3KC0A

Crystal structure of human liver fbpase in complex with tricyclic inhibitor 10b
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
327
structure length
319
Chain Sequence
b'DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Structure-based drug design of tricyclic 8H-indeno[1,2-d][1,3]thiazoles as potent FBPase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3kc0A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3kc0A02
4HE0A 1RDYA 4AS5A 1FBHA 5DW8A 4AS4A 2FBPA 2FIEA 5ET7A 1CNQA 4GBVA 2WEFA 5EYGA 1FBFA 1IMEA 1DK4A 1G0HA 1FPKA 2P3VA 5IZ3B 1NV5A 1YXIA 1IMCA 3RYDA 2GQ1A 4KXPA 5ESYA 1FPIA 2QVVA 3KC0A 1G0IA 5ET6A 1IMBA 1DBZA 3RPLB 1YZ0A 1FBPA 2CZIA 4HE1A 4GWZA 2F3BA 2Q74A 3LV0A 1NV3A 4GWSA 2Y5LA 1K9YA 1EYKA 1LBYA 1D9QA 1Q9DA 2P3NA 2R8TA 2WBBA 5EQ9A 1FBGA 3BIGA 1NUXA 1FPJA 4H46A 4HXVA 1LEVA 1NV4A 2QVRA 2Y5KA 4PTKA 5EQ8A 5ET8A 1YYZA 4IR8A 5FBPA 3QMFA 2BJIA 2FVZA 1NUWA 1FBDA 2FIXA 5I3SA 1FRPA 1LBVA 1NV0A 4MJOA 4I40A 1AWBA 5IZ1A 4GX4A 4H45A 1FJ9A 1NV1A 3KC1A 4GWUA 1QGXA 2VT5A 1FSAA 1SPIA 1NV6A 4FBPA 1NI9A 5T3JA 2DDKA 3IFAA 4QXDA 1FJ6A 1XI6A 4GWXA 1FPLA 3ROJA 5A5LA 1RDXA 1FTAA 1K9ZA 5EQAA 1BK4A 1FBCA 2CZKA 5EQ7A 1LBXA 2HHMA 1FBEA 3RPLA 5ET5A 5J16A 1DCUA 4GX3A 4I3YA 4N81A 1LBWA 1NUYA 5F24A 1KZ8A 1IMFA 3T0JA 2JJKA 2QFLA 1VDWA 2QVUA 5LDZA 1NUZA 1NV2A 2WBDA 2FHYA 2F3DA 2PCRA 3BIHA 4GWWA 3IFCA 4GX6A 1FPGA 4G61A 2Q8MA 2OX3A 3LUZA 4O7IA 1FPBA 4GBWA 4GWYA 1EYJA 3A29A 5IZ3A 2OWZA 1LBZA 1IMDA 3KBZA 1EYIA 4I3EA 4HE2A 5EYHA 1FPFA 3B8BA 1RDZA 1FPEA 1JP4A 3D1RA 1IMAA 1NV7A 1INPA 1FPDA 1KA0A 2CZHA 3FBPA 1KA1A
chains in the Genus database with same CATH superfamily
3TDJA 2DXYA 3G7WA 4NHBA 1OQHA 3UGWA 4G4PA 4DCXA 5H8NB 1B7HA 4TOZA 4N13A 1FBFA 1LAGE 4OEVA 1WVJA 2LAOA 5ESYA 3N6TA 3MQ9A 3IR1A 4YMAA 1DPEA 4KD5A 4RK9A 3DP4A 4AQ4A 3PPPA 4JVDA 2PVUA 4MIJA 4KCCA 1TXFA 1US4A 4XKRA 2I3VA 3BIGA 3OO6A 4JWYA 1ATGA 3HN0A 1XVXA 4ZEDA 1FTJA 4N91A 4MJOA 4I40A 1NL5A 1SI1A 5IZ1A 1VE4A 4RY1A 4U4SA 5TP9B 1OLCA 5I2NA 4N4UA 4YKKA 5A5LA 2PT2A 4LN5A 3TTLA 3RPLA 3PMVA 4QSCA 1EH3A 2OCUA 4K3FA 4GX3A 3T1BA 5IGAA 3OSQA 1L5TA 3HV1A 2JJKA 3MUQA 4OFOA 1I6QA 1BKAA 3G3IA 3S4UA 1MM6A 1FPGA 2OX3A 3OENA 2XX9A 4TLLB 4GWYA 4H1XA 5H8FA 4OWDA 2IEEA 4MHFA 4EXKA 5CMCA 4LA9A 2B3BA 1LAFE 3IX1A 1A8EA 2QSXA 3EKIA 4H6DA 3MZ9A 5I2NB 3IOWA 3E3KA 1AIVA 2B4MA 4QRZA 1OLAA 3RN8A 3T9HB 5L9SA 3RPLB 1G0IA 5I2KB 2WKYA 4H8IA 3MPLA 2PBWA 3FATA 1YPNA 1M5DA 4GRKA 3M8UA 1K9YA 1LBYA 3OOAA 3U8QA 3KOSA 4N17A 2XXXA 5I59A 1FBGA 1DSNA 4H46A 2HAVA 1NV4A 1B4ZA 3C35A 4IR8A 4EXLA 5H8FB 5AA3A 3RTFB 4O94A 4N8YA 3IO4A 3O97A 4H45A 5LOMA 3IK6B 4FATA 3T9UA 1NV1A 3DP6A 4DCYA 1FSAA 1NV6A 1URDA 1JETA 1PB9A 4QXDA 1FJ6A 1FPLA 1B0HA 3ROJA 2REGA 3PUYE 4DXUA 1IZ1A 3ODBA 3ECRA 1FBCA 3LC8A 1FQBA 5I5PA 1DCUA 1MG1A 3KBRA 4F1UA 3FV2A 4OZ9A 3TYHA 1J1NA 3CSBA 3T0JA 1MDQA 3ONMA 4Q8RA 2NXOA 1I6AA 2FHYA 1D9VA 1TWYA 2XX7A 3LUZA 2D3IA 3CG1A 1LBZA 4PFYA 1FPFA 5KZTA 4QFNA 1Y4CA 1QUJA 1IIWA 1MPBA 1PDAA 1WDNA 3KJTA 2ESNA 3SEYA 3VXCA 2V3QA 4E0XA 2B4LA 1CNQA 3C9HA 3LSFB 5KDTB 4QF9A 1I69A 3P7IA 1MQIA 4N8GA 4OYVA 1B05A 4NWCA 4HCYA 2KQZA 1ELJA 1DBZA 4JVCA 1A8FA 1B5JA 1PB7A 1VR5A 4GWZA 3EF7A 3CFZA 3N6UA 1B0LA 2H99A 3CI8A 4LZ7A 3USDA 3K1NA 3VLWA 1Y3PA 4UACA 4F3PA 5EQ8A 2QVRA 2VD2A 3GBAA 3H7MA 3MC2A 3OEMA 4ZEKA 4MH5A 1UTBB 3RNNA 1H3DA 3E13X 2DOJA 2AL4A 2DDKA 2M8CA 3UP9A 1MY2A 5CBRA 4P47A 4O8MA 3K2DA 1LBXA 5ICQA 4LQ5A 4PBQA 2WX9A 4IY6A 1LBWA 1T0KA 4PBHA 4MX6A 4U21A 3OD7A 5F7VA 3G3JA 3IB1A 1ZBMA 3H3GA 5TPAA 2OK2A 5LTCA 1N84A 3Q26A 1CB6A 2I58A 1FPEA 4I8CA 2HFBA 4OXVA 4XKQA 1OVTA 1YAEA 1MXVA 5EHSA 1TT1A 1B7ZA 4POXA 4F2OA 4R73A 1Z7ME 2FBPA 1NKXA 5ET7A 3UORA 1USYE 1JW4A 3V89B 1NH7A 2O69A 4R2BA 4PCDA 4PF8A 3IOTA 4PAIA 2GQ1A 1TFDA 3T96B 3KC0A 3K1MA 1FBPA 2W7YA 5H8QA 5CC2A 3BFTA 1ANFA 3K4UA 4PGNA 3G3GA 2O84X 2KR0A 4L17A 1LBCA 2PX1A 2UVJA 5TPAB 1B7UA 4F3BA 4OVTA 4AB6A 2P2AA 4N07A 5AA4A 2F36A 2A5SA 2DE2A 1FJ9A 5HPQA 3PD9A 3O2AA 4U23A 1A54A 3TAJA 4GF8A 4PQJA 5KCJA 3VV5A 1IUDA 1QULA 3QUJA 3B6TA 1Y3NA 3TTMA 3U92A 2ALUA 3PGFA 2DP8A 4R9GA 4I3YA 1AMFA 4R2FA 4YAHX 2DSFA 5H8QB 1A40A 2XWIA 4FE8A 2I4BA 1GTKA 4KFQA 3UN6A 2DWAA 4Q0CA 4R6KA 1QVSA 4R9FA 1MXXA 2XXWA 2F78A 4ZDMA 4NWDA 2PFYA 1PB8A 3GLBA 1RDZA 3F11A 3KSJA 5AA4B 1MXZA 1INPA 1PC3A 3PU5A 2HXRA 3W9VA 4OENA 3C36A 3TFLA 1I6BA 1N3XA 3SESA 5B70A 1RDYA 2Q89A 5BUUA 2I6EA 2VGQA 3CIJA 1IITA 4X1BA 1D4NA 2F6GA 1MY1A 1NV5A 4OANA 1LGBC 3VE1B 1B6HA 1YZ0A 3THIA 4HE1A 2XWVA 3U1OA 4NEDA 4KHZE 4BDQA 3MVZA 1SDXA 3TTNA 3VVDA 5K2XA 1B1XA 4ZEBA 4GWSA 3RT6B 1KWHA 2P3NA 5EQ9A 1XT8A 3PUZE 1MQDA 1NMUA 1LEVA 4F3GA 2AYSA 4PAFA 4YKIA 4UA8A 2UXAA 3H03A 1NUWA 1QUKA 1SW4A 2BJJX 2F7BA 1AWBA 2DVZA 3KJ7A 2O1MA 1H76A 4FBPA 5T3JA 3C32A 4JWXA 3K0VA 3KZGA 1FTAA 1Y9UA 2F8DA 3C33A 3VLUA 2RKMA 2FNCA 3H6TA 4GLIA 1IEJA 4XTCQ 5A5XA 1VDWA 3FVOA 2AIXA 4FEBA 4M1VA 3PPRA 2B65A 3N94A 3GYYA 4G61A 2H98A 2V93A 4ZS9A 1GVCA 4PDDA 1MRPA 3MVXA 2E1SA 1JP4A 3QSLA 1B5IA 4JVIA 4MNPA 5IM2A 3T9VA 4NF6A 5FHOA 3U65A 3TELA 2Y7IA 3I3VA 1NFTA 1UTHB 3RT8A 4U1ZA 2XA5A 1UIVA 2WEFA 5DYHA 5AE4A 3GXAA 1DK4A 3IOVA 4P1LA 1O64A 2Z8EA 1GR2A 4O3AA 2ZYOA 2CZIA 3OO7A 4XFEA 2D5WA 5A5XB 3E4RA 3EN3A 5TP9A 3ZKLA 3KFMA 4EF2A 3BFUA 4RYAA 1LBBA 4NGUA 4IO3A 3GBBA 4ISUA 1EZ9A 5I3SA 1B32A 1NV0A 1B3HA 4KPTA 1QW0A 4NF6B 4PE5B 1MS7A 2UVHA 1IXHA 2XXUA 4O3BA 1NNKA 5DVIA 3PUWE 3L6HA 2ZNTA 4DXCA 5EQAA 2PFZA 3FXBA 4WEDA 1R1NA 3MP1A 2R9JA 4U22A 2DYXA 5ET5A 3QK6A 2I48A 4LONB 1LAXA 1MH4A 1JEUA 2XXTA 5DVFA 4GWWA 4YU0A 5H8HB 3RLFE 1EYJA 4GXSB 4GL8A 4GIZA 4UABA 1SD3A 1RYXA 5I2KA 1LFIA 4M4GA 2I3WA 3VVEA 4N6PA 2UYEA 1MQGA 3KN8A 5EYGA 2XXHA 2Q2AA 4C1TA 3A09A 2ZYNA 3EHUA 2XHDA 3TTRA 4PETA 2XD3A 4KXPA 2QVVA 3RY3A 4EUOA 5FHMA 2Q9TA 2ZNUA 1LFGA 2XXPA 5CMKA 1P1NA 2F35A 3OXNA 3B6QA 1SW2A 4GWOA 3RPWA 3TQLA 4N15A 4C1UA 2XWKA 2Y5KA 2X7QA 3TUSA 4XXUA 4F3SA 4G68A 3S9EA 3V8XB 4P56A 3A3CA 4GWUA 1FW0A 3S9MC 3W15C 4OA4A 4GOTA 3SEXA 4XIGQ 2H5YA 1K9ZA 1D3KA 2H4IA 1XS5A 2DWJA 2ABHA 1PBQA 3PUXE 2DE4A 2RCBA 1IMFA 4I9DA 4YB6A 1MXUA 2QS2A 1B1HA 2QVUA 1FQAA 3MP6A 4RNSA 2PCRA 4GX6A 1BTJA 4IB2A 5KDTA 3VDFA 3QIMA 1Y20A 5CM6A 4IO2A 1EYIA 4PAKA 4NF0A 3IL1B 3H6UA 4KYDA 3Q28A 3FXUA 3QYTA 4G68B 5M2VA 4FECA 5CI5A 2YLNA 4OQOA 2GRVA 4IO6A 4HCWA 5FTHA 1O63A 5IZ3B 5CMBA 2G93A 3RUMA 1UTBA 1BLFA 2OWTA 1B3EA 2F3BA 2Q74A 5J1DA 3FJMA 2XX8A 1MY0A 4NMYA 3PTYA 4ESWA 2R8TA 3DELB 3TKDA 1HSLA 1DOTA 2GHAA 3Q25A 3ISPA 4HXVA 1FCKA 5ET8A 3SEVA 3KN3A 4H5GA 5I58B 2QRYA 3FIRA 1CE2A 4FEDA 1P1QA 4JSDA 4MAGA 2BJIA 1B3GA 3PV0E 4F39A 4F31B 1P1WA 2I0CA 2P0SA 3IFAA 5JTYA 4DI3D 1SQYA 2QS4A 1RDXA 4PFWA 1ZU0A 2V3UA 3CFXA 1Z7NE 4C0RA 4Q30B 1NUYA 3H6VA 4YB5A 2D21A 3MBPA 2QFLA 4KYSA 2OJTA 1S9TA 1B58A 1NUZA 1MH3A 4R6YA 4F2QA 2QL3A 4LUBA 2HZKA 4NTLA 4THIA 2G29A 4GBWA 4OTEA 2OWZA 4YKPA 3TPAA 4MCOA 3BKIB 2H9BA 4F1YA 4KR5A 3ZKKA 4R74A 5EHMA 2Z8DA 4ECFA 3N5LA 4G8NA 2F7AA 4QFOA 3T22A 4PFTA 2FYIA 1XOCA 4EDPA 3AXFA 3MPKA 1LCTA 2OPEA 2DE3A 5JTYB 2DWIA 2O6AA 4DXBA 1MY3A 4P0IA 1G0HA 4ELOA 2F7CA 4F19A 2ANJA 4YKJA 2R6GE 3SZPA 2OWSA 2RINA 3LSWA 2DVCA 1LB9A 4QFPA 3LUYA 1NV3A 2Z8FA 4TQUQ 2A5TB 3GZGA 2VPOA 2DS9A 3QAXA 2VOZA 3RGYA 3QXMA 4PTKA 4I62A 4LQ2A 1YYZA 5FBPA 2DQVA 2YJPA 5JK4A 1QUIA 3TEPA 2QJEA 3EHSA 4X1DA 1B9JA 4R75A 1A55A 4OVQA 1EZPA 1B4HA 2RC9A 1NI9A 4ZZEA 1Y1MA 4E0WA 1XI6A 3FD3A 3TCFA 3B50A 1XHYA 3G3HA 3B7DA 2CZLA 4P3LA 4PF6A 4DZ1A 4BLAA 2OZZA 3N26A 4GVOA 4HTGA 5ELVA 1N3WA 2FA7A 3LSLA 2F34A 1DTZA 3FV1A 3SEUA 2F5XA 1FTKA 2XXIA 1RYOA 1XVYA 2E0SA 5BWJA 2RC8A 2F3DA 1M5EA 1N7XA 1YTVA 4OVRA 4ESXA 1XC1A 4DDDA 2Q8MA 2VHAA 2WYPA 3O29A 4NF4B 1LSTA 3OSRA 2Y84A 4MNCA 3O6HA 3K1PA 4JBZA 4MLVA 1ZTYA 1SW1A 2UYFA 4MFIA 3FBPA 3MVWA 2L5VA 1HSEA 1VSOA 3KSXA 3IAZA 2DWHA 4RA1A 4YICA 3MYUA 1IMCA 1JVYA 2YPNA 1LFHA 1IMBA 2VD3A 4PFBA 4OFJA 2PYYA 4MMPA 1ZMGA 2CMOA 4F1VA 2Q88A 4P1EA 2NWJA 4EQBA 1QKAA 1NUXA 1FPJA 5DEXB 5B7DA 2WYKA 2NUVA 4BDMA 4H65A 3MP8A 4OETA 2FVZA 4N6DA 2Z22A 2GFEA 3MJNA 4BDOA 3OO9A 4MBPA 5AA1A 4FJPA 3EPEA 4IO5A 1FQCA 2ZZXA 4ELPA 4XKPA 2I49A 4NF5A 4KCDA 3FJGA 4ZZAA 1N04A 4GFRA 1YCJA 3ILTB 4PFIA 2ONSA 5EYFA 1P1OA 5J16A 4HW8A 3FJ7A 5F24A 3G3KA 3OELA 1MY4A 4G8MA 4O3CA 3HSTA 1UTHA 1MPCA 4NE4A 1SVXB 2NVUB 1AOVA 3SDFA 3A29A 4ONYA 5EYHA 4PFUA 1JQFA 3JYRA 5ITOA 2HQ0A 4F22A 4H0WA 2R71A 3T9XB 1P99A 2ZYKA 1FBHA 4AS4A 4GQOA 3C31A 4NF5B 3U94A 3MSTA 1YXIA 5I56A 2ZNSA 4NX1A 3DM0A 2RC7A 5CRYA 1EYKA 1FQFA 3TODA 5DVJA 1ZLQA 5IZZA 2WBBA 4JWOA 4FAJA 4JXIA 4QSDA 2P1SA 3FZVA 3W9WA 1DPPA 4OVSA 1NNPA 4AB5A 3VLVA 3QMFA 1OMPA 3TZAA 2FIXA 2HEUA 2Y7WA 4RPNA 3E78A 3MZBA 1M5CA 4WXJA 1QJMA 3CHGA 5H8HA 4R6HA 3PUVE 3G3FA 1LLSA 3M3LA 3R6UA 4RJZA 4QFLA 4JDFA 3T66A 3MWBA 4YZZA 5I56B 3D4GA 3HHFA 4BDRA 5CBSA 5L9OA 1GGGA 1IXIA 3E79A 3IOUA 1NV2A 4QSEA 4LP2B 3IB2A 4P0GA 1IQ7A 3PPQA 5FHNA 4G68C 3MW0A 3V83A 3B6WA 3I5OA 4PFRA 3VFJA 2I0BA 2GHBA 3S9NC 2Z23A 4PC9A 4EQ7A 4MNIA 3ZS6A 4X9TA 4IO7A 1BP5A 4YB7A 5HBCA 4QBAA 4P8BA 4YMBA 4RXLA 4NG7A 3M3KA 5DW8A 1ZKBA 2FIEA 1FTLA 3CRBA 1Y4TA 1A99A 4EF1A 4OERA 1D9YA 3FGSA 1FPKA 2P3VA 3RYDA 2CEYA 4U2RA 4U4XA 4XF5A 4MLQA 4GXAA 5I84A 4ZE8A 2OBGA 1O7TA 2ZXTA 1Y3QA 3ILUB 1B40A 4BDLA 4Z7EA 1NH8A 2QMWA 1ZIUA 1RKMA 3KGCA 1SYHA 3EHTA 3QUFA 2IA4A 3KEIA 3D4CA 5IKBA 3EQ1A 4X8RA 4LVQA 4DIGA 2H25A 1EZOA 3VXBA 4NN3A 4H5FA 1B5HA 1B51A 3TCHA 1H45A 1JNFA 1BK4A 3A3UA 4RPOA 3SEWA 3CG3A 3MZ1A 1LB8A 4LATA 4MEVA 1FBEA 3K00A 3FVNA 3K02A 2ZYMA 5ITPA 1FTMA 3CFLA 3IJXB 2QPQA 3HPIA 1VFEA 1S7YA 4HS7A 1POTA 2QS3A 5I7IA 4ZECA 4GL0A 1OVBA 3IJOB 5F1QA 5IZ3A 3IO6A 4I3EA 1IMDA 3KBZA 2QMXA 3B8BA 1IXCA 3TQWA 1SYIA 3HFUA 1NNFA 3LR1A 2ONKE 2QS1A 2ONRA 3Q27A 2CZHA 4KI0E 2UVIA 4PGPA 2V4CA 1SW5A 5CMMA 4AS5A 1PBPA 1N0TA 4GBVA 5I57A 5I58A 4IGRA 2Y7KA 3DLNA 4NAPA 4ZEIA 3FXRA 4BDNA 2O51A 2XD2A 3O9PA 3HHGA 3LV0A 3CSGA 3UIFA 1FQEA 2Q8JA 1B2HA 3PPNA 1LAHE 4X48A 1JEVA 3L6GA 2PMSA 2PT1A 3O66A 4WKMA 1WODA 4ZE9A 1R9LA 4H67A 4NF8A 2I4CA 2VPNA 4JSOA 1BIYA 1QGXA 4OVPA 4DLDA 1DTGA 1B3FA 3HO7A 3RTWB 1M5BA 5I59B 2OPDA 4MF3A 3TTKA 1IXGA 1JW5A 5I57B 2REJA 4XEQA 2OLBA 1FTOA 3K6VA 4OVJA 4ZEFA 3U93A 3TMGA 3R26A 4ND9A 4OHNA 2ZMBA 1FPBA 1Q1KA 2NOOA 1N76A 3WAFA 4HE2A 5AA2D 3HCQA 1MPDA 3KN7A 1IMAA 4O7MA 1MXYA 4U1OA 3H6WA 1URSA 2MKZA 4NF8B 1NNTA 1MXWA 1KA1A 3O6IA 4LZ8A 2V25A 1TFAA 3V5AA 2A5TA 2O7IA 3JZJA 4PE3A 2ZZVA 3OEKA 3R7XA 3JV9A 3MVYA 5AA2A 4NQ8A 5K2YA 2HXWA 4X04A 1UQWA 3PMXA 2HCAA 3C34A 1N7WA 3OMBA 1POY1 1MQHA 4F29A 3K01A 4FIMA 2ZZWA 5JEIA 4QFKA 3IB0A 1USYH 1MQJA 2O1LA 3LSXA 5DT6A 1B52A 2VP1A 2XWOA 5IAIA 1H44A 2UVGA 3SETA 1Y1ZA 2XXQA 3M3FA 3T93B 1H43A 4GWXA 1R6ZA 1PEBA 4NF4A 4LZ5A 5AA2B 4N81A 1KZ8A 1AL3A 2RF1A 3KOTA 4FORA 3C4MA 3OO8A 3K6UA 3VVFA 3FUZA 4IGTA 4F18A 4WEPA 4POWA 3IORA 1ZJLA 1MM7A 3BBRA 3D1RA 3FVGA 4XKNA 1KA0A 4G77A 4OMBA 3PMWA 3UK4A 2CEXA 2DXRA 1DMBA 2O68A 2HZLA 5DEXA 1IMEA 1S50A 4P9KA 5TU0A 2HAUA 3O28A 3U72A 1R9QA 1B3LA 3NOHA 4OEUA 4DE8A 2Y5LA 3K6WA 1D9QA 1Q9DA 1FQDA 2O7UA 3FXQA 4JB7A 3MAMA 1HSJA 3S2VA 1SBPA 2Y7RA 4IO4A 2XXVA 4H8JA 3PD8A 2V84A 1VFDA 2Q2CA 4R72A 1US5A 2F97A 5EQ7A 1AH5A 1LCFA 2HHMA 2RCAA 4RK2A 2V3TA 4IY5A 1QKBA 5LDZA 2XXKA 3E9XA 4KYEA 3BIHA 4DI4B 3TCGA 4O7IA 3KG2A 1F9BA 5KCJB 3I6VA 4KQPA 5L9MA 3UA8A 1NV7A 1FPDA 3O6GA 3SKPA 2Y7PA 4PDHA 1MDP1 4HE0A 4QHQA 5H8SA 1B46A 2THIA 1OQGA 5HM4B 1A7LA 3LBSA 2X7PA 4N6KA 1FPIA 5ET6A 4EQ9A 4Q5TA 1JW1A 2X26A 4PP0A 3ZSFA 3SERA 5ICTA 2GH9A 4ELQA 4P11A 4I1DA 1Q35A 3FVKA 1SI0A 1M5FA 4OFLA 1GV8A 4ELRA 3CR9A 2F6PA 1EU8A 1FBDA 1FRPA 1LBVA 5FTIA 4G2ZA 4GX4A 3WAEA 3KC1A 2KLFA 1URGA 2VT5A 2XXRA 1SPIA 5H8NA 3DP8A 3RQTA 2CZKA 3Q29A 3PPOA 3H4ZA 3FASA 1P1UA 4GD5A 1UIUA 3S9LC 4G8HA 2WBDA 1OIBA 2XXYA 5L8DA 3IFCA 1II5A 2HPGA 5DTBA 2B3FA 3CVGA 3K6XA 2AL5A 4TLMB 4OESA 1JVXA 3H06B 4Z0IA 5ISUA
chains in the Genus database with same CATH topology
4NHBA 1RDYA 4AS5A 2DE3A 4GBVA 1FBFA 1G0HA 1NV5A 4F19A 4NAPA 4OANA 5ESYA 1YZ0A 3SZPA 4HE1A 2XWVA 3LV0A 1NV3A 4GWSA 4JVDA 2P3NA 4MIJA 5EQ9A 2VPOA 3BIGA 1LEVA 4PTKA 4PAFA 1YYZA 5FBPA 1NUWA 5JK4A 4N91A 4MJOA 4I40A 1AWBA 5IZ1A 2DVZA 2VPNA 4OVQA 1QGXA 4OVPA 4FBPA 5T3JA 1NI9A 1XI6A 3B50A 4N4UA 5A5LA 1FTAA 4P3LA 4PF6A 4LN5A 3RPLA 4XEQA 4GX3A 2F5XA 3T1BA 5IGAA 2JJKA 1VDWA 4M1VA 2F3DA 4OVRA 3GYYA 1FPGA 4G61A 2Q8MA 2OX3A 1FPBA 2WYPA 4PDDA 4GWYA 4HE2A 4MNCA 1JP4A 4JVIA 4MHFA 4MNPA 5IM2A 1IMAA 4O7MA 3U65A 2MKZA 3FBPA 1KA1A 2L5VA 3EKIA 2XA5A 4PE3A 2WEFA 2ZZVA 1DK4A 4YICA 4NQ8A 2B4MA 3MYUA 4P1LA 1IMCA 4X04A 3RPLB 1G0IA 1IMBA 4PFBA 2CZIA 4XFEA 4MMPA 4F1VA 2ZZWA 1K9YA 4P1EA 1LBYA 4N17A 4NGUA 1FBGA 1NUXA 1FPJA 4H46A 1NV4A 2WYKA 4IR8A 2FVZA 5I3SA 1NV0A 4O94A 4N6DA 4N8YA 2XWOA 4H45A 1NV1A 1FSAA 1NV6A 4QXDA 2ZZXA 1FJ6A 4GWXA 1FPLA 3ROJA 5EQAA 1FBCA 2PFZA 3FXBA 4PFIA 5ET5A 5J16A 1DCUA 5I5PA 4F1UA 4N81A 5F24A 1KZ8A 3T0JA 2FHYA 4GWWA 3LUZA 4F18A 1EYJA 3A29A 1LBZA 5EYHA 1FPFA 4UABA 3D1RA 1KA0A 2CEXA 2V3QA 1FBHA 4AS4A 5EYGA 1CNQA 2B4LA 2HZLA 1IMEA 4P9KA 3MSTA 4N8GA 1YXIA 4PETA 4HCYA 4KXPA 2QVVA 2KQZA 4NX1A 1DBZA 4JVCA 4GWZA 3NOHA 2Q9TA 2Y5LA 1EYKA 1D9QA 1Q9DA 5IZZA 2WBBA 4N15A 2XWKA 5EQ8A 2QVRA 2Y5KA 3W9WA 4OVSA 3QMFA 2FIXA 3E78A 4P56A 4GWUA 3CHGA 2DDKA 4OA4A 4P47A 1K9ZA 4O8MA 5EQ7A 1LBXA 2HHMA 4YZZA 2DE4A 4PBQA 2WX9A 1LBWA 4PBHA 1IMFA 4MX6A 3E79A 2QVUA 5LDZA 1NV2A 2XXKA 2PCRA 3BIHA 4GX6A 4DI4B 4O7IA 5CM6A 5LTCA 4PFRA 1EYIA 4PAKA 4NF0A 4PC9A 1FPEA 4MNIA 1NV7A 4X9TA 1FPDA 4QBAA 4PDHA 4P8BA 4HE0A 4NG7A 5DW8A 2FBPA 2FIEA 5ET7A 4HCWA 1FPKA 2P3VA 5IZ3B 3RYDA 2CEYA 4PCDA 4N6KA 4PF8A 4PAIA 2GQ1A 1FPIA 3KC0A 5ET6A 4XF5A 1FBPA 2F3BA 2Q74A 5J1DA 4PGNA 2KR0A 3PTYA 2R8TA 3ISPA 4HXVA 5ET8A 4OVTA 4MAGA 2BJIA 1FBDA 4X8RA 1FRPA 1LBVA 2DE2A 4GX4A 1FJ9A 3KC1A 4NN3A 2VT5A 1SPIA 3IFAA 4DI3D 1RDXA 1BK4A 2CZKA 4MEVA 1FBEA 4I3YA 1NUYA 2QPQA 2QFLA 2XWIA 1NUZA 2WBDA 5I7IA 2HZKA 3IFCA 2HPGA 4GBWA 2PFYA 5IZ3A 2OWZA 4I3EA 1IMDA 3KBZA 3B8BA 4MCOA 1RDZA 3HFUA 1INPA 2CZHA 2HXRA 3W9VA 4PGPA 2V4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HE0 A;  1RDY A;  4AS5 A;  1FBH A;  5DW8 A;  4AS4 A;  2FBP A;  2FIE A;  5ET7 A;  1CNQ A;  4GBV A;  2WEF A;  5EYG A;  1FBF A;  1IME A;  1DK4 A;  1G0H A;  1FPK A;  2P3V A;  5IZ3 B;  1NV5 A;  1YXI A;  1IMC A;  3RYD A;  2GQ1 A;  4KXP A;  5ESY A;  1FPI A;  2QVV A;  3KC0 A;  1G0I A;  5ET6 A;  1IMB A;  1DBZ A;  3RPL B;  1YZ0 A;  1FBP A;  2CZI A;  4HE1 A;  4GWZ A;  2F3B A;  2Q74 A;  3LV0 A;  1NV3 A;  4GWS A;  2Y5L A;  1K9Y A;  1EYK A;  1LBY A;  1D9Q A;  1Q9D A;  2P3N A;  2R8T A;  2WBB A;  5EQ9 A;  1FBG A;  3BIG A;  1NUX A;  1FPJ A;  4H46 A;  4HXV A;  1LEV A;  1NV4 A;  2QVR A;  2Y5K A;  4PTK A;  5EQ8 A;  5ET8 A;  1YYZ A;  4IR8 A;  5FBP A;  3QMF A;  2BJI A;  2FVZ A;  1NUW A;  1FBD A;  2FIX A;  5I3S A;  1FRP A;  1LBV A;  1NV0 A;  4MJO A;  4I40 A;  1AWB A;  5IZ1 A;  4GX4 A;  4H45 A;  1FJ9 A;  1NV1 A;  3KC1 A;  4GWU A;  1QGX A;  2VT5 A;  1FSA A;  1SPI A;  1NV6 A;  4FBP A;  1NI9 A;  5T3J A;  2DDK A;  3IFA A;  4QXD A;  1FJ6 A;  1XI6 A;  4GWX A;  1FPL A;  3ROJ A;  5A5L A;  1RDX A;  1FTA A;  1K9Z A;  5EQA A;  1BK4 A;  1FBC A;  2CZK A;  5EQ7 A;  1LBX A;  2HHM A;  1FBE A;  3RPL A;  5ET5 A;  5J16 A;  1DCU A;  4GX3 A;  4I3Y A;  4N81 A;  1LBW A;  1NUY A;  5F24 A;  1KZ8 A;  1IMF A;  3T0J A;  2JJK A;  2QFL A;  1VDW A;  2QVU A;  5LDZ A;  1NUZ A;  1NV2 A;  2WBD A;  2FHY A;  2F3D A;  2PCR A;  3BIH A;  4GWW A;  3IFC A;  4GX6 A;  1FPG A;  4G61 A;  2Q8M A;  2OX3 A;  3LUZ A;  4O7I A;  1FPB A;  4GBW A;  4GWY A;  1EYJ A;  3A29 A;  5IZ3 A;  2OWZ A;  1LBZ A;  1IMD A;  3KBZ A;  1EYI A;  4I3E A;  4HE2 A;  5EYH A;  1FPF A;  3B8B A;  1RDZ A;  1FPE A;  1JP4 A;  3D1R A;  1IMA A;  1NV7 A;  1INP A;  1FPD A;  1KA0 A;  2CZH A;  3FBP A;  1KA1 A; 
#chains in the Genus database with same CATH topology
 3TDJ A;  2DXY A;  3G7W A;  4NHB A;  1OQH A;  3UGW A;  4G4P A;  4DCX A;  5H8N B;  1B7H A;  4TOZ A;  4N13 A;  1FBF A;  1LAG E;  4OEV A;  1WVJ A;  2LAO A;  5ESY A;  3N6T A;  3MQ9 A;  3IR1 A;  4YMA A;  1DPE A;  4KD5 A;  4RK9 A;  3DP4 A;  4AQ4 A;  3PPP A;  4JVD A;  2PVU A;  4MIJ A;  4KCC A;  1TXF A;  1US4 A;  4XKR A;  2I3V A;  3BIG A;  3OO6 A;  4JWY A;  1ATG A;  3HN0 A;  1XVX A;  4ZED A;  1FTJ A;  4N91 A;  4MJO A;  4I40 A;  1NL5 A;  1SI1 A;  5IZ1 A;  1VE4 A;  4RY1 A;  4U4S A;  5TP9 B;  1OLC A;  5I2N A;  4N4U A;  4YKK A;  5A5L A;  2PT2 A;  4LN5 A;  3TTL A;  3RPL A;  3PMV A;  4QSC A;  1EH3 A;  2OCU A;  4K3F A;  4GX3 A;  3T1B A;  5IGA A;  3OSQ A;  1L5T A;  3HV1 A;  2JJK A;  3MUQ A;  4OFO A;  1I6Q A;  1BKA A;  3G3I A;  3S4U A;  1MM6 A;  1FPG A;  2OX3 A;  3OEN A;  2XX9 A;  4TLL B;  4GWY A;  4H1X A;  5H8F A;  4OWD A;  2IEE A;  4MHF A;  4EXK A;  5CMC A;  4LA9 A;  2B3B A;  1LAF E;  3IX1 A;  1A8E A;  2QSX A;  3EKI A;  4H6D A;  3MZ9 A;  5I2N B;  3IOW A;  3E3K A;  1AIV A;  2B4M A;  4QRZ A;  1OLA A;  3RN8 A;  3T9H B;  5L9S A;  3RPL B;  1G0I A;  5I2K B;  2WKY A;  4H8I A;  3MPL A;  2PBW A;  3FAT A;  1YPN A;  1M5D A;  4GRK A;  3M8U A;  1K9Y A;  1LBY A;  3OOA A;  3U8Q A;  3KOS A;  4N17 A;  2XXX A;  5I59 A;  1FBG A;  1DSN A;  4H46 A;  2HAV A;  1NV4 A;  1B4Z A;  3C35 A;  4IR8 A;  4EXL A;  5H8F B;  5AA3 A;  3RTF B;  4O94 A;  4N8Y A;  3IO4 A;  3O97 A;  4H45 A;  5LOM A;  3IK6 B;  4FAT A;  3T9U A;  1NV1 A;  3DP6 A;  4DCY A;  1FSA A;  1NV6 A;  1URD A;  1JET A;  1PB9 A;  4QXD A;  1FJ6 A;  1FPL A;  1B0H A;  3ROJ A;  2REG A;  3PUY E;  4DXU A;  1IZ1 A;  3ODB A;  3ECR A;  1FBC A;  3LC8 A;  1FQB A;  5I5P A;  1DCU A;  1MG1 A;  3KBR A;  4F1U A;  3FV2 A;  4OZ9 A;  3TYH A;  1J1N A;  3CSB A;  3T0J A;  1MDQ A;  3ONM A;  4Q8R A;  2NXO A;  1I6A A;  2FHY A;  1D9V A;  1TWY A;  2XX7 A;  3LUZ A;  2D3I A;  3CG1 A;  1LBZ A;  4PFY A;  1FPF A;  5KZT A;  4QFN A;  1Y4C A;  1QUJ A;  1IIW A;  1MPB A;  1PDA A;  1WDN A;  3KJT A;  2ESN A;  3SEY A;  3VXC A;  2V3Q A;  4E0X A;  2B4L A;  1CNQ A;  3C9H A;  3LSF B;  5KDT B;  4QF9 A;  1I69 A;  3P7I A;  1MQI A;  4N8G A;  4OYV A;  1B05 A;  4NWC A;  4HCY A;  2KQZ A;  1ELJ A;  1DBZ A;  4JVC A;  1A8F A;  1B5J A;  1PB7 A;  1VR5 A;  4GWZ A;  3EF7 A;  3CFZ A;  3N6U A;  1B0L A;  2H99 A;  3CI8 A;  4LZ7 A;  3USD A;  3K1N A;  3VLW A;  1Y3P A;  4UAC A;  4F3P A;  5EQ8 A;  2QVR A;  2VD2 A;  3GBA A;  3H7M A;  3MC2 A;  3OEM A;  4ZEK A;  4MH5 A;  1UTB B;  3RNN A;  1H3D A;  3E13 X;  2DOJ A;  2AL4 A;  2DDK A;  2M8C A;  3UP9 A;  1MY2 A;  5CBR A;  4P47 A;  4O8M A;  3K2D A;  1LBX A;  5ICQ A;  4LQ5 A;  4PBQ A;  2WX9 A;  4IY6 A;  1LBW A;  1T0K A;  4PBH A;  4MX6 A;  4U21 A;  3OD7 A;  5F7V A;  3G3J A;  3IB1 A;  1ZBM A;  3H3G A;  5TPA A;  2OK2 A;  5LTC A;  1N84 A;  3Q26 A;  1CB6 A;  2I58 A;  1FPE A;  4I8C A;  2HFB A;  4OXV A;  4XKQ A;  1OVT A;  1YAE A;  1MXV A;  5EHS A;  1TT1 A;  1B7Z A;  4POX A;  4F2O A;  4R73 A;  1Z7M E;  2FBP A;  1NKX A;  5ET7 A;  3UOR A;  1USY E;  1JW4 A;  3V89 B;  1NH7 A;  2O69 A;  4R2B A;  4PCD A;  4PF8 A;  3IOT A;  4PAI A;  2GQ1 A;  1TFD A;  3T96 B;  3KC0 A;  3K1M A;  1FBP A;  2W7Y A;  5H8Q A;  5CC2 A;  3BFT A;  1ANF A;  3K4U A;  4PGN A;  3G3G A;  2O84 X;  2KR0 A;  4L17 A;  1LBC A;  2PX1 A;  2UVJ A;  5TPA B;  1B7U A;  4F3B A;  4OVT A;  4AB6 A;  2P2A A;  4N07 A;  5AA4 A;  2F36 A;  2A5S A;  2DE2 A;  1FJ9 A;  5HPQ A;  3PD9 A;  3O2A A;  4U23 A;  1A54 A;  3TAJ A;  4GF8 A;  4PQJ A;  5KCJ A;  3VV5 A;  1IUD A;  1QUL A;  3QUJ A;  3B6T A;  1Y3N A;  3TTM A;  3U92 A;  2ALU A;  3PGF A;  2DP8 A;  4R9G A;  4I3Y A;  1AMF A;  4R2F A;  4YAH X;  2DSF A;  5H8Q B;  1A40 A;  2XWI A;  4FE8 A;  2I4B A;  1GTK A;  4KFQ A;  3UN6 A;  2DWA A;  4Q0C A;  4R6K A;  1QVS A;  4R9F A;  1MXX A;  2XXW A;  2F78 A;  4ZDM A;  4NWD A;  2PFY A;  1PB8 A;  3GLB A;  1RDZ A;  3F11 A;  3KSJ A;  5AA4 B;  1MXZ A;  1INP A;  1PC3 A;  3PU5 A;  2HXR A;  3W9V A;  4OEN A;  3C36 A;  3TFL A;  1I6B A;  1N3X A;  3SES A;  5B70 A;  1RDY A;  2Q89 A;  5BUU A;  2I6E A;  2VGQ A;  3CIJ A;  1IIT A;  4X1B A;  1D4N A;  2F6G A;  1MY1 A;  1NV5 A;  4OAN A;  1LGB C;  3VE1 B;  1B6H A;  1YZ0 A;  3THI A;  4HE1 A;  2XWV A;  3U1O A;  4NED A;  4KHZ E;  4BDQ A;  3MVZ A;  1SDX A;  3TTN A;  3VVD A;  5K2X A;  1B1X A;  4ZEB A;  4GWS A;  3RT6 B;  1KWH A;  2P3N A;  5EQ9 A;  1XT8 A;  3PUZ E;  1MQD A;  1NMU A;  1LEV A;  4F3G A;  2AYS A;  4PAF A;  4YKI A;  4UA8 A;  2UXA A;  3H03 A;  1NUW A;  1QUK A;  1SW4 A;  2BJJ X;  2F7B A;  1AWB A;  2DVZ A;  3KJ7 A;  2O1M A;  1H76 A;  4FBP A;  5T3J A;  3C32 A;  4JWX A;  3K0V A;  3KZG A;  1FTA A;  1Y9U A;  2F8D A;  3C33 A;  3VLU A;  2RKM A;  2FNC A;  3H6T A;  4GLI A;  1IEJ A;  4XTC Q;  5A5X A;  1VDW A;  3FVO A;  2AIX A;  4FEB A;  4M1V A;  3PPR A;  2B65 A;  3N94 A;  3GYY A;  4G61 A;  2H98 A;  2V93 A;  4ZS9 A;  1GVC A;  4PDD A;  1MRP A;  3MVX A;  2E1S A;  1JP4 A;  3QSL A;  1B5I A;  4JVI A;  4MNP A;  5IM2 A;  3T9V A;  4NF6 A;  5FHO A;  3U65 A;  3TEL A;  2Y7I A;  3I3V A;  1NFT A;  1UTH B;  3RT8 A;  4U1Z A;  2XA5 A;  1UIV A;  2WEF A;  5DYH A;  5AE4 A;  3GXA A;  1DK4 A;  3IOV A;  4P1L A;  1O64 A;  2Z8E A;  1GR2 A;  4O3A A;  2ZYO A;  2CZI A;  3OO7 A;  4XFE A;  2D5W A;  5A5X B;  3E4R A;  3EN3 A;  5TP9 A;  3ZKL A;  3KFM A;  4EF2 A;  3BFU A;  4RYA A;  1LBB A;  4NGU A;  4IO3 A;  3GBB A;  4ISU A;  1EZ9 A;  5I3S A;  1B32 A;  1NV0 A;  1B3H A;  4KPT A;  1QW0 A;  4NF6 B;  4PE5 B;  1MS7 A;  2UVH A;  1IXH A;  2XXU A;  4O3B A;  1NNK A;  5DVI A;  3PUW E;  3L6H A;  2ZNT A;  4DXC A;  5EQA A;  2PFZ A;  3FXB A;  4WED A;  1R1N A;  3MP1 A;  2R9J A;  4U22 A;  2DYX A;  5ET5 A;  3QK6 A;  2I48 A;  4LON B;  1LAX A;  1MH4 A;  1JEU A;  2XXT A;  5DVF A;  4GWW A;  4YU0 A;  5H8H B;  3RLF E;  1EYJ A;  4GXS B;  4GL8 A;  4GIZ A;  4UAB A;  1SD3 A;  1RYX A;  5I2K A;  1LFI A;  4M4G A;  2I3W A;  3VVE A;  4N6P A;  2UYE A;  1MQG A;  3KN8 A;  5EYG A;  2XXH A;  2Q2A A;  4C1T A;  3A09 A;  2ZYN A;  3EHU A;  2XHD A;  3TTR A;  4PET A;  2XD3 A;  4KXP A;  2QVV A;  3RY3 A;  4EUO A;  5FHM A;  2Q9T A;  2ZNU A;  1LFG A;  2XXP A;  5CMK A;  1P1N A;  2F35 A;  3OXN A;  3B6Q A;  1SW2 A;  4GWO A;  3RPW A;  3TQL A;  4N15 A;  4C1U A;  2XWK A;  2Y5K A;  2X7Q A;  3TUS A;  4XXU A;  4F3S A;  4G68 A;  3S9E A;  3V8X B;  4P56 A;  3A3C A;  4GWU A;  1FW0 A;  3S9M C;  3W15 C;  4OA4 A;  4GOT A;  3SEX A;  4XIG Q;  2H5Y A;  1K9Z A;  1D3K A;  2H4I A;  1XS5 A;  2DWJ A;  2ABH A;  1PBQ A;  3PUX E;  2DE4 A;  2RCB A;  1IMF A;  4I9D A;  4YB6 A;  1MXU A;  2QS2 A;  1B1H A;  2QVU A;  1FQA A;  3MP6 A;  4RNS A;  2PCR A;  4GX6 A;  1BTJ A;  4IB2 A;  5KDT A;  3VDF A;  3QIM A;  1Y20 A;  5CM6 A;  4IO2 A;  1EYI A;  4PAK A;  4NF0 A;  3IL1 B;  3H6U A;  4KYD A;  3Q28 A;  3FXU A;  3QYT A;  4G68 B;  5M2V A;  4FEC A;  5CI5 A;  2YLN A;  4OQO A;  2GRV A;  4IO6 A;  4HCW A;  5FTH A;  1O63 A;  5IZ3 B;  5CMB A;  2G93 A;  3RUM A;  1UTB A;  1BLF A;  2OWT A;  1B3E A;  2F3B A;  2Q74 A;  5J1D A;  3FJM A;  2XX8 A;  1MY0 A;  4NMY A;  3PTY A;  4ESW A;  2R8T A;  3DEL B;  3TKD A;  1HSL A;  1DOT A;  2GHA A;  3Q25 A;  3ISP A;  4HXV A;  1FCK A;  5ET8 A;  3SEV A;  3KN3 A;  4H5G A;  5I58 B;  2QRY A;  3FIR A;  1CE2 A;  4FED A;  1P1Q A;  4JSD A;  4MAG A;  2BJI A;  1B3G A;  3PV0 E;  4F39 A;  4F31 B;  1P1W A;  2I0C A;  2P0S A;  3IFA A;  5JTY A;  4DI3 D;  1SQY A;  2QS4 A;  1RDX A;  4PFW A;  1ZU0 A;  2V3U A;  3CFX A;  1Z7N E;  4C0R A;  4Q30 B;  1NUY A;  3H6V A;  4YB5 A;  2D21 A;  3MBP A;  2QFL A;  4KYS A;  2OJT A;  1S9T A;  1B58 A;  1NUZ A;  1MH3 A;  4R6Y A;  4F2Q A;  2QL3 A;  4LUB A;  2HZK A;  4NTL A;  4THI A;  2G29 A;  4GBW A;  4OTE A;  2OWZ A;  4YKP A;  3TPA A;  4MCO A;  3BKI B;  2H9B A;  4F1Y A;  4KR5 A;  3ZKK A;  4R74 A;  5EHM A;  2Z8D A;  4ECF A;  3N5L A;  4G8N A;  2F7A A;  4QFO A;  3T22 A;  4PFT A;  2FYI A;  1XOC A;  4EDP A;  3AXF A;  3MPK A;  1LCT A;  2OPE A;  2DE3 A;  5JTY B;  2DWI A;  2O6A A;  4DXB A;  1MY3 A;  4P0I A;  1G0H A;  4ELO A;  2F7C A;  4F19 A;  2ANJ A;  4YKJ A;  2R6G E;  3SZP A;  2OWS A;  2RIN A;  3LSW A;  2DVC A;  1LB9 A;  4QFP A;  3LUY A;  1NV3 A;  2Z8F A;  4TQU Q;  2A5T B;  3GZG A;  2VPO A;  2DS9 A;  3QAX A;  2VOZ A;  3RGY A;  3QXM A;  4PTK A;  4I62 A;  4LQ2 A;  1YYZ A;  5FBP A;  2DQV A;  2YJP A;  5JK4 A;  1QUI A;  3TEP A;  2QJE A;  3EHS A;  4X1D A;  1B9J A;  4R75 A;  1A55 A;  4OVQ A;  1EZP A;  1B4H A;  2RC9 A;  1NI9 A;  4ZZE A;  1Y1M A;  4E0W A;  1XI6 A;  3FD3 A;  3TCF A;  3B50 A;  1XHY A;  3G3H A;  3B7D A;  2CZL A;  4P3L A;  4PF6 A;  4DZ1 A;  4BLA A;  2OZZ A;  3N26 A;  4GVO A;  4HTG A;  5ELV A;  1N3W A;  2FA7 A;  3LSL A;  2F34 A;  1DTZ A;  3FV1 A;  3SEU A;  2F5X A;  1FTK A;  2XXI A;  1RYO A;  1XVY A;  2E0S A;  5BWJ A;  2RC8 A;  2F3D A;  1M5E A;  1N7X A;  1YTV A;  4OVR A;  4ESX A;  1XC1 A;  4DDD A;  2Q8M A;  2VHA A;  2WYP A;  3O29 A;  4NF4 B;  1LST A;  3OSR A;  2Y84 A;  4MNC A;  3O6H A;  3K1P A;  4JBZ A;  4MLV A;  1ZTY A;  1SW1 A;  2UYF A;  4MFI A;  3FBP A;  3MVW A;  2L5V A;  1HSE A;  1VSO A;  3KSX A;  3IAZ A;  2DWH A;  4RA1 A;  4YIC A;  3MYU A;  1IMC A;  1JVY A;  2YPN A;  1LFH A;  1IMB A;  2VD3 A;  4PFB A;  4OFJ A;  2PYY A;  4MMP A;  1ZMG A;  2CMO A;  4F1V A;  2Q88 A;  4P1E A;  2NWJ A;  4EQB A;  1QKA A;  1NUX A;  1FPJ A;  5DEX B;  5B7D A;  2WYK A;  2NUV A;  4BDM A;  4H65 A;  3MP8 A;  4OET A;  2FVZ A;  4N6D A;  2Z22 A;  2GFE A;  3MJN A;  4BDO A;  3OO9 A;  4MBP A;  5AA1 A;  4FJP A;  3EPE A;  4IO5 A;  1FQC A;  2ZZX A;  4ELP A;  4XKP A;  2I49 A;  4NF5 A;  4KCD A;  3FJG A;  4ZZA A;  1N04 A;  4GFR A;  1YCJ A;  3ILT B;  4PFI A;  2ONS A;  5EYF A;  1P1O A;  5J16 A;  4HW8 A;  3FJ7 A;  5F24 A;  3G3K A;  3OEL A;  1MY4 A;  4G8M A;  4O3C A;  3HST A;  1UTH A;  1MPC A;  4NE4 A;  1SVX B;  2NVU B;  1AOV A;  3SDF A;  3A29 A;  4ONY A;  5EYH A;  4PFU A;  1JQF A;  3JYR A;  5ITO A;  2HQ0 A;  4F22 A;  4H0W A;  2R71 A;  3T9X B;  1P99 A;  2ZYK A;  1FBH A;  4AS4 A;  4GQO A;  3C31 A;  4NF5 B;  3U94 A;  3MST A;  1YXI A;  5I56 A;  2ZNS A;  4NX1 A;  3DM0 A;  2RC7 A;  5CRY A;  1EYK A;  1FQF A;  3TOD A;  5DVJ A;  1ZLQ A;  5IZZ A;  2WBB A;  4JWO A;  4FAJ A;  4JXI A;  4QSD A;  2P1S A;  3FZV A;  3W9W A;  1DPP A;  4OVS A;  1NNP A;  4AB5 A;  3VLV A;  3QMF A;  1OMP A;  3TZA A;  2FIX A;  2HEU A;  2Y7W A;  4RPN A;  3E78 A;  3MZB A;  1M5C A;  4WXJ A;  1QJM A;  3CHG A;  5H8H A;  4R6H A;  3PUV E;  3G3F A;  1LLS A;  3M3L A;  3R6U A;  4RJZ A;  4QFL A;  4JDF A;  3T66 A;  3MWB A;  4YZZ A;  5I56 B;  3D4G A;  3HHF A;  4BDR A;  5CBS A;  5L9O A;  1GGG A;  1IXI A;  3E79 A;  3IOU A;  1NV2 A;  4QSE A;  4LP2 B;  3IB2 A;  4P0G A;  1IQ7 A;  3PPQ A;  5FHN A;  4G68 C;  3MW0 A;  3V83 A;  3B6W A;  3I5O A;  4PFR A;  3VFJ A;  2I0B A;  2GHB A;  3S9N C;  2Z23 A;  4PC9 A;  4EQ7 A;  4MNI A;  3ZS6 A;  4X9T A;  4IO7 A;  1BP5 A;  4YB7 A;  5HBC A;  4QBA A;  4P8B A;  4YMB A;  4RXL A;  4NG7 A;  3M3K A;  5DW8 A;  1ZKB A;  2FIE A;  1FTL A;  3CRB A;  1Y4T A;  1A99 A;  4EF1 A;  4OER A;  1D9Y A;  3FGS A;  1FPK A;  2P3V A;  3RYD A;  2CEY A;  4U2R A;  4U4X A;  4XF5 A;  4MLQ A;  4GXA A;  5I84 A;  4ZE8 A;  2OBG A;  1O7T A;  2ZXT A;  1Y3Q A;  3ILU B;  1B40 A;  4BDL A;  4Z7E A;  1NH8 A;  2QMW A;  1ZIU A;  1RKM A;  3KGC A;  1SYH A;  3EHT A;  3QUF A;  2IA4 A;  3KEI A;  3D4C A;  5IKB A;  3EQ1 A;  4X8R A;  4LVQ A;  4DIG A;  2H25 A;  1EZO A;  3VXB A;  4NN3 A;  4H5F A;  1B5H A;  1B51 A;  3TCH A;  1H45 A;  1JNF A;  1BK4 A;  3A3U A;  4RPO A;  3SEW A;  3CG3 A;  3MZ1 A;  1LB8 A;  4LAT A;  4MEV A;  1FBE A;  3K00 A;  3FVN A;  3K02 A;  2ZYM A;  5ITP A;  1FTM A;  3CFL A;  3IJX B;  2QPQ A;  3HPI A;  1VFE A;  1S7Y A;  4HS7 A;  1POT A;  2QS3 A;  5I7I A;  4ZEC A;  4GL0 A;  1OVB A;  3IJO B;  5F1Q A;  5IZ3 A;  3IO6 A;  4I3E A;  1IMD A;  3KBZ A;  2QMX A;  3B8B A;  1IXC A;  3TQW A;  1SYI A;  3HFU A;  1NNF A;  3LR1 A;  2ONK E;  2QS1 A;  2ONR A;  3Q27 A;  2CZH A;  4KI0 E;  2UVI A;  4PGP A;  2V4C A;  1SW5 A;  5CMM A;  4AS5 A;  1PBP A;  1N0T A;  4GBV A;  5I57 A;  5I58 A;  4IGR A;  2Y7K A;  3DLN A;  4NAP A;  4ZEI A;  3FXR A;  4BDN A;  2O51 A;  2XD2 A;  3O9P A;  3HHG A;  3LV0 A;  3CSG A;  3UIF A;  1FQE A;  2Q8J A;  1B2H A;  3PPN A;  1LAH E;  4X48 A;  1JEV A;  3L6G A;  2PMS A;  2PT1 A;  3O66 A;  4WKM A;  1WOD A;  4ZE9 A;  1R9L A;  4H67 A;  4NF8 A;  2I4C A;  2VPN A;  4JSO A;  1BIY A;  1QGX A;  4OVP A;  4DLD A;  1DTG A;  1B3F A;  3HO7 A;  3RTW B;  1M5B A;  5I59 B;  2OPD A;  4MF3 A;  3TTK A;  1IXG A;  1JW5 A;  5I57 B;  2REJ A;  4XEQ A;  2OLB A;  1FTO A;  3K6V A;  4OVJ A;  4ZEF A;  3U93 A;  3TMG A;  3R26 A;  4ND9 A;  4OHN A;  2ZMB A;  1FPB A;  1Q1K A;  2NOO A;  1N76 A;  3WAF A;  4HE2 A;  5AA2 D;  3HCQ A;  1MPD A;  3KN7 A;  1IMA A;  4O7M A;  1MXY A;  4U1O A;  3H6W A;  1URS A;  2MKZ A;  4NF8 B;  1NNT A;  1MXW A;  1KA1 A;  3O6I A;  4LZ8 A;  2V25 A;  1TFA A;  3V5A A;  2A5T A;  2O7I A;  3JZJ A;  4PE3 A;  2ZZV A;  3OEK A;  3R7X A;  3JV9 A;  3MVY A;  5AA2 A;  4NQ8 A;  5K2Y A;  2HXW A;  4X04 A;  1UQW A;  3PMX A;  2HCA A;  3C34 A;  1N7W A;  3OMB A;  1POY 1;  1MQH A;  4F29 A;  3K01 A;  4FIM A;  2ZZW A;  5JEI A;  4QFK A;  3IB0 A;  1USY H;  1MQJ A;  2O1L A;  3LSX A;  5DT6 A;  1B52 A;  2VP1 A;  2XWO A;  5IAI A;  1H44 A;  2UVG A;  3SET A;  1Y1Z A;  2XXQ A;  3M3F A;  3T93 B;  1H43 A;  4GWX A;  1R6Z A;  1PEB A;  4NF4 A;  4LZ5 A;  5AA2 B;  4N81 A;  1KZ8 A;  1AL3 A;  2RF1 A;  3KOT A;  4FOR A;  3C4M A;  3OO8 A;  3K6U A;  3VVF A;  3FUZ A;  4IGT A;  4F18 A;  4WEP A;  4POW A;  3IOR A;  1ZJL A;  1MM7 A;  3BBR A;  3D1R A;  3FVG A;  4XKN A;  1KA0 A;  4G77 A;  4OMB A;  3PMW A;  3UK4 A;  2CEX A;  2DXR A;  1DMB A;  2O68 A;  2HZL A;  5DEX A;  1IME A;  1S50 A;  4P9K A;  5TU0 A;  2HAU A;  3O28 A;  3U72 A;  1R9Q A;  1B3L A;  3NOH A;  4OEU A;  4DE8 A;  2Y5L A;  3K6W A;  1D9Q A;  1Q9D A;  1FQD A;  2O7U A;  3FXQ A;  4JB7 A;  3MAM A;  1HSJ A;  3S2V A;  1SBP A;  2Y7R A;  4IO4 A;  2XXV A;  4H8J A;  3PD8 A;  2V84 A;  1VFD A;  2Q2C A;  4R72 A;  1US5 A;  2F97 A;  5EQ7 A;  1AH5 A;  1LCF A;  2HHM A;  2RCA A;  4RK2 A;  2V3T A;  4IY5 A;  1QKB A;  5LDZ A;  2XXK A;  3E9X A;  4KYE A;  3BIH A;  4DI4 B;  3TCG A;  4O7I A;  3KG2 A;  1F9B A;  5KCJ B;  3I6V A;  4KQP A;  5L9M A;  3UA8 A;  1NV7 A;  1FPD A;  3O6G A;  3SKP A;  2Y7P A;  4PDH A;  1MDP 1;  4HE0 A;  4QHQ A;  5H8S A;  1B46 A;  2THI A;  1OQG A;  5HM4 B;  1A7L A;  3LBS A;  2X7P A;  4N6K A;  1FPI A;  5ET6 A;  4EQ9 A;  4Q5T A;  1JW1 A;  2X26 A;  4PP0 A;  3ZSF A;  3SER A;  5ICT A;  2GH9 A;  4ELQ A;  4P11 A;  4I1D A;  1Q35 A;  3FVK A;  1SI0 A;  1M5F A;  4OFL A;  1GV8 A;  4ELR A;  3CR9 A;  2F6P A;  1EU8 A;  1FBD A;  1FRP A;  1LBV A;  5FTI A;  4G2Z A;  4GX4 A;  3WAE A;  3KC1 A;  2KLF A;  1URG A;  2VT5 A;  2XXR A;  1SPI A;  5H8N A;  3DP8 A;  3RQT A;  2CZK A;  3Q29 A;  3PPO A;  3H4Z A;  3FAS A;  1P1U A;  4GD5 A;  1UIU A;  3S9L C;  4G8H A;  2WBD A;  1OIB A;  2XXY A;  5L8D A;  3IFC A;  1II5 A;  2HPG A;  5DTB A;  2B3F A;  3CVG A;  3K6X A;  2AL5 A;  4TLM B;  4OES A;  1JVX A;  3H06 B;  4Z0I A;  5ISU A; 
#chains in the Genus database with same CATH homology
 4NHB A;  1RDY A;  4AS5 A;  2DE3 A;  4GBV A;  1FBF A;  1G0H A;  1NV5 A;  4F19 A;  4NAP A;  4OAN A;  5ESY A;  1YZ0 A;  3SZP A;  4HE1 A;  2XWV A;  3LV0 A;  1NV3 A;  4GWS A;  4JVD A;  2P3N A;  4MIJ A;  5EQ9 A;  2VPO A;  3BIG A;  1LEV A;  4PTK A;  4PAF A;  1YYZ A;  5FBP A;  1NUW A;  5JK4 A;  4N91 A;  4MJO A;  4I40 A;  1AWB A;  5IZ1 A;  2DVZ A;  2VPN A;  4OVQ A;  1QGX A;  4OVP A;  4FBP A;  5T3J A;  1NI9 A;  1XI6 A;  3B50 A;  4N4U A;  5A5L A;  1FTA A;  4P3L A;  4PF6 A;  4LN5 A;  3RPL A;  4XEQ A;  4GX3 A;  2F5X A;  3T1B A;  5IGA A;  2JJK A;  1VDW A;  4M1V A;  2F3D A;  4OVR A;  3GYY A;  1FPG A;  4G61 A;  2Q8M A;  2OX3 A;  1FPB A;  2WYP A;  4PDD A;  4GWY A;  4HE2 A;  4MNC A;  1JP4 A;  4JVI A;  4MHF A;  4MNP A;  5IM2 A;  1IMA A;  4O7M A;  3U65 A;  2MKZ A;  3FBP A;  1KA1 A;  2L5V A;  3EKI A;  2XA5 A;  4PE3 A;  2WEF A;  2ZZV A;  1DK4 A;  4YIC A;  4NQ8 A;  2B4M A;  3MYU A;  4P1L A;  1IMC A;  4X04 A;  3RPL B;  1G0I A;  1IMB A;  4PFB A;  2CZI A;  4XFE A;  4MMP A;  4F1V A;  2ZZW A;  1K9Y A;  4P1E A;  1LBY A;  4N17 A;  4NGU A;  1FBG A;  1NUX A;  1FPJ A;  4H46 A;  1NV4 A;  2WYK A;  4IR8 A;  2FVZ A;  5I3S A;  1NV0 A;  4O94 A;  4N6D A;  4N8Y A;  2XWO A;  4H45 A;  1NV1 A;  1FSA A;  1NV6 A;  4QXD A;  2ZZX A;  1FJ6 A;  4GWX A;  1FPL A;  3ROJ A;  5EQA A;  1FBC A;  2PFZ A;  3FXB A;  4PFI A;  5ET5 A;  5J16 A;  1DCU A;  5I5P A;  4F1U A;  4N81 A;  5F24 A;  1KZ8 A;  3T0J A;  2FHY A;  4GWW A;  3LUZ A;  4F18 A;  1EYJ A;  3A29 A;  1LBZ A;  5EYH A;  1FPF A;  4UAB A;  3D1R A;  1KA0 A;  2CEX A;  2V3Q A;  1FBH A;  4AS4 A;  5EYG A;  1CNQ A;  2B4L A;  2HZL A;  1IME A;  4P9K A;  3MST A;  4N8G A;  1YXI A;  4PET A;  4HCY A;  4KXP A;  2QVV A;  2KQZ A;  4NX1 A;  1DBZ A;  4JVC A;  4GWZ A;  3NOH A;  2Q9T A;  2Y5L A;  1EYK A;  1D9Q A;  1Q9D A;  5IZZ A;  2WBB A;  4N15 A;  2XWK A;  5EQ8 A;  2QVR A;  2Y5K A;  3W9W A;  4OVS A;  3QMF A;  2FIX A;  3E78 A;  4P56 A;  4GWU A;  3CHG A;  2DDK A;  4OA4 A;  4P47 A;  1K9Z A;  4O8M A;  5EQ7 A;  1LBX A;  2HHM A;  4YZZ A;  2DE4 A;  4PBQ A;  2WX9 A;  1LBW A;  4PBH A;  1IMF A;  4MX6 A;  3E79 A;  2QVU A;  5LDZ A;  1NV2 A;  2XXK A;  2PCR A;  3BIH A;  4GX6 A;  4DI4 B;  4O7I A;  5CM6 A;  5LTC A;  4PFR A;  1EYI A;  4PAK A;  4NF0 A;  4PC9 A;  1FPE A;  4MNI A;  1NV7 A;  4X9T A;  1FPD A;  4QBA A;  4PDH A;  4P8B A;  4HE0 A;  4NG7 A;  5DW8 A;  2FBP A;  2FIE A;  5ET7 A;  4HCW A;  1FPK A;  2P3V A;  5IZ3 B;  3RYD A;  2CEY A;  4PCD A;  4N6K A;  4PF8 A;  4PAI A;  2GQ1 A;  1FPI A;  3KC0 A;  5ET6 A;  4XF5 A;  1FBP A;  2F3B A;  2Q74 A;  5J1D A;  4PGN A;  2KR0 A;  3PTY A;  2R8T A;  3ISP A;  4HXV A;  5ET8 A;  4OVT A;  4MAG A;  2BJI A;  1FBD A;  4X8R A;  1FRP A;  1LBV A;  2DE2 A;  4GX4 A;  1FJ9 A;  3KC1 A;  4NN3 A;  2VT5 A;  1SPI A;  3IFA A;  4DI3 D;  1RDX A;  1BK4 A;  2CZK A;  4MEV A;  1FBE A;  4I3Y A;  1NUY A;  2QPQ A;  2QFL A;  2XWI A;  1NUZ A;  2WBD A;  5I7I A;  2HZK A;  3IFC A;  2HPG A;  4GBW A;  2PFY A;  5IZ3 A;  2OWZ A;  4I3E A;  1IMD A;  3KBZ A;  3B8B A;  4MCO A;  1RDZ A;  3HFU A;  1INP A;  2CZH A;  2HXR A;  3W9V A;  4PGP A;  2V4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...