3KC0A

Crystal structure of human liver fbpase in complex with tricyclic inhibitor 10b
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based drug design of tricyclic 8H-indeno[1,2-d][1,3]thiazoles as potent FBPase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase 1
total genus 99
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3kc0A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3kc0A02
1LBZA 5ET5A 3RPLA 1JP4A 4H45A 1LBXA 1BK4A 5IZ1A 1FSAA 1LBVA 2R8TA 1FBFA 2F3BA 2QFLA 4GWWA 2FIEA 5FBPA 4GWUA 1NV7A 2Y5LA 3B8BA 5ET8A 3IFAA 1IMFA 1EYKA 4QXDA 1FJ9A 1FPJA 1NI9A 1NV2A 5J16A 1EYIA 1NUXA 1IMBA 2P3NA 1YXIA 3KC0A 5IZ3B 1EYJA 1DCUA 1FPKA 3RPLB 4GWZA 1Q9DA 1YZ0A 4GWXA 1NV5A 1NUZA 1RDZA 3BIGA 5ESYA 1NUYA 1IMCA 1FPDA 3A29A 4GWYA 1SPIA 1K9YA 5IZ3A 1G0IA 2WBDA 4GX3A 4AS4A 1FBEA 1FPLA 2PCRA 4I3YA 1KA0A 4I3EA 1YYZA 1FBPA 2F3DA 4N81A 5F24A 1VDWA 1FJ6A 1FBCA 2Q74A 1INPA 4PTKA 5LDZA 1FPIA 3BIHA 1G0HA 4GBVA 3RYDA 1FPFA 3IFCA 1CNQA 3T0JA 2FIXA 2FHYA 2CZHA 2GQ1A 1FPGA 4GWSA 4H46A 4HXVA 5EQ9A 1IMDA 2Y5KA 1FPEA 1DBZA 1NV3A 4GX6A 1FBHA 4O7IA 2CZIA 1FPBA 1FBGA 2DDKA 1NUWA 1KA1A 1FBDA 4MJOA 5ET6A 1QGXA 1RDYA 1LBYA 4IR8A 1NV0A 1IMEA 4HE1A 1AWBA 2OX3A 2QVRA 1XI6A 5I3SA 2JJKA 3ROJA 2VT5A 3LV0A 1NV1A 3KBZA 4KXPA 5ET7A 4I40A 4GBWA 2OWZA 2Q8MA 3KC1A 3QMFA 1D9QA 1KZ8A 2CZKA 5EQAA 5EYGA 1NV4A 1RDXA 2FBPA 2BJIA 4GX4A 5DW8A 5EQ8A 5EQ7A 1DK4A 4FBPA 1LEVA 1LBWA 5EYHA 5T3JA 1FRPA 2QVUA 2WEFA 4AS5A 1FTAA 5A5LA 1NV6A 2P3VA 1IMAA 2WBBA 3LUZA 2FVZA 2HHMA 4G61A 3D1RA 3FBPA 4HE0A 1K9ZA 2QVVA 4HE2A
chains in the Genus database with same CATH superfamily
5L9SA 4QHQA 3RPLA 3MQ9A 4ECFA 3K4UA 1BK4A 1B3EA 1BKAA 5I2KA 1N0TA 3PMWA 1HSJA 1NV2A 4JSDA 3BKIB 2XX7A 1IXIA 3VFJA 3KC0A 3K2DA 1B5IA 1IXCA 1O7TA 4KYEA 3ZSFA 5L9OA 1ZU0A 2Q2AA 1FPKA 1J1NA 4I62A 4GWZA 3C35A 4GWXA 2UVHA 1SW1A 2KLFA 3KG2A 4LZ8A 2D5WA 2XXYA 1SI1A 5ESYA 1EZOA 2F7CA 1SPIA 3ILUB 4I3YA 3LBSA 5AA2D 2RC8A 4NF4A 5LDZA 2V93A 3TUSA 4GBVA 3GLBA 3RYDA 3CSBA 4ZZEA 2B4MA 4ZDMA 4H46A 4LATA 1B1XA 2RC7A 1VSOA 2ZXTA 3JV9A 4C0RA 1MDQA 4O7IA 1T0KA 4BDRA 3FD3A 3TKDA 4MJOA 5ET6A 2QMWA 4DZ1A 3R7XA 5BWJA 1NV0A 3SESA 2DOJA 1XI6A 3KBZA 1H76A 3RPWA 2Q8MA 2REGA 1NNPA 4PGPA 4XXUA 2AL4A 1FQEA 5DYHA 5ELVA 2F78A 5L9MA 3SEVA 2I58A 4JXIA 4ZE9A 4AS5A 4G68A 4OFOA 5ISUA 1GGGA 4NF6A 1EZPA 5TPAB 1SVXB 1Z7ME 1FQDA 2ZMBA 5I58B 1OIBA 3FVNA 3MVYA 3N6TA 2F3BA 3M3LA 5I59B 3V5AA 3PTYA 1JNFA 1A40A 1LB8A 4PAKA 1RDZA 3H6WA 3IR1A 3TCHA 2XWIA 2X7QA 4LONB 1DPPA 2Q88A 4GL0A 1JEVA 3PUXE 4N4UA 4F29A 4PTKA 1YTVA 5AA2B 4LVQA 3FJMA 3TCFA 3FIRA 3W9VA 4MIJA 3D4CA 2ZZVA 3O6GA 4PBHA 1XT8A 5I84A 5A5XA 4YKPA 4F1UA 3VE1B 1FQAA 2XXXA 2OBGA 1VFDA 1D3KA 2V84A 3FGSA 4YKJA 1RDYA 4KCDA 1AL3A 3B7DA 5AA1A 3O6IA 3MP8A 2DWAA 4FATA 2G93A 2JJKA 5CRYA 5KCJA 2QS1A 4ESXA 3T1BA 3MVWA 5EQAA 1POY1 1EH3A 1BIYA 3OO6A 2P1SA 3SERA 1MM6A 2O7IA 3C33A 4E0XA 1DK4A 4FBPA 4N8YA 3CG3A 4EUOA 4XKNA 1LGBC 4ELQA 4XKQA 4HTGA 4OESA 1MQDA 1UIVA 3C4MA 4U4XA 2VPNA 3FATA 4POXA 4YKIA 4EDPA 1SBPA 2WKYA 1DOTA 2G29A 4F1VA 3CIJA 5IM2A 1EYKA 1FJ9A 1N3WA 4P9KA 3LSFB 4RNSA 1EYIA 3K6XA 1A54A 1URSA 3MP1A 2O68A 3BFUA 4H1XA 2DE4A 4JSOA 5H8FB 3U93A 3SZPA 4YB5A 1UQWA 5F24A 1R9LA 1ZBMA 1B4ZA 1Q1KA 1MXZA 4PETA 1RYOA 3LR1A 4DXUA 2RCAA 2HXRA 2ANJA 1SYHA 3WAEA 1NKXA 4M1VA 1US4A 5H8NB 1TT1A 5CMBA 4DLDA 3EKIA 1SI0A 1L5TA 4GLIA 3PPQA 2ZYNA 2HAUA 2QVRA 3FASA 4F2OA 5ET7A 2XX9A 2XA5A 2HCAA 4ELRA 2Z8EA 1QUKA 3TTKA 4NAPA 5A5XB 5EYHA 1FTAA 3OXNA 3O66A 4HE0A 1RYXA 1CE2A 1O63A 4KPTA 1B9JA 4ZECA 3O9PA 3IOVA 1VR5A 4QFLA 3CFZA 1QKBA 3VXBA 1A8EA 5I59A 3THIA 4LQ2A 1ZTYA 2ONSA 3KBRA 3MVXA 3KSJA 4NG7A 1FTLA 3FZVA 1USYH 2QRYA 4NF6B 4M4GA 2PX1A 3OEMA 5I56B 2XHDA 1ZKBA 3GBAA 4AS4A 3TTRA 2DQVA 2B4LA 1FBPA 3PPRA 4U1OA 2F7AA 4R6YA 4P47A 3BIHA 4Z7EA 3ECRA 4BDOA 4WKMA 4JVIA 5H8QB 3DELB 4P0GA 2Y5KA 1FPEA 4GX6A 3M3FA 5DEXB 4IY6A 4OVPA 1FBHA 3G3FA 5EHMA 3H7MA 2XXQA 2OZZA 4LN5A 2NVUB 4DIGA 2R9JA 3W15C 1PB8A 5JEIA 4O94A 4LQ5A 3IL1B 5I2NA 1A7LA 3B6WA 4KFQA 4O3AA 1ANFA 2THIA 1B2HA 4G8NA 3R26A 5I57A 4QF9A 4P1LA 3FXRA 4KHZE 2YJPA 1NV6A 5K2YA 3TPAA 1IMAA 3KN8A 2DWHA 3PUVE 4UACA 1MPBA 4GOTA 1EZ9A 3SEWA 2XX8A 1LFIA 1XOCA 3OSRA 3PD9A 2F36A 1P1QA 2CZLA 3PGFA 4NE4A 2UXAA 4OEVA 2P3NA 1PDAA 1TWYA 2KQZA 1JETA 3VVEA 1IZ1A 4JVCA 4G8MA 1B0LA 4N6KA 2Z8DA 1JQFA 3RUMA 3MBPA 5K2XA 4I3EA 1QUIA 2X7PA 5CC2A 5HPQA 1H43A 3Q26A 4PE3A 4MLVA 4F39A 1USYE 2QL3A 1FPFA 4R9FA 3U8QA 3KOTA 4WXJA 3EHTA 5TPAA 1FTOA 2A5TA 1JVXA 3MPKA 5H8QA 3S2VA 3GYYA 4YZZA 1P1OA 2DE3A 4FEBA 3IJOB 1F9BA 3B50A 4PGNA 1ZMGA 4N91A 3RTWB 2Z8FA 1QW0A 1PB9A 3GXAA 4DCYA 4MLQA 2F5XA 1AIVA 3Q25A 1YAEA 4P8BA 2DWJA 4P1EA 3PMVA 4GXAA 3MW0A 4C1UA 2ZYMA 4NF4B 1MM7A 4F1YA 4AB5A 4MX6A 4G68C 1NNFA 4H0WA 2V4CA 3E79A 1LBWA 2M8CA 1AH5A 4OENA 1NH8A 2F8DA 3T66A 2FVZA 1MQHA 2PVUA 2FNCA 3C32A 4XF5A 2E0SA 4G4PA 2ZZWA 3P7IA 2NXOA 4ZEDA 1FBFA 2QFLA 2FA7A 5EHSA 4DE8A 3TMGA 4NMYA 2I3VA 3D4GA 4Q8RA 5FTIA 3TQLA 3H3GA 2UVGA 1PBPA 3TZAA 4MFIA 2O51A 1B58A 2B3BA 2I4CA 2V3TA 3RGYA 4WEDA 4GX3A 4MBPA 2H9BA 1MH3A 2F3DA 2OK2A 4PFBA 4OA4A 3QK6A 3T96B 1FBCA 2Q74A 5HBCA 3HN0A 2HAVA 4AQ4A 1A99A 4PDHA 3HHGA 1GTKA 5KCJB 3OO8A 5EQ9A 3KJTA 1LCTA 5I5PA 5CI5A 4PQJA 1FPBA 3HV1A 4C1TA 5AA4B 1FBDA 3PUYE 1B7UA 1QGXA 1MY1A 2XD2A 3PV0E 1B0HA 2L5VA 3LUYA 3K1PA 4U22A 1N04A 2Y7PA 3CR9A 3V8XB 2H99A 4PP0A 2H25A 2F35A 1LB9A 2F7BA 2H98A 1B3GA 2ZZXA 3OSQA 4EQ9A 5H8HA 2B65A 1NFTA 4FJPA 3FUZA 4NHBA 3RLFE 3UA8A 3T9XB 2QMXA 2HHMA 2RF1A 4H5GA 4KI0E 1JP4A 3G3IA 4R72A 3GZGA 1KWHA 2E1SA 3CRBA 1NI9A 3IOUA 4IO2A 1Y1MA 1DMBA 4PFRA 1Y3NA 2PFZA 1I6QA 3I5OA 4H67A 3VLUA 3OMBA 3SKPA 1MG1A 1BP5A 3MP6A 1XVYA 3E9XA 4UA8A 1K9YA 1R1NA 3PPOA 1IXHA 4GD5A 2HPGA 3KEIA 1G0HA 4ND9A 2H4IA 3K1NA 3L6GA 1FW0A 3IFCA 2XWOA 1VFEA 3T0JA 4GIZA 4P0IA 2CZHA 4OVJA 3K00A 5IKBA 1ELJA 2R6GE 3H6UA 3DLNA 2OWTA 4Q30B 2Y7RA 1D9VA 1NUWA 2NOOA 4R75A 2F6PA 4NGUA 1H45A 4YKKA 4DI4B 4ISUA 5F7VA 4F31B 1AOVA 3I3VA 1B3FA 2OWZA 1MQGA 5FTHA 1N7WA 1NNTA 3TDJA 3TTNA 2D21A 3T93B 3A3UA 3MZ9A 4IO6A 1MQJA 4TLMB 2VD3A 2F34A 5ICQA 1WDNA 4RPOA 5ICTA 1FRPA 3HO7A 4GRKA 1IITA 4FE8A 4DXCA 4YB6A 1B1HA 3N94A 5H8HB 3UGWA 4MHFA 1MDP1 3C31A 1LBXA 1LBVA 5AA2A 4XKPA 3B8BA 1B40A 4NF5B 4Z0IA 2O69A 3IO6A 1I69A 2GHAA 4KD5A 2OWSA 2O84X 3RPLB 3O97A 3FJ7A 1WODA 4G2ZA 1B05A 3IB0A 2F97A 1H3DA 4ZEIA 1N84A 1FPDA 3JZJA 5IZ3A 2WBDA 3MZ1A 3HCQA 2ALUA 4OETA 4OMBA 4IO4A 4N6DA 1OLCA 1URDA 2HXWA 3MSTA 4F3BA 4POWA 3OEKA 1LFHA 3CSGA 3RQTA 5CMCA 1CNQA 4PAFA 3FV2A 2I3WA 1M5BA 2Q8JA 3RT6B 2HQ0A 4DCXA 4MMPA 4PCDA 3UIFA 1LAHE 4XFEA 2VP1A 5HM4B 3RTFB 1LBYA 4FEDA 1AWBA 3SDFA 1LAFE 3TODA 2OX3A 4L17A 4F22A 2VPOA 4GQOA 2HZKA 4I40A 1LAGE 3LSLA 2ONRA 4GWOA 1EU8A 2A5SA 1RDXA 4GF8A 4JWYA 2RC9A 5LOMA 3QSLA 1II5A 4H5FA 3A3CA 5CM6A 3Q28A 2QVVA 3I6VA 3K02A 1HSEA 4EF1A 4LZ7A 1B6HA 2Y5LA 4N13A 4QXDA 1FPJA 4QFOA 5DVJA 3VXCA 2H5YA 2DVZA 2GFEA 4MEVA 2PBWA 3TFLA 1Q9DA 1UTBA 1NUZA 1QJMA 1POTA 4NEDA 4LZ5A 1XS5A 3G3GA 4LP2B 1M5FA 4O7MA 2XXVA 1FJ6A 4QSEA 1XHYA 4K3FA 3TAJA 4GL8A 3F11A 3KFMA 2ZYKA 1IEJA 5JTYB 4GFRA 1IMDA 2XXKA 2OPEA 2V3QA 2MKZA 1QVSA 4F3SA 3MWBA 5L8DA 1ZJLA 2Y7KA 3K6VA 2UVJA 4R2FA 1FCKA 3B6TA 1MY4A 1NV1A 3FVOA 4GBWA 3EN3A 3PU5A 2Q89A 3C36A 4N8GA 2DWIA 2ZNTA 3MJNA 1N76A 1TXFA 3KGCA 2ONKE 1LAXA 1GR2A 2PMSA 3OO7A 4THIA 3M3KA 4QFKA 2XD3A 1PEBA 3PMXA 2RINA 4XEQA 2ABHA 4MNCA 1SYIA 4G68B 3TYHA 3IB2A 2WYPA 4YICA 3N5LA 4F3PA 1HSLA 3E78A 4U1ZA 1YXIA 3FV1A 5H8FA 3CVGA 3IB1A 2VGQA 1NV5A 3U1OA 3K6WA 1P1NA 3H4ZA 1LSTA 3A29A 1PB7A 3G7WA 3SEXA 1KA0A 3HPIA 4P3LA 4N81A 1P1WA 1VDWA 1JW5A 3DM0A 3RN8A 1NNKA 1FPIA 3IK6B 2I49A 5TP9B 2OCUA 4KYDA 2FHYA 4KCCA 3KSXA 3U72A 2QS4A 4ZEFA 1NV3A 3UP9A 2GRVA 1MY3A 5DVFA 1OVTA 3IOTA 4OWDA 3H03A 4RXLA 3S9NC 3C9HA 3MYUA 3QMFA 4R73A 4ZZAA 4Q0CA 1IUDA 1D9YA 4GX4A 2OJTA 1S50A 5EQ8A 4PFYA 3RNNA 1O64A 3QIMA 1B3LA 1PC3A 3K1MA 3MPLA 4BLAA 2QS3A 1B51A 1UIUA 4N17A 5I7IA 3OOAA 1P99A 4HE2A 4IO7A 1LBZA 4HS7A 4DXBA 1SW5A 2AIXA 2ZNSA 3QUFA 4GXSB 2I4BA 3OELA 3EQ1A 1EYJA 1AMFA 5DTBA 2I48A 1DCUA 1FTMA 1YZ0A 2XXTA 3GBBA 3LSXA 5TU0A 3G3KA 5AE4A 2PCRA 1MS7A 2UYEA 1YCJA 4OTEA 4JDFA 1OLAA 5AA3A 5H8NA 4R74A 3K01A 3IORA 1Z7NE 4WEPA 4ZS9A 2FIXA 2GQ1A 4GWSA 1NH7A 3E4RA 4MAGA 5H8SA 4YMBA 5I57B 4TLLB 4R9GA 3VLWA 4I9DA 4TOZA 3NOHA 3G3JA 4OVQA 3B6QA 4EXKA 4HW8A 5IZZA 2UYFA 4NF0A 4IR8A 4HCWA 3IAZA 3IJXB 2R71A 1RKMA 3H6TA 1YPNA 3ROJA 4KXPA 3MAMA 5LTCA 1B7ZA 4X04A 5EYGA 1NV4A 2AL5A 3VV5A 2BJIA 4BDNA 3KZGA 1DPEA 1MPDA 1WVJA 4ZEBA 3O6HA 5J1DA 4OANA 4NQ8A 1I6BA 3OD7A 4KQPA 2ZYOA 5EYFA 5A5LA 4JBZA 2O1LA 1PBQA 1B5JA 3D1RA 2NWJA 5IGAA 4H8JA 3U65A 1QKAA 3O2AA 4G8HA 3R6UA 2DS9A 2Y7IA 5IZ1A 2R8TA 3MC2A 5M2VA 4XIGQ 5FBPA 2I6EA 1B52A 3E13X 1IMFA 3S9LC 1FTJA 4PFTA 2RKMA 5FHMA 1BTJA 2A5TB 2XXWA 3FXQA 3AXFA 4FAJA 3T9UA 4NN3A 1ATGA 2PT2A 1N7XA 1G0IA 2DVCA 4NF8B 1UTHB 1B46A 1US5A 3JYRA 2HFBA 2GH9A 2CMOA 2XXUA 1MY2A 4FIMA 4EXLA 4N07A 3W9WA 4UABA 2I0CA 3KN3A 4R2BA 1IQ7A 4R6HA 1FTKA 5DVIA 2Z23A 3PUWE 1DBZA 3CFXA 3KJ7A 2NUVA 2O6AA 5CBSA 4PDDA 4NTLA 1B32A 3H06B 1B3HA 4DDDA 4ELOA 3O28A 5KDTA 1Y9UA 4X8RA 5I3SA 4NWCA 1DSNA 4QFPA 3ONMA 1FQBA 2PYYA 1GVCA 4OERA 2CZKA 2B3FA 1OMPA 5DT6A 1MPCA 2FBPA 4QFNA 3G3HA 4U23A 4AB6A 2DXRA 3HFUA 1SQYA 3Q27A 2WEFA 3DP8A 2DP8A 1JVYA 1SD3A 1A8FA 3WAFA 3FBPA 3TTMA 4RJZA 1K9ZA 3PPPA 3S4UA 2WX9A 5ET5A 4N6PA 3ODBA 2D3IA 2KR0A 3EPEA 4EQ7A 4I8CA 2FIEA 2DSFA 3HHFA 1NV7A 4I1DA 4PFIA 3N26A 2O7UA 2VOZA 5BUUA 2XXHA 4DI3D 4GVOA 3CFLA 4G77A 2Y7WA 4P56A 3MUQA 1P1UA 1LCFA 5B7DA 2REJA 5FHNA 2GHBA 3FJGA 1I6AA 4N15A 3T9VA 4OFJA 5IAIA 1MXUA 1ZIUA 1BLFA 4BDLA 5CMKA 1M5EA 4OHNA 3S9EA 4QRZA 4MCOA 2Q2CA 3V89B 3C34A 4IO3A 2I0BA 2CZIA 4IO5A 2YLNA 3VVDA 1FBGA 2DDKA 3IOWA 1KA1A 5FHOA 3TCGA 5I56A 4OVRA 2AYSA 3ZKLA 1MH4A 3ISPA 2Z22A 2DXYA 1SW2A 1LLSA 2FYIA 1URGA 2DE2A 3ZS6A 3LC8A 2Y84A 3KC1A 3QYTA 5KDTB 1LBBA 3U92A 3L6HA 1MY0A 3N6UA 5CBRA 2DYXA 3OO9A 1S9TA 3IX1A 3HSTA 3T9HB 1NL5A 1Y20A 4PF8A 4X1BA 4Q5TA 2HEUA 2WBBA 4MNIA 3ILTB 5JTYA 1UTBB 3M8UA 4E0WA 2X26A 4KYSA 4FECA 2ESNA 4H45A 4H65A 1GV8A 1MXXA 1FSAA 4PFWA 4GWWA 2QSXA 4PF6A 5ET8A 4IY5A 2P0SA 4U4SA 3FVKA 1IMBA 1B4HA 3FXBA 1Y4CA 1NMUA 3T22A 3BIGA 3UORA 3OENA 1H44A 3VLVA 3TTLA 4GWYA 4F18A 2XXIA 4YB7A 1YYZA 4ELPA 2ZNUA 1OQGA 3RT8A 3PD8A 1N3XA 4IGTA 1JW1A 4PAIA 3EHUA 3K6UA 3VDFA 3V83A 1R6ZA 4MNPA 4F3GA 4HXVA 4PC9A 3E3KA 3CI8A 4JWXA 2CEYA 4PFUA 1UTHA 1MXYA 1MRPA 4HE1A 4X1DA 1D4NA 2VT5A 3LV0A 4MF3A 4MH5A 4RY1A 4LUBA 3A09A 4YU0A 3USDA 1Y3PA 2QS2A 4JB7A 4PBQA 5DW8A 4RK9A 2V25A 3TEPA 3PPNA 1M5CA 4EF2A 1LEVA 1CB6A 5T3JA 3O29A 4IB2A 1Y4TA 1B5HA 2P3VA 1LBCA 4OVSA 3SETA 3LSWA 5TP9A 4G61A 2IA4A 2XXRA 3MZBA 3KN7A 3VVFA 4OFLA 4H6DA 5I2KB 4GWUA 2YPNA 4JVDA 4NF5A 2XXPA 4P11A 4YMAA 1NUXA 1JW4A 5IZ3B 4XTCQ 2VHAA 1S7YA 5B70A 2XWVA 1NUYA 4F2QA 4KR5A 1DTZA 3RY3A 2HZLA 1OVBA 4RYAA 1QUJA 4OQOA 2PFYA 4ZEKA 1TFDA 4XKRA 2Q9TA 3UN6A 2O1MA 2QJEA 1FPGA 4OEUA 3H6VA 4QBAA 4YAHX 1ZLQA 3IO4A 3EF7A 3FXUA 3DP6A 4OXVA 3CG1A 4ZE8A 4QSCA 4X48A 4JWOA 5AA4A 2QPQA 1IMEA 1IXGA 4NX1A 1MXVA 3QXMA 1DTGA 5JK4A 3KOSA 2F6GA 1D9QA 1Y1ZA 2WYKA 3TQWA 3FVGA 4O8MA 1FQCA 3PUZE 5F1QA 5CMMA 3TELA 3CHGA 1A55A 1Q35A 1R9QA 4PE5B 2QVUA 1SW4A 4O3BA 1SDXA 4IGRA 4BDMA 4TQUQ 3MVZA 1Y3QA 2CEXA 4RPNA 3IFAA 1IIWA 4NF8A 5J16A 4OVTA 5KZTA 3BBRA 4O3CA 3UK4A 3U94A 3S9MC 4U21A 4QSDA 4RA1A 1TFAA 1IMCA 1FBEA 1FPLA 2XWKA 5ITPA 4OZ9A 5DEXA 5I2NB 4FORA 1INPA 1XVXA 2PT1A 1FQFA 4H8IA 1JEUA 2IEEA 4HCYA 1LFGA 2V3UA 4LA9A 3EHSA 1QULA 2P2AA 4BDQA 3QUJA 1XC1A 2OLBA 2BJJX 3QAXA 3DP4A 2LAOA 3BFTA 2UVIA 4EQBA 3ZKKA 4RK2A 1KZ8A 1VE4A 3Q29A 1MQIA 2OPDA 2W7YA 5ITOA 5EQ7A 4F19A 4OYVA 4R6KA 3SEYA 4ESWA 2VD2A 4X9TA 4NWDA 4ONYA 5I58A 3K0VA 3LUZA 2RCBA 3SEUA 1OQHA 1B7HA 1MXWA 4U2RA 1M5DA
chains in the Genus database with same CATH topology
1LBZA 2WX9A 5ET5A 4MHFA 3RPLA 3U65A 1JP4A 2CEXA 4H45A 1LBXA 4MNCA 2KR0A 1BK4A 5IZ1A 1FSAA 1LBVA 2R8TA 1FBFA 2F3BA 2QFLA 4GWWA 2FIEA 4PF6A 5FBPA 4GWUA 1NV7A 2Y5LA 3B8BA 5ET8A 4JVDA 4PFIA 4F1VA 3IFAA 2WYPA 1IMFA 3PTYA 5IM2A 1EYKA 4QXDA 1FJ9A 1FPJA 1NI9A 1NV2A 5J16A 4OVTA 4P9KA 4YICA 4DI3D 2DVZA 1EYIA 1NUXA 1IMBA 4MEVA 3E78A 2P3NA 1YXIA 3KC0A 2KQZA 4P56A 4PFRA 5IZ3B 2PFZA 1EYJA 3FXBA 1DCUA 1FPKA 3RPLB 4GWZA 1Q9DA 1YZ0A 4GWXA 4JVCA 4NN3A 1NV5A 1NUZA 4NG7A 4PAKA 1RDZA 3BIGA 5ESYA 2XWVA 2DE4A 1NUYA 1IMCA 1FPDA 3A29A 4GWYA 1SPIA 1K9YA 5IZ3A 2XWIA 4N6KA 1G0IA 2WBDA 4F18A 4GX3A 4AS4A 1FBEA 1FPLA 2PCRA 4N15A 3SZPA 4I3YA 1KA0A 2XWKA 2B4LA 4I3EA 1YYZA 4P3LA 1FBPA 4N6DA 2F3DA 4PFBA 4N81A 4O7MA 4N4UA 4OA4A 5F24A 1VDWA 2HPGA 1FJ6A 2HZLA 3MSTA 1FBCA 4P47A 2Q74A 1INPA 4PTKA 4PAIA 5LDZA 4PE3A 3W9WA 1FPIA 3BIHA 4UABA 1G0HA 4GBVA 2PFYA 4PETA 4JVIA 3RYDA 1FPFA 3IFCA 2XWOA 2Q9TA 2B4MA 1CNQA 4MIJA 4MNPA 4PAFA 4PDHA 4YZZA 3T0JA 3W9VA 2FIXA 2FHYA 2CZHA 2GQ1A 4MCOA 1FPGA 4GWSA 4H46A 2HXRA 2ZZVA 4HCYA 4QBAA 4HXVA 4PBHA 5EQ9A 1IMDA 4M1VA 4MAGA 5I5PA 2Y5KA 1FPEA 1DBZA 3GYYA 2XXKA 4PC9A 1NV3A 4GX6A 4F1UA 4OVPA 1FBHA 2V3QA 4O7IA 2CZIA 2MKZA 1FPBA 3EKIA 3NOHA 2DE3A 2CEYA 4PDDA 1FBGA 2DDKA 4MMPA 1NUWA 1KA1A 4OVQA 1FBDA 4PCDA 4XFEA 4MJOA 5IZZA 5ET6A 4LN5A 4NGUA 1QGXA 1RDYA 1LBYA 3B50A 4NF0A 4IR8A 4PGNA 1NV0A 2QPQA 1IMEA 4HCWA 4HE1A 1AWBA 4OVRA 4O94A 4DI4B 2L5VA 4N91A 4X8RA 4NX1A 3ISPA 2OX3A 2QVRA 1XI6A 5I3SA 2JJKA 3ROJA 2VPOA 2VT5A 3LV0A 1NV1A 3KBZA 4KXPA 5ET7A 2HZKA 5JK4A 4I40A 4GBWA 2F5XA 2XA5A 2OWZA 2Q8MA 2DE2A 3MYUA 4P8BA 5LTCA 3KC1A 3QMFA 1D9QA 1KZ8A 4X04A 2CZKA 5EQAA 3T1BA 2WYKA 4PGPA 5EYGA 1NV4A 4P1EA 4N8GA 1RDXA 2FBPA 2BJIA 4GX4A 4PBQA 4O8MA 5DW8A 5EQ8A 4NAPA 5EQ7A 4F19A 1DK4A 3CHGA 4FBPA 4MX6A 5J1DA 4OANA 4N8YA 2V4CA 3HFUA 4NQ8A 1LEVA 3E79A 1LBWA 5EYHA 2ZZXA 4X9TA 5T3JA 4P1LA 5CM6A 1FRPA 2QVUA 2WEFA 4PF8A 4AS5A 4NHBA 1FTAA 5A5LA 1NV6A 2P3VA 4OVSA 4N17A 1IMAA 2WBBA 3LUZA 2FVZA 2HHMA 4G61A 4MNIA 5I7IA 3D1RA 4XF5A 3FBPA 2VPNA 5IGAA 4HE0A 1K9ZA 4XEQA 2QVVA 4HE2A 2ZZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LBZ A;  5ET5 A;  3RPL A;  1JP4 A;  4H45 A;  1LBX A;  1BK4 A;  5IZ1 A;  1FSA A;  1LBV A;  2R8T A;  1FBF A;  2F3B A;  2QFL A;  4GWW A;  2FIE A;  5FBP A;  4GWU A;  1NV7 A;  2Y5L A;  3B8B A;  5ET8 A;  3IFA A;  1IMF A;  1EYK A;  4QXD A;  1FJ9 A;  1FPJ A;  1NI9 A;  1NV2 A;  5J16 A;  1EYI A;  1NUX A;  1IMB A;  2P3N A;  1YXI A;  3KC0 A;  5IZ3 B;  1EYJ A;  1DCU A;  1FPK A;  3RPL B;  4GWZ A;  1Q9D A;  1YZ0 A;  4GWX A;  1NV5 A;  1NUZ A;  1RDZ A;  3BIG A;  5ESY A;  1NUY A;  1IMC A;  1FPD A;  3A29 A;  4GWY A;  1SPI A;  1K9Y A;  5IZ3 A;  1G0I A;  2WBD A;  4GX3 A;  4AS4 A;  1FBE A;  1FPL A;  2PCR A;  4I3Y A;  1KA0 A;  4I3E A;  1YYZ A;  1FBP A;  2F3D A;  4N81 A;  5F24 A;  1VDW A;  1FJ6 A;  1FBC A;  2Q74 A;  1INP A;  4PTK A;  5LDZ A;  1FPI A;  3BIH A;  1G0H A;  4GBV A;  3RYD A;  1FPF A;  3IFC A;  1CNQ A;  3T0J A;  2FIX A;  2FHY A;  2CZH A;  2GQ1 A;  1FPG A;  4GWS A;  4H46 A;  4HXV A;  5EQ9 A;  1IMD A;  2Y5K A;  1FPE A;  1DBZ A;  1NV3 A;  4GX6 A;  1FBH A;  4O7I A;  2CZI A;  1FPB A;  1FBG A;  2DDK A;  1NUW A;  1KA1 A;  1FBD A;  4MJO A;  5ET6 A;  1QGX A;  1RDY A;  1LBY A;  4IR8 A;  1NV0 A;  1IME A;  4HE1 A;  1AWB A;  2OX3 A;  2QVR A;  1XI6 A;  5I3S A;  2JJK A;  3ROJ A;  2VT5 A;  3LV0 A;  1NV1 A;  3KBZ A;  4KXP A;  5ET7 A;  4I40 A;  4GBW A;  2OWZ A;  2Q8M A;  3KC1 A;  3QMF A;  1D9Q A;  1KZ8 A;  2CZK A;  5EQA A;  5EYG A;  1NV4 A;  1RDX A;  2FBP A;  2BJI A;  4GX4 A;  5DW8 A;  5EQ8 A;  5EQ7 A;  1DK4 A;  4FBP A;  1LEV A;  1LBW A;  5EYH A;  5T3J A;  1FRP A;  2QVU A;  2WEF A;  4AS5 A;  1FTA A;  5A5L A;  1NV6 A;  2P3V A;  1IMA A;  2WBB A;  3LUZ A;  2FVZ A;  2HHM A;  4G61 A;  3D1R A;  3FBP A;  4HE0 A;  1K9Z A;  2QVV A;  4HE2 A; 
#chains in the Genus database with same CATH topology
 5L9S A;  4QHQ A;  3RPL A;  3MQ9 A;  4ECF A;  3K4U A;  1BK4 A;  1B3E A;  1BKA A;  5I2K A;  1N0T A;  3PMW A;  1HSJ A;  1NV2 A;  4JSD A;  3BKI B;  2XX7 A;  1IXI A;  3VFJ A;  3KC0 A;  3K2D A;  1B5I A;  1IXC A;  1O7T A;  4KYE A;  3ZSF A;  5L9O A;  1ZU0 A;  2Q2A A;  1FPK A;  1J1N A;  4I62 A;  4GWZ A;  3C35 A;  4GWX A;  2UVH A;  1SW1 A;  2KLF A;  3KG2 A;  4LZ8 A;  2D5W A;  2XXY A;  1SI1 A;  5ESY A;  1EZO A;  2F7C A;  1SPI A;  3ILU B;  4I3Y A;  3LBS A;  5AA2 D;  2RC8 A;  4NF4 A;  5LDZ A;  2V93 A;  3TUS A;  4GBV A;  3GLB A;  3RYD A;  3CSB A;  4ZZE A;  2B4M A;  4ZDM A;  4H46 A;  4LAT A;  1B1X A;  2RC7 A;  1VSO A;  2ZXT A;  3JV9 A;  4C0R A;  1MDQ A;  4O7I A;  1T0K A;  4BDR A;  3FD3 A;  3TKD A;  4MJO A;  5ET6 A;  2QMW A;  4DZ1 A;  3R7X A;  5BWJ A;  1NV0 A;  3SES A;  2DOJ A;  1XI6 A;  3KBZ A;  1H76 A;  3RPW A;  2Q8M A;  2REG A;  1NNP A;  4PGP A;  4XXU A;  2AL4 A;  1FQE A;  5DYH A;  5ELV A;  2F78 A;  5L9M A;  3SEV A;  2I58 A;  4JXI A;  4ZE9 A;  4AS5 A;  4G68 A;  4OFO A;  5ISU A;  1GGG A;  4NF6 A;  1EZP A;  5TPA B;  1SVX B;  1Z7M E;  1FQD A;  2ZMB A;  5I58 B;  1OIB A;  3FVN A;  3MVY A;  3N6T A;  2F3B A;  3M3L A;  5I59 B;  3V5A A;  3PTY A;  1JNF A;  1A40 A;  1LB8 A;  4PAK A;  1RDZ A;  3H6W A;  3IR1 A;  3TCH A;  2XWI A;  2X7Q A;  4LON B;  1DPP A;  2Q88 A;  4GL0 A;  1JEV A;  3PUX E;  4N4U A;  4F29 A;  4PTK A;  1YTV A;  5AA2 B;  4LVQ A;  3FJM A;  3TCF A;  3FIR A;  3W9V A;  4MIJ A;  3D4C A;  2ZZV A;  3O6G A;  4PBH A;  1XT8 A;  5I84 A;  5A5X A;  4YKP A;  4F1U A;  3VE1 B;  1FQA A;  2XXX A;  2OBG A;  1VFD A;  1D3K A;  2V84 A;  3FGS A;  4YKJ A;  1RDY A;  4KCD A;  1AL3 A;  3B7D A;  5AA1 A;  3O6I A;  3MP8 A;  2DWA A;  4FAT A;  2G93 A;  2JJK A;  5CRY A;  5KCJ A;  2QS1 A;  4ESX A;  3T1B A;  3MVW A;  5EQA A;  1POY 1;  1EH3 A;  1BIY A;  3OO6 A;  2P1S A;  3SER A;  1MM6 A;  2O7I A;  3C33 A;  4E0X A;  1DK4 A;  4FBP A;  4N8Y A;  3CG3 A;  4EUO A;  4XKN A;  1LGB C;  4ELQ A;  4XKQ A;  4HTG A;  4OES A;  1MQD A;  1UIV A;  3C4M A;  4U4X A;  2VPN A;  3FAT A;  4POX A;  4YKI A;  4EDP A;  1SBP A;  2WKY A;  1DOT A;  2G29 A;  4F1V A;  3CIJ A;  5IM2 A;  1EYK A;  1FJ9 A;  1N3W A;  4P9K A;  3LSF B;  4RNS A;  1EYI A;  3K6X A;  1A54 A;  1URS A;  3MP1 A;  2O68 A;  3BFU A;  4H1X A;  2DE4 A;  4JSO A;  5H8F B;  3U93 A;  3SZP A;  4YB5 A;  1UQW A;  5F24 A;  1R9L A;  1ZBM A;  1B4Z A;  1Q1K A;  1MXZ A;  4PET A;  1RYO A;  3LR1 A;  4DXU A;  2RCA A;  2HXR A;  2ANJ A;  1SYH A;  3WAE A;  1NKX A;  4M1V A;  1US4 A;  5H8N B;  1TT1 A;  5CMB A;  4DLD A;  3EKI A;  1SI0 A;  1L5T A;  4GLI A;  3PPQ A;  2ZYN A;  2HAU A;  2QVR A;  3FAS A;  4F2O A;  5ET7 A;  2XX9 A;  2XA5 A;  2HCA A;  4ELR A;  2Z8E A;  1QUK A;  3TTK A;  4NAP A;  5A5X B;  5EYH A;  1FTA A;  3OXN A;  3O66 A;  4HE0 A;  1RYX A;  1CE2 A;  1O63 A;  4KPT A;  1B9J A;  4ZEC A;  3O9P A;  3IOV A;  1VR5 A;  4QFL A;  3CFZ A;  1QKB A;  3VXB A;  1A8E A;  5I59 A;  3THI A;  4LQ2 A;  1ZTY A;  2ONS A;  3KBR A;  3MVX A;  3KSJ A;  4NG7 A;  1FTL A;  3FZV A;  1USY H;  2QRY A;  4NF6 B;  4M4G A;  2PX1 A;  3OEM A;  5I56 B;  2XHD A;  1ZKB A;  3GBA A;  4AS4 A;  3TTR A;  2DQV A;  2B4L A;  1FBP A;  3PPR A;  4U1O A;  2F7A A;  4R6Y A;  4P47 A;  3BIH A;  4Z7E A;  3ECR A;  4BDO A;  4WKM A;  4JVI A;  5H8Q B;  3DEL B;  4P0G A;  2Y5K A;  1FPE A;  4GX6 A;  3M3F A;  5DEX B;  4IY6 A;  4OVP A;  1FBH A;  3G3F A;  5EHM A;  3H7M A;  2XXQ A;  2OZZ A;  4LN5 A;  2NVU B;  4DIG A;  2R9J A;  3W15 C;  1PB8 A;  5JEI A;  4O94 A;  4LQ5 A;  3IL1 B;  5I2N A;  1A7L A;  3B6W A;  4KFQ A;  4O3A A;  1ANF A;  2THI A;  1B2H A;  4G8N A;  3R26 A;  5I57 A;  4QF9 A;  4P1L A;  3FXR A;  4KHZ E;  2YJP A;  1NV6 A;  5K2Y A;  3TPA A;  1IMA A;  3KN8 A;  2DWH A;  3PUV E;  4UAC A;  1MPB A;  4GOT A;  1EZ9 A;  3SEW A;  2XX8 A;  1LFI A;  1XOC A;  3OSR A;  3PD9 A;  2F36 A;  1P1Q A;  2CZL A;  3PGF A;  4NE4 A;  2UXA A;  4OEV A;  2P3N A;  1PDA A;  1TWY A;  2KQZ A;  1JET A;  3VVE A;  1IZ1 A;  4JVC A;  4G8M A;  1B0L A;  4N6K A;  2Z8D A;  1JQF A;  3RUM A;  3MBP A;  5K2X A;  4I3E A;  1QUI A;  2X7P A;  5CC2 A;  5HPQ A;  1H43 A;  3Q26 A;  4PE3 A;  4MLV A;  4F39 A;  1USY E;  2QL3 A;  1FPF A;  4R9F A;  3U8Q A;  3KOT A;  4WXJ A;  3EHT A;  5TPA A;  1FTO A;  2A5T A;  1JVX A;  3MPK A;  5H8Q A;  3S2V A;  3GYY A;  4YZZ A;  1P1O A;  2DE3 A;  4FEB A;  3IJO B;  1F9B A;  3B50 A;  4PGN A;  1ZMG A;  4N91 A;  3RTW B;  2Z8F A;  1QW0 A;  1PB9 A;  3GXA A;  4DCY A;  4MLQ A;  2F5X A;  1AIV A;  3Q25 A;  1YAE A;  4P8B A;  2DWJ A;  4P1E A;  3PMV A;  4GXA A;  3MW0 A;  4C1U A;  2ZYM A;  4NF4 B;  1MM7 A;  4F1Y A;  4AB5 A;  4MX6 A;  4G68 C;  1NNF A;  4H0W A;  2V4C A;  3E79 A;  1LBW A;  2M8C A;  1AH5 A;  4OEN A;  1NH8 A;  2F8D A;  3T66 A;  2FVZ A;  1MQH A;  2PVU A;  2FNC A;  3C32 A;  4XF5 A;  2E0S A;  4G4P A;  2ZZW A;  3P7I A;  2NXO A;  4ZED A;  1FBF A;  2QFL A;  2FA7 A;  5EHS A;  4DE8 A;  3TMG A;  4NMY A;  2I3V A;  3D4G A;  4Q8R A;  5FTI A;  3TQL A;  3H3G A;  2UVG A;  1PBP A;  3TZA A;  4MFI A;  2O51 A;  1B58 A;  2B3B A;  2I4C A;  2V3T A;  3RGY A;  4WED A;  4GX3 A;  4MBP A;  2H9B A;  1MH3 A;  2F3D A;  2OK2 A;  4PFB A;  4OA4 A;  3QK6 A;  3T96 B;  1FBC A;  2Q74 A;  5HBC A;  3HN0 A;  2HAV A;  4AQ4 A;  1A99 A;  4PDH A;  3HHG A;  1GTK A;  5KCJ B;  3OO8 A;  5EQ9 A;  3KJT A;  1LCT A;  5I5P A;  5CI5 A;  4PQJ A;  1FPB A;  3HV1 A;  4C1T A;  5AA4 B;  1FBD A;  3PUY E;  1B7U A;  1QGX A;  1MY1 A;  2XD2 A;  3PV0 E;  1B0H A;  2L5V A;  3LUY A;  3K1P A;  4U22 A;  1N04 A;  2Y7P A;  3CR9 A;  3V8X B;  2H99 A;  4PP0 A;  2H25 A;  2F35 A;  1LB9 A;  2F7B A;  2H98 A;  1B3G A;  2ZZX A;  3OSQ A;  4EQ9 A;  5H8H A;  2B65 A;  1NFT A;  4FJP A;  3FUZ A;  4NHB A;  3RLF E;  3UA8 A;  3T9X B;  2QMX A;  2HHM A;  2RF1 A;  4H5G A;  4KI0 E;  1JP4 A;  3G3I A;  4R72 A;  3GZG A;  1KWH A;  2E1S A;  3CRB A;  1NI9 A;  3IOU A;  4IO2 A;  1Y1M A;  1DMB A;  4PFR A;  1Y3N A;  2PFZ A;  1I6Q A;  3I5O A;  4H67 A;  3VLU A;  3OMB A;  3SKP A;  1MG1 A;  1BP5 A;  3MP6 A;  1XVY A;  3E9X A;  4UA8 A;  1K9Y A;  1R1N A;  3PPO A;  1IXH A;  4GD5 A;  2HPG A;  3KEI A;  1G0H A;  4ND9 A;  2H4I A;  3K1N A;  3L6G A;  1FW0 A;  3IFC A;  2XWO A;  1VFE A;  3T0J A;  4GIZ A;  4P0I A;  2CZH A;  4OVJ A;  3K00 A;  5IKB A;  1ELJ A;  2R6G E;  3H6U A;  3DLN A;  2OWT A;  4Q30 B;  2Y7R A;  1D9V A;  1NUW A;  2NOO A;  4R75 A;  2F6P A;  4NGU A;  1H45 A;  4YKK A;  4DI4 B;  4ISU A;  5F7V A;  4F31 B;  1AOV A;  3I3V A;  1B3F A;  2OWZ A;  1MQG A;  5FTH A;  1N7W A;  1NNT A;  3TDJ A;  3TTN A;  2D21 A;  3T93 B;  3A3U A;  3MZ9 A;  4IO6 A;  1MQJ A;  4TLM B;  2VD3 A;  2F34 A;  5ICQ A;  1WDN A;  4RPO A;  5ICT A;  1FRP A;  3HO7 A;  4GRK A;  1IIT A;  4FE8 A;  4DXC A;  4YB6 A;  1B1H A;  3N94 A;  5H8H B;  3UGW A;  4MHF A;  1MDP 1;  3C31 A;  1LBX A;  1LBV A;  5AA2 A;  4XKP A;  3B8B A;  1B40 A;  4NF5 B;  4Z0I A;  2O69 A;  3IO6 A;  1I69 A;  2GHA A;  4KD5 A;  2OWS A;  2O84 X;  3RPL B;  3O97 A;  3FJ7 A;  1WOD A;  4G2Z A;  1B05 A;  3IB0 A;  2F97 A;  1H3D A;  4ZEI A;  1N84 A;  1FPD A;  3JZJ A;  5IZ3 A;  2WBD A;  3MZ1 A;  3HCQ A;  2ALU A;  4OET A;  4OMB A;  4IO4 A;  4N6D A;  1OLC A;  1URD A;  2HXW A;  3MST A;  4F3B A;  4POW A;  3OEK A;  1LFH A;  3CSG A;  3RQT A;  5CMC A;  1CNQ A;  4PAF A;  3FV2 A;  2I3W A;  1M5B A;  2Q8J A;  3RT6 B;  2HQ0 A;  4DCX A;  4MMP A;  4PCD A;  3UIF A;  1LAH E;  4XFE A;  2VP1 A;  5HM4 B;  3RTF B;  1LBY A;  4FED A;  1AWB A;  3SDF A;  1LAF E;  3TOD A;  2OX3 A;  4L17 A;  4F22 A;  2VPO A;  4GQO A;  2HZK A;  4I40 A;  1LAG E;  3LSL A;  2ONR A;  4GWO A;  1EU8 A;  2A5S A;  1RDX A;  4GF8 A;  4JWY A;  2RC9 A;  5LOM A;  3QSL A;  1II5 A;  4H5F A;  3A3C A;  5CM6 A;  3Q28 A;  2QVV A;  3I6V A;  3K02 A;  1HSE A;  4EF1 A;  4LZ7 A;  1B6H A;  2Y5L A;  4N13 A;  4QXD A;  1FPJ A;  4QFO A;  5DVJ A;  3VXC A;  2H5Y A;  2DVZ A;  2GFE A;  4MEV A;  2PBW A;  3TFL A;  1Q9D A;  1UTB A;  1NUZ A;  1QJM A;  1POT A;  4NED A;  4LZ5 A;  1XS5 A;  3G3G A;  4LP2 B;  1M5F A;  4O7M A;  2XXV A;  1FJ6 A;  4QSE A;  1XHY A;  4K3F A;  3TAJ A;  4GL8 A;  3F11 A;  3KFM A;  2ZYK A;  1IEJ A;  5JTY B;  4GFR A;  1IMD A;  2XXK A;  2OPE A;  2V3Q A;  2MKZ A;  1QVS A;  4F3S A;  3MWB A;  5L8D A;  1ZJL A;  2Y7K A;  3K6V A;  2UVJ A;  4R2F A;  1FCK A;  3B6T A;  1MY4 A;  1NV1 A;  3FVO A;  4GBW A;  3EN3 A;  3PU5 A;  2Q89 A;  3C36 A;  4N8G A;  2DWI A;  2ZNT A;  3MJN A;  1N76 A;  1TXF A;  3KGC A;  2ONK E;  1LAX A;  1GR2 A;  2PMS A;  3OO7 A;  4THI A;  3M3K A;  4QFK A;  2XD3 A;  1PEB A;  3PMX A;  2RIN A;  4XEQ A;  2ABH A;  4MNC A;  1SYI A;  4G68 B;  3TYH A;  3IB2 A;  2WYP A;  4YIC A;  3N5L A;  4F3P A;  1HSL A;  3E78 A;  4U1Z A;  1YXI A;  3FV1 A;  5H8F A;  3CVG A;  3IB1 A;  2VGQ A;  1NV5 A;  3U1O A;  3K6W A;  1P1N A;  3H4Z A;  1LST A;  3A29 A;  1PB7 A;  3G7W A;  3SEX A;  1KA0 A;  3HPI A;  4P3L A;  4N81 A;  1P1W A;  1VDW A;  1JW5 A;  3DM0 A;  3RN8 A;  1NNK A;  1FPI A;  3IK6 B;  2I49 A;  5TP9 B;  2OCU A;  4KYD A;  2FHY A;  4KCC A;  3KSX A;  3U72 A;  2QS4 A;  4ZEF A;  1NV3 A;  3UP9 A;  2GRV A;  1MY3 A;  5DVF A;  1OVT A;  3IOT A;  4OWD A;  3H03 A;  4RXL A;  3S9N C;  3C9H A;  3MYU A;  3QMF A;  4R73 A;  4ZZA A;  4Q0C A;  1IUD A;  1D9Y A;  4GX4 A;  2OJT A;  1S50 A;  5EQ8 A;  4PFY A;  3RNN A;  1O64 A;  3QIM A;  1B3L A;  1PC3 A;  3K1M A;  3MPL A;  4BLA A;  2QS3 A;  1B51 A;  1UIU A;  4N17 A;  5I7I A;  3OOA A;  1P99 A;  4HE2 A;  4IO7 A;  1LBZ A;  4HS7 A;  4DXB A;  1SW5 A;  2AIX A;  2ZNS A;  3QUF A;  4GXS B;  2I4B A;  3OEL A;  3EQ1 A;  1EYJ A;  1AMF A;  5DTB A;  2I48 A;  1DCU A;  1FTM A;  1YZ0 A;  2XXT A;  3GBB A;  3LSX A;  5TU0 A;  3G3K A;  5AE4 A;  2PCR A;  1MS7 A;  2UYE A;  1YCJ A;  4OTE A;  4JDF A;  1OLA A;  5AA3 A;  5H8N A;  4R74 A;  3K01 A;  3IOR A;  1Z7N E;  4WEP A;  4ZS9 A;  2FIX A;  2GQ1 A;  4GWS A;  1NH7 A;  3E4R A;  4MAG A;  5H8S A;  4YMB A;  5I57 B;  4TLL B;  4R9G A;  3VLW A;  4I9D A;  4TOZ A;  3NOH A;  3G3J A;  4OVQ A;  3B6Q A;  4EXK A;  4HW8 A;  5IZZ A;  2UYF A;  4NF0 A;  4IR8 A;  4HCW A;  3IAZ A;  3IJX B;  2R71 A;  1RKM A;  3H6T A;  1YPN A;  3ROJ A;  4KXP A;  3MAM A;  5LTC A;  1B7Z A;  4X04 A;  5EYG A;  1NV4 A;  2AL5 A;  3VV5 A;  2BJI A;  4BDN A;  3KZG A;  1DPE A;  1MPD A;  1WVJ A;  4ZEB A;  3O6H A;  5J1D A;  4OAN A;  4NQ8 A;  1I6B A;  3OD7 A;  4KQP A;  2ZYO A;  5EYF A;  5A5L A;  4JBZ A;  2O1L A;  1PBQ A;  1B5J A;  3D1R A;  2NWJ A;  5IGA A;  4H8J A;  3U65 A;  1QKA A;  3O2A A;  4G8H A;  3R6U A;  2DS9 A;  2Y7I A;  5IZ1 A;  2R8T A;  3MC2 A;  5M2V A;  4XIG Q;  5FBP A;  2I6E A;  1B52 A;  3E13 X;  1IMF A;  3S9L C;  1FTJ A;  4PFT A;  2RKM A;  5FHM A;  1BTJ A;  2A5T B;  2XXW A;  3FXQ A;  3AXF A;  4FAJ A;  3T9U A;  4NN3 A;  1ATG A;  2PT2 A;  1N7X A;  1G0I A;  2DVC A;  4NF8 B;  1UTH B;  1B46 A;  1US5 A;  3JYR A;  2HFB A;  2GH9 A;  2CMO A;  2XXU A;  1MY2 A;  4FIM A;  4EXL A;  4N07 A;  3W9W A;  4UAB A;  2I0C A;  3KN3 A;  4R2B A;  1IQ7 A;  4R6H A;  1FTK A;  5DVI A;  2Z23 A;  3PUW E;  1DBZ A;  3CFX A;  3KJ7 A;  2NUV A;  2O6A A;  5CBS A;  4PDD A;  4NTL A;  1B32 A;  3H06 B;  1B3H A;  4DDD A;  4ELO A;  3O28 A;  5KDT A;  1Y9U A;  4X8R A;  5I3S A;  4NWC A;  1DSN A;  4QFP A;  3ONM A;  1FQB A;  2PYY A;  1GVC A;  4OER A;  2CZK A;  2B3F A;  1OMP A;  5DT6 A;  1MPC A;  2FBP A;  4QFN A;  3G3H A;  4U23 A;  4AB6 A;  2DXR A;  3HFU A;  1SQY A;  3Q27 A;  2WEF A;  3DP8 A;  2DP8 A;  1JVY A;  1SD3 A;  1A8F A;  3WAF A;  3FBP A;  3TTM A;  4RJZ A;  1K9Z A;  3PPP A;  3S4U A;  2WX9 A;  5ET5 A;  4N6P A;  3ODB A;  2D3I A;  2KR0 A;  3EPE A;  4EQ7 A;  4I8C A;  2FIE A;  2DSF A;  3HHF A;  1NV7 A;  4I1D A;  4PFI A;  3N26 A;  2O7U A;  2VOZ A;  5BUU A;  2XXH A;  4DI3 D;  4GVO A;  3CFL A;  4G77 A;  2Y7W A;  4P56 A;  3MUQ A;  1P1U A;  1LCF A;  5B7D A;  2REJ A;  5FHN A;  2GHB A;  3FJG A;  1I6A A;  4N15 A;  3T9V A;  4OFJ A;  5IAI A;  1MXU A;  1ZIU A;  1BLF A;  4BDL A;  5CMK A;  1M5E A;  4OHN A;  3S9E A;  4QRZ A;  4MCO A;  2Q2C A;  3V89 B;  3C34 A;  4IO3 A;  2I0B A;  2CZI A;  4IO5 A;  2YLN A;  3VVD A;  1FBG A;  2DDK A;  3IOW A;  1KA1 A;  5FHO A;  3TCG A;  5I56 A;  4OVR A;  2AYS A;  3ZKL A;  1MH4 A;  3ISP A;  2Z22 A;  2DXY A;  1SW2 A;  1LLS A;  2FYI A;  1URG A;  2DE2 A;  3ZS6 A;  3LC8 A;  2Y84 A;  3KC1 A;  3QYT A;  5KDT B;  1LBB A;  3U92 A;  3L6H A;  1MY0 A;  3N6U A;  5CBR A;  2DYX A;  3OO9 A;  1S9T A;  3IX1 A;  3HST A;  3T9H B;  1NL5 A;  1Y20 A;  4PF8 A;  4X1B A;  4Q5T A;  2HEU A;  2WBB A;  4MNI A;  3ILT B;  5JTY A;  1UTB B;  3M8U A;  4E0W A;  2X26 A;  4KYS A;  4FEC A;  2ESN A;  4H45 A;  4H65 A;  1GV8 A;  1MXX A;  1FSA A;  4PFW A;  4GWW A;  2QSX A;  4PF6 A;  5ET8 A;  4IY5 A;  2P0S A;  4U4S A;  3FVK A;  1IMB A;  1B4H A;  3FXB A;  1Y4C A;  1NMU A;  3T22 A;  3BIG A;  3UOR A;  3OEN A;  1H44 A;  3VLV A;  3TTL A;  4GWY A;  4F18 A;  2XXI A;  4YB7 A;  1YYZ A;  4ELP A;  2ZNU A;  1OQG A;  3RT8 A;  3PD8 A;  1N3X A;  4IGT A;  1JW1 A;  4PAI A;  3EHU A;  3K6U A;  3VDF A;  3V83 A;  1R6Z A;  4MNP A;  4F3G A;  4HXV A;  4PC9 A;  3E3K A;  3CI8 A;  4JWX A;  2CEY A;  4PFU A;  1UTH A;  1MXY A;  1MRP A;  4HE1 A;  4X1D A;  1D4N A;  2VT5 A;  3LV0 A;  4MF3 A;  4MH5 A;  4RY1 A;  4LUB A;  3A09 A;  4YU0 A;  3USD A;  1Y3P A;  2QS2 A;  4JB7 A;  4PBQ A;  5DW8 A;  4RK9 A;  2V25 A;  3TEP A;  3PPN A;  1M5C A;  4EF2 A;  1LEV A;  1CB6 A;  5T3J A;  3O29 A;  4IB2 A;  1Y4T A;  1B5H A;  2P3V A;  1LBC A;  4OVS A;  3SET A;  3LSW A;  5TP9 A;  4G61 A;  2IA4 A;  2XXR A;  3MZB A;  3KN7 A;  3VVF A;  4OFL A;  4H6D A;  5I2K B;  4GWU A;  2YPN A;  4JVD A;  4NF5 A;  2XXP A;  4P11 A;  4YMA A;  1NUX A;  1JW4 A;  5IZ3 B;  4XTC Q;  2VHA A;  1S7Y A;  5B70 A;  2XWV A;  1NUY A;  4F2Q A;  4KR5 A;  1DTZ A;  3RY3 A;  2HZL A;  1OVB A;  4RYA A;  1QUJ A;  4OQO A;  2PFY A;  4ZEK A;  1TFD A;  4XKR A;  2Q9T A;  3UN6 A;  2O1M A;  2QJE A;  1FPG A;  4OEU A;  3H6V A;  4QBA A;  4YAH X;  1ZLQ A;  3IO4 A;  3EF7 A;  3FXU A;  3DP6 A;  4OXV A;  3CG1 A;  4ZE8 A;  4QSC A;  4X48 A;  4JWO A;  5AA4 A;  2QPQ A;  1IME A;  1IXG A;  4NX1 A;  1MXV A;  3QXM A;  1DTG A;  5JK4 A;  3KOS A;  2F6G A;  1D9Q A;  1Y1Z A;  2WYK A;  3TQW A;  3FVG A;  4O8M A;  1FQC A;  3PUZ E;  5F1Q A;  5CMM A;  3TEL A;  3CHG A;  1A55 A;  1Q35 A;  1R9Q A;  4PE5 B;  2QVU A;  1SW4 A;  4O3B A;  1SDX A;  4IGR A;  4BDM A;  4TQU Q;  3MVZ A;  1Y3Q A;  2CEX A;  4RPN A;  3IFA A;  1IIW A;  4NF8 A;  5J16 A;  4OVT A;  5KZT A;  3BBR A;  4O3C A;  3UK4 A;  3U94 A;  3S9M C;  4U21 A;  4QSD A;  4RA1 A;  1TFA A;  1IMC A;  1FBE A;  1FPL A;  2XWK A;  5ITP A;  4OZ9 A;  5DEX A;  5I2N B;  4FOR A;  1INP A;  1XVX A;  2PT1 A;  1FQF A;  4H8I A;  1JEU A;  2IEE A;  4HCY A;  1LFG A;  2V3U A;  4LA9 A;  3EHS A;  1QUL A;  2P2A A;  4BDQ A;  3QUJ A;  1XC1 A;  2OLB A;  2BJJ X;  3QAX A;  3DP4 A;  2LAO A;  3BFT A;  2UVI A;  4EQB A;  3ZKK A;  4RK2 A;  1KZ8 A;  1VE4 A;  3Q29 A;  1MQI A;  2OPD A;  2W7Y A;  5ITO A;  5EQ7 A;  4F19 A;  4OYV A;  4R6K A;  3SEY A;  4ESW A;  2VD2 A;  4X9T A;  4NWD A;  4ONY A;  5I58 A;  3K0V A;  3LUZ A;  2RCB A;  3SEU A;  1OQH A;  1B7H A;  1MXW A;  4U2R A;  1M5D A; 
#chains in the Genus database with same CATH homology
 1LBZ A;  2WX9 A;  5ET5 A;  4MHF A;  3RPL A;  3U65 A;  1JP4 A;  2CEX A;  4H45 A;  1LBX A;  4MNC A;  2KR0 A;  1BK4 A;  5IZ1 A;  1FSA A;  1LBV A;  2R8T A;  1FBF A;  2F3B A;  2QFL A;  4GWW A;  2FIE A;  4PF6 A;  5FBP A;  4GWU A;  1NV7 A;  2Y5L A;  3B8B A;  5ET8 A;  4JVD A;  4PFI A;  4F1V A;  3IFA A;  2WYP A;  1IMF A;  3PTY A;  5IM2 A;  1EYK A;  4QXD A;  1FJ9 A;  1FPJ A;  1NI9 A;  1NV2 A;  5J16 A;  4OVT A;  4P9K A;  4YIC A;  4DI3 D;  2DVZ A;  1EYI A;  1NUX A;  1IMB A;  4MEV A;  3E78 A;  2P3N A;  1YXI A;  3KC0 A;  2KQZ A;  4P56 A;  4PFR A;  5IZ3 B;  2PFZ A;  1EYJ A;  3FXB A;  1DCU A;  1FPK A;  3RPL B;  4GWZ A;  1Q9D A;  1YZ0 A;  4GWX A;  4JVC A;  4NN3 A;  1NV5 A;  1NUZ A;  4NG7 A;  4PAK A;  1RDZ A;  3BIG A;  5ESY A;  2XWV A;  2DE4 A;  1NUY A;  1IMC A;  1FPD A;  3A29 A;  4GWY A;  1SPI A;  1K9Y A;  5IZ3 A;  2XWI A;  4N6K A;  1G0I A;  2WBD A;  4F18 A;  4GX3 A;  4AS4 A;  1FBE A;  1FPL A;  2PCR A;  4N15 A;  3SZP A;  4I3Y A;  1KA0 A;  2XWK A;  2B4L A;  4I3E A;  1YYZ A;  4P3L A;  1FBP A;  4N6D A;  2F3D A;  4PFB A;  4N81 A;  4O7M A;  4N4U A;  4OA4 A;  5F24 A;  1VDW A;  2HPG A;  1FJ6 A;  2HZL A;  3MST A;  1FBC A;  4P47 A;  2Q74 A;  1INP A;  4PTK A;  4PAI A;  5LDZ A;  4PE3 A;  3W9W A;  1FPI A;  3BIH A;  4UAB A;  1G0H A;  4GBV A;  2PFY A;  4PET A;  4JVI A;  3RYD A;  1FPF A;  3IFC A;  2XWO A;  2Q9T A;  2B4M A;  1CNQ A;  4MIJ A;  4MNP A;  4PAF A;  4PDH A;  4YZZ A;  3T0J A;  3W9V A;  2FIX A;  2FHY A;  2CZH A;  2GQ1 A;  4MCO A;  1FPG A;  4GWS A;  4H46 A;  2HXR A;  2ZZV A;  4HCY A;  4QBA A;  4HXV A;  4PBH A;  5EQ9 A;  1IMD A;  4M1V A;  4MAG A;  5I5P A;  2Y5K A;  1FPE A;  1DBZ A;  3GYY A;  2XXK A;  4PC9 A;  1NV3 A;  4GX6 A;  4F1U A;  4OVP A;  1FBH A;  2V3Q A;  4O7I A;  2CZI A;  2MKZ A;  1FPB A;  3EKI A;  3NOH A;  2DE3 A;  2CEY A;  4PDD A;  1FBG A;  2DDK A;  4MMP A;  1NUW A;  1KA1 A;  4OVQ A;  1FBD A;  4PCD A;  4XFE A;  4MJO A;  5IZZ A;  5ET6 A;  4LN5 A;  4NGU A;  1QGX A;  1RDY A;  1LBY A;  3B50 A;  4NF0 A;  4IR8 A;  4PGN A;  1NV0 A;  2QPQ A;  1IME A;  4HCW A;  4HE1 A;  1AWB A;  4OVR A;  4O94 A;  4DI4 B;  2L5V A;  4N91 A;  4X8R A;  4NX1 A;  3ISP A;  2OX3 A;  2QVR A;  1XI6 A;  5I3S A;  2JJK A;  3ROJ A;  2VPO A;  2VT5 A;  3LV0 A;  1NV1 A;  3KBZ A;  4KXP A;  5ET7 A;  2HZK A;  5JK4 A;  4I40 A;  4GBW A;  2F5X A;  2XA5 A;  2OWZ A;  2Q8M A;  2DE2 A;  3MYU A;  4P8B A;  5LTC A;  3KC1 A;  3QMF A;  1D9Q A;  1KZ8 A;  4X04 A;  2CZK A;  5EQA A;  3T1B A;  2WYK A;  4PGP A;  5EYG A;  1NV4 A;  4P1E A;  4N8G A;  1RDX A;  2FBP A;  2BJI A;  4GX4 A;  4PBQ A;  4O8M A;  5DW8 A;  5EQ8 A;  4NAP A;  5EQ7 A;  4F19 A;  1DK4 A;  3CHG A;  4FBP A;  4MX6 A;  5J1D A;  4OAN A;  4N8Y A;  2V4C A;  3HFU A;  4NQ8 A;  1LEV A;  3E79 A;  1LBW A;  5EYH A;  2ZZX A;  4X9T A;  5T3J A;  4P1L A;  5CM6 A;  1FRP A;  2QVU A;  2WEF A;  4PF8 A;  4AS5 A;  4NHB A;  1FTA A;  5A5L A;  1NV6 A;  2P3V A;  4OVS A;  4N17 A;  1IMA A;  2WBB A;  3LUZ A;  2FVZ A;  2HHM A;  4G61 A;  4MNI A;  5I7I A;  3D1R A;  4XF5 A;  3FBP A;  2VPN A;  5IGA A;  4HE0 A;  1K9Z A;  4XEQ A;  2QVV A;  4HE2 A;  2ZZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...