3KBFA

C. elegans cu,zn superoxide dismutase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
SNRAVAVLRGETVTGTIWITQKSENDQAVIEGEIKGLTPGLHGFHVHQYGDSTNGCISAGPHFNPFGKTHGGPKSEIRHVGDLGNVEAGADGVAKIKLTDTLVTLYGPNTVVGRSMVVHAGQDDLGEGVGDKAEESKKTGNAGARAACGVIALAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title X-ray Crystal Structure of C. elegans Cu,Zn Superoxide Dismutase
rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
total genus 41
structure length 156
sequence length 156
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3kbfA00
3MNDA 1F1DA 2APSA 1EJ8A 1F18A 1E9OB 3QQDA 4OJAA 3T5WA 3GTTA 3KM1A 1S4IA 4A7VA 1PZSA 2AQTA 5CU9A 3KH3A 2XJLA 3GTVA 3LTVA 2JCWA 2VR7A 2VR8A 3KM2A 1RK7A 3ECUA 2NNXA 1CB4A 1SDAB 2AQNA 1P1VA 3SODB 1E9QA 3ECVA 1N18A 2Z7YA 2C9SA 1SXBA 3PU7A 3HOGA 1KMGA 2WZ0A 4BD4A 1TO4A 3GZQA 1OZTG 1YSOA 1SXSA 2V0AA 1F1AA 4U4IA 1U3NA 4MCNA 3F7LA 2WZ6A 3CQQA 1E9PB 2WWNA 1DSWA 1AZVA 5KBMA 1IBDA 1E9OA 3KH4A 1IBHA 1SXNA 3HW7A 4B3EA 4A7UA 2AEOA 4A7GA 1SPDA 4A7SA 1ESOA 1Q0EA 3H2PA 4FF9A 1Z9PA 1MFMA 1F1GA 2ZOWA 1PTZA 2Q2LA 1FUNA 2WKOF 1OALA 2E46A 4BCYA 1TO5A 3L9YA 4OH2A 2E47A 2WKOA 2AF2A 2AQPA 2XJKA 1UXMA 2GBTA 1L3NA 1OAJA 2WWOA 3QQDB 2JLPA 1HL5A 1SDYA 1OEZW 1UXLA 1JCVA 1XSOA 2ZKXA 3GZPA 1JK9A 1IB5A 2AQRA 2Z7WA 2K4WA 2WYZA 2ZKWA 1CBJA 3ECWA 2AQQA 1B4LA 4N3UA 2WYTA 4A7GF 5KBLA 3H2QA 2R27A 2Z7UA 3MKGA 2ZKYA 4BCZA 1QUPA 2GBVA 1N19A 5KBKA 2C9UA 2C9VA 3L9EA 1BA9A 1DO5A 1SRDA 1SOSA 1Z9NA 3GQFA 1E9PA 1E9QB 2LU5A 4A7QA 2VR6A 3CE1A 3KBFA 3GZOA 3K91A 4MCMA 3S0PA 1BZOA 1IBBA 3RE0A 1B4TA 3CQPA 4A7TA 2SODB 1SXZA 1IBFA 1SXCA 3HFFA 1OZUA 2Z7ZA 1YAIA 4L05A 2GBUA 4N3TA 1XTLA 1XTMA 1YAZA 1COBA 2AQSA 3F7KA 1SXAA 1JK9B 2WZ5A 1EQWA 1HL4A 1PU0A 3KBEA
chains in the Genus database with same CATH superfamily
4WEBH 4EXPX 1F58H 1HTYA 1NGXB 4N8VG 3II2A 3OSKA 5F0LB 2EDEA 5IVXE 3VH8B 1M9SA 3GF8A 3SPJA 3K6OA 2AXGA 4Y9CA 3MI6A 1CIUA 1WISA 3JBG7 2M83A 4UQ9A 4BM7A 2XKUA 4HAGA 2OZ4A 3Q3GB 3WY1A 1N5AA 3I9GH 3H9SD 3GJFK 5HJ3B 4M43L 1N5YH 4XMUA 2Y69B 2QKSA 1MH5A 2YMTA 5C07B 5I82A 43CAB 3S88H 3BP5A 2FL5B 3ZDWA 3V5HA 2BPBA 2FWSA 1YO4A 1RZPA 4YX2H 3SQBB 3V79C 5E2WH 1M7DB 2D3NA 3KPQA 2CG9X 2IALA 3DGCR 2OCJA 5E8PB 1GR7A 2XZAH 5IR1B 5JHMA 3MLYH 3RPIB 2K7QA 2VZTA 1CWVA 4NUJB 2FEJA 2Q5BA 3TO4C 3GIZH 4BHUI 4GKSA 3MLSL 4AGQA 1KCVH 5KVFH 2DWYA 1KTJA 1ZT1A 2C1OA 4LLYA 4X8GA 3PRZA 4N86A 1SXNA 5KOMC 4MBOA 1K85A 1EJOH 2CU9A 5J0BA 3C2AH 4KFZC 1U30A 3SKOB 2ZUVA 1GS6X 1MCPL 3WN5A 4MJ2A 3UTSE 1VHPA 3NCFB 1FZJB 1LHZA 4K73A 3WD5H 1MCOL 4ODSH 3OX8A 4Q14A 3AMLA 2P8PB 1YMME 4ZMLA 3R7RA 2ZWYA 1RUKL 2ICWA 1LK3H 1XCQA 2IANE 1CLYH 3P3RA 4WFFD 5EUKA 1G7QA 3BP6B 2DMKA 4DOHE 1ZTXH 5KG9A 1KBWA 2RD0A 4XT1C 4XPFH 1BECA 2C9PA 4GXVH 3C6EA 3NIGF 5DVMA 1MRCH 5JW3H 3E9UA 4X0KB 3OXSA 1U95A 5T33L 2RHEA 1HOEA 4BEIA 2GTZB 3HEIB 4MAYD 2BY3A 4PJAF 7FABL 1X5IA 1G7MA 3AQYA 2VOTA 3OKOB 4R8WL 1S5IH 5EU3A 3ZHNA 4U6HA 1NCIA 5EF2A 3D39D 3J07A 3O9WA 1YAZA 5ESVB 2TRHA 3IU3B 3F7KA 5ILTL 1MELA 43C9B 3TJEL 2Y3AA 3H4HA 4QO1A 4N90E 4WFED 2MFNA 4JO8A 4HSCX 2FT8A 2EXYC 1W15A 3VXPA 4OTXH 3VQMA 3QYNA 1KGCE 4TVPD 4J3BA 1BVKB 3UGUA 1XF5A 3EG9B 3MBED 1TSRA 3LRLA 4AIXA 3TIDB 3WMSA 5CU5A 4ZFOL 2PKDA 2HXAA 2ZG2A 4G5ZH 2VE6B 2JI1A 3ECUA 1AKJD 1C8PA 3CVIL 4PR5B 3DPDA 3APMA 4G6ML 2EDOA 3OB0H 2BXZA 5CCKH 1H6FA 1O7SA 2E27H 1JZFA 2J3SA 5F8QC 2G3ZA 1X7QA 4L29A 4KK9C 3NEOA 2BNQA 2NY0D 3CZLA 4IHOA 2DWDB 4Z7QB 3JWDC 4M00A 4LP5A 4MNQA 5IFJB 4NKIH 1NGPL 2CRIA 1JRHI 3RP1A 4GBXB 4MXWH 5DJCA 4HG4J 4Z0BH 1JZHA 4I0KA 4L3FA 3QR1A 5JOFA 3MRLA 4HCRL 4TNWF 3QIUA 1IC4L 2BSSA 3LHPL 3KLQA 1HSAA 3RDJA 4KK8C 4P4RA 4UIKH 3EKCA 1CD0A 2CDFB 4Y2NA 3RKDC 2VDQL 4ZQKB 4R26L 3FHAA 1CN4A 1S7SA 1U6AL 4L4TD 1A6UH 5T5FH 3JWDL 4YFEA 3IFNH 1SUJA 3ECBA 3EO9H 2UZXA 2ICEA 1D9KD 5FS5A 5EDXA 2RCSH 2OJ1A 3CDZB 3BVDB 1KJ2H 3DMMC 1UOLA 4IGBD 4ETYA 2GBTA 3DECA 1NC4A 3SZKC 1CBVH 4LLDA 1JTPA 2X89D 1E8XA 1XIWB 2KLSA 3DYPA 4FKEA 4M02A 4NM4H 5DTFA 1I31A 4M62H 1U2HA 1K8DB 4XMVA 5B3NA 5KVEL 2VMEA 4NIYE 4PJ9A 3ES6A 3VCLA 3QJFB 4KRPB 1MRDH 3PWNA 2AQQA 1YLBB 1C5BH 3QUYD 4ALAL 1SLXA 4EIBA 5HDBB 4CC4C 3W0WB 2B1AL 4WTQA 1YY8A 2WWMD 5CEYB 1YNLL 5E2UH 3FB7B 3HN8A 4PI0A 3ARDD 2HLFC 4LF3A 1TZIA 4NNPL 1BA9A 1SEQL 3BGMB 1I85A 4BH7A 4YDZA 4JRWA 2VDRB 5L6YL 2VSDA 1XCTA 4U05A 4YDIH 1DJXA 2APBA 3GSWB 1LILA 4I2XE 1Q90A 2K3HA 3IDJB 5C0CB 4MA3A 3UPRB 3D3VA 4GP4B 4GI8A 4ATWA 3TZVA 1KCWA 3HMXH 5EZOH 4R4FH 1HCFX 3BIKB 3Q0HA 4FHKA 4UF7C 1IKFL 3OHMB 1YNTF 2EIEA 1SOQA 4YUEH 2DQIH 5ECJE 5TK2A 1ID2A 5I9QB 5CR1A 1ZLUH 3VYOA 3D4ZA 2WP3O 4FCAA 2FWOB 1Z9MA 1NCDH 2IFFH 4RGMB 1CTOA 1U8QA 3ULVE 1E6OL 4YDJA 3KYOB 1B88A 1VCAA 5J9PA 3BAJA 2WOYA 4Y9EA 2CAKA 1MPAH 2YQ3A 2R83A 2VKXA 2VR8A 1LO4L 5D7LE 1R5IA 3JVFC 1Y18A 2NNXA 3F7VB 1AZBA 5LBGA 1BOYA 1LDSA 3FCTB 4DN4L 4WI7A 5ESAB 3P1VA 4DO4A 2HN7B 1K5WA 4B9ZA 4UM9A 2GB2A 1ROCA 3KVDD 3LEVH 3QUXA 3SKNA 4QT5B 3UJIH 1OSPH 5F3HB 5AW8B 3WIAA 5GZOA 1YPZB 1KIPA 4OZIE 4MGXA 4MAZA 4FQLL 2D03H 1KIUB 5AKVA 2QPEB 3JUZA 4PRIA 3QDME 3GXTA 1GXEA 2YAPA 3A0OA 5IKCB 2VLKE 1JPGB 3BVVA 1ZIBA 2RQ8A 2L0DA 3FS9A 3FU8A 4S1SH 2YXMA 5IHZA 5FA3B 3FU9A 4GY4A 3T4AA 3BZ4B 1EAPA 4XVSL 3H56A 2F53D 4GQ9L 4JO2H 1OSZB 3GK8L 3REVA 3ULUH 1IBHA 3QG7L 4WWKD 1I3GH 1OL0A 1I4FB 5J6HA 1Y6NR 4GRLA 1GZPB 4H44C 2QKIC 1I3UA 3UYRL 4AYDC 5KYYB 5CUSH 1RUMH 4LCCB 1WTGT 3CFQA 2APWA 3WUWB 5LWYL 5BMFH 1AD9A 1H5BB 3OKDA 4LCUB 2ZNWA 3EJTA 3ET9F 2AQ2A 1TU2B 3DVFA 1EK3A 3QRGL 3O81A 3S34L 1RUQL 5EUOE 5IVXA 4PJ8C 4P3CH 4E0RB 4KZDL 4PGEA 3V6FA 1GRWA 1FNHA 3K7UA 1HAUA 4JZJC 1DE4A 3RDTB 3EF4A 3ARBB 2EYTA 2VR3A 3MLUH 4PJXB 2EUXA 3AAZB 3R06A 4XPGH 4JFQA 2W0FA 4KVNH 4QHLA 1K4CB 2FEEL 3Q2WA 3FTUA 2D9QB 1VJSA 1QFWH 4MZIA 4MSWA 1GGUA 2L04A 3E1F1 3SGEH 2SODB 4IBWA 3GSOB 4WF7A 1IC7H 2L8AA 3HG1D 4AQEA 4AWJC 7CGTA 1ZEAL 3D0LB 5HDQH 5HBBA 1K3ZA 1AAJA 1R1CA 1GAFL 3O6MH 1DQLL 4OGXH 1KTBA 3O3EB 4MZ2A 5D7JC 3LNHA 1P84J 1LLAA 2P7TA 4JRXE 1MG3C 5C0EA 2JXMA 1EXUB 1V3KA 4S2SA 1HNGA 2FCBA 3MA9H 4YLQT 2NYYD 3GSNA 3N50A 1FL3A 1ZXQA 4G6KH 1FLRL 2ZCKL 4NKDA 5E8DL 3TNNB 5K9KB 4QNPF 5H94B 2R4RH 1D5MA 3CN4A 4GRMA 5BO1H 2CIIB 5GRYA 1A14L 2P5WE 3QJTB 3ESPA 3UC0L 4CILA 1UKTA 4P5KA 3WN6A 5LNGA 1FFOB 3FFCE 3FO1A 4ZFZA 2Q86A 1JZJA 4CC4A 1CT8A 4L18A 3RTLA 4M1DH 2PO6C 1NEPA 1CD1A 3ARFD 3MRIA 3TEYA 2DQ6A 5DHVH 3ARVA 1OGAB 1FL5A 4PRHB 3GZQA 4UDUB 1MVUB 2WVUA 3CLEL 3FFOA 4Q0XL 4ADIA 1PZ2A 1SXSA 1UZ8B 4X9GA 4E41D 4XN1A 4CMHB 1IIKA 2R29H 4NZDA 2FZ3A 5I1EL 5LDSA 4DZ8B 3PV7A 1E9OA 4W9FC 2NY2C 4PVBA 2C8NA 4FQXC 4JFFB 2IDUA 4P57B 2ENPA 2X2JA 1NBYB 3MMEB 4ELMF 2VO8A 4K8RC 4FTVD 5D7EA 1FCCA 4XNBA 3DETD 3EO0B 5LCVH 4HUVA 3OJ2C 2IG2L 1BQSA 3D2UA 5JNYB 5C7XL 3RZCA 1QNZL 3REWB 3F58H 7PCYA 3NBNA 2E8ZA 1MWAL 3VGBA 3VI3F 4P4KD 5F0JB 1QACA 2FNWA 3DSFL 5BS0E 2EYSA 4DAGH 1JAEA 2Z31D 4NCC1 3GKWL 5EBLA 4HGMA 2P8MA 4G70B 3EJCA 1CFSB 4CADA 2FJFB 3AXIA 4KVCL 4PJCE 1FZKA 3VSQA 1OLZA 3BP4A 4YAQB 4RZKA 4DEUA 5JOEA 5CAYB 4URKA 1A7QH 3V0IA 1FO0L 5HI4C 5KW9L 4K8RL 2HTLD 4OCNC 4QOKE 1TZHB 1NWOA 3HB3D 3UYPB 3P9WB 2AI0L 2KUTA 5EULV 4FQ2L 5HPMB 2ITCB 2YPLD 3VMOA 5F7HA 5AUMB 4HPYL 2P8LB 5DJXA 3BAKA 4EVNA 7PAZA 4Y2DA 5HGDB 3KZ8A 3NH7H 5A2AA 3QEGL 4HKBA 4EQ3A 3IJYA 1I9JH 1N67A 3GKZA 5DEGB 3TBWB 5B38B 2ATAA 4NQSA 3U4EA 2J6EH 5SWQA 4DPRA 2EEXA 3FB8A 1NANH 4N3TA 1NSNH 1ET7A 4Z7NF 4S0SD 5KYUA 2X70A 3OXRA 4Z7WE 5FM4A 1R9FA 4AZ8B 4CUCA 2AJSL 1D5BA 1E5UI 1FG2B 4I87A 3EO1A 1JZ7A 3EGXA 2WGXA 4E42A 4QRRB 2Z0UA 2ITEA 4J3VA 1FIGL 3QIBD 3OHXB 3P4NA 5AW4B 3T3ME 1FVDA 3M1BA 2HRPL 1TETH 5D2NC 3LEXB 4HWNA 3GS4A 4AK1A 5DYOB 2ATPB 3SQOH 1QBLL 2CLZB 3M86A 2YFNA 4PCSA 3SKJH 3ILQD 3KJ6H 4JFDB 3MRQB 1KCUL 2YD9A 3DA0A 4BXVA 1FZMA 5ESQB 6TAAA 3F04A 1JGEB 2BM3A 1Y0LA 2PTTB 2C9RA 4GMSL 4X4XB 2XN0A 1WAEA 2ZOKA 1NOAA 1T20A 3H9SE 1ZDQA 2Z4QB 3VB9A 4HISA 1U93B 5E9DE 1BEYH 1KGJA 1S7RA 1LO2L 4KQ3L 3WU1A 2CHDA 1OM3L 5BVJA 2H0JA 1HHHB 4NKMB 3PAZA 4S0HA 1G0DA 1MAML 4YZFE 5C0JB 4LOVA 3ULAB 1WCBB 2M1KA 4XVTL 4UINH 3QUML 4MDIB 2EE6A 2L7JA 4QLWA 1J0HA 1GSMA 4JGMA 4LHUA 1G9EA 3X1FA 2APVA 1G6RL 4Y9BA 5J4MA 4H0IA 2AK4B 2ZCLL 4B7IA 1U8NA 4J8QA 1P0SE 1QTPA 3IXAA 3UH8A 4OH2A 2GSGB 5L88L 4DP8X 4YOKA 1H0DA 1DL7H 4DKFL 1RUKH 1QOKA 3DURB 4MWFA 4MJIB 5AL0A 5DJ0A 4PS7A 4PJEA 1FG9C 4M93C 4P9HL 1UH3A 4QRPE 5MEPB 1XAKA 3TV8A 3VXMB 1AG6A 4BFGA 1WWAX 5TF1L 1QLFA 3PP4L 3S96A 5IEKB 3L3DA 3RVXD 1ZTMA 5D7LA 2ALWA 5DZAA 2PCFB 1WC7A 2ZKHL 2CGZA 4G71B 1H3WM 4TULL 1T0MA 1NC2D 3GSVA 3PDDA 4U1SA 4V33A 5T33H 4TQIA 4P04A 3VAEA 2MRYA 4AUYA 2BSTA 4Z3FA 2Y5EA 5CLWA 3KPRB 1MCCA 3RE0A 5HXMA 7FABH 2B0SL 3NFNA 1A3QA 1YEGL 4R8WH 4JFWA 4YBLC 4LESA 5KVGL 1GY1A 1HXYB 3DX2A 3QFDA 1J8HB 1AR1D 2CR6A 3UCQA 1PKQE 4FG0A 2B3IA 2MMXA 2JJTA 3UAJC 5IW6B 2VLKA 5ILTH 4YN3A 3FTXA 5CU9A 3VG9C 3P0GB 2PCYA 1L4IA 2PF6A 3O3DA 3WTTA 4R2GD 3NPZB 4JPWH 1UQSB 4TSBH 4MMYB 4CAGA 2G75A 3BVUA 1LP9F 2O6FA 3LN5A 4OKDA 2NUTA 3H85A 4MXVE 3BEWA 4NERA 1G1KA 3K6FA 3UBGA 4F33B 5LN8A 1ZKAA 3DX0A 2QR0B 1D7FA 1I9RL 3IDMA 4G6MH 3WE1A 3WFCL 4IOSD 5DXWA 4OAWA 4G59C 3VFOB 4RGOL 3O45B 4FFTA 5DHVB 3G6JF 4BUGA 1XGUB 3VD5A 1OAXL 5EUOA 5DD0L 4ZFGL 4KPHL 5GJTL 1NGPH 1ACYH 2XA8L 5C08A 3QNYB 1RERA 2CHXA 2VQ1A 3LKQA 4LEXH 1B0IA 4U4IA 4ZFQA 4GP8B 5KTEL 5T3XL 2JB6A 1W91A 3AG2B 3N5AA 4HCRH 4HJUA 4OIIH 1H3TA 4JY4A 4M5YL 3IU4H 3MV8E 5DJ2A 1IC4H 3LHPH 3VQ2C 5AL8A 1RD6A 1TFPA 3HW7A 2Q20A 3U9UB 2HTKD 3MRPA 4R96A 2PWFA 4P07A 2VDQH 1J9QA 3EBIA 3S36L 3VDBA 5DF0A 2RH0A 3JWDH 1QEWB 1YQVL 3BZ5A 4FNUA 5L4FA 5DO2C 4NPKA 2NRDA 1DANU 3AREB 4WDIA 1MH5B 3CFJA 3UTTD 1DVFC 5CGYD 5KSUB 4JRXA 2VDKL 2J43A 3JV5A 5KVEH 3T3PE 2V2TB 4PJGA 1P4BH 3KPQB 4GAGL 2VXUL 1JCVA 5I1KL 4ILDA 1XH3B 2UZYA 2ICWI 3NABH 3X1EA 4I88A 1ZMYA 4R0LB 3S97C 1E3ZA 4M4RB 1I1AC 1MREL 4LSTH 1ZT1B 2HJFA 2YJLA 1SEQH 5KUMA 3ZR5A 2P5WA 1BZ7A 1E9QB 4AOFA 5L6YH 3ROLA 1X5LA 5J3HC 3GMQA 1MFVA 1TZGH 3V0AC 5FO9B 3FFCA 1WBYA 3INOA 3JTSA 3O41A 5E6IC 2EDMA 2XTJC 3GMPA 1MXGA 4I0PA 2CO6A 3TEZA 1MI5E 1HN1A 4G5AA 1E5BA 5D7IE 4UTAL 1DN0A 3ZVVA 1I8IA 5GJSH 1WAAE 1IKFH 4XN8A 3FSAA 2X4OB 5LNEA 4PGBA 4BDVA 3A22A 1ZLWH 2WQVA 3D1MC 1NCUA 1Y1DA 3OAUL 1Z66A 4AY0A 2IGLA 1KYFA 2BFGA 1G87A 4B41A 2X7LA 4NQDD 3LIZL 1M56B 1MHHA 2EVJA 5DRXA 5IREA 5GS1C 4AT6B 3PAYA 4B6ZA 4HMCA 4F7TB 5CSGA 1UCTA 4YVUA 2TSAA 3QARA 5TD4A 4U1IB 4JO1L 2FE0A 3NT0A 5EU7E 4LZKA 4DN4H 3B2DC 3QJHB 2KPNA 1TEGA 2OA9A 2X2IA 4GQZA 1BLNB 1E7VA 2UXVA 1TT6A 2VNCA 4AKOA 3TEUA 5BJTB 1A6PA 4CMMB 5BS0A 3ROOB 3P4MA 1TMCB 4G8GA 4FQLH 1D2PA 3KE0A 2AJYH 3TIEB 3QXDB 1RCYA 2IBGA 5C0BD 3SO5A 1MJ8L 2E76C 3CSPA 4DGYH 5IB2A 3UMTA 2DB8A 1E4XI 1IARB 3L3IB 4EI5A 1L3WA 1T3FA 3HI6L 4F91B 4ORZC 4QOKA 2X6BA 2XY1A 1IEHA 4X5WA 2FATL 2J25A 4WK2B 3VRIB 3QULA 4GQ9H 3GK8H 3I3EA 5GGTA 1D3CA 4K9EC 3UO1L 2G0KA 1W8NA 2NCEA 1DLHA 1UHVA 3O11B 3QAZC 2IDFA 1A4KB 2UZIH 2DL9A 4I9XA 4NS0A 3UYRH 2F53E 3CVHA 2OMYB 4Y89A 5LWYH 5JPNC 3OF6A 2Y24A 4PUBL 3MODL 4LDLB 4XWOC 3RNQA 1CTMA 3N0AA 3QBTB 1X7QB 4L29B 4X7FC 4IHOB 3KPSD 5HYSG 1UB6B 4XOEA 2CBOA 3QEHA 3QRGH 1RUQH 3BO8B 2JLLA 4KTDL 4IJ3B 4U0RB 3QZLA 2WLIB 5DI8B 4G1MB 3LS5H 4OQTA 2FBJL 1JDDA 4JLRB 2ZSWB 1B4LA 4F9LC 4FQHB 3LV3A 3FU3A 3IAPA 2ZKYA 4N0RA 3MRLB 3Q7JA 3RIFK 3VFGL 4IIZA 1ZLDA 4MJ6A 3I9AA 1HSAB 3NRPA 4X80L 4WHDA 4E5XB 2ZTBA 4NCDA 4BBWA 2CCWA 4X6FB 1J8SA 2IAMC 2QMJA 4JPQA 5E6SB 3FQRA 4JAMA 4NQCD 2D7TL 3H9SA 5A3IC 2A6DA 5INCB 3ME0B 1ZEAH 4J3OD 1QQDB 1NFDB 4Y19B 5F89B 2PCXA 4ZW5A 2ITFA 5IMOB 1JK8B 1UH2A 2YEZB 5LAPA 1GAFH 1CDGA 1OZUA 1NC4B 1SJEB 4W6YB 1QI4A 4WTZA 1HDMB 4Z0XB 4WENB 3ZDYF 5ITBL 4OI8A 2BP0B 4HJSA 3LRSB 2HG0A 1OAYL 3V4VH 5DJDB 3QQDA 1Q9KB 2JJUA 4IKKA 1I7UA 4NAJA 4EOWH 3P4LA 4UQCA 1HZHH 1J1PL 1EZUA 2ZCKH 4LPUA 1JPEA 3L3GB 5I6LA 1X5KA 4E9LA 2YJQA 2VDMB 4L5FL 4OBSA 4FZEH 3TTSA 3BCDA 4JM2D 4H2CA 4HJ0D 4FXLA 4GKNA 2UX6A 3UC0H 3PREA 4K7FB 1KCSH 4ZXBC 1QVOA 2OJZH 3QJUB 4EE2A 4S1QH 3LPPA 3QISA 5K69A 4N85A 3ZO0A 1OTTD 3EH4B 4KKBD 2WLLB 1DFBL 3DO4A 4OZHF 2MCAA 5KSAA 5IB1A 3WTSA 3TT1L 1NBVH 4QRPA 3BWUC 4R7NA 3TBBA 4PRPE 3LXUX 4Q0XH 4CA4A 4L8CA 5SWZE 1IZKA 5JYLA 9PCYA 3S3PA 2GJZA 3OJDB 4JG9A 2D31B 3KR3H 4TUJA 4PGJA 2CO7B 4OUUA 4R4ND 5I1EH 3GUTB 2W95A 5B4MC 4KRLB 2OSLB 4LLQB 2YAOA 4NNXA 1AQHA 5GGUA 3CZUB 4Q56A 1R5VA 4XTRD 3R0MA 3NRFA 2E59A 1NUFA 1SHXA 1HHIB 3I6GB 2XVGA 1MFEL 3ESMA 2K3TA 5HDLA 4QGYA 5CJ5A 1AYRA 3ELAT 4Q89A 1YYML 4ZUSA 3RBSA 2AKRA 4PJBF 4ZDHB 3KCPA 4NUGL 1JNHB 4MAYA 4OZFB 1AG0A 2WQ8A 2XJKA 2HT3D 4FTVE 1G7JB 1ZHKB 3DSFH 3VWKC 3GKWH 3D39A 5BXFA 5C0AB 3W57A 2WNXA 5K9JL 1DANT 4C59B 1OD9A 4UWQB 1JN6A 4KVCH 4JZOB 4W9IC 1LQBC 1ORQA 3DLQR 2QTVA 4WWID 1AY1L 4PRBB 3MA7B 5KBLA 1FO0H 2WBXA 2X3BA 3AVEA 4K8RH 3TA3D 5KW9H 1KTLA 1HIMH 4OF8A 5EH1A 3E8UH 2AI0H 2F74A 1A1OA 4FQ2H 3NA9L 4WHYH 2Y7QB 3IBEA 3REVB 4BGDA 4HX1B 5KN5B 5J6GA 1TPXB 4MA1B 3S3CB 4DK6A 5J6HB 1IGJB 3VDAA 2DPKA 2VERA 3MBEA 3RNKB 4BFIB 5JPMC 5J1SC 1RU9H 2UUDK 2K8QA 4KKCC 3Q8FA 5GHWH 2RGSA 4ABVA 2V7HA 2XN1A 2LVEA 1QBBA 2EO7A 1KGXA 2NMSA 4TPRL 4TQHA 1DYZA 4YDKL 4LCWE 3UC2A 2A4ZA 1SBBA 4TTDC 1A7OH 1KGWA 2X9ZA 3BUTA 4CBPA 1ZHBA 4PRDB 2KMWA 4CNIA 4BRJA 3T09A 4B9FA 3EDJA 5BZDA 2BP3A 2AJSH 2XWEA 3M7FB 3UGEA 2E56A 2J6WA 2KI6A 3AW5A 3FU0A 3IGLA 2KL6A 2B20A 4LSUL 4MTMA 1AACA 2ZAGA 3IMTA 3HE7D 2F54B 4PV9A 1FIGH 3R19A 1DE4B 5JHDE 4YFDB 1H8SA 1XCWA 2HRPH 1AZRA 4A1RA 2BX5A 4DH2A 3FC8A 2RIKA 1QBLH 1U8CB 2CHZA 2EIDA 1GZQA 4WV1A 3GBNH 3CX5K 3L3JA 2O5XL 1KCUH 5AW9B 2R1YB 3LNIA 3DV4A 1JGUH 1FNFA 3QDAA 3T65A 3I2CL 4GMSH 2JJSC 2D3LA 2DV6A 3JYCA 4IBSA 5FGSA 5DFTA 2VMFA 3MROA 5IMLA 3LZPA 1AGEB 4N2HA 3NCEB 4FI7A 3U2SA 3D50A 2XN9D 1D9KA 2BSCA 5BNXD 4IGBA 4OFIA 5HYFA 5JHBA 2WYHA 1OM3H 3MJ9L 3Q13A 4NQXA 2X89A 3UDWA 4YE4L 5IWLA 2PXYC 1W72A 1LQSR 3IDYB 1UWYA 5CFAA 3TH2T 1CGYA 3CQQA 4MAUL 3QHFH 3QUYA 4WW2A 1YMHA 4L1BA 4EN3D 4XVTH 4LVHC 3GI8L 4K94C 4A55A 1EEUA 5LHDA 5FOJA 5ISZE 1F5WA 1MZYA 4WHTA 3SCMD 1MNUL 3HBPA 5H37A 3HCVB 3O4LD 3ARDA 3DGDA 1G6RH 1L9OA 4J12A 4TL5A 3UTSB 2ZCLH 4AMWA 1E27A 4P5MB 4WSGA 1MI5A 3NUKA 4L1LA 5DZJA 3NA4A 3RTQB 4PEEA 3GMLB 1WAAA 1YMMB 3P0YH 4ZFZB 3WJLA 1CT8B 4PFEA 5JMOC 2AF2A 4QTHA 2IPTL 3QXTA 4ZJ9A 4PG9A 1D5IL 2IANB 1AGFA 2VDOH 4OZ4B 1PIGA 3S3SA 5FYKE 5KYXB 2BMKA 5ADOL 2QV4A 4JANA 5ABAA 4XMXA 1MRFH 1JK9A 1OQXA 3MN8A 3SY0B 3UBXA 4DOHB 4PQXA 4ABUA 4P59L 1BEXA 3WJJC 3CSYA 1HEZA 3QZBA 3PP4H 1K6QL 1RZJC 3B3IB 4TULH 1HSBA 1T1WB 1TYJA 1JFQL 3VXUD 4ORGB 3BWUF 4A6YA 4XCEA 5DDHB 3E7JA 3V6BR 2B0SH 2A9MH 4CVZB 4YDVB 5KVGH 1P9MA 5LKNA 5AKTA 3RWHA 2E7DA 3RZCB 2M26A 3AU1A 4Z7OE 2FJGB 3ZE2E 2WLZA 2KC0A 4M6NL 1A2YA 4AENA 2BWDA 4JGNA 1FC1A 3CJJA 1ZSHA 2EYSB 2XQYG 4L4VB 1F4YL 1RZJL 5TQ0L 4PP2A 3QWOB 4YSTA 4N2CA 1P1ZA 2FO4B 5HJGA 3TH3T 1A9VA 1IQDA 1BQHA 5AVWB 1SYSA 2ZX7A 2C7UA 1RJYA 2IH3A 3GTVA 2F53A 5DJXB 1QBML 3LCYA 4EVNB 4PAZA 4FS0A 5C9KA 5E1QA 2W0PA 4KJWD 1G94A 2DM2A 2BZDA 1OV8A 3CHXA 1KJ3L 3QZOA 3WFCH 3IJYB 4DP2X 4GG6B 4RGOH 2EXSA 2O4EA 4NQSB 2XBZA 1PS3A 3I75B 1OAXH 3K6SA 5D1QD 5DD0H 2ZD0A 3WMQA 4KPHH 5GJTH 4ZFGH 5GGVL 1P5UB 3PWJB 1QLEH 1AO7E 4OGAC 2H2PC 4F7MA 2R69A 4NN7C 5KTEH 5T3XH 3UTZA 1Y6MR 3FPXA 4BFRA 1PG7L 1QWHA 5JXED 2JKIS 1IM9B 1G7PB 3AU0A 2D4DA 3S9DB 5I1AA 4XNMB 4JS7A 5DJ8A 2RA1A 2Q10A 3WENA 2Y23A 4M29A 1ZS2A 3H0TB 4PREB 5I2IA 2AEOA 3ZMNA 3NIFF 5CF3A 2CCVA 5E7BA 2F61A 1SVZA 3S36H 1ID5I 5HD8C 4F7CA 2LQRA 1OGSA 1WBXB 3KVPA 3SDDD 3EYUL 1LE9A 1PTZA 3L95A 4WUUD 1IFHH 2EXWD 1XR8B 4IIQA 3Q2CA 5FC9A 3HG1A 5I8CA 4FQXB 3WNLA 4XCCL 4GAGH 1BJ1J 5DHEA 4AVIA 4Z6AT 5KJRL 3UTTE 3OZ9L 1MWOA 4S0TD 4YVNA 2VDLH 5EO1A 3V9CA 4RMTA 2JKRM 2EADA 2OSXA 4KMTL 4NUPA 4LPCA 1T2JA 2DKSA 4KMQA 2EDYA 1KJVA 1AGDB 1OQOA 3FRPB 3MRNA 5EU4B 4NO0D 5GRXG 5IMMA 3DO3A 4ZOAA 1KN2H 2HFEA 4BSWA 1YCSA 1BVOA 5EN2A 2J8UF 3HS0A 2HVKB 3IFOB 1CF8L 3HPJB 4CVXB 3DSNB 4I2XB 3MRBB 4FXTA 1LEKB 4UBDC 4EF3A 2K6YA 4PJDF 1DBKH 1F3DJ 3NJJA 4WU5A 4M7KL 1B4TA 3FBQA 4AYBA 3WAKA 2FUQA 1IFRA 2MCG1 1L0PA 2I24N 3QORB 2ORBL 1AZCA 4UTAH 1UXSB 4YIQB 1TJGL 2VAAB 5T1KB 3ZE1E 1YEHL 5D96C 3ARFA 4PGCA 3WNKA 1D5RA 4L8DA 4PH8A 3FOMB 4H8PA 4QYOA 1KCRL 3RVTD 1RZFH 4OLYH 2EH8L 3LIZH 2G2RB 4E41A 1IBZA 3KDMB 3KWUA 5BRZE 2F15A 3RIAK 1FAKT 2OZ4L 1EJFA 4P2CG 5EOTB 5GRWA 1B0GA 5FO7A 3ZKND 4JO1H 3K1KC 3FQ4A 3GSVB 4U1SB 1NPUA 1UEYA 3FB5A 3GZKA 1CDYA 3V0EA 4TRPL 3FO0L 3FQNA 4OZIB 1ZS8B 4FTVA 3WFDL 5LVEA 4PMEA 1JRHH 1U8IB 5D2NB 5CLYA 4L1DA 2CJ3A 2PW2B 3QDMB 1L6PA 2WXLA 3QWRD 2B3RA 1BJMA 1MJ8H 2QVKA 2CM5A 3RGVC 4P4KA 2GUYA 2IFGA 5HGAA 3VSVA 3H54A 2Z31A 4NWTL 3ZE0E 3TN0C 1IM3B 4OI9A 2FATH 3KWWA 4N2KA 1OB0A 2IOMA 1E9PB 3RWEB 4UQ3B 4JNXA 1WP6A 3UO1H 4DKTA 5KBNC 3O3AB 1QKZL 1T83A 4MQ7A 1G9HA 4H25B 3DV6A 1TVHB 32C2A 1TENA 2EEFA 2YPLA 3K5RA 1CFTA 4GIAA 1NEZA 1K4DA 3QDGB 4I3GA 4PJ6A 2X44D 4Q6IA 1D5XB 3BEVA 3QI9D 1I8KB 3MODH 4OAWB 4PUBH 2VKWA 3V5KB 3D18B 6FABL 2IQ9L 5CZXD 3T77B 2BS9A 4XVOA 1GGYA 2LHAA 4L0PB 1NCTA 2H47C 4JDZB 2CUHA 4K9EH 1NGZB 2FBJH 5DJYA 3LPFA 3EFOB 5DGQA 1FAIL 3P77A 4JFPB 5I8KH 4U31A 4XNYL 2A4CA 4UANA 2A9BA 4PD4K 2AW2A 2VJ8A 3VFGH 3HRZA 4JPKL 2XPYA 4ES8A 3QIBA 3MJGX 1HNYA 1PQZA 5M7QA 4YK4C 2DWSA 3R8QA 2XXMB 3QDJE 4FJYA 4I5BA 4LASL 9CGTA 4BFJA 3BN9D 1TXKA 1XDTT 4W9EC 4ZUUA 5CGBA 3VUAA 4POZD 1QFPA 5C1MB 3G5VB 5F3BA 2K9UA 3MRMB 4DERA 5C0DB 1CICD 2OPCA 1CU4L 2CWRA 2DQTH 1DUYA 3WKQA 2MJWA 5I8EA 3QH3B 2VM9A 3EW3B 3VD7A 1II4E 3WEOA 4M8QA 4NQCE 4L3EE 1COBA 3MRKB 2X4QA 1BFOB 4FA6A 5KVDE 3IGAB 3QEQB 3MFFA 1A9BB 4M7JL 1OAYH 3FUDA 1WWBX 1W0WB 1F18A 3GRWH 1WG3A 2JTDA 2DQFB 3PABB 3RVVC 3A5VA 4FA7B 1Q4NX 3IDIB 4JO4H 3KMDA 5DZ9A 4L5FH 4P23B 5A43C 2JIXB 2YKKA 4LVOC 1N8ZB 1ODAA 3TCLB 1U8PB 4X9HA 1W6LA 3U4BL 3VG9B 3QIUC 1CGWA 5AVUB 3S8WA 3JTSB 1OF2A 1ITCA 1JXKA 5DYFA 3X14B 1RUPL 4RQQA 3D9AH 4L0YA 1QLEB 3KEDA 4KDWA 2HUHA 5E08L 1J9SA 3G04A 4N6QA 1IJNA 3THML 1I8IB 4BFBD 3TT1H 3CFMA 3UYOD 3BWZA 2UXTA 2DJ4A 3UABA 2HH0L 1FFTB 4X8XA 2NXYC 2OMTA 3SPIA 3BT0A 4YDLB 3MLRL 3EJZD 2I32A 2C1PB 2X4TB 3IDXH 4NO5B 1IGTA 4WO4D 5DEFA 4PJ9C 3F7PC 5F9WC 3QJRB 3VU1A 1NGYB 3CZFA 3WJMB 1GGCH 2KLTA 2Y36H 5LGJA 2NW3A 3WELA 4M3HA 3P02A 2H41A 3QPXL 2GAZA 4BA0A 4KQ4L 4AYMC 3ETSA 3H55A 4GKOA 1YYMH 1AHKA 1I85C 1NC2A 2CA3A 3ALXA 1RK1A 2WBJD 3FMGL 4FQJH 4JBSA 4U1HB 3UG4A 2G9HB 4XCNB 4NC1C 1Z2KA 2YR3A 2X4NA 3FO2B 3ESVF 2F1BA 2ZP8A 1E2ZA 1YEJH 1CQKA 4PJCB 1JI1A 2BSRA 4LSSL 3TZVC 1NCGA 1TF4A 1DJHA 4YGAB 3RWCA 1T3FB 5JIHA 3ZMRA 2WKGA 3OLGA 5DK0B 1RK0A 3SDYL 3TBYA 2XC8A 2EICA 2VDML 3NA9H 4YEEA 4K3HA 2CH8A 3SDXA 4AV0A 1NBCA 1TUPA 1EERB 2WIMA 3PGCA 3GMRB 4E9XA 1T0PB 4MLIA 4OZGA 3L9EA 4AJWA 2FR4A 2I60H 4Y4HD 1CC3A 1BMZA 3KPLA 4HT1H 4PG2C 4DW2H 1WITA 3CVHB 1V55B 3CXDH 4JQIL 1HI6B 4AEFA 1SJHB 4YDKH 1M05B 4R83A 4XNQA 3MLPA 5D70H 4IOSA 3D87B 5L4IA 4Z7WB 2AJZA 4QKTA 4RIRA 3DKHA 4WZ9A 2KKQA 5K1VA 3WBDA 4ELKB 5JMRA 1X5FA 3QUXC 4MS8C 4KTGA 5GZOC 2CR0A 4LSUH 5A2KH 4XNZB 1PU0A 1TTAA 4FX5A 3PGFL 1NWPA 3KGTA 3RWGA 3EXJA 2IAAC 4XB3A 4BFFA 1LK2A 5IOPB 5DS8A 3Q6FA 4MJ6B 3CFEB 5IP4A 2CRZA 5MP6L 4OCMC 5IBLC 4I7ZC 5LGHL 1X5GA 3MREA 4MQXC 4UOJA 1AANA 3EOBB 2XG5B 5FHAL 2HAZA 2PYED 1Q9LA 1BZ9A 3MGTA 1JVOA 4I48B 3I2CH 4XMLL 5TQ2L 5HI5C 5I6XC 1NUDA 2ZX5A 3C5ZD 4GRLC 4XOCA 4KK6D 2A6DB 1RHHA 1M2OA 5C6PB 2BCKB 5E9DB 2BIQA 2EDXA 3A21A 3UTTA 1IEBB 5SV4A 3ZZSA 1C08B 3OKNB 1ZA6B 1JUFB 3MJ9H 4WHCA 2X88A 3DIDA 1U0QA 4YE4H 4ZMZA 3HG0A 5EF3A 3BMWA 3HZMA 5G4NA 1RSFA 4PJIE 3FTGA 2B8OT 2LTQC 4MAUH 5D1XE 1R4XA 5IVNA 1BQHG 2EKSB 3NJIA 1Q0YH 4APXA 4APQD 4B7LA 1MNUH 1SF5A 3VXOA 5E8EB 3BSHA 5FYLE 3ESOA 5LGYA 1P7KB 1SQMA 2X4UA 3ARZA 1UXWA 3UZEA 4Y1SA 4NC0B 1U8HA 1G9ML 4W6XB 3HAEA 4UTBA 3GGWA 3OL2A 3PGDB 3RLSA 4FOMA 3O4LE 4DEPC 5FYKU 4WKZB 2WUBL 1E4HA 1D5IH 3GMNB 3KPMB 4N8VB 4RBPH 5KSAB 3GIVB 4V1DE 1MCLA 5DSCB 4F58L 4QRPB 3U6XS 3U7YL 3C6LB 2AQ3A 4K94H 1P7QB 3VD2A 4P59H 1P6AB 3PL6A 5C0NC 1JHLL 2JNZA 5CLXA 5GSVA 3NCYP 3T0ED 3KL3A 2SEBB 2Z7UA 1N0LA 2K45A 4LIQE 5E9NA 2XZCL 3QZNA 4U3SB 2XIIA 3WS3B 4ERSL 4UNIA 4NQDA 3SHSA 5J12C 4NNXB 3MRGB 4XPHL 5D1ZD 2GSIB 3HZVA 3ZRFC 1ETZB 3F2LA 1NICA 1CFBA 1XGPA 2E3VA 2P5ED 4NLAA 3OQ3B 4MB4A 2ED8A 2DEXX 2ZYRA 3NZ8A 3PCYA 3RRQA 3ZDXB 2D7MA 1INEL 4ONHB 3QG6B 3OLEA 1INQA 3WCYA 4A7TA 1L5GB 4ZMPA 1PKQB 4WVRA 3VXUE 2FH8A 4BK8A 3CTTA 5FX3A 2J1WA 5C8JB 2Q0ZX 3ZYZA 4OT1H 1MFCL 2CJUL 3VFNB 5JO5A 1UWEH 5EV7A 1AGCB 5CBAA 1F4YH 1RZJH 5TQ0H 1H6EA 4MVBC 4PV8A 1JN6B 4BZ1A 2P47B 5K39A 4KX7A 1CXEA 3G9AB 2OMVB 5C0BA 5DMGC 3SE9L 4G82A 1UB5B 2Q76A 3U46B 5CIPB 1G7IA 4BSVA 5EA0H 3VI4A 4YHKL 4JFHD 1TTGA 2IMMA 3PP3H 5EEZA 1HE7A 1OAUL 2VISA 4X5LA 4L23A 3GC3A 5EOCJ 4K9JA 5JORB 2OMWA 1KJ3H 1R17A 2D2CC 3K1DA 4PMFA 2BP8A 3Q01A 4P2RD 5C0FA 1AVAA 1NQBA 4KROD 3KLAB 4MDRA 2CO3A 2GFBB 1Z5HA 3QR2A 2DWEA 4QRSA 2LGNA 1L7IH 3L5WA 1ZLEA 1MJUL 3FYIB 3WTYA 5I66A 1EEQA 3KPSA 3HE6B 2O61B 1P7HL 3OZLA 4IM8A 2WXIA 4R7VA 4M1CD 4R97B 2A9DA 3KLHD 5IK3A 2C3VA 2N56A 5B39G 5D1QE 4ZXBB 2F7PA 3MV8B 2X4PB 4PBXA 2HFGL 3NMEA 1ERNA 3A47A 2GITA 4WI0A 3U0TA 3RYMA 5C2BL 4FABL 5PAZA 4HIEA 4X4ZA 1JV2B 3ETBJ 2F08A 1B6DA 3EYUH 1RIUL 4KVPA 1T4WA 4ZZFA 3W11D 4Y2DC 3U0PA 4L8SB 2V5YA 1G0YR 2MKWA 2VCOA 3T4YA 5H35A 3T3PB 3MV7D 2WIIA 4NQCA 1MLCA 4S1DD 5BPPA 2CRMA 4P5RA 4XCCH 5I75B 5KJRH 4WIQA 3GXDA 2XWDA 4YDNA 3PXLA 4KMTH 2C34A 2R4SL 1TQBB 2FX8L 1Q9OB 3OKEA 1T1XA 1W72B 1GGBL 5DA4A 5DVKA 2O6CA 3GHBL 4X7TA 3BVTA 2IEPA 4DP4X 3V0FA 2V5TA 4JW3A 3ILDA 3ULSA 1FQ9C 4HG4K 1QA9B 3OGCA 3C6SA 3AS2A 1NEZG 1QATA 3TEXA 3B5HA 5TDOA 5IROC 3WOVA 3F62A 1E27B 4JM2A 4OFVA 2W9DL 1MI5B 4A2EA 3OKLA 5D7IB 1YEEL 3JXAA 2Y7SA 2ORBH 1LO0L 4IKIA 1BFSA 1PNDA 4ZO6A 1PAMA 2ADGA 4LNVA 3TYFA 4Z3TA 3B9AA 2PPCA 4HS8L 2D7OA 4F1SA 2FEDD 1YEHH 1B6UA 2BMKB 1QSED 3H7BA 3SGKA 1JK9B 3FT3A 1KCRH 4FFYA 4R5VA 1M7IB 1HYRC 5TDNA 3IE4A 5DLMH 2EH8H 2AEPH 1NGWA 4U3CA 2FWLB 3QCTH 1L6XA 2AERT 1PZSA 1J05B 4HEME 2H26A 1EEZB 3AMKA 1MHEB 5JW5A 5HHMD 1WHOA 1OANA 4RMBA 3D7PA 1EUTA 4X6CF 3FO0H 2EECA 5BRQA 3WFDH 1MUJB 4FG6D 4OD2A 1E4WL 1JZEA 1UURA 2GK0A 5E2TL 4BKTC 2XYBA 5JA8B 3UTOA 1RIHL 3FT4B 1HL8A 3NRQA 1HINL 4QXUH 4AENB 4IU2A 4KO5A 2Q2EB 4M3KB 4C56D 3MYZA 4OVVA 3VGDA 2YEQA 2YD6A 35C8L 3F5WA 3V55A 4NWTH 4F93B 4G3YL 2XKNA 1MCWM 5I19L 1HZLA 3JV6A 1LD9B 3BXNA 4H0HB 4RCAA 4WU7B 2OJEB 4WI9A 1DSWA 3QS2A 3TA3A 5D2LE 3PIQA 5I0XA 3GBML 5KYWB 4HAFA 3N3EA 4B3EA 2QPUA 3OJMB 4ZOCA 1Q0EA 1KEGL 1SEBA 4JCMA 1ZLSL 3EYFA 4PYGA 4GW5A 4RRPA 1TVBA 4G7VL 5EBMA 1RQ5A 4PP1C 2YC1A 4LPXA 3VDCA 5EIVA 2WKOF 6FABH 4LVHB 5DO8A 2IQ9H 2VLJE 4QY8B 2XTSA 5AW7B 2D0GA 3MO1A 5JHLA 5LXVA 1CGSL 1I8LA 3EUUA 1ZVSA 2V9RA 1JERA 4LCYA 3ULVL 2AJXL 5E99H 2Q7YB 4K3DL 1DUZA 3GJEA 4AQ1A 5H2BB 1AZUA 5CEZE 5E4IA 4XNYH 3BVXA 4YHIA 4F8TA 1YEFL 5CSBA 2HPOA 4NI6A 3WKML 2XTLA 3HE7A 4FXKB 1HQRB 4JPKH 4Z78A 8FABB 2Y07H 4C83B 4N8PA 5IUSA 2MQ0A 1LEGA 1EGJA 4PTUA 2EVFA 1MEXL 4KHXL 4PVLA 4KJPD 1AYOA 1T66C 3V4PA 5BUAA 5KSVA 4OD3L 4C8XA 2E4FA 1T6WA 1DVQA 3C8KA 1CU4H 4LXFA 3WFZA 4I4WA 5C07D 1I53A 1OOWA 2XX1A 3RQ3A 1KSRA 2FVNA 4M7JH 4PWKA 1KC5L 3WY4A 3N42B 1YA5A 3SEPA 3KBEA 2OLDA 2A5UA 4DIXA 1HKLH 3DRTB 3KM1A 4L1SA 3MRCB 1CDCA 1TTRA 4BSWB 5T5NG 4HH8A 2ZJSL 4EN3A 3EDKA 3F7YB 1FF5A 3QC5X 1OVZA 4JG1L 4DK3A 4HF5H 4AJYV 1OTSC 3FQTB 3SCMA 4B9YA 5JIMA 3EJRA 1F11A 3O4LA 4FN0A 3VTMA 1SYVA 2XWJA 3AS0A 2J71A 1OGTB 1S7XB 5CCHE 3F05A 4FGMA 1B2YA 3MUJA 4KY1L 4OJEH 1C1EL 1ZXKA 3TV3L 5F6IB 1E4XH 1VPOL 5INDA 3THMH 2GCYB 4PRPB 4KNTA 3SKUD 5SWZB 2FGWL 2FD6H 1H8NA 4F9PA 1KIQB 2HH0H 3CCHB 4JFTA 3EBHA 4D3CL 4JQVA 2EJ1A 3IMVA 3MLRH 3S5LB 5J11B 1KZYA 3DX7B 3FCSA 4PGCB 3AC0A 1G7LA 4OUOA 1P84K 2YHGA 3ZL2A 4F8QA 4QWWC 1EX0A 1P5VB 2AV7A 4K7PL 1NCBL 1CGVA 4G9DB 2OK0L 3CHSA 4XI5C 5L2JB 2YN5A 3RUGB 1QABA 3DX8B 1E8YA 1S5HB 5HGGS 3L4WA 3FDWA 3FMGH 4DP5X 1FDLL 3VXUA 1GGIL 1TYEB 4RGNC 1FE8L 2OMXB 1BOGB 3IJHB 1VB9A 1ECZA 3UP1A 5F0PB 1IUZA 4LQFH 4YC2B 4EI0A 3BT2H 5JA9A 3HHSA 2QGDA 4UDTA 5KS9A 1FV1A 4I0PC 3TNMA 4LSSH 2I9LA 4MDJA 5K5YA 1FYHB 1YN6B 5HGAB 4AEHH 3S98A 2MNWA 2AVGA 3CHOA 4JFUA 3OB8A 2ARWA 2OYPA 4I3SL 3F6IA 3WO4B 1T5WA 4HHGA 1HS6A 1YYCA 4JKPL 4JRYE 2UXGA 1U92B 1J0ZA 5IQLA 3CDYA 4J7RA 1FN4B 1R34A 3HG4A 1CFTB 2KBGA 4OJDH 1O7DE 4LCWB 1P4UA 2LU3A 2HUEA 1BBDL 3DROB 4PJEF 1S78D 4XE0A 3Q1EA 5IHWA 3FO9A 4N2FA 1EVTC 1DBML 4PU2A 2EKJA 5IB3B 2FYYB 5D1QA 2Y7OA 1B3IA 1REIA 3FT0A 3MCYA 4N2MA 5AZEL 2DI8A 2YGVA 3X12A 5JHDB 1Y7VA 3CFBB 3PGFH 5IJVA 3P77B 5DFVD 2APSA 1HWWA 5CN1A 2E9WA 4FL4B 3G08B 4GBXD 3T0DA 3VNYA 1QHQA 4GI9A 4RAVB 1SDDB 5HY9B 3HRZB 5JXEA 1TDQA 2RB8A 2YPKB 1TQSA 4JREB 5MP6H 5MHSE 3LZLA 3QUZC 1BVLA 1PSKH 3T8MA 1PDKB 1PBYA 5FHAH 4B60A 5I76A 3JWOC 5TQ2H 4AM0A 3OMIB 5F1IA 1AJ7L 3KPOB 4N20A 1AS8A 3TEWA 1P1VA 3MCKB 5E70A 3HI1A 1N2RB 1A6VL 2IGFL 3B2PA 2WCGA 3C8HA 3QCUL 3U6RA 1NAMB 3QNXA 4WUUA 5F1KC 4QJ4B 3VSUA 4PWFA 5KJ7E 3DJSA 5EIIA 1T04A 5IF0B 1IEAB 2Z8RA 2X4QB 2H7WA 2RR3A 3KEHA 4KZCA 3VE0B 4B50A 4F7EA 1MNNA 1XIWD 2BIOA 1AHWB 4A38A 5ERWA 1PX3A 1SHWA 1NDTA 1WHPA 2UY6B 5ISZB 1JHTA 2NX5B 4HKXB 1PZ3A 2Q8BH 3JWOL 4KRPD 1GS8A 4NPJA 2EDRA 4WO0A 4YHLL 1VDGA 3VMPA 4NP9A 3FH5A 3W0WD 4NO0A 4Y16B 4HCIA 1J12A 3RGVB 1Q94A 5CMAA 3CVHL 3P30H 1LXMA 3E3QE 1TQVA 2WXMA 1LEIA 3TN0B 4OCWL 5EUOF 3WL9B 4BUQA 2A7BA 3MYJA 4XRCB 4F3FA 3EFFB 3DOHA 3HC3H 3AWGA 5HHPA 1KBGH 1KPVA 1VACB 1I7RA 3BPCB 2WUBH 4U1JA 5D7KD 3Q06A 5A6LA 1MQ8A 3ZTDC 4UU9A 5D72L 4GRWE 3RVUD 5C0CD 5JW4Q 2ZCHH 4OQTL 3U7YH 4TNVF 4U6YB 1HHKB 2OMTB 3GPSA 4YZWA 3MBWB 1JHLH 5G4OA 4AYSA 3FUEA 1KUMA 4G11A 4WUKL 4OFDA 1EHLH 5LG6A 4D9QD 5A7EA 4A2DA 1A7RL 3GXNA 1CO1A 1CXIA 5FA4B 3Q5TA 1VFMA 1FYTB 4L3CB 4XPHH 1A1MB 4WW1B 3T0EE 3LRMA 4ZNEE 1W9XA 3LQZA 1J9CT 3RWDA 1TZOA 4YSUA 2GAZB 3AQZA 1I7TB 5C9JA 1INEH 4Z7OB 1F3JA 3PXHA 1IBBA 3D34A 1UJ3B 4HGWB 4PJGF 3ZE2B 2K4AA 2P5EE 1KJMA 4J3OG 2HJLA 4F1ZA 4KGJA 2C3WA 4ZS7L 1MFCH 2CJUH 3RL2A 1ND0A 4CBZA 5DRWB 1N8OE 2R0WL 3QXAA 2BSRB 3QWRA 3NJMA 1U8MA 2ICES 4H8UA 2WTRA 3SE9H 3GSNH 1IAIM 2EIKB 5IIEB 1FORH 3Q2LA 3NSXA 3VD1A 1U8LA 1OAUH 3FKUS 4ZFFB 1VADB 4FXGA 2FYVA 3I6SA 2AMGA 2ADFL 1BP3B 1HHGA 1KLGB 1HXMA 2DQCL 2MPAL 4UT6H 4Y5VC 3WYRA 3R8BB 1TFHA 1OB1A 2OL3A 2EO9A 2FQEA 3BZFA 3GINA 4Q9QL 3QZWG 1NA8A 1MCDA 4XP4L 1KGIA 1GKEA 2L4OA 3AT9A 3QI9A 1AO7B 4RZCB 4ODWB 3PHQB 4LVOB 1MJUH 4YBHA 4LBEA 1FJ1B 2J56A 4PWHA 4WJ5A 5BOZG 2WAQA 4HUWB 4PJ7E 4LSVL 4YH6A 5ES4B 3NGBC 1UFUA 2HFGH 5D5MA 3GJFA 4X8JA 4LARH 3LNFA 2Y22A 3UAEA 5E94B 1V7ML 4XMKL 4ZSOA 4K3JH 5C2BH 3C09C 3RDTD 4FABH 3ARBD 2NXYB 4F37K 4XBGA 2UV3A 1RIUH 4NO3A 3W9EA 1UVQA 1BZ9B 2OULB 2Z3FA 2VM4A 1F1GA 3MBEC 4HOWA 4MJJA 1X9RA 1XGQA 2FWUA 1OALA 4POYA 2PNDA 4RMUA 3B6SA 3WGUB 1A0QL 1CICA 4JFZL 3MRDB 3IF1B 2R1XA 3S37L 3KGUA 3CSBA 2R4SH 3IWVA 5IVZB 1IE4A 2FX8H 2ZKXA 4KOBA 3MV7E 4TSCL 3FTGB 4O02B 2HWZL 1CBJA 2ROXA 2NY0C 1H8LA 3GHBH 2R9HD 3MZTA 4XAKE 3NZUA 3GB7A 1H6UA 2YUVA 5AVZB 3RL1A 5K1NA 1MJ7L 4J27A 2HCZX 1WVZA 4U3XA 1PD6A 3OV6A 1OSYA 4U1MA 1JZGA 5IB5A 3J7HA 4ZX6A 25C8H 2F58L 5JUEL 2ADJA 2A2QT 1WO2A 2PYFA 2W9DH 5E4EC 1SJVA 1BVZA 1YEEH 3AUVA 1LO0H 4XC3L 2COVD 4HPOH 2X1OA 3W39A 4G6AD 3WNIA 4ZMNA 2EE0A 1LE5A 3ZE1B 1M6OB 4KZEH 5ICXA 1NPJA 2ZXGA 1OP3K 4D0CA 1TJIL 1HCYA 1J5CA 1XTMA 1SN0A 4Y5XB 5I73C 5F72S 3EYVB 4R3SA 3T8VA 3PL6B 5IB4B 5FECA 3GLDA 1OGAD 2VQ4A 3ISRA 1UFGA 4PRHD 4Z77A 4NHUB 4XMPH 5BRZB 2MOVA 3UDWC 2UWEA 1HAWA 5IWLC 1XCXA 3MUGB 4WO4A 2NXZC 2UYLA 1FSKC 1DZ0A 1IKNC 5EC2A 4W4OC 1NIEA 2FHBA 3QUYC 4WW2C 4OKVA 4QXVA 5EMYA 4YL4A 4IMLA 4O2FA 4PLKD 4U1LB 2ADYA 4JFFD 3PV6A 4LSQL 5E2TH 1E4WH 4LEEA 2BIMA 3WY3A 5EWIL 3F00A 3NOIA 3H2WA 4FQQA 2WBJA 4FADA 4XX1E 3MGOA 4PJHE 2BXYA 1AMXA 3BGFB 1AC6A 4NWUH 5HHME 4NSKA 5DHMC 3VYPA 1HINH 3C60C 3KJ4B 5IEHA 4D0BA 2NNAB 3SPHA 3APNA 3HOGA 1ZGLA 3AWEA 3QUKB 1W72L 3N44F 3WJLC 2P24B 4NJAL 3IMWA 3ZE0B 35C8H 1WFUA 5E1AB 4ANXA 4G3YH 5TE4L 4ZTOL 3JT2A 5I19H 1ILUA 4GO9A 4X6DA 5BV7B 3N1FC 4FYTA 4FP8L 1G4RA 3LMJL 4K15A 2JKJA 1TSHA 4JG5A 2DKMA 4C56E 1Z3GL 2WXJA 3GHEL 3GBMH 2YD7A 5ABZA 4QIRA 2NY3B 3LDBB 3BUQA 1F4XL 2OMWB 5DMKB 4Y4HA 4G7VH 2QQKL 4YNYA 2GUOB 4ZUTB 3BYYA 2LE9A 4J4PD 1DJGA 4TLKA 1S7WB 2HLAB 1R3JA 3BP7B 3NCXA 3L4ZA 4XN7A 1H9DA 1BMGA 3FULA 4HXBL 4LLUA 4ZW6A 3UZVA 4DKAA 1CL7I 1CGSH 2WV3A 3CVCA 1JE6A 2K0RA 2YMXL 2AJXH 3H4FA 4MXQD 4F2FA 4QTFA 5ENWB 3BRFA 4K3DH 3AS1A 2AXJA 5GS0D 4HLJA 3STZB 2BINA 1MCIA 2WO4A 4HZLB 1YEKL 4KUCD 4NQVA 5J13C 2IBZX 3ABLB 2Y7MA 4NAQA 3SYQA 4DUXA 1UOWA 3IJ9A 1PMYA 1Q9WA 3BLKA 3WHE0 3EHBB 4QRRD 1A02N 4PRAB 1S3KL 1WD8A 5EEYA 2GITB 4WI0B 5AB9A 1KPUA 3CVDA 4KOCA 3FN3A 3QDJB 3RU8H 5FO8A 5K9QG 2RFXB 5HGBB 4A6YL 1MEXH 4X6CB 3BSZH 1RY7B 5CEXB 1KOAA 2VQUA 5EO0B 3VJ6A 3GSRA 4WI6A 1YQ2A 1CR9L 4JFDD 2PYEA 2WMPA 1MFDL 4NENA 4WWKC 3L13A 4HIPA 3C5ZA 4N5ED 5J12B 3BPNC 3IWUA 3SYOA 4DO6A 4L3EB 1MLCB 4Y2OB 1T22B 3CPLB 4G8EA 4IK7A 4YR6A 1DSFL 3VQLA 4KI5D 4YWGL 4AKQA 1RV6X 2NNCA 5IJCC 4Z7UE 1CGXA 5F7EL 5KSBE 4R9HA 3FAWA 5IOKA 2DS4A 3ZQ9A 3ABKB 2YZ8A 2L3BA 1IBGL 3FFDB 3D48R 5D4IA 1JHKH 1G7HB 1MW3A 1FFNB 2W9EH 2XXCB 3ULSB 2QDWA 1UYWL 2HYMA 4MD4B 3DBXA 2ZJSH 3HC4L 5DJ6B 4IRZA 4EZKA 4LKCB 4D9LH 1AQDA 4JG1H 2ZOUA 4APQA 3OGOE 2X5PA 4X8CA 4UNTA 2BNRB 5HYSB 4ZS6D 1DQML 2W0LA 3FSOA 1TJXA 5ITFB 1KB9J 2Q3ZA 1W0VA 3TV3H 2AK4D 1ONQA 4JFXB 2AEIT 1A5FL 3G6AA 1U3JA 3CHRA 5CD5D 3U7WH 3QYMA 2KZKA 3MJ8B 2JKSA 3F12B 5E2VH 4D3CH 2R69L 1AI1L 3C12A 3NPSB 2VWEE 1FI8C 4JCWA 4IIQC 5E8NA 5K93A 5AB2A 5MENE 1J5OL 4G8FB 4N2NA 3T2LA 4M61A 4MJID 5C86A 2KT6A 1NUGA 3QK0A 4H8WC 1NCBH 1T4KB 5DS1A 5JQ6L 2OK0H 4ZTPL 2QSCH 3K6IA 4ZNEA 4F7PA 3T0EA 3WEAA 3U7AA 3VXMD 1AZVA 2F7QA 1KXQE 3ZKQD 2NSMA 3FB6B 5D1ZA 1L7TL 3SKMB 1SPDA 3VFSA 5JW5B 2HKFL 2P5EA 2NYYC 5J89A 4M7LH 4KKLD 3IETA 3U0WL 2X38A 1U8OB 2GK0B 3QCVL 1PF3A 3B7UX 3GO1L 5AVRB 3KPRD 3MNWB 4L8BB 3O4OC 2R1WB 5EIIG 2E47A 5I0YA 4JHBA 4H8WL 4X7EC 1VFAA 3KAAA 1ZDSA 4UM8A 4AG4H 2YWZA 3VXRB 1J8HD 2X09A 4WW2F 4AW7A 3HMWL 2QGEA 5GSRA 3L4TA 1R24A 5HHXL 1WLHA 5ID1B 5DD6B 3BWAB 2G5BA 3ARFC 2VJ0A 4JKPH 1ZVYA 5FK9A 3B9KB 4R90L 1AKPA 3O6FB 4XO3A 3PJSB 2BOCB 4BUHA 4GLRI 3GXPA 3QFGA 1TZAA 1N3NA 4AYGA 3ECQA 1NIBA 3Q2VA 1QG3A 5TDPB 1ZT4A 3FQ2A 5FUCE 4YLCA 1UA6L 1DEEA 1TVBB 1XH1A 2N1TE 3MRHA 2QVMA 1BBDH 4XXDB 2F5AH 4U6XA 1DBMH 4ZYKB 4PJ7A 4UB0L 3LKPA 5E24E 3HA0A 1T0NA 3AQXA 2FSDA 5AZEH 2JK5A 4NRXA 3T0BA 5ICZB 3DO7B 2ZOLA 4JKWA 3QFJE 5FKPA 3U30B 5G55A 2F19H 1JNLL 4XCYA 4AQ1B 3SDCB 3V5DB 5DUML 1RJLA 4GH7B 4XAWL 3P2BA 2XQBL 1XZ0A 4Z78B 4XH2B 3OSVA 3DX6B 2Z31C 2X42A 2OSWA 4NN6B 2F2HA 4BELD 2K9FB 1FFPA 1SVBA 1U58A 2V3FA 3CC5B 3PNWA 4ENZA 4H1LA 4RFEA 3GMOA 2EDHA 3IVKB 2B9BA 2HTLC 4GG8B 1HOCB 3HB3C 5KSVB 3H3PL 5EEUA 1A6VH 1A8JH 3BAXA 3QCUH 4LGPB 4QUOA 4JPIB 4Q6IC 3ARED 3MV7A 2HKAA 4PJIB 5HHVL 4YHZL 2JKWA 3VFTA 4D8PB 3RGBA 5D1XB 3VFPA 4NOBA 2JCCE 1CDBA 3CU7A 3VFVB 5GGTH 5LXGH 2H9GA 3JWOH 2WZ6A 1BQRA 1UD8A 1JVKA 4GAYB 4N2EA 4B0MB 4AMXA 5HJDA 4DP9X 3ILPA 5TE6L 4M6ML 2EDLA 5T3ZD 2AK1L 2JF1A 4RNRA 2OP4L 3QIBC 3QR0A 3RY6A 2R56L 4OCWH 4J8RB 3I9PA 1KCBA 2XWCA 4MJ5B 5K9QI 2WAHA 3WAJA 2ZSVB 5AW2B 3QIWB 3T1FB 2RAMA 3JV4B 4V1DB 3ILQC 4PGDA 5INDB 2DYPB 3L9YA 4YSSA 1F4HA 3UADA 3C75A 4OQTH 2J1KA 5DFAA 3UEQA 2BHFA 2BHZA 2ZUUA 1YNKL 1DBJL 2ITDB 4LB8A 2NQCA 1NCNA 2YK1L 5D7KE 4OU3A 4EUPA 4WUKH 1QSEA 4LL1A 5C0CE 2N01B 1A7RH 1JWUA 3MX0A 4XNUL 1FNLA 5C6TH 3B7TA 3QRLA 4YBQD 3NCBB 2QELA 4IRJB 3VWJB 4PRNA 1LM8V 4X5QA 3RWJB 3L8QA 1QZNA 3IRPX 4KXAA 4KQ0A 4N22A 4JVUA 1PKOA 2FIKA 4XMZA 8PAZA 3FOLB 3K91A 3L7EA 1K8IA 4TL4A 4FAAB 4CSPA 1LWRA 1Z3RA 1KTCA 2V9TA 1JGDB 3NFPA 4ZS7H 2VC2B 3FT9A 5TFSL 3HHSB 2Q8AL 2R0WH 4HZ1A 4GAJL 3FTWA 2ENYA 3KPPA 3I02A 4WI3A 1Y6KR 4KKPA 1XF2A 4HV8A 4IRSB 1UWFA 1GW6A 1QTYT 3PDOA 5J06A 4C56A 3RZWA 3WIHA 2XXFA 1MHCA 3DJRA 2G60L 1BW8A 3E6FA 4QRBA 2J73A 2WLKA 5J7CC 1T5KA 1GSKA 4KZ0A 4DN3H 2DQGL 1AIFB 1OK8A 4JO3H 3L3OA 4YXHL 4CN6A 5KVFE 2DQCH 4PJFE 2MPAH 3S5YA 2CJSA 2EDBA 1URIA 4DGWC 2DQEL 4ODUB 2BLFA 3RVXC 4KWUA 2IWGA 4GW1B 4DKFH 5GGQH 4C4KO 4Q9QH 2DDQL 2K8MA 3QUMA 1WUZA 2BNUA 4RISL 4ZRGA 1EAOA 5D9SA 1MY7A 5DT1L 5FDWA 2VDNB 4OLZH 1T1ZB 2QQNH 5FM5M 1R5WA 2YSSB 5I1IL 1JFHA 5LAXB 1PYWB 4XC1H 4LSVH 3NEXA 4L0ZA 4XB7A 1A7NL 4ODVL 1AR1C 1NDGA 1ZY9A 3WNJA 5C0IA 2EIZA 2V9UA 5ELIA 1OP4A 4M3JA 4TYUA 1IBDA 1NGXA 1BVLB 1ZTXE 4PIBA 4ACTA 4R2GC 4HKJB 1AGBB 1DO6A 1KB5B 3VH8A 4I77H 4FNLH 2Z8WC 5H4YA 4V2BA 3L1FA 3WNNA 4GB9A 2VN7A 4PJXE 2K70A 3Q3GA 4DQOL 3U6RB 2J5WA 3FQXB 2FGZA 4Y9GA 4JFZH 5HJ3A 2ZXDA 4Y19D 4HIIB 4XVJL 3S37H 1T04B 3NSCA 5C07A 3B8SA 43CAA 1NC4D 1XSOA 3BVNB 2FL5A 3V0VB 1T7WA 4TSCH 1HE8A 1KBBA 2HWZH 4LMQI 5T1MA 2R0ZL 3SQBA 2KS0A 1DBAL 3KNBB 1M7DA 2QBWA 1C16B 3H6AA 3NIDF 3POCA 1OIOA 1IMHC 4TVPH 2WTOA 1BBJB 1U9KA 4Y1AE 2WVVB 4KTEH 5IR1A 3IRCA 3RPIA 3MV9B 1YN7B 5DD3L 2B77A 4F15C 1J1XH 2F58H 5JUEH 3IFLL 1GHFH 5FGRA 4Z23A 5EF0A 4IK6A 2IV9A 2G3NA 1KXTB 3L4YA 1N64L 4HLZH 4MCMA 3K8MA 5G5DB 5AVXB 3I74A 2HTKC 2QL1A 1J48A 2NY1B 2WQSA 4AGPA 3VGAC 4KHTH 4AV4A 3FUFA 3SKOA 1NFKA 1TJIH 5CO1A 2QPDB 2J44A 1CVRA 4YHYB 2CXKA 1FZJA 3ML9A 4G8IB 5CGYC 1T7ZA 5E00B 2P8PA 3WHXB 4Y1TA 4ZTEA 2ODIA 3FU6A 1KXQA 3JTTB 1WDAA 4WNJA 2WWKT 4A7VA 2ZWZA 3ARYA 4P9ML 1Q1JL 1OGAE 3PXJA 3QJSB 2CLVB 3RPBA 3BP6A 3CDFA 4B97A 5C9JB 1BD2B 2OI9C 3COOA 1EXGA 4LSQH 4ABWA 4G80B 1CGUA 1E5CA 4FRWA 1MF2L 1ILSA 3UZEC 3QJQB 4X0KA 2CBMA 3QUZB 3AM8A 2GTZA 4ZOEA 2DYSB 4LKXB 4XPAL 5AW1B 4U7SA 3OKOA 1IL1B 4LL9A 5FCSH 4YMPA 2W38A 4FP8H 3LZRA 1X6NA 3K8KA 3IE9A 5C0AD 3GLZA 1DEDA 5CJQL 5ESVA 5D2LB 4GI6A 3IU3A 5EO9B 1Z3GH 4N0CD 1JV5B 5H37H 3GHEH 43C9A 1RZ7H 5IZ7A 5GGRY 4JFVA 3UMNA 3ZDZE 3BQUB 1F4XH 3WNMA 3CX5J 2H2SD 2AFNA 2A77L 2BFVH 3FUKA 1BVKA 2N7SA 4YE0A 3KPTA 4UTBL 5F2FA 3EG9A 2H1LM 3T0XA 1BFVH 2VLJB 2EE3A 3TIDA 1MDAA 4WK4B 3ARGB 4XP9L 5IG7B 4KU1A 3QJXA 4PB0L 3SDAB 1TQUA 3LNGA 4HXBH 4CKQA 3K71B 2VE6A 2A74B 5JOPD 5F6HJ 3N0PB 3SBRA 4NQEE 1KLUB 4TLTA 2CGRH 3B9VA 1MFBH 4PR5A 3K72B 5C71A 3N1GC 4WJ5B 3V6OA 2EYRB 1BF5A 1OPOA 1YEKH 2Z7WA 4NFCA 3ZJAA 1Z5LB 3H42L 2DWDA 1G1OA 2WNKA 3CWGA 5IQ9B 5IFJA 1S3KH 5I71B 2F54D 4GBXA 5DR5H 4JN1L 2BIPA 4A6YH 3L5XH 4RETB 5E2JA 3JWNE 3K4ZA 2N0KA 5MERB 2EILB 3ABZA 4JG0L 4QRRE 1BZQK 1E8ZA 4KNUA 3ZY7A 2AEQL 1UGKA 2Y25A 5CN3A 2DEWX 1FH5L 2CDFA 2G0LA 4ZQKA 4X6EB 3HUJE 3AXLB 4H88L 4ZUWB 2JCCA 4YWGH 2WNWA 4BZ1L 3S36X 1VKXB 5F7EH 2BRQA 3SDXF 3CDZA 4GSDL 4OZGF 2DF3A 1IBGH 3KCWA 5T5NF 1XIWA 5FYJD 2IXQA 1K8DA 3OKMB 3EAKA 5F7DA 4PS8A 3HC4H 4HWEH 3QJFA 3P3YA 5IQNA 1I1FB 1LO3H 1VF5C 3RJOA 2HSIA 3BI9X 1F4WL 1AOHA 3DIFB 3W0WA 3CG8A 4JVPA 3ULUE 1DQMH 1KPRB 3KM2A 5CEYA 2RACA 4KXBA 5F1NB 1E43A 3BGMA 1JPTL 3UTSD 3V4LA 4NJ9L 1A5FH 2J88L 3RTQD 1SXBA 1C7TA 2R69H 1AI1H 1XF4B 1YMMD 1YEDB 2IH8A 3IGFA 5F9OL 3IDJA 5C0CA 4Y5VB 2BZ7A 2AK4E 2IAND 4UAOC 4J3OC 3UPRA 2IC2A 4JN2A 1JJUA 1T5XB 5FECB 1J9TA 4HWBL 3BIKA 4N8CL 4HBCL 5JQ6H 2EDTA 5K59E 4ZTPH 5DK2B 5LQBL 3KXFB 1A1NB 3UERA 4K71C 1OARL 5M95B 2LFGA 4TOYH 4NO2B 1NBZB 2BS71 4MJ4A 5GGSB 4MJIE 2TSBA 3P73B 5FB8B 5CJ8A 3BPLB 3EJUA 2FWOA 3TU6A 1E67A 2HKFH 4Y8DC 5AYTA 3KYOA 1ZD6A 2OQJB 2XICA 1QI3A 3U0WH 2YUZA 4FCHA 4N0FB 3GO1H 4U7KA 3WIIL 4FQQB 5KVDL 4JM2C 1N59B 3F7VA 3Q1SL 5F7UA 4HJ0C 4H8WH 4XX5A 3RZCD 5FM8A 2EIBA 4BFEA 3HMWH 3O2VH 2JLPA 1Q8MA 4QT5A 5F3HA 2V2WB 1YPZA 1OTTC 2A6JB 4KKBC 4N90D 2W9LA 1GOGA 4JRYB 4EDWL 4L4VD 4WFHD 1KIUA 5DEZA 3SGKC 4FNTA 1KGCD 1R47A 4PJFA 2FBOJ 4X99A 5IKCA 4S1RL 1JPGA 3VA2C 1DO5A 4ONFL 1Z9NA 2D9CA 4R4NC 3E38A 4X4ME 5FA3A 4A66A 2MIZA 3BZ4A 2GABA 1UA6H 4LO9A 1A7BA 1OSZA 3M17B 4EPSA 3EADA 3BPOC 1I4FA 3GUFA 1LTXA 4XTRC 1GZPA 2F7IA 5KYYA 4OM0L 1N68A 1WS8A 3DUSB 4KJYB 4UB0H 2Z7ZA 4LCCA 3ZKMC 3U6XA 4NIKB 3WUWA 4FFYL 1H5BA 2AQSA 4KDVA 4LCUA 1JNLH 3N41B 4L9DA 3ZTJG 5DQ9B 5DUPH 1EAQA 5DUMH 3ZUNC 1KTKE 1TU2A 2HT3C 5F7FA 4UOZA 4AEIH 2XQBH 3SY6A 3FNKA 4G7RB 1Q9WB 2CIKB 1XEDA 4ECNA 3D4YA 4OSUH 4ZQTA 4NRZB 2PP8A 5GISL 1F6AB 1JZ2A 2E6PA 1IM9D 4NQQA 4HULB 2B1HL 2IIJA 3QZMA 5I73B 1HILA 3FH7A 3RDTA 3ARBA 5F88B 3TA3C 3N43B 4PJXA 3WXVL 1J7VR 3AAZA 3Q44A 3H3PH 2H3NB 3A24A 1RZKL 4JJ5B 4DVBB 1K4CA 3D25B 2NXZB 4M4PA 4MS6A 1M2VB 2EP6A 3NIGE 3UIZA 1TJMA 3ABGA 4G1EB 5CLZA 2GYSA 5HHVH 4Z9KB 3NDYE 3PWVB 3GSOA 2PPDA 4PJAE 1ZOXA 2XWBB 2Z64C 3VI4F 2M8XA 5JR1L 5DS2A 4P2QE 4FQXD 1QFOA 2BY2A 4HOXA 4I13B 1I8LC 3JVGA 4MD0B 3V52L 5E6RB 1W16A 5ANME 3O3EA 4HKZB 2NTSP 1QI5A 4HFUL 3C60B 4NYLB 3DBXB 2XV2A 1E5AA 1EXUA 4H7VA 1UZ6F 4JKMA 5D4QA 3HE7C 3QT2A 3UBHA 3WLWD 2OP4H 2W07B 2R56H 1XB6A 1TITA 5GRVL 4XWGL 4TTGA 3C5JB 5CZVL 1XR9B 1AC0A 3TNNA 5K9KA 4JMNA 4GRWB 2FSEB 1VGEL 5H94A 3OQRA 5JHLL 1UD3A 2CIIA 2J8OA 1TQWA 3IK2A 3I3DA 2M2DA 3IM1A 3QORD 3RVWD 2XWXA 1YNKH 1DBJH 1FFOA 3FTVA 3U4AA 1JGVH 3HVDA 2YK1H 3PQYB 2XRAL 5T1KD 1CDHA 1F3RB 2WBWB 1GW0A 1NGQH 4BQ8A 4CVWA 2GG1A 1OGAA 3QXVA 3ULVD 4PRHA 3HNTL 1JTOA 4I1RA 1MVUA 2I5YL 4UDUA 4JDVB 1EGJL 1UZ8A 3ARUA 3M7OA 5L2KB 3BDYL 3VH8G 1JNNL 4HIJB 2CNYA 3V4PL 1NOLA 1PZ5B 1NZRA 1RUAH 4HH9B 5IW1B 5J13B 4MD5B 1Z6JT 1N26A 4J3OF 5A16B 3S2AA 1D6VL 4DZ8A 2A4EA 3VFWB 4EN3C 2XA3A 1QYGH 3I9IA 1EV2E 1UJTA 2GK2A 3EJYD 4JFFA 3JT0A 2XIDA 4P57A 4TLSA 4JE4B 3SCMC 1NBYA 5J57B 3KW8A 3MMEA 5TFSH 2E7LA 2YZ1A 4Y88A 3ARPA 3CZEA 2Q8AH 1S8DB 2BO0A 4TMPA 3SBQA 5CFHA 1VFAB 3EO0A 2WVTA 4O5LH 3TPUB 1SJXA 1EWHA 3S3DB 3QDMD 5JNYA 4GJTB 4LVNC 1S7TA 4MHHG 3REWA 4ZMYA 2RMNA 1EQWA 4AL8C 5T1LB 3Q8CA 2ZOTA 3PHSA 5L0QB 1MJJB 2G60H 1KT2B 4L1TA 1WZMA 4JM2F 4JM0A 1IM3D 1CFSA 4N2OA 2FJFA 4XMWA 2DQGH 3ZR6A 1PCSA 4YAQA 1M53A 2I26N 3JYBA 1NKRA 3KGRA 2AJUL 2DQEH 3UYPA 1TZHA 1ROWA 2ZONA 4FMFA 3FUHA 5DQDL 2LLLA 3MV01 5GRUH 5HPMA 2ZUWA 1ZE3C 2ITCA 3O0LA 1CE1L 2DDQH 1O7VA 3QDGD 4ZT1A 5AUMA 2P8LA 2X28A 2AXHA 4NQEA 3T0AA 1FRGH 4RISH 5DT1H 4J4PA 4OCSL 4WGVB 1RZGB 3E9TA 2DM7A 2FLRT 5I1IH 4XXCA 1T21B 3TBWA 5DEGA 2FIRT 5B21A 3U9PL 3P2TA 1KGUA 1NLBL 5B38A 2EVHA 5FEBA 5FKPB 3FW6A 3T2QA 2DY2A 3B2XA 2WSKA 2CSPA 3VX1A 1A4CA 2J5LB 4AZ8A 1ANUA 1FG2A 1PZCA 1F8TH 1HH6B 1I3RB 3TBSB 2AZUA 3DJ9A 4P5TC 4QRRA 4KH9A 2GW5A 1JGLL 3Q8BA 4JRLA 3OHXA 4XZ4A 4OLXL 4H1LB 1JYNA 3GMOB 4A37A 5D71L 4HWUA 4FKKA 2ZKMX 5EEXA 5IW3A 3LEXA 2CKBH 1CMOA 5DYOA 2ATPA 4BFOA 3ESNA 4OCRL 2CLZA 2BRRL 2VC2L 4OFPA 7TAAA 3FL7A 2IADB 4DQOH 2V2XB 4JFDA 3MRQA 2PPEA 2UVEA 4DUWA 2BVQB 5ESQA 3CXHJ 4KJWC 2B5IB 1D6EB 1JGEA 3KYAA 4XVJH 4CW1B 1ACXA 2PTTA 3G5ZB 2OZNA 4X4XA 3VFTB 1SDYA 2NY5C 4UI2A 3AABA 2VMCA 2K4WA 1SJMA 1WGVA 2Z4QA 4O2CB 1DBAH 5FCUL 5D1QC 3DUHA 3VACA 1U93A 1KXVC 1NFDE 3QEQD 4Y19E 4DF9A 3LXBA 5AB1A 3CFDB 5CP3H 2EC9U 1HHHA 1N19A 5DD3H 4MMXA 4NKMA 3F8UB 2XQYK 3E8VA 4K5LA 4QRAA 4W6WB 1H8OA 1MY5A 1MW0A 1QX1A 3V8OA 5JXEC 5C0JA 1GYAA 1WCBA 4P23D 2JIXD 1U2YA 4D9RD 2GEQA 4MDIA 3GS7A 3UPCA 2NY5L 1CZ8L 2P9RA 4IBQA 1SHMA 3TPKA 3IDNB 5B39B 2X05A 2AK4A 3SDDC 2LLNA 1O9VA 4QHKI 3R18A 2GSGA 2F8XC 4A2HA 4KAQL 1E4JA 4EI6B 3DURA 4OJFH 4MJIA 3W2DL 3T5WA 1FCGA 3GTTA 5FF6B 1WFNA 4P9MH 1N7ML 1Q1JH 1S4IA 1GOHA 4LFHD 3V7AG 5KEZA 4UILL 1HCVA 3TCTA 1WJ3A 2YLKA 5MEPA 3VXMA 2CJTA 2VDPH 3CBJB 4NCC2 3NCYS 1FNSH 3S4SG 1IGML 4FG2A 2WQUA 4FQCL 4U1KB 5IEKA 1RFDH 4PJHB 2BWQA 3QDHA 1KY6A 3EGSB 3CZKA 2C9SA 1Q38A 4YO0A 4ABQA 3TESA 5J5EA 2ZX6A 1L0QA 3KS0H 3KPRA 1FHNA 5AAWC 4XPAH 1ZHNB 1WQVT 2PWHA 4F2ME 1YDPB 3DOSB 4IOFD 1NKOA 1HXYA 3ASWA 3EJPA 1F97A 2HKHH 3CSTA 3S7GA 1J8HA 1W8OA 3QYCA 1J86A 1SBSL 5DLLA 4XB8A 5MEOB 3AY4A 5IW6A 4E9RA 2DMBA 4LRIA 3V10A 3F64A 2GIYA 4M7ZB 1INDL 2DJUA 3RVTC 4BZ2A 1ULVA 4MMZC 1UZGA 3KH4A 4LRNH 4MMYA 3HAEH 4UTBH 1TTFA 4ENEC 4ZPTB 3LZFL 4XP9H 1S46A 1RZ8B 3EH3B 3ZKNC 1GYUA 1NIAA 3QC6X 4F33A 4B5EA 3B56A 2XYCA 5IFHH 2QR0A 3QO1B 3DHMA 3GHPA 2APXA 2VLME 3N9GH 3O45A 4XOBA 5DHVA 3U4KA 3VFOA 1XGUA 4D8OA 5HSFA 3H42H 5JOPE 4ANVA 4G42B 1WT5A 5I5IA 3TGXA 2DN7A 2R29A 4TF4A 5PCYA 1YEIH 2XTJD 3QNYA 1KN4H 3A4EA 5FW6A 3KWTA 1DCLA 3HPLB 4TSAL 1ASOA 1CUOA 5TPWL 1XGRB 4A63A 4NP4L 1PG7X 2F54E 2AEQH 2LU5A 4WJKB 1X3DA 1IQWL 5KS9F 1RHFA 2A9NH 1FH5H 2IDSA 3U9UA 5AENA 2N0MA 4U6VL 3HZKB 4PJAA 1EZLA 4Z7UB 4ELME 3C08H 4H88H 4P2QA 1QEWA 5KSBB 4WKXA 1CXFA 1OT4A 3INUH 3L6FB 3LKNA 5E9DD 4BK5A 3AREA 1IGIH 3QI9C 1E40A 3BOVA 5KSUA 5T1MB 3DC0A 5JLZB 5CZXC 1E5ZA 2V2TA 3VI3E 2VT0A 5DJZB 1ASPA 1UD5A 3F6LA 2N7BA 1CG9B 4GFTB 1XH3A 4H26B 2OX5B 4XP6H 1F4WH 2WLNA 5FYJE 1AS6A 3CD4A 3X1NA 4R0LA 2BSDA 2FO1A 2OW6A 2OL3L 3UZQB 1SGKA 4M4RA 3B2UD 1PX4A 2ERJC 3PWUB 4NJ9H 1RVFL 1E9QA 5BQDA 1G6VK 2WC7A 2J88H 3LX9A 5MENB 5FO9A 3B2VL 3WUWG 5CEZL 4JHZA 3WEXB 5F9OH 1E2VA 3BN9C 4NGHH 1NMBH 4NUMA 1F4AA 3A4AA 3VRLE 2OTPA 3ZGHA 5KSAD 4FQIL 3CIAA 1N4XL 1CICC 4JJOA 5C2UB 2WXRA 4QRPD 1KV7A 2R59A 4N8CH 3C6LD 4HBCH 1P7QD 5LQBH 2X4OA 5I16B 1IAKA 1OARH 3GDCA 3LKSB 1FZOB 4HCGA 4PWIA 4UAHA 2WWNA 1ZV9A 1TZ8A 2C7FA 2CKBB 5FGBA 5IJKA 1A4JB 1AXSB 5IY5B 3H53A 3ZBMA 1Z0NA 1HEHC 1J5DA 1CL7H 1J88A 1ZPUA 4AT6A 4NNYB 4F7TA 5DZLA 2W94A 4J3OH 3WIIH 4U1IA 5LGKA 3GEFA 1JPSL 2Z34A 3Q1SH 3DXAE 1X9QA 4M8UA 3QJHA 1A3RL 4WNQB 5E4AA 4X7SL 3VFRB 1BLNA 5AB0A 2LAAA 1OCZB 2BJMH 5B7FA 2YOCA 5BJTA 4LP4A 4CMMA 5FUOL 4AKPA 1B3JA 3ROOA 2WYZA 4KXCA 3TIEA 3QXDA 3IJ8A 5HHOB 3H2QA 4HDIB 5A3ID 2WCPA 4MA8L 2VABB 3L3IA 2Y0SA 4P3DB 5CILL 4JFEE 1QWUA 3P3TA 4S1RH 4YLBA 2WP3T 1TQCB 4ONFH 1MCNA 4L4VE 4WFHE 2E4TA 4WO4C 1L9RA 1OAKH 3VRIA 4ADJA 5IQ7L 3WEBA 3CSGA 1S3RA 2A6IB 2BIHA