3KCEA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
146
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 44
structure length 146
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kceA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kceA02
3UI4A 3O5FA 2KGJA 3O5OA 2MDIA 4IQ2A 2DK1A 3UQIA 2KXQA 3JYJA 3KABA 1L1PA 2ZQUA 2JX8A 4TW6A 4C02B 3PRDA 1QPFA 2KE0A 4DRNA 5I98A 1F8AB 1WMVA 4W9QA 2K8IA 2AWGA 1P5QA 3CGMA 3KAHA 1ZCNA 2ZR4A 3CGNA 4W9OA 2YSHA 3O5LA 5HWCA 3WH0A 4ODMA 4QT3A 1QZ2A 3UQAA 2JV4A 2M8JA 4TYOA 5HWBA 3H9RB 4DRPA 4TW7A 2VN1A 3I6CA 1EG3A 1FKFA 1YATA 4GGQA 3CNGA 3TC5A 4LAWA 1FKTA 1D6OA 2Q5AA 3O5JA 3MDYB 4QIBA 5HT1A 4DRMA 4LAXA 3O5KA 2KO7A 4DT4A 1F40A 2RUDA 3RFWA 3RGCA 2DWVA 5CQ2A 4ODQA 2KR7A 1PBKA 4ODPA 2PPOA 3NRKA 3ODKA 3O5IA 3M85A 1FKDA 4ODRA 5HW8A 4QT2A 2RE3A 1J4RA 2XP7A 2ZAJA 4N19A 4E5RA 5HUAA 2M08A 2E45A 2M8IA 3KACA 4ITZA 3KAGA 2YSIA 1D7IA 1JNTA 1D7JA 2YSBA 5AHTA 2L4JA 2BA1A 2KFWA 1J4HA 5DIVA 4DRQA 1EG4A 1FKSA 2Y78A 3KZ7A 4LAVA 2ZQVA 4JFKA 2JXWA 2UZ5A 2PV2A 4DRHA 3KCEA 2XP8A 4JYSA 4MGVA 3UF8A 5HW7A 1NMWA 1N1AA 3O5GA 3O5DA 3IHZA 2MPHA 2RUQA 3O5QA 3EY6A 2JMFA 3KAIA 1EYMA 1FKIA 1A7XA 4DRIA 5HW6A 4DH0A 4FAPA 1WR7A 4ODNA 2L2SA 2M2AA 1ROTA 1B6CA 3B7XA 2IF4A 1FKHA 4R0XA 2MF9A 1BKFA 1FKBA 3UQBA 4ODLA 2YSGA 3FAPA 4DZ3A 2PV1A 1QPLA 4JFLA 3PA7A 3L4HA 1FKKA 4ODOA 4ODKA 5GPGA 2D9FA 3NI6A 4GIVA 2VCDA 2MNTA 1FKGA 4U86A 2DK7A 5HTGA 2M3OW 1FJDA 1NSGA 2RURA 3KADA 4FN2A 1YW5A 1R9HA 2PBCA 1U79A 5B8IC 4MSPA 1JVWA 4G50A 3NTPA 1TCOC 1J4IA 3KAFA 3O5MA 1Q1CA 2RSEA 4JFIA 4NNRA 2OFNA 5D75A 1PINA 2PPNA 4JFJA 2MLYA 4W9PA 2DG9A 3TDBA 2F2DA 2LGOA 1J6YA 2ZQTA 1JMQA 4LAYA 3OOBA 4DRJA 1W26A 3JXVA 2F21A 4DRKA 2XP4A 2N87A 3JYMA 1ZK6A 2YSFA 1EQ3A 1C9HA 2FAPA 2MLZA 2XP5A 1HXVA 4J4OA 2MLXA 2RQSA 2ZQSA 3TCZA 1ROUA 5BXJA 1M5YA 2DMVA 1D7HA 2DG4A 4U84A 3PRBA 3M7NA 2ITKA 3O5RA 2XPBA 1FKRA 4IQCA 4REXA 1FKLA 1T11A 4DZ2A 3GPKA 2ZR6A 3UI5A 2F4EA 1Q6HA 1K9QA 2ZR5A 2LKNA 1Q6UA 2XP3A 1FKJA 5J6EA 4DIPA 2PPPA 4BF8A 1NMVA 4TW8A 2LJ4A 1BL4A 4TNSA 4G2PA 4IPXA 1FAPA 4TX0A 2XP6A 2FKEA 4JFMA 2XPAA 2LPVA 3IK8A 5HKGA 1Q6IA 2XP9A 3O5PA 1FD9A 3O5EA 2DG3A 2DJYA 4J4NA 3VAWA 3LUOA 3IKGA 3UI6A 2M1IA 1KT1A 4U85A 4DROA 1KT0A 1JNSA 5DITA 2JZVA 1O6WA 2LAJA 3LE4A 2RUCA 3IKDA 5DIUA 1K9RA 2KI3A 1TK7A 2EZ5W 4O2TA 1Y0OA 1I5HW 2PV3A
chains in the Genus database with same CATH superfamily
1X6NA 3UI4A 2ETNA 3O5FA 1E9LA 2KGJA 3O5OA 2MDIA 4KR0B 1W1PA 1RP5A 4IQ2A 2DK1A 3UQIA 2KXQA 4Z2KA 3JYJA 3KABA 2OLHA 4MPKA 1L1PA 2ZQUA 2OWOA 1HJWA 2JX8A 4TW6A 1HKKA 4C02B 3PRDA 1ZB5A 1QPFA 2DT2A 1WAWA 2KE0A 4DRNA 2YBTA 3MCBA 1F8AB 5I98A 1WMVA 1ZBVA 4W9QA 1XHGA 2K8IA 2WK2A 2AWGA 4Z2GA 1E6RA 1P5QA 3CGMA 3KAHA 1ZCNA 2ZR4A 1FFQA 3CGNA 4W9OA 2YSHA 3O5LA 5HWCA 4HBEA 3WH0A 1ITXA 4ODMA 3ALFA 3AS2A 4QT3A 3RM4A 1QZ2A 3UQAA 1TR8A 1W1TA 2JV4A 2M8JA 2DSWA 3PR9A 3QOKA 4TYOA 5GQBA 5HWBA 3H9RB 4DRPA 4TW7A 2VN1A 2A3CA 3I6CA 1EG3A 2WLYA 1FKFA 1X6LA 1YATA 4GGQA 3CNGA 3TC5A 4LAWA 4WIWA 1FKTA 1D6OA 2Q5AA 1E6PA 3O5JA 3MDYB 2A3BA 4WKFA 4QIBA 2DT3A 5HT1A 4DRMA 4LAXA 1GOIA 1OGBA 3O5KA 2KO7A 4IT4A 4NSBA 4DT4A 1F40A 2RUDA 3RFWA 4WJXA 3RGCA 2DWVA 5DF0A 5CQ2A 2YBUA 4ODQA 2KR7A 1PBKA 3FY1A 2PI6A 1NH6A 4ODPA 2PPOA 3NRKA 3ODKA 2DSVA 3ARZA 1E15A 3O5IA 3M85A 5E65A 1FKDA 4ODRA 1ZBWA 5HW8A 4XAKA 4QT2A 1UR9A 4P8VA 2RE3A 1J4RA 2B5UB 2AOSA 2XP7A 1HJVA 2O9OA 3CHFA 2ZAJA 3CHDA 4N19A 4E5RA 5HUAA 2M08A 2E45A 2M8IA 3KACA 2WADA 3WD4A 4ITZA 4GLXA 4PTMA 1OWQA 3KAGA 1E44A 3FSBA 2YSIA 1LG1A 4MNKA 1D7IA 1JNTA 1D7JA 2YSBA 1HKIA 5AHTA 1E6ZA 2L4JA 3WIJA 2BA1A 4WKAA 2EULA 2KFWA 1J4HA 3B9EA 2PN0A 4ZS6A 1NWUA 1WB0A 5DIVA 4DRQA 4MAVA 5U47A 2QF8A 1EG4A 1ZBCA 1FKSA 4LGXA 2A3AA 3LKXB 4A0TA 2Y78A 3KZ7A 4LAVA 2ZQVA 4JFKA 2JXWA 2FDMA 2UZ5A 2PV2A 1LQ0A 4DRHA 4Z2IA 3PQHA 3KCEA 1JNDA 2XP8A 1NWSA 4JYSA 4KQZA 5E64A 4MGVA 4DWSC 3UF8A 3MQHA 2G41A 5HW7A 1NMWA 1W9PA 1N1AA 3FS8A 1OGGA 3O5GA 3O5DA 2DSZA 3ARPA 1W1VA 3IHZA 2MPHA 2RUQA 3O5QA 3EY6A 1KFWA 2JMFA 3KAIA 4Z2JA 1EYMA 1FKIA 1A7XA 2O92A 4DRIA 5HW6A 4DH0A 4FAPA 1WR7A 4DWSB 3WL0A 4ODNA 1FLCA 2L2SA 2M2AA 1ROTA 1B6CA 3ARSA 4QZVB 3WL1A 1CTNA 1W9UA 3B7XA 2IF4A 2ESCA 4UDMA 1UR8A 1FKHA 3CHCA 2MF9A 1BKFA 4R0XA 1FKBA 3UQBA 1GPFA 2A3EA 3CHEA 3BMBA 4ODLA 4AY1A 2YSGA 3FAPA 4MNMA 4DZ3A 2PV1A 1QPLA 4JFLA 3PA7A 2QRVA 3L4HA 5JH8A 2Y8NB 1FKKA 3ARTA 1GRJA 4ODOA 4ODKA 5GPGA 2D9FA 3NI6A 4GIVA 3WQWA 2VCDA 2MNTA 4ZPWR 1FKGA 4U86A 4HARA 2DK7A 3W4RA 5HTGA 2M3OW 1FJDA 1NSGA 2RURA 4S3KA 3KADA 1WNOA 4P8UA 3GU0A 3FSCA 4A0UA 1VF8A 4FN2A 1YW5A 1R9HA 2G8ZA 2PBCA 1RD6A 1U79A 3ARRA 2B31A 5B8IC 4MSPA 1JVWA 3B9DA 4G50A 3NTPA 1TCOC 1J4IA 3LKXA 4P8WA 3WQVA 1HKJA 3KAFA 3O5MA 4MNJA 1K9TA 1Q1CA 2DT0A 3WD2A 2RSEA 4JFIA 4NNRA 2OFNA 5D75A 1PINA 2YAJB 2DPEA 2PPNA 4JFJA 2MLYA 4W9PA 2DG9A 4HBOA 3TDBA 2F2DA 2LGOA 3WD0A 1J6YA 2ZQTA 3WD3A 1JMQA 4LAYA 1H0IA 3ARXA 3OOBA 1NWTA 1E6NA 4DRJA 1ZL1A 5E5WA 1W26A 3BXWA 1JCHB 3JXVA 2F21A 5E66A 1JNEA 2WLZA 4IT6A 4DWSA 1ZU8A 4ZPTR 4DRKA 4Q22A 1FFRA 2XP4A 2N87A 3JYMA 2DSUA 1ZK6A 2YSFA 1EQ3A 1C9HA 2FAPA 1LG2A 2MLZA 2XP5A 3MQGA 1HXVA 4J4OA 1SYTA 3RMEA 2MLXA 2RQSA 4WK9A 2ZQSA 3TCZA 1ROUA 2P4VA 5BXJA 1M5YA 3AQUA 1EHNA 5DEZA 2DMVA 1D7HA 4DWSD 2DG4A 3ARWA 4U84A 3ARUA 3M7NA 2ITKA 3PRBA 4NZCA 3O5RA 2XPBA 1FKRA 4IQCA 4W5UA 4REXA 1FKLA 1T11A 4DZ2A 3GPKA 3EIPA 2ZR6A 3OA5A 4ML4A 3UI5A 3RM9A 1HJXA 2F4EA 1TFVA 1Q6HA 3WD1A 1K9QA 2ZR5A 2LKNA 3ARVA 1Q6UA 3B9AA 2XP3A 1FKJA 1LL7A 2DT1A 1W9VA 5J6EA 4DIPA 2PPPA 4BF8A 1NMVA 4L72B 4S3JA 1LL6A 5HBFA 4TW8A 1IX5A 2LJ4A 4WKHA 1BL4A 4TNSA 1O6IA 4G2PA 3PRAA 4Z2HA 4IPXA 1FAPA 3MCBB 4TX0A 3G6LA 4P8XA 2XP6A 2FKEA 2F23A 4JFMA 5E62A 2XPAA 4L3NA 4Z2LA 2LPVA 3IK8A 1LL4A 5HKGA 1Q6IA 2XP9A 1XRVA 3O5PA 1EIBA 1FD9A 5GPRA 3AS1A 3GTYX 3O5EA 3AROA 2DG3A 4MNLA 2DJYA 3WKZA 4J4NA 1H0GA 3VAWA 1NWRA 3LUOA 3IKGA 4MTVA 3UI6A 3FXYA 2M1IA 1LJYA 3RM8A 5DO2A 1KT1A 4U85A 4DROA 2WAEA 4URIA 1KT0A 4Q7NA 4R5EA 1JNSA 5DITA 3ALGA 2JZVA 1O6WA 2LAJA 1D2KA 3ARYA 3LE4A 2RUCA 4ZPVR 3IKDA 3ARQA 5DIUA 1ZBKA 1W1YA 1K9RA 2WM0A 2KI3A 1TK7A 3CH9A 1GUVA 1EDQA 3CZ8A 2EZ5W 1HKMA 4O2TA 3B8SA 2IUZA 1Y0OA 3AS3A 3G6MA 1I5HW 1SR0A 2PV3A 3AS0A
chains in the Genus database with same CATH topology
1X6NA 3UI4A 3O5FA 1E9LA 2KGJA 3O5OA 2MDIA 4KR0B 1W1PA 1RP5A 4IQ2A 2DK1A 3UQIA 2KXQA 4Z2KA 3JYJA 3KABA 2OLHA 4MPKA 1L1PA 2ZQUA 2OWOA 1HJWA 2JX8A 4TW6A 1HKKA 4C02B 3PRDA 1ZB5A 1QPFA 2DT2A 1WAWA 2KE0A 4DRNA 2YBTA 3MCBA 1F8AB 5I98A 1WMVA 1ZBVA 4W9QA 1XHGA 2K8IA 2WK2A 2AWGA 4Z2GA 1E6RA 1P5QA 3CGMA 3KAHA 1ZCNA 2ZR4A 1FFQA 3CGNA 4W9OA 2YSHA 3O5LA 5HWCA 4HBEA 3WH0A 1ITXA 4ODMA 3ALFA 3AS2A 4QT3A 3RM4A 1QZ2A 3UQAA 1TR8A 1W1TA 2JV4A 2M8JA 2DSWA 3PR9A 3QOKA 4TYOA 5GQBA 5HWBA 3H9RB 4DRPA 4TW7A 2VN1A 2A3CA 3I6CA 1EG3A 2WLYA 1FKFA 1X6LA 1YATA 4GGQA 3CNGA 3TC5A 4LAWA 4WIWA 1FKTA 1D6OA 2Q5AA 1E6PA 3O5JA 3MDYB 2A3BA 4WKFA 4QIBA 2DT3A 5HT1A 4DRMA 4LAXA 1GOIA 1OGBA 3O5KA 2KO7A 4IT4A 4NSBA 4DT4A 1F40A 2RUDA 3RFWA 4WJXA 3RGCA 2DWVA 5DF0A 5CQ2A 2YBUA 4ODQA 2KR7A 1PBKA 3FY1A 2PI6A 1NH6A 4ODPA 2PPOA 3NRKA 3ODKA 2DSVA 3ARZA 1E15A 3O5IA 3M85A 5E65A 1FKDA 4ODRA 1ZBWA 5HW8A 4XAKA 4QT2A 1UR9A 4P8VA 2RE3A 1J4RA 2AOSA 2XP7A 1HJVA 2O9OA 3CHFA 2ZAJA 3CHDA 4N19A 4E5RA 5HUAA 2M08A 2E45A 2M8IA 3KACA 2WADA 3WD4A 4ITZA 4GLXA 4PTMA 1OWQA 3KAGA 3FSBA 2YSIA 1LG1A 4MNKA 1D7IA 1JNTA 1D7JA 2YSBA 1HKIA 5AHTA 1E6ZA 2L4JA 3WIJA 2BA1A 4WKAA 2KFWA 1J4HA 3B9EA 4ZS6A 1NWUA 1WB0A 5DIVA 4DRQA 4MAVA 5U47A 2QF8A 1EG4A 1ZBCA 1FKSA 4LGXA 2A3AA 3LKXB 4A0TA 2Y78A 3KZ7A 4LAVA 2ZQVA 4JFKA 2JXWA 2FDMA 2UZ5A 2PV2A 1LQ0A 4DRHA 4Z2IA 3PQHA 3KCEA 1JNDA 2XP8A 1NWSA 4JYSA 4KQZA 5E64A 4MGVA 4DWSC 3UF8A 3MQHA 2G41A 5HW7A 1NMWA 1W9PA 1N1AA 3FS8A 1OGGA 3O5GA 3O5DA 2DSZA 3ARPA 1W1VA 3IHZA 2MPHA 2RUQA 3O5QA 3EY6A 1KFWA 2JMFA 3KAIA 4Z2JA 1EYMA 1FKIA 1A7XA 2O92A 4DRIA 5HW6A 4DH0A 4FAPA 1WR7A 4DWSB 3WL0A 4ODNA 1FLCA 2L2SA 2M2AA 1ROTA 1B6CA 3ARSA 4QZVB 3WL1A 1CTNA 1W9UA 3B7XA 2IF4A 2ESCA 1UR8A 1FKHA 3CHCA 2MF9A 1BKFA 4R0XA 1FKBA 3UQBA 1GPFA 2A3EA 3CHEA 4ODLA 4AY1A 2YSGA 3FAPA 4MNMA 4DZ3A 2PV1A 1QPLA 4JFLA 3PA7A 2QRVA 3L4HA 5JH8A 2Y8NB 1FKKA 3ARTA 4ODOA 4ODKA 5GPGA 2D9FA 3NI6A 4GIVA 3WQWA 2VCDA 2MNTA 4ZPWR 1FKGA 4U86A 4HARA 2DK7A 3W4RA 5HTGA 2M3OW 1FJDA 1NSGA 2RURA 4S3KA 3KADA 1WNOA 4P8UA 3FSCA 4A0UA 1VF8A 4FN2A 1YW5A 1R9HA 2G8ZA 2PBCA 1RD6A 1U79A 3ARRA 2B31A 5B8IC 4MSPA 1JVWA 3B9DA 4G50A 3NTPA 1TCOC 1J4IA 3LKXA 4P8WA 3WQVA 1HKJA 3KAFA 3O5MA 4MNJA 1K9TA 1Q1CA 2DT0A 3WD2A 2RSEA 4JFIA 4NNRA 2OFNA 5D75A 1PINA 2YAJB 2DPEA 2PPNA 4JFJA 2MLYA 4W9PA 2DG9A 4HBOA 3TDBA 2F2DA 2LGOA 3WD0A 1J6YA 2ZQTA 3WD3A 1JMQA 4LAYA 1H0IA 3ARXA 3OOBA 1NWTA 1E6NA 4DRJA 1ZL1A 5E5WA 1W26A 3BXWA 3JXVA 2F21A 5E66A 1JNEA 2WLZA 4IT6A 4DWSA 1ZU8A 4ZPTR 4DRKA 4Q22A 1FFRA 2XP4A 2N87A 3JYMA 2DSUA 1ZK6A 2YSFA 1EQ3A 1C9HA 2FAPA 1LG2A 2MLZA 2XP5A 3MQGA 1HXVA 4J4OA 1SYTA 3RMEA 2MLXA 2RQSA 4WK9A 2ZQSA 3TCZA 1ROUA 5BXJA 1M5YA 3AQUA 1EHNA 5DEZA 2DMVA 1D7HA 4DWSD 2DG4A 3ARWA 4U84A 3ARUA 3M7NA 2ITKA 3PRBA 4NZCA 3O5RA 2XPBA 1FKRA 4IQCA 4W5UA 4REXA 1FKLA 1T11A 4DZ2A 3GPKA 2ZR6A 3OA5A 4ML4A 3UI5A 3RM9A 1HJXA 2F4EA 1TFVA 1Q6HA 3WD1A 1K9QA 2ZR5A 2LKNA 3ARVA 1Q6UA 3B9AA 2XP3A 1FKJA 1LL7A 2DT1A 1W9VA 5J6EA 4DIPA 2PPPA 4BF8A 1NMVA 4L72B 4S3JA 1LL6A 5HBFA 4TW8A 1IX5A 2LJ4A 4WKHA 1BL4A 4TNSA 1O6IA 4G2PA 3PRAA 4Z2HA 4IPXA 1FAPA 3MCBB 4TX0A 3G6LA 4P8XA 2XP6A 2FKEA 4JFMA 5E62A 2XPAA 4L3NA 4Z2LA 2LPVA 3IK8A 1LL4A 5HKGA 1Q6IA 2XP9A 1XRVA 3O5PA 1EIBA 1FD9A 5GPRA 3AS1A 3O5EA 3AROA 2DG3A 4MNLA 2DJYA 3WKZA 4J4NA 1H0GA 3VAWA 1NWRA 3LUOA 3IKGA 4MTVA 3UI6A 3FXYA 2M1IA 1LJYA 3RM8A 5DO2A 1KT1A 4U85A 4DROA 2WAEA 4URIA 1KT0A 4Q7NA 4R5EA 1JNSA 5DITA 3ALGA 2JZVA 1O6WA 2LAJA 1D2KA 3ARYA 3LE4A 2RUCA 4ZPVR 3IKDA 3ARQA 5DIUA 1ZBKA 1W1YA 1K9RA 2WM0A 2KI3A 1TK7A 3CH9A 1GUVA 1EDQA 3CZ8A 2EZ5W 1HKMA 4O2TA 3B8SA 2IUZA 1Y0OA 3AS3A 3G6MA 1I5HW 1SR0A 2PV3A 3AS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UI4 A;  3O5F A;  2KGJ A;  3O5O A;  2MDI A;  4IQ2 A;  2DK1 A;  3UQI A;  2KXQ A;  3JYJ A;  3KAB A;  1L1P A;  2ZQU A;  2JX8 A;  4TW6 A;  4C02 B;  3PRD A;  1QPF A;  2KE0 A;  4DRN A;  5I98 A;  1F8A B;  1WMV A;  4W9Q A;  2K8I A;  2AWG A;  1P5Q A;  3CGM A;  3KAH A;  1ZCN A;  2ZR4 A;  3CGN A;  4W9O A;  2YSH A;  3O5L A;  5HWC A;  3WH0 A;  4ODM A;  4QT3 A;  1QZ2 A;  3UQA A;  2JV4 A;  2M8J A;  4TYO A;  5HWB A;  3H9R B;  4DRP A;  4TW7 A;  2VN1 A;  3I6C A;  1EG3 A;  1FKF A;  1YAT A;  4GGQ A;  3CNG A;  3TC5 A;  4LAW A;  1FKT A;  1D6O A;  2Q5A A;  3O5J A;  3MDY B;  4QIB A;  5HT1 A;  4DRM A;  4LAX A;  3O5K A;  2KO7 A;  4DT4 A;  1F40 A;  2RUD A;  3RFW A;  3RGC A;  2DWV A;  5CQ2 A;  4ODQ A;  2KR7 A;  1PBK A;  4ODP A;  2PPO A;  3NRK A;  3ODK A;  3O5I A;  3M85 A;  1FKD A;  4ODR A;  5HW8 A;  4QT2 A;  2RE3 A;  1J4R A;  2XP7 A;  2ZAJ A;  4N19 A;  4E5R A;  5HUA A;  2M08 A;  2E45 A;  2M8I A;  3KAC A;  4ITZ A;  3KAG A;  2YSI A;  1D7I A;  1JNT A;  1D7J A;  2YSB A;  5AHT A;  2L4J A;  2BA1 A;  2KFW A;  1J4H A;  5DIV A;  4DRQ A;  1EG4 A;  1FKS A;  2Y78 A;  3KZ7 A;  4LAV A;  2ZQV A;  4JFK A;  2JXW A;  2UZ5 A;  2PV2 A;  4DRH A;  3KCE A;  2XP8 A;  4JYS A;  4MGV A;  3UF8 A;  5HW7 A;  1NMW A;  1N1A A;  3O5G A;  3O5D A;  3IHZ A;  2MPH A;  2RUQ A;  3O5Q A;  3EY6 A;  2JMF A;  3KAI A;  1EYM A;  1FKI A;  1A7X A;  4DRI A;  5HW6 A;  4DH0 A;  4FAP A;  1WR7 A;  4ODN A;  2L2S A;  2M2A A;  1ROT A;  1B6C A;  3B7X A;  2IF4 A;  1FKH A;  4R0X A;  2MF9 A;  1BKF A;  1FKB A;  3UQB A;  4ODL A;  2YSG A;  3FAP A;  4DZ3 A;  2PV1 A;  1QPL A;  4JFL A;  3PA7 A;  3L4H A;  1FKK A;  4ODO A;  4ODK A;  5GPG A;  2D9F A;  3NI6 A;  4GIV A;  2VCD A;  2MNT A;  1FKG A;  4U86 A;  2DK7 A;  5HTG A;  2M3O W;  1FJD A;  1NSG A;  2RUR A;  3KAD A;  4FN2 A;  1YW5 A;  1R9H A;  2PBC A;  1U79 A;  5B8I C;  4MSP A;  1JVW A;  4G50 A;  3NTP A;  1TCO C;  1J4I A;  3KAF A;  3O5M A;  1Q1C A;  2RSE A;  4JFI A;  4NNR A;  2OFN A;  5D75 A;  1PIN A;  2PPN A;  4JFJ A;  2MLY A;  4W9P A;  2DG9 A;  3TDB A;  2F2D A;  2LGO A;  1J6Y A;  2ZQT A;  1JMQ A;  4LAY A;  3OOB A;  4DRJ A;  1W26 A;  3JXV A;  2F21 A;  4DRK A;  2XP4 A;  2N87 A;  3JYM A;  1ZK6 A;  2YSF A;  1EQ3 A;  1C9H A;  2FAP A;  2MLZ A;  2XP5 A;  1HXV A;  4J4O A;  2MLX A;  2RQS A;  2ZQS A;  3TCZ A;  1ROU A;  5BXJ A;  1M5Y A;  2DMV A;  1D7H A;  2DG4 A;  4U84 A;  3PRB A;  3M7N A;  2ITK A;  3O5R A;  2XPB A;  1FKR A;  4IQC A;  4REX A;  1FKL A;  1T11 A;  4DZ2 A;  3GPK A;  2ZR6 A;  3UI5 A;  2F4E A;  1Q6H A;  1K9Q A;  2ZR5 A;  2LKN A;  1Q6U A;  2XP3 A;  1FKJ A;  5J6E A;  4DIP A;  2PPP A;  4BF8 A;  1NMV A;  4TW8 A;  2LJ4 A;  1BL4 A;  4TNS A;  4G2P A;  4IPX A;  1FAP A;  4TX0 A;  2XP6 A;  2FKE A;  4JFM A;  2XPA A;  2LPV A;  3IK8 A;  5HKG A;  1Q6I A;  2XP9 A;  3O5P A;  1FD9 A;  3O5E A;  2DG3 A;  2DJY A;  4J4N A;  3VAW A;  3LUO A;  3IKG A;  3UI6 A;  2M1I A;  1KT1 A;  4U85 A;  4DRO A;  1KT0 A;  1JNS A;  5DIT A;  2JZV A;  1O6W A;  2LAJ A;  3LE4 A;  2RUC A;  3IKD A;  5DIU A;  1K9R A;  2KI3 A;  1TK7 A;  2EZ5 W;  4O2T A;  1Y0O A;  1I5H W;  2PV3 A; 
#chains in the Genus database with same CATH topology
 1X6N A;  3UI4 A;  2ETN A;  3O5F A;  1E9L A;  2KGJ A;  3O5O A;  2MDI A;  4KR0 B;  1W1P A;  1RP5 A;  4IQ2 A;  2DK1 A;  3UQI A;  2KXQ A;  4Z2K A;  3JYJ A;  3KAB A;  2OLH A;  4MPK A;  1L1P A;  2ZQU A;  2OWO A;  1HJW A;  2JX8 A;  4TW6 A;  1HKK A;  4C02 B;  3PRD A;  1ZB5 A;  1QPF A;  2DT2 A;  1WAW A;  2KE0 A;  4DRN A;  2YBT A;  3MCB A;  1F8A B;  5I98 A;  1WMV A;  1ZBV A;  4W9Q A;  1XHG A;  2K8I A;  2WK2 A;  2AWG A;  4Z2G A;  1E6R A;  1P5Q A;  3CGM A;  3KAH A;  1ZCN A;  2ZR4 A;  1FFQ A;  3CGN A;  4W9O A;  2YSH A;  3O5L A;  5HWC A;  4HBE A;  3WH0 A;  1ITX A;  4ODM A;  3ALF A;  3AS2 A;  4QT3 A;  3RM4 A;  1QZ2 A;  3UQA A;  1TR8 A;  1W1T A;  2JV4 A;  2M8J A;  2DSW A;  3PR9 A;  3QOK A;  4TYO A;  5GQB A;  5HWB A;  3H9R B;  4DRP A;  4TW7 A;  2VN1 A;  2A3C A;  3I6C A;  1EG3 A;  2WLY A;  1FKF A;  1X6L A;  1YAT A;  4GGQ A;  3CNG A;  3TC5 A;  4LAW A;  4WIW A;  1FKT A;  1D6O A;  2Q5A A;  1E6P A;  3O5J A;  3MDY B;  2A3B A;  4WKF A;  4QIB A;  2DT3 A;  5HT1 A;  4DRM A;  4LAX A;  1GOI A;  1OGB A;  3O5K A;  2KO7 A;  4IT4 A;  4NSB A;  4DT4 A;  1F40 A;  2RUD A;  3RFW A;  4WJX A;  3RGC A;  2DWV A;  5DF0 A;  5CQ2 A;  2YBU A;  4ODQ A;  2KR7 A;  1PBK A;  3FY1 A;  2PI6 A;  1NH6 A;  4ODP A;  2PPO A;  3NRK A;  3ODK A;  2DSV A;  3ARZ A;  1E15 A;  3O5I A;  3M85 A;  5E65 A;  1FKD A;  4ODR A;  1ZBW A;  5HW8 A;  4XAK A;  4QT2 A;  1UR9 A;  4P8V A;  2RE3 A;  1J4R A;  2B5U B;  2AOS A;  2XP7 A;  1HJV A;  2O9O A;  3CHF A;  2ZAJ A;  3CHD A;  4N19 A;  4E5R A;  5HUA A;  2M08 A;  2E45 A;  2M8I A;  3KAC A;  2WAD A;  3WD4 A;  4ITZ A;  4GLX A;  4PTM A;  1OWQ A;  3KAG A;  1E44 A;  3FSB A;  2YSI A;  1LG1 A;  4MNK A;  1D7I A;  1JNT A;  1D7J A;  2YSB A;  1HKI A;  5AHT A;  1E6Z A;  2L4J A;  3WIJ A;  2BA1 A;  4WKA A;  2EUL A;  2KFW A;  1J4H A;  3B9E A;  2PN0 A;  4ZS6 A;  1NWU A;  1WB0 A;  5DIV A;  4DRQ A;  4MAV A;  5U47 A;  2QF8 A;  1EG4 A;  1ZBC A;  1FKS A;  4LGX A;  2A3A A;  3LKX B;  4A0T A;  2Y78 A;  3KZ7 A;  4LAV A;  2ZQV A;  4JFK A;  2JXW A;  2FDM A;  2UZ5 A;  2PV2 A;  1LQ0 A;  4DRH A;  4Z2I A;  3PQH A;  3KCE A;  1JND A;  2XP8 A;  1NWS A;  4JYS A;  4KQZ A;  5E64 A;  4MGV A;  4DWS C;  3UF8 A;  3MQH A;  2G41 A;  5HW7 A;  1NMW A;  1W9P A;  1N1A A;  3FS8 A;  1OGG A;  3O5G A;  3O5D A;  2DSZ A;  3ARP A;  1W1V A;  3IHZ A;  2MPH A;  2RUQ A;  3O5Q A;  3EY6 A;  1KFW A;  2JMF A;  3KAI A;  4Z2J A;  1EYM A;  1FKI A;  1A7X A;  2O92 A;  4DRI A;  5HW6 A;  4DH0 A;  4FAP A;  1WR7 A;  4DWS B;  3WL0 A;  4ODN A;  1FLC A;  2L2S A;  2M2A A;  1ROT A;  1B6C A;  3ARS A;  4QZV B;  3WL1 A;  1CTN A;  1W9U A;  3B7X A;  2IF4 A;  2ESC A;  4UDM A;  1UR8 A;  1FKH A;  3CHC A;  2MF9 A;  1BKF A;  4R0X A;  1FKB A;  3UQB A;  1GPF A;  2A3E A;  3CHE A;  3BMB A;  4ODL A;  4AY1 A;  2YSG A;  3FAP A;  4MNM A;  4DZ3 A;  2PV1 A;  1QPL A;  4JFL A;  3PA7 A;  2QRV A;  3L4H A;  5JH8 A;  2Y8N B;  1FKK A;  3ART A;  1GRJ A;  4ODO A;  4ODK A;  5GPG A;  2D9F A;  3NI6 A;  4GIV A;  3WQW A;  2VCD A;  2MNT A;  4ZPW R;  1FKG A;  4U86 A;  4HAR A;  2DK7 A;  3W4R A;  5HTG A;  2M3O W;  1FJD A;  1NSG A;  2RUR A;  4S3K A;  3KAD A;  1WNO A;  4P8U A;  3GU0 A;  3FSC A;  4A0U A;  1VF8 A;  4FN2 A;  1YW5 A;  1R9H A;  2G8Z A;  2PBC A;  1RD6 A;  1U79 A;  3ARR A;  2B31 A;  5B8I C;  4MSP A;  1JVW A;  3B9D A;  4G50 A;  3NTP A;  1TCO C;  1J4I A;  3LKX A;  4P8W A;  3WQV A;  1HKJ A;  3KAF A;  3O5M A;  4MNJ A;  1K9T A;  1Q1C A;  2DT0 A;  3WD2 A;  2RSE A;  4JFI A;  4NNR A;  2OFN A;  5D75 A;  1PIN A;  2YAJ B;  2DPE A;  2PPN A;  4JFJ A;  2MLY A;  4W9P A;  2DG9 A;  4HBO A;  3TDB A;  2F2D A;  2LGO A;  3WD0 A;  1J6Y A;  2ZQT A;  3WD3 A;  1JMQ A;  4LAY A;  1H0I A;  3ARX A;  3OOB A;  1NWT A;  1E6N A;  4DRJ A;  1ZL1 A;  5E5W A;  1W26 A;  3BXW A;  1JCH B;  3JXV A;  2F21 A;  5E66 A;  1JNE A;  2WLZ A;  4IT6 A;  4DWS A;  1ZU8 A;  4ZPT R;  4DRK A;  4Q22 A;  1FFR A;  2XP4 A;  2N87 A;  3JYM A;  2DSU A;  1ZK6 A;  2YSF A;  1EQ3 A;  1C9H A;  2FAP A;  1LG2 A;  2MLZ A;  2XP5 A;  3MQG A;  1HXV A;  4J4O A;  1SYT A;  3RME A;  2MLX A;  2RQS A;  4WK9 A;  2ZQS A;  3TCZ A;  1ROU A;  2P4V A;  5BXJ A;  1M5Y A;  3AQU A;  1EHN A;  5DEZ A;  2DMV A;  1D7H A;  4DWS D;  2DG4 A;  3ARW A;  4U84 A;  3ARU A;  3M7N A;  2ITK A;  3PRB A;  4NZC A;  3O5R A;  2XPB A;  1FKR A;  4IQC A;  4W5U A;  4REX A;  1FKL A;  1T11 A;  4DZ2 A;  3GPK A;  3EIP A;  2ZR6 A;  3OA5 A;  4ML4 A;  3UI5 A;  3RM9 A;  1HJX A;  2F4E A;  1TFV A;  1Q6H A;  3WD1 A;  1K9Q A;  2ZR5 A;  2LKN A;  3ARV A;  1Q6U A;  3B9A A;  2XP3 A;  1FKJ A;  1LL7 A;  2DT1 A;  1W9V A;  5J6E A;  4DIP A;  2PPP A;  4BF8 A;  1NMV A;  4L72 B;  4S3J A;  1LL6 A;  5HBF A;  4TW8 A;  1IX5 A;  2LJ4 A;  4WKH A;  1BL4 A;  4TNS A;  1O6I A;  4G2P A;  3PRA A;  4Z2H A;  4IPX A;  1FAP A;  3MCB B;  4TX0 A;  3G6L A;  4P8X A;  2XP6 A;  2FKE A;  2F23 A;  4JFM A;  5E62 A;  2XPA A;  4L3N A;  4Z2L A;  2LPV A;  3IK8 A;  1LL4 A;  5HKG A;  1Q6I A;  2XP9 A;  1XRV A;  3O5P A;  1EIB A;  1FD9 A;  5GPR A;  3AS1 A;  3GTY X;  3O5E A;  3ARO A;  2DG3 A;  4MNL A;  2DJY A;  3WKZ A;  4J4N A;  1H0G A;  3VAW A;  1NWR A;  3LUO A;  3IKG A;  4MTV A;  3UI6 A;  3FXY A;  2M1I A;  1LJY A;  3RM8 A;  5DO2 A;  1KT1 A;  4U85 A;  4DRO A;  2WAE A;  4URI A;  1KT0 A;  4Q7N A;  4R5E A;  1JNS A;  5DIT A;  3ALG A;  2JZV A;  1O6W A;  2LAJ A;  1D2K A;  3ARY A;  3LE4 A;  2RUC A;  4ZPV R;  3IKD A;  3ARQ A;  5DIU A;  1ZBK A;  1W1Y A;  1K9R A;  2WM0 A;  2KI3 A;  1TK7 A;  3CH9 A;  1GUV A;  1EDQ A;  3CZ8 A;  2EZ5 W;  1HKM A;  4O2T A;  3B8S A;  2IUZ A;  1Y0O A;  3AS3 A;  3G6M A;  1I5H W;  1SR0 A;  2PV3 A;  3AS0 A; 
#chains in the Genus database with same CATH homology
 1X6N A;  3UI4 A;  3O5F A;  1E9L A;  2KGJ A;  3O5O A;  2MDI A;  4KR0 B;  1W1P A;  1RP5 A;  4IQ2 A;  2DK1 A;  3UQI A;  2KXQ A;  4Z2K A;  3JYJ A;  3KAB A;  2OLH A;  4MPK A;  1L1P A;  2ZQU A;  2OWO A;  1HJW A;  2JX8 A;  4TW6 A;  1HKK A;  4C02 B;  3PRD A;  1ZB5 A;  1QPF A;  2DT2 A;  1WAW A;  2KE0 A;  4DRN A;  2YBT A;  3MCB A;  1F8A B;  5I98 A;  1WMV A;  1ZBV A;  4W9Q A;  1XHG A;  2K8I A;  2WK2 A;  2AWG A;  4Z2G A;  1E6R A;  1P5Q A;  3CGM A;  3KAH A;  1ZCN A;  2ZR4 A;  1FFQ A;  3CGN A;  4W9O A;  2YSH A;  3O5L A;  5HWC A;  4HBE A;  3WH0 A;  1ITX A;  4ODM A;  3ALF A;  3AS2 A;  4QT3 A;  3RM4 A;  1QZ2 A;  3UQA A;  1TR8 A;  1W1T A;  2JV4 A;  2M8J A;  2DSW A;  3PR9 A;  3QOK A;  4TYO A;  5GQB A;  5HWB A;  3H9R B;  4DRP A;  4TW7 A;  2VN1 A;  2A3C A;  3I6C A;  1EG3 A;  2WLY A;  1FKF A;  1X6L A;  1YAT A;  4GGQ A;  3CNG A;  3TC5 A;  4LAW A;  4WIW A;  1FKT A;  1D6O A;  2Q5A A;  1E6P A;  3O5J A;  3MDY B;  2A3B A;  4WKF A;  4QIB A;  2DT3 A;  5HT1 A;  4DRM A;  4LAX A;  1GOI A;  1OGB A;  3O5K A;  2KO7 A;  4IT4 A;  4NSB A;  4DT4 A;  1F40 A;  2RUD A;  3RFW A;  4WJX A;  3RGC A;  2DWV A;  5DF0 A;  5CQ2 A;  2YBU A;  4ODQ A;  2KR7 A;  1PBK A;  3FY1 A;  2PI6 A;  1NH6 A;  4ODP A;  2PPO A;  3NRK A;  3ODK A;  2DSV A;  3ARZ A;  1E15 A;  3O5I A;  3M85 A;  5E65 A;  1FKD A;  4ODR A;  1ZBW A;  5HW8 A;  4XAK A;  4QT2 A;  1UR9 A;  4P8V A;  2RE3 A;  1J4R A;  2AOS A;  2XP7 A;  1HJV A;  2O9O A;  3CHF A;  2ZAJ A;  3CHD A;  4N19 A;  4E5R A;  5HUA A;  2M08 A;  2E45 A;  2M8I A;  3KAC A;  2WAD A;  3WD4 A;  4ITZ A;  4GLX A;  4PTM A;  1OWQ A;  3KAG A;  3FSB A;  2YSI A;  1LG1 A;  4MNK A;  1D7I A;  1JNT A;  1D7J A;  2YSB A;  1HKI A;  5AHT A;  1E6Z A;  2L4J A;  3WIJ A;  2BA1 A;  4WKA A;  2KFW A;  1J4H A;  3B9E A;  4ZS6 A;  1NWU A;  1WB0 A;  5DIV A;  4DRQ A;  4MAV A;  5U47 A;  2QF8 A;  1EG4 A;  1ZBC A;  1FKS A;  4LGX A;  2A3A A;  3LKX B;  4A0T A;  2Y78 A;  3KZ7 A;  4LAV A;  2ZQV A;  4JFK A;  2JXW A;  2FDM A;  2UZ5 A;  2PV2 A;  1LQ0 A;  4DRH A;  4Z2I A;  3PQH A;  3KCE A;  1JND A;  2XP8 A;  1NWS A;  4JYS A;  4KQZ A;  5E64 A;  4MGV A;  4DWS C;  3UF8 A;  3MQH A;  2G41 A;  5HW7 A;  1NMW A;  1W9P A;  1N1A A;  3FS8 A;  1OGG A;  3O5G A;  3O5D A;  2DSZ A;  3ARP A;  1W1V A;  3IHZ A;  2MPH A;  2RUQ A;  3O5Q A;  3EY6 A;  1KFW A;  2JMF A;  3KAI A;  4Z2J A;  1EYM A;  1FKI A;  1A7X A;  2O92 A;  4DRI A;  5HW6 A;  4DH0 A;  4FAP A;  1WR7 A;  4DWS B;  3WL0 A;  4ODN A;  1FLC A;  2L2S A;  2M2A A;  1ROT A;  1B6C A;  3ARS A;  4QZV B;  3WL1 A;  1CTN A;  1W9U A;  3B7X A;  2IF4 A;  2ESC A;  1UR8 A;  1FKH A;  3CHC A;  2MF9 A;  1BKF A;  4R0X A;  1FKB A;  3UQB A;  1GPF A;  2A3E A;  3CHE A;  4ODL A;  4AY1 A;  2YSG A;  3FAP A;  4MNM A;  4DZ3 A;  2PV1 A;  1QPL A;  4JFL A;  3PA7 A;  2QRV A;  3L4H A;  5JH8 A;  2Y8N B;  1FKK A;  3ART A;  4ODO A;  4ODK A;  5GPG A;  2D9F A;  3NI6 A;  4GIV A;  3WQW A;  2VCD A;  2MNT A;  4ZPW R;  1FKG A;  4U86 A;  4HAR A;  2DK7 A;  3W4R A;  5HTG A;  2M3O W;  1FJD A;  1NSG A;  2RUR A;  4S3K A;  3KAD A;  1WNO A;  4P8U A;  3FSC A;  4A0U A;  1VF8 A;  4FN2 A;  1YW5 A;  1R9H A;  2G8Z A;  2PBC A;  1RD6 A;  1U79 A;  3ARR A;  2B31 A;  5B8I C;  4MSP A;  1JVW A;  3B9D A;  4G50 A;  3NTP A;  1TCO C;  1J4I A;  3LKX A;  4P8W A;  3WQV A;  1HKJ A;  3KAF A;  3O5M A;  4MNJ A;  1K9T A;  1Q1C A;  2DT0 A;  3WD2 A;  2RSE A;  4JFI A;  4NNR A;  2OFN A;  5D75 A;  1PIN A;  2YAJ B;  2DPE A;  2PPN A;  4JFJ A;  2MLY A;  4W9P A;  2DG9 A;  4HBO A;  3TDB A;  2F2D A;  2LGO A;  3WD0 A;  1J6Y A;  2ZQT A;  3WD3 A;  1JMQ A;  4LAY A;  1H0I A;  3ARX A;  3OOB A;  1NWT A;  1E6N A;  4DRJ A;  1ZL1 A;  5E5W A;  1W26 A;  3BXW A;  3JXV A;  2F21 A;  5E66 A;  1JNE A;  2WLZ A;  4IT6 A;  4DWS A;  1ZU8 A;  4ZPT R;  4DRK A;  4Q22 A;  1FFR A;  2XP4 A;  2N87 A;  3JYM A;  2DSU A;  1ZK6 A;  2YSF A;  1EQ3 A;  1C9H A;  2FAP A;  1LG2 A;  2MLZ A;  2XP5 A;  3MQG A;  1HXV A;  4J4O A;  1SYT A;  3RME A;  2MLX A;  2RQS A;  4WK9 A;  2ZQS A;  3TCZ A;  1ROU A;  5BXJ A;  1M5Y A;  3AQU A;  1EHN A;  5DEZ A;  2DMV A;  1D7H A;  4DWS D;  2DG4 A;  3ARW A;  4U84 A;  3ARU A;  3M7N A;  2ITK A;  3PRB A;  4NZC A;  3O5R A;  2XPB A;  1FKR A;  4IQC A;  4W5U A;  4REX A;  1FKL A;  1T11 A;  4DZ2 A;  3GPK A;  2ZR6 A;  3OA5 A;  4ML4 A;  3UI5 A;  3RM9 A;  1HJX A;  2F4E A;  1TFV A;  1Q6H A;  3WD1 A;  1K9Q A;  2ZR5 A;  2LKN A;  3ARV A;  1Q6U A;  3B9A A;  2XP3 A;  1FKJ A;  1LL7 A;  2DT1 A;  1W9V A;  5J6E A;  4DIP A;  2PPP A;  4BF8 A;  1NMV A;  4L72 B;  4S3J A;  1LL6 A;  5HBF A;  4TW8 A;  1IX5 A;  2LJ4 A;  4WKH A;  1BL4 A;  4TNS A;  1O6I A;  4G2P A;  3PRA A;  4Z2H A;  4IPX A;  1FAP A;  3MCB B;  4TX0 A;  3G6L A;  4P8X A;  2XP6 A;  2FKE A;  4JFM A;  5E62 A;  2XPA A;  4L3N A;  4Z2L A;  2LPV A;  3IK8 A;  1LL4 A;  5HKG A;  1Q6I A;  2XP9 A;  1XRV A;  3O5P A;  1EIB A;  1FD9 A;  5GPR A;  3AS1 A;  3O5E A;  3ARO A;  2DG3 A;  4MNL A;  2DJY A;  3WKZ A;  4J4N A;  1H0G A;  3VAW A;  1NWR A;  3LUO A;  3IKG A;  4MTV A;  3UI6 A;  3FXY A;  2M1I A;  1LJY A;  3RM8 A;  5DO2 A;  1KT1 A;  4U85 A;  4DRO A;  2WAE A;  4URI A;  1KT0 A;  4Q7N A;  4R5E A;  1JNS A;  5DIT A;  3ALG A;  2JZV A;  1O6W A;  2LAJ A;  1D2K A;  3ARY A;  3LE4 A;  2RUC A;  4ZPV R;  3IKD A;  3ARQ A;  5DIU A;  1ZBK A;  1W1Y A;  1K9R A;  2WM0 A;  2KI3 A;  1TK7 A;  3CH9 A;  1GUV A;  1EDQ A;  3CZ8 A;  2EZ5 W;  1HKM A;  4O2T A;  3B8S A;  2IUZ A;  1Y0O A;  3AS3 A;  3G6M A;  1I5H W;  1SR0 A;  2PV3 A;  3AS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...