3KC0A

Crystal structure of human liver fbpase in complex with tricyclic inhibitor 10b
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based drug design of tricyclic 8H-indeno[1,2-d][1,3]thiazoles as potent FBPase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase 1
total genus 99
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3kc0A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3kc0A02
1FPGA 2FIXA 1LBYA 1K9ZA 1NI9A 3LV0A 1FBFA 4HE0A 1FPLA 1NV4A 4GWXA 4FBPA 4GBWA 2Y5KA 1NUXA 3B8BA 4H46A 1IMCA 3BIGA 5ET6A 1FJ6A 1FBGA 1G0IA 1NV3A 3KBZA 5EQ9A 5EQAA 5EYHA 2F3DA 2WBBA 1LBXA 1FRPA 1QGXA 5EQ8A 4I40A 5EQ7A 3D1RA 1EYKA 3IFCA 5DW8A 1INPA 2BJIA 4HXVA 1LEVA 1FPBA 5T3JA 1FPIA 4H45A 1CNQA 1FBDA 1NV2A 3RPLB 1FPJA 3KC1A 5I3SA 1JP4A 1G0HA 1LBZA 1RDXA 2Q74A 3ROJA 4O7IA 1BK4A 1NV5A 1FBHA 1IMFA 1FPDA 4I3YA 1YYZA 5ET7A 1FPEA 1DCUA 2P3VA 5ET5A 1D9QA 4GX4A 1NV7A 3RPLA 1NUWA 2QVRA 5IZ3B 1EYIA 1SPIA 4N81A 1LBVA 2P3NA 1FSAA 1EYJA 1RDZA 1YZ0A 1IMAA 2PCRA 1FBPA 1KA0A 2JJKA 3IFAA 1KZ8A 1K9YA 2OX3A 1FTAA 2QVUA 1FJ9A 2R8TA 4I3EA 1KA1A 2CZHA 2DDKA 3KC0A 1FBCA 3RYDA 1FPFA 1NV6A 5F24A 2Q8MA 1DBZA 3FBPA 1LBWA 2Y5LA 4IR8A 1VDWA 2WBDA 4GWYA 4QXDA 2FHYA 5IZ1A 5ET8A 2QVVA 5IZ3A 4AS5A 5A5LA 3A29A 3T0JA 2CZIA 1NUZA 2GQ1A 1NUYA 1NV1A 4GWZA 2FVZA 5LDZA 1NV0A 1AWBA 1FPKA 1DK4A 1XI6A 4KXPA 3LUZA 4HE1A 5ESYA 5EYGA 4MJOA 4GWWA 4HE2A 2FBPA 3QMFA 1IMDA 1FBEA 2QFLA 2FIEA 2HHMA 4GX3A 4GBVA 4GWUA 1IMEA 2F3BA 2VT5A 2WEFA 4PTKA 4AS4A 4GWSA 1YXIA 1Q9DA 4G61A 4GX6A 1IMBA 1RDYA 5FBPA 2CZKA 2OWZA 5J16A 3BIHA
chains in the Genus database with same CATH superfamily
2THIA 3GBAA 4GRKA 2F7CA 4AB5A 1NV4A 2B3FA 4LZ8A 4G68B 2DSFA 1QUJA 4OERA 3EN3A 3FJMA 3HO7A 1N84A 2O7IA 2Q9TA 2UYEA 3CFXA 2RINA 4NQ8A 3TKDA 4F29A 4M1VA 4Q8RA 2Y7RA 3TCGA 2Q88A 2X7PA 1SW4A 4HS7A 1BKAA 4QFOA 4JVIA 3IO4A 3HN0A 4P1LA 4YICA 4I3YA 2O1LA 3C35A 4N13A 1NV7A 2I49A 3EKIA 3RT8A 4QSEA 4F3GA 4OWDA 3PUVE 1O63A 1M5EA 4OENA 5CMKA 2Q2CA 1NH8A 4H8JA 4N6DA 3O2AA 4HW8A 5AE4A 2Q8MA 3FBPA 2DWAA 2V3TA 3KEIA 4GWYA 4MX6A 1NFTA 3K0VA 3S2VA 3N6UA 4JSOA 4O8MA 4XFEA 4N4UA 1SW5A 4U1ZA 1L5TA 4N15A 3HHGA 3KFMA 3LBSA 5ICTA 1MPCA 2REGA 2FBPA 3GYYA 2QFLA 2FIEA 3CFLA 4U22A 2XXWA 2QS4A 3T1BA 1GR2A 3DP8A 2HEUA 2O1MA 3C4MA 2DXRA 1DPEA 3LV0A 1SI0A 5JK4A 4H8IA 4MMPA 4QSCA 3I3VA 1M5FA 4GFRA 3W9WA 2L5VA 3FVOA 1LBXA 3E78A 5EQ8A 4QSDA 2F5XA 2H98A 5DW8A 4RA1A 2X7QA 5TP9A 2PT2A 3S4UA 2XXRA 2VD3A 4JVCA 5TP9B 2V3QA 1JP4A 4N6KA 2Q74A 3H6WA 4H6DA 4FJPA 1FTOA 3U1OA 4U2RA 3CI8A 2XWVA 3HHFA 1M5DA 4JSDA 3LSXA 1EYIA 2P3NA 5H8HA 5H8FA 4PF6A 3VXBA 5I2NB 5H8HB 3VVFA 4XKRA 3B6QA 1Q35A 1UTBB 3KOTA 3LUYA 2P1SA 3LSLA 1NNKA 1PDAA 4PDHA 3C36A 3TZAA 3BFUA 3KG2A 5EYGA 2XXYA 4QF9A 3K6XA 4GOTA 3SEUA 3FVKA 1B0LA 4P0IA 1ZU0A 4R74A 3FVNA 4POXA 3PD9A 4F18A 4IGRA 2XD2A 4KCDA 4OESA 1FPGA 4NF8A 2RC9A 4BLAA 2Y7WA 1K9ZA 1YTVA 1FPLA 1I6QA 4WEDA 1B5JA 3H06B 1B3GA 3ZKKA 1YAEA 3FV1A 3IX1A 1QGXA 4FATA 5FTIA 2Y7KA 4PBQA 3I6VA 3O9PA 3RTFB 4IO6A 3MPLA 1FPJA 4OFOA 1H3DA 4IO2A 5IGAA 1LAHE 3B6WA 5CRYA 5ET7A 1QKAA 4KFQA 3OO8A 2P3VA 2XXUA 4PFBA 4PGNA 4ECFA 1RDZA 2GHAA 3EHTA 5M2VA 1JEVA 3IOUA 4OEVA 3K01A 5FHNA 1MY1A 4C1TA 3LSFB 3EHSA 3LSWA 4OANA 1JQFA 4G68A 2CZIA 4AB6A 2ESNA 2DXYA 3TAJA 1B58A 2XWIA 1SBPA 2PX1A 2XWOA 2XX9A 4OETA 4LQ2A 1IMDA 4LN5A 1FQCA 2Y7IA 4ZE8A 1IXCA 3HPIA 1JNFA 2HAVA 4GWUA 1UQWA 3D4GA 3SDFA 1Y9UA 2I3VA 3FV2A 1RDYA 1IUDA 5I7IA 1B7ZA 2Z23A 5AA4B 3SETA 1ZLQA 2OK2A 4PCDA 1ZJLA 4MFIA 3Q27A 1BLFA 4FE8A 1P1QA 4OFJA 1QUIA 1Y1MA 4H46A 3BIGA 4XTCQ 1PB9A 3EQ1A 4I40A 1A54A 3M3LA 4TLLB 4NF8B 2DVCA 2OWTA 3VV5A 3IB0A 2H4IA 4Z7EA 3OENA 3T96B 4ZECA 5DEXB 1TWYA 2CEXA 1IMFA 3N26A 3B6TA 1Y3QA 2O7UA 5HPQA 1NL5A 4MLVA 1DCUA 3TEPA 3FJGA 1SYIA 1D9QA 1MY2A 5AA3A 4YAHX 4NG7A 1MY0A 2OLBA 4N91A 3FXQA 3FXUA 1FQDA 3F11A 5J1DA 4RPNA 1LSTA 1XVYA 3GLBA 2QVVA 1ZIUA 3A29A 5I57A 3T0JA 4U1OA 2HZLA 4GWZA 3RGYA 1IXGA 1USYE 2H5YA 5ESYA 1JW5A 2QJEA 1JEUA 1P1UA 4OVPA 4ELPA 4F1VA 4X9TA 1PBQA 1IMEA 2WEFA 5I2KB 2DWIA 3EPEA 3QIMA 1IIWA 3TQLA 3RPWA 5I58A 3Q28A 1LCTA 2AYSA 1MXXA 1B52A 5TPAA 1FJ6A 1FBGA 3FD3A 1A99A 3CSBA 5B7DA 3IFCA 1I6AA 3K1PA 5IKBA 1NNFA 1QKBA 1AMFA 2D5WA 4R6YA 4Z0IA 4OTEA 1FTLA 3OSRA 1DSNA 1LBZA 2X26A 5JTYB 1CE2A 1XT8A 2F34A 1IEJA 4ELOA 1OQGA 4GX4A 5IZ3B 1FQBA 1EYJA 4OFLA 4MIJA 1UIUA 4OVSA 1B7UA 1B46A 3OO7A 4PFUA 4PF8A 2ALUA 3I5OA 4NF5A 5ET8A 4IO7A 2GQ1A 4ZEIA 4JWXA 1NV0A 1ZTYA 4KXPA 1LLSA 5CMBA 5ICQA 1YCJA 4R2FA 1VSOA 4P1EA 4XXUA 1BIYA 1MG1A 1LCFA 2ZYMA 2VD2A 3PU5A 1LFGA 3Q29A 1AIVA 4PQJA 2ZZVA 3TTMA 3A3CA 3Q26A 3H7MA 4IY5A 4G8MA 3BBRA 1IQ7A 1TXFA 2QS3A 2Y5KA 1Y4CA 3OOAA 3IOVA 3HCQA 5HBCA 3OO6A 1LB8A 1R1NA 4O3CA 1HSEA 1OMPA 1US4A 5CBSA 1Y20A 1FBDA 5LTCA 4JBZA 1B4ZA 3QAXA 1IXIA 3RPLB 3K6WA 4YZZA 3O97A 2P2AA 3KJTA 4PAIA 4ESXA 2PT1A 1PC3A 3KZGA 2QL3A 4R73A 1LB9A 3U8QA 5CMCA 3H6UA 5F7VA 1UTBA 1PB8A 2D21A 4DLDA 1B32A 3OO9A 1Y3PA 1RYOA 3VLVA 3ZS6A 4MNPA 4ZEBA 2YLNA 3MVYA 3RT6B 4JXIA 1NV6A 5AA2D 2Y5LA 2NUVA 3IB2A 3TCHA 4OMBA 3GXAA 5IZ1A 2FHYA 4GLIA 5IZ3A 4AS5A 2XA5A 4NGUA 2FNCA 3K1NA 5IZZA 2O6AA 3O28A 5LDZA 3TTRA 3CSGA 2G93A 1SQYA 5BWJA 1M5CA 3KOSA 2ONSA 4JDFA 3UP9A 3H3GA 1ANFA 1YXIA 5DVFA 5I59B 3T22A 3HSTA 4DI4B 4F3BA 4YKIA 2I4CA 2XXPA 4NMYA 4NF6A 1DOTA 1P1OA 2VP1A 4YKPA 4X48A 4GIZA 1N0TA 2VOZA 1I6BA 3O6HA 5I56A 3KSXA 1MDQA 1NUXA 4RXLA 2CEYA 2WBBA 4THIA 4N8GA 5ITPA 4OVJA 3UN6A 1JVYA 3IOWA 3QUFA 2OBGA 3HV1A 3M3FA 3VVDA 4MF3A 3RTWB 2XXIA 4LVQA 2WX9A 1G0HA 1H43A 3U93A 4O3AA 4PE5B 4QFNA 4NF0A 3VFJA 3DELB 2HCAA 4XIGQ 4KHZE 2QMWA 4UABA 5AA1A 4FAJA 4P8BA 1R9LA 2ZNTA 4LUBA 5F1QA 4EDPA 2JJKA 2HFBA 3IFAA 5KCJA 1FJ9A 2AIXA 4H1XA 4R72A 4KPTA 3LR1A 3T9VA 1ATGA 2OWSA 5F24A 5L9SA 3CRBA 1ZKBA 2RC8A 4WXJA 2OJTA 2NOOA 1N76A 4NTLA 4GWOA 1B5HA 1XI6A 1FCKA 1MS7A 3FGSA 3A09A 3BKIB 5BUUA 4ZZAA 2H25A 4GXSB 1MQJA 3IOTA 2ZXTA 3MP8A 2HZKA 3W15C 3O29A 2A5TB 4POWA 3ILTB 1GV8A 3QUJA 3R6UA 1FQFA 1TT1A 5FBPA 5J16A 5IAIA 1B6HA 1XVXA 2CZLA 4NF5B 2FIXA 1NI9A 1JETA 3CG1A 4QBAA 4DIGA 5EHSA 3K6UA 3UA8A 4RPOA 4PBHA 5I2NA 1OIBA 3PPPA 4ZEKA 5ET6A 2IA4A 1G0IA 3KBZA 3T9XB 4BDLA 1YPNA 2UVHA 2A5SA 3VE1B 3S9NC 4K3FA 4YKJA 5EQ7A 1FTMA 1EYKA 5I2KA 1OVTA 4PETA 1Z7NE 2ZNUA 5JEIA 1XOCA 1WODA 3FZVA 1P1WA 4R9FA 4F39A 4F3SA 2FYIA 4MNIA 4EF2A 3IK6B 2PYYA 2GH9A 5KDTA 4LA9A 5ITOA 3IAZA 1LBVA 2VPOA 3EHUA 1Y4TA 1MRPA 2M8CA 3IL1B 4P47A 1DPPA 3ZSFA 2B4MA 4HCWA 5A5XB 2OZZA 1VDWA 3TCFA 4G4PA 4G8HA 2A5TA 1QUKA 3N94A 1B3FA 4MCOA 3KJ7A 5ISUA 1DTZA 2V84A 3TUSA 4HE1A 4NN3A 1FW0A 1O7TA 4QHQA 4I9DA 1II5A 1LAGE 4GWWA 3RY3A 3QMFA 2Z8EA 4OYVA 4PP0A 4GBVA 5L9OA 3MC2A 3U65A 4MEVA 1M5BA 3OSQA 5CM6A 2DP8A 2DOJA 4KQPA 3KN3A 1LBCA 3MYUA 3IR1A 4HE0A 3RLFE 4YMBA 1QULA 1MDP1 3LC8A 1SVXB 2ABHA 4RY1A 3ODBA 2ANJA 3B8BA 2W7YA 3ECRA 2DVZA 2OPDA 2O68A 4H5FA 4XKQA 4ND9A 1Z7ME 1H76A 4P56A 3K4UA 1URDA 2NVUB 3ISPA 1NV2A 2F97A 3R7XA 3U94A 3CG3A 2Q89A 2E1SA 2UXAA 4QRZA 3MQ9A 3S9EA 5CI5A 3MAMA 3V83A 2I4BA 5K2XA 5CMMA 4I1DA 4OZ9A 1POTA 3SKPA 4EQ9A 3UK4A 4AQ4A 1MPDA 4E0XA 4WEPA 2ZZWA 3IJXB 4HCYA 2DWHA 2PFZA 5TPAB 3ZKLA 4Q30B 2G29A 4ELQA 3R26A 2V3UA 4IGTA 1MM6A 3SEYA 1AOVA 2KR0A 1N7WA 4DCYA 4O3BA 2REJA 1D4NA 3E3KA 3TFLA 3EF7A 4LQ5A 1N3XA 2VPNA 4TLMB 2ONKE 4JVDA 4NF4B 3PGFA 1OLCA 1B4HA 1B9JA 3ONMA 1B3HA 3MVZA 4KYDA 4N17A 4EUOA 3TYHA 4EQBA 4IB2A 2HXWA 4H67A 2PVUA 4BDQA 4GL8A 3RN8A 2XXQA 4X1DA 4GWXA 2B3BA 3E9XA 3OMBA 5EQ9A 4MLQA 2RF1A 3W9VA 2F78A 4P0GA 1D9YA 3H4ZA 5DVIA 1INPA 2XD3A 4GQOA 4UACA 2HXRA 4QFKA 4ESWA 4F2QA 3SZPA 2F7BA 4BDRA 1QW0A 3OEKA 4JWYA 3UORA 3CIJA 1NH7A 2QMXA 1GTKA 5ET5A 3A3UA 1URGA 4F3PA 2QVRA 4N07A 2QS2A 3PUWE 5EHMA 1KA0A 1SW2A 1FTAA 1MXZA 3M3KA 4EXLA 3NOHA 3Q25A 1KA1A 4E0WA 3S9LC 1FPFA 4HTGA 4N8YA 4EXKA 3KN8A 2UVJA 2ZYNA 1B3LA 2F35A 1MXVA 4PFWA 4NF4A 4TOZA 1LAFE 5DTBA 4PAKA 2QSXA 2GRVA 1PBPA 4MNCA 5AA2A 4NAPA 1JW1A 4GX3A 2BJJX 5I5PA 2F3BA 2VT5A 5JTYA 1R9QA 4G61A 1Q9DA 2XXXA 3PPOA 3H6TA 3VVEA 4GX6A 4H65A 4FEDA 4OQOA 1B05A 2CZKA 2HQ0A 4TQUQ 2RCBA 2WYPA 1NMUA 3RNNA 3WAFA 3DP6A 1FQAA 3K6VA 1LBBA 2ZZXA 5EQAA 4LP2B 2QS1A 5I58B 5HM4B 3BFTA 4PGPA 3MVWA 3IO6A 2I6EA 4XKPA 3MZBA 1I69A 3G3FA 5LOMA 3L6HA 4H45A 3PPNA 3CVGA 3KC1A 2XXHA 1RDXA 3USDA 1FBHA 4EF1A 1USYH 2B4LA 3OELA 2ZYKA 5CC2A 4IO3A 1MPBA 4BDOA 1FSAA 3WAEA 4PFYA 1IMAA 5H8NB 1Q1KA 1VFDA 4FEBA 4JWOA 2XXVA 5DVJA 2QVUA 4G8NA 2VHAA 3GZGA 5FHOA 2DDKA 4OXVA 4UA8A 3E4RA 4DE8A 2F6PA 1DBZA 4IR8A 3THIA 1XHYA 1B51A 1TFDA 4OA4A 5B70A 1P99A 4NWCA 2XXTA 3B7DA 1FPKA 1PEBA 3FVGA 5KZTA 4XKNA 2OCUA 1B2HA 1EZOA 1SYHA 4QFPA 2ZMBA 4GF8A 4U4SA 4C0RA 3G3HA 2XHDA 4YMAA 3IB1A 4DDDA 2YPNA 3AXFA 5TU0A 2LAOA 1B5IA 4ZE9A 5H8NA 4NEDA 4U23A 2F36A 1D9VA 5EYHA 1B0HA 4F1UA 1B40A 2GFEA 4PFTA 3KN7A 2I0BA 3K00A 4KI0E 4I62A 2Q8JA 4LATA 4MH5A 1LAXA 2RKMA 2ONRA 1FPIA 1CNQA 4PE3A 4G2ZA 3QYTA 3FXBA 4GVOA 3SEVA 1BK4A 3UIFA 1URSA 4YB6A 1XC1A 4ZDMA 4YB5A 1RYXA 2OPEA 4OVQA 2PBWA 4N81A 3H6VA 1MY4A 2OX3A 1RKMA 1B1XA 2KQZA 3DM0A 4MHFA 4ZEFA 5ELVA 4QXDA 4NE4A 5A5LA 1NUYA 1NV1A 4R2BA 1AWBA 4ZZEA 3SEXA 3U92A 2V4CA 1UTHB 3FJ7A 2XXKA 1T0KA 1NNPA 3PD8A 3ILUB 2F8DA 4QFLA 3TQWA 3E13X 5K2YA 5EYFA 5CBRA 2IEEA 4DXUA 3T93B 3RQTA 1LFHA 3PTYA 4GWSA 1IZ1A 1SI1A 3MUQA 1VE4A 2I0CA 2V93A 5KCJB 1H44A 4F31B 1EZ9A 3GBBA 2DE4A 1OVBA 3DP4A 4FBPA 3VDFA 2FA7A 1SW1A 1QVSA 5I56B 1NV3A 1DMBA 2F3DA 4LONB 1FRPA 2I48A 1AH5A 1H45A 1F9BA 1JW4A 3MW0A 1LFIA 1LEVA 1FPBA 2XX8A 3B50A 1OQHA 1MH4A 1OLAA 3SERA 4EQ7A 5AA2B 3C33A 2AL4A 3K02A 3K2DA 4ELRA 4NX1A 1IXHA 1FPEA 3H03A 5H8QB 3TODA 1NUWA 3OXNA 4O94A 1ZMGA 1YZ0A 4H5GA 1K9YA 4ZS9A 3OEMA 2ZYOA 2UYFA 4F22A 2E0SA 1HSJA 1J1NA 3VLUA 2UVIA 3KC0A 3RUMA 4X1BA 3O6IA 4FIMA 4PC9A 4G77A 1LBWA 1MQIA 2F7AA 4N6PA 1Y3NA 3DLNA 4RK9A 1FTKA 3U72A 4GD5A 3JV9A 2I3WA 2D3IA 1DK4A 3C32A 1WDNA 4NF6B 4MJOA 1FQEA 2H99A 3TDJA 1B1HA 3CHGA 3O66A 1S50A 1N3WA 4P3LA 5DT6A 3TELA 1BP5A 1UIVA 2RC7A 4ISUA 3T66A 3MP1A 4DXBA 2QRYA 2Y84A 5AA4A 3G3KA 4KYSA 2YJPA 3TMGA 4PDDA 1AL3A 2Q2AA 4GXAA 4F1YA 3JYRA 2H9BA 1POY1 5H8QA 1A55A 4RK2A 3C9HA 2BJIA 2F6GA 4KD5A 3VXCA 5T3JA 5I59A 3FATA 2MKZA 4R6HA 4LZ7A 3S9MC 3MZ1A 4O7IA 2R6GE 1N7XA 2VGQA 1D3KA 1HSLA 1FPDA 3PMXA 1PB7A 2V25A 1YYZA 3V5AA 4IO5A 2GHBA 3G7WA 1A8EA 3PPRA 3HFUA 3SEWA 3FASA 1GGGA 2DE2A 5H8SA 1EU8A 3MZ9A 4RJZA 1US5A 5I57B 3T9UA 4X04A 4I8CA 4YKKA 2WBDA 4DCXA 3JZJA 2Y7PA 1R6ZA 3OD7A 1LGBC 1A8FA 1DTGA 3C31A 4M4GA 5KDTB 3N5LA 3MVXA 3G3GA 1FBEA 1CB6A 2I58A 2WYKA 3FIRA 4DI3D 2HHMA 1SDXA 1N04A 3V8XB 4P9KA 4PTKA 3PMVA 3L6GA 2XX7A 4KR5A 3MWBA 2OWZA 3K1MA 1FTJA 1EH3A 3V89B 2DS9A 4G68C 4DXCA 3QXMA 4GBWA 2DE3A 4Q0CA 3CFZA 4XF5A 4OHNA 3D1RA 2QPQA 4R9GA 4ZEDA 1MM7A 4HXVA 5DEXA 4BDMA 2O51A 1B3EA 1MXWA 2NWJA 1O64A 4BDNA 1NV5A 3PMWA 3IJOB 1VR5A 3VLWA 4OVTA 4ONYA 1VFEA 1JVXA 3FUZA 4GL0A 4P11A 4RYAA 3RPLA 4NHBA 5H8FB 1SPIA 5L9MA 3MSTA 4MBPA 4OEUA 1FBPA 1MXYA 3SESA 4H0WA 4O7MA 2R8TA 4I3EA 2O69A 4R75A 3G3IA 2Z8FA 1MQHA 3TTLA 4L17A 2DYXA 3QK6A 1A40A 3UGWA 3MJNA 4OVRA 1MY3A 4JB7A 4U4XA 2Z22A 4WKMA 4HE2A 1IITA 2R71A 3KBRA 1S7YA 2CMOA 1MH3A 3C34A 5IM2A 2XWKA 4FECA 4RNSA 1MXUA 4AS4A 2HAUA 4NWDA 3G3JA 3KGCA 4IO4A 4YB7A 2KLFA 4FORA 4R6KA 1ZBMA 1LBYA 1FBFA 1QJMA 3QSLA 4KYEA 1GVCA 1IMCA 4U21A 2HPGA 4F2OA 1A7LA 4X8RA 4IY6A 4PFRA 4XEQA 2PFYA 3P7IA 3TTNA 1SD3A 1MQGA 4PFIA 1XS5A 1BTJA 4C1UA 5DYHA 2ZNSA 3PUYE 1TFAA 3O6GA 5I3SA 3ROJA 2Z8DA 1KWHA 4Q5TA 2DQVA 2WKYA 2RCAA 4F19A 3MPKA 1MQDA 3IORA 4YU0A 2PCRA 2PMSA 1NKXA 1NNTA 2B65A 5L8DA 1KZ8A 5A5XA 2NXOA 2O84X 3PUZE 1ELJA 3TTKA 2CZHA 1FBCA 3RYDA 3PV0E 3T9HB 5FHMA 2R9JA 3D4CA 1EZPA 3PPQA 3CR9A 1NUZA 4KCCA 5I84A 1WVJA 2FVZA 1S9TA 3LUZA 4PAFA 1B7HA 2P0SA 3TPAA 4DZ1A 2AL5A 1Y1ZA 4MAGA 3FXRA 3MBPA 1P1NA 1UTHA 1IMBA 3MP6A 3PUXE 3N6TA 3KSJA 3E79A 2UVGA 3M8UA 3BIHA 2DWJA 4LZ5A 5FTHA
chains in the Genus database with same CATH topology
1FPGA 2FIXA 2WYPA 1LBYA 1K9ZA 1NI9A 3MYUA 3LV0A 1FBFA 4HE0A 4QBAA 1FPLA 4PCDA 2DE4A 5JK4A 1NV4A 4MMPA 4GWXA 4PBHA 4FBPA 4XFEA 4GBWA 2Y5KA 1NUXA 2DE3A 3B8BA 2DVZA 4H46A 1IMCA 3BIGA 5ET6A 1FJ6A 1FBGA 1G0IA 1NV3A 3KBZA 5EQ9A 5EQAA 5EYHA 2F3DA 2CEYA 2L5VA 4PDDA 4PGNA 3W9VA 2WBBA 1LBXA 2HPGA 1FRPA 2Q9TA 1QGXA 4XF5A 3E78A 4N8GA 5EQ8A 4PGPA 4X8RA 4I40A 5EQ7A 3D1RA 2F5XA 2QPQA 4NQ8A 4PBQA 4PFRA 1EYKA 3IFCA 4XEQA 2PFYA 5DW8A 1INPA 4M1VA 2BJIA 4HXVA 1LEVA 4P56A 1FPBA 5T3JA 4PETA 4PFIA 1FPIA 4H45A 2HXRA 1CNQA 3ISPA 1FBDA 1NV2A 2MKZA 5LTCA 3B50A 3RPLB 4JVCA 4PE3A 1FPJA 3KC1A 2WX9A 3SZPA 5I3SA 2V3QA 4YZZA 1JP4A 1G0HA 1LBZA 1RDXA 3FXBA 4N6KA 2Q74A 3ROJA 4O7IA 1BK4A 1NV5A 2CEXA 5IGAA 1FBHA 1IMFA 4PAIA 4NF0A 4PC9A 4JVIA 4P1LA 4NX1A 1FPDA 4OVTA 4YICA 4I3YA 2XWVA 1YYZA 4MNIA 5ET7A 2B4LA 1FPEA 4F19A 1DCUA 2P3VA 5ET5A 4UABA 1D9QA 4GX4A 1NV7A 3HFUA 4OVQA 3RPLA 4NHBA 1NUWA 2QVRA 3EKIA 4P8BA 2ZZWA 5IZ3B 4PFBA 1EYIA 1SPIA 3MSTA 4N81A 1LBVA 2P3NA 1FSAA 1EYJA 1RDZA 1YZ0A 1IMAA 2PCRA 2VPOA 1FBPA 1KA0A 2JJKA 2DE2A 3IFAA 2PFZA 1KZ8A 1K9YA 2OX3A 4MIJA 4N91A 1FTAA 4OVSA 2QVUA 4O7MA 1FJ9A 2KQZA 2R8TA 4MNPA 4PF6A 3T1BA 4I3EA 3NOHA 4P47A 4N6DA 5J1DA 4P3LA 1KA1A 2CZHA 2DDKA 3KC0A 4X04A 1FBCA 3RYDA 1FPFA 1NV6A 5F24A 2Q8MA 1DBZA 2B4MA 3FBPA 4HCWA 4MHFA 1LBWA 4N8YA 2Y5LA 4IR8A 1VDWA 2WBDA 4GWYA 4MX6A 4OANA 4QXDA 2FHYA 5IZ1A 5ET8A 2QVVA 5IZ3A 4AS5A 5A5LA 2XA5A 4OA4A 3A29A 3T0JA 2CZIA 4NGUA 1NUZA 2GQ1A 4O8MA 2KR0A 1NUYA 1NV1A 4N4UA 2HZLA 4GWZA 2FVZA 4MCOA 4NG7A 4OVRA 5LDZA 1NV0A 4PDHA 1AWBA 1FPKA 4N15A 1DK4A 1XI6A 4KXPA 2XWIA 4PF8A 5IZZA 3LUZA 4HE1A 2V4CA 4PAFA 2XWOA 5ESYA 5EYGA 4NN3A 3W9WA 4PAKA 4MJOA 2XXKA 4GWWA 4HE2A 3CHGA 4MNCA 2FBPA 3QMFA 1IMDA 1FBEA 2VPNA 2WYKA 2QFLA 3GYYA 4LN5A 4NAPA 4P1EA 2HZKA 4OVPA 4DI3D 4JVDA 2FIEA 4MAGA 2HHMA 4F1VA 4GX3A 5IM2A 4GBVA 2XWKA 4X9TA 2ZZXA 5I5PA 4GWUA 4P9KA 1IMEA 2F3BA 2VT5A 2WEFA 4PTKA 4AS4A 3PTYA 4GWSA 4HCYA 1YXIA 1Q9DA 4G61A 3U65A 4MEVA 4GX6A 1IMBA 4DI4B 4F18A 1RDYA 5FBPA 2ZZVA 4N17A 2CZKA 3E79A 2OWZA 5J16A 4O94A 3BIHA 4F1UA 5CM6A 5I7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPG A;  2FIX A;  1LBY A;  1K9Z A;  1NI9 A;  3LV0 A;  1FBF A;  4HE0 A;  1FPL A;  1NV4 A;  4GWX A;  4FBP A;  4GBW A;  2Y5K A;  1NUX A;  3B8B A;  4H46 A;  1IMC A;  3BIG A;  5ET6 A;  1FJ6 A;  1FBG A;  1G0I A;  1NV3 A;  3KBZ A;  5EQ9 A;  5EQA A;  5EYH A;  2F3D A;  2WBB A;  1LBX A;  1FRP A;  1QGX A;  5EQ8 A;  4I40 A;  5EQ7 A;  3D1R A;  1EYK A;  3IFC A;  5DW8 A;  1INP A;  2BJI A;  4HXV A;  1LEV A;  1FPB A;  5T3J A;  1FPI A;  4H45 A;  1CNQ A;  1FBD A;  1NV2 A;  3RPL B;  1FPJ A;  3KC1 A;  5I3S A;  1JP4 A;  1G0H A;  1LBZ A;  1RDX A;  2Q74 A;  3ROJ A;  4O7I A;  1BK4 A;  1NV5 A;  1FBH A;  1IMF A;  1FPD A;  4I3Y A;  1YYZ A;  5ET7 A;  1FPE A;  1DCU A;  2P3V A;  5ET5 A;  1D9Q A;  4GX4 A;  1NV7 A;  3RPL A;  1NUW A;  2QVR A;  5IZ3 B;  1EYI A;  1SPI A;  4N81 A;  1LBV A;  2P3N A;  1FSA A;  1EYJ A;  1RDZ A;  1YZ0 A;  1IMA A;  2PCR A;  1FBP A;  1KA0 A;  2JJK A;  3IFA A;  1KZ8 A;  1K9Y A;  2OX3 A;  1FTA A;  2QVU A;  1FJ9 A;  2R8T A;  4I3E A;  1KA1 A;  2CZH A;  2DDK A;  3KC0 A;  1FBC A;  3RYD A;  1FPF A;  1NV6 A;  5F24 A;  2Q8M A;  1DBZ A;  3FBP A;  1LBW A;  2Y5L A;  4IR8 A;  1VDW A;  2WBD A;  4GWY A;  4QXD A;  2FHY A;  5IZ1 A;  5ET8 A;  2QVV A;  5IZ3 A;  4AS5 A;  5A5L A;  3A29 A;  3T0J A;  2CZI A;  1NUZ A;  2GQ1 A;  1NUY A;  1NV1 A;  4GWZ A;  2FVZ A;  5LDZ A;  1NV0 A;  1AWB A;  1FPK A;  1DK4 A;  1XI6 A;  4KXP A;  3LUZ A;  4HE1 A;  5ESY A;  5EYG A;  4MJO A;  4GWW A;  4HE2 A;  2FBP A;  3QMF A;  1IMD A;  1FBE A;  2QFL A;  2FIE A;  2HHM A;  4GX3 A;  4GBV A;  4GWU A;  1IME A;  2F3B A;  2VT5 A;  2WEF A;  4PTK A;  4AS4 A;  4GWS A;  1YXI A;  1Q9D A;  4G61 A;  4GX6 A;  1IMB A;  1RDY A;  5FBP A;  2CZK A;  2OWZ A;  5J16 A;  3BIH A; 
#chains in the Genus database with same CATH topology
 2THI A;  3GBA A;  4GRK A;  2F7C A;  4AB5 A;  1NV4 A;  2B3F A;  4LZ8 A;  4G68 B;  2DSF A;  1QUJ A;  4OER A;  3EN3 A;  3FJM A;  3HO7 A;  1N84 A;  2O7I A;  2Q9T A;  2UYE A;  3CFX A;  2RIN A;  4NQ8 A;  3TKD A;  4F29 A;  4M1V A;  4Q8R A;  2Y7R A;  3TCG A;  2Q88 A;  2X7P A;  1SW4 A;  4HS7 A;  1BKA A;  4QFO A;  4JVI A;  3IO4 A;  3HN0 A;  4P1L A;  4YIC A;  4I3Y A;  2O1L A;  3C35 A;  4N13 A;  1NV7 A;  2I49 A;  3EKI A;  3RT8 A;  4QSE A;  4F3G A;  4OWD A;  3PUV E;  1O63 A;  1M5E A;  4OEN A;  5CMK A;  2Q2C A;  1NH8 A;  4H8J A;  4N6D A;  3O2A A;  4HW8 A;  5AE4 A;  2Q8M A;  3FBP A;  2DWA A;  2V3T A;  3KEI A;  4GWY A;  4MX6 A;  1NFT A;  3K0V A;  3S2V A;  3N6U A;  4JSO A;  4O8M A;  4XFE A;  4N4U A;  1SW5 A;  4U1Z A;  1L5T A;  4N15 A;  3HHG A;  3KFM A;  3LBS A;  5ICT A;  1MPC A;  2REG A;  2FBP A;  3GYY A;  2QFL A;  2FIE A;  3CFL A;  4U22 A;  2XXW A;  2QS4 A;  3T1B A;  1GR2 A;  3DP8 A;  2HEU A;  2O1M A;  3C4M A;  2DXR A;  1DPE A;  3LV0 A;  1SI0 A;  5JK4 A;  4H8I A;  4MMP A;  4QSC A;  3I3V A;  1M5F A;  4GFR A;  3W9W A;  2L5V A;  3FVO A;  1LBX A;  3E78 A;  5EQ8 A;  4QSD A;  2F5X A;  2H98 A;  5DW8 A;  4RA1 A;  2X7Q A;  5TP9 A;  2PT2 A;  3S4U A;  2XXR A;  2VD3 A;  4JVC A;  5TP9 B;  2V3Q A;  1JP4 A;  4N6K A;  2Q74 A;  3H6W A;  4H6D A;  4FJP A;  1FTO A;  3U1O A;  4U2R A;  3CI8 A;  2XWV A;  3HHF A;  1M5D A;  4JSD A;  3LSX A;  1EYI A;  2P3N A;  5H8H A;  5H8F A;  4PF6 A;  3VXB A;  5I2N B;  5H8H B;  3VVF A;  4XKR A;  3B6Q A;  1Q35 A;  1UTB B;  3KOT A;  3LUY A;  2P1S A;  3LSL A;  1NNK A;  1PDA A;  4PDH A;  3C36 A;  3TZA A;  3BFU A;  3KG2 A;  5EYG A;  2XXY A;  4QF9 A;  3K6X A;  4GOT A;  3SEU A;  3FVK A;  1B0L A;  4P0I A;  1ZU0 A;  4R74 A;  3FVN A;  4POX A;  3PD9 A;  4F18 A;  4IGR A;  2XD2 A;  4KCD A;  4OES A;  1FPG A;  4NF8 A;  2RC9 A;  4BLA A;  2Y7W A;  1K9Z A;  1YTV A;  1FPL A;  1I6Q A;  4WED A;  1B5J A;  3H06 B;  1B3G A;  3ZKK A;  1YAE A;  3FV1 A;  3IX1 A;  1QGX A;  4FAT A;  5FTI A;  2Y7K A;  4PBQ A;  3I6V A;  3O9P A;  3RTF B;  4IO6 A;  3MPL A;  1FPJ A;  4OFO A;  1H3D A;  4IO2 A;  5IGA A;  1LAH E;  3B6W A;  5CRY A;  5ET7 A;  1QKA A;  4KFQ A;  3OO8 A;  2P3V A;  2XXU A;  4PFB A;  4PGN A;  4ECF A;  1RDZ A;  2GHA A;  3EHT A;  5M2V A;  1JEV A;  3IOU A;  4OEV A;  3K01 A;  5FHN A;  1MY1 A;  4C1T A;  3LSF B;  3EHS A;  3LSW A;  4OAN A;  1JQF A;  4G68 A;  2CZI A;  4AB6 A;  2ESN A;  2DXY A;  3TAJ A;  1B58 A;  2XWI A;  1SBP A;  2PX1 A;  2XWO A;  2XX9 A;  4OET A;  4LQ2 A;  1IMD A;  4LN5 A;  1FQC A;  2Y7I A;  4ZE8 A;  1IXC A;  3HPI A;  1JNF A;  2HAV A;  4GWU A;  1UQW A;  3D4G A;  3SDF A;  1Y9U A;  2I3V A;  3FV2 A;  1RDY A;  1IUD A;  5I7I A;  1B7Z A;  2Z23 A;  5AA4 B;  3SET A;  1ZLQ A;  2OK2 A;  4PCD A;  1ZJL A;  4MFI A;  3Q27 A;  1BLF A;  4FE8 A;  1P1Q A;  4OFJ A;  1QUI A;  1Y1M A;  4H46 A;  3BIG A;  4XTC Q;  1PB9 A;  3EQ1 A;  4I40 A;  1A54 A;  3M3L A;  4TLL B;  4NF8 B;  2DVC A;  2OWT A;  3VV5 A;  3IB0 A;  2H4I A;  4Z7E A;  3OEN A;  3T96 B;  4ZEC A;  5DEX B;  1TWY A;  2CEX A;  1IMF A;  3N26 A;  3B6T A;  1Y3Q A;  2O7U A;  5HPQ A;  1NL5 A;  4MLV A;  1DCU A;  3TEP A;  3FJG A;  1SYI A;  1D9Q A;  1MY2 A;  5AA3 A;  4YAH X;  4NG7 A;  1MY0 A;  2OLB A;  4N91 A;  3FXQ A;  3FXU A;  1FQD A;  3F11 A;  5J1D A;  4RPN A;  1LST A;  1XVY A;  3GLB A;  2QVV A;  1ZIU A;  3A29 A;  5I57 A;  3T0J A;  4U1O A;  2HZL A;  4GWZ A;  3RGY A;  1IXG A;  1USY E;  2H5Y A;  5ESY A;  1JW5 A;  2QJE A;  1JEU A;  1P1U A;  4OVP A;  4ELP A;  4F1V A;  4X9T A;  1PBQ A;  1IME A;  2WEF A;  5I2K B;  2DWI A;  3EPE A;  3QIM A;  1IIW A;  3TQL A;  3RPW A;  5I58 A;  3Q28 A;  1LCT A;  2AYS A;  1MXX A;  1B52 A;  5TPA A;  1FJ6 A;  1FBG A;  3FD3 A;  1A99 A;  3CSB A;  5B7D A;  3IFC A;  1I6A A;  3K1P A;  5IKB A;  1NNF A;  1QKB A;  1AMF A;  2D5W A;  4R6Y A;  4Z0I A;  4OTE A;  1FTL A;  3OSR A;  1DSN A;  1LBZ A;  2X26 A;  5JTY B;  1CE2 A;  1XT8 A;  2F34 A;  1IEJ A;  4ELO A;  1OQG A;  4GX4 A;  5IZ3 B;  1FQB A;  1EYJ A;  4OFL A;  4MIJ A;  1UIU A;  4OVS A;  1B7U A;  1B46 A;  3OO7 A;  4PFU A;  4PF8 A;  2ALU A;  3I5O A;  4NF5 A;  5ET8 A;  4IO7 A;  2GQ1 A;  4ZEI A;  4JWX A;  1NV0 A;  1ZTY A;  4KXP A;  1LLS A;  5CMB A;  5ICQ A;  1YCJ A;  4R2F A;  1VSO A;  4P1E A;  4XXU A;  1BIY A;  1MG1 A;  1LCF A;  2ZYM A;  2VD2 A;  3PU5 A;  1LFG A;  3Q29 A;  1AIV A;  4PQJ A;  2ZZV A;  3TTM A;  3A3C A;  3Q26 A;  3H7M A;  4IY5 A;  4G8M A;  3BBR A;  1IQ7 A;  1TXF A;  2QS3 A;  2Y5K A;  1Y4C A;  3OOA A;  3IOV A;  3HCQ A;  5HBC A;  3OO6 A;  1LB8 A;  1R1N A;  4O3C A;  1HSE A;  1OMP A;  1US4 A;  5CBS A;  1Y20 A;  1FBD A;  5LTC A;  4JBZ A;  1B4Z A;  3QAX A;  1IXI A;  3RPL B;  3K6W A;  4YZZ A;  3O97 A;  2P2A A;  3KJT A;  4PAI A;  4ESX A;  2PT1 A;  1PC3 A;  3KZG A;  2QL3 A;  4R73 A;  1LB9 A;  3U8Q A;  5CMC A;  3H6U A;  5F7V A;  1UTB A;  1PB8 A;  2D21 A;  4DLD A;  1B32 A;  3OO9 A;  1Y3P A;  1RYO A;  3VLV A;  3ZS6 A;  4MNP A;  4ZEB A;  2YLN A;  3MVY A;  3RT6 B;  4JXI A;  1NV6 A;  5AA2 D;  2Y5L A;  2NUV A;  3IB2 A;  3TCH A;  4OMB A;  3GXA A;  5IZ1 A;  2FHY A;  4GLI A;  5IZ3 A;  4AS5 A;  2XA5 A;  4NGU A;  2FNC A;  3K1N A;  5IZZ A;  2O6A A;  3O28 A;  5LDZ A;  3TTR A;  3CSG A;  2G93 A;  1SQY A;  5BWJ A;  1M5C A;  3KOS A;  2ONS A;  4JDF A;  3UP9 A;  3H3G A;  1ANF A;  1YXI A;  5DVF A;  5I59 B;  3T22 A;  3HST A;  4DI4 B;  4F3B A;  4YKI A;  2I4C A;  2XXP A;  4NMY A;  4NF6 A;  1DOT A;  1P1O A;  2VP1 A;  4YKP A;  4X48 A;  4GIZ A;  1N0T A;  2VOZ A;  1I6B A;  3O6H A;  5I56 A;  3KSX A;  1MDQ A;  1NUX A;  4RXL A;  2CEY A;  2WBB A;  4THI A;  4N8G A;  5ITP A;  4OVJ A;  3UN6 A;  1JVY A;  3IOW A;  3QUF A;  2OBG A;  3HV1 A;  3M3F A;  3VVD A;  4MF3 A;  3RTW B;  2XXI A;  4LVQ A;  2WX9 A;  1G0H A;  1H43 A;  3U93 A;  4O3A A;  4PE5 B;  4QFN A;  4NF0 A;  3VFJ A;  3DEL B;  2HCA A;  4XIG Q;  4KHZ E;  2QMW A;  4UAB A;  5AA1 A;  4FAJ A;  4P8B A;  1R9L A;  2ZNT A;  4LUB A;  5F1Q A;  4EDP A;  2JJK A;  2HFB A;  3IFA A;  5KCJ A;  1FJ9 A;  2AIX A;  4H1X A;  4R72 A;  4KPT A;  3LR1 A;  3T9V A;  1ATG A;  2OWS A;  5F24 A;  5L9S A;  3CRB A;  1ZKB A;  2RC8 A;  4WXJ A;  2OJT A;  2NOO A;  1N76 A;  4NTL A;  4GWO A;  1B5H A;  1XI6 A;  1FCK A;  1MS7 A;  3FGS A;  3A09 A;  3BKI B;  5BUU A;  4ZZA A;  2H25 A;  4GXS B;  1MQJ A;  3IOT A;  2ZXT A;  3MP8 A;  2HZK A;  3W15 C;  3O29 A;  2A5T B;  4POW A;  3ILT B;  1GV8 A;  3QUJ A;  3R6U A;  1FQF A;  1TT1 A;  5FBP A;  5J16 A;  5IAI A;  1B6H A;  1XVX A;  2CZL A;  4NF5 B;  2FIX A;  1NI9 A;  1JET A;  3CG1 A;  4QBA A;  4DIG A;  5EHS A;  3K6U A;  3UA8 A;  4RPO A;  4PBH A;  5I2N A;  1OIB A;  3PPP A;  4ZEK A;  5ET6 A;  2IA4 A;  1G0I A;  3KBZ A;  3T9X B;  4BDL A;  1YPN A;  2UVH A;  2A5S A;  3VE1 B;  3S9N C;  4K3F A;  4YKJ A;  5EQ7 A;  1FTM A;  1EYK A;  5I2K A;  1OVT A;  4PET A;  1Z7N E;  2ZNU A;  5JEI A;  1XOC A;  1WOD A;  3FZV A;  1P1W A;  4R9F A;  4F39 A;  4F3S A;  2FYI A;  4MNI A;  4EF2 A;  3IK6 B;  2PYY A;  2GH9 A;  5KDT A;  4LA9 A;  5ITO A;  3IAZ A;  1LBV A;  2VPO A;  3EHU A;  1Y4T A;  1MRP A;  2M8C A;  3IL1 B;  4P47 A;  1DPP A;  3ZSF A;  2B4M A;  4HCW A;  5A5X B;  2OZZ A;  1VDW A;  3TCF A;  4G4P A;  4G8H A;  2A5T A;  1QUK A;  3N94 A;  1B3F A;  4MCO A;  3KJ7 A;  5ISU A;  1DTZ A;  2V84 A;  3TUS A;  4HE1 A;  4NN3 A;  1FW0 A;  1O7T A;  4QHQ A;  4I9D A;  1II5 A;  1LAG E;  4GWW A;  3RY3 A;  3QMF A;  2Z8E A;  4OYV A;  4PP0 A;  4GBV A;  5L9O A;  3MC2 A;  3U65 A;  4MEV A;  1M5B A;  3OSQ A;  5CM6 A;  2DP8 A;  2DOJ A;  4KQP A;  3KN3 A;  1LBC A;  3MYU A;  3IR1 A;  4HE0 A;  3RLF E;  4YMB A;  1QUL A;  1MDP 1;  3LC8 A;  1SVX B;  2ABH A;  4RY1 A;  3ODB A;  2ANJ A;  3B8B A;  2W7Y A;  3ECR A;  2DVZ A;  2OPD A;  2O68 A;  4H5F A;  4XKQ A;  4ND9 A;  1Z7M E;  1H76 A;  4P56 A;  3K4U A;  1URD A;  2NVU B;  3ISP A;  1NV2 A;  2F97 A;  3R7X A;  3U94 A;  3CG3 A;  2Q89 A;  2E1S A;  2UXA A;  4QRZ A;  3MQ9 A;  3S9E A;  5CI5 A;  3MAM A;  3V83 A;  2I4B A;  5K2X A;  5CMM A;  4I1D A;  4OZ9 A;  1POT A;  3SKP A;  4EQ9 A;  3UK4 A;  4AQ4 A;  1MPD A;  4E0X A;  4WEP A;  2ZZW A;  3IJX B;  4HCY A;  2DWH A;  2PFZ A;  5TPA B;  3ZKL A;  4Q30 B;  2G29 A;  4ELQ A;  3R26 A;  2V3U A;  4IGT A;  1MM6 A;  3SEY A;  1AOV A;  2KR0 A;  1N7W A;  4DCY A;  4O3B A;  2REJ A;  1D4N A;  3E3K A;  3TFL A;  3EF7 A;  4LQ5 A;  1N3X A;  2VPN A;  4TLM B;  2ONK E;  4JVD A;  4NF4 B;  3PGF A;  1OLC A;  1B4H A;  1B9J A;  3ONM A;  1B3H A;  3MVZ A;  4KYD A;  4N17 A;  4EUO A;  3TYH A;  4EQB A;  4IB2 A;  2HXW A;  4H67 A;  2PVU A;  4BDQ A;  4GL8 A;  3RN8 A;  2XXQ A;  4X1D A;  4GWX A;  2B3B A;  3E9X A;  3OMB A;  5EQ9 A;  4MLQ A;  2RF1 A;  3W9V A;  2F78 A;  4P0G A;  1D9Y A;  3H4Z A;  5DVI A;  1INP A;  2XD3 A;  4GQO A;  4UAC A;  2HXR A;  4QFK A;  4ESW A;  4F2Q A;  3SZP A;  2F7B A;  4BDR A;  1QW0 A;  3OEK A;  4JWY A;  3UOR A;  3CIJ A;  1NH7 A;  2QMX A;  1GTK A;  5ET5 A;  3A3U A;  1URG A;  4F3P A;  2QVR A;  4N07 A;  2QS2 A;  3PUW E;  5EHM A;  1KA0 A;  1SW2 A;  1FTA A;  1MXZ A;  3M3K A;  4EXL A;  3NOH A;  3Q25 A;  1KA1 A;  4E0W A;  3S9L C;  1FPF A;  4HTG A;  4N8Y A;  4EXK A;  3KN8 A;  2UVJ A;  2ZYN A;  1B3L A;  2F35 A;  1MXV A;  4PFW A;  4NF4 A;  4TOZ A;  1LAF E;  5DTB A;  4PAK A;  2QSX A;  2GRV A;  1PBP A;  4MNC A;  5AA2 A;  4NAP A;  1JW1 A;  4GX3 A;  2BJJ X;  5I5P A;  2F3B A;  2VT5 A;  5JTY A;  1R9Q A;  4G61 A;  1Q9D A;  2XXX A;  3PPO A;  3H6T A;  3VVE A;  4GX6 A;  4H65 A;  4FED A;  4OQO A;  1B05 A;  2CZK A;  2HQ0 A;  4TQU Q;  2RCB A;  2WYP A;  1NMU A;  3RNN A;  3WAF A;  3DP6 A;  1FQA A;  3K6V A;  1LBB A;  2ZZX A;  5EQA A;  4LP2 B;  2QS1 A;  5I58 B;  5HM4 B;  3BFT A;  4PGP A;  3MVW A;  3IO6 A;  2I6E A;  4XKP A;  3MZB A;  1I69 A;  3G3F A;  5LOM A;  3L6H A;  4H45 A;  3PPN A;  3CVG A;  3KC1 A;  2XXH A;  1RDX A;  3USD A;  1FBH A;  4EF1 A;  1USY H;  2B4L A;  3OEL A;  2ZYK A;  5CC2 A;  4IO3 A;  1MPB A;  4BDO A;  1FSA A;  3WAE A;  4PFY A;  1IMA A;  5H8N B;  1Q1K A;  1VFD A;  4FEB A;  4JWO A;  2XXV A;  5DVJ A;  2QVU A;  4G8N A;  2VHA A;  3GZG A;  5FHO A;  2DDK A;  4OXV A;  4UA8 A;  3E4R A;  4DE8 A;  2F6P A;  1DBZ A;  4IR8 A;  3THI A;  1XHY A;  1B51 A;  1TFD A;  4OA4 A;  5B70 A;  1P99 A;  4NWC A;  2XXT A;  3B7D A;  1FPK A;  1PEB A;  3FVG A;  5KZT A;  4XKN A;  2OCU A;  1B2H A;  1EZO A;  1SYH A;  4QFP A;  2ZMB A;  4GF8 A;  4U4S A;  4C0R A;  3G3H A;  2XHD A;  4YMA A;  3IB1 A;  4DDD A;  2YPN A;  3AXF A;  5TU0 A;  2LAO A;  1B5I A;  4ZE9 A;  5H8N A;  4NED A;  4U23 A;  2F36 A;  1D9V A;  5EYH A;  1B0H A;  4F1U A;  1B40 A;  2GFE A;  4PFT A;  3KN7 A;  2I0B A;  3K00 A;  4KI0 E;  4I62 A;  2Q8J A;  4LAT A;  4MH5 A;  1LAX A;  2RKM A;  2ONR A;  1FPI A;  1CNQ A;  4PE3 A;  4G2Z A;  3QYT A;  3FXB A;  4GVO A;  3SEV A;  1BK4 A;  3UIF A;  1URS A;  4YB6 A;  1XC1 A;  4ZDM A;  4YB5 A;  1RYX A;  2OPE A;  4OVQ A;  2PBW A;  4N81 A;  3H6V A;  1MY4 A;  2OX3 A;  1RKM A;  1B1X A;  2KQZ A;  3DM0 A;  4MHF A;  4ZEF A;  5ELV A;  4QXD A;  4NE4 A;  5A5L A;  1NUY A;  1NV1 A;  4R2B A;  1AWB A;  4ZZE A;  3SEX A;  3U92 A;  2V4C A;  1UTH B;  3FJ7 A;  2XXK A;  1T0K A;  1NNP A;  3PD8 A;  3ILU B;  2F8D A;  4QFL A;  3TQW A;  3E13 X;  5K2Y A;  5EYF A;  5CBR A;  2IEE A;  4DXU A;  3T93 B;  3RQT A;  1LFH A;  3PTY A;  4GWS A;  1IZ1 A;  1SI1 A;  3MUQ A;  1VE4 A;  2I0C A;  2V93 A;  5KCJ B;  1H44 A;  4F31 B;  1EZ9 A;  3GBB A;  2DE4 A;  1OVB A;  3DP4 A;  4FBP A;  3VDF A;  2FA7 A;  1SW1 A;  1QVS A;  5I56 B;  1NV3 A;  1DMB A;  2F3D A;  4LON B;  1FRP A;  2I48 A;  1AH5 A;  1H45 A;  1F9B A;  1JW4 A;  3MW0 A;  1LFI A;  1LEV A;  1FPB A;  2XX8 A;  3B50 A;  1OQH A;  1MH4 A;  1OLA A;  3SER A;  4EQ7 A;  5AA2 B;  3C33 A;  2AL4 A;  3K02 A;  3K2D A;  4ELR A;  4NX1 A;  1IXH A;  1FPE A;  3H03 A;  5H8Q B;  3TOD A;  1NUW A;  3OXN A;  4O94 A;  1ZMG A;  1YZ0 A;  4H5G A;  1K9Y A;  4ZS9 A;  3OEM A;  2ZYO A;  2UYF A;  4F22 A;  2E0S A;  1HSJ A;  1J1N A;  3VLU A;  2UVI A;  3KC0 A;  3RUM A;  4X1B A;  3O6I A;  4FIM A;  4PC9 A;  4G77 A;  1LBW A;  1MQI A;  2F7A A;  4N6P A;  1Y3N A;  3DLN A;  4RK9 A;  1FTK A;  3U72 A;  4GD5 A;  3JV9 A;  2I3W A;  2D3I A;  1DK4 A;  3C32 A;  1WDN A;  4NF6 B;  4MJO A;  1FQE A;  2H99 A;  3TDJ A;  1B1H A;  3CHG A;  3O66 A;  1S50 A;  1N3W A;  4P3L A;  5DT6 A;  3TEL A;  1BP5 A;  1UIV A;  2RC7 A;  4ISU A;  3T66 A;  3MP1 A;  4DXB A;  2QRY A;  2Y84 A;  5AA4 A;  3G3K A;  4KYS A;  2YJP A;  3TMG A;  4PDD A;  1AL3 A;  2Q2A A;  4GXA A;  4F1Y A;  3JYR A;  2H9B A;  1POY 1;  5H8Q A;  1A55 A;  4RK2 A;  3C9H A;  2BJI A;  2F6G A;  4KD5 A;  3VXC A;  5T3J A;  5I59 A;  3FAT A;  2MKZ A;  4R6H A;  4LZ7 A;  3S9M C;  3MZ1 A;  4O7I A;  2R6G E;  1N7X A;  2VGQ A;  1D3K A;  1HSL A;  1FPD A;  3PMX A;  1PB7 A;  2V25 A;  1YYZ A;  3V5A A;  4IO5 A;  2GHB A;  3G7W A;  1A8E A;  3PPR A;  3HFU A;  3SEW A;  3FAS A;  1GGG A;  2DE2 A;  5H8S A;  1EU8 A;  3MZ9 A;  4RJZ A;  1US5 A;  5I57 B;  3T9U A;  4X04 A;  4I8C A;  4YKK A;  2WBD A;  4DCX A;  3JZJ A;  2Y7P A;  1R6Z A;  3OD7 A;  1LGB C;  1A8F A;  1DTG A;  3C31 A;  4M4G A;  5KDT B;  3N5L A;  3MVX A;  3G3G A;  1FBE A;  1CB6 A;  2I58 A;  2WYK A;  3FIR A;  4DI3 D;  2HHM A;  1SDX A;  1N04 A;  3V8X B;  4P9K A;  4PTK A;  3PMV A;  3L6G A;  2XX7 A;  4KR5 A;  3MWB A;  2OWZ A;  3K1M A;  1FTJ A;  1EH3 A;  3V89 B;  2DS9 A;  4G68 C;  4DXC A;  3QXM A;  4GBW A;  2DE3 A;  4Q0C A;  3CFZ A;  4XF5 A;  4OHN A;  3D1R A;  2QPQ A;  4R9G A;  4ZED A;  1MM7 A;  4HXV A;  5DEX A;  4BDM A;  2O51 A;  1B3E A;  1MXW A;  2NWJ A;  1O64 A;  4BDN A;  1NV5 A;  3PMW A;  3IJO B;  1VR5 A;  3VLW A;  4OVT A;  4ONY A;  1VFE A;  1JVX A;  3FUZ A;  4GL0 A;  4P11 A;  4RYA A;  3RPL A;  4NHB A;  5H8F B;  1SPI A;  5L9M A;  3MST A;  4MBP A;  4OEU A;  1FBP A;  1MXY A;  3SES A;  4H0W A;  4O7M A;  2R8T A;  4I3E A;  2O69 A;  4R75 A;  3G3I A;  2Z8F A;  1MQH A;  3TTL A;  4L17 A;  2DYX A;  3QK6 A;  1A40 A;  3UGW A;  3MJN A;  4OVR A;  1MY3 A;  4JB7 A;  4U4X A;  2Z22 A;  4WKM A;  4HE2 A;  1IIT A;  2R71 A;  3KBR A;  1S7Y A;  2CMO A;  1MH3 A;  3C34 A;  5IM2 A;  2XWK A;  4FEC A;  4RNS A;  1MXU A;  4AS4 A;  2HAU A;  4NWD A;  3G3J A;  3KGC A;  4IO4 A;  4YB7 A;  2KLF A;  4FOR A;  4R6K A;  1ZBM A;  1LBY A;  1FBF A;  1QJM A;  3QSL A;  4KYE A;  1GVC A;  1IMC A;  4U21 A;  2HPG A;  4F2O A;  1A7L A;  4X8R A;  4IY6 A;  4PFR A;  4XEQ A;  2PFY A;  3P7I A;  3TTN A;  1SD3 A;  1MQG A;  4PFI A;  1XS5 A;  1BTJ A;  4C1U A;  5DYH A;  2ZNS A;  3PUY E;  1TFA A;  3O6G A;  5I3S A;  3ROJ A;  2Z8D A;  1KWH A;  4Q5T A;  2DQV A;  2WKY A;  2RCA A;  4F19 A;  3MPK A;  1MQD A;  3IOR A;  4YU0 A;  2PCR A;  2PMS A;  1NKX A;  1NNT A;  2B65 A;  5L8D A;  1KZ8 A;  5A5X A;  2NXO A;  2O84 X;  3PUZ E;  1ELJ A;  3TTK A;  2CZH A;  1FBC A;  3RYD A;  3PV0 E;  3T9H B;  5FHM A;  2R9J A;  3D4C A;  1EZP A;  3PPQ A;  3CR9 A;  1NUZ A;  4KCC A;  5I84 A;  1WVJ A;  2FVZ A;  1S9T A;  3LUZ A;  4PAF A;  1B7H A;  2P0S A;  3TPA A;  4DZ1 A;  2AL5 A;  1Y1Z A;  4MAG A;  3FXR A;  3MBP A;  1P1N A;  1UTH A;  1IMB A;  3MP6 A;  3PUX E;  3N6T A;  3KSJ A;  3E79 A;  2UVG A;  3M8U A;  3BIH A;  2DWJ A;  4LZ5 A;  5FTH A; 
#chains in the Genus database with same CATH homology
 1FPG A;  2FIX A;  2WYP A;  1LBY A;  1K9Z A;  1NI9 A;  3MYU A;  3LV0 A;  1FBF A;  4HE0 A;  4QBA A;  1FPL A;  4PCD A;  2DE4 A;  5JK4 A;  1NV4 A;  4MMP A;  4GWX A;  4PBH A;  4FBP A;  4XFE A;  4GBW A;  2Y5K A;  1NUX A;  2DE3 A;  3B8B A;  2DVZ A;  4H46 A;  1IMC A;  3BIG A;  5ET6 A;  1FJ6 A;  1FBG A;  1G0I A;  1NV3 A;  3KBZ A;  5EQ9 A;  5EQA A;  5EYH A;  2F3D A;  2CEY A;  2L5V A;  4PDD A;  4PGN A;  3W9V A;  2WBB A;  1LBX A;  2HPG A;  1FRP A;  2Q9T A;  1QGX A;  4XF5 A;  3E78 A;  4N8G A;  5EQ8 A;  4PGP A;  4X8R A;  4I40 A;  5EQ7 A;  3D1R A;  2F5X A;  2QPQ A;  4NQ8 A;  4PBQ A;  4PFR A;  1EYK A;  3IFC A;  4XEQ A;  2PFY A;  5DW8 A;  1INP A;  4M1V A;  2BJI A;  4HXV A;  1LEV A;  4P56 A;  1FPB A;  5T3J A;  4PET A;  4PFI A;  1FPI A;  4H45 A;  2HXR A;  1CNQ A;  3ISP A;  1FBD A;  1NV2 A;  2MKZ A;  5LTC A;  3B50 A;  3RPL B;  4JVC A;  4PE3 A;  1FPJ A;  3KC1 A;  2WX9 A;  3SZP A;  5I3S A;  2V3Q A;  4YZZ A;  1JP4 A;  1G0H A;  1LBZ A;  1RDX A;  3FXB A;  4N6K A;  2Q74 A;  3ROJ A;  4O7I A;  1BK4 A;  1NV5 A;  2CEX A;  5IGA A;  1FBH A;  1IMF A;  4PAI A;  4NF0 A;  4PC9 A;  4JVI A;  4P1L A;  4NX1 A;  1FPD A;  4OVT A;  4YIC A;  4I3Y A;  2XWV A;  1YYZ A;  4MNI A;  5ET7 A;  2B4L A;  1FPE A;  4F19 A;  1DCU A;  2P3V A;  5ET5 A;  4UAB A;  1D9Q A;  4GX4 A;  1NV7 A;  3HFU A;  4OVQ A;  3RPL A;  4NHB A;  1NUW A;  2QVR A;  3EKI A;  4P8B A;  2ZZW A;  5IZ3 B;  4PFB A;  1EYI A;  1SPI A;  3MST A;  4N81 A;  1LBV A;  2P3N A;  1FSA A;  1EYJ A;  1RDZ A;  1YZ0 A;  1IMA A;  2PCR A;  2VPO A;  1FBP A;  1KA0 A;  2JJK A;  2DE2 A;  3IFA A;  2PFZ A;  1KZ8 A;  1K9Y A;  2OX3 A;  4MIJ A;  4N91 A;  1FTA A;  4OVS A;  2QVU A;  4O7M A;  1FJ9 A;  2KQZ A;  2R8T A;  4MNP A;  4PF6 A;  3T1B A;  4I3E A;  3NOH A;  4P47 A;  4N6D A;  5J1D A;  4P3L A;  1KA1 A;  2CZH A;  2DDK A;  3KC0 A;  4X04 A;  1FBC A;  3RYD A;  1FPF A;  1NV6 A;  5F24 A;  2Q8M A;  1DBZ A;  2B4M A;  3FBP A;  4HCW A;  4MHF A;  1LBW A;  4N8Y A;  2Y5L A;  4IR8 A;  1VDW A;  2WBD A;  4GWY A;  4MX6 A;  4OAN A;  4QXD A;  2FHY A;  5IZ1 A;  5ET8 A;  2QVV A;  5IZ3 A;  4AS5 A;  5A5L A;  2XA5 A;  4OA4 A;  3A29 A;  3T0J A;  2CZI A;  4NGU A;  1NUZ A;  2GQ1 A;  4O8M A;  2KR0 A;  1NUY A;  1NV1 A;  4N4U A;  2HZL A;  4GWZ A;  2FVZ A;  4MCO A;  4NG7 A;  4OVR A;  5LDZ A;  1NV0 A;  4PDH A;  1AWB A;  1FPK A;  4N15 A;  1DK4 A;  1XI6 A;  4KXP A;  2XWI A;  4PF8 A;  5IZZ A;  3LUZ A;  4HE1 A;  2V4C A;  4PAF A;  2XWO A;  5ESY A;  5EYG A;  4NN3 A;  3W9W A;  4PAK A;  4MJO A;  2XXK A;  4GWW A;  4HE2 A;  3CHG A;  4MNC A;  2FBP A;  3QMF A;  1IMD A;  1FBE A;  2VPN A;  2WYK A;  2QFL A;  3GYY A;  4LN5 A;  4NAP A;  4P1E A;  2HZK A;  4OVP A;  4DI3 D;  4JVD A;  2FIE A;  4MAG A;  2HHM A;  4F1V A;  4GX3 A;  5IM2 A;  4GBV A;  2XWK A;  4X9T A;  2ZZX A;  5I5P A;  4GWU A;  4P9K A;  1IME A;  2F3B A;  2VT5 A;  2WEF A;  4PTK A;  4AS4 A;  3PTY A;  4GWS A;  4HCY A;  1YXI A;  1Q9D A;  4G61 A;  3U65 A;  4MEV A;  4GX6 A;  1IMB A;  4DI4 B;  4F18 A;  1RDY A;  5FBP A;  2ZZV A;  4N17 A;  2CZK A;  3E79 A;  2OWZ A;  5J16 A;  4O94 A;  3BIH A;  4F1U A;  5CM6 A;  5I7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...