3KCEA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
146
Chain Sequence
b'KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 44
structure length 146
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kceA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kceA02
4QT3A 4DZ2A 2F2DA 1Q6IA 4DRJA 1EQ3A 1I5HW 3L4HA 3UQAA 4BF8A 3M85A 2KXQA 1M5YA 4NNRA 3OOBA 1FKDA 2PPPA 4G50A 1JNTA 4DZ3A 1PBKA 2RUQA 1FAPA 2FAPA 2Q5AA 5DIUA 2UZ5A 4TYOA 2M08A 5CQ2A 2M2AA 3RGCA 2D9FA 2XP7A 4DRQA 4U86A 1C9HA 3CGMA 1WR7A 4J4OA 1J6YA 3IK8A 1O6WA 3FAPA 1Y0OA 3B7XA 1FKKA 3KACA 1L1PA 5HT1A 4JFJA 4E5RA 4ODRA 1KT0A 2VCDA 3JXVA 2KGJA 1BL4A 2RURA 4REXA 3O5PA 3TCZA 4ODOA 2FKEA 2PV3A 1F40A 2DG4A 4O2TA 1JNSA 4DRKA 3H9RB 4R0XA 2ZQVA 4JFMA 2JV4A 1P5QA 3CGNA 4ITZA 2KFWA 2DK1A 5HWCA 1YATA 4LAVA 2YSFA 4JFLA 3KAGA 3O5GA 3O5KA 4W9QA 2ZQTA 4TW8A 2MNTA 2XP9A 1YW5A 2YSIA 1Q6UA 2ZAJA 1U79A 4G2PA 3VAWA 3O5EA 5HWBA 2F21A 4IPXA 1D7IA 5BXJA 2ZR6A 2KI3A 4QIBA 1Q6HA 2DMVA 4W9OA 2N87A 4N19A 2DK7A 3KCEA 2M3OW 2OFNA 4LAYA 1D7JA 1QZ2A 1F8AB 2PBCA 3UQBA 3O5OA 1ROUA 2LPVA 1FKJA 2RUDA 1JVWA 2M8IA 5HW8A 1FD9A 2RSEA 3JYMA 4QT2A 3CNGA 2M1IA 2LKNA 2DJYA 3KAIA 4GIVA 3UI5A 5HW7A 4JFIA 1WMVA 2LGOA 4LAWA 5I98A 2PV1A 4DRIA 5DIVA 3GPKA 2EZ5W 3UF8A 2BA1A 2JX8A 2LAJA 4MSPA 4ODLA 1EG3A 2ZQSA 2XP8A 3O5RA 2PV2A 2MDIA 2JMFA 2PPNA 3KAHA 2RUCA 2KE0A 1TK7A 1D7HA 3KADA 3IHZA 5HTGA 3LE4A 4ODKA 2MF9A 2ZR5A 2MLXA 4ODNA 3JYJA 1FKBA 1ZCNA 2F4EA 2XPAA 3UQIA 1T11A 3WH0A 2K8IA 3I6CA 4DIPA 4ODPA 2DG3A 1FKLA 1FKRA 1FKSA 3UI4A 5J6EA 5D75A 2KR7A 4TW6A 3UI6A 2ITKA 1JMQA 4DRMA 5HUAA 4U85A 1B6CA 4LAXA 2AWGA 4FN2A 5DITA 2XP4A 5HW6A 3KABA 2L2SA 1QPFA 3O5JA 4TNSA 1QPLA 2ZR4A 4TX0A 2M8JA 2KO7A 2VN1A 1NMVA 3O5QA 1K9RA 4J4NA 3RFWA 1K9QA 4DROA 2E45A 3IKGA 3MDYB 3TDBA 2YSHA 2MLZA 4DRHA 5GPGA 4IQCA 3O5MA 1KT1A 1J4RA 4DH0A 3O5FA 1FKFA 2XPBA 5B8IC 1ROTA 3NRKA 2DG9A 1TCOC 1W26A 3O5LA 2LJ4A 1EG4A 3IKDA 1Q1CA 1BKFA 2JZVA 1D6OA 3KZ7A 2PPOA 4DRPA 4TW7A 1A7XA 4IQ2A 4JYSA 3EY6A 1NSGA 1PINA 4DT4A 4C02B 4GGQA 1N1AA 1NMWA 1R9HA 2L4JA 1FKHA 2RQSA 3PRDA 4ODMA 5HKGA 1FKTA 2JXWA 4U84A 2XP5A 2DWVA 3LUOA 4DRNA 3ODKA 4JFKA 2YSBA 1J4IA 2IF4A 3NI6A 3PA7A 3O5DA 1FJDA 1HXVA 3TC5A 1FKIA 2XP3A 3KAFA 2ZQUA 4MGVA 1FKGA 4W9PA 4ODQA 5AHTA 1ZK6A 2MPHA 3PRBA 1J4HA 4FAPA 3O5IA 2YSGA 2MLYA 1EYMA 3M7NA 2XP6A 3NTPA 2RE3A 2Y78A
chains in the Genus database with same CATH superfamily
4QT3A 4DZ2A 2F2DA 3WL1A 1Q6IA 4WKFA 4DRJA 4Z2GA 1EQ3A 1WNOA 1ZBVA 1ITXA 1EHNA 1I5HW 3L4HA 1W9UA 3ARQA 3WD1A 3UQAA 1RD6A 4BF8A 3M85A 2KXQA 1M5YA 4NNRA 3RM8A 3ARUA 1HJWA 1GRJA 3OOBA 1FKDA 1W9VA 2PPPA 4ZPVR 3MCBA 1FFRA 4G50A 1JNTA 3MQHA 4DZ3A 1FLCA 1PBKA 2RUQA 3ARXA 1FAPA 2FAPA 2Q5AA 2ESCA 5DIUA 2UZ5A 3GU0A 4TYOA 5DO2A 2M08A 4Z2LA 5CQ2A 2M2AA 3RGCA 2D9FA 2XP7A 2ETNA 3RM4A 4U86A 4DRQA 2G8ZA 1C9HA 3CGMA 4DWSC 1WR7A 4J4OA 1J6YA 3IK8A 1O6WA 3FAPA 1Y0OA 3B7XA 1E6PA 1FKKA 3KACA 1L1PA 5HT1A 3FY1A 4JFJA 1LL7A 4E5RA 5E66A 1NWTA 1LG2A 4ODRA 1KT0A 2VCDA 3JXVA 2KGJA 1BL4A 2RURA 4REXA 3O5PA 2YAJB 3TCZA 4ODOA 2FKEA 2PV3A 1F40A 4XAKA 2DG4A 4O2TA 1JNSA 4DRKA 3H9RB 4R0XA 2ZQVA 4Z2IA 4JFMA 3CZ8A 2JV4A 1P5QA 3CGNA 1XRVA 5DEZA 2PI6A 4ITZA 2KFWA 2DK1A 1GUVA 5HWCA 2OWOA 3AROA 1YATA 2AOSA 4LAVA 1GOIA 4Z2JA 3WD0A 2YSFA 4JFLA 3KAGA 4HBEA 3O5GA 3O5KA 4W9QA 2ZQTA 4MNMA 4TW8A 1UR9A 2MNTA 2XP9A 1KFWA 1HKKA 1YW5A 2DT2A 5E5WA 1H0GA 2PN0A 2YSIA 1D2KA 2B31A 1Q6UA 2WLZA 2ZAJA 1U79A 1ZBWA 4P8VA 5JH8A 4G2PA 4A0UA 3VAWA 3O5EA 3B8SA 3WQWA 3AS3A 5HWBA 2F21A 2Y8NB 4IPXA 3FS8A 1D7IA 1WAWA 1LQ0A 5BXJA 1LL4A 2ZR6A 2KI3A 4ZPWR 4QIBA 1Q6HA 1W9PA 2DMVA 1IX5A 4W9OA 2N87A 4N19A 4MNLA 2F23A 4IT4A 4MPKA 2DK7A 3WQVA 3KCEA 1NWSA 4Z2KA 2M3OW 2OFNA 4LAYA 1D7JA 1QZ2A 1W1VA 1F8AB 4MTVA 2OLHA 2PBCA 3UQBA 3O5OA 1W1YA 1ROUA 2LPVA 1FKJA 2IUZA 2A3AA 2RUDA 1JVWA 1ZB5A 4KQZA 5E62A 2M8IA 5HW8A 1E44A 4WIWA 1HKIA 1FD9A 3BXWA 4DWSB 5GPRA 2RSEA 3JYMA 2DSUA 4MNKA 3BMBA 3RM9A 4QT2A 3CNGA 2M1IA 3ARRA 3WD2A 3CHFA 2LKNA 2DJYA 3GTYX 3KAIA 4ML4A 4GIVA 3UI5A 4DWSD 3ARWA 5HW7A 1JNEA 4JFIA 1WMVA 2LGOA 4GLXA 4LAWA 3WIJA 5I98A 2PV1A 4L72B 4DRIA 5DIVA 3GPKA 1NWUA 4IT6A 2G41A 3G6MA 2EZ5W 3UF8A 2BA1A 4ZPTR 2JX8A 2LAJA 1ZBKA 3PQHA 4NSBA 3LKXA 4MSPA 3ARZA 4ODLA 1EG3A 2DPEA 3ARVA 2ZQSA 3ARTA 3AS2A 2XP8A 2DT1A 3O5RA 2PV2A 4S3JA 2MDIA 3FSCA 2JMFA 1HKJA 2PPNA 3KAHA 3OA5A 2RUCA 3MQGA 2KE0A 1W1PA 4AY1A 1TK7A 1D7HA 3KADA 1E9LA 3IHZA 3WD3A 5HTGA 1JNDA 3LE4A 4ODKA 4MAVA 4S3KA 1ZBCA 2DT3A 2MF9A 3MCBB 2ZR5A 2MLXA 4ODNA 3JYJA 1FKBA 3RMEA 2DSZA 1ZCNA 4Q22A 2F4EA 2XPAA 3UQIA 1T11A 3EIPA 3WH0A 2K8IA 2QF8A 3I6CA 4DIPA 4ODPA 2DG3A 1FKLA 4URIA 4NZCA 2DSVA 5E64A 1FKRA 1FKSA 3UI4A 5J6EA 1HKMA 5D75A 1X6LA 1NH6A 2QRVA 4Z2HA 2KR7A 4TW6A 3CHDA 3UI6A 2ITKA 4P8XA 4HARA 1JMQA 1NWRA 4DRMA 2DT0A 5HUAA 2B5UB 2P4VA 4U85A 1O6IA 1OGGA 2WLYA 1B6CA 4LAXA 5GQBA 2AWGA 4FN2A 2WAEA 5DITA 2XP4A 5HW6A 3KABA 1OWQA 1QPFA 2L2SA 2YBUA 3PRAA 2EULA 3O5JA 1ZL1A 4TNSA 5E65A 1QPLA 2ZR4A 1FFQA 4TX0A 2M8JA 3ARSA 1SYTA 2KO7A 4P8UA 2VN1A 1LG1A 1NMVA 3O5QA 1K9RA 1K9TA 4WKAA 4J4NA 1EDQA 3RFWA 3G6LA 1TFVA 3CHEA 1K9QA 3PR9A 4DROA 3ALGA 2E45A 3IKGA 3MDYB 3TDBA 2MLZA 2YSHA 2O9OA 1VF8A 4DRHA 5GPGA 4IQCA 3O5MA 1KT1A 2O92A 1J4RA 3ALFA 4DH0A 3O5FA 1HJXA 3FSBA 1FKFA 2XPBA 5B8IC 4WKHA 1W1TA 3QOKA 3CHCA 1E6RA 5DF0A 1ROTA 3NRKA 4UDMA 1JCHB 2DG9A 3W4RA 1TCOC 1W26A 3O5LA 2WK2A 2LJ4A 1LL6A 3WD4A 5U47A 1EG4A 3IKDA 3ARYA 1Q1CA 3CH9A 4L3NA 1BKFA 2JZVA 1D6OA 3KZ7A 4MNJA 1UR8A 2PPOA 1HJVA 4HBOA 4DRPA 3ARPA 1X6NA 4TW7A 1A7XA 4IQ2A 2YBTA 4JYSA 3EY6A 1NSGA 3FXYA 1PINA 4DT4A 4C02B 1OGBA 2DSWA 4GGQA 3B9EA 4QZVB 1N1AA 1NMWA 1R9HA 4P8WA 2L4JA 1FKHA 2RQSA 3PRDA 4ZS6A 4ODMA 1H0IA 2WADA 5HKGA 1FKTA 1RP5A 2JXWA 2A3BA 4U84A 2XP5A 2DWVA 4Q7NA 3AS1A 3LUOA 4PTMA 2FDMA 1E6ZA 4DRNA 1LJYA 3WL0A 4DWSA 3ODKA 1ZU8A 1EIBA 4JFKA 2YSBA 1E6NA 1J4IA 1CTNA 2IF4A 3NI6A 3WKZA 3PA7A 2A3EA 1SR0A 3O5DA 1FJDA 4LGXA 1HXVA 3TC5A 1FKIA 2XP3A 4KR0B 3KAFA 2ZQUA 4MGVA 1FKGA 1E15A 4W9PA 4A0TA 4ODQA 5AHTA 1ZK6A 2MPHA 3PRBA 2WM0A 1J4HA 3B9DA 4WK9A 4WJXA 4FAPA 3AS0A 3O5IA 4R5EA 3LKXB 3B9AA 2YSGA 2MLYA 1TR8A 1EYMA 3M7NA 3AQUA 1XHGA 2A3CA 1GPFA 2XP6A 5HBFA 4W5UA 3NTPA 2RE3A 1WB0A 2Y78A
chains in the Genus database with same CATH topology
4QT3A 4DZ2A 2F2DA 3WL1A 1Q6IA 4WKFA 4DRJA 4Z2GA 1EQ3A 1WNOA 1ZBVA 1ITXA 1EHNA 1I5HW 3L4HA 1W9UA 3ARQA 3WD1A 3UQAA 1RD6A 4BF8A 3M85A 2KXQA 1M5YA 4NNRA 3RM8A 3ARUA 1HJWA 3OOBA 1FKDA 1W9VA 2PPPA 4ZPVR 3MCBA 1FFRA 4G50A 1JNTA 3MQHA 4DZ3A 1FLCA 1PBKA 2RUQA 3ARXA 1FAPA 2FAPA 2Q5AA 2ESCA 5DIUA 2UZ5A 4TYOA 5DO2A 2M08A 4Z2LA 5CQ2A 2M2AA 3RGCA 2D9FA 2XP7A 3RM4A 4DRQA 4U86A 2G8ZA 1C9HA 3CGMA 4DWSC 1WR7A 4J4OA 1J6YA 3IK8A 1O6WA 3FAPA 1Y0OA 3B7XA 1E6PA 1FKKA 3KACA 1L1PA 5HT1A 3FY1A 4JFJA 1LL7A 4E5RA 5E66A 1NWTA 1LG2A 4ODRA 1KT0A 2VCDA 3JXVA 2KGJA 1BL4A 2RURA 4REXA 3O5PA 2YAJB 3TCZA 4ODOA 2FKEA 2PV3A 1F40A 4XAKA 2DG4A 4O2TA 1JNSA 4DRKA 3H9RB 4R0XA 2ZQVA 4Z2IA 4JFMA 3CZ8A 2JV4A 1P5QA 3CGNA 1XRVA 5DEZA 2PI6A 4ITZA 2KFWA 2DK1A 1GUVA 5HWCA 2OWOA 3AROA 1YATA 2AOSA 4LAVA 1GOIA 4Z2JA 3WD0A 2YSFA 4JFLA 3KAGA 4HBEA 3O5GA 3O5KA 4W9QA 2ZQTA 4MNMA 4TW8A 1UR9A 2MNTA 2XP9A 1KFWA 1HKKA 1YW5A 2DT2A 5E5WA 1H0GA 2YSIA 1D2KA 2B31A 1Q6UA 2WLZA 2ZAJA 1U79A 1ZBWA 4P8VA 5JH8A 4G2PA 4A0UA 3VAWA 3O5EA 3B8SA 3WQWA 3AS3A 5HWBA 2F21A 2Y8NB 4IPXA 3FS8A 1D7IA 1WAWA 1LQ0A 5BXJA 1LL4A 2ZR6A 2KI3A 4ZPWR 4QIBA 1Q6HA 1W9PA 2DMVA 1IX5A 4W9OA 2N87A 4N19A 4MNLA 4IT4A 4MPKA 2DK7A 3WQVA 3KCEA 1NWSA 4Z2KA 2M3OW 2OFNA 4LAYA 1D7JA 1QZ2A 1W1VA 1F8AB 4MTVA 2OLHA 2PBCA 3UQBA 3O5OA 1W1YA 1ROUA 2LPVA 1FKJA 2IUZA 2A3AA 2RUDA 1JVWA 1ZB5A 4KQZA 5E62A 2M8IA 5HW8A 4WIWA 1HKIA 1FD9A 3BXWA 4DWSB 5GPRA 2RSEA 3JYMA 2DSUA 4MNKA 3RM9A 4QT2A 3CNGA 2M1IA 3ARRA 3WD2A 3CHFA 2LKNA 2DJYA 3KAIA 4ML4A 4GIVA 3UI5A 4DWSD 3ARWA 5HW7A 1JNEA 4JFIA 1WMVA 2LGOA 4GLXA 4LAWA 3WIJA 5I98A 2PV1A 4L72B 4DRIA 5DIVA 3GPKA 1NWUA 4IT6A 2G41A 3G6MA 2EZ5W 3UF8A 2BA1A 4ZPTR 2JX8A 2LAJA 1ZBKA 3PQHA 4NSBA 3LKXA 4MSPA 3ARZA 4ODLA 1EG3A 2DPEA 3ARVA 2ZQSA 3ARTA 3AS2A 2XP8A 2DT1A 3O5RA 2PV2A 4S3JA 2MDIA 3FSCA 2JMFA 1HKJA 2PPNA 3KAHA 3OA5A 2RUCA 3MQGA 2KE0A 1W1PA 4AY1A 1TK7A 1D7HA 3KADA 1E9LA 3IHZA 3WD3A 5HTGA 1JNDA 3LE4A 4ODKA 4MAVA 4S3KA 1ZBCA 2DT3A 2MF9A 3MCBB 2ZR5A 2MLXA 4ODNA 3JYJA 1FKBA 3RMEA 2DSZA 1ZCNA 4Q22A 2F4EA 2XPAA 3UQIA 1T11A 3WH0A 2K8IA 2QF8A 3I6CA 4DIPA 4ODPA 2DG3A 1FKLA 4URIA 4NZCA 2DSVA 5E64A 1FKRA 1FKSA 3UI4A 5J6EA 1HKMA 5D75A 1X6LA 1NH6A 2QRVA 4Z2HA 2KR7A 4TW6A 3CHDA 3UI6A 2ITKA 4P8XA 4HARA 1JMQA 1NWRA 4DRMA 2DT0A 5HUAA 4U85A 1O6IA 1OGGA 2WLYA 1B6CA 4LAXA 5GQBA 2AWGA 4FN2A 2WAEA 5DITA 2XP4A 5HW6A 3KABA 1OWQA 1QPFA 2L2SA 2YBUA 3PRAA 3O5JA 1ZL1A 4TNSA 5E65A 1QPLA 2ZR4A 1FFQA 4TX0A 2M8JA 3ARSA 1SYTA 2KO7A 4P8UA 2VN1A 1LG1A 1NMVA 3O5QA 1K9RA 1K9TA 4WKAA 4J4NA 1EDQA 3RFWA 3G6LA 1TFVA 3CHEA 1K9QA 3PR9A 4DROA 3ALGA 2E45A 3IKGA 3MDYB 3TDBA 2MLZA 2YSHA 2O9OA 1VF8A 4DRHA 5GPGA 4IQCA 3O5MA 1KT1A 2O92A 1J4RA 3ALFA 4DH0A 3O5FA 1HJXA 3FSBA 1FKFA 2XPBA 5B8IC 4WKHA 1W1TA 3QOKA 3CHCA 1E6RA 5DF0A 1ROTA 3NRKA 2DG9A 3W4RA 1TCOC 1W26A 3O5LA 2WK2A 2LJ4A 1LL6A 3WD4A 5U47A 1EG4A 3IKDA 3ARYA 1Q1CA 3CH9A 4L3NA 1BKFA 2JZVA 1D6OA 3KZ7A 4MNJA 1UR8A 2PPOA 1HJVA 4HBOA 4DRPA 3ARPA 1X6NA 4TW7A 1A7XA 4IQ2A 2YBTA 4JYSA 3EY6A 1NSGA 3FXYA 1PINA 4DT4A 4C02B 1OGBA 2DSWA 4GGQA 3B9EA 4QZVB 1N1AA 1NMWA 1R9HA 4P8WA 2L4JA 1FKHA 2RQSA 3PRDA 4ZS6A 4ODMA 1H0IA 2WADA 5HKGA 1FKTA 1RP5A 2JXWA 2A3BA 4U84A 2XP5A 2DWVA 4Q7NA 3AS1A 3LUOA 4PTMA 2FDMA 1E6ZA 4DRNA 1LJYA 3WL0A 4DWSA 3ODKA 1ZU8A 1EIBA 4JFKA 2YSBA 1E6NA 1J4IA 1CTNA 2IF4A 3NI6A 3WKZA 3PA7A 2A3EA 1SR0A 3O5DA 1FJDA 4LGXA 1HXVA 3TC5A 1FKIA 2XP3A 4KR0B 3KAFA 2ZQUA 4MGVA 1FKGA 1E15A 4W9PA 4A0TA 4ODQA 5AHTA 1ZK6A 2MPHA 3PRBA 2WM0A 1J4HA 3B9DA 4WK9A 4WJXA 4FAPA 3AS0A 3O5IA 4R5EA 3LKXB 3B9AA 2YSGA 2MLYA 1TR8A 1EYMA 3M7NA 3AQUA 1XHGA 2A3CA 1GPFA 2XP6A 5HBFA 4W5UA 3NTPA 2RE3A 1WB0A 2Y78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QT3 A;  4DZ2 A;  2F2D A;  1Q6I A;  4DRJ A;  1EQ3 A;  1I5H W;  3L4H A;  3UQA A;  4BF8 A;  3M85 A;  2KXQ A;  1M5Y A;  4NNR A;  3OOB A;  1FKD A;  2PPP A;  4G50 A;  1JNT A;  4DZ3 A;  1PBK A;  2RUQ A;  1FAP A;  2FAP A;  2Q5A A;  5DIU A;  2UZ5 A;  4TYO A;  2M08 A;  5CQ2 A;  2M2A A;  3RGC A;  2D9F A;  2XP7 A;  4DRQ A;  4U86 A;  1C9H A;  3CGM A;  1WR7 A;  4J4O A;  1J6Y A;  3IK8 A;  1O6W A;  3FAP A;  1Y0O A;  3B7X A;  1FKK A;  3KAC A;  1L1P A;  5HT1 A;  4JFJ A;  4E5R A;  4ODR A;  1KT0 A;  2VCD A;  3JXV A;  2KGJ A;  1BL4 A;  2RUR A;  4REX A;  3O5P A;  3TCZ A;  4ODO A;  2FKE A;  2PV3 A;  1F40 A;  2DG4 A;  4O2T A;  1JNS A;  4DRK A;  3H9R B;  4R0X A;  2ZQV A;  4JFM A;  2JV4 A;  1P5Q A;  3CGN A;  4ITZ A;  2KFW A;  2DK1 A;  5HWC A;  1YAT A;  4LAV A;  2YSF A;  4JFL A;  3KAG A;  3O5G A;  3O5K A;  4W9Q A;  2ZQT A;  4TW8 A;  2MNT A;  2XP9 A;  1YW5 A;  2YSI A;  1Q6U A;  2ZAJ A;  1U79 A;  4G2P A;  3VAW A;  3O5E A;  5HWB A;  2F21 A;  4IPX A;  1D7I A;  5BXJ A;  2ZR6 A;  2KI3 A;  4QIB A;  1Q6H A;  2DMV A;  4W9O A;  2N87 A;  4N19 A;  2DK7 A;  3KCE A;  2M3O W;  2OFN A;  4LAY A;  1D7J A;  1QZ2 A;  1F8A B;  2PBC A;  3UQB A;  3O5O A;  1ROU A;  2LPV A;  1FKJ A;  2RUD A;  1JVW A;  2M8I A;  5HW8 A;  1FD9 A;  2RSE A;  3JYM A;  4QT2 A;  3CNG A;  2M1I A;  2LKN A;  2DJY A;  3KAI A;  4GIV A;  3UI5 A;  5HW7 A;  4JFI A;  1WMV A;  2LGO A;  4LAW A;  5I98 A;  2PV1 A;  4DRI A;  5DIV A;  3GPK A;  2EZ5 W;  3UF8 A;  2BA1 A;  2JX8 A;  2LAJ A;  4MSP A;  4ODL A;  1EG3 A;  2ZQS A;  2XP8 A;  3O5R A;  2PV2 A;  2MDI A;  2JMF A;  2PPN A;  3KAH A;  2RUC A;  2KE0 A;  1TK7 A;  1D7H A;  3KAD A;  3IHZ A;  5HTG A;  3LE4 A;  4ODK A;  2MF9 A;  2ZR5 A;  2MLX A;  4ODN A;  3JYJ A;  1FKB A;  1ZCN A;  2F4E A;  2XPA A;  3UQI A;  1T11 A;  3WH0 A;  2K8I A;  3I6C A;  4DIP A;  4ODP A;  2DG3 A;  1FKL A;  1FKR A;  1FKS A;  3UI4 A;  5J6E A;  5D75 A;  2KR7 A;  4TW6 A;  3UI6 A;  2ITK A;  1JMQ A;  4DRM A;  5HUA A;  4U85 A;  1B6C A;  4LAX A;  2AWG A;  4FN2 A;  5DIT A;  2XP4 A;  5HW6 A;  3KAB A;  2L2S A;  1QPF A;  3O5J A;  4TNS A;  1QPL A;  2ZR4 A;  4TX0 A;  2M8J A;  2KO7 A;  2VN1 A;  1NMV A;  3O5Q A;  1K9R A;  4J4N A;  3RFW A;  1K9Q A;  4DRO A;  2E45 A;  3IKG A;  3MDY B;  3TDB A;  2YSH A;  2MLZ A;  4DRH A;  5GPG A;  4IQC A;  3O5M A;  1KT1 A;  1J4R A;  4DH0 A;  3O5F A;  1FKF A;  2XPB A;  5B8I C;  1ROT A;  3NRK A;  2DG9 A;  1TCO C;  1W26 A;  3O5L A;  2LJ4 A;  1EG4 A;  3IKD A;  1Q1C A;  1BKF A;  2JZV A;  1D6O A;  3KZ7 A;  2PPO A;  4DRP A;  4TW7 A;  1A7X A;  4IQ2 A;  4JYS A;  3EY6 A;  1NSG A;  1PIN A;  4DT4 A;  4C02 B;  4GGQ A;  1N1A A;  1NMW A;  1R9H A;  2L4J A;  1FKH A;  2RQS A;  3PRD A;  4ODM A;  5HKG A;  1FKT A;  2JXW A;  4U84 A;  2XP5 A;  2DWV A;  3LUO A;  4DRN A;  3ODK A;  4JFK A;  2YSB A;  1J4I A;  2IF4 A;  3NI6 A;  3PA7 A;  3O5D A;  1FJD A;  1HXV A;  3TC5 A;  1FKI A;  2XP3 A;  3KAF A;  2ZQU A;  4MGV A;  1FKG A;  4W9P A;  4ODQ A;  5AHT A;  1ZK6 A;  2MPH A;  3PRB A;  1J4H A;  4FAP A;  3O5I A;  2YSG A;  2MLY A;  1EYM A;  3M7N A;  2XP6 A;  3NTP A;  2RE3 A;  2Y78 A; 
#chains in the Genus database with same CATH topology
 4QT3 A;  4DZ2 A;  2F2D A;  3WL1 A;  1Q6I A;  4WKF A;  4DRJ A;  4Z2G A;  1EQ3 A;  1WNO A;  1ZBV A;  1ITX A;  1EHN A;  1I5H W;  3L4H A;  1W9U A;  3ARQ A;  3WD1 A;  3UQA A;  1RD6 A;  4BF8 A;  3M85 A;  2KXQ A;  1M5Y A;  4NNR A;  3RM8 A;  3ARU A;  1HJW A;  1GRJ A;  3OOB A;  1FKD A;  1W9V A;  2PPP A;  4ZPV R;  3MCB A;  1FFR A;  4G50 A;  1JNT A;  3MQH A;  4DZ3 A;  1FLC A;  1PBK A;  2RUQ A;  3ARX A;  1FAP A;  2FAP A;  2Q5A A;  2ESC A;  5DIU A;  2UZ5 A;  3GU0 A;  4TYO A;  5DO2 A;  2M08 A;  4Z2L A;  5CQ2 A;  2M2A A;  3RGC A;  2D9F A;  2XP7 A;  2ETN A;  3RM4 A;  4U86 A;  4DRQ A;  2G8Z A;  1C9H A;  3CGM A;  4DWS C;  1WR7 A;  4J4O A;  1J6Y A;  3IK8 A;  1O6W A;  3FAP A;  1Y0O A;  3B7X A;  1E6P A;  1FKK A;  3KAC A;  1L1P A;  5HT1 A;  3FY1 A;  4JFJ A;  1LL7 A;  4E5R A;  5E66 A;  1NWT A;  1LG2 A;  4ODR A;  1KT0 A;  2VCD A;  3JXV A;  2KGJ A;  1BL4 A;  2RUR A;  4REX A;  3O5P A;  2YAJ B;  3TCZ A;  4ODO A;  2FKE A;  2PV3 A;  1F40 A;  4XAK A;  2DG4 A;  4O2T A;  1JNS A;  4DRK A;  3H9R B;  4R0X A;  2ZQV A;  4Z2I A;  4JFM A;  3CZ8 A;  2JV4 A;  1P5Q A;  3CGN A;  1XRV A;  5DEZ A;  2PI6 A;  4ITZ A;  2KFW A;  2DK1 A;  1GUV A;  5HWC A;  2OWO A;  3ARO A;  1YAT A;  2AOS A;  4LAV A;  1GOI A;  4Z2J A;  3WD0 A;  2YSF A;  4JFL A;  3KAG A;  4HBE A;  3O5G A;  3O5K A;  4W9Q A;  2ZQT A;  4MNM A;  4TW8 A;  1UR9 A;  2MNT A;  2XP9 A;  1KFW A;  1HKK A;  1YW5 A;  2DT2 A;  5E5W A;  1H0G A;  2PN0 A;  2YSI A;  1D2K A;  2B31 A;  1Q6U A;  2WLZ A;  2ZAJ A;  1U79 A;  1ZBW A;  4P8V A;  5JH8 A;  4G2P A;  4A0U A;  3VAW A;  3O5E A;  3B8S A;  3WQW A;  3AS3 A;  5HWB A;  2F21 A;  2Y8N B;  4IPX A;  3FS8 A;  1D7I A;  1WAW A;  1LQ0 A;  5BXJ A;  1LL4 A;  2ZR6 A;  2KI3 A;  4ZPW R;  4QIB A;  1Q6H A;  1W9P A;  2DMV A;  1IX5 A;  4W9O A;  2N87 A;  4N19 A;  4MNL A;  2F23 A;  4IT4 A;  4MPK A;  2DK7 A;  3WQV A;  3KCE A;  1NWS A;  4Z2K A;  2M3O W;  2OFN A;  4LAY A;  1D7J A;  1QZ2 A;  1W1V A;  1F8A B;  4MTV A;  2OLH A;  2PBC A;  3UQB A;  3O5O A;  1W1Y A;  1ROU A;  2LPV A;  1FKJ A;  2IUZ A;  2A3A A;  2RUD A;  1JVW A;  1ZB5 A;  4KQZ A;  5E62 A;  2M8I A;  5HW8 A;  1E44 A;  4WIW A;  1HKI A;  1FD9 A;  3BXW A;  4DWS B;  5GPR A;  2RSE A;  3JYM A;  2DSU A;  4MNK A;  3BMB A;  3RM9 A;  4QT2 A;  3CNG A;  2M1I A;  3ARR A;  3WD2 A;  3CHF A;  2LKN A;  2DJY A;  3GTY X;  3KAI A;  4ML4 A;  4GIV A;  3UI5 A;  4DWS D;  3ARW A;  5HW7 A;  1JNE A;  4JFI A;  1WMV A;  2LGO A;  4GLX A;  4LAW A;  3WIJ A;  5I98 A;  2PV1 A;  4L72 B;  4DRI A;  5DIV A;  3GPK A;  1NWU A;  4IT6 A;  2G41 A;  3G6M A;  2EZ5 W;  3UF8 A;  2BA1 A;  4ZPT R;  2JX8 A;  2LAJ A;  1ZBK A;  3PQH A;  4NSB A;  3LKX A;  4MSP A;  3ARZ A;  4ODL A;  1EG3 A;  2DPE A;  3ARV A;  2ZQS A;  3ART A;  3AS2 A;  2XP8 A;  2DT1 A;  3O5R A;  2PV2 A;  4S3J A;  2MDI A;  3FSC A;  2JMF A;  1HKJ A;  2PPN A;  3KAH A;  3OA5 A;  2RUC A;  3MQG A;  2KE0 A;  1W1P A;  4AY1 A;  1TK7 A;  1D7H A;  3KAD A;  1E9L A;  3IHZ A;  3WD3 A;  5HTG A;  1JND A;  3LE4 A;  4ODK A;  4MAV A;  4S3K A;  1ZBC A;  2DT3 A;  2MF9 A;  3MCB B;  2ZR5 A;  2MLX A;  4ODN A;  3JYJ A;  1FKB A;  3RME A;  2DSZ A;  1ZCN A;  4Q22 A;  2F4E A;  2XPA A;  3UQI A;  1T11 A;  3EIP A;  3WH0 A;  2K8I A;  2QF8 A;  3I6C A;  4DIP A;  4ODP A;  2DG3 A;  1FKL A;  4URI A;  4NZC A;  2DSV A;  5E64 A;  1FKR A;  1FKS A;  3UI4 A;  5J6E A;  1HKM A;  5D75 A;  1X6L A;  1NH6 A;  2QRV A;  4Z2H A;  2KR7 A;  4TW6 A;  3CHD A;  3UI6 A;  2ITK A;  4P8X A;  4HAR A;  1JMQ A;  1NWR A;  4DRM A;  2DT0 A;  5HUA A;  2B5U B;  2P4V A;  4U85 A;  1O6I A;  1OGG A;  2WLY A;  1B6C A;  4LAX A;  5GQB A;  2AWG A;  4FN2 A;  2WAE A;  5DIT A;  2XP4 A;  5HW6 A;  3KAB A;  1OWQ A;  1QPF A;  2L2S A;  2YBU A;  3PRA A;  2EUL A;  3O5J A;  1ZL1 A;  4TNS A;  5E65 A;  1QPL A;  2ZR4 A;  1FFQ A;  4TX0 A;  2M8J A;  3ARS A;  1SYT A;  2KO7 A;  4P8U A;  2VN1 A;  1LG1 A;  1NMV A;  3O5Q A;  1K9R A;  1K9T A;  4WKA A;  4J4N A;  1EDQ A;  3RFW A;  3G6L A;  1TFV A;  3CHE A;  1K9Q A;  3PR9 A;  4DRO A;  3ALG A;  2E45 A;  3IKG A;  3MDY B;  3TDB A;  2MLZ A;  2YSH A;  2O9O A;  1VF8 A;  4DRH A;  5GPG A;  4IQC A;  3O5M A;  1KT1 A;  2O92 A;  1J4R A;  3ALF A;  4DH0 A;  3O5F A;  1HJX A;  3FSB A;  1FKF A;  2XPB A;  5B8I C;  4WKH A;  1W1T A;  3QOK A;  3CHC A;  1E6R A;  5DF0 A;  1ROT A;  3NRK A;  4UDM A;  1JCH B;  2DG9 A;  3W4R A;  1TCO C;  1W26 A;  3O5L A;  2WK2 A;  2LJ4 A;  1LL6 A;  3WD4 A;  5U47 A;  1EG4 A;  3IKD A;  3ARY A;  1Q1C A;  3CH9 A;  4L3N A;  1BKF A;  2JZV A;  1D6O A;  3KZ7 A;  4MNJ A;  1UR8 A;  2PPO A;  1HJV A;  4HBO A;  4DRP A;  3ARP A;  1X6N A;  4TW7 A;  1A7X A;  4IQ2 A;  2YBT A;  4JYS A;  3EY6 A;  1NSG A;  3FXY A;  1PIN A;  4DT4 A;  4C02 B;  1OGB A;  2DSW A;  4GGQ A;  3B9E A;  4QZV B;  1N1A A;  1NMW A;  1R9H A;  4P8W A;  2L4J A;  1FKH A;  2RQS A;  3PRD A;  4ZS6 A;  4ODM A;  1H0I A;  2WAD A;  5HKG A;  1FKT A;  1RP5 A;  2JXW A;  2A3B A;  4U84 A;  2XP5 A;  2DWV A;  4Q7N A;  3AS1 A;  3LUO A;  4PTM A;  2FDM A;  1E6Z A;  4DRN A;  1LJY A;  3WL0 A;  4DWS A;  3ODK A;  1ZU8 A;  1EIB A;  4JFK A;  2YSB A;  1E6N A;  1J4I A;  1CTN A;  2IF4 A;  3NI6 A;  3WKZ A;  3PA7 A;  2A3E A;  1SR0 A;  3O5D A;  1FJD A;  4LGX A;  1HXV A;  3TC5 A;  1FKI A;  2XP3 A;  4KR0 B;  3KAF A;  2ZQU A;  4MGV A;  1FKG A;  1E15 A;  4W9P A;  4A0T A;  4ODQ A;  5AHT A;  1ZK6 A;  2MPH A;  3PRB A;  2WM0 A;  1J4H A;  3B9D A;  4WK9 A;  4WJX A;  4FAP A;  3AS0 A;  3O5I A;  4R5E A;  3LKX B;  3B9A A;  2YSG A;  2MLY A;  1TR8 A;  1EYM A;  3M7N A;  3AQU A;  1XHG A;  2A3C A;  1GPF A;  2XP6 A;  5HBF A;  4W5U A;  3NTP A;  2RE3 A;  1WB0 A;  2Y78 A; 
#chains in the Genus database with same CATH homology
 4QT3 A;  4DZ2 A;  2F2D A;  3WL1 A;  1Q6I A;  4WKF A;  4DRJ A;  4Z2G A;  1EQ3 A;  1WNO A;  1ZBV A;  1ITX A;  1EHN A;  1I5H W;  3L4H A;  1W9U A;  3ARQ A;  3WD1 A;  3UQA A;  1RD6 A;  4BF8 A;  3M85 A;  2KXQ A;  1M5Y A;  4NNR A;  3RM8 A;  3ARU A;  1HJW A;  3OOB A;  1FKD A;  1W9V A;  2PPP A;  4ZPV R;  3MCB A;  1FFR A;  4G50 A;  1JNT A;  3MQH A;  4DZ3 A;  1FLC A;  1PBK A;  2RUQ A;  3ARX A;  1FAP A;  2FAP A;  2Q5A A;  2ESC A;  5DIU A;  2UZ5 A;  4TYO A;  5DO2 A;  2M08 A;  4Z2L A;  5CQ2 A;  2M2A A;  3RGC A;  2D9F A;  2XP7 A;  3RM4 A;  4DRQ A;  4U86 A;  2G8Z A;  1C9H A;  3CGM A;  4DWS C;  1WR7 A;  4J4O A;  1J6Y A;  3IK8 A;  1O6W A;  3FAP A;  1Y0O A;  3B7X A;  1E6P A;  1FKK A;  3KAC A;  1L1P A;  5HT1 A;  3FY1 A;  4JFJ A;  1LL7 A;  4E5R A;  5E66 A;  1NWT A;  1LG2 A;  4ODR A;  1KT0 A;  2VCD A;  3JXV A;  2KGJ A;  1BL4 A;  2RUR A;  4REX A;  3O5P A;  2YAJ B;  3TCZ A;  4ODO A;  2FKE A;  2PV3 A;  1F40 A;  4XAK A;  2DG4 A;  4O2T A;  1JNS A;  4DRK A;  3H9R B;  4R0X A;  2ZQV A;  4Z2I A;  4JFM A;  3CZ8 A;  2JV4 A;  1P5Q A;  3CGN A;  1XRV A;  5DEZ A;  2PI6 A;  4ITZ A;  2KFW A;  2DK1 A;  1GUV A;  5HWC A;  2OWO A;  3ARO A;  1YAT A;  2AOS A;  4LAV A;  1GOI A;  4Z2J A;  3WD0 A;  2YSF A;  4JFL A;  3KAG A;  4HBE A;  3O5G A;  3O5K A;  4W9Q A;  2ZQT A;  4MNM A;  4TW8 A;  1UR9 A;  2MNT A;  2XP9 A;  1KFW A;  1HKK A;  1YW5 A;  2DT2 A;  5E5W A;  1H0G A;  2YSI A;  1D2K A;  2B31 A;  1Q6U A;  2WLZ A;  2ZAJ A;  1U79 A;  1ZBW A;  4P8V A;  5JH8 A;  4G2P A;  4A0U A;  3VAW A;  3O5E A;  3B8S A;  3WQW A;  3AS3 A;  5HWB A;  2F21 A;  2Y8N B;  4IPX A;  3FS8 A;  1D7I A;  1WAW A;  1LQ0 A;  5BXJ A;  1LL4 A;  2ZR6 A;  2KI3 A;  4ZPW R;  4QIB A;  1Q6H A;  1W9P A;  2DMV A;  1IX5 A;  4W9O A;  2N87 A;  4N19 A;  4MNL A;  4IT4 A;  4MPK A;  2DK7 A;  3WQV A;  3KCE A;  1NWS A;  4Z2K A;  2M3O W;  2OFN A;  4LAY A;  1D7J A;  1QZ2 A;  1W1V A;  1F8A B;  4MTV A;  2OLH A;  2PBC A;  3UQB A;  3O5O A;  1W1Y A;  1ROU A;  2LPV A;  1FKJ A;  2IUZ A;  2A3A A;  2RUD A;  1JVW A;  1ZB5 A;  4KQZ A;  5E62 A;  2M8I A;  5HW8 A;  4WIW A;  1HKI A;  1FD9 A;  3BXW A;  4DWS B;  5GPR A;  2RSE A;  3JYM A;  2DSU A;  4MNK A;  3RM9 A;  4QT2 A;  3CNG A;  2M1I A;  3ARR A;  3WD2 A;  3CHF A;  2LKN A;  2DJY A;  3KAI A;  4ML4 A;  4GIV A;  3UI5 A;  4DWS D;  3ARW A;  5HW7 A;  1JNE A;  4JFI A;  1WMV A;  2LGO A;  4GLX A;  4LAW A;  3WIJ A;  5I98 A;  2PV1 A;  4L72 B;  4DRI A;  5DIV A;  3GPK A;  1NWU A;  4IT6 A;  2G41 A;  3G6M A;  2EZ5 W;  3UF8 A;  2BA1 A;  4ZPT R;  2JX8 A;  2LAJ A;  1ZBK A;  3PQH A;  4NSB A;  3LKX A;  4MSP A;  3ARZ A;  4ODL A;  1EG3 A;  2DPE A;  3ARV A;  2ZQS A;  3ART A;  3AS2 A;  2XP8 A;  2DT1 A;  3O5R A;  2PV2 A;  4S3J A;  2MDI A;  3FSC A;  2JMF A;  1HKJ A;  2PPN A;  3KAH A;  3OA5 A;  2RUC A;  3MQG A;  2KE0 A;  1W1P A;  4AY1 A;  1TK7 A;  1D7H A;  3KAD A;  1E9L A;  3IHZ A;  3WD3 A;  5HTG A;  1JND A;  3LE4 A;  4ODK A;  4MAV A;  4S3K A;  1ZBC A;  2DT3 A;  2MF9 A;  3MCB B;  2ZR5 A;  2MLX A;  4ODN A;  3JYJ A;  1FKB A;  3RME A;  2DSZ A;  1ZCN A;  4Q22 A;  2F4E A;  2XPA A;  3UQI A;  1T11 A;  3WH0 A;  2K8I A;  2QF8 A;  3I6C A;  4DIP A;  4ODP A;  2DG3 A;  1FKL A;  4URI A;  4NZC A;  2DSV A;  5E64 A;  1FKR A;  1FKS A;  3UI4 A;  5J6E A;  1HKM A;  5D75 A;  1X6L A;  1NH6 A;  2QRV A;  4Z2H A;  2KR7 A;  4TW6 A;  3CHD A;  3UI6 A;  2ITK A;  4P8X A;  4HAR A;  1JMQ A;  1NWR A;  4DRM A;  2DT0 A;  5HUA A;  4U85 A;  1O6I A;  1OGG A;  2WLY A;  1B6C A;  4LAX A;  5GQB A;  2AWG A;  4FN2 A;  2WAE A;  5DIT A;  2XP4 A;  5HW6 A;  3KAB A;  1OWQ A;  1QPF A;  2L2S A;  2YBU A;  3PRA A;  3O5J A;  1ZL1 A;  4TNS A;  5E65 A;  1QPL A;  2ZR4 A;  1FFQ A;  4TX0 A;  2M8J A;  3ARS A;  1SYT A;  2KO7 A;  4P8U A;  2VN1 A;  1LG1 A;  1NMV A;  3O5Q A;  1K9R A;  1K9T A;  4WKA A;  4J4N A;  1EDQ A;  3RFW A;  3G6L A;  1TFV A;  3CHE A;  1K9Q A;  3PR9 A;  4DRO A;  3ALG A;  2E45 A;  3IKG A;  3MDY B;  3TDB A;  2MLZ A;  2YSH A;  2O9O A;  1VF8 A;  4DRH A;  5GPG A;  4IQC A;  3O5M A;  1KT1 A;  2O92 A;  1J4R A;  3ALF A;  4DH0 A;  3O5F A;  1HJX A;  3FSB A;  1FKF A;  2XPB A;  5B8I C;  4WKH A;  1W1T A;  3QOK A;  3CHC A;  1E6R A;  5DF0 A;  1ROT A;  3NRK A;  2DG9 A;  3W4R A;  1TCO C;  1W26 A;  3O5L A;  2WK2 A;  2LJ4 A;  1LL6 A;  3WD4 A;  5U47 A;  1EG4 A;  3IKD A;  3ARY A;  1Q1C A;  3CH9 A;  4L3N A;  1BKF A;  2JZV A;  1D6O A;  3KZ7 A;  4MNJ A;  1UR8 A;  2PPO A;  1HJV A;  4HBO A;  4DRP A;  3ARP A;  1X6N A;  4TW7 A;  1A7X A;  4IQ2 A;  2YBT A;  4JYS A;  3EY6 A;  1NSG A;  3FXY A;  1PIN A;  4DT4 A;  4C02 B;  1OGB A;  2DSW A;  4GGQ A;  3B9E A;  4QZV B;  1N1A A;  1NMW A;  1R9H A;  4P8W A;  2L4J A;  1FKH A;  2RQS A;  3PRD A;  4ZS6 A;  4ODM A;  1H0I A;  2WAD A;  5HKG A;  1FKT A;  1RP5 A;  2JXW A;  2A3B A;  4U84 A;  2XP5 A;  2DWV A;  4Q7N A;  3AS1 A;  3LUO A;  4PTM A;  2FDM A;  1E6Z A;  4DRN A;  1LJY A;  3WL0 A;  4DWS A;  3ODK A;  1ZU8 A;  1EIB A;  4JFK A;  2YSB A;  1E6N A;  1J4I A;  1CTN A;  2IF4 A;  3NI6 A;  3WKZ A;  3PA7 A;  2A3E A;  1SR0 A;  3O5D A;  1FJD A;  4LGX A;  1HXV A;  3TC5 A;  1FKI A;  2XP3 A;  4KR0 B;  3KAF A;  2ZQU A;  4MGV A;  1FKG A;  1E15 A;  4W9P A;  4A0T A;  4ODQ A;  5AHT A;  1ZK6 A;  2MPH A;  3PRB A;  2WM0 A;  1J4H A;  3B9D A;  4WK9 A;  4WJX A;  4FAP A;  3AS0 A;  3O5I A;  4R5E A;  3LKX B;  3B9A A;  2YSG A;  2MLY A;  1TR8 A;  1EYM A;  3M7N A;  3AQU A;  1XHG A;  2A3C A;  1GPF A;  2XP6 A;  5HBF A;  4W5U A;  3NTP A;  2RE3 A;  1WB0 A;  2Y78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...