3KC0A

Crystal structure of human liver fbpase in complex with tricyclic inhibitor 10b
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Structure-based drug design of tricyclic 8H-indeno[1,2-d][1,3]thiazoles as potent FBPase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3kc0A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3kc0A02
1FPIA 1G0HA 1FPEA 4GWWA 1KZ8A 2WBDA 1NUXA 3D1RA 5EYGA 1FBPA 1QGXA 2QVVA 2Y5LA 2Y5KA 2DDKA 2GQ1A 2OWZA 2Q74A 4GWSA 1K9YA 1FPKA 2PCRA 2CZKA 1RDXA 4MJOA 1NI9A 1Q9DA 1DCUA 2QVUA 2WEFA 4N81A 1INPA 1FBDA 1NV6A 2HHMA 3BIHA 5EQAA 5ET5A 2P3VA 1FPBA 5ESYA 5ET6A 3IFCA 1FRPA 3RYDA 3LV0A 1FBEA 3RPLB 1G0IA 1NV4A 1RDYA 5LDZA 4HE1A 2F3DA 1FJ9A 1BK4A 2FIEA 5IZ3B 1NV0A 1IMFA 1FBGA 1NV1A 2FBPA 4GBVA 1FJ6A 1IMCA 1EYJA 4GWUA 4I40A 1IMEA 1LBYA 2BJIA 3QMFA 4PTKA 5F24A 2Q8MA 1IMAA 5T3JA 1FPFA 4KXPA 3LUZA 5A5LA 5FBPA 2QFLA 5I3SA 1IMBA 1LBXA 1LBVA 3A29A 3RPLA 1LBZA 1D9QA 5EQ9A 3T0JA 4GX3A 5IZ3A 4IR8A 5ET7A 5EYHA 4I3YA 5ET8A 1FPDA 4GWZA 1YXIA 2FHYA 5IZ1A 2WBBA 4AS5A 2P3NA 1LEVA 4GX6A 4I3EA 5J16A 3IFAA 2QVRA 1NV7A 2R8TA 1DK4A 3KC0A 3KBZA 4HXVA 1FPJA 1XI6A 1KA1A 4G61A 4HE0A 4QXDA 1NV2A 4H46A 2OX3A 3FBPA 1KA0A 5DW8A 1NUWA 4GWXA 5EQ8A 4H45A 1FBHA 2CZHA 1NUYA 1FBFA 4O7IA 1FPLA 1EYIA 1FBCA 1VDWA 4GX4A 3BIGA 1K9ZA 1FTAA 1LBWA 1RDZA 2FVZA 1NV5A 1CNQA 4GWYA 3ROJA 1FPGA 1IMDA 1FSAA 1YZ0A 2JJKA 4FBPA 4GBWA 2VT5A 1EYKA 1SPIA 1YYZA 2FIXA 5EQ7A 1JP4A 4AS4A 1AWBA 4HE2A 2CZIA 1NUZA 3KC1A 3B8BA 2F3BA 1NV3A 1DBZA
chains in the Genus database with same CATH superfamily
2XXKA 4I9DA 1I6BA 5I56B 2VPOA 2Q2AA 3PUZE 1N04A 1S9TA 4EXKA 1IITA 4GOTA 2DVCA 2XHDA 3VLUA 3PV0E 4KFQA 3BIHA 5ESYA 1FPBA 4WEPA 4FE8A 3S9MC 3O97A 3VLVA 1FBEA 2F7AA 4R75A 1GGGA 5L9MA 3LBSA 4OHNA 2XXXA 1B7HA 3CSBA 4NG7A 5AA4B 1R9LA 3MWBA 4KYEA 2V4CA 3K4UA 3FZVA 2ALUA 3L6HA 4KXPA 1ZJLA 4LUBA 4GL0A 1US4A 3O66A 2OLBA 3MVXA 5IZ3A 1T0KA 1TFAA 2DVZA 3VXBA 3ECRA 2DWHA 2XX7A 4XTCQ 4ELPA 4I3EA 4NEDA 2R8TA 1A55A 3H06B 4H46A 4QSDA 4H67A 3O9PA 1AH5A 3PUXE 2XWVA 1MXVA 3K1MA 3H4ZA 1Z7NE 1MQDA 2DP8A 4ELRA 4WXJA 1B9JA 1K9ZA 4O3BA 4OENA 2ZZVA 4FIMA 1IUDA 4NX1A 2CZIA 3KC1A 2UVHA 1ZU0A 2I0BA 3D1RA 4X04A 1ZLQA 1QUKA 4IO7A 1UTHB 5BWJA 1OLAA 4GRKA 4LZ5A 4NN3A 2PCRA 4NWCA 3VVEA 4ZEDA 2YJPA 3T93B 1M5DA 2P3VA 4F3GA 3FJGA 4OEVA 3VFJA 3PMXA 5BUUA 3HPIA 5LDZA 4EQ9A 1NV0A 4OERA 5DVIA 4HS7A 2OPDA 2XWKA 3TEPA 5TPAA 3MP1A 3LUYA 4QSCA 2GHAA 4RJZA 1IMAA 3FXUA 3LUZA 2Y7WA 3QAXA 5I3SA 2O6AA 4G68B 4RNSA 1B58A 2XXVA 1SBPA 4H1XA 2REJA 5ICQA 1BP5A 2PFZA 3TZAA 2Z8DA 1B7UA 1B52A 4Z0IA 5TP9A 3C36A 5H8QB 5I2KB 4UA8A 4U4XA 2NVUB 3SEWA 1DTGA 2Q88A 4KCCA 4N91A 3EHUA 1MRPA 4JWYA 4H8IA 1UIVA 3F11A 4U1OA 3T9HB 3KN7A 1VDWA 4ESXA 1ZKBA 4HCWA 3S9EA 2DWIA 1B32A 1USYE 2D3IA 1RYOA 2Z22A 1B0LA 3KEIA 3TCHA 4NTLA 1B0HA 4F3BA 4ELOA 1UTBB 4NF8B 1MY3A 3OENA 3UGWA 4BDLA 2DE2A 1LFIA 1TT1A 3ZS6A 3H3GA 2R9JA 5I5PA 1FPKA 4OVJA 2O84X 3IB0A 1NI9A 1FBDA 1DPEA 4ZZAA 2FYIA 5EQAA 3KOSA 5ET6A 5IZZA 2WYPA 3IB1A 1JQFA 4U23A 2WKYA 3MZ9A 4JWOA 4ZZEA 1DSNA 2XA5A 3PMWA 2OPEA 2RC9A 3IK6B 4FECA 1TXFA 5ISUA 3SEVA 4GWOA 2P0SA 2KR0A 1MH3A 3TTNA 2HQ0A 1IQ7A 4JBZA 1LBVA 4PFBA 1EH3A 1OIBA 4IO6A 4QFKA 4GQOA 4R9FA 1N7WA 4KHZE 2ZNUA 1Q1KA 5I58B 3MPLA 2P1SA 2RINA 3EHTA 4ZECA 1D9YA 3PUWE 1QUJA 2CEYA 2LAOA 1Y4TA 1MM6A 4R6YA 3QXMA 3PPRA 4U1ZA 1MXZA 5DVFA 3VXCA 4O7IA 3U94A 2A5TB 4THIA 2V3UA 2Z8FA 3FATA 2F6GA 3RGYA 1FCKA 4TLLB 2ONKE 2F78A 3SERA 5A5XB 2OBGA 3S9LC 1MDP1 4F29A 3H6WA 3IOUA 1EZPA 4OESA 4EF1A 4PFRA 4MFIA 5ICTA 2Q74A 3O6IA 1N3XA 1EZ9A 1RDXA 3KGCA 3SETA 2DXRA 5EHMA 3OOAA 1ZMGA 5ET5A 5H8HA 1M5BA 3QUJA 2OWTA 3W9VA 3RPLB 1N76A 3IAZA 4NF5A 3IOVA 2DYXA 2ZYMA 3WAEA 5JK4A 3B6WA 2ZZWA 3OEMA 3T1BA 1VFEA 1MS7A 1FPFA 3E3KA 3CFXA 3TDJA 4PDDA 5KDTA 2F5XA 3G7WA 2YLNA 3KOTA 3RUMA 1HSLA 2H4IA 3H03A 1AIVA 5L9SA 2PMSA 4P3LA 1F9BA 3CHGA 4QFOA 4QXDA 3FJ7A 3DP4A 4QRZA 3DLNA 3FBPA 3TCGA 4E0WA 1FBFA 1NKXA 1YAEA 4R6KA 1QVSA 4Q0CA 3N6UA 4C1UA 5AA2D 4XKRA 4PF8A 3FUZA 5LOMA 3I6VA 5CBSA 4IO5A 3ILTB 2VT5A 4IB2A 1A54A 3MZBA 4N6PA 2RKMA 4H8JA 1MH4A 2QS4A 1EU8A 4MHFA 4ZEKA 1I69A 3U8QA 3CFZA 1M5EA 3FV2A 4EXLA 1B3EA 4KD5A 2QVVA 2XXHA 1LBBA 2E0SA 2AYSA 4NGUA 4ESWA 3GBBA 4EF2A 1GTKA 4KR5A 4IGRA 4GFRA 3K6WA 1M5CA 3Q25A 3MSTA 1NV6A 2ANJA 1MY1A 2I48A 3RT8A 1B2HA 1FRPA 3M3FA 3FD3A 1B3GA 2QRYA 4DDDA 1NV4A 1RDYA 3OO7A 4OVPA 1BK4A 5IZ3B 4P1EA 2WX9A 4X9TA 5H8SA 3MYUA 1IMCA 1QJMA 4Q8RA 5CMBA 4Q30B 1SVXB 2I3VA 1JW1A 3GLBA 1LBXA 2PT2A 2VOZA 3V5AA 1QW0A 2GRVA 1SYHA 3T9VA 4IR8A 1XT8A 3E78A 4H0WA 4OFLA 4X1BA 4G61A 2AL5A 1NV2A 2XXTA 4PC9A 3C9HA 2F35A 2R6GE 5FHMA 5H8FA 3DP6A 4LA9A 3H6UA 1SI1A 1P99A 2Q2CA 3HFUA 3BIGA 4HW8A 3BFTA 1FTAA 1LBWA 3FVGA 1LLSA 3H6TA 5FTIA 1FSAA 3H7MA 4N8GA 1ZTYA 1JNFA 1NFTA 4JSDA 2E1SA 3RLFE 5HBCA 4GF8A 3LSFB 4OWDA 1MY2A 1UIUA 3UN6A 4YMAA 1G0HA 3FJMA 4PETA 3EHSA 4DZ1A 1NUXA 3U1OA 2I6EA 2Y5KA 2OWZA 2F97A 2Z23A 5ITOA 3C35A 4KYSA 4FJPA 3W9WA 4NF4A 2QL3A 4UABA 2CEXA 5KZTA 5TPAB 2I0CA 3M8UA 1WVJA 4RA1A 4MLQA 2DXYA 1NH8A 4ELQA 1VFDA 4GWUA 2HFBA 2QS3A 4RY1A 5TP9B 4N6DA 2O68A 4YMBA 1SQYA 1OVTA 1EZOA 1H76A 3TMGA 5M2VA 4U22A 2B4MA 3CIJA 4F1VA 3OO6A 1P1WA 2DE3A 2PVUA 4JWXA 1ZIUA 1VE4A 2V3QA 2PT1A 5EQ8A 1P1OA 4R9GA 3T9XB 1EYIA 3K0VA 3TYHA 1FBCA 4GX4A 5K2YA 1CNQA 2FNCA 1PBPA 3T9UA 1YZ0A 1TFDA 3E13X 3KN8A 3S2VA 4MAGA 4GVOA 3UIFA 2ZYKA 4MNCA 1USYH 3MPKA 4RPNA 2HAVA 1IZ1A 5CBRA 4QBAA 4PP0A 1ANFA 3UA8A 4H5FA 4P0GA 1PBQA 1DCUA 3GZGA 3IJXB 1QKBA 3CR9A 3KBRA 2VHAA 1OQGA 1LCTA 3O6GA 5IGAA 2RCAA 3QIMA 2F3DA 3V83A 1XS5A 4G8NA 4GBVA 4O94A 1ELJA 5F24A 2Q8MA 1H44A 1SYIA 5KCJA 3A29A 3DP8A 1MXXA 4LZ7A 4YAHX 5EQ9A 5DT6A 3Q26A 2X7PA 4QSEA 3TUSA 3HCQA 4OVRA 1FTMA 3PU5A 4GIZA 4Z7EA 1OLCA 2O69A 2F8DA 4TOZA 3WAFA 1LAGE 3UP9A 2B3FA 3PPNA 3BKIB 5EYFA 2XXUA 1S50A 4LATA 3IO6A 4YKJA 1FBHA 4RK9A 4G2ZA 3IB2A 4U4SA 5B70A 3SEYA 1P1QA 1P1UA 1PB9A 2NOOA 2XD3A 3K6XA 3E79A 3O28A 3PUVE 2GH9A 2UVGA 3RT6B 1YYZA 5EQ7A 4AS4A 1R6ZA 4ZE9A 3A3CA 4OFOA 1Y20A 1KWHA 2B3BA 5H8HB 3G3KA 1B5JA 3VVDA 5EYGA 3TTRA 1NH7A 1MXYA 1PB8A 4IO3A 4NF5B 1POTA 1DMBA 2XXYA 4MIJA 4O3AA 3AXFA 1B4HA 2RC8A 4M4GA 3DM0A 3ZKLA 3THIA 2AL4A 3MJNA 4X1DA 4DI3D 2UYFA 5KDTB 4LQ5A 1B6HA 4DCYA 3P7IA 2X26A 1RYXA 4MNIA 3T96B 5IKBA 4LZ8A 3FV1A 1LFGA 4YKPA 1IMBA 1R1NA 1LBZA 3B6TA 1SW4A 3JZJA 4PAIA 4KI0E 3UK4A 3W15C 1Y1MA 5TU0A 4PE5B 5I59A 1ATGA 2O7UA 2WBBA 4HTGA 2YPNA 3IFAA 4JDFA 3KJTA 5AA2A 4HXVA 1H43A 3RN8A 2UYEA 3HO7A 5I84A 2QMXA 4N8YA 3EKIA 2O1MA 3OMBA 3O6HA 4GBWA 3GBAA 3PGFA 4G8MA 1B5IA 4FORA 3SDFA 5I2NA 1DBZA 2WBDA 3G3GA 4DCXA 3O2AA 1A7LA 3PMVA 1JEVA 4NMYA 4TQUQ 1CE2A 1LAXA 2CZKA 4MJOA 2WEFA 4ZEBA 4DXBA 3U92A 2Q9TA 2DOJA 4NF6A 4XFEA 1A99A 1IXCA 1XVXA 4YICA 1NNFA 1Y3NA 4XEQA 3RYDA 2ABHA 4N07A 2R71A 1FJ9A 3Q29A 3PPQA 1L5TA 1LFHA 1EYJA 3UORA 2XX9A 4DLDA 4OEUA 4G8HA 2QS1A 3C33A 4AB5A 3T0JA 4F1YA 1FQFA 1JVXA 2GFEA 5H8FB 3R7XA 2F6PA 1Z7ME 4AS5A 1YCJA 2GHBA 3PPPA 4KCDA 4F22A 2FA7A 3Q27A 1MY0A 4PFUA 2F36A 2F34A 1O63A 2OZZA 4IY5A 1B51A 1Y3PA 3TQWA 1URGA 4NHBA 4F18A 2KLFA 1GVCA 4AB6A 3HSTA 3MP8A 3TTKA 5JTYA 4BDNA 4RK2A 2WYKA 3ZSFA 1IXHA 3PD8A 4TLMB 1EYKA 4NF4B 3OO9A 4OANA 1JP4A 4HE2A 4N4UA 3B8BA 3ODBA 1RKMA 3SESA 2RF1A 3CRBA 3N26A 2D21A 4PBHA 1HSEA 1FBPA 4DIGA 1CB6A 3TELA 1US5A 3B7DA 1DOTA 3MW0A 4FEBA 5CM6A 2HXRA 2I58A 4P47A 3OXNA 3MZ1A 2XD2A 1FQEA 3U93A 1G0IA 1SW1A 3HN0A 4KQPA 4BDOA 4BLAA 2ZXTA 1POY1 1IMFA 5LTCA 4U21A 2I3WA 5EHSA 4G68C 3VV5A 4QHQA 4P56A 3S9NC 5FBPA 1IXIA 1OVBA 3RNNA 3V89B 5IM2A 2ONRA 5EYHA 2PBWA 1B3HA 1I6QA 1YXIA 2PFYA 1MPBA 2P2AA 2DWJA 4KPTA 1XHYA 4ZEFA 4ZEIA 1XI6A 2VP1A 5AA1A 1P1NA 3K2DA 2F7BA 4BDQA 2OX3A 4X8RA 3G3FA 4K3FA 2CZHA 1FTLA 1GV8A 2H98A 4MCOA 4O8MA 1B3FA 2VD2A 2ONSA 3NOHA 1VR5A 5H8NA 3K01A 3JV9A 1YTVA 1AWBA 3OSRA 2D5WA 1N3WA 2V84A 1FPIA 2OCUA 3TCFA 1JETA 3KZGA 4KYDA 4OVTA 2DDKA 2GQ1A 2OK2A 2HXWA 2XXWA 4XKQA 4E0XA 1K9YA 4GXSB 3IR1A 3LSLA 4OVQA 4L17A 1MPDA 2QVUA 5HPQA 2XWIA 2A5SA 3GYYA 4PF6A 2UVIA 4UACA 5CC2A 5KCJB 1LSTA 1GR2A 3RQTA 1SDXA 3CG3A 4YU0A 5J1DA 5DYHA 2M8CA 3Q28A 5A5LA 4O3CA 3TQLA 3IJOB 3FVKA 3I3VA 5K2XA 4GX3A 2O51A 1WDNA 1MG1A 4R73A 3JYRA 1NNPA 5CMMA 4X48A 1NV7A 3V8XB 3KC0A 4P0IA 4MX6A 2DQVA 1NNKA 5HM4B 5DEXA 4H5GA 5FHOA 3TTLA 4GLIA 1FPLA 3R6UA 1O64A 5AA3A 1FTJA 2CZLA 1BKAA 3VVFA 1FTOA 4MH5A 1PB7A 3MC2A 1FPGA 1XOCA 2W7YA 2JJKA 4MLVA 4DE8A 3PTYA 3IORA 4G4PA 4NE4A 3TFLA 4PAKA 1SD3A 1NUZA 3G3JA 3IOTA 2F3BA 1BIYA 2ZYNA 1AL3A 4FATA 4GL8A 2ZYOA 1JW5A 3CFLA 5I57A 3C32A 3QSLA 3N6TA 3S4UA 3MVYA 2QS2A 3KFMA 2Y7PA 4N81A 2HCAA 2HHMA 3OSQA 2ZNSA 5CMCA 3TKDA 3N94A 3RTFB 2DE4A 5F1QA 3MVWA 1SI0A 5I59B 1FJ6A 2XXPA 4MF3A 4R72A 1LBYA 4PTKA 5AA2B 3MVZA 2H5YA 5I7IA 4LN5A 3O29A 3EQ1A 1NL5A 5ELVA 1D9QA 1A8FA 1OMPA 2Y84A 3QK6A 3MQ9A 3PUYE 4I3YA 1IXGA 4MEVA 2PX1A 2THIA 2FHYA 5J16A 1LEVA 4MBPA 3TPAA 1XVYA 3KBZA 4LVQA 2ZZXA 4YKKA 1KA1A 2Q8JA 4BDMA 4WEDA 5DW8A 1NUWA 1Y9UA 4R2FA 5I2NB 2XX8A 1QUIA 1RDZA 1NV5A 2HEUA 3K1NA 2Q89A 2ZNTA 1IEJA 3MP6A 1MM7A 2FIXA 4XXUA 4F1UA 4M1VA 3PPOA 1NV3A 2X7QA 2H9BA 4NF6B 4GWWA 4AQ4A 1KZ8A 4O7MA 4F3SA 1D3KA 1SW2A 1QGXA 4I1DA 4JVDA 3TAJA 4PFYA 4H65A 4IY6A 3G3IA 1Q9DA 2Y7RA 1BTJA 1URSA 3CSGA 2Y7KA 4YB7A 3IFCA 4PQJA 5I56A 3SEXA 2BJJX 3C34A 3TTMA 3EN3A 4HE1A 4RPOA 2DSFA 4QFLA 1FBGA 4I40A 2NXOA 1IMEA 4I8CA 2BJIA 3FASA 1M5FA 5AE4A 3PD9A 3TODA 4EUOA 4R2BA 2QFLA 3KN3A 2NWJA 4PGNA 1VSOA 3K1PA 1O7TA 4PFTA 4ECFA 2I49A 1FPDA 5IZ1A 1B40A 1H3DA 5AA4A 4GX6A 5JTYB 3IX1A 1DK4A 4WKMA 1LCFA 5L8DA 2IEEA 4MMPA 3M3KA 1XC1A 2KQZA 2MKZA 1FTKA 2V25A 3VE1B 2HAUA 4GWXA 3IL1B 2F7CA 3OO8A 1MPCA 4GWYA 3ROJA 1MQIA 2I4CA 4NAPA 3ILUB 1LBCA 2AIXA 4LQ2A 1SPIA 2H99A 3G3HA 5IAIA 1QKAA 2UVJA 3H6VA 4ZE8A 1N0TA 3T66A 4OETA 1FPEA 3HHGA 4ISUA 4IO4A 1PEBA 4EDPA 4GD5A 3D4CA 3D4GA 2VGQA 2O1LA 2NUVA 4XIGQ 4XKPA 2Y7IA 3KG2A 1B1HA 1INPA 4RXLA 3OELA 4F2QA 4QFNA 2L5VA 1UTHA 1MXUA 5CMKA 4POXA 3M3LA 4PCDA 1NV1A 2FBPA 2QJEA 4JVCA 4YKIA 4EQBA 3QMFA 4EQ7A 1A40A 4YB5A 1DPPA 4YZZA 4F19A 1N84A 4POWA 2DWAA 3MUQA 4IGTA 3L6GA 4OVSA 3ZKKA 3SKPA 4LONB 4BDRA 4GWZA 1AOVA 3N5LA 3I5OA 2P3NA 3KSXA 1JW4A 1JVYA 1FW0A 1FPJA 1FQBA 5H8NB 3LC8A 3FXBA 2XXRA 4G68A 4MNPA 2OWSA 4H45A 1R9QA 1LAFE 4R6HA 2QMWA 1B05A 2H25A 3BBRA 5H8QA 5I2KA 2FVZA 5CRYA 3SZPA 3ISPA 3LSXA 4GXAA 1NNTA 3QUFA 3RPWA 5B7DA 4DXUA 1LB8A 1TWYA 2G93A 2G29A 3DELB 5F7VA 4N13A 4NF0A 3A09A 4GWSA 1Y4CA 2CMOA 4JSOA 4YB6A 5DVJA 4P9KA 4PGPA 2ESNA 3FVOA 3K6VA 4QF9A 2REGA 4JXIA 3CI8A 4H6DA 1UTBA 3C4MA 4NF8A 3OEKA 3FXRA 3VDFA 4G77A 2HPGA 2Z8EA 3LV0A 1AMFA 3KJ7A 4I62A 4XKNA 1MQGA 3USDA 2XXQA 4FAJA 2XXIA 4R74A 1WODA 4PFIA 4F31B 1LB9A 4OTEA 1II5A 2RC7A 3MBPA 3CVGA 5T3JA 1Q35A 1H45A 4F2OA 3FVNA 4OYVA 5FHNA 3T22A 5DEXB 4ZDMA 2DS9A 5ET8A 4NWDA 1IIWA 2B4LA 2VPNA 1OQHA 1MY4A 4ND9A 2QVRA 1MQJA 4OZ9A 1URDA 3LSWA 1PC3A 1KA0A 1B5HA 4N15A 4QFPA 1NUYA 3FIRA 1D9VA 3A3UA 3K02A 2PYYA 3IO4A 3MAMA 5I58A 3BFUA 1B4ZA 3E9XA 1B7ZA 2ZMBA 5I57B 3EF7A 1BLFA 3B6QA 4DXCA 1D4NA 2OJTA 1MDQA 2A5TA 2V93A 3RTWB 3U72A 4C0RA 1PDAA 1MXWA 2Y5LA 2IA4A 1FQDA 2B65A 3R26A 2QPQA 1QULA 4OXVA 1JEUA 4P1LA 4Q5TA 5JEIA 1FQCA 3U65A 5A5XA 3VLWA 3LR1A 4JB7A 3HHFA 4OQOA 3HV1A 3E4RA 3FGSA 3SEUA 1UQWA 1SW5A 3FXQA 4ZS9A 1A8EA 4FEDA 4P8BA 3OD7A 2FIEA 1B3LA 1FQAA 1LGBC 1J1NA 4JVIA 4PBQA 1YPNA 3K00A 2VD3A 4PDHA 2V3TA 1Y1ZA 5CI5A 4U2RA 2RCBA 4PFWA 4OFJA 5FTHA 1B46A 2HZLA 4P11A 3RPLA 1HSJA 5DTBA 3EPEA 1Y3QA 4HCYA 5ET7A 4DI4B 1I6AA 1NMUA 3KSJA 2O7IA 2XWOA 5L9OA 1S7YA 4N17A 1B1XA 3QYTA 1DTZA 3C31A 2I4BA 3GXAA 4RYAA 1N7XA 4OMBA 4HE0A 4F3PA 3IOWA 3RY3A 4LP2B 4PAFA 4XF5A 2HZKA 3B50A 2QSXA 1ZBMA 3ONMA 4ONYA 5ITPA 1IMDA 3CG1A 4FBPA 4C1TA 4NQ8A 2UXAA 4N6KA 4OA4A 4IO2A 4PE3A 4F39A 1LAHE 3K6UA 1MQHA
chains in the Genus database with same CATH topology
4GWWA 2XXKA 1KZ8A 2WBDA 4O7MA 2QVVA 1QGXA 4NGUA 2VPOA 4JVDA 2CZKA 4MJOA 1Q9DA 2WEFA 3MSTA 1NV6A 2Q9TA 3BIHA 4XFEA 5ESYA 1FPBA 4YICA 3IFCA 4XEQA 1FRPA 3RYDA 1FBEA 1NV4A 1RDYA 4HE1A 4OVPA 1FJ9A 1BK4A 5IZ3B 4P1EA 2WX9A 1FBGA 4X9TA 3MYUA 1IMCA 1EYJA 4I40A 4NG7A 1IMEA 2BJIA 2V4CA 4KXPA 2QFLA 1LBXA 4PGNA 3T0JA 5IZ3A 2DVZA 4IR8A 1FPDA 3E78A 5IZ1A 4AS5A 4I3EA 4GX6A 2R8TA 1DK4A 4G61A 1NV2A 4H46A 4MMPA 2MKZA 2KQZA 4PC9A 2XWVA 4GWXA 4NHBA 4F18A 3HFUA 3BIGA 1K9ZA 1FTAA 1LBWA 4GWYA 3ROJA 4NAPA 2ZZVA 2WYKA 1FSAA 4N8GA 1EYKA 1SPIA 4OANA 1JP4A 4NX1A 4HE2A 4N4UA 2CZIA 3KC1A 3B8BA 1G0HA 1FPEA 4PETA 4PBHA 1NUXA 3D1RA 1FBPA 4X04A 2Y5KA 2OWZA 4NN3A 2PCRA 3W9WA 5CM6A 4UABA 2CEXA 2HXRA 1INPA 4P47A 2P3VA 2L5VA 1G0IA 5LDZA 4PCDA 1NV0A 1IMFA 1NV1A 5LTCA 2FBPA 2XWKA 4JVCA 4GWUA 3QMFA 4N6DA 1IMAA 4P56A 3LUZA 5FBPA 5I3SA 4YZZA 4F19A 5IM2A 5EYHA 4OVSA 2PFZA 2B4MA 4GWZA 1YXIA 4F1VA 2PFYA 2P3NA 2DE3A 1FPJA 1XI6A 4N91A 3FXBA 2V3QA 2OX3A 4X8RA 5EQ8A 4MNPA 4H45A 2CZHA 1EYIA 4MCOA 1FBCA 1VDWA 4GX4A 4O8MA 2FVZA 1CNQA 3NOHA 4HCWA 3SZPA 1YZ0A 3ISPA 4MAGA 1AWBA 4MNCA 1FPIA 2DE2A 2DDKA 2GQ1A 4OVTA 4NF0A 4QBAA 4GWSA 1K9YA 5I5PA 1FPKA 4P9KA 4PGPA 4OVQA 1NI9A 1DCUA 2QVUA 1FBDA 2XWIA 5EQAA 5ET6A 3GYYA 4PF6A 5IZZA 2HPGA 2WYPA 3LV0A 5IGAA 2F3DA 2XA5A 5J1DA 4GBVA 4PFIA 4O94A 5F24A 2Q8MA 5T3JA 2KR0A 5A5LA 1LBVA 3A29A 5EQ9A 4PFBA 4GX3A 4OVRA 5ET8A 2B4LA 2VPNA 2QVRA 1NV7A 3KC0A 2CEYA 4MX6A 1KA0A 1FBHA 4N15A 1NUYA 4O7IA 1FPLA 3E79A 1FPGA 2JJKA 3PTYA 1YYZA 5EQ7A 4AS4A 4PAKA 1NUZA 2F3BA 5EYGA 2Y5LA 4PFRA 2Q74A 2QPQA 4MIJA 1RDXA 4P1LA 4N81A 3U65A 2HHMA 5ET5A 4DI3D 3W9VA 3RPLB 2DE4A 4P8BA 2FIEA 5JK4A 2ZZWA 4JVIA 4MNIA 4PBQA 1FJ6A 3T1BA 4PDHA 1LBYA 4PTKA 1FPFA 5I7IA 4LN5A 2HZLA 4PDDA 1IMBA 3RPLA 1LBZA 1D9QA 2F5XA 4PAIA 4HCYA 5ET7A 4DI4B 4I3YA 4MEVA 2FHYA 2XWOA 2WBBA 5J16A 1LEVA 4N17A 4P3LA 3IFAA 3CHGA 3KBZA 4HXVA 2ZZXA 1KA1A 4HE0A 4QXDA 3FBPA 5DW8A 1NUWA 4N8YA 4PAFA 1FBFA 4XF5A 3EKIA 1RDZA 2HZKA 3B50A 1NV5A 1IMDA 4PF8A 4FBPA 4GBWA 2VT5A 4NQ8A 4N6KA 2FIXA 4OA4A 4PE3A 4F1UA 4MHFA 4M1VA 1NV3A 1DBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPI A;  1G0H A;  1FPE A;  4GWW A;  1KZ8 A;  2WBD A;  1NUX A;  3D1R A;  5EYG A;  1FBP A;  1QGX A;  2QVV A;  2Y5L A;  2Y5K A;  2DDK A;  2GQ1 A;  2OWZ A;  2Q74 A;  4GWS A;  1K9Y A;  1FPK A;  2PCR A;  2CZK A;  1RDX A;  4MJO A;  1NI9 A;  1Q9D A;  1DCU A;  2QVU A;  2WEF A;  4N81 A;  1INP A;  1FBD A;  1NV6 A;  2HHM A;  3BIH A;  5EQA A;  5ET5 A;  2P3V A;  1FPB A;  5ESY A;  5ET6 A;  3IFC A;  1FRP A;  3RYD A;  3LV0 A;  1FBE A;  3RPL B;  1G0I A;  1NV4 A;  1RDY A;  5LDZ A;  4HE1 A;  2F3D A;  1FJ9 A;  1BK4 A;  2FIE A;  5IZ3 B;  1NV0 A;  1IMF A;  1FBG A;  1NV1 A;  2FBP A;  4GBV A;  1FJ6 A;  1IMC A;  1EYJ A;  4GWU A;  4I40 A;  1IME A;  1LBY A;  2BJI A;  3QMF A;  4PTK A;  5F24 A;  2Q8M A;  1IMA A;  5T3J A;  1FPF A;  4KXP A;  3LUZ A;  5A5L A;  5FBP A;  2QFL A;  5I3S A;  1IMB A;  1LBX A;  1LBV A;  3A29 A;  3RPL A;  1LBZ A;  1D9Q A;  5EQ9 A;  3T0J A;  4GX3 A;  5IZ3 A;  4IR8 A;  5ET7 A;  5EYH A;  4I3Y A;  5ET8 A;  1FPD A;  4GWZ A;  1YXI A;  2FHY A;  5IZ1 A;  2WBB A;  4AS5 A;  2P3N A;  1LEV A;  4GX6 A;  4I3E A;  5J16 A;  3IFA A;  2QVR A;  1NV7 A;  2R8T A;  1DK4 A;  3KC0 A;  3KBZ A;  4HXV A;  1FPJ A;  1XI6 A;  1KA1 A;  4G61 A;  4HE0 A;  4QXD A;  1NV2 A;  4H46 A;  2OX3 A;  3FBP A;  1KA0 A;  5DW8 A;  1NUW A;  4GWX A;  5EQ8 A;  4H45 A;  1FBH A;  2CZH A;  1NUY A;  1FBF A;  4O7I A;  1FPL A;  1EYI A;  1FBC A;  1VDW A;  4GX4 A;  3BIG A;  1K9Z A;  1FTA A;  1LBW A;  1RDZ A;  2FVZ A;  1NV5 A;  1CNQ A;  4GWY A;  3ROJ A;  1FPG A;  1IMD A;  1FSA A;  1YZ0 A;  2JJK A;  4FBP A;  4GBW A;  2VT5 A;  1EYK A;  1SPI A;  1YYZ A;  2FIX A;  5EQ7 A;  1JP4 A;  4AS4 A;  1AWB A;  4HE2 A;  2CZI A;  1NUZ A;  3KC1 A;  3B8B A;  2F3B A;  1NV3 A;  1DBZ A; 
#chains in the Genus database with same CATH topology
 2XXK A;  4I9D A;  1I6B A;  5I56 B;  2VPO A;  2Q2A A;  3PUZ E;  1N04 A;  1S9T A;  4EXK A;  1IIT A;  4GOT A;  2DVC A;  2XHD A;  3VLU A;  3PV0 E;  4KFQ A;  3BIH A;  5ESY A;  1FPB A;  4WEP A;  4FE8 A;  3S9M C;  3O97 A;  3VLV A;  1FBE A;  2F7A A;  4R75 A;  1GGG A;  5L9M A;  3LBS A;  4OHN A;  2XXX A;  1B7H A;  3CSB A;  4NG7 A;  5AA4 B;  1R9L A;  3MWB A;  4KYE A;  2V4C A;  3K4U A;  3FZV A;  2ALU A;  3L6H A;  4KXP A;  1ZJL A;  4LUB A;  4GL0 A;  1US4 A;  3O66 A;  2OLB A;  3MVX A;  5IZ3 A;  1T0K A;  1TFA A;  2DVZ A;  3VXB A;  3ECR A;  2DWH A;  2XX7 A;  4XTC Q;  4ELP A;  4I3E A;  4NED A;  2R8T A;  1A55 A;  3H06 B;  4H46 A;  4QSD A;  4H67 A;  3O9P A;  1AH5 A;  3PUX E;  2XWV A;  1MXV A;  3K1M A;  3H4Z A;  1Z7N E;  1MQD A;  2DP8 A;  4ELR A;  4WXJ A;  1B9J A;  1K9Z A;  4O3B A;  4OEN A;  2ZZV A;  4FIM A;  1IUD A;  4NX1 A;  2CZI A;  3KC1 A;  2UVH A;  1ZU0 A;  2I0B A;  3D1R A;  4X04 A;  1ZLQ A;  1QUK A;  4IO7 A;  1UTH B;  5BWJ A;  1OLA A;  4GRK A;  4LZ5 A;  4NN3 A;  2PCR A;  4NWC A;  3VVE A;  4ZED A;  2YJP A;  3T93 B;  1M5D A;  2P3V A;  4F3G A;  3FJG A;  4OEV A;  3VFJ A;  3PMX A;  5BUU A;  3HPI A;  5LDZ A;  4EQ9 A;  1NV0 A;  4OER A;  5DVI A;  4HS7 A;  2OPD A;  2XWK A;  3TEP A;  5TPA A;  3MP1 A;  3LUY A;  4QSC A;  2GHA A;  4RJZ A;  1IMA A;  3FXU A;  3LUZ A;  2Y7W A;  3QAX A;  5I3S A;  2O6A A;  4G68 B;  4RNS A;  1B58 A;  2XXV A;  1SBP A;  4H1X A;  2REJ A;  5ICQ A;  1BP5 A;  2PFZ A;  3TZA A;  2Z8D A;  1B7U A;  1B52 A;  4Z0I A;  5TP9 A;  3C36 A;  5H8Q B;  5I2K B;  4UA8 A;  4U4X A;  2NVU B;  3SEW A;  1DTG A;  2Q88 A;  4KCC A;  4N91 A;  3EHU A;  1MRP A;  4JWY A;  4H8I A;  1UIV A;  3F11 A;  4U1O A;  3T9H B;  3KN7 A;  1VDW A;  4ESX A;  1ZKB A;  4HCW A;  3S9E A;  2DWI A;  1B32 A;  1USY E;  2D3I A;  1RYO A;  2Z22 A;  1B0L A;  3KEI A;  3TCH A;  4NTL A;  1B0H A;  4F3B A;  4ELO A;  1UTB B;  4NF8 B;  1MY3 A;  3OEN A;  3UGW A;  4BDL A;  2DE2 A;  1LFI A;  1TT1 A;  3ZS6 A;  3H3G A;  2R9J A;  5I5P A;  1FPK A;  4OVJ A;  2O84 X;  3IB0 A;  1NI9 A;  1FBD A;  1DPE A;  4ZZA A;  2FYI A;  5EQA A;  3KOS A;  5ET6 A;  5IZZ A;  2WYP A;  3IB1 A;  1JQF A;  4U23 A;  2WKY A;  3MZ9 A;  4JWO A;  4ZZE A;  1DSN A;  2XA5 A;  3PMW A;  2OPE A;  2RC9 A;  3IK6 B;  4FEC A;  1TXF A;  5ISU A;  3SEV A;  4GWO A;  2P0S A;  2KR0 A;  1MH3 A;  3TTN A;  2HQ0 A;  1IQ7 A;  4JBZ A;  1LBV A;  4PFB A;  1EH3 A;  1OIB A;  4IO6 A;  4QFK A;  4GQO A;  4R9F A;  1N7W A;  4KHZ E;  2ZNU A;  1Q1K A;  5I58 B;  3MPL A;  2P1S A;  2RIN A;  3EHT A;  4ZEC A;  1D9Y A;  3PUW E;  1QUJ A;  2CEY A;  2LAO A;  1Y4T A;  1MM6 A;  4R6Y A;  3QXM A;  3PPR A;  4U1Z A;  1MXZ A;  5DVF A;  3VXC A;  4O7I A;  3U94 A;  2A5T B;  4THI A;  2V3U A;  2Z8F A;  3FAT A;  2F6G A;  3RGY A;  1FCK A;  4TLL B;  2ONK E;  2F78 A;  3SER A;  5A5X B;  2OBG A;  3S9L C;  1MDP 1;  4F29 A;  3H6W A;  3IOU A;  1EZP A;  4OES A;  4EF1 A;  4PFR A;  4MFI A;  5ICT A;  2Q74 A;  3O6I A;  1N3X A;  1EZ9 A;  1RDX A;  3KGC A;  3SET A;  2DXR A;  5EHM A;  3OOA A;  1ZMG A;  5ET5 A;  5H8H A;  1M5B A;  3QUJ A;  2OWT A;  3W9V A;  3RPL B;  1N76 A;  3IAZ A;  4NF5 A;  3IOV A;  2DYX A;  2ZYM A;  3WAE A;  5JK4 A;  3B6W A;  2ZZW A;  3OEM A;  3T1B A;  1VFE A;  1MS7 A;  1FPF A;  3E3K A;  3CFX A;  3TDJ A;  4PDD A;  5KDT A;  2F5X A;  3G7W A;  2YLN A;  3KOT A;  3RUM A;  1HSL A;  2H4I A;  3H03 A;  1AIV A;  5L9S A;  2PMS A;  4P3L A;  1F9B A;  3CHG A;  4QFO A;  4QXD A;  3FJ7 A;  3DP4 A;  4QRZ A;  3DLN A;  3FBP A;  3TCG A;  4E0W A;  1FBF A;  1NKX A;  1YAE A;  4R6K A;  1QVS A;  4Q0C A;  3N6U A;  4C1U A;  5AA2 D;  4XKR A;  4PF8 A;  3FUZ A;  5LOM A;  3I6V A;  5CBS A;  4IO5 A;  3ILT B;  2VT5 A;  4IB2 A;  1A54 A;  3MZB A;  4N6P A;  2RKM A;  4H8J A;  1MH4 A;  2QS4 A;  1EU8 A;  4MHF A;  4ZEK A;  1I69 A;  3U8Q A;  3CFZ A;  1M5E A;  3FV2 A;  4EXL A;  1B3E A;  4KD5 A;  2QVV A;  2XXH A;  1LBB A;  2E0S A;  2AYS A;  4NGU A;  4ESW A;  3GBB A;  4EF2 A;  1GTK A;  4KR5 A;  4IGR A;  4GFR A;  3K6W A;  1M5C A;  3Q25 A;  3MST A;  1NV6 A;  2ANJ A;  1MY1 A;  2I48 A;  3RT8 A;  1B2H A;  1FRP A;  3M3F A;  3FD3 A;  1B3G A;  2QRY A;  4DDD A;  1NV4 A;  1RDY A;  3OO7 A;  4OVP A;  1BK4 A;  5IZ3 B;  4P1E A;  2WX9 A;  4X9T A;  5H8S A;  3MYU A;  1IMC A;  1QJM A;  4Q8R A;  5CMB A;  4Q30 B;  1SVX B;  2I3V A;  1JW1 A;  3GLB A;  1LBX A;  2PT2 A;  2VOZ A;  3V5A A;  1QW0 A;  2GRV A;  1SYH A;  3T9V A;  4IR8 A;  1XT8 A;  3E78 A;  4H0W A;  4OFL A;  4X1B A;  4G61 A;  2AL5 A;  1NV2 A;  2XXT A;  4PC9 A;  3C9H A;  2F35 A;  2R6G E;  5FHM A;  5H8F A;  3DP6 A;  4LA9 A;  3H6U A;  1SI1 A;  1P99 A;  2Q2C A;  3HFU A;  3BIG A;  4HW8 A;  3BFT A;  1FTA A;  1LBW A;  3FVG A;  1LLS A;  3H6T A;  5FTI A;  1FSA A;  3H7M A;  4N8G A;  1ZTY A;  1JNF A;  1NFT A;  4JSD A;  2E1S A;  3RLF E;  5HBC A;  4GF8 A;  3LSF B;  4OWD A;  1MY2 A;  1UIU A;  3UN6 A;  4YMA A;  1G0H A;  3FJM A;  4PET A;  3EHS A;  4DZ1 A;  1NUX A;  3U1O A;  2I6E A;  2Y5K A;  2OWZ A;  2F97 A;  2Z23 A;  5ITO A;  3C35 A;  4KYS A;  4FJP A;  3W9W A;  4NF4 A;  2QL3 A;  4UAB A;  2CEX A;  5KZT A;  5TPA B;  2I0C A;  3M8U A;  1WVJ A;  4RA1 A;  4MLQ A;  2DXY A;  1NH8 A;  4ELQ A;  1VFD A;  4GWU A;  2HFB A;  2QS3 A;  4RY1 A;  5TP9 B;  4N6D A;  2O68 A;  4YMB A;  1SQY A;  1OVT A;  1EZO A;  1H76 A;  3TMG A;  5M2V A;  4U22 A;  2B4M A;  3CIJ A;  4F1V A;  3OO6 A;  1P1W A;  2DE3 A;  2PVU A;  4JWX A;  1ZIU A;  1VE4 A;  2V3Q A;  2PT1 A;  5EQ8 A;  1P1O A;  4R9G A;  3T9X B;  1EYI A;  3K0V A;  3TYH A;  1FBC A;  4GX4 A;  5K2Y A;  1CNQ A;  2FNC A;  1PBP A;  3T9U A;  1YZ0 A;  1TFD A;  3E13 X;  3KN8 A;  3S2V A;  4MAG A;  4GVO A;  3UIF A;  2ZYK A;  4MNC A;  1USY H;  3MPK A;  4RPN A;  2HAV A;  1IZ1 A;  5CBR A;  4QBA A;  4PP0 A;  1ANF A;  3UA8 A;  4H5F A;  4P0G A;  1PBQ A;  1DCU A;  3GZG A;  3IJX B;  1QKB A;  3CR9 A;  3KBR A;  2VHA A;  1OQG A;  1LCT A;  3O6G A;  5IGA A;  2RCA A;  3QIM A;  2F3D A;  3V83 A;  1XS5 A;  4G8N A;  4GBV A;  4O94 A;  1ELJ A;  5F24 A;  2Q8M A;  1H44 A;  1SYI A;  5KCJ A;  3A29 A;  3DP8 A;  1MXX A;  4LZ7 A;  4YAH X;  5EQ9 A;  5DT6 A;  3Q26 A;  2X7P A;  4QSE A;  3TUS A;  3HCQ A;  4OVR A;  1FTM A;  3PU5 A;  4GIZ A;  4Z7E A;  1OLC A;  2O69 A;  2F8D A;  4TOZ A;  3WAF A;  1LAG E;  3UP9 A;  2B3F A;  3PPN A;  3BKI B;  5EYF A;  2XXU A;  1S50 A;  4LAT A;  3IO6 A;  4YKJ A;  1FBH A;  4RK9 A;  4G2Z A;  3IB2 A;  4U4S A;  5B70 A;  3SEY A;  1P1Q A;  1P1U A;  1PB9 A;  2NOO A;  2XD3 A;  3K6X A;  3E79 A;  3O28 A;  3PUV E;  2GH9 A;  2UVG A;  3RT6 B;  1YYZ A;  5EQ7 A;  4AS4 A;  1R6Z A;  4ZE9 A;  3A3C A;  4OFO A;  1Y20 A;  1KWH A;  2B3B A;  5H8H B;  3G3K A;  1B5J A;  3VVD A;  5EYG A;  3TTR A;  1NH7 A;  1MXY A;  1PB8 A;  4IO3 A;  4NF5 B;  1POT A;  1DMB A;  2XXY A;  4MIJ A;  4O3A A;  3AXF A;  1B4H A;  2RC8 A;  4M4G A;  3DM0 A;  3ZKL A;  3THI A;  2AL4 A;  3MJN A;  4X1D A;  4DI3 D;  2UYF A;  5KDT B;  4LQ5 A;  1B6H A;  4DCY A;  3P7I A;  2X26 A;  1RYX A;  4MNI A;  3T96 B;  5IKB A;  4LZ8 A;  3FV1 A;  1LFG A;  4YKP A;  1IMB A;  1R1N A;  1LBZ A;  3B6T A;  1SW4 A;  3JZJ A;  4PAI A;  4KI0 E;  3UK4 A;  3W15 C;  1Y1M A;  5TU0 A;  4PE5 B;  5I59 A;  1ATG A;  2O7U A;  2WBB A;  4HTG A;  2YPN A;  3IFA A;  4JDF A;  3KJT A;  5AA2 A;  4HXV A;  1H43 A;  3RN8 A;  2UYE A;  3HO7 A;  5I84 A;  2QMX A;  4N8Y A;  3EKI A;  2O1M A;  3OMB A;  3O6H A;  4GBW A;  3GBA A;  3PGF A;  4G8M A;  1B5I A;  4FOR A;  3SDF A;  5I2N A;  1DBZ A;  2WBD A;  3G3G A;  4DCX A;  3O2A A;  1A7L A;  3PMV A;  1JEV A;  4NMY A;  4TQU Q;  1CE2 A;  1LAX A;  2CZK A;  4MJO A;  2WEF A;  4ZEB A;  4DXB A;  3U92 A;  2Q9T A;  2DOJ A;  4NF6 A;  4XFE A;  1A99 A;  1IXC A;  1XVX A;  4YIC A;  1NNF A;  1Y3N A;  4XEQ A;  3RYD A;  2ABH A;  4N07 A;  2R71 A;  1FJ9 A;  3Q29 A;  3PPQ A;  1L5T A;  1LFH A;  1EYJ A;  3UOR A;  2XX9 A;  4DLD A;  4OEU A;  4G8H A;  2QS1 A;  3C33 A;  4AB5 A;  3T0J A;  4F1Y A;  1FQF A;  1JVX A;  2GFE A;  5H8F B;  3R7X A;  2F6P A;  1Z7M E;  4AS5 A;  1YCJ A;  2GHB A;  3PPP A;  4KCD A;  4F22 A;  2FA7 A;  3Q27 A;  1MY0 A;  4PFU A;  2F36 A;  2F34 A;  1O63 A;  2OZZ A;  4IY5 A;  1B51 A;  1Y3P A;  3TQW A;  1URG A;  4NHB A;  4F18 A;  2KLF A;  1GVC A;  4AB6 A;  3HST A;  3MP8 A;  3TTK A;  5JTY A;  4BDN A;  4RK2 A;  2WYK A;  3ZSF A;  1IXH A;  3PD8 A;  4TLM B;  1EYK A;  4NF4 B;  3OO9 A;  4OAN A;  1JP4 A;  4HE2 A;  4N4U A;  3B8B A;  3ODB A;  1RKM A;  3SES A;  2RF1 A;  3CRB A;  3N26 A;  2D21 A;  4PBH A;  1HSE A;  1FBP A;  4DIG A;  1CB6 A;  3TEL A;  1US5 A;  3B7D A;  1DOT A;  3MW0 A;  4FEB A;  5CM6 A;  2HXR A;  2I58 A;  4P47 A;  3OXN A;  3MZ1 A;  2XD2 A;  1FQE A;  3U93 A;  1G0I A;  1SW1 A;  3HN0 A;  4KQP A;  4BDO A;  4BLA A;  2ZXT A;  1POY 1;  1IMF A;  5LTC A;  4U21 A;  2I3W A;  5EHS A;  4G68 C;  3VV5 A;  4QHQ A;  4P56 A;  3S9N C;  5FBP A;  1IXI A;  1OVB A;  3RNN A;  3V89 B;  5IM2 A;  2ONR A;  5EYH A;  2PBW A;  1B3H A;  1I6Q A;  1YXI A;  2PFY A;  1MPB A;  2P2A A;  2DWJ A;  4KPT A;  1XHY A;  4ZEF A;  4ZEI A;  1XI6 A;  2VP1 A;  5AA1 A;  1P1N A;  3K2D A;  2F7B A;  4BDQ A;  2OX3 A;  4X8R A;  3G3F A;  4K3F A;  2CZH A;  1FTL A;  1GV8 A;  2H98 A;  4MCO A;  4O8M A;  1B3F A;  2VD2 A;  2ONS A;  3NOH A;  1VR5 A;  5H8N A;  3K01 A;  3JV9 A;  1YTV A;  1AWB A;  3OSR A;  2D5W A;  1N3W A;  2V84 A;  1FPI A;  2OCU A;  3TCF A;  1JET A;  3KZG A;  4KYD A;  4OVT A;  2DDK A;  2GQ1 A;  2OK2 A;  2HXW A;  2XXW A;  4XKQ A;  4E0X A;  1K9Y A;  4GXS B;  3IR1 A;  3LSL A;  4OVQ A;  4L17 A;  1MPD A;  2QVU A;  5HPQ A;  2XWI A;  2A5S A;  3GYY A;  4PF6 A;  2UVI A;  4UAC A;  5CC2 A;  5KCJ B;  1LST A;  1GR2 A;  3RQT A;  1SDX A;  3CG3 A;  4YU0 A;  5J1D A;  5DYH A;  2M8C A;  3Q28 A;  5A5L A;  4O3C A;  3TQL A;  3IJO B;  3FVK A;  3I3V A;  5K2X A;  4GX3 A;  2O51 A;  1WDN A;  1MG1 A;  4R73 A;  3JYR A;  1NNP A;  5CMM A;  4X48 A;  1NV7 A;  3V8X B;  3KC0 A;  4P0I A;  4MX6 A;  2DQV A;  1NNK A;  5HM4 B;  5DEX A;  4H5G A;  5FHO A;  3TTL A;  4GLI A;  1FPL A;  3R6U A;  1O64 A;  5AA3 A;  1FTJ A;  2CZL A;  1BKA A;  3VVF A;  1FTO A;  4MH5 A;  1PB7 A;  3MC2 A;  1FPG A;  1XOC A;  2W7Y A;  2JJK A;  4MLV A;  4DE8 A;  3PTY A;  3IOR A;  4G4P A;  4NE4 A;  3TFL A;  4PAK A;  1SD3 A;  1NUZ A;  3G3J A;  3IOT A;  2F3B A;  1BIY A;  2ZYN A;  1AL3 A;  4FAT A;  4GL8 A;  2ZYO A;  1JW5 A;  3CFL A;  5I57 A;  3C32 A;  3QSL A;  3N6T A;  3S4U A;  3MVY A;  2QS2 A;  3KFM A;  2Y7P A;  4N81 A;  2HCA A;  2HHM A;  3OSQ A;  2ZNS A;  5CMC A;  3TKD A;  3N94 A;  3RTF B;  2DE4 A;  5F1Q A;  3MVW A;  1SI0 A;  5I59 B;  1FJ6 A;  2XXP A;  4MF3 A;  4R72 A;  1LBY A;  4PTK A;  5AA2 B;  3MVZ A;  2H5Y A;  5I7I A;  4LN5 A;  3O29 A;  3EQ1 A;  1NL5 A;  5ELV A;  1D9Q A;  1A8F A;  1OMP A;  2Y84 A;  3QK6 A;  3MQ9 A;  3PUY E;  4I3Y A;  1IXG A;  4MEV A;  2PX1 A;  2THI A;  2FHY A;  5J16 A;  1LEV A;  4MBP A;  3TPA A;  1XVY A;  3KBZ A;  4LVQ A;  2ZZX A;  4YKK A;  1KA1 A;  2Q8J A;  4BDM A;  4WED A;  5DW8 A;  1NUW A;  1Y9U A;  4R2F A;  5I2N B;  2XX8 A;  1QUI A;  1RDZ A;  1NV5 A;  2HEU A;  3K1N A;  2Q89 A;  2ZNT A;  1IEJ A;  3MP6 A;  1MM7 A;  2FIX A;  4XXU A;  4F1U A;  4M1V A;  3PPO A;  1NV3 A;  2X7Q A;  2H9B A;  4NF6 B;  4GWW A;  4AQ4 A;  1KZ8 A;  4O7M A;  4F3S A;  1D3K A;  1SW2 A;  1QGX A;  4I1D A;  4JVD A;  3TAJ A;  4PFY A;  4H65 A;  4IY6 A;  3G3I A;  1Q9D A;  2Y7R A;  1BTJ A;  1URS A;  3CSG A;  2Y7K A;  4YB7 A;  3IFC A;  4PQJ A;  5I56 A;  3SEX A;  2BJJ X;  3C34 A;  3TTM A;  3EN3 A;  4HE1 A;  4RPO A;  2DSF A;  4QFL A;  1FBG A;  4I40 A;  2NXO A;  1IME A;  4I8C A;  2BJI A;  3FAS A;  1M5F A;  5AE4 A;  3PD9 A;  3TOD A;  4EUO A;  4R2B A;  2QFL A;  3KN3 A;  2NWJ A;  4PGN A;  1VSO A;  3K1P A;  1O7T A;  4PFT A;  4ECF A;  2I49 A;  1FPD A;  5IZ1 A;  1B40 A;  1H3D A;  5AA4 A;  4GX6 A;  5JTY B;  3IX1 A;  1DK4 A;  4WKM A;  1LCF A;  5L8D A;  2IEE A;  4MMP A;  3M3K A;  1XC1 A;  2KQZ A;  2MKZ A;  1FTK A;  2V25 A;  3VE1 B;  2HAU A;  4GWX A;  3IL1 B;  2F7C A;  3OO8 A;  1MPC A;  4GWY A;  3ROJ A;  1MQI A;  2I4C A;  4NAP A;  3ILU B;  1LBC A;  2AIX A;  4LQ2 A;  1SPI A;  2H99 A;  3G3H A;  5IAI A;  1QKA A;  2UVJ A;  3H6V A;  4ZE8 A;  1N0T A;  3T66 A;  4OET A;  1FPE A;  3HHG A;  4ISU A;  4IO4 A;  1PEB A;  4EDP A;  4GD5 A;  3D4C A;  3D4G A;  2VGQ A;  2O1L A;  2NUV A;  4XIG Q;  4XKP A;  2Y7I A;  3KG2 A;  1B1H A;  1INP A;  4RXL A;  3OEL A;  4F2Q A;  4QFN A;  2L5V A;  1UTH A;  1MXU A;  5CMK A;  4POX A;  3M3L A;  4PCD A;  1NV1 A;  2FBP A;  2QJE A;  4JVC A;  4YKI A;  4EQB A;  3QMF A;  4EQ7 A;  1A40 A;  4YB5 A;  1DPP A;  4YZZ A;  4F19 A;  1N84 A;  4POW A;  2DWA A;  3MUQ A;  4IGT A;  3L6G A;  4OVS A;  3ZKK A;  3SKP A;  4LON B;  4BDR A;  4GWZ A;  1AOV A;  3N5L A;  3I5O A;  2P3N A;  3KSX A;  1JW4 A;  1JVY A;  1FW0 A;  1FPJ A;  1FQB A;  5H8N B;  3LC8 A;  3FXB A;  2XXR A;  4G68 A;  4MNP A;  2OWS A;  4H45 A;  1R9Q A;  1LAF E;  4R6H A;  2QMW A;  1B05 A;  2H25 A;  3BBR A;  5H8Q A;  5I2K A;  2FVZ A;  5CRY A;  3SZP A;  3ISP A;  3LSX A;  4GXA A;  1NNT A;  3QUF A;  3RPW A;  5B7D A;  4DXU A;  1LB8 A;  1TWY A;  2G93 A;  2G29 A;  3DEL B;  5F7V A;  4N13 A;  4NF0 A;  3A09 A;  4GWS A;  1Y4C A;  2CMO A;  4JSO A;  4YB6 A;  5DVJ A;  4P9K A;  4PGP A;  2ESN A;  3FVO A;  3K6V A;  4QF9 A;  2REG A;  4JXI A;  3CI8 A;  4H6D A;  1UTB A;  3C4M A;  4NF8 A;  3OEK A;  3FXR A;  3VDF A;  4G77 A;  2HPG A;  2Z8E A;  3LV0 A;  1AMF A;  3KJ7 A;  4I62 A;  4XKN A;  1MQG A;  3USD A;  2XXQ A;  4FAJ A;  2XXI A;  4R74 A;  1WOD A;  4PFI A;  4F31 B;  1LB9 A;  4OTE A;  1II5 A;  2RC7 A;  3MBP A;  3CVG A;  5T3J A;  1Q35 A;  1H45 A;  4F2O A;  3FVN A;  4OYV A;  5FHN A;  3T22 A;  5DEX B;  4ZDM A;  2DS9 A;  5ET8 A;  4NWD A;  1IIW A;  2B4L A;  2VPN A;  1OQH A;  1MY4 A;  4ND9 A;  2QVR A;  1MQJ A;  4OZ9 A;  1URD A;  3LSW A;  1PC3 A;  1KA0 A;  1B5H A;  4N15 A;  4QFP A;  1NUY A;  3FIR A;  1D9V A;  3A3U A;  3K02 A;  2PYY A;  3IO4 A;  3MAM A;  5I58 A;  3BFU A;  1B4Z A;  3E9X A;  1B7Z A;  2ZMB A;  5I57 B;  3EF7 A;  1BLF A;  3B6Q A;  4DXC A;  1D4N A;  2OJT A;  1MDQ A;  2A5T A;  2V93 A;  3RTW B;  3U72 A;  4C0R A;  1PDA A;  1MXW A;  2Y5L A;  2IA4 A;  1FQD A;  2B65 A;  3R26 A;  2QPQ A;  1QUL A;  4OXV A;  1JEU A;  4P1L A;  4Q5T A;  5JEI A;  1FQC A;  3U65 A;  5A5X A;  3VLW A;  3LR1 A;  4JB7 A;  3HHF A;  4OQO A;  3HV1 A;  3E4R A;  3FGS A;  3SEU A;  1UQW A;  1SW5 A;  3FXQ A;  4ZS9 A;  1A8E A;  4FED A;  4P8B A;  3OD7 A;  2FIE A;  1B3L A;  1FQA A;  1LGB C;  1J1N A;  4JVI A;  4PBQ A;  1YPN A;  3K00 A;  2VD3 A;  4PDH A;  2V3T A;  1Y1Z A;  5CI5 A;  4U2R A;  2RCB A;  4PFW A;  4OFJ A;  5FTH A;  1B46 A;  2HZL A;  4P11 A;  3RPL A;  1HSJ A;  5DTB A;  3EPE A;  1Y3Q A;  4HCY A;  5ET7 A;  4DI4 B;  1I6A A;  1NMU A;  3KSJ A;  2O7I A;  2XWO A;  5L9O A;  1S7Y A;  4N17 A;  1B1X A;  3QYT A;  1DTZ A;  3C31 A;  2I4B A;  3GXA A;  4RYA A;  1N7X A;  4OMB A;  4HE0 A;  4F3P A;  3IOW A;  3RY3 A;  4LP2 B;  4PAF A;  4XF5 A;  2HZK A;  3B50 A;  2QSX A;  1ZBM A;  3ONM A;  4ONY A;  5ITP A;  1IMD A;  3CG1 A;  4FBP A;  4C1T A;  4NQ8 A;  2UXA A;  4N6K A;  4OA4 A;  4IO2 A;  4PE3 A;  4F39 A;  1LAH E;  3K6U A;  1MQH A; 
#chains in the Genus database with same CATH homology
 4GWW A;  2XXK A;  1KZ8 A;  2WBD A;  4O7M A;  2QVV A;  1QGX A;  4NGU A;  2VPO A;  4JVD A;  2CZK A;  4MJO A;  1Q9D A;  2WEF A;  3MST A;  1NV6 A;  2Q9T A;  3BIH A;  4XFE A;  5ESY A;  1FPB A;  4YIC A;  3IFC A;  4XEQ A;  1FRP A;  3RYD A;  1FBE A;  1NV4 A;  1RDY A;  4HE1 A;  4OVP A;  1FJ9 A;  1BK4 A;  5IZ3 B;  4P1E A;  2WX9 A;  1FBG A;  4X9T A;  3MYU A;  1IMC A;  1EYJ A;  4I40 A;  4NG7 A;  1IME A;  2BJI A;  2V4C A;  4KXP A;  2QFL A;  1LBX A;  4PGN A;  3T0J A;  5IZ3 A;  2DVZ A;  4IR8 A;  1FPD A;  3E78 A;  5IZ1 A;  4AS5 A;  4I3E A;  4GX6 A;  2R8T A;  1DK4 A;  4G61 A;  1NV2 A;  4H46 A;  4MMP A;  2MKZ A;  2KQZ A;  4PC9 A;  2XWV A;  4GWX A;  4NHB A;  4F18 A;  3HFU A;  3BIG A;  1K9Z A;  1FTA A;  1LBW A;  4GWY A;  3ROJ A;  4NAP A;  2ZZV A;  2WYK A;  1FSA A;  4N8G A;  1EYK A;  1SPI A;  4OAN A;  1JP4 A;  4NX1 A;  4HE2 A;  4N4U A;  2CZI A;  3KC1 A;  3B8B A;  1G0H A;  1FPE A;  4PET A;  4PBH A;  1NUX A;  3D1R A;  1FBP A;  4X04 A;  2Y5K A;  2OWZ A;  4NN3 A;  2PCR A;  3W9W A;  5CM6 A;  4UAB A;  2CEX A;  2HXR A;  1INP A;  4P47 A;  2P3V A;  2L5V A;  1G0I A;  5LDZ A;  4PCD A;  1NV0 A;  1IMF A;  1NV1 A;  5LTC A;  2FBP A;  2XWK A;  4JVC A;  4GWU A;  3QMF A;  4N6D A;  1IMA A;  4P56 A;  3LUZ A;  5FBP A;  5I3S A;  4YZZ A;  4F19 A;  5IM2 A;  5EYH A;  4OVS A;  2PFZ A;  2B4M A;  4GWZ A;  1YXI A;  4F1V A;  2PFY A;  2P3N A;  2DE3 A;  1FPJ A;  1XI6 A;  4N91 A;  3FXB A;  2V3Q A;  2OX3 A;  4X8R A;  5EQ8 A;  4MNP A;  4H45 A;  2CZH A;  1EYI A;  4MCO A;  1FBC A;  1VDW A;  4GX4 A;  4O8M A;  2FVZ A;  1CNQ A;  3NOH A;  4HCW A;  3SZP A;  1YZ0 A;  3ISP A;  4MAG A;  1AWB A;  4MNC A;  1FPI A;  2DE2 A;  2DDK A;  2GQ1 A;  4OVT A;  4NF0 A;  4QBA A;  4GWS A;  1K9Y A;  5I5P A;  1FPK A;  4P9K A;  4PGP A;  4OVQ A;  1NI9 A;  1DCU A;  2QVU A;  1FBD A;  2XWI A;  5EQA A;  5ET6 A;  3GYY A;  4PF6 A;  5IZZ A;  2HPG A;  2WYP A;  3LV0 A;  5IGA A;  2F3D A;  2XA5 A;  5J1D A;  4GBV A;  4PFI A;  4O94 A;  5F24 A;  2Q8M A;  5T3J A;  2KR0 A;  5A5L A;  1LBV A;  3A29 A;  5EQ9 A;  4PFB A;  4GX3 A;  4OVR A;  5ET8 A;  2B4L A;  2VPN A;  2QVR A;  1NV7 A;  3KC0 A;  2CEY A;  4MX6 A;  1KA0 A;  1FBH A;  4N15 A;  1NUY A;  4O7I A;  1FPL A;  3E79 A;  1FPG A;  2JJK A;  3PTY A;  1YYZ A;  5EQ7 A;  4AS4 A;  4PAK A;  1NUZ A;  2F3B A;  5EYG A;  2Y5L A;  4PFR A;  2Q74 A;  2QPQ A;  4MIJ A;  1RDX A;  4P1L A;  4N81 A;  3U65 A;  2HHM A;  5ET5 A;  4DI3 D;  3W9V A;  3RPL B;  2DE4 A;  4P8B A;  2FIE A;  5JK4 A;  2ZZW A;  4JVI A;  4MNI A;  4PBQ A;  1FJ6 A;  3T1B A;  4PDH A;  1LBY A;  4PTK A;  1FPF A;  5I7I A;  4LN5 A;  2HZL A;  4PDD A;  1IMB A;  3RPL A;  1LBZ A;  1D9Q A;  2F5X A;  4PAI A;  4HCY A;  5ET7 A;  4DI4 B;  4I3Y A;  4MEV A;  2FHY A;  2XWO A;  2WBB A;  5J16 A;  1LEV A;  4N17 A;  4P3L A;  3IFA A;  3CHG A;  3KBZ A;  4HXV A;  2ZZX A;  1KA1 A;  4HE0 A;  4QXD A;  3FBP A;  5DW8 A;  1NUW A;  4N8Y A;  4PAF A;  1FBF A;  4XF5 A;  3EKI A;  1RDZ A;  2HZK A;  3B50 A;  1NV5 A;  1IMD A;  4PF8 A;  4FBP A;  4GBW A;  2VT5 A;  4NQ8 A;  4N6K A;  2FIX A;  4OA4 A;  4PE3 A;  4F1U A;  4MHF A;  4M1V A;  1NV3 A;  1DBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...