DUMH 5DZJA 1MFEH 5EIIB 2JI3A 2O5YH 5AZEH 3VVWA 1FAIL 4I85A 4OGZA 5T1MB 2VB5A 3MI6A 4GKLA 4D8OA 3WJLA 4JANB 4KDTA 3IB4A 1IKNC 4FCAA 4HIHB 4IRZH 4U1LB 4JM2A 2BSRA 2XWJA 4ZD3L 1B3IA 4FNLL 5T3ZD 4QY8A 2ITCA 1OF2B 2E3VA 4P4RA 5IM7A 3P4NB 4ZXBD 4P5KB 3NCWA 1IM9B 3MCKB 1SVCP 4X98B 5GRYA 3U2IA 2J44A 3DUSA 5CUSL 3VXQB 2DMBA 4N90E 1NBCA 5ISZB 1MCOL 4HUUA 4RGNC 4Y2OB 4I13B 5EOCH 4JDZB 3FQ4A 2HPOA 4I0PA 1Q1JH 1UB6B 1HCVA 3VX1A 4NQTA 1BMWA 1P4UA 4NWUL 1JD7A 1WH0A 5IVZA 5HJBA 1ECZA 1ZWIA 1CURA 1ZOXA 2C9AA 2R15A 3LMJL 3MNZA 4G59C 4YXLL 1FZKB 1CFTA 4IGBD 4R97C 3BGAA 1UOKA 3OSKA 5ICYB 2OZNA 3K6FA 1MXDA 3ZVVA 2IDFA 1R5WB 2DQIH 1RK1B 2WD0A 3JQOB 4X6DE 5ALCL 5HJGA 1S9VA 1DANU 1TEYA 3TIEA 2QGCA 5KZCB 2VW6A 1X6LA 3TWCH 4AV5A 1JVKA 3EZJB 3PNWB 3ZKQD 5L88H 3K6IA 5E0FA 4ZXBA 1L7TH 3KR3H 1G7PB 1EEYB 2FEDD 2H32B 3RTLA 3G04B 5KN5A 2CO4A 2A4CA 5A43C 4H8PA 1TMQA 5KYUA 4L1TA 3S48A 2V9QA 3BRGC 5TE4H 2YN3A 2NXZB 4PRBA 1USZA 1NFDB 4G1EA 2ZOKA 2FEEL 1I9RL 2YBRA 3OB0K 4ZUUA 5AVYB 1T6VN 3ZOAA 5I19L 4JHBA 2FBOJ 4Y4KB 3C9NA 4YXKH 4ZS6D 3UAJD 2HH0H 2CDGA 3SPGA 4HOWA 5A2CA 5HDOA 4CNIA 4YHIA 3S36X 4F20A 4I3SH 5IQLA 4XC3H 2VZTA 3FT1A 5EWIL 3TZVB 4FHBD 1A7OL 1OM3L 1BZOA 4ZAKD 5BOZG 5B7EA 2FO8A 1A2YA 2HX8A 3LEYL 4HT1H 5KANG 1W8OA 1LK2A 4WWKC 2V8MA 4PBVC 3M1OA 4HYTB 3V6OE 2EDNA 2MQCA 1YN7A 3BYTA 5E6ZA 2EDLA 5I1CL 2Z93A 3L3OA 1BAWA 1A3ZA 2YKKA 2P5WB 4GI8A 3QR2A 4NS0A 4RVBA 4JFEB 1NMAL 1R9FA 3FT4A 4UTBH 3UMTA 2DMHA 1P7KA 2K8QA 3KPNA 4LLWA 3UAJA 3L4YA 1VZIA 5FUZH 3SDXE 1RIHH 1FO0B 1RK7A 3WXVH 4JJ5B 1F5WA 4A7QA 3FUEA 2OMTA 2UY7B 2BHYA 3TVMC 4HIEB 4YSDA 2CUMA 4ZAKA 1DL7L 1QLEB 1QNZL 2Y69B 2IG2H 1J87A 1QLRB 2GCYA 3ZL1A 2HVJB 1ZE3C 3MV8E 2AEQH 1KWGA 4OFIA 3CDZA 1QQDB 1E6JL 3U82B 4KVCL 3L45A 2HLEB 4U1MB 5DJ0B 5FDWB 4N6RA 5HYJB 3ZDXE 5KVDL 3RU8H 1RZGA 3EHBB 1TTRA 3PWLB 4S2SB 4Z7VE 1MRCH 3MRNA 3GMPA 3T4YB 5L2JB 4B27A 4OI9A 3GUTA 3QRGH 2FQFA 2H1LM 2E7DA 1ADQL 1F6AA 2BNRD 2CKBA 5ETUA 4IHBA 3DX6A 5AYUL 3WEOA 4OGAC 3RX7A 5LUMA 4PJXE 1BXVA 2BHZA 5ANMA 4BZ2L 3WI9A 1DE4A 3BHBB 3B7TA 3ZGIA 2X4OA 3RDTC 4LKXB 4BWUA 1BM3H 1CTMA 5E2TH 3PWJB 3M8OH 4KK6D 4JZOA 5CJQL 2D3VA 2K78A 1BA9A 2VRQA 4H44C 3SQBB 5KVGH 3ULVH 1J9SA 1Z9MA 3IJYB 2OMYB 3KLHC 3WLBA 1AKJA 1GGIL 4DEWA 4JZJB 4HV8B 3SCMC 4GKZB 3VG0L 3FF8A 5FA4B 1N3NB 1N67A 4NENA 1RZKH 4DIXA 5DEJA 4CRPA 4K5MA 4GY4A 1T04B 4W9IC 3VWJD 4Q6IB 3WJMB 2BSDA 3E1ZA 5L4IA 1VFUA 2BNRA 1NAMA 1GCFA 4GMTH 4APQB 1F3RB 1LDPL 4N0YL 4AMXA 2PWEA 1ZHBB 5L0QC 5L8KB 1OLZA 3NIGE 2F54E 3TBWB 2YAFA 3PGFL 1ET8A 3QS2A 2YAEA 2FJGA 4JFHD 3PWVB 4YDLB 2B5IC 5CCJA 1AHWC 3RZCD 4U3CA 3T6ZA 3EYQC 4ERSH 5LDSA 4RIRA 2AEPL 3CK0H 2FGWH 2ZKYA 3D85D 4KOBA 4QTIH 3FUIA 4XXWC 5ESQB 2ZOWA 3UGUA 2BOBA 2JB6B 3IDNB 1KELH 1CE1H 1T7WA 4IIQB 1LE5A 5BO1L 5FA3A 2RCSL 3VWJA 3WEBA 4ODSH 1KJ2L 3FO1A 1SDDB 1CL7H 1DFBH 1LVEA 1UGNA 4KWUA 1HJBC 3QFDB 2DLEA 1W72H 3ETTA 3OXRB 4NT6A 4R7XA 3COOA 1U8QA 1A1OB 4U6TA 4GSDL 3IMBA 2EVGA 1ZPUA 4XB8A 1UATA 5ACZB 4M5ZH 4XGZA 3RZCA 4MD0A 2OSLA 1DCLA 2HAZA 3IJ8A 1KIQA 3NJNA 1MWAA 4JO2H 2AAAA 2EE6A 5JXAL 4PS3A 4CDGC 3CU1A 5D1XE 3GNMH 2C9SA 5IG7B 4PJHF 4YWGL 3DV6B 4PJGE 1NCIA 1ZLUK 4GXUM 5GSVA 1WZAA 1AGFB 2MNJB 1F6LL 3ROLB 3DECA 4HF5H 1MHHB 5IUCA 1COBA 4M1GH 1UXMA 4XVTL 1YMHA 2WLLB 3A23A 4KK5D 2DQUH 2HLFD 1O7SA 2X28A 3BEWA 1B4LA 3I50L 1U93A 2OCFD 3SBPA 4EN2A 4L3EB 1B4JL 1F11A 1K6QL 1P4BL 3CVIL 5K39B 3TEYA 4YHOH 3OX8A 2CJTA 1HHJA 2H9GA 2JELL 5FGCB 1E67A 2OA9A 1FYTA 4AGPA 1LWHA 3BZDA 4XVSH 2Z8SA 2AXHA 4FTVE 2WUCH 2EE9A 1N26A 1VIWA 1UA6L 3RUGE 5FEBA 2VR5A 2H1PL 1UQSB 3KWWA 1U30A 3QCTL 4QCIA 2EDHA 3D3VE 5CN3A 1UKSA 3MUY1 4NLAA 4UAOC 5C8JA 2GJPA 4XX1E 4WUUA 4X50A 4AMKL 4PJHA 4NO3A 4WNQA 4G5ZL 4N2AA 1KCVL 3HFFA 5HGHB 1JTPA 3ZDXB 2L7QA 2YAOA 3VFWB 3UTTD 1HNYA 3E6FB 4A39A 1T89C 1IQDA 5FUCC 2DQGL 2JJVA 2QQLL 3WDHA 3ZX1A 2NY2B 3O9WD 2AZUA 5CN1A 2VRKA 3V5KB 5KVFH 1G1OA 4UQAA 1FDLL 3C87A 4PJXB 1XVSA 5EB9A 4ZW6A 4D94A 1EJFA 3MXVH 4FFYH 1FFTB 3N44F 4R0LB 4QRPE 3QJQB 3RVTD 3HHSA 3KNBB 4Z7NF 3ATFA 2UZYB 1FNAA 4RFNC 4WV1A 5B38B 1RQ5A 5ADOL 2AI0L 2WO4A 4YN3A 3O3BB 3U0TA 4OZGE 1CICB 1PFOA 3V9EA 2XIDA 5FGBC 2F15A 5D7JB 2NDGA 1INEH 5IT2H 2EIZB 2X6AA 5C0GA 1AFVH 1BZ8A 4JHVA 3UTTA 5L2KD 1T21B 4HS3A 1KN4H 5LN8A 1UG9A 3BUTA 3O9WA 5FYKD 4RAUA 1AQMA 1RJCA 4AUYA 3DC0A 2Y7SA 2ZSVA 3ARED 3QT2A 2ATPB 3MBWA 2DL9A 3MJGX 5AVRB 3ZE1F 3U48A 5F9WB 5J6HB 1DJGA 3NIGB 2F54B 3ALPA 1J0IA 3FB6B 4MCYA 4R2GD 3DJ9A 3WXWL 1F4YL 3GSWA 3L5XH 4BSWB 1HH6A 5JPNB 5LVEA 3L08A 4P2YA 2XX0A 3UCRA 5DUML 3PWPE 1MFEL 2EEFA 2RA1A 2O5YL 5L9DH 1TTFA 4J2XA 1B0WA 4M8QA 2BZDA 2Q0ZX 3L3JA 1B3JA 4MMYA 5DA0B 2LU5A 5IFHH 4QXUH 4QEGA 3BH9A 3QDAA 3L9RB 4M61A 4OD2A 3H2WA 5T1LD 4K7PX 5I73C 1FO0H 43C9B 1RZIA 1YNTF 4AUJA 4CADA 4KXBA 1XO8A 1ZPLA 4H5SB 3ZTCC 1XFPA 5HGBB 2WB7A 1JGVL 4ECNA 4ODTH 1OSZB 2VDMH 2BOCA 4KK8C 3JXAA 2EXWD 4HAKA 2DLHA 5C86A 2Q10A 2FT6A 3HRZB 4HH8A 1S7UB 4JO5A 3FFDB 4PV8A 5D1XB 3VCLA 3DPBB 3QNXB 4MA1C 5E23A 1Q9WA 3EGXB 5CSZB 2OPCA 5D2LB 2P4AB 3MNDA 3OJMB 5E2UL 2P8LA 3N1MC 3EUUA 4LVNB 1JUFA 1Q9OB 3H3KA 1PG7L 3PXJA 3OMIB 4TSCH 3HI5H 1EJ8A 2L7EA 2MCG1 5L88L 4JY6B 5T1LA 3JWNG 3U1SL 1L7TL 3KR3L 2VSCA 2CA3A 1RSFA 3VRLF 1PGRB 1T0NB 1DSWA 3O4OC 3LS5H 4PHXA 2G5UA 3RAJH 3B7YA 4L2YA 1CJYA 1H3XA 5TE4L 1YNTA 3C6LC 3RLSA 1SRDA 3EJTA 3GO1H 3VFVB 5EDSA 3CDYA 4FTVB 2JCCE 5D96B 3MRDB 3N06B 5I5IA 2VN4A 5MERB 3RUGB 1X5GA 4NZUH 1AGCA 4A55A 1Q9LA 4XPHH 4AH2A 5JDSA 4YJZL 5DC9B 4KRMB 1Q72H 4KTDH 1MFMA 4N5ED 5JZ7D 3OJDB 2HH0L 3O8XC 5FFGA 3D3VB 2AV7B 4RRPG 2AV1A 5LJYH 4I3SL 2H5UA 4HGMA 3MUJA 3H8NA 4HEPG 1J1PH 3BVNA 4P2QD 4UBDD 5FF6A 3FU6A 3UPCA 1NGWA 2A9MH 4R4BA 2IMMA 3VJ6A 4DERA 2H7WA 4HT1L 2FCBA 1ZVYA 2C26A 2X12A 2YD7A 1OP5H 4F58H 3BEVB 2A73B 4Y1AD 4ZUSB 5FWQA 3IMUA 3FB8B 2BNQA 3F83A 2O6FA 1JNNL 3QJHB 3NABH 4KKPA 2FWOA 3R8BB 5JIKA 4RX4D 3U6XA 2ENQA 3V4VA 4QMEA 2V2TA 4TTDC 1QASA 2FL5B 5IHZA 3Q8EA 3RZWA 4MNQA 4PJ7F 4KMTH 4N9GB 1PDKB 4QRPB 3UBXI 2QGDA 3UCQA 4C56B 4RSYA 4E9RA 5FV2A 2XBDA 1NFIB 2X4PA 1RIHL 5AAMA 3VYNA 3QVAA 3WXVL 4K23H 5EZOH 1UXLA 3ZN6A 3VO0A 1BBDL 4P2QA 4XNBA 2HA1A 4H8WC 4MD5B 2IG2L 8CGTA 1HSBB 1ZK5A 2JTYA 3P30L 5CJBA 4F7CA 2J21A 1A7PH 5DMYA 3JTTB 5KBNC 3O45A 4RRPM 3NVQA 4Y1AA 5D1QE 3KPMB 2ZNWA 3HAEA 4L8CB 5C0AA 3RU8L 3TF4A 2RJMA 4KKAC 4RX4A 1MRCL 3MO1A 3G5YB 4TL4A 2O6CA 3KG5A 1U2CA 3CFKB 3BESR 1JPEA 3QRGL 4JQIH 5E2VL 3TA3C 3QUMB 1E8XA 4WO4B 2NX5E 3K2KA 5BUGA 3FCBA 2BRRH 4U6XA 5GJTL 3SKOB 1GZQB 3RWHB 4Q0XH 2ZJSH 4ZX5A 3H6AA 4OQTL 1RMFH 4FQ2H 4A1RA 3PWPB 5KSBF 1BM3L 5E2TL 4PJ7A 1KWKA 5EN2B 1OANA 4MDJA 1KTLB 3M8OL 1ASPA 5CJOH 3L95A 3FQYA 4NC2B 4JUSA 5SWQA 4IOIB 1MOEA 2GJ6A 5JHLH 3MNVB 5KVGL 1OB0A 2NDFA 4W9JC 5KSVB 1ODAA 5EA0L 3N42B 3VI4E 1M6OB 1EWHA 3WFBL 3OQRA 4R7VA 1RZPA 2CJ3A 2Z92A 4LVEA 4PJ9B 3WD5H 2MPVA 3NCYP 4CC4A 3WEAA 2WYHA 3VXSE 4ZFGH 4LEBA 5JW4M 1OCZB 1W0YT 1YY8A 3TBYB 2C9RA 1A5FL 1ZSDA 1UH2A 4DETA 3FQNA 4ENEC 1J5HA 4QRRE 2XQYA 5AW9B 5I6NA 4ZPVB 3RTQC 3W38A 4UT6A 2F7QA 2DQ6A 1MPAH 1NCCH 2J6WA 2VDQB 1TMCB 1MJJA 4ERSL 2QADC 3E2HB 5JHMA 3WNMA 4R4NC 5E1IA 3VFOB 4AV4A 1CTOA 3QPXH 4QTIL 3K81A 4B3VA 2GI7A 4QTHA 4MMZC 4LIQE 1QSFD 2GC4C 5B39G 3QEQE 1KELL 1CE1L 3MLRL 3RVWD 5CAYB 5DF0A 2BIHA 4ODSL 2OI9C 1S7QB 3QUGA 3A5VA 5EO1B 2FRGP 4C57C 1HHIA 1DFBL 3WNNA 1E9OA 3NSDA 4LP5A 1W72L 4IOFD 4D3CH 5F3BB 3W9EB 4FNSA 4YL4A 2UXFA 1BJ1J 2WINA 3FCUB 3UXFA 1IC4H 2W07B 4M03A 4RGOL 3MRFB 4RETB 5LGHH 1MVYA 2FATH 2JCCB 5HHOD 4N26A 1X9QA 4M5ZL 1QFWH 4ODUB 2CO2A 2JJTC 4KJPD 3G5XA 4Y4FB 1B0GB 4JO2L 1SM3H 1SDAB 3OM3B 1TCRA 4X7TB 2QKIA 1WE5A 2ICWB 3GNML 3P4MA 5GGTH 2RB8A 2R23B 4PJBF 1QSFA 4GRLB 2HN7A 3UTPE 5AD0A 1IGYA 3HS0C 5JXED 5CFHA 2VLJE 2QPUA 3RBGA 2KERA 2AEIT 2BC4B 4JK0D 4AZUA 1CYXA 2ATKA 2ROYA 5AL8A 3BISA 4MHHI 5I66A 2WQAA 2A74C 3I6SA 1NICA 2V5TA 3DJTA 4FTDA 3VGGA 3ZTJG 4Q74A 2E27H 4ZUWA 3QO1B 4DGWC 2EO1A 2WAHA 4IBWA 4YHOL 4PP1D 3RVUD 4X6BA 1G7LA 3VDBA 5HHOA 4XN2A 1NGYA 1H15B 2PTVA 4G2AA 3SDYL 3CSPA 1U4FA 2BY2A 3HR5A 4AVHA 3IDIA 1PS3A 3F01A 1VA9A 2WUCL 4BGLA 1ACCA 3IFNL 1OE3A 2HG5A 2E4TA 4TVPD 3HE7C 2FIRT 5EBGA 4PP2A 5JXEA 1M4KA 3RRQA 5FR3A 4WGKA 3IT8D 3LD8C 4UT9L 2TRYA 5C71A 3D4GA 2VW4A 4U7MA 3EJZC 2GUYA 4JB9H 4G42A 3BZFB 1JCVA 2GFBA 4DVBA 4PJBA 4WO0A 3PF2A 1ZD6A 5IMKB 4JHUA 4YDVB 5D1QB 1QKZH 5J0BA 3KGSA 3TT3H 3IJEB 1YNKH 1KJ3H 2VM3A 1K2DB 2IWEA 5MI0C 2ZF8A 4N5UA 4N28A 3Q6FB 1MCWW 1TJIH 3DTDA 4YC2C 2A6IB 2CG9X 5KVFL 1MSPA 1NCUA 3F7LA 1E27A 1PIFA 2NW2B 4YNYA 1P1ZA 2I5YH 2QVMA 5C08E 2JLLA 1TIUA 3MXVL 4FG6C 5IMMA 1QA9B 4XH2B 3VXMB 1RJLB 1P4LA 1K8DA 2AFNA 3H2PA 2NY4C 4NHUB 3EO1A 5BO0D 2WUBH 1JWMA 1QLFA 2GABA 1ETZB 2EVHA 1CXHA 1MIEL 2PR4H 3FW6A 3LTVA 4HGWA 4QGTA 5GGQH 3HPJB 1RV6X 3ARDB 1BZDA 1U36A 5C6TH 1THAA 4F33B 5CGMA 3OKEB 2ARJQ 3VI4B 1DCEA 1KPVA 5IT2L 1JP5A 1AFVL 1XIWB 3ZR5A 4FFVC 4KTYA 1WBXB 1KN4L 4J3UA 7TAAA 3S3PA 4Z23A 1U92A 4M02A 3QEGL 4QXTB 3WAJA 2PTTB 4AE1A 4S0SD 3VXSB 1JGLL 3HLAB 3V0VA 4M62L 1BG9A 3W5MA 1IC5H 4LMQI 1H5BA 1S7TB 3L2LA 1JF6A 4EVNA 4H25B 4GEJA 4M8UA 2IPTH 3PIQA 1EANA 4QRSA 3L5XL 4L8BA 2R2BA 4PJEF 5C70A 4KZEH 1H3TA 5IB4B 3LZPA 4K71C 5BVJA 4F7TA 1XR8A 1ILSA 2E6QA 4IS6B 2AQPA 1SLUA 4PYGA 4WY7L 5A2IH 3X14A 3P4OA 5L9DL 2ZAHA 4PGCA 1S7WB 5I74B 1I1AD 4GRMA 4XO9A 2DEWX 2NYYC 5DJDB 3MROA 2YBGA 4YHZH 3MDJA 1F41A 3GQFA 3H7LA 4FXGB 3Q8BA 4N68A 4QXUL 5IFHL 3L3KA 3BWSA 2WVVB 1XGRA 5IW1B 3TV8A 5EBMA 1TJGH 3O6LH 1FO0L 2AXJA 1A0QH 4XBEH 5HHXH 3DRTB 1XF1A 3FFCD 2QLVB 4CC1A 2C7UB 4GSQA 2Y9RT 1C16B 4KXAA 1FLTX 2YQBA 3E0GA 1BFVH 1FL3A 1JMXA 1QLEL 2ENSA 5EF0A 2LGNA 3CFBB 1P84K 4ODTL 5D93B 5DD0H 5JHBA 4YE0A 2R1XA 2OMZA 3VD4A 3SD5A 3QDGD 1INQA 4J4PA 2KDGA 3DX8A 3GM8A 5IIEA 4U1NA 4HJ0C 3P3TA 4JQXA 32C2A 3SYPA 2VL5A 2BJMH 1P5VA 3DJSA 2G2NA 3P9LB 2VLJB 1ZIAA 2IAMB 3KPQB 1QW8A 3FB5A 2KL6A 2J1WA 3UAEA 3U9UA 3PXHA 2GC7C 1RUML 4TSCL 4NQXB 1YN6A 4NZRH 1QRND 5JQIB 4KV5E 2XX1A 2SODB 1ROCA 3MJ8A 5E56A 4AL8H 3OTTA 2DZEA 4GS7B 4FYTA 5LWYH 2CBMA 1HHHB 3IBEA 5DD6A 4LCCC 4OFYD 4M4RB 2H0JA 4P4KD 1I1RA 3ESMA 3SGEH 3RAJL 4Q9RH 5FLUA 3RY6A 3GSRA 4PGZA 5F9JB 1EFXB 3FU8A 3ESOA 3QDGA 4B9GA 1F2QA 2R0LH 3RKDD 5KVEH 1NGXA 2ZUXA 4L8SB 2OR9H 1NINA 2WQVA 4QI3A 4XPHL 1I8LA 3BW9A 2ED8A 4KTDL 1PAMA 4NNYA 3PY9A 4XBMA 3JV6B 5A6MA 2JWYA 1M7IB 2DTML 4JDEA 3HZMA 5E4IA 2G9HA 4JX0A 4NKIL 3RWJA 1J1PL 1QRNA 4LSVH 4HDIB 1TXKA 2YRZA 4N2EA 4FJYA 4GFXA 1I3GH 2A9ML 4W4OA 4NUQA 2VLME 2COVD 4OFYA 4JREC 3TONA 1QHPA 2P3YA 4WHCA 1DO6A 2VDPB 3ABMB 2VDQH 2FNBA 1Z2KA 1VFAA 4IIZA 4TSBH 4AY0A 5H8DA 4Y1SA 5C08B 4Q9QH 4FXKC 1LYQA 4XBPA 5SX4I 2VDNH 2XUWA 2N7AA 4KMTL 3VWKD 5FX3A 3EBIA 3WE6A 5HJ3A 4C55A 2CIIA 4MZIA 3UROR 3D2UD 3UADA 4XP5H 4RFOH 4RZCA 5DK0A 2GSIA 3US9A 1RIVL 4PWFA 2YPLE 3PWUA 4H20L 2R0WH 4NKOB 2VUKA 3U6RB 2QGEA 3HA0A 1A7PL 3ME0A 4FLSA 3QP3A 4DTGH 3HUJF 35C8L 4K94C 4LLUA 1ND0B 5K9JH 1I8MA 2XA8L 4K3DH 1WTLA 5D55A 5C0CA 1KXTB 4CVZA 1AC6A 3RNQB 3PG2A 1UB5B 1IQWL 1YEGL 3N5AA 4R7DB 5TQ0L 3VFSB 4ALAH 4B41A 4JQIL 4UB0H 3QRFM 3KMDA 2NZ1A 1PEWA 2BIQA 3UPRA 2D7TH 1WO2A 3NJLA 2BRRL 1F3JB 1C5CH 3SDAD 1HSAA 3RI5K 2EXSA 2XWCA 3F12A 4Q0XL 2ZJSL 7FABH 4GUQA 3MAWA 1U8CA 5DRWB 1MCHA 2YZ8A 3V6ZB 5IOPB 3IVKB 3GT6A 4BDVA 5DCCA 2XXCB 5E6IB 5CR8A 1A9EB 3WFCH 2WTPA 4G8FA 12E8H 3ES6A 3P1VA 4JFYB 2QSQA 4M56A 3PDOA 5T33H 2M83A 3OLGA 5DC2A 1TOXA 3MPCA 2BP8B 4XXCA 2ZXCA 3QAZC 4S1DD 2XBTA 3GBDA 3E1F1 3K5SA 4XNYH 3HUJA 5FM5M 1PVHA 3WD5L 5FOJA 1N6VA 1NC2B 4A6YA 4MQXC 4PJDE 1AXIB 3VFUB 4P3DB 5CWSB 4TLUA 5KBPA 3SDAA 2IV9A 4EO5A 2HLAA 1MELA 3PHSA 5HPOA 1E5ZA 1D5MA 2EDTA 1ML0A 4KX7A 3KLKA 3RVXC 1UFGA 5DTFB 1A9BA 1MPAL 1NCCL 2X4TB 4Z95H 4NSKA 2NQ3A 2HRPH 5IF0A 5K1NA 1S9YB 3EJRA 3QPXL 1WICA 5H37H 3FQWA 5IMLB 1YYCA 3R06B 1T83A 1CZ8H 4KOCA 1XF5A 2IALA 1AAJA 1VESA 4K5OA 3AT8A 2OBGA 5FECB 3AJ7A 1HI6B 3BZEA 1EZVY 2JVUA 1VADB 4BK4A 4D3CL 3ML9A 4P23A 2VMCA 2G3NA 4KROD 2CRYA 3A67L 3ESNA 4JFFD 4MB4A 3MU3A 2FATL 2R51A 4GQ9H 3GGWA 1TU2B 5DK2B 3ABLB 1QFWL 5DGQA 3HE6A 1ASOA 2I9TB 1SM3L 4N2DA 5DU7A 4MCMA 1N8ZB 2NNXA 3IRCA 4Z9KB 4N22A 5GGTL 2LW3A 4DKFL 2QSVA 1MQ8A 1T3FA 4KPHH 3U2SB 4N86A 3IMRA 1XD1A 1WCBA 3QI9C 3F04A 3I2CH 1E6OL 4MWFB 5JMOC 3B5HA 4W4NA 4BK5A 2OCJA 2V2XB 4NFCA 4Z3EA 1EHLH 5KAQG 4Z7WB 5J1AB 4AXWA 3QJRB 5EFIB 1EEUA 4TNVK 2CKNA 1ZLWH 4BRJA 2E27L 3DTXB 2GSGA 2ZPKH 4MJIE 4JFFA 3IJHA 3VQ2C 1OVZA 4AG4L 5IJDC 3KPOB 4P5TD 4ELME 1LEGB 2WVSA 5GQBA 1LE9A 2EADA 1HDMA 4ZTEA 2C3HA 1WFMA 1MFVA 4U2ZA 2I60H 2D73A 1NMCB 3BKJL 4V1DE 3IBOA 2VLRA 3ULUC 4EXPX 1UD4A 2QMJA 2YLHA 3O6FC 4I1NB 4G9DB 2Z6FA 5LGJB 2YPLB 4NRYA 4OUOA 5JORA 1X5MA 5ENWA 4E41D 1XH0A 4YDNA 5KJRH 2P80A 3KL5A 1M05A 1CYWA 3BP4A 5LB1A 5I28A 2MEJB 4HH9B 4NQVA 4H2CA 2KPNA 2FIKB 2YC1A 5DMKB 2KUTA 2XV6B 5K93A 5C0JB 3R4RA 4S1SH 3R1GL 3ARFB 3ARGD 4N8UA 3NFNB 4KY1L 5G2NA 1AQ8A 3BFOA 3NYKA 1KJ3L 2BW5A 3GJFB 3ILPA 3LKRB 4MCNA 5ESAA 3KDMB 3QUZB 3U79A 5D7LD 4P5TA 2VIRB 4OLEA 5EPMB 3K71B 1BD2D 1TJIL 1X5AA 5F0LB 1JZ7A 4XT1C 1F6FB 2GT9A 2Q6WB 4QR7A 3MV7E 2BSED 2OMXB 1BECA 3SHSA 2I5YL 5J1SC 1IBHA 2YGPA 1Z3GH 5K9QG 3NRFA 3KPSE 3PAVA 4XRCB 3W82A 1AGBB 2AK4B 1CLZL 2R9HD 3FTWA 2OYPA 2AJYH 3PQYD 4E41A 4Z7AA 2G9KA 5DZLA 4BEIA 2YA0A 3D0LB 2AJSH 2PR4L 2Q7YA 5GGQL 2XVBA 1NUDA 3NJVA 2IPKA 3P73B 3ZYIA 4ANKA 2E59A 1G0DA 4NBZB 2H41A 1H6TA 1J86A 4LPXA 2Q2EB 4JZNB 4P5MB 2P7TB 4FQXC 4LKCB 4NKDA 3IYLW 3WTUA 4Y5VC 1BD2A 3RWEA 5CD3B 4PJDB 2X1PA 4AW7A 4I1PA 3VMPA 1IC5L 1A02N 2PO6D 2JNZA 3MKKA 2XA3A 3JWNH 3TN0C 4DN4H 3OKOB 4FQQA 3D69B 3UFIA 2VZSA 3MLXH 2IPTL 2QR0B 3MJWA 5CZKA 1B9ZA 1OW0C 5BRZE 2KLTA 1H3GA 4PRDA 4WI8A 4AV0A 5F89A 3PQYA 1T1WB 4WJ5B 3HMXH 3VD2A 3QJZA 2VDPH 4ZUTA 4OZIF 3K1KC 3HBZA 2UYLB 3OHMB 3RY4A 1U8JB 5A1AA 2H2SD 5D6CB 1ZXKA 4PJ6A 3VSVA 4YHZL 3LEXB 4OKDA 4AVIA 2XICA 4M1CD 2Q76A 4N1HB 3RGVC 1L9QA 5AKSA 3O6MH 1JZFA 2OTUB 2ZCHH 2YEZB 3F7KA 4J8RB 2BIPA 3X12B 1BDYA 3QXAB 4XMWA 2Z8WC 1YAZA 3NFSH 5H4YA 1EHNA 1TJGL 1VEPA 1HZLA 1Q8MA 1CGXA 1KYOK 1KIPA 1SUHA 2H0PA 2N56A 2PO6A 4XBEL 5AOJA 3Q44A 5HHXL 3KD4A 3EAKA 1T4KA 2OJ1A 1GYUA 1YA5A 3HG2A 5D6DA 1BFVL 1OTUD 5BJTB 4XVUC 5IQOA 3IDGB 1QACA 3NAAH 3D0VA 1G7MA 1I8AA 1C1EH 1U8HA 2NYKA 3E6HB 3FT0A 3P54A 2D31A 3C60D 4X4XA 4YBQD 5DVLA 4NRXA 2QPEB 3MJ9H 3QDJA 2E9WA 5GISH 2Y5TA 4Z78A 2WVUA 2W0FB 3X3GH 1SQ2N 1JF1A 3J8F7 3NZUA 4GIOA 4YDMA 3GSOB 3X13B 3ZYZA 5HPMB 1UJ3C 4OZIA 1EDYA 4IK6A 3GI8L 5F2FA 5AVQB 2GUOA 4ONFH 2I7SA 5I1AA 1MVUA 1GTNA 3MRKB 1DEDA 4NZRL 4QHPA 1CS6A 1DZBA 3RPKA 1GH7A 5E94B 4AL8L 4DP0X 3K6SB 5LWYL 3DRQB 1JNJA 3HZ3A 1ZLSL 2OZ4A 3B3IA 2BNUA 2FJFB 4MJIB 4UM8B 4LNRB 3NFPB 4Y5XB 1RZ8B 4OB5H 4Q9RL 2AMGA 3NCJH 4ELMB 3TESA 3FSZA 3CZFA 3NZ8B 3C60A 1VKXA 2R0LL 1JXJA 3S9DB 2ZXQA 1HCZA 5CXPA 2XHNA 3C5JA 2HRLA 3N40F 1RCYA 2BCMA 2OR9L 2OSYA 2X70B 4HAFA 4ELKA 4LESA 1SJEA 5DVOA 2OULB 3IGUA 2YAHA 1F4HA 5EEXA 1N4XH 3QCVH 3LNGA 4BFGA 3VTAA 4TVPH 1MZZA 1OARH 3DX7B 4Y16A 5GGVH 1MY5A 1L6XA 2ADIB 1DANT 3BGMB 4YK4B 1I3GL 5I8CA 1UD6A 2OCCB 4JRXD 3L17A 1JYWA 4HULB 2LE9A 1BVKB 2VLKE 4WI4A 4XHJC 4FCHA 3UBXA 4B5EA 4HG4J 5J12B 2VDQL 4DQOH 2V37A 5IVNA 4XMZA 1VCBC 4TKWA 3TU6A 5C07A 2NY3B 1JXKA 3MV7B 3RJQB 4TSBL 5J11B 3K0YA 4KI5C 2FWSA 2EC8A 2VLLB 3PJSB 1DQMH 1ECYA 1P7QB 4EIZC 2MRYA 1WWCA 4JG9A 4Q9QL 3KPSB 1JWUA 2VDNL 1XTMA 3SE9H 4Z7OE 1CDIA 3WGUB 1W80A 4C4BA 3FTGB 4EKJA 1A1NB 3OL2A 1QRKA 5D70H 2Q2LA 3H2QA 3QZPA 3ENEA 2X89D 4G11A 3SY0B 4I9XA 5MEOA 5H2BA 1S9XA 3RIFK 3IDYB 3KWUA 2EINB 4GG6F 1AMYA 3ABGA 1S2EA 4GW4A 4IBVA 2Q3XA 3I75B 4JN2B 3VXUA 1TTUA 1UWXK 2KZWA 3DOHA 4JPQA 4LHJB 2HMIC 4LRIA 3HC4H 3GRGA 3SYOA 4DTGL 2A83B 4RGND 3WHE1 2GY7B 2CBOA 5K9JL 2JV6A 2OLDA 2WLIB 4K3DL 2ZX5A 1Y18A 1Z6JT 5F9OH 3GZPA 2ICWJ 3G08B 1HEZB 1NEPA 3WL9A 1TZ8A 3Q6GH 5GS3A 3ZIMA 3QGVA 1VFMA 2J12B 3FCTA 2VWEC 1LEKA 4UB0L 4KKLC 2XI9A 2QMKA 4EQ3A 1OV8A 1SYVB 2FYYB 4HWBL 2B39A 4N2BA 4QYAA 5BRZB 1QO3A 5AKVA 2X2JA 1TVBB 2X89A 2BSSB 3KPRB 4FFZA 3FTYA 3IDJB 4NZFA 4ONOA 4Y9BA 5F7DA 5FGRA 1A6AB 5KSAC 1FFQA 2OJZL 1YLBB 2V4LA 5D7HA 1ZT1A 2ZCZA 1EQWA 1DJHA 4IJ3B 1HYSC 2Z35B 1NPUA 4UIKH 4LQ1A 12E8L 1AZVA 2ESVE 4MVBC 2X4NB 3D25A 4GQZA 3IF1A 2DH3A 3LNDA 3REVA 3ZL2A 4PTTA 4HUWA 2ZP0T 1AOZA 1Z0MA 4ZPTA 5T3ZE 5IEHB 5KS9F 5T33L 4GG6A 3HB3C 1ZVSB 4G8GD 4L4TB 1F90H 4U7SA 5D71H 1EJOH 1RZ7H 5FGSA 4E9QA 4XNYL 1N68A 2YJLA 3QIBC 3DSNA 1CXIA 3OLDA 3BKYH 4LDLB 4UU9A 1T2QH 4G8EA 4OZHF 5IGXH 4X9HA 4YIQA 2VSKB 1L7IH 4N8CH 2X09A 4G7RB 1BLIA 5EU4A 1JHLH 3M1CA 4YL9A 3BP5A 3P0YH 4R8WH 1RJZA 3EGDB 5HYIA 3ZTJH 3DGCR 4XPGH 1SNRA 4FL4C 2DMKA 1PKOA 3HW7A 1DJZA 3AGVA 2HJKA 4JKLA 3ARRA 3IXAB 1T03H 4Z95L 3GIZH 1XZ0B 1USQA 4TUJB 5FK9A 1OCOB 4OF8A 4WWKD 1HC1A 3VAEA 1CMOA 3FCSB 2HRPL 3UDWC 2A6DA 3Q06A 2EEBA 3NG5A 4TRPH 1S9KC 4KMLB 4NYLB 3DVIA 4WGVB 5GS1B 1DDTA 3M86A 4JHWH 3T65B 3CFCH 3HLKA 2PYEE 4MA8H 3GRWH 2KQNA 2HVKB 5I6MA 5KS9A 5CFAA 3GMMA 1A8JH 3DK2A 1LO2H 1DUYA 5IW6A 1ITCA 4XOEA 5ABZA 3ECQA 3LV3B 5F7AA 2J1KA 1TQSA 3ULVC 3LKSA 4KO5A 1W8NA 1Q0YL 5LCVA 1GPOH 3FYIB 4UQBA 4WKZA 3TVMD 3CVHH 3EOAB 3QEUA 3O6KH 5E5MB 4OZHA 5BW7C 4GQ9L 1VRSA 1J0YA 4MJ6B 4RZKA 1J48A 1RZKC 2DM3A 4G6JH 3B1TA 1M9SA 4LPVA 3PAYA 4L37A 5T1DH 2B0SH 4XNUH 5DD5H 2GTWA 4XCNA 3L1OL 1A66A 4WWKA 1DQQA 5E08L 1KBPA 5HGGS 1JPGB 1I31A 4MQ7A 1CFQA 1BPVA 4NUMA 4UZGA 3SPVA 1O7DE 3F5WB 4DPBX 1OK0A 4N0RA 3D18A 5HYQB 3I85A 3DPDA 3QSKB 4PV1C 1ZLUH 2MTPA 2HFFB 3BSZA 4UOQA 2KC0A 2FD6H 2WBJB 4GAGH 4EAEA 2JXMB 1G87A 3I2CL 2YPKB 4LLDA 5FCSH 3Q5YA 4OGAD 5TJWK 2B14A 1QHQA 2CDEA 2G4EA 1EHLL 15C8H 4I2XB 2VLKB 1BX2A 1EO5A 3H9SA 1CO1A 1R3LB 2EH7H 2YK1H 2QDVA 1CVSC 3RDTD 1D9KC 2Y23A 2AQRA 3EYVB 3GFUA 3TVMA 2ZPKL 3DURB 2CPUA 2V7NB 3IU4L 2DIAA 3NCXA 4K5NA 5BS0D 4I4WA 1JZGA 3CBJB 5EORH 1LP9F 2HFGH 4LIQL 4GXUN 3U4EA 4Z7OB 1TZHB 2JMRA 4NM4L 1SBSH 4N2MA 4WFGD 3KLHD 4RFEB 2IMNA 1R3KB 2Z3FA 3KHQA 4BV1A 2ZX7A 1B0RA 1YECH 2XJLA 1J9CT 2FEEI 4PI2A 3T09A 3II1A 1PQZA 3VD3A 4YGVA 1EXGA 3DXAD 1UM5H 2NUPA 4PW9A 3BWUC 5I5JA 4JM2B 2BSRB 4NZ8A 4FLHA 5I6XB 2XWJB 4OCWH 1FHNA 4QY8B 2N4IA 3EH1A 2ITCB 2MH4A 4S1SL 3RPBA 3K4AA 4P4RB 5IM7B 1JZ3A 2J8HA 4K4KA 3DUSB 5BS0A 2AANA 3N6YA 3ASOB 2BNRE 1GJIA 4HUUB 3EYQD 5TK2A 3ISWA 4E2OA 5I6LA 5CEZD 2XYCA 1E40A 4U05A 1Z7JA 3UJTH 2R39A 4I0PB 3SCMA 2O5XH 4W6WB 1JZ2A 3BFWA 4WI6A 3IE9A 4G70B 4DJMA 4MS6A 5IVZB 1LP9A 4FQCH 1AR1C 1ZWIB 3R0NA 5F1KC 3MNZB 4ICWA 3VU2A 4ZMQA 4K0OA 1MIMH 3WNKA 2HZHA 4RISH 2AJYL 2X40A 3DXAA 1NGZA 2NY5H 1CFTB 4JBSA 1JGEA 4OFKA 2D7OA 4GOSA 1S9VB 3TIEB 3WN5C 4JM0A 1KULA 5JHDD 1ZJAA 4L3FA 4OZFG 4WK4B 4ZXBB 3T3PF 5ERWA 5ABDE 5KN5B 1HKFA 1QR1A 4F7PA 3SE3C 3ZDZF 1AHWA 2AQ2A 2Q8AH 3U36A 5CO1A 5KYUB 2R29H 2VISA 2JJSC 4TUKH 2CZNA 3TLRA 1U3HC 3FU5A 2BMKA 2DWEA 3ZBMA 1NEZG 4XXWA 3OAYH 4DN4L 5F7FA 3UBFA 3TIDA 4G1EB 2ZOKB 2YBRB 3MLXL 4ZUUB 4FMKA 2CCVA 4KO9A 3GXUB 4IDJL 5F71A 3ZE0F 1K3IA 3W0WD 4ZNEA 2AW2A 4NQCD 3HMXL 4CNIB 5LG6A 4YHIB 2VDPL 3IN0A 5JA9A 4X0NA 4WF7A 3MNMA 2H2PC 2FSDA 4OCMC 3ECUA 2ZKXA 5JHDA 3ATDA 5GRJL 4B97A 2XZAH 5B3JF 1A2YB 3O6ML 2ZCHL 2OAAA 1LK2B 1H9VA 2Z7ZA 1NKOA 3NFSL 1NL0H 4MAUL 1YN7B 5EV7A 1OT4A 4Z3GA 4F8OA 1A4KA 2Z93B 3O41A 3L3OB 3SGKC 2WMPB 3HZKA 4BFOA 1WA2X 5DLMH 4KITB 1NMBH 1SN5A 5DRNA 1IT9H 2X0WA 4NUGH 1FYTE 2F53A 1JN6A 3FT4B 4P0DA 1XL6A 4A2HA 3HG1D 1MCIA 4LLWB 1P7KB 4NQCA 3KPNB 1C1EL 3MNWA 3ZKXB 2XZCH 4OR1A 4Y4KC 4A2FA 3ZGHA 3NPSB 2KKQA 4JFZH 1UH3A 1A6UH 5GISL 1O6VA 2OMTB 4JFQA 4NQSB 3NDYE 4HIIA 2YKLL 5E8PA 4CMHB 4ZAKB 2GCYB 4PRHA 2NSQA 3WIFA 4AYID 3POHA 5ADPH 4WUUE 3B9DA 3CDZB 5B3NA 4PJHE 3QEHA 4G8AC 1YYMH 2DQMA 4WFFD 3FPYA 1AG6A 3CX2A 4Y2DA 4N6RB 1YEJH 3EDJA 1RHFA 4GUPA 3SKJL 3N9GH 1XB8A 2WZ0A 2PF6A 3QIWC 3MRNB 3GMPB 1IZKA 5JW5B 3ZW3A 4JO1L 3GUTB 3BZ5A 1JPFA 4OB5L 1SMDA 5ETUB 1DVXA 3HG1A 1F6AB 2CKBB 3NCJL 3DX6B 4IBLT 5IMOA 5EIVA 1QW9A 5ANMB 4OIBA 3SGDH 4WI0A 1U2YA 4LPUA 3SPIA 2X4OB 5DYOA 1E4XH 2YD4A 4UQCA 1AQHA 1E7VA 3VXQA 3AAZB 5DHEA 2Y6SC 2GY5A 4JZOB 4PJ5D 4HJSA 5BXFA 1N4XL 3QCVL 4JFXA 1CB4A 1UB6A 2UUDK 4MXQC 3WLBB 1AKJB 1OARL 4F9PC 2F8IA 1ZMYA 4NP4H 4RNRA 5GGVL 1GZHC 4NENB 2J2ZA 4JQVA 3UTTE 2RTTA 1AMXA 5K1JA 2VDRH 5MENA 3ESUF 1SEQH 5IESL 4B0MB 1A3RL 4O4YL 2CRZA 1KCBA 2XPYA 1F00I 3EH5B 4LLQA 5E8NA 2BNRB 1NAMB 4EOWH 3ABZA 3C08L 1RK1A 2DY2A 2H26A 3FQ1A 5DO2C 4YAQA 5I17B 4AK2A 2WXPA 3J2PA 4HU8A 2BDNL 3BIKA 5FUOH 3NACH 2D4DA 1DQML 5FGBA 1IFRA 1DEEA 3G04A 3SE9L 5GZNC 1KGYE 4MNHA 3NGBB 5I8KH 4M6NL 1AKPA 4PJ5A 3NESA 5D70L 4DP8X 1JGIA 5FHAL 4RIRB 3M45A 1YEDA 3QCUH 4LSTL 4PRNA 5T5FA 3R7RA 1LQSR 1J5IA 1N59A 4F8LA 4OIIL 1BWMA 4Z7NE 5KBKA 3WS3B 2BOBB 5F6HI 5DZPA 1LE5B 4LU5H 3PS6A 2EZ0C 5FA3B 3VWJB 2EIDA 1IU1A 3FO1B 2O1AA 1RJYA 4KK8D 5F9OL 1F13A 4HUXA 2R1YA 2OXGA 2VXSH 3Q6GL 5DZOA 1PD0A 1U8QB 1LD9A 3C2SA 4GRWH 3R8QA 3NIDF 3A21A 2DI8A 3I3BA 1BQSA 3T0VA 4XGZB 3ZE1E 3RZCB 4P5RA 4MD0B 2OSLB 5DHVH 25C8H 2AKRA 1H0DA 1KIQB 1KIUA 1HWHB 2BX5A 3WIIH 4H88H 4AYEC 3MUHL 3EFDH 4TLSA 2CJUL 3MA7A 3LXAA 3UC2A 4QJ5B 4LEOA 4BWTA 5GSVB 4NO0D 4G3YH 4EF3A 4HIJA 1YMHB 3C6LD 4EZJA 1KB5A 1BXAA 2J57A 3BEWB 1F90L 1KJVA 1U93B 1BCIA 1IC7H 2CM5A 2OTWA 4N2OA 3X11A 4WU7A 1F11B 3V4PA 4FNQA 1OHQA 1TEFA 3BKYL 3C09C 4L1HA 1HHGA 4WEBH 2ATAA 2WK2A 3OX8B 5IGXL 1HHJB 2H9GB 3D8MA 1MHEA 3O8XD 2J8OA 2PETA 2HUEA 4N8CL 4ZS7H 1FYTB 2ZAIA 1JHLL 5DJ0A 5IBLC 3P0YL 4LLMA 2FSEA 4R8WL 2MCMA 2XPGA 5JW3H 4KDVA 4XPGL 1IAII 2PCPA 5IP4A 1FCCA 1K4DA 3RBSA 3KWWB 4QCIB 4RH4A 1CLCA 3WFEH 1TG8A 2EQDA 4NO0A 1TVHA 1CI5A 3FRPG 3QNZA 1Y0LA 2XBZA 3ERXA 4AQOA 1IJNA 2W88A 1V3LA 4BUQA 1UEMA 3AQYA 2FQEA 4PJHB 4JW3A 5DZVA 4WNQB 2C1PA 3IPFA 1ZVHA 4V2BA 4JHWL 3CFCL 1JPST 3BUDA 1PKQA 3GRWL 5JLZA 3V6OC 2WXKA 1HE8A 1IQDB 2RQEA 1XDTT 4AENA 1LO2L 2RACA 2BNQE 4FD0A 1BQUA 4K3HA 2WLJA 3VRLE 3V0JA 4GKZA 5C0NC 3CVHL 1WWWX 3MRCA 4MNQE 5BQ7A 3IDMA 2F9BT 3HHSB 1DVZA 3BUIA 4O02A 3DX9B 2WN2A 4XNUL 5T1DL 4KZDH 5I9QB 3TYGH 1UZ6F 4WV1B 1TSHA 3KWXA 4UNUA 4TTGA 2Z7YA 2A4ZA 1OGAD 4UQ3A 3U0TB 4PMEA 4L3AA 4G9FD 5FM4A 4D7PA 4KKAD 3AMLA 4J7RA 5CF3A 2EUZA 3OAUH 2ICES 3TA3D 1A47A 1EAQA 4GAGL 2OMBA 3NA4A 5C0GB 5E1QA 3UTTB 5BV7B 1KXVC 4JGNA 4HS3B 4PUBH 3QXTA 4BQ6A 3GINA 4X7FC 3O9WB 1A7QL 4G8IA 4RAUB 1QOKA 5C0AE 1JZ8A 2EH7L 2YK1L 2ZSVB 2NY2C 3MBWB 4L9DA 1EK3A 4NCC1 4MCYB 2F7PA 2CO6A 3GSWB 1HH6B 3OKLA 1MLCA 4R0LC 2VUYA 5IQ7H 2V3FA 3HKZA 3MUUA 5F97E 1SBSL 3IM1A 2P26A 4ZMNA 4F93B 3O11A 1OGAA 2I26N 3DETC 3I6LE 4PJ7E 3ZYJA 2WNKA 5D7SL 4U33A 4M8QB 4BSVA 4D9RD 4KNUA 2GJ6E 3L3JB 5G4MA 4MMYB 1LMKA 4WWOA 3G6DH 4OCWL 3BH9B 4YHML 4FERA 3UAFA 4M61B 4OD2B 4Z7OF 4EZMA 4U1SA 4ENED 1EO8H 1RZIB 4CADB 3RTQD 1YUKB 2RMNA 4R2GB 4QHKJ 2ICCA 2JTDA 3AMKA 5GZOC 2QADD 2D3JA 2WLKA 1T1YA 5GS2D 1KGCD 4R4ND 3UJTL 3ZE1B 4WI7A 3B7SA 2LV4A 2BOCB 2DI7A 5AB1A 2BVTA 2O5XL 4DGIH 3S3BB 3HNTH 5CNHA 2ZF9A 4FQCL 5K39A 2N7BA 3VCLB 4CGTA 1B90A 4RISL 4BH8A 1E4WH 2IFFH 4DFHA 3TPUA 43CAA 1Q9WB 4IU2A 2EUWA 2HJFA 4JLRA 5C92A 3FSWA 5KSBE 3DTUB 2P8LB 1JWSA 4MS8C 1F58H 1ZGLB 4AJWA 1WG3A 4J3OG 4OJAA 1JUFB 3GDBA 1DJXA 1ESOA 4RAVA 3Q1EA 4E0RA 4PJCE 2NCEA 5T1LB 1WRFA 4CVXA 4ELDA 1UQSA 3RTQA 2CHZA 5I1KH 1CFVH 1ETB1 4FADA 3WIHH 4PBXA 1LJMA 2PWGA 2Q8AL 3TF7C 1XSKA 5SWSE 1I85C 5SX5K 4DKDC 4UM9D 1L0XA 1YNTB 4PY7A 2R69A 4MMZA 5DQ9B 5AW1B 5GRZA 2FYVA 1RH8A 3RIAK 3VMNA 3FKUS 1UFUA 5JUEH 1BJ8A 1SJMA 3M7OA 1AGCB 1PFCA 2CDFA 1Q9LB 3GHBL 1T1ZA 4AH2B 4LLAA 2OYMA 4PAZA 1F86A 1NGPH 3ZO9A 4ETQB 3HRZC 2K3HA 4G6FD 3L7FA 4HPOL 2KYIA 2VH5H 5D1ZC 4KQ4L 2AV1B 5E99L 3EF7A 3LZLA 1J18A 2O5ZH 5ESVA 5HXMA 4N2LA 3BVNB 2Z0UA 4LVNC 4ZTOH 5FF6B 2XVKA 2XZAL 1NGWB 4HCRH 5LXGH 3K6DA 1T7YA 4R4BB 4WQOA 3VJ6B 5AOIA 1QUPA 4BH7A 5CCKH 1AYRA 3LKNA 1QEXA 2ZYHA 2R4SH 3KLSA 5MP6H 3ROOA 4ODWA 1A4CA 2JKLA 4JRFA 4UM9A 3IJSA 1ES0B 5KW9H 2BNQB 2DD8H 3HE7D 1L4IA 2FWOB 3UBHA 4XO8A 4YBLB 3V4VB 3HS0A 1UKQA 4P2OC 2V2TB 2H4EA 5DLML 5A2AA 5IHZB 3OB8A 2X6CA 1IT9L 1P69B 5D96C 4CUCA 3FQUA 3EJZD 4BKTC 4XPBH 2XZCL 3B2VL 1VJSA 4LASH 3RWDA 2X4PB 2XIIA 5HHMD 2A74A 4JFZL 1SOXA 1KBKA 4L1LA 5F70A 1J5DA 4P2QB 1MHPL 4X9GA 3Q8AA 5H4ZA 1Q0XH 4FI7A 4F7CB 1EGJA 2Q9OA 1TNNA 4PJBE 3O45B 4Y1AB 5D2LF 1QPKA 1YYML 3LIUA 3BJ91 3QNYA 2ICEC 5JIHA 1MWAH 1YEJL 2LLNA 3HAEB 5C0AB 3N9GL 1EFQA 4FG6D 4PFEA 4X6EA 2L8AA 1GGCH 1BQHA 2NY4D 1ZTXE 3P69A 2FGZA 4OV5A 1BEYL 1CL7I 1MFDH 1KJMA 3NIFF 4ZO8A 3F7YA 3TFKC 4RMTA 1M7XA 3OZ9H 4G6AC 4PJ7B 1E4XL 1XGZA 4MDJB 4RA3A 3N0AA 5CBEA 3L95B 3KH4A 4FFVD 5SWQB 1R47A 5HGBA 2XXMB 4DP4X 4L5FE 3HG0A 1WFOA 2WQRA 1PLAA 3BVUA 5DQJA 1QTSA 1U8IA 1ZT4A 4MASA 1AQDA 1PU0A 1GYAA 1S7UA 3D52A 4APXA 1N5YL 4H0GA 5B3SB 2O72A 1BFOA 2Z92B 3VD7A 4ZBJA 2VDRL 2Q8BH 1SEQL 5B1KA 2BVOA 3EGXA 5D2LA 2ZKWA 1Z66A 5DHXB 3UTSD 2C9UA 3LB6C 1YY8B 4QOKD 1LDSA 2F08A 1I4FA 1ZSDB 3WMQA 5FUOL 3NACL 2NYYD 3FQNB 2YXFA 2E6JA 3AGWA 3BPOC 1SOQA 5GRVK 4U6HA 4AL8C 1AZCA 5I8KL 5MHSD 3WO4B 3S35H 1ZEAH 3B9VA 4ZX3A 4TV3A 1NDGA 1MJJB 3QCUL 1KTCA 3QXVA 4JFDE 2EDDA 3KYNA 1FGNH 4QTHB 4U3SA 1I7TA 1CXKA 5I8EA 3FH7A 3A22A 2BIIA 2XNAB 3FO2A 2W92A 5IUSA 4LU5L 1JVLA 1TQWA 3KJ4C 4WW2C 5GSRA 1BLNA 1P5UA 1WUZA 4PYHA 4KRLB 4ZSOA 3UTSA 3C6EA 1HHIB 4QOKA 2WANA 3KJ6H 2ARJA 4ZMTA 4K2UH 3CQQA 2K3TA 2WINB 4QKTA 4FC3E 4XMPL 3SB3A 1QSZA 4S0TD 3VXPA 1YNLH 4HJ0D 4DKEL 4UMGA 2FX9L 5EUKA 3EJQA 4DUWA 4WZ9A 2RAMA 1Z9OA 3MLUL 1RLBA 4U1JA 5C97A 3G5XB 2GYSA 5BV7H 3U4KA 1LHZA 5JQ6L 2EABA 2QSCH 4PJEE 3WIIL 1TCRB 1YMMD 2QKIB 2ZYSA 3QJHA 4H88L 3P4MB 1E5BA 5E4EC 3V5DA 3EFDL 3KXFD 1QSFB 2HN7B 5AD0B 1IGYB 1FPTH 5EBLA 3GHPA 4A2MA 4XNAA 2X9YA 4G3YL 4RDQF 3GPEA 4NOFA 1I7UA 4LDEB 3Q43A 3H3PH 2ATKB 2OFQA 3CFMA 3ELQA 4RAHA 3M07A 2C4FU 4OGYH 3VM7A 2K6WA 5I66B 1IC7L 4C4KT 1AGDB 3A4EA 3MGAA 4XPAH 4XNQA 4FE9A 1C7TA 4GP4B 1KB3A 4ZUWB 4WEBL 4X6BB 1G7LB 3RB7A 3ZO0A 5HHOB 4XPTH 1YJDH 1F1GA 5DJCA 1Z5HA 3HR5B 4PLNC 2B1AH 4ZS7L 1HL8A 2Z31C 3IDIB 3QDGE 4W68A 4XNZB 2VDLH 4BINA 1BF8A 2QVFB 4L8CA 2HG5B 1YMMA 2QV4A 2WKLA 5T1KD 4LOVA 1UXSA 4LSSL 3VM5A 4KH2A 3KXFA 5CSGA 4J8QA 1HESA 5DUBA 4PP2B 1CDGA 1QUNA 5KYYA 4GSUA 1EIBA 1QFOA 4G72B 2R0ZH 5CS7A 4ALAC 3KCWA 1JNHA 4U3HA 4XBGA 1R5VA 1ZHNB 5I1GL 4EPSA 2NTFA 2CLZA 1MFAL 3EW3B 2GFBB 1QRNE 3ZQXA 4DVBB 2GHWB 1QX1A 4PJBB 2CMRH 2EACA 2YD2A 5E9DD 1MCSA 5F0MB 4H40A 3O4LD 2FH8A 4XXDA 1ZDSA 5JNYA 4GINA 5IBTH 2GEQA 3ARBD 1M6UA 2Z7UA 2VXQA 2ID5A 1IGFH 4POZC 1E27B 3SIKA 5FO9A 4YNYB 1MFCH 3ARYA 1P1ZB 2Q87A 2VN3A 5T1KA 5T3ZL 1A4BA 4NN7C 1G1KA 1YEIH 5IMMB 3BVXA 4BXSV 1M71A 1V7NL 1P4LB 1K8DB 1YEHH 1O9ZA 4X99A 1E8ZA 4KZDL 3EO1B 1OE2A 1JWMB 3HEIB 2OJEA 2V5SA 2VR9A 3U0WH 3MC0A 2IO5A 3WJJC 4HGWB 4RMSA 3BKCH 4D9LH 5E9DA 3L4WA 1ANUA 4JN1H 2EIKB 3O4LA 3STZA 1KPVB 5AAWC 5FHBH 1E3FA 4F9LC 1U3JA 1ZV5A 4QKXB 1MCPH 1E2VA 1UURA 2ZX8A 3FTVA 4ZFQA 2EDFA 3GZOA 3PHQA 4PUBL 1U92B 2QKSA 5C0CE 1E8YA 3BO8A 2GBTA 1NCDH 1EUUA 1WGVA 1SXZA 3V0VB 5JMRA 1H5BB 3FQXA 4PS4H 5AZUA 4OZFH 5EEZA 4EVNB 4X42A 3JYBA 3CUPA 3ZUCA 4UZSA 3B2MA 3PIQB 4QRSB 5A2FA 4L8BB 2R2BB 4EI5A 5EOQH 5BVJB 3Q2NA 4F7TB 1XR8B 4MSWB 3GIVA 2IJ0C 4CSTA 1KCSH 5DUPH 3X14B 3WHE0 3P4OB 4AGLA 3L4TA 4EDWH 4PGCB 4HISA 4ORGA 4GRMB 3JV5A 3PFUA 1JZHA 3MROB 2QSTA 2TAAA 4MQXD 2BXZA 1WK0A 4L1DA 5BMFL 3AWGA 1JI1A 2XV0A 2ZAGA 3G6DL 3ML8A 1WF5A 3TV3H 4HKBB 1DVQA 1K85A 5I1JL 3V0GA 3L3KB 2F1AA 2CR3A 2ZZUT 1XGRB 5A3IC 5EBMB 1K8IA 2DEYX 4W81A 1NUFA 3DIFB 2IQ9H 1RUQL 2Z4QA 5AW2B 3UJIH 3MODH 3HUJE 1XCQA 3RVXD 4KDWA 4WEMB 4JG5A 3VVVA 5BRQA 4AWJC 1FL3B 4AQ8C 2J20A 3QQ9C 2X2UA 4TQ8A 5HDRA 4KKRA 3KAAA 2R1XB 2OMZB 2X1QA 4I18B 3Q9QA 4Z6AT 1MCRA 2E75C 3ZZSA 3HNTL 1INQB 2VZOA 3DX8B 2VNCA 5IIEB 1I1AB 2LVCA 3L8QA 4U1NB 2HTLC 4OLYH 3FYEB 4G7SB 3LHPH 32C2B 2VC2H 1E4WL 4GT0A 4M9PA 5I74C 1P5VB 5T3XH 4HK0A 3TH3T 5J13B 4WVRA 2VSDA 3BRDA 3EO9H 1F58L 2AGJL 3FB5B 2CKBL 1AACA 4LT7A 3U9UB 2N0KA 4ENZA 5CHNA 1E90A 1XH1A 1YN6B 2J56A 2R2CA 1EVTC 4U49A 2CGZA 3MJ8B 5I1KL 1CFVL 1NCHA 4HS8H 1MJ8H 3PCYA 3HFML 1C7SA 5DD6B 3BAYA 3GMQA 2XVLA 4HX1A 1CG9A 4IQHA 3BZFA 4AITA 3GSRB 3MXWL 3RE0A 3L48A 3RFRA 1XV8A 3QDGB 4X8XA 2EIMB 5FOBA 1BOGA 4OF3A 4BZ2A 4LLVA 1XH3A 5JUEL 1NGXB 4I3RH 3QI9D 1BGXH 4CGUB 1HJCA 4CN4A 3ZQWA 3BW9B 1VGEH 3L9YA 5EH1A 1YEFH 3QAQA 3DYPA 4HHAB 3UTOA 2VH5L 1ET7A 1OOWA 2ENYA 3TC9A 5BNXD 3BT2H 1XH2A 1NAML 2O5ZL 4JDEB 2G9HB 1AO7A 3BVWA 3DSFL 3RWJB 1QRNB 4HC1H 1TQCB 1WTGT 4ZTOL 4S1RH 1M3JA 1AXSA 1RJLA 4HCRL 5LXGL 5CGTA 3ULUF 2ZYRA 5CCKL 1DQJA 1F56A 1LWRA 4UT6H 2R4SL 4P4KB 1X5HA 5MP6L 4M3HA 4PGDA 4JAMA 3MA9H 1MCJA 3X3FH 1M53A 1XSJA 2WBKA 5DXWA 3JZ7A 3PNRB 4AM0Q 1VFAB 3JUZA 3L3IA 4AKQA 4ZNCD 3ULUD 4XAKE 3O6FD 4JO4L 4WUKL 1BAFH 2JK5A 1FSKB 3AM8A 4PSRA 4XBPB 3VG9C 1IGIH 1PD6A 1NCJA 4MGXA 1HT6A 4XPBL 3WE6B 5HJ3B 4LASL 4ONGH 1YPZA 1M57B 2CIIB 2F5AH 1BIHA 2EIBA 4JY4B 1S3KL 5ID0A 2VLRE 3D33A 4RZCB 5DK0B 3RNKB 2GSIB 4GKNA 3JWNC 1PLCA 1XEDA 4BSJA 1PD1A 1Y07A 1Q0XL 3FTUA 3GXDA 5DMIL 3UEQA 3WTYA 2PW2A 1U91A 3ME0B 4HK3J 4KTEL 4YZWA 4HXBH 3H0TA 4LLUB 1KJ2A 4DK3A 4FHJA 1I8MB 4IOSD 4LDOB 4F8NA 3CE1A 4YEEA 4XNXH 2YUXA 3INOA 2VT0A 3MCG1 1MWAL 5C0CB 3RHWF 4OLVH 1F42A 3T2NL 4CVZB 4LL9A 1G6RH 1GGCL 3O6FA 4A04A 1YVLA 5DR5H 1AJ7L 2BP5M 5IY5B 3AADB 1G0XA 2I24N 1I7ZA 4OJYA 3QHZH 4KMQA 1OP5K 1HSAB 3F12B 3D2UB 1EZLA 3QHTC 1A64A 3CHQA 3IWVA 3OZ9L 1JDDA 1U8CB 3PP3H 3DRTA 2Q3AA 3EBGA 3OVUB 3UERA 2C7FA 3CH1A 4WI5A 4BDVB 4ZYKA 5IQMA 4FQXD 4G8FB 1JV2A 3FAXA 4YXHH 3ES6B 1CT8A 1N18A 3HG3A 3ARPA 3DMMA 3FZUC 1D7CA 3PDOB 4IOSA 4UV4H 1GGUA 4IU3A 3FDWA 4LPTA 4LHQB 4M6OH 3TN0D 1XAKA 3LDBC 4XCCH 1IGTA 1IE5A 2Q8BL 3HUJB 1W0VA 1QTYT 1BD2E 2ZUVA 3NA9H 1P2CA 4A6YB 1L9NA 3DVGA 5DT1H 3ATEA 2NPLX 3CZUB 4AC4A 3SDAB 2HLAB 2X9ZA 1D5MB 3V5HA 1L9PA 2FDBP 5GIRA 5CP7A 1I82A 4NEHB 2OW7A 3OKMA 2W81C 4Y4HC 3PQYE 3S35L 1A9BB 3Q01A 4NSKB 2LQRA 4YHPA 4PCTA 4JKWA 5BZXA 1EFXA 1R24A 4G5AA 1FGNL 3FQWB 4IRSA 1ZTXH 2YRLA 3CFEB 1RULH 2NOYA 4LAQH 1UWXH 4X9FA 1WQVT 3RA7L 4RMVA 3S98A 3WSQL 4AEEA 2IBZY 1OW0A 3VFPA 5I15H 1L6ZA 1FLRH 1OGTA 1XF5B 2IALB 4XVUD 4G83A 3LKPA 1UT9A 1ROWA 1IFHL 5EN3A 3BZEB 4QRUA 1BZ7A 4DEPC 4MB3A 5I6OA 1FCGA 3O3AA 3QDMD 3RIKA 4PB0L 1L9RA 3N0PB 3UABA 5ACMA 4X9YA 4P23B 2MOVA 4L5FH 4CU6A 1JGDA 3LN9A 1W16A 3BP6B 5I1EH 2BY3A 1MCWM 1P6AB 1SN0A 1Z9SA 4N9OB 4TYUA 3GGWB 3RGVA 4P2AA 3HE6B 3ZDYF 5BV7L 1OAJA 4X5XA 3IDXH 2QSCL 2I32A 4H1LG 3QDJE 4L9LC 2VXUH 1UHVA 1UZ8A 2IOIA 4YO0A 1T3FB 4XZ4A 4Y9GA 5A6LA 1FPTL 1OK8A 4UTAH 2KPWA 3QYCA 4YQXH 1UCBH 1WCBB 3RWIA 2WN3A 2VJ8A 3EFOB 3BVVA 5C09E 5K5YA 1CTNA 1P1VA 4AQ1C 1CQKA 3T04D 1K3ZA 1G5AA 3OSVA 4PRAA 3QDMA 5C0RL 1DVFC 4MNGE 4AXWB 4XPAL 5I76A 1OAYH 5IV2A 2KZKA 3OAWA 2ED7A 4U31A 2GSGB 3S35X 4JFFB 3TNMA 5DDHA 3IJHB 4DP5X 1N6QL 1M56B 3GMOA 3INUH 1I8IA 1FN4A 1YJDL 2X6MA 1XCXA 1UJ3A 1LE9B 3GSXB 1NCAH 1J8RA 5AG8A 1HDMB 1FFOA 4CBZA 3UIYA 3RPIA 2NXYC 4HK3N 1YC8A 3RNQA 4N2GA 3FS9A 4R7DA 1NBQA 1HQ4A 2UY6A 2VLRB 5HTSA 4BCZA 4Y5YA 4KI5F 3FTXA 3AWFA 3W5NA 4NRYB 5JORB 4XHJD 5ENWB 3I02A 4MLSA 4AYBA 4IRZA 4HALA 1M05B 2QQKH 4NQVB 2CMRL 3PGDA 1L3WA 2W9LA 2YC1B 4ISVB 4KI5D 4X0KA 2DWYA 3NJIA 3FRUA 2LU3A 3WUWA 4TQHA 2L04A 2X9XA 2QVIA 3ILPB 5ESAB 1T4WA 3AY4C 3N85H 4P5TB 1CR9H 4JFYA 3P3YA 3VXRD 5CJXC 2GT9B 5C07E 4Z0BH 3LZRA 1IGFL 2DLFH 5D2NC 4HPHA 4HUCA 1MFCL 1OTSC 4PG2C 4DGYH 5DC4B 4K8RH 2BP8A 3D1MC 4PJIB 4F80A 1TJHL 1TTAA 1YEIL 2YARA 4LCWE 2HMID 1FNLA 2CO1A 4PRPE 4GKOA 3T6QC 2XFXA 5E0QA 1YEHL 1DUZA 3TJEH 3UZVA 4PRIE 1TTBA 4E41B 1Q0EA 3U0WL 4FNTA 5DURD 4RWHA 3R18A 4UQ2A 1CE6A 1YEKH 3BKCL 3DHJA 5FYJH 2IPKB 4D9LL 5TF0A 4V2CB 3TURA 3VXUE 2HRGA