3KBFA

C. elegans cu,zn superoxide dismutase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
b'SNRAVAVLRGETVTGTIWITQKSENDQAVIEGEIKGLTPGLHGFHVHQYGDSTNGCISAGPHFNPFGKTHGGPKSEIRHVGDLGNVEAGADGVAKIKLTDTLVTLYGPNTVVGRSMVVHAGQDDLGEGVGDKAEESKKTGNAGARAACGVIALAAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title X-ray Crystal Structure of C. elegans Cu,Zn Superoxide Dismutase
rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
total genus 41
structure length 156
sequence length 156
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3kbfA00
2ZKYA 1DO5A 1E9QA 1EJ8A 1SDAB 4MCMA 2XJKA 2AQPA 1N19A 1P1VA 1SXBA 4BD4A 5KBMA 3L9YA 2K4WA 2WZ0A 3GQFA 1HL5A 2AQNA 1E9PA 2WWNA 2WYTA 2AQQA 1SXSA 3H2PA 2GBTA 1E9OB 4OJAA 5KBLA 1JK9B 4BCZA 1JCVA 2R27A 1COBA 1QUPA 3RE0A 1YAZA 1HL4A 1U3NA 3QQDB 3KBFA 4A7VA 3HFFA 1B4TA 1F18A 4BCYA 3GZOA 1TO4A 1E9QB 3ECUA 1SOSA 1SXAA 1SXCA 3GTTA 3HW7A 2WYZA 1Q0EA 2AQTA 3HOGA 1IBDA 1ESOA 1CB4A 2WKOF 2GBUA 1MFMA 2AQSA 2VR8A 1RK7A 2V0AA 2ZKWA 4FF9A 1OALA 3MNDA 1E9PB 1SXZA 2VR7A 3PU7A 2C9VA 2LU5A 4OH2A 2JCWA 2AF2A 4A7SA 4N3TA 2JLPA 2VR6A 4A7QA 1PTZA 2AQRA 1UXLA 1TO5A 5KBKA 3ECVA 1BZOA 1Z9NA 1OEZW 1S4IA 1SDYA 1JK9A 4A7GA 2WZ6A 5CU9A 1XTMA 1FUNA 1SXNA 3GZPA 3KH3A 1PU0A 1EQWA 1IBFA 2APSA 1BA9A 2SODB 1SPDA 3GTVA 1DSWA 4U4IA 1IB5A 3KM2A 1F1DA 1OZUA 3MKGA 2ZOWA 3T5WA 4A7UA 3CE1A 1UXMA 1N18A 1XTLA 1CBJA 2E47A 1IBHA 3KM1A 3KBEA 4A7TA 2Z7ZA 4MCNA 3SODB 1YSOA 2Z7UA 3F7LA 3K91A 1PZSA 2AEOA 1F1GA 2Q2LA 4B3EA 2E46A 3ECWA 3S0PA 2WKOA 4A7GF 1E9OA 1OZTG 3CQQA 2C9SA 2NNXA 2ZKXA 1L3NA 2C9UA 3F7KA 2Z7WA 4L05A 1SRDA 2XJLA 3QQDA 3CQPA 1YAIA 2GBVA 1XSOA 2Z7YA 2WZ5A 3H2QA 1KMGA 3GZQA 1Z9PA 3KH4A 1IBBA 2WWOA 1AZVA 3LTVA 1F1AA 1OAJA 1B4LA 3L9EA 4N3UA
chains in the Genus database with same CATH superfamily
4GAFB 2HKHL 3GSUB 4YPJA 5ECGA 1KZYA 2OMTB 3LN5B 3ES6B 5HGAB 5KJ4A 3UTZB 2P5ED 4W9GC 2QQQA 1J05B 4ZS6C 3T2NH 3VXMA 3ZTEA 3U6RB 2QPFA 1HIML 1QO3A 1U8KB 4TQEL 3UG5A 1YEJH 4JFHD 4IBYA 4TULH 4DGYH 1DDTA 1IKNA 4NQDB 3KDMA 1BHGA 3F6JA 3OKMB 5TQ0H 2PR4H 3SE4A 3ZE2F 1JCVA 1EVUA 5HHOB 4OV5B 3JWNE 2CMRH 1PG7H 5LXGL 1HU8A 3FH5A 3I3DA 5CEZL 2DBJA 5D1QB 4J3OF 1A9VA 3V0FA 1CLYH 1WZ1H 3QDJB 5EU7C 4KK9D 3FU8A 3KWWA 3KJ4C 4MHHI 5JDJA 1AOZA 5TE7H 2VXUL 3MCKB 4AT6A 1JPEA 3CN2A 2X3CA 3BKCL 2XBTA 4AE1A 3REVB 5DK0A 3GSXB 2YUWA 1AI1L 3IDXL 2WKOF 4FP8L 4R5VA 3U4BH 1FO0A 1KYFA 2A83B 2RCSL 3ZHLA 1CURA 4XP9H 2HXAA 3PWUB 4MQ7A 5C0CB 4EKXA 4GKSB 1S46A 2O6DA 3PFQA 4MS8C 3OL2A 5BCAA 3LRMA 5ICZA 5DYFA 3QDAA 1AXSB 3LZOA 4M7LL 2VERN 4O2FA 4WGVB 5D5MF 3K6FA 5DS2A 4J3WA 4P46A 2Y1VA 3ULSB 3MRMB 4XMKL 2XKNA 4LO9A 2QQNH 3WIHL 1T2XA 2Y69B 3QEGL 2Q5BA 1SEBB 2AEQH 5C0JB 3OKOA 3KR3L 4NQTA 1JMZA 3ASWA 1JZJA 4OM1L 4OCLC 3WFHB 5E4OA 2VE6A 1OSPL 2G4GA 1FGNH 1T5KA 2ZPKH 3GSOA 1SYSA 3MYZA 1BBJA 3VYOA 4JFEE 3MLWL 1DVFC 2JCCB 1M4KA 1TMCB 2H6PB 3L5HA 1NL0L 4HJTA 3SQBA 2XVBA 5I6LA 3V0VB 4U0QB 4UM8A 1W16A 5EZLB 2DS4A 5GGVH 4RMQA 2BH0A 3WFBL 2YGOA 1ONQB 3PWLB 4GBXC 1B9ZA 3PJSB 4Z7OE 4JB9H 3X14A 1EO8H 3KPQB 1I1FB 5CSZB 1YMHA 4C59B 1NLBL 4P8QA 5J3HD 3F7YA 4LCCA 3H0TB 4JRYA 3CN4A 2ZSWA 1OHQA 2NY0C 2VDMH 4X80L 1ZOXA 4PJ6A 1IU1A 3I84A 5IK3A 2PO6A 5KS9F 4AIEA 3SZKC 5E1HB 3QRGH 2ICEA 3K5RA 3DUSB 3DBSA 1FFOA 2HN7A 2XHNA 4N2NA 2NY7H 3QJOA 2XZQH 4YX2L 4N8VG 4P0DA 3OAUL 4NKIL 5A2FA 4JRXE 4A2FA 1QMUA 4C56D 2WYTA 5H37A 4M6OL 1RUKH 3UBHA 5HD8C 1T20B 2CGRH 4N8VB 5A6IA 1KEGH 1YEHL 4HWEL 3BFQG 2D7TL 1PKQA 3KYMB 3IDYB 3QIUA 1FNAA 1BOYA 1K8DB 2NTFA 3EJTA 4N2LA 3FOLB 3MR9B 2EVGA 2KLTA 1Y1DA 5I19H 3EF7A 2FK9A 2ID5A 4L48A 1JFQL 5JIIA 3K7UA 2WQAA 4JG0H 2J5WA 3KXFA 1T03H 5IEKA 3FU6A 1T21B 2FHBA 2YMXL 3CLFH 5KSUA 2XU9A 1EA9C 4I77H 1MFMA 1MFEL 3QUXD 3SY6A 4LVHB 4H13C 1BD2B 4JEGB 5LLIC 4J8QA 4UDTA 4D9RE 4M43L 1ZLSL 4Y9FA 2N1KA 4Y2DB 2B9AA 2IC2A 3NABH 1T0NA 4NQEA 3W2DH 4FQJH 4FQ1H 4ZX6A 2R15A 3NPSC 4UTAL 2FEEL 5ERWA 1XAUA 1HNYA 1SM3H 3TPKA 2OK0L 3FO0H 4O4YH 3ETBJ 1QFHA 3HZKA 4XCEA 1E90A 4G9FA 5L8LB 4FQHA 3CZFB 1USQA 1SNRA 2NY6D 5SWZA 3WN6A 4MNQD 2X4SA 1IVTA 1CICD 2VXQA 4BDVB 2HRHA 4M00A 1KJ3L 4PJFB 4HUXA 4XI5C 1V7MH 1KZQA 4Y5YB 3VD1A 3FS9A 1YEEL 5FEBA 5IVXA 1D5IH 3DX7B 5L88L 1CIDA 5SWZE 5T1DH 3SKOB 1L6XA 5K9QI 4FFWD 3LJ3A 3QZLA 4WGWB 1E3FA 3T8VA 3VXPB 1QRND 5SX4I 3UTPE 4G6MH 5I17A 2NY1B 1V27A 3TIEB 3BO8A 3LKQA 4YHNA 4U2YA 5BVJA 4N8CL 1D9KC 2VLJE 2W0PA 4JFPB 5TPWH 4QXTB 4GAJL 1U8LA 2YK1H 5AW4B 3CC5A 2SEBA 3L3GB 4FMVA 1RP9A 2XA8H 4L8SC 3RKDD 2EIZB 3DOIA 4I9WE 5KSVB 3WS6A 4PV8A 1YY9C 1VFBB 5EUOF 1X5AA 3FXIC 4JDTH 4R7XA 2J21A 4PJDE 5C09B 5C0GB 2AFNA 3T2NL 2AK4A 3WUWB 2W9DH 2NZ1A 2OX5B 4QHMB 1MCCA 4N2KA 1YEJL 3BSGA 3KLHD 5I1HH 3RWEA 4B53A 2RFXB 4DGYL 5IFAH 4OLXH 4HUVA 3QI9B 3JV6B 1SJHB 5LB1A 1ZIBA 5FW6A 3QDHA 2EABA 2W60B 2PR4L 3TTSA 4OZGA 1GY1A 1EJOH 1SZNA 3WEXA 2CMRL 1CVRA 1JNHA 2QGDA 1DZ0A 1PG7L 1JF5A 3S37X 1SLUA 3SSGA 1CLYL 2WAHA 4JQVA 3IRPX 3P3UA 4Z7AA 1VB9A 2XKUA 5TE7L 2ADIA 2KLSA 3HR6A 2ZCZA 4U3SA 1T7ZA 1Z9MA 3GSUA 2NY4D 2OZNA 3VFTB 4G82A 2OMTA 3QCTH 5HGAA 5TH2B 2E27L 2VZ3A 3U4BL 3UTZA 1J05A 2VC2B 2M26A 2WLKA 4XAKD 4XP9L 4P5SA 3ROLB 1NAMH 2VR6A 2Q1EA 1C5DA 5FYLH 2F5BH 3SPHA 5K9OB 1MDTA 5DHDA 2VN3A 2E86A 2R29H 3ZL1A 3H9YA 1RJCA 3S3CB 1JUFA 1ZSDB 3RVTC 3NQKA 2QQNL 4FNRA 5ECJE 3UAEA 2CHZA 5D1QA 2AEQL 2AC0A 5FHAH 1WWCA 1OP5H 2OQJB 1ZS2A 1P5VB 3BEVB 4OZIA 5MP6H 1DVYA 1NUNB 5IQ7L 4FTDA 5I8EB 4POUB 4ZFFB 3T65B 4BIKA 4U3XA 3ARBA 1UD6A 4GRMA 1FGNL 3B3IA 2ZPKL 5AVTB 2Q0ZX 4N0FB 4WI7A 5E0FA 3VTMA 3X11B 4U6YB 2A83A 4I5BA 5LCVA 5BUGA 3V55A 4NP9A 5IW3A 2MPAH 1AXSA 3KMDA 4Q6IA 3VFOA 4YHYB 2BZ7A 5GGVL 3X1NA 4FTVB 2VXVH 3BUYA 4K7PX 1FWXA 3WIAA 4QRBA 3MHZA 1E28B 3IMTA 5F9OH 4JB9L 5KN5B 1EO8L 5EUKA 3I6SA 3NDZE 2ATPA 4BFIA 5D2LB 4M7ZC 1F2QA 2X88A 5EIQA 1UWFA 4GW1A 1WAPA 1Y18A 2VDML 5E9AA 4ZQTA 4G6KH 5DQ9B 3WMQA 1F8TH 2VKXA 4ZS6D 1HXKA 2ZAIA 3C87A 4BH7B 1T7XA 4QHPA 3VD9A 1WFIA 3NIDF 2RIKA 3QRGL 4PJBF 3QYNA 4YXHH 12E8L 2NY7L 2XZQL 4DUVA 2PUQT 5DURB 4U6TA 5E4EB 1EZVY 3RI5K 5BZWB 1YYLH 2OCJA 1YEWA 2CGRL 4BCYA 3UH8A 3I9PA 1KEGL 3PWLA 2FBRA 1HEZA 3KGRA 3F58H 5CWSA 1MY5A 4EI0A 2FWUA 2Q3XA 2AQ2A 1YNLH 2J8HA 4R4FH 5I19L 5MI0C 4W9FC 3U4EB 4KDTC 2WXGA 3HUJB 4KV5F 4JG0L 4Z3GA 1T03L 3FAWA 4PJ7A 1IKOP 1DBBL 5E8OB 2NOYA 2ZWLT 5CFAA 2LE9A 4TUKH 3CLFL 2NDFA 3TYGH 1P4BL 2E74C 3DUUA 3NEOA 1SVBA 4I77L 3BPOC 3FTWA 4I85A 1Q94A 4X4YA 4BQ6A 3IU3B 4LFHG 2NW2A 3PV7A 4HGMA 2BNRD 2BRRH 3CVHB 5J6HB 1PQZA 4PTTB 3GXNA 1MCWW 1SLXA 2LHAA 5E9DD 2DWDB 1L5GA 1T20A 4JVWA 5HHMD 3E3QC 1KIRB 2RBLA 3DWTA 2H45A 3L2NA 2YA0A 4MYPA 5T1KB 4PP1D 3NABL 1MWAL 1NCIA 4OI8A 3W2DL 4FQJL 2WP3O 4FQ1L 5DS1A 4YDLB 2C9XA 5HGBA 3QJQB 3JWDH 4NRZB 4NKOB 4HJUA 4PS4H 1OZUA 3T3PE 1SM3L 4PBXA 3FO0L 4XCYB 2CKNA 4HJJH 4O4YL 5TDNB 4WUKH 3SE9H 4D0DB 4JR9H 1L4IA 5D4IA 1F56A 4J6IA 3BVNA 3O0RL 4Z7QB 1SYVB 5HVGB 3S96B 4ZD3H 1FJ1B 2KPNA 3O45B 3QJXA 4X6CF 2XQ0A 1HC1A 2EDRA 3CVBA 1V7ML 2AJVH 4GRLC 3QEQA 5EOTB 3RLSA 4D0BB 3D6GA 2NT1A 4LAQH 1CT8A 1AD0B 1OQOA 5AOMA 5I30H 1D5IL 5KSAB 5T1DL 4GBXD 4P3DB 4IIQB 2AEPH 1GKOA 4HISA 3TFKC 2NY0D 5BRZD 2VOTA 3NSXA 2H2PD 5CKGA 1FFNB 5ICXA 3WCYA 4MB5A 2XIDA 2XV6B 5CMAB 4BINA 3BISA 3IPBA 5MERA 1JZ8A 3S7GA 4BD4A 3PHSA 1J12A 4G72B 2AXJA 4HJ0C 3SPVA 1IAKB 5TPWL 2BW5A 4N0UA 3CH1B 2V5RA 4PRID 2X53A 4TUUA 2YK1L 3UDWA 1PW3A 1UJ3C 5LGJB 3VG9B 2E3VA 3AG4B 4KXBA 2XA8L 5HDBB 3ZL2A 4QRAA 4RAVA 3RTQC 5HD8D 3POCA 3JV4A 7PAZA 5E2JA 4JDTL 4J28A 2V5SA 3WD5L 3QWQB 1U4EA 4KOCA 5IJDC 3IN2A 1KIPB 1T6VN 1AQKH 2GTZB 3MNWA 2W9DL 4PWEA 5BXFA 2BVTA 4PGCA 3PXHA 2DQTH 4AYMC 5I1HL 4M1GH 3LN9A 1R3KA 1IKFH 4GQ9H 5IFAL 4OLXL 2YARA 2F5AH 3OXSA 3VX0A 3CLWA 1FVEB 3BT2H 4H1LG 2CUMA 5BQ7A 1EUTA 1EJOL 1VIWA 2QDWA 3QQNA 5ENWB 1QLFA 3WTTA 4PY7A 1UJTA 4H1LB 1K6QH 1JXKA 1CF1A 2W0LA 4FLHA 5I6NA 1ZLWH 1KGJA 3AB0B 3EJRA 3NCBB 4JKWA 4JO8A 1QSEA 3WEMA 1ZTXE 2VABA 1ECYA 5CNHA 3EYFA 1EFXD 4J1UB 4CDGC 5KSVA 1W8OA 1YMMD 3OVUB 3X1EA 1KC5H 3IMVA 3QCTL 1KULA 2DQJH 5C09A 1BZOA 4JG9A 3WUWA 3P69A 1BLIA 4L29A 4MNHB 1R3LB 2P24A 5CBAB 5EBLA 2EACA 2XWBB 5FECA 5KAQG 1NAML 1JAEA 5DI8B 2O6EA 5KSBB 3JVFC 5FYLL 2F5BL 1M1XB 1C5BH 4HCRH 4EOWH 3II1A 3TNNB 1P1ZA 1D2OA 1N2RA 3IDJB 4XPHH 5IKCB 2R29L 3GIVA 3SEPA 1A5FH 2R9HC 4MQSB 2E47A 1IBHA 4MQXD 3QR0A 1D5XB 1S5IH 2J1KA 1ZSHA 2QFPA 5GJSH 5D1ZC 3UIZA 5I24A 5FHAL 5C07E 4GT0A 4HF5H 5EFIB 1GS8A 4MA8H 5MP6L 5MEPB 2VLKB 4CC1A 2ZF9A 5IJVA 1E3ZA 1W72A 1BVKA 1FNGB 2JELH 4KY1H 3IJYA 2NX5E 4DN3H 5CIPB 3JWDC 2ZOKB 4X8GA 3GZQA 4WSKA 4YHZH 2ZXBA 1BYOA 3ROLA 4ANUA 1ETZA 4ZMWA 5LBGA 2X6UA 3ET9F 4JY6B 2K45A 3KPRB 4N3UA 2MPAL 1SDAB 5HTSA 4PGDA 3OG6B 4XN9A 4UV7H 4ZUVA 4GY4A 3IDNB 3CIQA 2VXVL 3SPGA 4K2UH 4FOMA 3TCTA 3QQ9C 3GMNA 4J3VA 3RUGF 5F9OL 1S78D 4TMPA 5KBMA 3P9LB 3MV9A 4OLUH 4PU2A 3PP3H 1P5VA 1ES0B 4R7VA 5DVKA 1YY9D 3IK2A 3ATEA 3RPKA 4NZTH 4G6KL 3G08B 1YN6A 1F8TL 3WY4A 2WTOA 3T65A 2W07A 3VWJA 4DT2A 5FW7A 3Q6GH 3BVUA 4ZFFA 3II3A 1U3NA 2XNAB 3ARWA 1REIA 1I8LC 1DCEA 4P05A 2QADB 4N0FA 3X11A 1B4TA 4FXGC 2VQ1B 4YXHL 4U6YA 3TOPA 4EUPA 4A68A 6CGTA 1Z9OA 4JFTA 3VXUD 3MGAA 5AKVA 3RQ3A 3V6OA 3AROA 1RJZA 3WIFB 4OF5A 4MKMA 3BIKA 4QDGA 2F53E 1NC4D 2DEWX 2R69A 4Z95H 2VLMD 3FULA 1NDGA 3BJ91 2XXCB 2KZWA 2Z31C 1CGXA 3T8XB 1LE5B 1G7JB 4Y19A 4CMHC 2E7DA 4OCMC 2VR8A 4HU8A 4AKQA 1IIIA 3CVCA 3DV6A 3GT6A 1XH0A 3IDMA 4W70A 5KN5A 3F58L 4KJPC 4KXZH 4GG6E 5D2LA 3QDGA 1AG0A 1U8NB 2JFCA 4YSSA 5HYJE 1YNLL 4R4FL 3RVUC 4KGJA 3IT8D 4QRPA 2GEQA 5DQ9A 2K6YA 2BZDA 5DZLA 5HVFB 1QFUH 4ZFGH 3PV6B 2XTSA 4TUKL 2BM3A 3I6LE 4YN3A 3TYGL 2XG5A 3ARGC 2AEWA 3MV8D 1T1ZB 5KVGH 3BYYA 5IQ9B 2NYYC 3V79C 1N64H 1DHKA 5C0BA 1WIPA 4FC3E 1YC8A 2VSCA 3VNZA 3OWEA 5D7JC 3AWGA 1A22B 2EEAA 5DD6A 3G6JE 4YSAA 2X2UA 5ESQB 3AS0A 2ZOOA 1NIEA 3T2QA 2YUZA 1URZA 3SGDI 2DD8H 1TIUA 5HI5D 1KB5H 3GDBA 3C08L 3FPXA 3JWDL 5EB9A 4AW7A 4OQTH 4LCWB 2VJXA 4PS4L 3ZKQD 3CN1A 1PLAA 3QUKA 4HJJL 3SE9L 1KPVB 4CADB 1ROWA 4WUKL 5J11C 4HKJB 4HOMA 4JR9L 2E46A 2UX6A 3R0NA 4N2MA 3JUYA 2AV7B 3ZDYB 2WXRA 2Z8SA 1UXSB 3E9UA 3QG6A 3VCLB 4AITA 4JFED 4BA0A 1Z2KA 3U9WA 1CS6A 1JGDB 1GZQB 4ZD3L 1J1PL 1SRDA 2VMJA 3ZIYA 2H26B 2FWOA 5B3JE 5HYSA 3FRPA 1U58A 2JK5A 3IU3A 2AJVL 4Y5XB 5A40E 2VISA 5F88B 3CVHA 3KLAB 1WWWX 4LAQL 1OCWH 5KTEH 5I30L 2OMXA 4YHLH 4WWKC 3WE6B 1QSFB 3HG3A 1LTXA 1EJ8A 2LU3A 2DWDA 4P5RA 3HRZA 4QOKB 1I8IA 1BJ1J 4QPEA 1GC1H 2AEPL 2UWEB 4TLKA 3E0GA 2PPEA 3VSTA 1TNNA 5JW4M 2YAFA 5L8KB 4CRPA 2Y24A 4G6FB 1K4CB 4MNGA 4JAMB 4H26B 2J7LA 1AS6A 3H9HB 3F3HA 3EYSH 4N85A 2JQAA 3UAJC 4A7VA 1KXQA 3QNYA 1INQB 1KG0A 4ZAKD 4POZD 3BWSA 1CJYA 3W56A 1CFBA 2GIXA 4UM9D 5KVDE 2VDRL 1E9QB 4E42B 1OAUH 1AD0A 3L13A 1FP5A 4P3WA 1B0IA 2DYPD 3TGXA 4IOSD 3GJFA 1AQKL 2GJ6A 5KSAA 3NSDA 4I0PA 3NN8A 1IAMA 2F74B 4D0CA 3V0IA 4P57B 2DQTL 4M1GL 1W15A 1IKFL 4GQ9L 2VWEE 2F5AL 1UCTA 1Q1PA 1RZ8B 2PMZA 3ARED 1P5UA 4MAZA 2BHFA 3BT2L 4RZCA 5EOQH 3BE1L 2LOEA 2ZJSH 2XN0A 1HZKA 4PLJC 4Y1AB 4B7LA 4X7SH 4IKJA 1Z5LA 3OSKA 3K6DA 4CKVX 4JPIB 4I48A 1K6QL 1KDJA 4PJGB 4QT5A 3AGVA 4JFFB 3R1GH 1ACZA 5AW1B 1OSYA 4KI5C 4ZUUA 1K85A 2XV2A 1JDAA 3RGVB 1PCXA 2DKSA 3Q5YA 1RERA 4PY8J 1JL8A 1KC5L 1CQYA 2ITEA 2N3JA 3O4OC 2DQJL 3A6CH 3V0AC 2OZ4H 1UURA 5KG9A 4V11A 4F7CA 5EEUA 3ZE0B 2B8OT 2H1LM 1I1AD 3EUDA 4I2XA 3S36X 4X83A 3UPRA 4ZODA 3BW9B 3OR6A 1HI6A 2PYEB 4DPBX 3JTSB 1C5BL 3A22A 4HCRL 4EOWL 1FVEA 1XGQB 3K91A 4XPHL 1MOEA 4AZ8B 4M56A 4YDKH 5F1KC 1A5FL 1OWRM 1J5CA 1P0SE 5F7KC 5F1NA 1LM8V 1BLNB 2H9GA 2XX0A 1S5IL 4X6DF 4TVPE 4H1LA 5GJSL 4OW6A 4JM2F 4XH2A 2PXYC 2A38A 4HF5L 5JPNC 4DCQA 3EBIA 4MA8L 4MD5B 3HA0A 4GXFA 5BOJA 4X8XA 4DP2X 5JMOC 1U21A 2JELL 4M7KH 4KY1L 4PS3A 1U3HA 3FYIB 4KKBD 4DN3L 2ZKYA 3MLVH 4BFJA 3TH2T 4YO0A 1UEYA 2RJMA 2V2XB 4YHZL 2QQLH 3FQTB 3K2UH 2X4QB 2ZYRA 3MLTB 5JXAH 1MJ8H 4IGBB 1J8HB 5DI8A 2QEJA 2AJ3B 2EE2A 1USZA 3P73A 2A4ZA 4JY4A 4UF7C 3BZDA 4UV7L 3IDJA 1KTLB 4DVRH 3IJSA 5CEXB 1XMWA 3D8MA 5IEHB 4K2UL 4BJLA 5IT2H 1JVKA 1T4KA 3JWNG 4OLUL 5D4HA 4NRYB 4FNUA 3HG5A 1T7WA 4JFYA 3RTQD 4ACPA 3MRCB 4R0LC 1BCIA 1L9RA 3PHOA 4MDRA 2VLKA 1G6RB 2CJ3A 4IIZA 3VAEA 4NZTL 4F9PA 1PSKH 2HTLD 3SDCB 3HBGA 1R3HA 3Q6GL 1MUJB 2VQ4A 1GC1C 2GABA 3OF6D 2WV3A 4HD5A 1JRHL 5GZNA 3MZGB 5CIPA 4OGXH 5I6XB 2XG4B 1SN2A 4OD3H 4XP4H 3ARFA 3EJUA 3ZHKA 1W91A 2F15A 3U82B 2OI9B 5KVEE 4Z95L 3KPOB 3D1MC 2YWZA 3AY4C 4NO2A 1GGIH 3W9DA 3IDNA 3ARZA 3TN0B 4CUCA 2BZCA 2VM9A 1U8PB 3LZFH 3UABA 1NBCA 1MRCH 3P9LA 5AALA 3SKNB 1M7DB 1NCJA 2N1TE 2WLJA 5DJ2B 2ZICA 1F4YH 2JI1A 1ICTA 1NGWA 2NY2C 1W8EA 4NBYB 3T09A 2LLLA 4K8RD 3R7RA 4A39A 4X6CA 1J5HA 1KLUA 1IGCH 2XVKA 1JNNL 3G08A 3MUGB 5IW6B 4KU1A 1JWUA 1KGUA 3VFWB 2ZUSA 1QFUL 3LKOB 1JGEA 4N68A 2XNAA 3T2LA 3VXTA 5B3SB 1FNEB 4PJEA 4WUUE 3EDKA 1JYVA 5KVGL 5I8OH 1S7VA 4R3SB 3AU1A 5SV4A 1HE8A 3LKSB 5J8OA 4WAFA 1HT6A 5E4AA 2WYIA 1N64L 2DQDH 4X8JB 3KM1A 4D3CH 2R9HD 2XTJE 5D93C 3ULUE 3VDBA 3QUGA 4X4ME 4FFVC 5IROA 2R2HA 1LE5A 1G7JA 2NDGA 3ZTDC 4S0TD 4M1CC 3O9WA 4MJ5A 4QUOA 4BK5A 2F9BT 1SOKA 4NAMA 2F08A 2DD8L 5ESVB 5IVNA 1EZLA 4NUGL 5IP4A 1KB5L 1E8XA 3ZKXC 1M9WA 4OQTL 4UT6A 4XWGH 1X5HA 2V2WB 5TDPB 5CLYA 4R97B 3RFZC 1N4XH 1ID5I 1K8IA 2QR0A 2WVUA 3O4LA 3UAAA 4Z7OB 4CGTA 4X4KA 3FB5A 4LDOB 1XH3A 3AY2A 4LVNB 5ACZA 4MZRA 4Q9CA 4MDIB 1GPOH 4O51B 4WFFE 4GP5B 3NFSH 5D6DC 5EH1A 2O5YH 1YEIH 4KKAD 1IEAA 1TJHH 3OJDB 2NXZB 2X4UA 1OCWL 5PAZA 5KTEL 4YHLL 4LLMA 3TT3H 3WY2A 3D33A 5GJTH 3HE6A 5ESQA 3MBEC 5CZRA 4XN7A 3W81A 4LOFA 1PD6A 1GC1L 5EU3B 4JRXB 2NYKA 3WAKA 3DTXB 5H4YA 4ZMXA 2ENSA 4NJAH 4W9HC 4JM0A 1KTKE 1VFUA 2O4EA 1JIBA 2BIHA 2X0UA 1FLTX 3L1EA 4M5TA 3ZTJG 3ZY7A 3ISYA 3IAPA 4FNQA 4Y4KD 4ONHB 4UANA 3EYSL 3FTXA 3CZKA 1CFSB 5INDA 3D3VE 3VCLA 1DJHA 5F93C 4UILH 1B6UA 1U6AH 4JE4B 1G1OA 3KPSB 4GUCA 4G70B 4DKAA 3LS4L 3SBWA 1OAUL 3S8FB 4N87A 2ALAA 3D4ZA 1QSFA 4RQQA 4RGOH 1YQVH 5IOPA 1RVFH 3GBDA 1I9IH 3MSPA 4KJPD 4GI6A 4GG8A 4UDUB 4YE0A 1WZKA 3AMLA 3V0GA 4PCTA 3D4GA 3I2CH 1JGUH 3FFDB 5B1AB 5EOQL 2FHFA 4YVNA 2ZJSL 2OW7A 2YQGA 3QH3B 2DDQH 3WNKA 2WBJC 1Q90A 4RA0C 5KZCB 4H26A 4I4WB 4U1KB 4X7SL 3WHE1 4XMXA 3A6OA 2BY1A 3ARGD 1Q9KB 1ZHBB 5ETUA 3R1GL 2E7HA 5FCUH 5I6KA 5HVWA 2EXYC 4GOSA 4AQOA 4HUMB 4PIRF 3BZ5A 2B5IB 4YFEA 3MKGA 4S2SA 4ZZKA 5D7JD 5JORA 3HBQA 3BSHA 2E4FA 1S3KL 3A6CL 3VXQA 2Z7ZA 1R34A 4HWNA 2OZ4L 1A1NA 1RAMA 4PREA 4IDJH 2JLLA 3V5HA 5LVEA 4XNUH 4ATTA 1J0KA 5KYXB 3DGCR 2MQ3A 4TV3A 1J9SA 4HG4K 5ID1B 2H2SC 1XL4A 3HE7B 1UYWH 5E51A 4ELMB 2B1HH 4ZSOA 2BLFA 3O3DA 1IIKA 5DRXA 2NXYD 4KH9A 4N6RA 4YDKL 1XF4A 2Q87A 1MFUA 3RL1B 1IFGA 1DQIA 1GZHC 1ND0B 3UAFA 4XBGA 3Q8BA 5K33A 1MI5D 2EO7A 4JPIA 4PJGA 1OAJA 2B20A 4YDVA 3QORA 4YL4A 3VNYA 5E08H 1PPIA 4I88A 3GSNH 2KH2B 3H9SE 5EIVA 2BX5A 4TNEA 4R90H 3WJJC 4HH8A 1P6FA 4A6YB 5DJAB 2D3NA 4MLIA 3TBWA 1AACA 2VLJB 3BAEH 1CDHA 3FU5A 3MLVL 3IFOA 2B08A 4O2CA 3D2UA 2C5DC 4U05A 4Q7DA 1HHJB 2BS8A 4HZ1A 2QQLL 5KVFE 3K2UL 4XPBH 1MJ8L 4PB0H 4RSYA 4NX0A 2WXOA 3WJMB 4GKOA 2PYEA 5BUPA 3JTSA 5HGHA 1VAHA 2EDXA 1NFIA 3EOTH 4DVRL 4NENA 1N59A 4OGQC 5JXEA 3P4NA 2DLFH 1WD9A 5E8DH 4PGBB 2HZHA 1Z32X 2DIAA 2A1WH 1VEMA 5IT2L 1S7SB 4L5FH 5I1AB 4NOBA 1I7TB 4U1SA 4LPUA 5D55A 2VXQH 4ZFOL 4OD1H 5E6IB 2YGPA 3AQYA 5EO9B 4YSQA 1J0ZA 1S9XB 4KKZA 4IJTA 4OJFH 2G3MA 4OGXL 3JQOB 3B3BA 3LPGA 4OD3L 4XP4L 3FQTA 2AF2A 1TJGL 3I02A 4N3TA 4NRXB 5DJDA 3RY6A 2ESVA 3FO9A 4RESB 4ES8A 5HY9B 4XP1H 5E2VH 3RZCC 1GGIL 1P2CB 5CEXA 3BGFC 2WNKA 3JVGA 5HHVH 1W0VA 3H53A 1XHHA 3LZFL 3HNTH 3LPWA 1MRCL 3EGDB 5CU9A 4MXWH 1L6ZA 2A6JB 4MD0B 2OSWA 4G59C 1F4YL 2LFGA 1X6LA 3WNJA 5D7IF 1XL6A 1QKZL 1IGCL 1NGZA 2YAMA 3KL5A 2A74C 4A55A 5FYKU 5GSRA 1KTBA 4YC2C 4M8VA 5AOKA 5FDWB 4U0RB 4C54A 1NAKH 3IGAA 2CR0A 5EMYA 2K7QA 2Z6FA 1V10A 1S7XB 1DVZA 1MW3A 1SF3A 1J9RA 3K8LA 3ZXAC 4LCCC 5I8OL 4FADA 1KCWA 4PRBB 1JD9A 3PNWA 4FFZA 1PG7X 1DBJH 2YUVA 3D34A 3MAWA 3P0YH 2DQDL 4RMSA 4KAQH 1LGVA 3KEDA 5ISZA 3IJ7A 4UNIA 4EI5B 4PVBA 3IWUA 3KLDA 1QHOA 2BDNH 4PCSA 4Z7VE 4ZK8A 2ADJA 1IAOB 4GINA 3HI1A 4H25A 3TN0A 1UB5B 3DJTA 4RDQF 3TBCA 3SKUD 1GS6X 5SX4H 4QHNB 1GZPA 1XSJA 1BXUA 3LXAA 1U91A 3MNVB 1WFTA 3P40A 4XWGL 4NLAA 2X1OA 4LCUA 1N4XL 3M86A 4Z7WE 4C4UA 3SDAB 1JZEA 5E1IA 1BZ7B 4HCIA 4HEPA 3H3KA 3AG3B 3QEHB 2CK0H 1GPOL 3OKKA 4R3SA 3LKSA 3NFSL 4R5TA 2ZXQA 2O5YL 4NKDB 1YEIL 2F8VA 4OGYH 4N20A 1TJHL 3ULVH 3H85A 2UUDK 1EUUA 2K6WA 4IRZA 1E43A 3TT3L 2RALA 5DEFA 1NCOA 4UI2A 3OAYK 3TEWA 3L3JA 3WL9B 4RFNC 5DLMH 4AVHA 4KRPC 2DWSA 1YZZA 1EDQA 3Q2WA 3L3DB 4XWOD 1MCIA 1I75A 5E6YA 3UCRA 4NJAL 1IC7H 5KYNA 2C26A 3WJLA 3GTTA 2V2WA 2MQ0A 1FIGH 1MCWM 1P7QB 4U3CA 1D6EA 4U49A 5FO9B 4FCAA 2B15A 5F89B 2JNZA 4HIIB 1XGZA 4UILL 5AW5B 4Z0XA 1U6AL 3ZR6A 4ANVA 2WCPA 4F20A 5HVHB 4EQ3A 4MDIA 4O51A 1Z3GH 1UEMA 4XGZB 1U41A 4G8EA 1MW2A 3KVPA 4CSSA 2F53D 4NSKA 4XXCC 4XX1E 3BD5A 2H6OA 1OGAD 4JCLA 4RGOL 1YQVL 2Q8AH 2HMIC 1RVFL 4ABWA 1ETJA 1I9IL 4FYTA 1OTUC 2E8YA 2Y5QA 4ZBJA 3U4AA 4F15C 4I3RH 2NY2D 5EZPA 4NO0A 4XBMA 2CH8A 4X6DA 3BZEB 1HSBB 2X4RB 2E9GA 1JGUL 3I2CL 4Y4FB 4JM2A 3TASA 3TVMB 1J5DA 5F3FA 4Q8BA 4H20L 4NJ9H 4PJHF 1BW8A 3MRLB 5FYJE 2YXFA 1QABA 3QAZB 1CU4H 4E0RA 1ANUA 5B38A 1EXGA 3BXNA 4F2EA 5HI4D 3QZBA 1HQ4B 4PLKC 5FCUL 3RHWF 3ZE1F 1BOGA 1Z7JA 1SHWA 3SODB 4XBPA 1IM9D 1A3QA 3KPSA 4W9ZA 5TE4H 4KX8A 2HPTA 2GK0B 2QLYA 4FFVD 5FC9A 2EEDA 3EJPA 2V9UA 1I8KB 1F42A 5I1DA 1EMTH 3LKPB 4YDJB 1YNTF 4IDJL 5IUCA 3O2VH 1UQSA 4XNUL 5T1LD 1Y6NR 2ZXEB 5F8QC 1MRDH 2IAMB 4MRCA 3CSBA 1UYWL 1XVSA 2YD9A 2B1HL 2DJMA 3BRFA 4LP4A 5HSFA 1KIUA 1NKRA 1MEXH 1SBSH 1U8CA 4GW4A 2VSKB 4X8CA 1R5VA 3TNMB 4U1GB 3C9NB 4U1KA 1WQVT 2F54D 3MRKB 3FSOA 4HH9B 5L4JA 4GKNA 2VLLA 2I07A 1KBGH 1ZHBA 5ADPH 2CXGA 3QA3B 5BS0D 5L2KB 5E08L 1WAAF 4HLZH 1AO7E 5F9JA 2EDTA 3TJEH 1TR7A 1EFQA 3GSNL 5AAMA 4ZXBC 1MY7A 1NCDH 2A9NH 5AVRB 4R90L 3EJYD 1DVSA 1ADWA 4U1LB 4WW2F 2GPZA 3MJ7A 3BAEL 4WJ5A 1ZT1A 4JQVC 5FM5M 2JIXD 3DHPA 2A5UA 3F2LA 3MBED 2BIIA 3X3GH 2P80D 5IGXH 4KJYB 3QFDB 1NCBH 3DSFL 2R23A 1KPUA 1WA0X 4XPBL 3RNQB 4PB0L 1NDMB 3GXFA 1NFDB 1EANA 1WCQA 3EYOA 4RZKA 4ELMA 1XT5A 5B1KA 1I7UB 1MQ8A 3EOTL 5FKAB 2WK2A 3BUBA 3IJEB 4JJ5A 2PW1B 2DLFL 2XWTA 4LCIH 5E8DL 4AQ1B 4JANB 5DZOA 3CSPA 2A1WL 2P7TB 3F8UB 4L5FL 3ULVC 1A4AA 4OF8A 3DECA 1TJMA 4HFWA 1V3JA 1H15A 1ZV5A 3MUZ1 2UY7B 4LMQI 2VXQL 4X7CC 4OD1L 1KYOK 2CXKA 2ZXAA 4B50A 4PRPA 4HCGA 1PMYA 4GRWE 2JLPA 3FSVA 4ELDA 1MIMH 5J06A 4OJFL 4WWOA 5SWSD 4DFIA 3GUTA 5MENA 4TTDC 2VLRE 1PJWA 2NNCA 4BSVB 4QO1A 4R4BB 4WEUD 4J3OH 3DK0A 3R0MA 3ARBC 4XP1L 2IGLA 5CN1A 3E8UH 4K5PA 5E2VL 4B60A 3KH3A 5HHVL 3WXVH 5JPMB 1N0LB 3VE0A 1FLRH 3HNTL 3W5MA 1UB6A 4OUUB 1RZPA 4MXWL 3D5OF 5M7QA 1T1WA 4UQ9A 3T3MB 4NZDA 5DJ8B 1NGPH 4TQHA 1NAKL 5CHNA 4F8QA 3FFCE 4FXKB 1S9XA 2D3JA 2IWFA 1TJXA 3Q6FA 4NUJA 4ODUA 4PRHE 5C07B 2CJTA 4R2GC 4MMZA 3VGHA 1ZVYA 4LQFH 4NUQA 1DBJL 3O8XD 3OKNB 4KZEL 3P0YL 1OP4A 2OL3A 3ETSA 1NIDA 3DX0A 3FOMA 4KKRA 1LVEA 4KAQL 4NHUB 1AQDA 4FHBD 4L3AA 1OTTC 2NX5B 4M48H 5DUBB 1FVDB 5IQLA 2BDNL 1A7NH 1WFNA 2P5WD 4RGMC 1CGYA 5CGMA 4LLDA 2BVUA 1N19A 4MD0A 4LSTH 5AOIA 4ADIA 1F86A 4CL7A 3FB6B 2E56A 1OT4A 2RH0A 3QDMA 1YECH 1F3RB 4FQQA 2E7LA 2VZOA 1OLLA 1O75A 5CCHE 1E6OH 2CK0L 1I8MB 1CFQB 4G8FA 4YGVB 4OGYL 1B2WH 4UOQA 3ULVL 2WIIA 1DVUA 2BNUB 2ZUWA 1K3IA 2R4SH 3U1QA 3WLBA 5DXWA 5I0DA 2Y6SC 1FL5B 1AHWC 4PJIE 5DLML 2XN9D 1IAOA 5DJCB 2OFQA 4M5ZH 3V4PA 3STBA 1I4FB 3F7QA 1U92B 2BIMA 2DW5A 5BOZG 3AQZA 3NZSA 5B1JA 3QJRB 1IC7L 3R8QA 4J3SA 3SGEH 4PJ9B 3QIBA 4NQSA 4AQEB 1NBVH 2JJSC 3GI9H 5C0AE 1FIGL 3PQYD 2JKRM 1VESA 2BRQA 1HH9B 1TFPA 2A73B 3C60C 4NWTH 4ZMNA 3F62A 2CO7A 3U1PA 4FQXB 3CDFA 2NW3B 2J5LB 3NJIA 4GUPB 4IEFA 2YD7A 4NP4H 2IEPA 1OF0A 1CDGA 4OVUA 1OAYH 3CPLA 1Z3GL 1TO5A 3CUPB 2BP0B 1JK8B 1L9QA 1QBAA 4RLDA 3MRRA 3GB7B 3FUIA 3RZCD 2MEJB 2J44A 3L3OB 3AWFA 4FN0A 4XB8A 3HUJF 4AM0Q 2A6KB 4AM0A 3RWDB 1NCNA 1VADB 1VJSA 3SO3C 2Q8AL 4F58H 4F7TB 4O2EB 4TNVF 4EE2A 4IJ3B 3NCYS 3ARRA 4ZQKB 1LE9B 3SDXE 4I3RL 1GJIA 5A2BA 3U79A 5FK9B 2Q86A 4R7NB 4AUJA 3BVVA 4UQCA 1HYSC 2EICA 5IMOB 3GMPB 4MJIE 2XOTA 4NJ9L 4Z7NE 1GGCH 4XNZB 2NRDA 1E42A 3EO0B 1CU4L 5IB5B 4D7PA 1NUFA 4BSJA 4EIGB 4IRSA 3F12B 4J3OC 5F89A 2KLRA 2AERT 3MREB 1TTCA 4HIIA 5DJXB 2ZD0A 2HSIA 3VA6A 3Q01A 1S6NA 3D39B 4EUPH 3QC6X 4QHKI 1OZTG 3AACA 3RWGB 4F5CA 1R33A 2MSPA 4HOWA 4HWZA 4KRNA 1TZOA 5E5MB 5TE4L 3QXTA 1LNUB 2XJLA 4XE0A 2HRPH 4B5EA 5JIQA 1EGJH 3UYOD 3ULUD 4DK5A 8PAZA 3ARDB 1BPVA 1DSYA 5AZUA 3CZGA 5FR3A 3CX5J 1EMTL 3PCYA 3WEBA 1UZ6F 2DF3A 3VQ1C 2BFGA 3O2VL 2DQUH 5CBEB 1A3LH 4XVTH 1MRDL 5HYEA 4B7IA 4AUYA 2ZX8A 4I1PA 2EYRB 1QBLH 3BZEA 5INCB 4Y4FA 5HP5A 1BGXH 3FO1B 1BX2B 1SBSL 1MEXL 35C8H 1QUNB 4WU7B 2OMWA 1QEWB 1EJFA 4ORGB 3DK2A 2FHCA 3SGKC 4HX1A 1KENH 4MJ6A 1H9VA 5AUMA 1KBGL 5ADPL 4NNYB 4ODTH 5E1AA 5DSCB 5LDSA 4LSQH 3LSOB 3DPDA 3J27A 4WFFD 3RPIA 3CBKB 3STLB 3TJEL 3CLEH 4WO4D 1NCDL 2A9NL 3ZDXE 4EN3B 3IFLH 3ZK0A 4G8GA 1VKXB 1MJJB 1N3NB 1AGFA 2HJLB 4AMWA 2D3VA 3WDHA 1I8KA 3X3GL 4JUTA 1IARB 5IGXL 2YMTA 5CGTA 1NCBL 1QYGH 2OCCB 1CDYA 2DYSB 5HJ3A 2ICWJ 4MCZB 3EDFA 4LEBA 4N2BA 5HDBF 1PZ5B 4WFED 3TBTB 1G9MH 2JB5H 3TA3C 1AMXA 3QFJD 5D7IA 3T0EA 1J8SA 4LCIL 5LAPA 4NM4H 4HH9A 2K0RA 3O0LA 3ESUF 4HUWB 5LUMA 3CDGB 2CNZA 5BV7H 1HCFX 1UWGH 1K4DB 3RGHA 4U1LA 4D94A 2CDFA 3VI3F 2HMID 1BBDH 5IMLB 3OMNB 1AGEB 3N50A 5KVMC 3W11C 2C7UB 1MIML 3M17B 1OTUD 1IX2A 3G5XA 4F9LC 4KJYA 3OMZA 3WOVA 2WSKA 3VH8G 2VDOH 2GITB 3O6FB 3VI4E 3GBLA 2Y7LA 2CO2A 4PJ8D 4HIQA 4X6EB 3E8UL 2J55A 4PGEB 5GGRB 2G2PA 3WXVL 3VWKC 4G8IB 3VH8B 3B7RL 2YA1A 4BSWB 1FLRL 3KPLB 1FYTD 3GMOA 1U30A 2WC7A 3SGDH 2BSEA 2C1OA 4MB3A 1BVLB 3KPTA 3U7YH 2RMNA 4KBPA 3QUXB 4P2RB 2IANE 3NACH 3KWXA 4ZYKA 1CYWA 5LNGA 5BUAA 2NY3D 2ZSVA 3S2AA 4Y16A 4H8UA 5TF1H 2XWJA 4H8HA 1NGPL 4P06A 3EAKA 2JKSA 2KS0A 3QNZB 1IO4C 1QHQA 4QTHA 1HHHB 1PIGA 3DXAD 3GJFH 4OFYD 1KBKA 4PJCE 4YQXH 4X2UA 1F1AA 4M9OA 3OD3A 4LQFL 2Z65C 1I1RA 4X5QA 3T71A 1NBZB 1WV7T 3TZVB 3D4YA 4Y7OC 5GGUB 5F6IB 4HQQH 1AYOA 1NGQL 1A7NL 4L1TA 4QKTA 4LHJB 2IAAC 1AD9A 4PFEA 1TZHA 1Q0XL 3VDCA 2NUPB 2V2TA 4XB7A 4LIQH 1KXVA 1BQSA 1X7TA 2E6PA 3HJ0A 3KYOB 4ZUWA 5HDWA 3V6OC 4OUUA 3WFZA 4LSTL 1A4KA 4JFSA 4ZXBD 4IK6A 4AQ8C 5JIKA 4LXFA 3ZO9A 5FB8B 1YECL 3RIAF 3ZU8A 2HLAA 4YDIH 1P9MA 1IGJA 2IDUA 5EBMA 2JV6A 3RDTB 4M7JH 4GUOA 2IALA 2CBPA 3C5ZA 1E6OL 1Q9WA 3UBGA 4V1DA 4Y4HA 3ESVF 5DYOA 3V0DA 3VFNA 2AQTA 1B2WL 5JIMA 4NO3A 4N24A 4G9DB 5DFAA 2R4SL 5DUBA 3NTCH 5CLXA 1OY3B 4N2AA 1WISA 5IB1B 4M5ZL 5DU7A 3VFSB 3UROR 5TFSH 2BSSA 1BFSA 4KNSA 5EU6E 2LTQC 4L8DB 1CGTA 1SQMA 1NBVL 3GI9L 4PSPA 3PGDA 4K3JL 4A66A 5DJZA 1X5KA 4NWTL 5C0IA 5MHSD 1I9RH 4K4KA 1F6AB 3KGSA 2GQHA 4P5TA 4TTDD 2OTWB 4KVPA 1G9MC 4AH2A 1YNTA 1OAYL 2EXWD 2Y7QA 1I8MA 1XDTT 2DN7A 5A7EA 1CDCA 2V17H 2DQGH 5D1XC 1X6NA 3RBSA 5EF0A 4HGWB 3K6SB 1JMXA 1HHGA 1S5HB 3QUYD 2BNUA 3QXDB 4IS6B 2DZEA 3EH4B 4J3TA 3L3KB 2M8XA 4F58L 3NZUA 1R5IB 1AQ8A 4WUUB 2F61A 5BV7C 1DEEA 3QT2A 5FO7B 5JHAA 5DJCA 5FHBH 1HFUA 4P5MB 4NKQB 5I2IA 3IJ8A 1NM9A 3VRJA 2XTJB 4AQEA 1WWBX 3GJEB 3MUUA 2C4FT 4YBHA 5IUSA 1AIFB 2JMRA 3HRZC 1GGCL 1CD9B 3G5VB 3O6KH 4W9KC 1OSEA 4ACTA 4WW2A 1E67A 3FN0H 1JYXA 4R2GD 2P5EA 3KYAA 3CFJA 4FQXA 4M93B 4QGYA 4XVUC 4JHAH 2NW3A 2AANA 4KPHH 2FEJA 4OZFG 4ADJA 3BD4A 3LEXB 3N41B 2IPTH 4KI5E 3WMSA 1YEGH 1V05A 2HRPL 3GB7A 2FNBA 4AJVA 1EGJL 2Z8RA 4OZFB 3WDIA 3SKMA 2CO3A 3UGUA 3CFCH 4NCDA 4F7TA 3ZDYF 4O2EA 2DQUL 5DHVB 5DDHA 1A3LL 1G7MA 1MFAH 4XVTL 5HBBA 2Y7NA 1QBLL 5FK9A 1SMAA 1SXSA 1BGXL 5IMOA 1VA9A 5GS1A 5HHPB 35C8L 4I0PC 4HIEA 5AVZB 2UY6A 1HEHC 3EO0A 3D69A 1KENL 4TUOB 1TCMA 3F12A 3DMMB 2V7HB 5D2NB 4ODTL 1AKJB 1P5UC 5DJXA 2EAEA 5G4MA 3FT3A 3GXUB 3D39A 4IRJD 4XPFL 1L9OA 2ZUUA 4MXQC 3CLEL 3N42F 3CFUA 5J9PA 3VFMB 3IFLL 3UO8B 5E5MA 3PL6C 1JXFA 1LNUA 2WZAA 4MA1C 3RBGA 3SCMD 2YBGA 3D3VB 2WVTA 3PNRB 3PHQB 1NMCB 1RK7A 5CBEA 1A25A 1QYGL 1UD8A 2XPGA 1P6WA 1MFDH 2L7EA 2EYRA 2QPEB 1CCZA 1G9ML 1GJWA 2JB5L 1BX2A 4XN8A 4C58B 3H4HA 5JW4N 1X5GA 1TU2A 3C60D 5IF0B 1QEWA 1ED3B 1DJYA 4L3EE 1FCCA 4NM4L 3HAEG 4DGWC 3OJMB 1BF5A 1Z9NA 3W39B 2DL2A 1T89A 4NO5A 1F11A 3E7JA 5DSCA 1ZAGA 3LSOA 3W0WB 3ZDZF 5BV7L 3IAGC 3STLA 2BXYA 1UWGL 4HOXA 1UXWB 3HAEB 4PJ5E 1EHLH 3ZYIA 1HILA 1VKXA 1JVOA 2SODB 3VYPA 1BBDL 1M6OA 2JTDA 4WZ9A 3TONA 1VENA 1KN2H 4JDZA 2Q20A 5CXPA 2XXGA 1N18A 1OCCB 4IBQA 4RGNE 4S0HA 4JFDB 3KJ4B 4BZ1A 3POHA 3BZFA 3O3EA 5GS0H 1HYSD 2RTTA 2VDLH 3HN8A 4RRPM 2IF7A 2MTPA 1U3HC 3H56A 4NCC2 3APDA 4ZOCA 3MA9H 3M45A 3DVGB 1DUZA 3WMPA 1AR1C 2ED6A 2RR3A 5FYJD 2CLZB 3SD5A 1ETA1 3VXRE 3US1A 2E59A 4J3OD 5E8PA 2EYSA 2HLFD 2F7OA 4WNSA 3W3BA 4PI0A 4HIPA 3U7YL 4GKZA 2CLRB 2HA1A 4P9MH 3ZE0F 3QJFB 1N7MH 2WZ5A 2YD8A 3NACL 4HUWA 3MGOA 3CDGA 2WXIA 4L18A 2V5MA 3G6DH 4QCIB 5TF1L 5FX3A 5AAWA 5IMMA 1NC2D 2DIBA 4C56A 1MVUA 4NUPA 4WK2B 1IGFH 4OCSL 1KDIA 4UIMB 3GIZH 4YQXL 4R7DB 2EDBA 1SXBA 2HP4A 4PWJA 3NZ8A 2OYKA 1ILSA 1CO1A 2NQ3A 3H9SB 4F9PC 4MZIA 3FAXA 2X4PB 4HQQL 2FX9H 3OZLA 4DPRA 2WXLA 1T3FB 1U8IB 3OHMB 5GGRA 5ABZA 4PJXF 3VH8A 4NXKA 2I7OA 3MFFB 3WTWA 4LIQL 1DVFB 2V33A 1XSIA 3O3BB 4X7EC 1AO7D 3QUXA 3BDYH 3NCFB 4TRPH 1OOAA 1YA5A 3M7OA 5DC0A 2EDHA 4XR8C 3NFNA 2COVD 4YDIL 3M07A 2QVFB 1KYDA 3QNZA 4LESA 4M7JL 5CP7A 5EBWA 3ZSSA 3NJMA 2FVNA 2PYFA 5E4IA 4JZJA 5IR1B 3A4DA 1J11A 3WNNA 3LKNA 2GI7A 4F7MB 3DHJA 4G7YH 1WBXB 1M42A 1MXGA 1NBYA 1F02I 2DM3A 5GGUA 2MQCA 5J5EA 3MROA 1DE4B 2DLEA 3WNOA 4UQDA 3K4AA 3HBPA 4PRIB 5TFSL 2ZX7A 3KYOA 3KPPB 3KWVA 2XX1A 4MNQA 3IEAA 5I8KH 4GSQA 2XICA 3VSVA 3UTTE 2BP8B 1MLCB 1CICA 1F4AA 4KZ0A 4B9CA 5IROC 4DTGH 5GGTH 1E8ZA 4NDMB 3LH8A 4AIZA 1YEKH 1OGSA 4NCC1 3GSRB 4LVEA 1FV1A 5B8CA 1DLHA 3SBPA 1M1SA 3P9MA 3BCFA 2ZIDA 2VLRD 1AQHA 3FQYA 1JDDA 2V17L 3EUUA 3T4YB 3WKMH 3GMLA 2BCMA 1ZGLM 2DQGL 1RIUL 3B43A 1QRNA 3FK3A 4JM4H 1E0OB 1UGNA 2IOIA 3F7RA 4GKLA 1J0JA 2M2DA 2Y72A 5FUCC 2XVLA 1E9OA 5FHBL 5JIHA 1JTTA 1C8QA 3U9UB 5K59E 1E5BA 4L8DA 1LD9B 4M5SA 4Z76A 5DMYA 1XGRA 1IBZA 3V8CA 1EXUB 4Z7VB 3HIZA 1T22B 1E2WA 5EU5A 4Z5RB 1SJEB 1QVOB 3O6KL 4RDBA 2FEDC 3FN0L 4M61B 5GS0C 3LVTA 4PRHD 3LNHA 2ZCLH 2UZPA 4JHAL 4LLYB 1N12A 3LKRA 2OTWA 4KPHL 4W68A 1MPAH 1JNLH 3MJGX 1VPOH 2IPTL 1W6WA 3NPSB 3EOAA 4UT7H 4LHUD 1YEGL 5E7FA 1GOFA 5C08D 1WIUA 4HGWA 5H8DA 3NSCA 3UZEA 3K6SA 2WLZA 1F4HA 4IS6A 3DROB 5HGDA 3CFCL 1R5IA 3THMH 3TT1H 4Z7OF 2IGFL 3LH2H 2H6UA 2PTTB 4PI2A 1IL1A 1MFAL 4TLUA 3RTLA 1CD1A 3SBWC 4ODXB 4MWFB 1D7FA 1FL6B 1W0WA 3D85B 4JZNB 5EF3A 4OCNC 3GJEA 3LNFA 5D4QA 1AIFA 5J6GA 1E4JA 3OKYA 1RK0B 2GK2A 3RHWK 1RZIB 3QZWA 4RAUB 1CZ8L 3RWJB 3T04D 3C6SA 1TVHB 3HW7A 3VI3A 1MCBA 2WOYA 3LCYA 2F1AA 1BVOA 1UD2A 5CR8A 4RWHA 2BY3A 2OTPA 2YPKB 1E8YA 3LEXA 5ANMB 4HPOH 5JZ7D 1H3GA 4FFZH 1J0YA 2WW8A 3DRTA 3U46B 3IPEA 2AJSH 1ZE3H 3PIQA 1D9KB 2C9VA 1A64A 1HESA 4U1JA 1W0YT 1FZMB 3G5ZA 4XX1G 3TXAA 4KITB 5DHVA 1KTDB 4DVBB 4L8SB 1MFDL 3GBML 4U3HA 4OIAA 4Y5VC 1R17A 1RY7B 1KLGB 2VDNH 3FT4B 4LCYB 5AQ0A 3MRGB 2OV0A 3B6SB 3WIHA 4DZBA 3MUJA 4DO5A 1J8RA 2KZBA 4OBRA 3IYLW 1BA9A 2VDMB 2GW5A 5I9QB 4F33B 1A6ZA 4LEOA 2HG5A 3DHUA 1D5RA 2XETA 5D1XD 1SDDB 4AX3A 4APQB 1H8OA 1EHLL 2JXMB 1Q4NX 4U4BA 4N2FA 1C08B 3DX9B 1KN2L 3QORC 3V6FB 3VGGA 2VUOA 2BVPB 1U8QA 4WHTA 2B1OA 1YY8B 4FHJA 1KJ2L 1K72A 4J5VA 4ZO7A 4L4TE 1G43A 5GS0L 3FDWA 2VDLL 1TEFA 3VRIB 2V4LA 3MA9L 1ZLDA 4NBXB 3OZ9H 1PX3A 2VN5A 4YFLI 2CHDA 4E41B 1FL3B 1VEOA 4XVUD 1ET8A 3B7UX 15C8H 4XXWA 1OV8A 1YPZB 3MV7D 5IBLD 3W39A 4AVJA 4P9ML 4Z7UE 1FIEA 1Y6KR 4X7FC 1N7ML 3MV8B 5E9NA 3D51A 2AAVA 2R83A 3LD8C 4PY8I 1JZFA 3MX0B 3IJHA 4IMLA 5IM7A 1CFTA 1IGFL 1NEPA 1V5JA 2R7EB 4IHBA 4WI9A 5E8NA 4CAGA 3GIZL 3H9ZA 4N9OB 3RRQA 1KCKA 4JN2A 4MMYB 4JRYE 1KTJA 5CZXD 4NC1C 3ZOAA 1MCHA 4PRNA 3B4NA 5HYQA 2FX9L 4YPGB 4JHVA 1NQBA 2EIBA 2H32H 5JDSA 5TE6H 5E23A 3HLAA 1TO4A 4AYDC 5AW9B 1QFPA 2X4TA 5T3ZE 3RY6C 1MVFA 4MXQD 1AC6A 4PUBL 1F58H 3PL6D 4YE4H 3BDYL 2FYYB 5ILTH 1S9VB 1WBYB 2BNRA 3JVGC 1B3IA 4PJDF 4QCIA 5AVYB 4P5KB 3QIWC 3JYCA 3ESOA 4UMGA 1TCRA 3VXSD 2VR7A 4YGAB 4LLQB 5HPMB 1CG9B 3BYTA 4OF3A 2Q8BH 1WSST 1P4LA 2W81C 4U1HA 3VQ2C 2V9QA 4ZMOA 3EGSA 4G7YL 1V3KA 4NHCH 4UTBH 2HX8A 3KXFE 4JFOB 1RJLA 4DGIH 1U8IA 2DWEB 3RIKA 2BERA 5I75B 4B6ZA 2DTSA 3K5SA 4M6MH 5F71A 1ZE3C 1P4IH 5GISH 3SGJC 4F37F 1GJUA 1WITA 4XXDA 1C7TA 1RZ7H 5JIPA 4DTGL 4UM9B 4WTXA 5GGTL 2FT7A 1FDLH 1YEKL 4XB3A 2E9BA 3EBAA 4L9LC 2WSPA 5FM4A 4GBXA 4NQEE 3GC3A 1OK8A 3BP7A 3E2HC 3GXPA 4KKLC 3INOA 5IR1A 3WKML 5MI0B 5DRWB 2PNDA 4K9JA 1WBXA 2IG2H 5BRZA 3FFCB 4JM4L 2C9PA 5C0FB 2ENQA 4Q2ZA 5C9KA 4X0KB 1I1YA 4I18A 3AT9A 2WM0A 5DQJA 2APFA 3RNKB 2P8MA 1WD8A 2X70B 4ZW5A 2F0CA 3LPOA 2LT9A 4PRIA 2IAND 1A8ZA 3ECQA 2CAKA 3QXVA 2GG1A 3MQIA 1MLCA 3QUZD 3D48R 4NLHA 5IVXE 2BFVH 3EBHA 1T04B 4N2DA 4QRRB 2J1ZA 4OT1L 4YVUA 5JQIB 1KY6A 3GSRA 1XZ0B 4PV9B 1BXAA 1IQDA 2ZCLL 4NPYB 2DQFA 4MB1A 1IV8A 1E9PA 2HUEA 3WJLC 1JNLL 1AIZA 2E7BA 2EJ1A 3EW3B 4NQCE 2W0FB 4UT7L 2Z8WC 3MRBB 4X6BA 3R7QA 3L5XH 4GQQA 5AL8A 2NQDA 3R8BB 4F8NA 3EXJA 4WTQA 4D9LH 4HOZA 2NUTB 3HTLX 2IH8A 5TF0A 3THML 3TT1L 1XCTB 3Q2VA 5CSBA 3LH2L 3EYQD 3FSWA 5LBSH 3RDJA 4D8PB 3KPNB 4X9GA 4XNMB 2WWKT 1D7DA 4GRLB 4GYBA 1R0AH 1DFXA 3MRIB 2V6HA 4AXWA 1EFXA 1YMMA 4PJIB 1FFQA 3KNBA 3ZYJA 2OMZB 3K2IA 1TQVA 2JKNA 4DP4X 1IC4H 2H47C 4JPKH 1J8KA 4KRMB 2G75A 3ZKND 4FERA 4JM2C 2FQDA 5CLWA 3FUDA 1Z9SA 4ODSH 4HPOL 2MOGA 5C0AB 4FFZL 3OR7B 4JQIH 4X6FB 3SE3C 7FABH 1ZEAH 1IC5H 2OL3H 4N2GA 4QMEA 2W95A 4OZGE 1UOKA 1BDYA 3CHXA 2AJSL 3G6AA 3DPBA 1KYUA 3RAJH 1GYCA 5I76A 4X5WA 3C8HA 1LO5A 4BKLA 4QWWD 1UJ3B 2L7QA 2ZUQC 3U0TB 3CMGA 3NJXA 4KXDA 5EU6D 5AD0A 2VXSH 1IM3B 4CU6A 4WHCA 2VIRB 2VDNL 4QNPE 4YDNA 2L4OA 1DQQB 1CK0H 4G3YH 4LL1A 1W8NA 3C8KB 1RK0A 1RSFA 5HYIA 1RZIA 3BVWA 1EPFA 4AKPA 1TQCC 3SDXB 5E8EB 2Q7YA 2XTLA 1E4XI 2I9LA 4FG6C 1B0RA 3OG4B 4MJIB 4OV6F 4NQDE 1E2ZA 4B97A 1R3IH 4B9IA 4P2OC 3U46A 3LV3B 1T2JA 3ALPA 4A2LA 4BRVA 5IIEB 4YS4A 4G1EB 3TS8A 1V8HA 1UWYA 3CFKB 3GMRB 1FZMA 5D1QE 3HHSB 2PPDA 3QDJE 1AGDB 1XEUA 4PJXA 1I31A 4QTFA 1IBBA 3V4PH 3E6FB 1EV2E 4XCCL 4OZIE 4WCYH 1MREH 3ARPA 3EADA 3T3PF 4L8SA 5T3XH 2ITDB 2WAQA 1BAWA 5FO8B 2YC1A 3FB8B 3P2DA 3DDGA 2B4CH 3FT4A 2WD0A 1JCKA 4LCYA 4YAQA 3MO1A 5GS0D 2FEDD 3H7BB 3OZ9L 4GW5B 4EIZC 3TBVB 3S4SA 5I66B 1YG9A 1Z5HA 3BEWB 3L9YA 2D9QB 4UQ3B 3PPSA 2YD0A 4AGNA 1F3JB 1JZ2A 1AHKA 2N0MA 5JHBA 2RHEA 4LP8A 3UTOA 1HDMB 1SDDA 3VXUA 2FJUB 5CKAA 2OMYB 4CN1A 3OHXB 3SDDD 2JXMA 3NG5A 2RA1A 2IIJA 2PTUA 1NC4A 4IQHA 2GUOA 4Z3IA 1C08A 3F84A 3V6FA 2QPUA 1J9TA 5D1ZB 3GKZA 1M05B 3M8OL 5A7BA 1BG9A 2QSVA 3DVNB 3ZDXB 1BIIA 3ETBF 3I74A 1BQHA 3DX6B 1KN4H 2VM4A 4NYLB 5CO1A 2J72A 4ADGA 4OM0H 3FQXA 1JNJA 4JFQA 2A9CA 5TE6L 2BS71 2N7AA 4FNTA 3MLPA 4WJG3 4UOW0 1F2XK 2JCCE 1WS8A 3PWJA 3O3AA 3TJHC 3EYUH 4KHXL 4MVBD 5M95B 4A37A 3MV8A 1F58L 3KPMB 5DMKA 1TYRA 4YE4L 5EU4B 5ILTL 3SYAA 5AAPA 2HRLA 1JYWA 2UVEA 2Y7SA 3MX0A 3I6GB 4OTXH 3PAZA 2R0KH 4RFEA 1JOIA 2Q8BL 5DHXB 3ECVA 1G0DA 5GS2H 2QTEA 4P4KC 2GT9A 1O7DE 3FTZA 3Q06A 4AJWA 3QJZA 1HOCA 3ALXA 1G7HA 4HMDA 1GSKA 4NHCL 1FVCB 4UTBL 5E99H 1MWAA 1T1XA 3FTVA 3NIFB 4H2AA 4ZFZB 4MMZC 1CLOH 4FXGB 2FJHB 1JHTB 1ZT4A 2ADGB 3BGMA 2WHVA 3CZLA 3LIZH 4JFEA 4BRJA 3N04A 2WPGA 3QWOB 4M6ML 4YHMH 1KCRH 5DK2A 1P4IL 5GISL 1IGMH 5F3BA 5IB4B 3EDEA 3ZQ9A 4PJ5D 1RZ7L 4YSCA 4LLAA 2CK2A 2OYMA 3CFQA 4UYPA 5EIIG 5ES4B 1FDLL 1QA9B 1X5XA 3HG1B 3MYJA 2Z31B 3L4WA 5TDOB 3U36B 3BAYA 1BFOA 4DUXA 2EXSA 4LLQA 5DLLA 1CG9A 3IGLA 1MAJA 3ABZA 3MRNB 3PWPB 4RGND 5EIIB 4P4RB 4PPTA 3OTTA 4LEXH 3TV3H 2AI0H 4RIRA 2I9TB 2CCLA 3AQDA 3V7MA 2G3NA 3IFPB 4LRNH 3QQ3B 2BMKA 4E9XA 2IG2L 1V7NH 2WBKA 3DOSA 4LBEB 5C6TH 4UQIM 2O6CA 4B9GA 4M4RB 5C3TA 1CC3A 2YZ8A 1B2YA 3N3EA 1NGXA 4QR7A 4R8WH 5I8CA 1GR7A 2CUHA 5AVQB 5T1JA 1BD2E 3TBSA 3TM6A 3QEQE 3QP3A 4ODWA 3IVKB 2J4WL 1DDHA 1Z5YD 1RURH 2GTWB 4ZAKA 5C3IA 5A2IH 3AU0A 4J8RA 2BFVL 1UWXH 4UM9A 3HFMH 4NQVB 4Z9KB 2DRUA 2IXQA 4NWUL 3OKEB 2XFGB 4ZO6A 3BAIA 4TNWF 3ZE2E 4IOSA 1AZUA 1QNIA 5FFGA 1XIWB 4JDVB 1NPNA 4L4VD 5E2TH 3QIBC 2B4CC 4XHJC 4IBSA 4KI1A 3ZMEA 5JOFB 3L5XL 1BMZA 3AREA 2J56A 2W1NA 3G5YB 4HKZB 4QRQB 5J11B 2HAZA 5D7KE 3WN5A 4D9LL 4WDIA 4X0KA 5GGSB 1WH0A 4Q0XH 2J3SA 2AMGA 4UCFA 3S5LG 1JPFB 1U8MA 4I3GA 4YBQC 3RNKA 1U3ZA 2Q3AA 4LGRB 5LBSL 3T77B 1MI5B 3IXAB 1TYEB 4MCYB 2PCFB 3HB3C 4DHLA 1KXHA 2Q76B 3D06A 4HIJA 4PJFE 2PP7A 4L1DA 2UZXB 5F7DA 1R0AL 3IM1A 2WQRA 5TGBB 3S5LB 2Z91B 3QIWD 4WWKB 3PE9A 2P48B 4H8WH 1T04A 1PVHA 3JTTB 3F05A 1IC4L 2DJ4A 2F7QA 4JPKL 2WNGA 1XZ0A 2R1YA 2KZKA 2LAAA 1LP9B 2G9HA 3Q2LA 3RL2A 3KDPB 3WNLA 5EZOH 1KOAA 4ODSL 4O02A 4KKNA 1I1AA 4JQIL 4NPJA 7FABL 1ZEAL 1IC5L 2OL3L 1Y0LB 2FO8A 4KROB 4GIOA 2FO4A 3V7AE 3GRWH 4IRSC 2GSIA 3D7PA 1ETB1 1NAMA 3QPXH 5EC1A 5EG6C 2Z34A 4JS7A 4NN7C 1I7ZB 4GG6F 4AEHL 4PBVC 2R51A 1QSEE 4Z77B 2VXSL 3LNEA 3KPNA 1JYNA 4J3XA 4BK4A 2A4EA 4GSDH 3HC0A 5LBVA 3MRIA 4ZZFA 9PCYA 1H8SA 1CK0L 2WO2B 4LU5L 1M2VB 4DEWA 5C09E 1DQLH 2FECI 1Y6MR 1A7PH 3B8SA 2DLGA 1XQ4A 3VFGL 1PNDA 1PZUB 3G04B 5C0DB 4XN4A 3CFEB 4L05A 1N8ZA 3CQPA 4HXAH 1KGCE 3BP6B 5E03A 3G6JF 2FAUA 3RVWC 5FOBB 5JLZB 1LDSA 2QBWA 3ILPB 3T6ZA 4AW4A 3V4PL 3KWTA 4WCYL 1MREL 2FWSA 4ETQB 5DJ0B 5T3XL 1F5WA 4K3EH 3RTQA 4LSQL 4KK8C 1KB9K 1HSAB 3BP4A 2B4CL 2X6MA 1XR9A 1TMQA 3TO2B 4XPGH 3C8KA 1PZCA 3OF6A 1EHKB 3QZNA 4I1RA 3UC0H 5B3JF 3HR5B 5D9SB 2FZ3A 4FFYA 1AP2A 3NEEA 3KBFA 4HK0A 1ODUA 3I85A 1T5XA 5HJBA 4OCYH 5D1ZI 1QQDB 2DLTA 3R06A 1PY9A 1EVTC 3LV3A 4J6RL 5I6MA 1JS4A 4G1EA 4XRCB 5B39G 3Q2CA 3U7WH 3WKYA 3GMRA 2Y0SA 3CSTA 3F6LA 3MV9E 2Y5TB 2E76C 2PXYB 3DV4B 3CFIC 4H5SA 1DSFH 1KNOB 1KN4L 1RK1B 4G11A 5B39B 8CGTA 1M7UA 3GRGA 4ZPTB 3SJVB 4AMKH 3DDFA 5FO8A 4DKDC 1XO8A 4OM0L 4QD2E 4G1MA 2N7BA 4NAJA 4IDLA 5D7SL 4WNJA 5DZJA 1ID2A 4GW5A 4WJKB 1KB5B 5H35A 1G1CA 1OW0A 2FJFB 4HJ1A 2LGNA 4UQ3A 2R39A 3EYUL 1HEJC 3V6OE 5KBKA 2DWYA 3BN9C 3TESA 5IMKB 2ZONA 5GIRA 4A04A 4L3EB 4W9LC 4NAQA 4OTXL 2VNCA 3DIFA 3C5JA 2R0KL 1DZBA 2VMCA 3L3HB 1G7IA 4J23A 2X42A 3V9FA 2Z4QB 1P7BA 5D1ZA 5D2LE 1M05A 3QDGE 2I60H 3BAJA 4H8WC 3LNIA 3DVNA 3FU7B 4R0LB 3DX6A 1BM3H 4QRPE 3HC3H 1E4KC 1ZPLA 5A3IC 2X2JA 3C5SB 4OF7A 3VXNB 2ICWB 2XY2A 1CLOL 3GPSA 5D6CA 2EILB 3L1OL 3LIZL 1WTGT 1TTAA 1TVDA 1MW0A 4HEME 1KCRL 4HZLA 2FH6A 4OCWH 1IGML 4YHML 4BFNA 4P2OD 2NNAB 3HBZA 1AH1A 2B0SH 2UXVA 2W9LA 4EKJA 1X9QA 3GSVB 3VXRB 1PYWB 2Y1AA 4E9LA 5J13C 4LHQB 3D9AH 4U6HA 2BOBA 1I8UA 1KT2B 3I6GA 5FGCE 2PLTA 4PP2A 1TTGA 4KNUA 5JYMA 3I9GH 1MSPA 3EJSA 3RVVC 1U8OA 2AJXL 3PXLA 4BM7A 3DKHA 4L4TD 4LEXL 3TV3L 2AI0L 4WKXA 5LQBH 2NY2B 3OB0K 1XF3A 4LRNL 1SUHA 3UTSD 3GM0A 4OIIH 1P9MC 1UASA 1XGYH 4NT6B 5D71H 4FEIA 4JFVA 4Y4KA 3T8MA 2VITB 3C5ZC 1WVZA 2EKSA 1I8LA 4ZFZA 1B0GB 2IADA 4Y4HC 1LJMA 1KTRL 2DWTA 1X4ZA 2RACA 4R8WL 3VJ6B 2ADGA 4P3CL 3BWAA 5EO1A 4FFTA 4PH8A 3X3FH 1KTCA 4OAWB 3GS7A 1M57B 1OANA 2Y1ZA 1RURL 3HZYB 3K2MC 3MLUH 4QRTB 3UMTA 5KANI 1U93A 3OMAB 3CSYB 3OLDA 4RISH 1SFHA 5D93B 43C9B 5TDOA 3EFOB 2X41A 3HG1A 2Z31A 3U36A 4Y2DC 1GHFH 4ONFH 4OR1A 5B3NA 5E2TL 2IQAA 3V5KA 1LK3H 4NNXB 5EIIA 5AKTA 1QRKA 3MN8A 4JRYD 3ZKXB 3NZHH 1T5WB 2YGQA 1ODAA 3RFZB 3QQ3A 3EHBC 4GO9A 3OQ3B 4LBEA 1RIHH 3BH4A 3EJCA 1WP6A 3PF2A 4P5TC 4TNGA 2JQMA 4L23A 4Q0XL 2LU5A 2QSTA 4L3CB 2J6EH 5T3ZD 3TJHD 4IU3B 1X5YA 2VSDA 3ARGA 2VW7A 3P4OB 1ZA3B 1T83C 4KK5D 2QSQA 4ZUSB 1ZLVH 3QPQD 4OD2A 2VZUA 1EAJA 5TJWK 4KK6D 2Q10A 2IBGA 2AW2A 5KUMA 4H8WL 5D7JA 2GJ6E 2BWDA 3TU6A 3VACA 1MHHA 2FH8A 5EHFA 3FMGH 3OKEA 1BREA 4P4KD 4C83B 4JDVA 1DN2A 2EYTA 1D5ZA 4OY9A 2MOQA 5EZOL 3UTTB 3IXTB 4YH6A 3ZPDA 3VD4A 1QR1A 4PN6A 1R5WA 1C12A 4QRQA 3MCG1 4MX7A 1CBJA 1L0QA 2DQHH 4WW2C 3GRWL 1ZLUK 2NY1C 3QPXL 4BV1A 2QGEA 5CN3A 3P0VH 2GI0A 4FA6A 1PIFA 4BQ8A 2DI8A 3W1ZA 4P2QB 1OLZA 4HBQA 5BZZA 1MI5A 3BH9B 2WLIA 4OLYH 1HHIB 2I69A 3CZEA 3L7EB 2UZXA 3CQQA 4GSDL 4PEEA 4Q74A 1HCZA 3S5LA 3ARYA 2I7SA 4P23C 1DQLL 4XMZA 1A7PL 1JRHI 2G3XA 4ZFOB 4KK9C 3LN4B 4I2XE 2HVKA 3SE8H 1X9UA 5GS1C 1PS3A 2GFBA 3M1OA 2YEZB 4HXAL 2D03H 1BXXA 4UBDD 3OAZK 3ULUF 2ENPA 2WBJB 4RNRB 1A6AA 2CG9X 1MAMH 1OF2B 5EOCH 1LEKB 1DL7L 1NOFA 2L7UA 1WF5A 5F0PB 3RWIB 1OHZA 5J1AB 2ZP8A 3I75B 3I9IA 1PZDA 4Y7MA 2WUBH 1A9EA 1G7QA 1YNKL 3AUWB 3CFTA 4K3EL 4ORZC 2H3NA 2MOVA 4EXPX 3ROOB 3Q05A 4XPGL 2P42B 5T3XD 1QFWH 3ATBA 3EJJX 2XQYA 3HMWH 1Q0YL 2AXGB 2VH5H 3UC0L 4XHJD 2OYLA 5C0DA 4B9JA 4NQCD 5KSBE 3MA7A 3SY0B 1SXAA 2BOCA 3CHSA 4OCYL 4Q52A 3Q8EA 4Z3TA 1ZLEA 2ITCA 2MIZA 4F7PA 2N0KA 2WLLA 3VXMB 3C6LD 4K94H 1QO3B 3TF7C 1XMEB 1OT1A 3U7WL 1WAEA 2IH1A 2YSSA 3GTNA 3H54A 3ASOB 2V3EA 4X7DC 3B56A 4OH2A 1L9NA 3KDMB 1DSFL 4ETQA 2ERJC 2VLKE 4XODA 1SN5A 1N70A 1UA3A 4AMKL 4E9QA 5KW9H 2RAMA 1B9KA 2QPDB 2XI9A 4K9EH 2QFRA 1IVLA 4DOHE 3B9DA 3KWWB 2P1YA 4GMSH 5IQNA 3AT8A 3S2CA 5J3HC 1HZHH 4AT6B 2IBZY 2JI2A 3EZJB 3T2PA 2VTFA 3C75A 3CX2A 5DK0B 4LKCA 5C8JA 3QAQA 1QQDA 3REWA 1WDAA 3MMEA 2M83A 2IMMA 3HI5H 3PS6A 4YHYC 4MQ7B 1QD0A 5HHNA 2XN9B 5L4IA 5FGBC 5ICZB 1TQWA 2I60L 5KWYC 5JPNA 3CD4A 4FLSA 5AAWC 4Z1PA 4P46B 2W59A 1BM3L 4X7TB 3HC3L 5B39A 1Z1WA 5IVZA 4FG4A 5TQ2H 4PQXA 3Q3GA 1IQWH 2CDGB 4PCYA 4BQBA 4F2FA 4X4ZA 1PZAA 4PJEE 2XV0A 3OKOB 4OQTA 3ABMB 4OCWL 5C9JA 1KIQA 2VE6B 3EYVA 4I13B 2B0SL 4NQDD 4EQ2A 4LCVA 2GY7B 4NC2B 3R4RA 1YC7A 1SYSB 5HHOD 4ZNEA 3K2KA 3RVWD 3D9AL 4PGJA 5C0RH 4IK7A 2WNWA 3CSFA 4CC0A 5D1QD 3I9GL 2AXFB 4KUZH 1ZHLA 5J1SC 3QDJD 3CZNA 2H8PA 1MCNA 2IOOA 5LQBL 2WTPA 5DGQA 1SMDA 4UM8B 4R0LA 4KK8D 3US0A 2A74B 4OIIL 1XGYL 4OJDH 5D71L 4QKXB 4WWNA 3DGGA 1ZVNA 4GXUM 3NDYE 3X14B 4CGUB 3KBPA 1F3DJ 1S9WA 1YMHB 4JZJC 5F7UA 4TVSa 3F7YB 4LCCB 4BZYA 3K72A 5C0CD 3NVQA 3CU7A 5IB3A 4XTRC 4MDJB 1SJXA 3X3FL 4NQXA 1KJMA 4UOZA 2NNAA 5IK3B 2PO6B 3MLUL 5DTFA 4RISL 1OSPH 3AVEA 3GSVA 3NESA 2ICEB 3AY4A 1CB4A 1FFOB 2HN7B 2O61A 1WGVA 1JPST 1OGAA 1UOWA 1GHFL 4ONFL 2V0AA 5EEWA 5BJTA 1LK3L 1R75A 1CICC 1TFHA 1FG2A 3NZHL 4TQPA 4WFGE 5T33H 2DQMA 3UPCA 3VFUA 3SOBH 1PKQB 5LJYH 3N0PB 3B7SA 3GXTA 3QIUB 1NANH 4JO3H 4URKA 1P7HL 1KBWA 5CZVL 2J6EL 2NTFB 2MJWA 4JN1H 2BS9A 3T6XA 3BN9D 2ROYA 4NXSA 4K94C 4J2QA 4HIHB 3UBXI 3U48A 3RWHA 3KXFB 1FUNA 1NCTA 2D2OA 2DM2A 3TC9A 5IEKB 1IM9A 3CIAA 1QSFE 1ROCA 3WNPA 3EFOA 4RFNB 3FMGL 5JW5B 3GSNB 5DJYA 4KRPB 1PDKA 3N44F 2UWEE 4ZO8A 5A6MA 4FQCH 5T1LA 4UDTB 1OAXH 3MRJA 4K9EC 1NINA 3S5ZA 3QWRD 2ZYIA 3NCJL 1H19A 2DQHL 4G5ZH 2BHZA 3QZOA 1F13A 4JL2A 2VZTA 4JHBA 2FR4A 3QFJB 4CSTA 1T0NB 4NQEB 3VW3H 1TLKA 3P0VL 2DEXX 3KLHC 2JTYA 5LKNA 4G42A 2F54A 4OCXH 1KGIA 4PBWD 2Q3ZA 4MASA 5ERWB 1XSOA 3VG9C 1SFDA 1ZA3A 5BS0A 2NZIA 4OLYL 2YRZA 1D6VH 1A21A 3CFDA 1OGPA 3HZKB 4XCEB 2PPCA 4G9FB 1JF1A 4FQHB 5D70L 1DO5A 3S3DB 5SWZB 2UXFA 1DQTA 2FIKB 5T5NG 4AK1A 3UBXA 2JIXA 3MBEA 1HWHB 5DEGA 4F15B 4QY8A 3HS9A 4HUXB 1EEQA 1DBAH 2AVFA 3SE8L 2AV1A 2DOCA 2J1YA 4ZSOE 5IVXB 5JOEA 1HL5A 2D03L 3ZUCA 1K2DA 5L4FA 1O7VA 2NY4C 3WU1A 2QSCH 2X44D 5DHYA 5F7LB 4OZHF 4Y1AE 4LOVA 1MAML 1NFKA 4YSOA 5EOCL 4FE9A 2YOCA 2NY5H 3EO9H 4KO7A 4PJGE 1A9BA 1H6EA 3VMNA 2WUBL 4JPQA 1BD2D 3K4DA 2AQ3A 3QQ4B 3UACA 5I17B 3BH9A 4YHNB 1XF5B 1J5IA 5I74C 5BVJB 4G71B 4Z7WF 1YN7B 1OVZA 2PCPA 1U8LB 4Y2DD 1QFWL 4WIQA 4OVVA 3CC5B 2SEBB 3HMWL 2VH5L 4QAMB 4LSVH 3BQVA 1QBMH 5SWSA 4PV8B 3SD2A 4ICXA 4JGMA 1KF9B 1UOLA 2PYEE 2YAOA 2PKDA 5JHDD 5L88H 3E6HA 3V4VA 2AK4B 4K94L 1A7OH 2YA2A 2B2XH 4K7FB 2A99A 3AFLA 4WW1B 5K9QG 3S3SA 2CHWA 3RWEB 4TKWA 3L7FA 4HUVB 3BPNC 2EVJA 2KBGA 3QO1A 4HBCH 1TTUA 4MLSA 4OZGB 3WEXB 2J8UA 2WNXA 5KW9L 3AXLA 1JNHB 5CGYC 3CDZA 2K8QA 4NC1E 3VRLE 3WHXA 4WSJA 4XMLH 5GGSY 4CVXB 4K9EL 1Y7VA 4GAJH 2MMXA 4XNAA 2Z0BA 4GMSL 1GIGH 1HH6A 4UOW1 2AXGA 4A7UA 1NTDA 2ADIB 2FQGA 2ZOWA 1HZHL 1J8HE 4U3SB 1NEZA 3CDYA 3SY0A 1AXIB 2LVCA 2I26N 1DLFH 2NY1D 2P4AB 2J1WA 2AEOA 4XXWC 3HI5L 1T4WA 2P5WA 5I0WA 1GZHA 3LIUA 1C5DB 1O6VA 4MZ2A 3K81A 4EIUA 3R19A 3GSQA 2H0EA 2VL5A 1UUSA 3T1WA 1G84A 4P23D 1JUFB 3WJJA 3QR1A 2R2CA 4GP8B 5TQ2L 2GJPA 3AWEA 3H7LA 5C09D 4KXAA 1IQWL 3CXHJ 4GT7A 4BQ9A 4LASH 1AGBA 1UCBH 4OZIB 2XJKA 2OM5A 1UH4A 2X1PA 3T4AC 4LBAA 3EGXA 1DYZA 1IT9L 3QI9D 4PHZA 3HG2A 4PYHA 5ISZE 3ARBB 4GRMB 3B3IB 2E27H 2AQNA 5DC2A 4D8OA 4I5BB 5C0RL 1GTFA 2WQXA 4KUZL 1J9QA 4H0GA 2V8LA 4S1DD 4NEHB 5F1IB 1P7KA 2XN9A 4X9HA 1PAMA 2Z35A 3WS3A 3UGXA 3NK3A 4GLRH 1UM6H 4Q6IB 3VFOB 4AOFA 4X7TA 1VHPA 3UYPA 3BUYB 3CQFA 2O5ZH 4Q4IA 3A3YB 5EUKB 3PQYA 2ATPB 4BFIB 1YUKB 2CDGA 4PP1C 1ET5A 1CXKA 5H2BA 2G9KA 2Z8VC 4R2GB 2O72A 4NN5C 4GW1B 4UUJA 1LK2B 1Y18B 2GBUA 2MKWA 4FZ8H 4GFXA 5IQ7H 1HAWA 3IBOA 4P99A 1IC0A 2X3BA 2NY5C 4RGMB 3WNIA 3RZCA 3KYNB 1J87A 4HWBA 2ZXCA 4XCNB 5SWQA 2D0HA 2AXFA 4ZDHA 1XXDC 3ATAA 5E1GA 3PUCA 5I15H 5T33L 2A9AA 2IPKA 1JTPA 2OXGA 3M1CA 2A74A 1H6UA 1MXDA 4PVMA 3F64A 3SOBL 3CMOH 4JO3L 1HEZB 3UZQA 5CWSB 4Y9CA 1T6BX 3BLBA 4N90E 1PCSA 2IQ9H 4JN1L 4WI4A 2CJSA 4B0MB 2VAAA 4HLZG 4MDJA 2H2PC 3D50A 4PJ7B 4ONGH 3GGWA 4HV8A 4I18C 4TNWK 4GRWF 2IDTA 4GMTH 1FZOA 3DUUB 4FTVD 12E8H 1Q94B 4X4MA 4X4YB 1G6RH 1F6FB 1RP8A 3NJNA 3MLRH 4U1NA 1E4XH 2NW2B 3SZ6A 3JWNH 3N1GC 3LQMA 5FA3B 3E80A 4BFOA 2CZNA 3OB0H 1PQZB 4FQCL 4N1EA 4NPKA 4X6DE 1FZJA 2GUYA 3U83A 3WO4C 1OAXL 5KJ7E 2AVGA 1L5GB 1NCGA 5C7ZA 1UENA 3U4KA 5BO1H 4BZ2H 4G5ZL 1UA6H 4DK6A 5F1OB 3VW3L 4EIBA 3OPZL 2GSGA 1J1XH 4UWQB 3PDOA 1ZRUA 3O41A 4OCXL 5HGBB 3JTBA 1L0PA 5DURD 3U2IA 1QLRA 4ODBD 1O9ZA 1EZVX 3KPSE 5DUPH 2FYVA 4HIHA 5B1CA 5KYYA 1D6VL 3FT2B 1F4WH 4NUMA 1DBBH 3BVNB 4WO4A