3KBFA

C. elegans cu,zn superoxide dismutase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
SNRAVAVLRGETVTGTIWITQKSENDQAVIEGEIKGLTPGLHGFHVHQYGDSTNGCISAGPHFNPFGKTHGGPKSEIRHVGDLGNVEAGADGVAKIKLTDTLVTLYGPNTVVGRSMVVHAGQDDLGEGVGDKAEESKKTGNAGARAACGVIALAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structure of C. elegans Cu,Zn Superoxide Dismutase
rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 41
structure length 156
sequence length 156
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3kbfA00
1F1GA 2GBVA 1P1VA 2WWOA 1COBA 1JCVA 2WKOA 2WZ5A 1YAZA 2VR8A 1EQWA 4OH2A 3MKGA 1SXNA 2AQTA 2GBTA 1B4LA 2GBUA 1DSWA 3GZQA 3H2QA 4N3TA 3KH4A 1QUPA 1MFMA 1Z9NA 3QQDA 3MNDA 2E47A 1B4TA 3CQPA 4A7GF 1TO4A 1CB4A 2Z7YA 1U3NA 2NNXA 1PZSA 2WYTA 3HW7A 1N19A 1JK9A 1Q0EA 2AQSA 2AQQA 2E46A 3S0PA 1UXLA 1SDAB 4MCMA 2JLPA 3LTVA 1TO5A 4MCNA 2AQPA 1XTMA 2WZ0A 4A7SA 1F18A 2AQNA 1E9OB 5CU9A 1SOSA 1SXBA 3HFFA 4A7TA 5KBKA 2SODB 2ZOWA 4BCYA 3ECVA 1AZVA 1OAJA 2K4WA 2Z7ZA 1IBDA 3KBFA 1SRDA 3ECUA 1OZTG 3K91A 4B3EA 2WYZA 1IBBA 1IBHA 2ZKWA 3KBEA 3KH3A 2XJKA 2C9SA 3GQFA 3KM2A 2AF2A 1RK7A 4FF9A 4L05A 3PU7A 4A7VA 1DO5A 1SPDA 1UXMA 2C9VA 2ZKYA 1IB5A 4OJAA 3CE1A 2C9UA 5KBMA 1E9PA 1JK9B 1SXSA 1XSOA 2ZKXA 1E9QA 3GZPA 3SODB 4A7QA 1L3NA 2R27A 1OALA 1SDYA 1HL5A 1F1DA 1OEZW 4BD4A 2VR7A 3HOGA 3F7KA 3T5WA 1PTZA 2Z7WA 1F1AA 1HL4A 2Q2LA 2VR6A 5KBLA 1SXZA 3F7LA 4N3UA 1E9PB 1N18A 3CQQA 3QQDB 2LU5A 1KMGA 1FUNA 1YSOA 3ECWA 2AEOA 4BCZA 4A7GA 1BZOA 3GTVA 1CBJA 1PU0A 1XTLA 2Z7UA 3KM1A 4A7UA 1ESOA 1IBFA 3L9YA 1EJ8A 3GTTA 1YAIA 1S4IA 2WZ6A 2V0AA 1Z9PA 2APSA 3RE0A 1E9OA 3H2PA 2JCWA 2XJLA 2AQRA 2WWNA 2WKOF 1SXAA 3L9EA 4U4IA 1OZUA 3GZOA 1BA9A 1SXCA 1E9QB
chains in the Genus database with same CATH superfamily
3VCLA 3KLAA 2F19H 4R6UA 4XCYB 5AYUL 4CVZB 2WZ5A 5E6RB 1GS8A 3D52A 3Q8EA 2EKSA 1UUSA 3OQ3B 1G6RH 4MMZB 2F7PA 2NNFA 3RVUD 1HWWA 1E4WL 5KZCD 1IC5L 2P26A 3GFUA 2XN9D 5KYYB 2ATKB 2ITFA 5TF0A 1HEZB 2XKUA 3FTUA 1YN7B 3VI3B 4AYFB 5F7YC 3HE6B 3MUUA 2VDKH 3GSVB 1OP9A 1TQCC 2H8PB 2F0CA 5T1LA 4XCYA 3BWZA 4EI6A 3LH2L 5IVOA 4KK5C 5KAQG 1P5VA 4LCCB 5TDOB 3WG7B 2EE2A 5CEZH 2PR4L 3BXNB 2ALAA 5EA0L 5IP4A 1R6VA 4UQ3A 4NUJA 5LDSA 3E8VA 2VMCA 2JLPA 3U4EB 3ZQXA 4TF4A 4MCNA 4ODVH 4MTMA 1KBVA 2E76C 4ZFFB 4X9BA 3QUZA 3DMMD 2AQ1A 4NUPA 3BH4A 3VW3L 4MAUH 4AQEA 4F93B 1A6VL 1I1AC 5DVLA 3ARFB 1WBXB 1UD2A 4HVBA 2OTWB 1NGQH 2FSEA 3D3VD 5FA4B 4BCYA 4C56B 3IFLH 2F18A 1I1RA 3RJOA 1T3FA 4JFFA 5EBLA 5J6HA 1TJGL 3ZW3A 1RIUL 4LSRH 1ZHBB 3HBQA 1BLNB 1QHOA 2BVPA 2JKTM 2EDOA 4GFTB 2BSDA 1MCBA 3TEZA 1NCGA 2C9SA 4MCZA 2NLJB 1D9KD 5AKSA 1JXJA 2XIIA 4J5VA 1HXMB 3FCUB 4NKDB 5KJ4A 1S9XB 4KY1L 1GVIA 2FEDD 5FGCB 1WPCA 2FX7H 5AOZA 3UC2A 1PDKA 1JK9B 4XAWH 3STLB 4JM2D 4H26B 3S4SB 3EFOB 5KSBF 1G4MA 1P6WA 3UDWA 3SE9H 3UP6A 3GMNB 1CFTB 2O6EA 4ONFL 2R7EA 3D2UA 2MCG1 3VRJA 3ELAT 1FAIL 1YLBB 4Z7UE 4FFVD 5AZ2L 1WRFA 1AI1L 9PCYA 1CTNA 2APFA 4JFYB 2GYSA 2AKRA 1OAUH 4F15C 1JGLH 5FIEA 3LPFA 3Q3GB 4XBPB 2ITCB 4I3RL 1U0QA 5EWIL 3D2UB 5HGDB 1MW0A 1HSBB 3VRJB 3L1OH 2YD4A 2EDFA 1N10A 1CD1A 3AGVA 1QFWH 4PGDB 5FWRA 5GRWA 1DJHA 1S8DB 4HG4K 4ZO8A 4F27A 4RAVB 2VH5L 4W6XB 3QUHA 1WH0A 2FO4A 1EX0A 3ZE1F 4E41B 5DJXB 4W68A 1NOFA 4NN7B 3BO8B 5FHAH 4H8QA 1V8HA 5L4IA 2DMKA 2IQ9H 2TSAA 3JV4A 5TDOA 4OGXH 1IVLA 1EHXA 5FW7A 3L1EA 3D30A 3TIDA 1KB5L 2EDLA 3O6FA 2W92A 4WU5A 3WE1A 4MJ6A 5IT2L 4A2HA 4G59C 3H9YA 2H9GB 3QR1A 3QG6A 5CUSL 4B9GA 3GXDA 2X4UB 4WI3A 1NDMA 1BPLB 2K78A 5KTEL 4AQEB 3CBKB 1BVLA 4GI6A 3PHOA 3MNWB 3SKOA 2AQQA 1ZJBA 2Z3FA 3HLKA 3G6AB 4LXFA 1W0VB 3GDCA 3HPJB 4JFHD 2OS7A 4GXVL 2XG5B 1F4YL 2PPFA 4BFJA 2YPVH 2BY0A 4LKCB 3QCVL 2BP8B 4Y2NA 1OY3B 5FV1L 3Q1SH 1XGYH 2IAMD 4BE6A 3L2LA 5LAXA 2I9LA 5D93B 4YSRA 1GR7A 1OTTD 4DP4X 1T20B 3X1NA 1X7SA 5FYKU 4H8WL 4YSEA 3SHSA 5DZ9A 1JF5A 4Q52A 3FQYA 4K3JL 3L81A 4RMRA 2A99A 5CD5C 4Z3TA 4Y4HD 4ZZKA 5ILTH 12E8L 2D7TL 4ZQKB 5E99H 3LKRB 1E4XI 4TSBL 5IV2B 5L9DH 1DN0B 3GXFA 1KB9J 3FSZA 5DQJB 3WNNA 3DGGA 2IMNA 1M7DA 1YY8B 2D7OA 5JXEA 1AE6H 3P77A 4PJ5B 3UPRB 1NDGB 1BAFL 5DD0H 3GRWA 4YO0A 3CFJB 3QQ4A 1PG7X 5FGSA 3WKQA 4WHTA 5I2IB 3NJLA 3U2SB 5HBBA 1JVLA 1NCDL 2ATPA 2D3JA 5HDLA 3QO0A 3LXAA 2BVOB 4HUWA 4LKXB 1VFOA 4TUOB 4Y16D 3HZYB 2VMFA 3UJIL 4LMQI 2CLZB 1KYOJ 4X9FA 4KDVA 2XTJE 2GI7A 4TULH 4PWJA 3IK2A 5DJAB 5GGRA 1D5XB 2B1AL 4I0KA 2VSKB 2W9LA 1ETB1 3NUKA 4TNVF 1MVUA 3QUYB 1O9ZA 1D6EB 2YKLH 4LPVA 4WHCA 3GXNA 2CO6B 1GMIA 5E2TH 2FO4B 1V7ML 1IILE 2GEEA 2HFTA 2FYVA 1GPOL 4LHUB 4ZXBC 4JRXE 3TCLA 5LXVA 1ESOA 1DBKL 1FL6A 4JFTA 4R3SA 1J8RA 1Y6NR 4LSQL 3EH5B 4UDUA 5EB9A 1R0AL 3H7BA 1EBPA 1IEBA 2EH7L 2F1AA 2ZF9A 2XWZA 5IJVB 2WSKA 3O4LA 3QUMA 3VXSA 2O5NA 3D09A 1TUPA 3W9DA 2WMPB 4OUOA 5GSVA 3FL7A 1TZIB 3QIUD 3OPZL 3RPBA 1U8JB 2OXGB 2VQUA 1UATA 3HC4H 5DEFB 1J5OH 3MBED 1EAJA 1FFNB 1R3LB 5FM8A 4EOWH 4OLXL 4WV1A 1FPTH 3FAXA 4JFXB 4GKNB 4Y9GA 3D2UD 2A0LD 1WZLA 3PP4H 4XXDA 3VB9A 4TQ8A 3TN0A 1E0OB 3QZNA 5HDBE 3W5MA 1SY6A 3BYTA 4IRSA 3SDDB 4J3WA 4ATWA 3GBML 3BZFA 2DQUH 3JWOL 1GYUA 3ARGD 4JHBA 1BGXL 1QQDB 4K3GA 2V2TA 4NWUL 3MJ9A 4KVNL 2W80C 5C9KA 4MJIE 1PFOA 5EU3B 4E5XA 2P5WD 4PJXF 4QCIB 3BRFA 1EA9C 2NY2C 3HFFA 1F97A 5LKNA 1RZIA 3NQIA 5FB8A 3ULUH 3LDBB 2FECL 4FLRA 3N1PC 5DJ6A 1T0NB 3HRPA 4WUKL 2B5IB 5FYLH 4PP1D 1D9KB 4PJEB 3Q2LA 4WVRA 1AO7A 3B7TA 4K15A 5ANHA 4DN3H 5E8EB 2VDNL 1UWYA 1JERA 3IWUA 3KWWB 4KZCA 3IJSB 4P2YA 5DUBB 2O6PA 5C08B 4GYBA 2CDEA 2YOAA 4ONHA 3WIHL 3S37H 1Y18B 1JHLH 4X5LA 2XZCL 2P43B 1A7NH 1DUYA 2E4FA 2YMXL 4LPXA 4Z0BH 1PIFA 5ETUA 5DHYB 3OKLA 1YQVL 3G5YB 4PIBA 1XHHA 2IQ9L 2IBZX 3C6LC 4ODSH 3QUXD 2A1WH 4AGLA 4I18A 3VFWB 4BDVA 1A14L 2IADA 4URKA 5AFAA 5IW6A 1QOKA 1U8OA 3AB0B 2EH8L 4R7DA 5I71B 1SMAA 1EDYA 1X4XA 4W9KC 2BFVH 3SYAA 1LQBC 5ACLA 3WEOA 1B3IA 1OAXL 2BNQB 2NNCA 1XCTB 5D96B 3RDTB 4XPTH 1KELL 4BWTA 1UWXH 1EPFA 3O6KH 5IJVA 1I53A 3H4FA 5IGXL 1NUGA 2OJEB 3ENEA 3FT4A 5EOTB 3RJDA 2NY0B 5BJTA 2C34A 3TBWA 3VI3E 5ESQB 2EXYC 2E6QA 4AEHL 2JNZA 3AW5A 3D48R 4BKSC 4P3WA 1XCQB 5FUOH 4BRVA 4LLYA 4TLTA 4QGYA 5LB1A 1TYJA 1XF1A 4NKIL 3V95A 3WO4C 5MENE 5AAMA 3O6FB 3F6JA 3UAJD 3OC8A 4NQSB 4XT1C 1X4YA 3D1MC 4Q2ZB 5CMAA 2PF6A 2K70A 3U6XA 3GSWB 1GYCA 2OW7A 4C83A 1SZNA 4HC1H 4XMUA 3MJ6A 1SUJA 1LXMA 1RPQA 2JJSA 4BH8A 3RGVC 4WCYH 1J10A 5B7FA 3MRBB 4DT2A 1EHLH 3RKDC 2J2ZA 1QBAA 2YFNA 4FFWC 2YGOA 2EVIA 1LK2B 4G82A 3IMTA 1GW0A 4YDLC 2DWDB 4JFDD 5LXGL 1C5DB 2TSBA 2WQVA 3UGEA 3BUYB 1XQ4A 3BH8B 4HUUA 3KPSD 4PVNA 2GJRA 2HT3D 3U79A 1GTNA 3SPVA 1CR9L 2OL3H 3AQZA 5D2LB 3RURA 2QPEB 3APDA 3NRPA 5A40E 2Z4TA 4K55A 1USZA 2X70A 3QUXA 2DIEA 4TULL 4MMXA 1ZV9A 3F58L 2HFFB 5JOFB 4NXSA 4M56A 1P0SE 1XZWA 4LLAA 4G7VH 3ETSA 1I1YB 4W9HC 3WFZA 4YMPA 3IAPA 2VXTH 5CLTA 5EA0H 5SWSA 2WCSA 4M3JA 1INDH 1JHTB 5JR1H 5DYFA 3WFHB 1JXKA 5ESQA 3H9SB 4X5XB 4BK4A 1NFDB 3N06B 4KNUA 2Y07H 1WBYA 3KHQA 4Q8BA 5B7EA 2QGBA 2BOCA 3KR3H 5KVDE 5K9KA 4KJPD 3QAZB 2YRPA 3S8WA 3B9AA 4JFOB 3OD3A 3QHTC 4QJ4B 2P80D 1EFXB 2G5BA 4Y5VB 1W8OA 3T0EB 2OMXB 3UJTL 1MAML 3A6OA 5AW5B 1MCEA 3P0GB 3K7UA 4G6KL 1OP4A 1T2QL 3WJLC 5I76A 1UYWH 3SJVA 1KLGB 1J5OL 4JN1H 5BO0D 2QADC 3VQ1C 4UT9A 3AXHA 1KMGA 1PLGL 1DQDH 2QJDA 1MIEL 4K94L 1EGJH 1SJEA 4JY6A 4BCZA 3UAAA 4X50A 4WKXA 3S98A 3LRSA 3F12A 2J1KA 1QW8A 1JPFA 3H7LA 3MREB 2LHAA 4BA8A 4I4WA 3VD9A 3IJ9A 3ZY7A 1JI2A 3QZWG 5F8RC 1QLEL 3NFNA 4UT6A 2X4QB 3UOAB 3R8QA 2OTUB 4JQXC 4QHNA 3QCUH 5CXPA 1KEML 4JK0D 4OJFH 4YHZH 2Q9OA 1KYOK 2AK4B 2GBTA 3IJHA 1A6TB 1MCSA 4YSCA 4PD4K 1WUNT 1F4YH 3DIFA 4FLSA 4RQQB 4LHJB 4WV1B 3VXQB 1AS7A 3WXWH 4BUGA 5CD5D 3L3IA 1UC6A 3ILQD 1EIBA 4POUB 4FS0A 1QZ1A 2QPSA 2Z92A 4FFZL 4XBGB 3UIYA 1AFVH 2PW1B 3GS0A 4JCMA 5D6DA 3GSQA 3CX2A 1UQSA 4X6EB 3RPKA 1OOWA 1PZSA 1JL8A 4PTUA 3IYLW 5C2UB 1T21B 2PYEB 4FNPA 5F1IA 2BPBA 4Y4HB 5AQ0A 2FX7L 2BHUA 3RWEA 1NFAA 4IS6B 1DUZA 5ILTL 3NH7L 3TM6A 3W11D 1QACA 4OF6A 5EOCJ 1O75A 1MW2A 1NA8A 3QDGE 2ZP9A 4UM8B 1RV6X 4TLUA 4XRCB 2EZ0C 3KCPB 3EGXA 1GC1C 2WXFA 1B0RB 1EZSA 1FYTD 1RFDH 2YPVA 3MBWB 5I1AA 1BYNA 3GO1L 4MCYB 4J2XA 4WY7H 2PPCA 3BAKA 3V5DA 1G4RA 4XPHH 3IVKB 2CE6A 4NO0B 4OCRH 1UA3A 1I8MB 1HNGA 3V9CA 2A4EA 4P4RA 4PY7B 3WFEH 4OZHF 4XNMA 2IG2L 3QDGB 1FZKB 4IOFC 4LLVB 1GW6A 4G11A 4X7EC 4HUMB 1UZ8A 2DLIA 2CHDA 3J2PA 3EBAA 3AY4C 4LPCA 3QE5A 5GISL 3ZDYF 2BSSA 5CSBA 3TCXA 2Z35A 4ATTA 4JPVH 4XN5A 4PW4A 3BZ5A 3ZK0A 4PH8A 3N40P 1MFAL 1SF3A 4WIQA 2EDRA 4O2CA 3MV8E 2BOLA 2DQIL 1PLCA 1RZ8A 3OGCB 5TH2A 1K4DA 1Q0YH 1YEJH 3GLZA 2NDGA 4RVBA 5BS0B 3GMPA 2V2WA 5IEKA 5D7EA 5DFWH 5AWNL 1WUZA 4C8XA 3DDGA 4PRPD 4I89A 4HG4J 2E3VA 1A7RL 1U92B 3CX5J 1Z0NA 1J7VR 1H6EA 3WO4B 3MLTB 3GUTB 1NH6A 1RI8A 4H0HB 1FL3A 2B8OT 3KYOB 2WOBA 4GXFA 2E7BA 5DTFB 2XJLA 5SX5H 3RILA 2DI8A 3UADA 2FD6L 4GSDL 3QUML 3KH4A 1KLFB 5E8OB 1JGIA 3L6FA 2JQAA 2EIEA 3ESUF 1BZ9A 2WLMA 1RUKL 3FU8A 1CF1A 4EI5D 3ISRA 3GJFK 2Y2YA 1F00I 2AANA 2CIKB 5DTFA 3BFWA 1A6VH 2OLDA 1KTKE 4MSWA 4N3TA 5CKAA 3RPIA 2VQ1A 2C3VB 5IUCA 1S7SB 1XZ0A 1NGYA 1PNCA 1RK0B 3BD4A 3MXWL 3U9UA 2CCVA 3ARDA 2Z7YA 1W72A 1BIIB 3OKNA 5AOKA 3KWWA 2YQ2A 3E9UA 1TTFA 3ZUCA 5DJDA 2AGJH 3CFTA 2XZQH 4QXGL 2F5BL 1DYZA 3P3UA 3A3YB 4M6NH 1RHHB 5BS0A 1J0ZA 4NDMB 2HFFA 5D5ME 5C0JA 3QJVB 3PJSA 3GXIA 2CO7A 2ZF8A 3FQUB 4OGYL 3EO1A 3TWCL 4UT9H 1FFOA 1U2HA 3EJZD 5IROA 1OP3K 3FSAA 5I6PA 1T7ZA 2WMPA 5DRNA 2B5IC 2BVTA 4JQIH 5TJWK 5B1CA 2K7PA 3WS6C 2QMJA 3BN9D 3TYGH 4UQ2A 3B2XA 3HCVA 1FGNL 3NABH 4TUKL 1ZEAL 1P7KB 4QXVA 3DX3A 5SWQB 2IIJA 4KXBA 2GFBB 2VM4A 1CGTA 2LU3A 3ZT7A 2YSSA 1V3KA 2FT6A 3G9VA 4JJ5B 2CXGA 3ARWA 1JF1B 1RZPA 3GMLA 2Y2TA 4K3DH 5CZXC 1SXSA 3MPCA 5DK0B 3S96A 2FLBT 3K0YA 5IBUG 5FFGA 5JPMB 4UILH 2R27A 4MCZB 2OI9B 2W8CA 1J5DA 4N0FB 4PJHB 4KKLD 3QHZL 4GRLB 4Y89A 2R8SL 5KVFE 2DQEL 1QYGL 4I5BB 3FONB 2O6CA 1KJVA 2B3IA 4NQUA 3SO5A 3LPGA 4ONGH 2GUOA 4OVUA 2YPLD 2KZ1B 4OAWA 1DQLH 4M5SA 1W6WA 2ZP8A 5J11B 5GRYA 1XT5A 2BIPA 3ECWA 5H4ZA 4XGZB 2QTVA 5IMMA 2J5LB 4AGMA 4QIRA 4TSCL 5I1KH 4F9PA 1TEGA 2WLNA 5DS8B 2HKFL 2LU7A 2EVGA 2G9HB 1JPSL 4X83A 1VACB 3CFDA 2CLRB 3OTTA 4PEEA 1L0PA 2YEZB 3H9HA 1L6ZA 1KB5A 1XCTA 4CN1A 5EC2B 2CAKA 4YLCA 4GAYA 4JG1H 1W80A 5ADOH 3S88L 3WSQL 5AB9A 1SXAA 2BDNL 3JVGC 4UNUA 5DGQA 3KWTA 4F7TB 3O2WH 2LV4A 2EIBA 3K6OA 4AC4A 1F1GA 5E9DD 4P2QB 1SBBA 4ZUSA 2GTWB 2NR6D 1XCQA 4PLJC 2X05A 3EHBB 1EAOA 4OM0L 1TZAA 4MS8C 5I2IA 3WJLA 5CEZE 3TBYA 1P7KA 2VNCA 3H3KA 4AVHA 1TIUA 3OM3B 4N2EA 3MJ9L 1SEBA 4FNLH 5IVZB 2X2HA 2HTKD 3I85A 4TPRL 2FBOJ 2OA9A 3RGBA 2OMZB 5IB3A 4NJAL 3ARBA 4KK8C 1YNKH 2BSTB 5KG9A 4HOZA 1NPUA 1U8QB 5I8OL 4FJZA 1OCCB 3I50H 3VXPA 1NAKL 3KPSA 4EKXA 1ZOXA 5TE6L 2A9MH 2F1BA 3LTVA 1U33A 3GEWB 4HEPG 1XGUA 1FNLA 2VITA 2X9WA 2UWEA 4FFVC 4FQJH 4Z78B 3BN3B 1AVAA 1BVZA 1U3ZA 4JQIA 4KRPD 1C7SA 5D7LE 4A2EA 3DGDA 3BI9X 2J8UA 2DD8L 2K8QA 4WU7B 1TEFA 2SEBB 3K46A 4PFEA 2XG4A 2HN7A 5E6IB 3TEUA 1MXGA 3BRDA 3UTTA 3SDAC 2ENSA 4HEME 1YYML 4N2CA 4LCVA 3IBEA 4E5XB 3ULVC 3QQ3A 4AT6B 4MRCA 2P24A 3TN0C 2JXMB 2YMTA 1LO5A 1BFVL 4G7SB 2X12A 4RRPG 3V0EA 4MXVF 5LN8A 1T6VN 2E86A 2FBJL 1KCSH 1RVFH 4AQ1A 1CO1A 3NCEB 3HNTL 4H0GA 4JFEA 3ZRCC 3KLQA 1U36A 4HFUH 1G7PA 3D39E 3ARGC 5DQDH 4WW2C 2X4SB 1R5IB 2IFGA 4CRPA 5GGSA 5C1MB 1FYTA 3ZKMC 1S5HA 2BIMA 3T04D 3FN9A 3WHXA 1T4KA 3WTSA 4Y16C 3SDAD 5B38A 2AKRB 1JZFA 1H8LA 4ZYKB 1PL3A 5C09B 4HOWA 1AHWB 1Q9LB 5F6IC 1OHQA 5T1LD 5FOBA 5DSCB 4MGXA 2FYYB 2Y2WA 3P0VL 4FQIH 2CLRA 2JE8A 4NCC2 4A39A 3R0MA 5BZWA 4JRFA 4XCFH 4X7TA 5E5MA 5JYMA 1QR1A 3QAZC 3EFOA 4RAVA 1M71B 3QPKA 2PTVA 4LIQH 3X1EA 3KMDA 4MQSB 4HPYH 1GYVA 1N5YL 4JPSA 1T21A 1CBJA 3MUZ1 4HP5A 4DN3L 4YS4A 4LLWA 4PJFA 1VPOL 4ELKA 1E43A 2ADJA 1MI5B 5DRXA 3UP1A 3NFPA 5EORH 2ZICA 3U1SH 4KH2A 3HZKA 1MVUB 3D9AL 5JW5A 4FJ6A 1J1PH 1ZA6B 1Z5YD 3FO9A 1BEYH 3RI5K 4J3BA 3U7WH 1Q1JL 1MXDA 4YSDA 2HH0H 4O5LL 3T3ME 3VYPA 1NC2B 2QELA 3LCYA 4KX8A 2PLTA 4ETQB 4TVPH 5B21A 1U8HA 5DFVC 3C5SA 3GSRA 2G3NA 1B4LA 5I0XA 2FHBA 2R2HA 3CSPA 5I1KL 3HN3A 3LZOA 3D05A 4PY7A 2VAAB 3GB7A 2P5ED 4N5EC 5DYOA 3K6FA 4CW1A 4JDVA 4F7PB 2IFFH 5DD1L 4DJMA 3T3MF 2KLSA 3X12A 3F7RA 1VAHA 3HC0B 3KL5A 3Q8CA 3QYCA 3D07A 4U1JA 2DWSA 4B41A 2AXHA 3MV8A 3U4BL 1FBIL 5DQ9B 1ZLSH 4UILL 3U0WH 2NY4C 4NO5B 2I5YH 1KIQA 5CN1A 1ICTA 3MV9B 4TQEH 1ZSHA 4YIQB 1KLUB 5AW8B 5MEOA 1TZGH 5KVGL 2VZ1A 5EF0A 1RUPL 4KNTA 5G4MA 3R1GL 3BE1H 4JDEB 3AU1B 1YNKL 2Y7OA 4FQXB 4GUOA 1SRDA 1GGYA 3U4KA 3ZZLA 2F53A 5IJKC 1CYGA 5EUOA 3SPJA 1IBBA 2ESVA 1XGTB 2CK0L 3VI4B 5IW1B 3F83A 4XP9H 1IC4L 2MTAA 3SQOH 5F7NC 5KZCB 2AF2A 1WISA 5T5NF 3MRNA 5ADPL 1ORQB 1LEIB 3TO2B 4DVRH 4HEPA 2CU9A 4TKWA 4CSZA 1MFDL 1URIA 1AG6A 4LF3A 3LSOA 5L88H 5JORB 4YEFA 5A43C 5LDUA 2BDNH 1AP2A 3ISWA 4JKPH 5IEHA 5CCJA 2V9TA 4LLMA 3EFDL 5EO1A 4QRSB 2QKIA 4I0PA 5GGUA 2ADGA 3VI4E 4HCRH 4Z7WE 4AOFA 4G2AA 1UWGL 3Q8FA 4R4NC 3H53A 2X1WL 1UB5A 4JG0L 4ALAC 4WKZA 5I1CL 1KCSL 2R29H 5GS1B 3OXRB 3V4PL 4PUBL 1H3XA 1HS6A 3IT8D 5DS8A 5JQ6H 2IF7A 2NXZB 4NBYB 4Y2OA 1OKEA 4URTB 1BVLB 1QLFB 3UTTD 1OAKL 4LLDA 1LDSA 4AYEC 5EO0A 4FOMA 5INDB 4WEEA 2ZX7A 4MQXD 2Y36H 4CVUA 3ASWA 5BRZE 4QXUH 4JG9A 5C0AA 3CFQA 5EF1A 3RWGB 3DX2A 1K72A 1FYHB 4AQAA 4JM2F 4YDVB 3T3PE 1UOKA 3B9KD 4Z76A 3UDWC 1UG9A 2K9UA 3EW3B 4OM1H 3H9ZA 5K9OA 2L3BA 3CFBB 4FKKA 3I02B 4NWTH 1EEZB 2CBOA 4MAUL 4GKZB 2VDOH 2EP6A 2LGNA 1X6LA 4LCIH 3KYKL 3OAYK 1CLCA 1OSZA 2YWYA 3TCTA 2WWOA 2CPCA 4G43B 1YDPB 3UBGA 5J6GB 2FT7A 4DNLA 2ZG1A 4XPHL 4DGYL 1MVFA 2QKIC 2XWBA 4I0PC 5C0CE 2DIBA 2NW3B 3AJ7A 4D3CL 4HFUL 2J55A 4U3HA 3MVSA 1OSZB 2P42B 1PGRB 4NAQA 2KS0A 2P8LB 4NHCL 3PDOA 3QWNA 1FH5H 1Q9OB 3KDMB 1Q0EA 1OM3H 5DEFA 3GXTA 3PUUA 4CA4A 1T0OA 4JKNA 3WHE0 3CJJA 3ULUC 1MJUH 4KO9A 4G1MB 4JO3L 4NM4L 2WAHA 1JIBA 1PVHA 2CHXA 3TZVD 1Y6KR 3GLAA 2HT2D 4UI2A 2FO1A 4PTTA 3P0YH 2HSIA 3APCA 3JSSA 3FO0H 5HDBB 1ECYA 4LLYB 2Y24A 3T8VA 5CFAA 2A3TA 4MA1C 2FEEI 4CSPA 2WXPA 2AK1H 2VN6A 1LEIA 5JA9A 4XNUH 3W57A 1KJ2H 5KYXB 1HHIA 2FCBA 1WP6A 2R1WA 1Z5LA 4GW1B 2NTSP 2AXGB 4OF3A 4J1UA 4GEIA 5F7UA 1NIFA 5JZ7D 5DFTA 2AMUA 2YLKA 3W9EB 5DC2A 5I1LB 4FQQA 5DLLA 1OK0A 5IB2A 5B38B 1J1OH 5KJRL 5MERA 1CDCA 2OMTB 4PJ9B 4X6CB 2J73A 1WF5A 1AO7B 1XGZA 2FD6H 3VM7A 4KUCD 1UASA 3V0WL 3SQBB 3PJNA 2WLHA 2X6AA 2FWUA 4RNRB 2D2OA 3KPRD 4JG1L 2EKSB 1MH5B 4GMSL 1R75A 4YHLL 4G5ZH 4G8EA 2Q2LA 3NJMA 1EFXA 3TURA 3C5ZA 1DUYB 1YRKA 4PBVC 2WBKA 3DBSA 3D51A 5GSRB 3TU6A 4X5WA 1KCWA 3WI9A 3S6CA 1I3VA 3TT1H 3FMGH 3RZCC 2IALB 4LHUG 2Q8AL 4OLVH 2FEJA 4PV9A 1TITA 4E9XA 3BZFB 4V33A 1JNLL 1KGCE 1YN6A 1T0PB 4IBTA 2PPDA 2H3NA 4Y5YA 5F88B 3HE7A 4K5LA 4HWEH 5I6NA 5CLZA 2QBWA 8CGTA 1VF5C 1BMGA 4Z78A 2JI3A 5C0GB 4ZTOL 2V3FA 3NDYE 4I1NB 4WTWA 4ZO7A 1UXWB 1INEH 1VJSA 2K9FB 1U95A 5FO7A 1A4AA 4OZFA 3WELA 3W39B 2VW7A 1RUMH 3CZNA 1NEPA 3JTBA 4M00A 4KY2A 1S2EA 1S7RA 3QO1B 1FWXA 4G42A 2XHNA 4X0NA 5DEZA 2AXGA 1C16A 1C5BL 3GDBA 3MUGB 3QXWA 3G9AB 2FT8A 2DBLH 3SDCA 3SO3B 1KFAL 1RFDL 4EUPB 5G4OA 4AXWB 1JPSH 2GTZB 3O11B 4M5YH 1NC4A 1QUNA 4I2XA 4JRLA 3Q3GA 4XBPA 5A6MA 3HNTH 1KWKA 1CVSC 3O4OB 4WW2A 5FYJH 2ZUYA 1HTYA 1PKQB 5C86A 3OLDA 5K9JL 4TOYL 2XBDA 5IOKA 3U2JA 2NY3C 3QARA 2X87A 2AQNA 2H6UA 1OVZA 1K4CA 2CDFB 3TBVB 1HDMA 1HN1A 2CHZA 2JK5B 2X4OA 3UO8B 5AD0B 3TVMB 3EH2A 4KGJA 5J6SA 1CGXA 1S7WB 4JBSA 3RWEB 1DVQA 3UX9B 1TOXA 3PWPD 3QWOA 1QR1B 4LDOB 2OM5A 3HG0A 3G08B 4NYLB 3RWHB 3V7MA 1EJOH 2QPDB 5D7SL 2JB6B 2P8MA 2NY2D 3DV4B 3ZDXE 5DRNB 4GT0A 4HWZA 1KT2A 2WLLA 3MXWH 1M7IA 2ZUWA 3P4OA 1YC7A 4BGDA 5I1AB 2CGYA 2NZ9D 3FB7B 3IDNA 2YIHA 1A7RH 2CNYA 4QGTA 2C7FA 3MLZL 5EWIH 1IM3A 2EIDA 3OG6B 3D85B 1QTYT 3IF1A 5E8DL 4L3EE 2FSDA 2I60L 4PRAB 1MDAA 3HI1A 3BDXA 5CN2A 1E30A 1FORL 2DZEA 1S7XA 1NL0L 3C6SA 1QNZL 1OEZW 2CIIA 2EDTA 1MAJA 2XTJC 4YBQC 4UMSA 4LGPB 1WO2A 3T5WA 2EVFA 4XR8C 1UZ6F 2Z7WA 1PZBA 3VXNB 1QFOA 2A6JA 4LSTH 2EEFA 5D9SA 1CICA 1SM3L 1T0MA 3TJPA 3IPEA 4QKTA 5F0PB 2DTMH 4APXB 3BOVA 2ZUTA 5E1AA 1Q9LA 2ADFH 3X14A 4LP8A 3RUGA 4U3CA 1LK3H 2BZ7A 3LH2H 2HTLD 1X5IA 2Z31D 4QWWD 3F7YA 3T8XA 3G6JE 3CFEA 5GS0L 1CDBA 1GYAA 4GB9A 5IR1A 1KYAA 1OB1A 4Y4FA 3SBRA 3HVDA 4JO3H 2ZJSL 5T1MA 4EN3B 4F9PC 5GRJH 3GBDA 5F3BB 2VMJA 3I9AA 1M7DB 2V9QA 3J27A 2EYRA 4WI5A 4KZDH 3VGAC 2BC4B 3CHXA 2ITEA 3O8XD 1A6ZB 1F58L 4YEEA 5I1DA 2PR9A 1JPTH 3PS6A 4F8NA 4JM2A 4OQTH 2ZNXA 4WUKH 3UTSA 4FA8A 1Q72L 2AJYL 2YZ1A 2F53B 3S35L 1MHHB 4QO1B 4F8TA 1F3JA 4DO5A 2ZD0A 2PXYB 3RL2B 5J9PB 2GI0A 2YA0A 5JHDE 2MOGA 2VLRE 4ZFZB 3VDBA 3SKMB 3RZCB 3EH4B 4ELMB 2H9GA 1OE1A 4BSWB 4JRWA 1AXTH 2RFXA 3HI6H 1Q4NX 3DBXA 1A7NL 5ELIA 4B3VA 5C92A 2BWIA 3ZSSA 1A9EB 1MJ7H 4O2EB 4MASA 2D31B 1SDDA 2DH3A 2VUYA 43C9A 1DL7L 4XOEA 2JB6A 2P8MB 4GMSH 4K8RD 1MWAL 3U1QA 4DO4A 5DJXA 4O58H 5I71C 1HHIB 5IROC 4M48L 4C59B 4JFZL 1XCWA 3D18A 2NCEA 4N2KA 3TO4B 4XMXA 3WCYA 4LL9A 3FMGL 1NMBH 2FR4B 1P7BA 1F11A 1DZBA 1MFBL 4KQ3H 4OLVL 1UWEL 3DMMC 4PUBH 3HZMB 1D5RA 4X0KA 1QFHA 3KEDA 5LVEA 3PE9A 4K5PA 2EIZA 4KK6D 1KPRA 4HDIB 4MFHA 2ZSWB 3M1OA 5F1OB 4Z7NB 3IDIB 5D4JA 5DMGC 4PJDA 1H8NA 1G9HA 4GPVA 4FQHA 3WFDL 5HJ3A 3RNQB 3I74A 4B0MB 3T2NL 3MRIB 4AIEA 4DTGL 4TVPE 5C3TA 3UTQA 4ENZA 2IXQB 2OSXA 1P7HL 5DJ2B 1AXSB 5JA8B 5AVQB 4J27A 4KKZA 2EIZB 3TV8A 2GFBA 4OM1L 4BD4A 2D4FA 2WN3A 2KQMA 1RMFH 3CIAA 4L4TD 1AR2A 3CX5K 3NN8A 5CO1A 4OZGA 1RPKA 4KJPC 1NDGA 5A6IA 2FEDC 3QZWA 1PZ3A 1CFMA 1UQSB 3FQ1A 4LSVH 5I1GL 5DJ2A 2V9RA 5ANMA 2NY2B 1RJYB 3G6JF 4OCSL 2YD3A 4GRLA 5GS1A 3OWRA 1A1MA 4YR6B 5E08H 5KSBE 3ELQA 2IBZY 4X6FA 1PIGA 5DS1A 3KXFB 1AGFB 2EDYA 5E6SB 2JJUA 3C60C 1R46A 4JO1H 1AE6L 4PJXB 1UACH 1UB6B 4PS3A 3EOAA 4JAMB 5C0CB 3N43F 2MQGA 3FB8A 3SPHA 2FNWA 1N6QH 3WGVB 1SEQH 3ECBA 5KSAD 1I7ZB 3MRFA 3HHSB 3RDJA 5DA4A 4YO0B 2X0WA 4MS8D 2GBVA 1IQDA 1P1VA 3EO9H 1HHKB 4P4KD 4Y1AA 5DO8A 1UKTA 4OH2A 5DZLA 3VNYA 4D8PA 2QQKL 3BWUF 4LSSL 2R2CA 2CBPA 1MHEA 1YYMH 4KUCF 5AOLA 1T1XA 1FVCA 1XV8A 1XH0A 2NX5B 3SJVE 4KNSA 4KKRA 1EXUA 5HGGS 5E2WL 2FNBA 1VADB 4G80A 3BVNB 2BNRE 4LP5A 1TKWA 3QIWB 2G4GA 4MJ5A 1LGVA 4UT7H 3ZE0B 5JHAA 3BKYH 3OKNB 5GXBB 4GSXA 1N3NB 3PQYB 4X7SH 1FHGA 1K3IA 3OKEA 4K8RL 4KH9A 3KGTA 2G60L 1RZKC 1ZDSA 1RJYA 3MNVA 4PWIA 2C3HA 3ARZA 2YRLA 3S35X 3N9GL 4QF1A 2AXFA 2X3CA 5EU7C 2O1AA 4ZFGH 2OTPA 3O4LD 5FO2A 2F74A 1CE1H 2WC7A 5MEPB 2X41A 3BVUA 5C07E 4UZSA 4JFXA 2E7LA 5DJ6B 2LU4A 1X5ZA 5DD1H 1ZHLA 4YSAA 1YY9C 1ECZA 3B2PA 5DR5H 2GCYA 1QAWA 5JPNB 2MSPA 1YEIL 2VJ0A 3HN5A 3M17B 4U1KB 4KMLB 5DC4B 3A47A 5AW1B 4AL8H 2G4EA 5D72L 5D7LD 5TFSL 1OTTC 4JREB 2DBJA 4YJZL 5J56B 1E9PA 2F58L 5ICXA 3HC0A 3HHRB 3LXCA 1UD6A 1FFTB 3KNBB 3BUYA 3MRHA 1MCDA 1R3JB 1T0MB 3U1SL 3AABA 1E50A 3W0WB 2XIBA 3QEHA 5D8JH 3DECA 4J6RL 3LIUA 4ANWA 4NLAA 4DFHA 4M8VA 3TFKC 2X7LB 1I4FB 3OKMB 1ZLUH 4XP4L 5E2VH 1IZJA 2BLFA 3HS8A 4OVVA 4WJ5A 2YO3A 2YRZA 4BH8B 3HMXA 3AWEA 1CTMA 4BFEA 3PP4L 3T0XA 2ZG2A 5C0FA 4JQXA 1CGVA 2Q10A 4FTVD 2WW8A 4XNQB 1HYRC 2Q1EA 3FHAA 3CMOH 2QGEA 3VAEA 2FL5A 1BLNA 1WT5A 4JKMA 2CJUH 5TDPA 2CQVA 3CFKB 4MYPA 5I6XB 1G7JB 4HUUB 3FQUA 1SLXA 3AACA 5C0BD 3VXQA 2A1WL 5T3ZL 4NQQA 4GRMA 4OIAA 5I15L 4WW1B 5PAZA 3RAJL 5HI3D 5CU9A 4NN6B 2PKDA 1YY8A 3RWDB 2VDPB 1KN2H 5DMIL 1COBA 1HHJA 2PCXA 2R1YB 5HHVH 4AIZA 3E8UH 3DVFA 3V5KA 4XVUC 1BX2A 1WFJA 4UQEA 1E28B 4WGVB 3M45A 3B1UA 4NUJB 4RMVA 5ECJE 3I3BA 1SJHB 1ZTXH 3B3IB 1PX3A 2E7CA 4R7DB 1JK8A 3SCMB 1NBCA 1P1ZA 3O3BA 5EIIG 5D1QD 1ZT4A 1L5GB 2XYCA 3CZUB 4HPHA 1PSKH 4PJ7A 3TNNA 1GXEA 1BVKA 3SYPA 3SE6A 1YN6B 1N2RA 5E4EC 4UMGA 2GTZA 3O11A 1INDL 1YPZA 3OL2A 3VRIA 3EADA 4RWYL 5ADPH 5BJTB 2XWTA 4KHXH 2RMNA 1FVEB 2VTFA 2FGZA 2V3DA 4ODSL 4EXPX 1SN2A 5KYUB 3P54A 5JHDD 1BAFH 5FK9B 5KBKA 4X4ZA 3V5HB 5EG6C 4HD5A 5C2BH 1H0DA 1FFPB 2ZYIA 5GZOA 1T2QH 2EDJA 2XWTB 4JHZA 1RJCA 4UQAA 1Q9KA 3R7QA 3VD2A 3UTPE 2G5UA 4JPWH 1FNHA 2SEBA 4LQFH 1FPTL 2DYPB 1SNRA 2UVEA 4XN2A 3AS2A 5JQ6L 1DCLA 3GWJA 4MJ6B 4PW9A 3S3PA 1SYSA 3M8OL 1KJMB 1DO5A 2YKLL 3QRBA 1WZKA 1OSPL 1BDYA 1QRNE 1V7MH 3BHBA 2IWKA 2ZOOA 4LPWA 3FB7A 5IB2B 4L37B 4ZUVB 4G8GA 4EIBA 5DUBA 3EOBB 2FHCA 4R90H 5EZOL 4JFOA 4GW5A 3TC9A 1I1AD 3WKNA 5D1QB 4U49A 3REVA 4ZFOA 3ARBD 1U8KB 2ADYA 1G1YA 4PTTB 5EF2A 1LD9A 4FQXD 5GHWH 5CU5A 2XA8L 2AP2A 4Z7WB 4I88A 1BXVA 2Z31A 5EIVA 5JOFA 1CFVH 3LJ3A 2PN5A 4BFKA 3UJJL 3QDAA 1I1YA 5DVPA 1VERA 4KTDL 3BPLC 4YE0A 2B9AA 3QPXH 3S5YA 2P5PA 4NAJA 5LBSH 1QLRB 3B37A 4YL9A 2GAZA 1RU9L 4OCWH 3U0TA 4DKEH 4Z8FL 2H41A 4LL4A 4OLUL 1UD3A 43CAA 2KH2B 1MFCL 4DETA 1E9OA 5J1TC 3PNRB 4M3KB 5T5FH 1N26A 1S7UB 5DU7A 4B5EA 5DUJA 4TRPL 1LHZA 1UENA 3AU0A 2J6EL 3GB7B 4HZLA 2GUYA 2WWMD 1E9QB 4N9OB 4BBWA 1QG3A 4DK3A 4OI8A 1KIRA 4FADA 1KWGA 2OP4H 4FA7B 3SPCA 4XMTA 5KBPA 4RGNB 2FZ3B 3RWIA 3MKGA 3VWKB 4I18C 4TNFA 4C4KO 4ZFGL 2F8XC 3QHFL 5I74C 2C4FT 3VI3F 3TYGL 3LQAL 4NUGL 4PRNB 4YVNA 3KYAA 5E6UB 5JW3L 4FZ8H 4IRZH 5CMAB 4LBEB 3ZDYB 3QUGA 5FYJD 4XZ4A 4U31A 2ZOTA 4KROD 2JTDA 5EEUA 4JFQA 4MX7B 3N1GC 3F7VB 4HGWA 2IDSA 4L0ZA 3SGEI 2F58H 5EO0B 3BQUA 1XSIA 2AABH 3K8MA 4PCYA 1Q9WA 4RAUA 2XXCB 5HVGB 3RG1C 4Z7OB 4TNGA 5DEJA 3REVB 4R3SB 5JIHA 5SWZA 2IGFH 2WJ5A 3L4WA 4XC3L 2UZIH 3ARGB 4NQXA 5AVVB 2WAQA 4HUNB 3KBHE 5IB4A 1YNLL 5I9QC 1L9TA 3WNPA 1OGPA 4HZAA 2NZ1A 3QCTL 2VW4A 3GSOB 1IC1A 3BCFA 5D7IF 4A2DA 4MAYB 3MRKB 4RMWA 5I1HH 4HJJH 4L4VD 1S7VB 4QRUA 4RISH 1DDTA 1O5PA 1ZANH 3DO3A 2X38A 4OTXL 1UEYA 5DD5H 2CBTA 2E7MA 3MLUH 5C7XH 4ZMXA 3LNDA 4Z9KB 5C09D 4X5QA 2Y5TA 3QC5X 1C9SA 4NOFA 5HYQB 1UACL 4UM9B 4PJIE 3W9EA 5I1LA 5D2NB 2XXGA 1ANUA 4W70A 2AEQL 4NQDE 3EYOB 4OCRL 4PWKA 4OQTL 4X7DC 4BUQA 1TTBA 3KPMB 3QUKA 1NKGA 5ID1B 2RH0A 3V10A 3WFEL 3WUWA 4QHLA 1UM4L 4RSVA 2BO0A 5MHSD 1VFUA 4FXKB 1QSEE 3MR9A 4PP2A 3GMPB 4KJYA 4U7SA 4W9LC 1FO0H 2NNRA 2AI0L 5DHMC 3I6KB 4F2EA 5D71L 5FLUA 2VRKA 1AR1C 3K8LA 4RZCB 2E9BA 5CJXC 4ZXBA 1M7IB 2ED8A 4FQQB 1JGEB 5I1IH 3W81A 4AITA 2AS5M 1RZJL 1T22A 1FC1A 1WEJH 3WXVL 4NRXB 4F37K 3IAQA 1BA9A 3L3OB 2N4IA 1IGFL 2KDYA 2V7HA 1KTJA 4LLUB 7CGTA 5E8NA 3OKYA 1R4XA 1ZGLA 3QEUA 4HK0B 2OKMA 1S7XB 5K39B 1T5WA 5CBEB 5IQOA 4BQ6A 1T6WA 2Q86A 3FTZA 4OZFH 1BBJA 3X11B 3EHBD 4LPUA 2FECI 2X4NB 1BF5A 1CURA 3ME0B 4HALA 1EZVX 3TV3L 4KI5C 1E5BA 4Q9RL 1PNDA 1VENA 2ZYRA 2YXMA 1ZEAH 3QXDA 3IJEA 1IAIL 4R4FH 3U25A 4P2QD 4GSDH 1JYXA 1AZUA 3O6ML 1YNTA 1OWWA 4DW2L 3S4SA 1S9WA 3WY2A 2BVOA 1TU2B 4PWHA 2FH6A 3DX7A 4WI0A 3TLRA 5F1IB 1YEGH 1PD1A 3LN5B 4M43H 2WB1A 3IS1X 3F04A 1U3HA 4PHXA 3KS0J 2KI6A 4FZEL 1YO4A 4ODXA 3QUYA 2D9CA 3T0WA 1GGIH 4PR5A 5IKCB 1ADQH 3QORA 1UYWL 2AMGA 3OKEB 4ZG1A 4H1LA 1WCBA 4IU2A 1FFOB 4N25A 3DRQA 2VAJA 4HPYL 5BQ7A 4KRNA 2DTML 1GS7A 1OGAB 5I6KA 1I3GH 4DP2X 3BP4A 5AKTA 1U58A 2X42A 1V54B 4KAQH 5AB2A 3GI9H 1TTCA 3VFSA 3SEPA 2R0KH 4G3YH 1SPDA 1SVBA 4KXZH 4HCRA 5J12B 1HCVA 2PYEE 2WNKA 1OXYA 4X7SL 1OL0A 2HJLB 4QHLB 1OF2A 1M6OA 4K73A 4KXAA 3QWRD 4G6FD 1FNEB 4J3XA 2G60H 4KBPA 4IBWA 5F9JB 3LRKA 4G8GE 3IETB 4L4TE 1PF3A 3SGKC 3PQYA 1XMEB 5MEND 4Q9QH 3LZFL 5E9DA 1S46A 1ZJAA 4ZS6D 3NIGF 4YDZA 4YSPA 2XACC 1EH9A 3VXMD 1VIWA 3WTXA 1MJ8H 4MDRA 1A64A 1N4XL 2OYLA 2C9AA 3BKJL 3DA0A 1T3FB 2BP0B 3LKSA 2X4UA 1FNGA 3PWUB 2D7MA 5IIEA 1BQ5A 2VM9A 2QEJA 4WSJA 1Q94B 2APBA 5B1BB 3GTVA 4DCQA 4M4RA 4QOKD 2O5ZH 4S0HA 3EBHA 1G7PB 1RZFH 4CMHB 3U6RB 2WQUA 3RGVD 4E9YA 1XGUB 1M1XA 4JE0A 2MQ0A 4MQ7B 1KFGA 4C4BA 2LTQC 4OJDH 1HK6A 4Q6IA 4ABQA 4OGYH 1K6QH 2EEAA 2YEZA 4FN0A 2N0KA 2ZCZA 3FT3B 3QNXB 2MTPA 3HLAA 2GITA 2DQIH 3RVXC 5T3ZE 4NZTL 2OL3B 1HXKA 1EEUA 5AYQA 1RP9A 3CLFL 3EJYC 2D7PA 2VCOA 3F5WA 3MA9H 4ZTPH 4V1DE 4OZIE 2HJFA 3LMJH 3LNIA 3B5HA 4YFLI 3KLSA 1B2YA 5DK2A 1FVDA 3NTCH 1P5UA 3O3EA 3POHA 5E08L 4RGNC 3HAEG 2EDMA 2XG5A 3MDJA 1QR4A 1NPNA 1A3RH 2R56L 4Y4FC 1MFDH 3G5ZA 5L2JA 3N42F 2G30A 4NNXA 1PEZA 5FC9A 2F5AH 2ZWLT 3OMNB 3LNFA 1A7QH 3THML 2BW5A 3NACH 3IKCA 2HG5A 3JWOC 2L7JA 4F57H 5J06A 2EUXA 3FB8B 4NP9A 1OAYH 5CP7B 3P4NA 4LESA 1IGMH 4MA7L 5IFHL 3T0EE 1IBDA 1D6EA 4WK2B 1KGIA 3ZL4H 5HXMA 1CI3M 2D31A 43C9B 4QY8A 1X5JA 4K5OA 4KOBA 5BS0D 4RETB 3KHOA 2IANB 3DXAD 4HD9A 5I0WA 2BSBA 4DGVL 3O9WA 3BAYA 3DO4A 3ULVF 2D3NA 2DJUA 1UZGA 3WV0A 5DEGB 1NIBA 2XBTA 1A21A 4ZMAT 1AQ8A 1EMTL 1NGWB 2QR0A 3LKPB 2P5WE 4F7MB 1BPVA 2QKSA 3B9KC 5F6IB 3FCSA 4XP6L 3VMOA 5ES4B 5IJBC 3MV7E 5LCVH 3DI3B 1JPGA 4QTIH 4XX5A 3BAJA 1HL4A 4R2GD 3UBXG 3KNBA 4K3EL 3N44F 5GQBA 4EPSA 3CXDL 5DK2B 5EOCL 4S0TD 4XRCA 3QJZA 5C09A 5DJCB 1BQUA 4UIKL 3HRZC 2MPVA 2J88L 3O2VL 4Y19E 1A22B 1KYFA 1FGNH 2NY1C 4XHJC 2FR4A 4N24A 1HE8A 3GMMB 3CSBA 4O51A 3FC8A 1JGDB 2PO6A 4LVHB 5LBGA 1HQRA 2HLFD 3L3OA 2OK0L 3VFMA 1JG9A 3CZLA 1AC6A 1P9MC 4DZBA 3NP4A 3GZOA 4J4PD 4WK0B 4L37A 4ZUVA 3P0VH 1NSNH 2XUWA 3LD8C 4FQIL 2DQTL 3CBRA 2WQAA 1NCOA 2HVBA 5BRZD 2ENQA 3UG4A 2QDVA 4KK6C 4DP8X 1BZ7A 3VXRD 4EQ2A 1T20A 4MJID 5B1JA 4X5PA 4XCNA 1QSEA 2WNGA 5ALBH 1G7LA 3AS3A 4K3HA 4LSUH 4LEBA 1B90A 4FYRA 2X6UA 2XQ0A 4I87A 4H25A 4HLJA 4P9HH 4XHJD 3V0GA 3G6DL 4W6WB 4FCAA 1FNFA 4HCFA 3W2DH 1G9EA 3WIHH 3B3IA 2AZAA 5JUEL 3MFGB 4TQPA 2UZXA 4UZGA 5BV7H 3LRMA 3QJFB 1LWHA 3ZX1A 5L2KB 1QFWM 4GUQA 5CJQH 1AO7D 1WZ1H 3WO3B 2G9HA 4L48A 3MLTA 3GUTA 1H9VA 4I77H 4WI9A 1CDYA 3MC0A 5F9AC 1MCJA 3EG9B 4HAFA 4KJWD 5HHOD 2VN7A 1IV8A 4UV4H 4AM0B 1NAMA 2FRGP 3IXTA 1FZKA 3QDHA 3Q01A 4LFHD 5DD6A 1I7ZA 3MRFB 4MB5A 5DMJB 5DJCA 5D7IE 4BE5A 4ETQA 1KACB 3DETC 3E8UL 4XCFL 4X7FC 4P2QA 4L4VA 3SDDD 1RLBA 3TIDB 3C6LA 1RIVL 2YXWA 3GIVB 4QOKE 2ROXA 4D8PB 5IHBA 1A6UH 3HG1B 3D12B 3VXOA 3B7UX 4LMQE 4M5ZL 3IDUA 4FXGB 4JJHA 4HUVA 2WM0A 2GJZA 2QQQA 2XWDA 1OPGH 1JOIA 4G1EA 2W91A 5EF3A 1P6AB 1R47A 3OR6B 4OZ4A 4PCSA 4R7NA 5LUMA 4NPJA 2VLMD 4HIHA 5DO2D 1IKFH 2AJXH 4GMTL 3I2CL 3MV8D 1AGCA 2GJZB 2IPTH 2WYHA 4JRXB 1AIFB 4J3TA 2FGWH 2GBAA 1AYRA 3EXLA 4NUQA 1H5BC 2K4AA 4AQ8A 2BK8A 1V7NL 1NJ9B 3K81A 3Q7JA 5C97A 2E6PA 1AMXA 2BSEA 4XN4A 2Q5BA 1MI5E 4FQCL 2MHAA 4DGYH 5IHUL 2RFXB 2C3WA 4JFFB 1UGKA 1MUJA 1AIFA 4IS6A 3ZKSD 1ACYH 1R3HA 4MHHG 4J39A 1UT2A 4GRWF 4IRJD 5LGHL 2R23B 5GPRA 1EJ8A 2WUBL 1QLFA 1XGRB 4FLQA 4BQ8A 4HT1H 2OCJA 4P2AA 4FMKA 4Y5XB 2VLJB 3BDYL 4RIRB 5DQJA 4APQB 2HTLC 3TONA 1JWUA 2RGSA 3K2KA 4U4IA 3C09C 3TZVA 3DHPA 5ICXB 1JMXA 4KTEH 1VEPA 2VR8A 1E67A 1HL9A 1KZYA 2JI2A 1BECA 2DD8H 4AKQA 1EZLA 4Y19B 4G80B 2LR4A 5FHBL 2Y36L 2CBMA 4G9FE 3R7RA 3PWLA 1Z32X 3QDMB 3WY4A 5AUMA 3QXVA 1UOWA 2EYSB 1RHHA 2ICWI 3ZE1E 3RGHA 4MA8H 4U6XA 4GP4B 2Y07L 2X89D 4K4KA 3IBOA 4XB3A 2ARJQ 2YPLE 3L95B 4PJ9A 4ANVA 1ZVSA 4FABH 5EN3A 4N2GA 2OCFD 3WUZA 1KN4L 3BEWA 3DVNA 4B0MM 3RX8A 5CCGE 4PY8J 5HDOA 3BAXA 1DHKA 5J1AA 3C60B 3L5HA 1YC8A 3VSTA 2IADB 1YPZB 3DUUB 1CLZL 1EO8L 1H6FA 2DF3A 3OVUB 1DJSA 2ICCA 4P5MA 4R5XA 3QXUA 2CKBL 5GS1C 3SKUD 1E27B 1NGZA 1WBZA 2K4WA 1IO4C 4JFED 3PWUA 1GGTA 3G6DH 4GXUM 1QBLH 5FGBC 3IJYA 1IM3B 4FZ8L 4WWPA 3CK0H 5JHLA 5JUEH 2O61A 3GQFA 4I4WB 2CG9X 4NQEE 4H1LB 4KVNH 1HESA 2OX5A 5KYXA 5DC0A 1JWUB 2ZOUA 1BBDH 3JUZA 3ZN6A 5EULV 4MZIA 5D1XE 5TGBB 4HKZB 1XL6A 3CVBA 1ROWA 5D2LF 2F8OA 5C08D 3FO0L 4K2UL 2IWGA 2Q6WB 1NSNL 4G5AA 4UOQA 2DM4A 5C8JB 1B6DA 3VRIB 5T5FL 1JP5A 5IJKA 3HOGA 3HRZB 4JDTH 1HDMB 2X4OB 3JUYA 2MNJB 3FN3A 4NENA 3UZVB 1RZIB 3QDJE 5AW6B 1FGVH 3DMMA 2I7SA 3LIZH 4G7YL 4OT1H 4PR5B 5IKCA 5FYKE 3HS0B 2EDEA 1F0LA 3P2TA 1KY7A 2CCLA 1LLAA 4WENB 2IPUK 2VERN 4YHPB 2R1WB 3UC0H 2R7EB 3QPQC 3MX0A 2K6WA 4NHUA 4Y1TA 3VVVA 1XTLA 1LK2A 3N85H 4Z3JA 1A1NB 3GD1C 1ASPA 1MHPH 3MO1B 1DUZB 3GTTA 1KBKA 3NTCL 5D7JB 3WNJA 3WTVA 3ZHKA 4PJAE 3CZJA 5INDA 1YYLL 1M9WA 3IF1B 2CCWA 3FS9A 3MX0B 4JZJA 4NHUB 4V2CB 4AEFA 1VRSA 1RZJC 2FATL 5KVMC 5F7BA 1SY6L 3OHXA 2X70B 3VFRB 3RVWC 3LYRA 3QFJD 5TDPB 1NCDH 3RJQB 3WJJA 4EJ1C 5BVPH 1AQDA 1ASQA 2BVPB 3ARQA 4QT5A 3O45A 3ECQA 3SY6A 2CZNA 4P2OD 4L1HA 1YEFL 2MPAL 3T1FB 3BP6A 4EXKA 1D5MB 5MI0C 1AR1D 4JM2C 5GJSH 4JJ5A 4OFIA 1MCOH 3T4AB 2XWBB 4ODWB 3VJ6B 1DSYA 1Q38A 3BDYH 5GGRY 4JY4B 3EG9A 1IQWL 2NQDA 2H32A 1GOGA 3EJQA 3C2AH 2VLME 1KGXA 2D7TH 5DMGD 4UYPA 3CC1A 3HEIB 3C9NB 4U6HA 3U0TB 2K0RA 2RIKA 3A6CL 4JVWA 5TPWH 1CK0H 3REWA 5KSBA 5FKPB 1CDJA 4OIIL 1CF8H 5B1KA 2VLRD 4FJYA 3FBKA 2QQNH 5B8CB 4Q56A 1BSIA 1IEAB 4XOBA 5HHOB 2F53D 1MEXH 1EXHA 3KGUA 4X99B 4MDJA 4QTIL 5JIQA 1AQKL 3ECUA 3HG4A 5IQMA 2IMMA 5D93C 2ZNWA 4C54A 3NYKA 1W9XA 3CXDH 3MXVL 1KELH 4P5TA 5MENA 3O9WD 4WHYH 3SE3C 5J9PA 2XJKA 4YHKL 3R19A 3EOBA 1IIIA 3RP1A 1FL3B 2X4QA 4FQXA 1IGIH 4Z0XB 1GS6X 5GS0H 4HH9B 3VXRB 4MXQC 3LRLA 3D6GA 1V05A 1NIEA 3P3YA 5ALCH 2OR9L 3JXAA 3S4SG 1XF5A 4AYDC 5K9QG 4ODTL 3QFJA 1Z3RA 1D5MA 4KPHL 3T0EC 3CK0L 3O0RL 1AGFA 1LL1A 4OJYA 3ARXA 1ZHNA 5FB8B 1C12A 1TJGH 3HPLA 3DOIA 2J71A 2IAMA 3KYOA 3QUZC 3MOAL 3D4YA 3KLHC 4B50A 3TVMC 3CZSA 3V6OE 2YS4A 4XVSH 4R0LC 2JQZA 3ESVF 5T3XL 1BOYA 1NOLA 3RWIB 1IFRA 4MLIA 3W2DL 4KK9C 2WB7A 1LNUB 2QFRA 2GY5A 1MW3A 2BY3A 2BS71 5FYKH 3TX4A 3BUPA 3TA4D 2JFCA 3ARVA 3TCLB 3JWDL 1UJ3A 1QSVA 3SE9L 4H0LC 4MCYA 1MIEH 3GXUB 1K4DB 4NRZA 5KOVC 4JFQB 4MX7A 2KPNA 1GHFH 3HE7D 5EPMB 3B2UC 3DSNA 4LSPH 5HDBF 5C0EA 5KS9F 5A7BA 3F85A 4PRHD 1T7YA 1GGIL 1I8KA 4AL8C 2XTJD 3AT9A 1F3DJ 3JVGA 3LS5L 1S5HB 7PAZA 2ZJSH 3CVHA 3OAZK 1JK9A 1ZIBA 4G8GD 2OK0H 1U8PB 4XPAL 3DX9A 3OSVA 3AT8A 3K71A 3H3BC 4LAQH 4LLDB 3OQRA 4IM8A 5E8DH 1F90L 4GKLA 2FJHA 4GIOA 4PLKD 5TF1L 3MOQA 6FABL 3JBG7 4A7SA 1KPVA 3SKNA 3OAUH 2HWZH 1K6QL 1A7PL 4FYTA 3FQWA 2IDCA 4NBZB 3AMKA 1SM3H 1UXWA 2SODB 4L4TB 1NCWL 4XO8A 3OB0K 4WFFD 2F6AA 2DQJH 2PPAA 2VL5A 1MCOL 2X4RA 1SOQA 3RZWA 3QEQA 4R96B 1NAMB 3IXTB 1ZE3C 4Y2DC 2WYZA 3S48A 1YMHB 3FOMA 4QYOB 1IGJA 3AADB 2P3YA 2PXYA 1C5CH 3QIBC 3RL2A 3V6ZA 1RZKL 1OV8A 3SDCB 1U8NA 1Y1DA 2F08A 2I25N 2PWDA 4P9MH 2HFGL 4L5FL 3WIIL 4MKMA 4QJ3B 4TUJB 4ES9A 4KITB 2P7TA 3EDKA 4C57C 3HG1A 2EO1A 4JZJC 4GRWB 1D5XA 4BELD 3W3BA 3FRUA 3FRPB 4YSUA 3ZPDA 3V6OA 5DUMH 4BXSV 2AV7A 4QI3A 2VXQH 5IF0A 1BQHA 4OV5B 2IC2A 3PJSB 5CZXD 2CRMA 4PJ7E 3VWJA 3SDXA 5JMRA 4CDGC 5KYYA 5DD6B 3QT2A 3MLPA 1UJ3C 2XCMC 4XH2A 1WZAA 4ZUTA 4XO9A 1MHEB 3S34L 1T03H 1CGWA 2EDNA 3WUWG 4GRWE 5ICZB 3W5NA 1JWMB 4X4XA 3ATBA 1RUAL 4H8WH 1WGVA 3AC0A 1VKXA 1F4WH 1ZVSB 3E3QE 4QRQB 4U0RB 3KM1A 1Z5LB 4UQ3B 2YPKA 4JPVL 2EXYD 4M5YL 1BWMA 1JMZA 4WEMB 1J05B 1Q1PA 2C4XA 2KQNA 4NOBA 4CAGA 4P3CL 3QP3A 1JDCA 5IROD 2A74C 5GGVH 1J11A 5F7EH 1JZ5A 4WU7A 3BT2H 4LT7A 2VABB 4DCQB 3LRHA 4JAMA 4KPHH 3ULUD 1F5WA 1URZA 1WCQA 4A2FA 4YX2H 4IBSA 1RZ8B 5TH2B 1FRGH 4JZOB 4J3OD 1MFUA 2K8MA 4PN6A 1XGTA 1ZT4B 1U4EA 1MFBH 2JSFA 2V3EA 1NBQA 4WFEE 3MNDA 2A9BA 3U83A 1GOFA 1BXXA 3KVPA 1E4XH 4L18A 4HS6A 1OGAD 3AREC 1WG3A 3CPUA 2XT1B 1QPXA 2WXOA 4M6OL 3US0A 1HCFX 3B1TA 3KYMB 3NZ8A 5AUMB 5KVEL 2WVUA 1CT8B 3STLA 1DQQA 2R0LH 3H42H 4FFZA 4BZ2A 2EUVA 3EAKA 2P48B 4YHZL 5CJ8A 5A1AA 3TIEB 2GY7B 4W4NA 4WWKC 3UFIA 5E9DE 1NCBL 1E7VA 1Z66A 4WFGD 4Y8AA 1T89A 4FQCH 4RFEA 3UAJA 3ZR5A 3H85A 1ZV2A 2EO9A 1U3HB 1FYTB 2YD9A 2XBZA 4H8VA 3TBWB 4NZ8A 4XVSL 2B08A 4FF9A 4OBSA 4BZ1A 4CVWA 3TOPA 1LM8V 2KLRA 2Z6FA 3LHPL 4F33B 4QR7A 5EU6D 3L3JA 2HRPH 4NQDB 2GJ6D 3FUNA 4FXGA 5FOBB 4EIZC 4JZOA 5GRJL 5C0JB 3CSTA 1E90A 3QZBA 1IE4A 4YH6A 2YEVB 3S8FB 1R1CA 1G7QA 1LO3H 4Z77A 5K9QI 1J5HA 2L7EA 4AYFA 4Y2DB 1QRND 4AYBA 3FQ2A 2I85A 2AXFB 3MCYA 4AKPA 3EH3B 1EAPB 4UQ2B 1YJDC 4EUPH 1OW0A 1CFQB 4JHAH 3RFRA 3WLBB 3VQLA 1JZ2A 2E9IA 2UXTA 4WO4B 5KAQF 2OZ4H 2EC8A 2Q76B 4WJKB 5C0DA 3U46A 4N2FA 3WE6B 1OARL 2CRYA 5LNDA 3NQKA 2QSTA 3CDZA 4H13C 1T66C 1FVEA 2OMBA 3N43B 2OAAA 5FM4A 1E3ZA 1IQWH 1EAPA 1IAII 1L0QA 1ZKAA 2WKOF 4MXWL 2WLIA 3T2QA 4K9EC 3NEEA 4UBDD 1YY9D 1AD9A 3UZEC 2BY2A 1T0NA 2FSEB 4UTBA 5B3JE 2E8YA 5TQ2L 2O30A 1EQWA 1JNHA 4NKOA 1S7QB 4PGCB 4UM9D 2DQJL 4BRJA 4QHNB 1DSWA 1VLXA 3VD0A 1AKJB 1ZWIA 3UC0L 4MNHB 1JFQL 1B0GB 1QP1A 4HSCX 4OF8A 3FQTB 3N85L 3QA3A 2HKHL 5H2BB 1WDAA 1B9ZA 1WFNA 5K9KB 2DRUA 3F01A 4APXA 4QRAA 5AOIA 2VLKE 5C7XL 1RIHL 4XNYH 2NYZA 1YYLH 2PCPA 2G3XA 3LEYH 4KJWC 3T4AA 3LOWA 3MACL 3C8HA 2RTTA 4M61B 4OFDA 1AJ7L 4CU7A 2Z34A 4WJG3 5FYJE 2EDWA 2NYYD 4I2XE 4NGHH 3WFCL 1MWAB 3MGTA 1NAML 1T2XA 1BZQK 1H8OA 1BLIA 4HXAL 4UNTA 4F7KA 4M8UA 4JFEE 4U6YB 5EEVA 1C8PA 3L9RB 4HC1L 4L8SB 2OMUB 2D7NA 5L4FA 4YDIH 4AYMC 3FB5A 5GRVL 1NC2D 1ML0A 4ORZC 4G8FA 5G4NA 3FU5A 4QAWA 5CP7A 1LMIA 3DOSA 3C6SB 1NINA 3D25B 5CJ5A 3GSNL 3MOBH 2WNWA 3PV6B 3C5JB 5AKRA 1S7UA 3EJTA 4Y16B 4YHIB 5I6XC 3CE1A 2C9UA 2GB2A 4PBXA 5DO2C 2W9EL 2QQLH 3LEXA 4KKCD 3FCTB 5D1QC 2GC7C 3GUFA 5E95B 1KPRB 5E5RB 4I1PA 3Q6GL 4OD1H 3G6JA 4ZT1A 3NIDF 2H0EA 1SJXA 3NFSL 2DV6A 1A9BA 3D06A 3EO0B 2UZYB 3IWVA 4Z7QF 1NCCH 1U21A 3BAIA 2CKBH 4J8QA 3UYOD 3WIHA 2PYFA 4J4PA 1EBAA 3ML9A 2JKJA 3ZKQD 2WLKA 4MYWB 32C2A 5L2JB 4N1HB 2EIKB 1OM3L 3HBGA 3WIFB 5DF0A 1R3KA 3P9LB 1UURA 1NCIA 3WDHA 2IAMB 1MJUL 4KKAD 1LEGB 5ABDE 2L7QA 1FG2A 4MNHA 2WSPA 3BZEB 1G1KA 4K0OA 1L9RA 2M26A 1I1AB 3VACA 1UM6H 1QFPA 4JR9L 4KU1A 4M62L 4AE1A 2WKOA 4IJ3B 4NB7A 3QO0B 2V7NB 3DTXA 2BOBA 3P2BA 3QR2A 3APNA 2PYEA 3PP3K 3ZHFA 3BSGA 2WO4A 3OZLA 4PRDB 3IMUA 3AWGA 1ZGLM 3NT0A 3HC2A 5KUKA 5LBVA 5IFJA 5AAMC 3DUSA 1KGCD 2AJZA 1NGPH 4QWWC 2E9WA 4ORGA 4HAKA 5TE7H 3U9WA 1CI5A 2QV2A 1QRNB 4XOAA 2C1OB 2NXYC 3CMOL 4PGBA 2DKUA 5MEQB 3S8GB 4JE4B 3S2AA 3VGFA 2CJ3A 4YPGB 1NDMB 1QA9B 5IEHB 1KV7A 4X98A 2VXUL 4OV5A 5EH1A 4F58L 4KZEL 1GGBH 3QJRB 1NFDF 1YECL 3OAZH 2B1HH 2C9XA 4G9FD 3RUGB 4IMKA 2DEWX 2HKHH 5F8QC 3KYNA 5INCA 4G7QB 3WS3B 4PBDA 4B3EA 1QSFE 4AC2A 4BXVA 1G9NC 1DQVA 1QPKA 5AOJA 3PV7A 2VE6A 4WFHE 3AU1A 4OGZA 3S34H 3LHAA 1SEBB 1KTLB 5IVZA 1TJIL 1FNEA 3NIGE 4MRBA 3DRTA 2P5WB 4MHHI 1PSKL 4TSCH 1A6AB 5F6HJ 3PRZA 3ZDXF 2H6PA 1LE9B 3F7VA 4HGWB 5AW4B 2ZOKA 1MRCL 2A9ML 1NUFA 3NIDE 5DHXB 2J8HA 2R69L 3BKCL 5F7DB 6TAAA 1RULH 5DWPA 1PQZB 3ULVL 1DBJL 2AEWA 3BAWA 1HCYA 4GQ9H 4U1LA 4AMKH 1DTUA 2MH4A 4OGXL 4E5XG 1IM9A 3NJKA 3L13A 2R1XB 4JKKA 4ODBD 4DEWA 3VFUB 5IT2H 3CFCH 3KPPA 3WS6A 2WXGA 2IFFL 1DBBL 3V8OA 2PABA 3INUL 1BFSA 3MRQA 1WAPA 1K85A 1PU0A 5JLZA 2B14A 3EYSH 5A2CA 3RVVC 2HCZX 1ILUA 5ISZE 2ZCLH 2IDQA 2GHZA 1CXHA 5HHPA 4MXQD 1JJUA 4PJBE 4AK2A 5I8OH 4LARL 5HGBA 4XO5A 3VYNA 4AW7A 5LWYL 2X10A 4P2OC 5DI8B 2NY1D 1O5DT 3OKDB 4HF5H 3K6SB 3R18A 4P46D 4LHUD 4FP8L 5DK0A 3TBSB 5BCAA 1XH3A 3Q06A 2G0LA 4WO0A 3CZFB 3BLBA 3HZMA 1BG9A 3ABGA 1QUNB 4I2XB 4NCC1 4P06A 2IOIA 5D1QA 3ULUF 2ICES 3SDYL 2DQHH 3QSKB 5D1ZI 4FE9A 2DAVA 5C9JB 1TZOA 3LNGA 4P8QA 4NNXB 2A9CA 4L8DA 1NFKA 5CSZB 4PGEA 3X17A 1OK8A 4JKLA 3HPLB 4A55A 2CDEB 4XAKD 3NSJA 1M2VA 2NXZC 4WWKA 2O5XL 5HGHB 1SOXA 1QSFA 2J12B 4UM8A 1ND0A 3BEVB 4LEEA 4ZXBB 1MHCB 3FN0H 5DD0L 2F19L 2H8PA 3GKZA 4AH2A 2WBXA 2CA4A 1S9KC 2BXZA 4S0SD 4GSQA 3HJ0A 2X9ZA 2YD0A 2D03H 3M1BB 1T2JA 4N68A 4P99A 1MNUL 3BP7A 1XSKA 2XFXA 5EBWA 2OL3A 3GPSA 4G42B 4CVXA 1ET7A 1IGTA 5T1DL 1ZV5A 3WS3A 4RFOL 4RLDA 3REWB 5KSBB 3W56A 3RDTA 4PVMA 4CN4A 2CJSA 2P45B 1LYQA 1JPFB 1CLOL 5GHWL 3WKYA 3D3VE 1ZT1B 4Z7WF 1EWHA 3D0VB 3LPOA 5JXEC 5CKGA 5E03A 5K93A 4PJEA 3S36H 4N90E 1IGJB 4ZMYA 1S7VA 4QRUB 1R0AH 3DX6B 3Q13A 4PJ7B 1A3LH 5EORL 1ONQB 2HTKC 2YARA 2GT9B 5I8KL 1F1DA 3FO1A 3O0LA 3R4DA 1ZPLA 3HUJE 4MJJA 3IDXH 2LTQB 3O41B 4Z0XA 1CFSB 5HVHB 2X3AA 3RX7A 1MCPH 2P49B 2ZONA 3GJEA 1VACA 2H1LM 1N18A 4YDJA 3GRWH 4KRPB 1I3GL 1JRHH 2CALA 2R2BA 1CGYA 4NZTH 4PVBA 1MH5A 5I8CA 5IB4B 3DVGB 3UO1H 1F8TL 1QFUH 4JO2L 1GHFL 2CHNA 3G08A 4P23A 2XTJB 5T33L 5BXFB 4E2OA 2HRPL 1JGVL 1JNNH 2HJKA 4XAWL 4HJ0D 4NP4L 4P9ML 1W15A 5E1HB 4JGJA 4B5ZA 1UOVA 3WNKA 5BMFL 2BVEA 1UH4A 3Q2CA 4UTBH 4A38A 3MRDB 4YHPA 1KXVC 2JWYA 5IMLB 2G5BB 4Y5VA 3CHSA 4UUJB 4ZJ9A 2ENYA 3CSYB 2P7TB 1DFBH 3U30C 2F5AL 1DBAL 3CH1A 1MI5A 4MVBD 5IQ9A 3NACL 1CFNA 4KX7A 1ZGLP 1SJVA 1F11B 3EGSA 2J57A 3MRCB 1B4JL 3BPNC 2WTRA 1K5WA 4M8QB 1BD2A 1J8HE 3DETD 4U3SA 3QDGA 1GJUA 2ZX9A 1E5ZA 2FLMA 4NKDA 1RD6A 5E70A 2CDGB 4A7GF 4ANUA 3HBPA 3MUGA 1J5IA 1L7TL 3O9WB 4G9DA 1CFNB 2AQSA 4PJIA 2XQYK 1YEEL 3DV6A 2VW6A 3KXFE 5F7KC 1NFIA 4ZYKA 5K59E 1J9TA 2VSDA 3O3EB 1I7RA 4GS7C 2WXIA 4NIYE 3KCPA 4V11A 5H8DA 3UEZA 4AMXA 5SX4H 5EBLB 2XKNA 3NFPB 3V0FA 1F18A 3QORC 4Z76B 2YWZA 3II3A 4OCYH 3IJHB 3DX9B 4G5ZL 4U2ZA 3ZTDC 1LO3L 3UEQA 4PRHE 1M71A 4L1BA 4HZLB 1KB3A 4N8CL 2LABA 5F3FA 1E4WH 4L3EB 4GJTB 4K8RC 1DP0A 4U0QB 1A6PA 5FX3A 4X8JB 5KEZA 2ZKWA 1SHXA 3L1FA 3FQTA 2O5ZL 4P23D 3IU4H 5FA3A 1JGUH 2EKJA 2GT9A 3BJ91 2BZDA 4LARH 5EU5A 4XN7A 3L8QA 4XI5D 4LPYA 1BP3B 4KMTH 4OZFG 2C3GA 4PJGA 2EE0A 4WEBL 1G5GA 1KLFA 4WWKD 4Z7VE 3M86A 3RX5A 4Z7AA 1FNSL 2XZAH 3X3FL 5DQ9A 1SYVB 2YPLA 1UFUA 2LLGA 3PWVA 1G7MA 4AUYA 1RZJH 1WEJL 3WXVH 2QQKH 4U05A 3MTRA 4UOW0 5D7SH 2BMKA 3RLSA 3BD3A 2MQCA 1HI6B 1EXGA 4PV1C 2XN9B 2H1PL 1PY0A 2DYSB 4ZS7L 5B22A 3QUXC 4Y1AD 4JVPA 2B0SL 3LKQB 4MNQA 1VADA 1BM7A 2VYRE 4F5CA 1N9PA 5IIEB 5I6LA 2N59A 1U58B 2RBLA 3AG3B 5I8KH 3ZUNC 2O93L 2BP8A 4XCCH 1NICA 3FFCB 4LEXH 3V0VB 4BSVB 1XF3B 5MERB 3WEXA 1O6SA 1P4LA 1Y18A 1GSKA 1YHPA 4BFGA 2OJZH 4LNVA 1E8ZA 1YEGL 3LEVH 3VWJC 2OMZA 5IB3B 2FUQA 3FT2B 3IETA 5C70A 2C5DC 3PHOB 5T1DH 3OMIB 4K7PX 3RGVA 4AYSA 5D9SB 5HI5C 5I5MA 5BVJA 1IGYB 1Z3GH 2QVIA 5J57B 1YMMA 4XNMB 3BSHA 2VN4A 4V1DA 4O02H 2R29A 5H37G 1GZQB 1XF4B 3E38A 4Q9CA 2P4AB 3VXUB 1OCZB 3A4EA 1A4JA 4WWID 2MHAB 1MAKA 3LVEA 3BSZL 1N5YH 2VDLB 2IBGA 2WD0A 4PJBA 2VDPL 4HWEL 3GINA 4L4TA 4QRRD 2VXSH 2Z8VC 5ESAA 3QIBA 1TCRB 4XP5H 3L08A 1HKLL 3VFGH 3AREB 1QHPA 2JKRM 2NXZD 4N0UB 1HIMH 3G5VB 4C58B 4YDVA 3O8XA 1INEL 1F4AA 5TK2A 5HVWA 5IHHA 2W0PA 1DVFC 4IRSB 1RAMA 1M3JA 4OCLC 4N8VA 1CYXA 5HY9B 1AFVL 3HR5A 4DUWA 1WFIA 1JRHL 2ERJB 3E7JA 4PU2A 3CLFH 5IB1B 2DJMA 2DBLL 1P4IL 2D73A 3DGGB 3C5ZC 3IDMB 4M6MH 2FLRT 4Z7OF 3H0TA 2GK0A 4HS8L 4DGWC 4U6YA 1KY6A 2FJFA 3BQUC 2FL5B 2C9PA 4UQDA 3TF4A 5DHVA 4JFSA 4U3XA 1FO0B 1HWGB 5IBLC 3C6LB 3GIZH 5JIIA 3MLRH 2XWEA 4I77L 3AXIA 4F37F 3CDFA 3QDGD 2F1EA 3LZPA 3FO1B 4KVPA 4OFPA 1XIWC 4BSWA 2BHZA 1GGBL 3OC5A 5IGXH 4OJFL 3RAJH 2XQBL 4JX0A 2P5WA 3HKZA 4U0RC 3UL4A 4ACTA 4UTAL 1RSYA 3F7KA 1TETL 3QQNA 4O9HH 4PB9L 1PPIA 4PW3A 5BVJB 5GGQL 5GIRB 1HQ4A 1Q72H 2AJYH 3S35H 3ULVE 1X5YA 4M02A 2YPKB 1L9PA 5EOTA 3OX8A 3WEAA 1ID2A 2MPAH 3QEGH 1T04A 4P4KC 2W60A 4J3SA 2X09A 4A7GA 5I19L 4NZRL 3Q48A 4JL2A 5EO9A 2C1PA 4ZBJA 1HHHA 4DGUA 2A83A 3SDYH 3BPCA 1LTXA 2LFEA 5IW6B 2WZ6A 5IVXF 2IVFC 2HRHA 3KR3L 3BPOC 4J8RA 3GSNH 2V8LA 3MOBL 1CXLA 2NCMA 1JPEA 2GTWA 5AYTA 2IAMC 2DQ6A 1D5BA 4UV7H 5EO9B 4IKNA 5CZVH 3T6XA 4F2ME 1A8JH 5E6ZA 1G9NL 2XPGA 4I9XA 3T0EA 3PL6D 4LCWE 4PCKA 5IJCC 2P5EB 2LT9A 3ES6B 1KN4H 2YJQA 4LASH 2P24B 4Y5XC 1L9OA 2AK4D 2BSTA 5LG6A 1KGUA 1Y0LB 3A4FA 5I0YA 5FGBA 4JY4A 3W0WD 1KCVH 3SKOB 3LZQA 2B59A 3SBQA 1XH2A 4CKVX 4TLKA 2WKGA 1BG1A 5BO1L 4QXUL 4NO5A 1WTLA 1CLOH 4P5KA 2XV2A 3KL0A 1EO5A 3PREA 4LDCA 2VERA 5KVDL 3B8YA 2AV7B 4R84A 3CFKA 1M2OA 4UU9A 1KCRL 1MLBB 1D6VL 3IDJA 1JUFA 1DE4A 3QORB 3FUIA 3CVIH 1C7TA 4KTEL 1EANA 4IRJA 5HGHA 5IHZB 3IDMA 3QC6X 3BLPX 1MCLA 4K2UH 3BW9B 4G6KH 3CFCL 4FG4A 3B5TA 5CJOL 1MCRA 4W9GC 4MA8L 2NMSA 4Y4KB 3AG4B 3K5SA 1K4CB 4BGLA 5DJ0A 1ACYL 3BP6B 3IAGC 1YEKH 1UT1A 4XNZB 3O4LE 4TNVK 2WUBH 2Q3AA 4HKXB 5IJDC 2C9VA 1KPUA 2W0FB 1EEZA 4OFKA 4GG8B 4U1GB 1T1YA 1ULVA 5A2KH 4U4BA 3L3HB 2GCYB 2FIKB 1MQ8A 3ESNA 3EUUA 3FSVA 1KGJA 1XF2A 2Z0UA 1LE9A 1JZEA 4HMDA 4YXKL 1HAWA 4KQ4L 4IQHA 4R83A 5DEGA 4PJ8D 3LXBA 4JM0A 4XHQA 2YD6A 4PJGF 3MUY1 2C9QA 3CFNA 2FIKA 3TBVA 1CE6B 4ZX6A 3FSOA 2BXYA 4IU3B 3NAAH 4HFWB 1OGTA 3R8BB 5IMKB 1NMBL 1MCQA 1CFSA 2XX0A 3QJXA 2R1XA 2ERJC 4GO8A 43CAB 1YEDB 3MU3A 5HHMD 5GGSY 4ANXA 2AERT 3FT9A 3FFCA 2O5XH 2ZX6A 4XTRD 1FE8L 1KTCA 4RQQA 1QO3B 3OZ9L 2WN2A 2LW3A 4PWFA 3L7FB 2EEDA 2HX8A 4H44C 4PJGE 5E5LA 3DURA 4PQXA 1DQKA 1BMZA 2Z0BA 4AVKA 1MLCB 3QFDA 2KZBA 1IIKA 4NM8H 5I1EL 3FUFA 2OTWA 2AQ3A 4PLKC 1RULL 5HSFA 1MSPA 2Y1YA 1UTDA 1FFPA 2FBRA 2B9BA 4PJFE 5J5EA 2AQTA 1KC5L 5LGJA 4PB0L 2E6JA 1A25A 2EO7A 2Z91A 1P84K 1IT9H 3GXPA 4UAOC 1F6AA 4KUZL 4N0YH 3VFNA 1T5KA 3FTWA 4ISVA 4TV3A 1MHPL 2JVUA 1MPAL 4TNWF 4QNPE 2YLHA 3EXJA 2BIOA 2ZP0T 4XAKE 2HKAA 4OIBA 2V7NA 4JRYD 1S7QA 2D9QB 4PGCA 1NQBA 4W9FC 2DM2A 3SOBH 4LF3B 4YK4B 4UV7L 5DXWA 4N9GA 1BFOA 4XCNB 4M5ZH 3NIGB 1CLVA 3GKWL 3NDZE 3SYQA 1MOEA 3KGSA 4J6RH 4WF7A 2AAVA 4HSAC 4J3OF 5D7KD 3KVQA 2WLLB 5SX5K 4HFWA 4DZBB 4XPGL 3H0TB 1SJEB 4JY6B 5ALCL 1HHJB 3GNML 1NTDA 3MMEB 4I3SL 4AMKL 2XZAL 3QEGL 2Z7ZA 3IM1A 1I85A 2F54D 1WZMA 3AGWA 3CZFA 4AJWA 3CXHJ 4Q7DA 3T1FA 5F3HB 3L5IA 2N1KA 4ANKA 5F44A 3EBGA 4CILA 3MLSH 1D7CA 1MFNA 5TQ0L 3BWAB 3L3KB 2QZQA 1GCYA 3PFUA 3CTTA 5CN3A 2Y72A 4XXCA 3C08L 3D69A 2JKXA 5AVRB 5CZVL 4O02B 4TTGA 1NEZA 1QATA 3FCGA 2NUPA 1JV5A 2CO1A 3ARGA 4A2MA 3CPLB 2VDLH 1BFVH 1PCSA 4Q97A 4B9CA 1WV7T 3TWCH 4GXUN 4OD2A 2R2HB 3D33A 2IH1B 3CQQA 1IGYA 3B2VH 1XEUA 4XCEA 4QRRA 3NZSA 4RMBA 3VRLF 1XO8A 1TQWA 3D39B 3ILPB 3KPNB 2XX1A 4HEMA 2J6WA 5DVKA 2V2XB 1LQSR 1CE1L 4LSSH 2OYPA 3EO0A 4G6JL 4CMHC 3CFBA 2Z7UA 4JFYA 3VMPA 1A9EA 2WGNB 1DO6A 2BNQE 4PRIA 4WI7A 4Z7IA 3D39A 3KPNA 2R4RH 5E8PB 4GQRA 1ZGLB 2AITA 4WTQA 1A6AA 2WXKA 2YSSB 2R51A 3N5AA 4KFMA 5GRXG 3T08A 2VXSL 3CN3A 3HZVB 4OLWH 4F20A 4F8OA 5K5YA 4HKZA 4R7NB 4AQ8C 1I8MA 3LVTA 4GW5B 5I5JA 3O9WC 5AAPA 2YD7A 2R8SH 1OAUL 3ARBC 2GBUA 1CDUA 1LP9B 4ALAL 3SB3A 4MDIB 3NJVA 3CHRA 4XP4H 3QRFM 2WLYA 4UAHA 4XN8A 4JPKL 3TYFB 2F54B 2BRRL 2YC1B 3ARFD 3AWFA 3JTSA 1EHAA 3BPNB 4N6RB 5AL0A 4ZSOE 3GJFA 2CR6A 5IOPA 1QFWL 4O2EA 3DMMB 3DC0A 4BH7A 3IGAB 1DQQB 5C07B 2IH3B 4PLNC 2XV3A 5EUKA 5CIPA 3EYQD 4KMTL 4WEBH 5JNYB 1Z9LA 1JV2B 2WZ0A 3DROB 1X9UA 3TTYA 5EMYA 2ARJB 2F7OA 3FTGB 3O3DA 4YXKH