3KCEA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
146
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 44
structure length 146
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kceA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kceA02
4ODLA 1FKFA 4IPXA 2Q5AA 4DRKA 4DZ3A 4DROA 1BL4A 2XP6A 3MDYB 3O5OA 1P5QA 3TC5A 2RSEA 1D6OA 2ZQTA 5I98A 3O5EA 1I5HW 1YW5A 4U85A 4G50A 4LAVA 5HUAA 2RUCA 2F21A 3EY6A 3B7XA 1KT0A 4DIPA 4ODOA 1N1AA 1TCOC 1NMWA 3UQBA 4J4OA 3NTPA 2LPVA 3KZ7A 3NI6A 1WR7A 3M7NA 1JVWA 3OOBA 1Q6IA 2Y78A 2ZR6A 2XP7A 4W9QA 2YSFA 4FAPA 5B8IC 3KAHA 4ODKA 4JYSA 1FKIA 3IKDA 4J4NA 1FAPA 4ODPA 1B6CA 1WMVA 2RURA 4TX0A 1BKFA 2M8IA 5BXJA 2ZQSA 2XP3A 4LAXA 1W26A 4NNRA 2AWGA 1FJDA 5HKGA 1FKRA 1J6YA 3KADA 4QIBA 2E45A 1J4HA 3O5GA 4DRQA 3PRDA 3O5PA 4TW7A 3KAGA 4MGVA 2ITKA 1M5YA 1J4RA 1PINA 3CGNA 3O5FA 2KO7A 3O5KA 1FKKA 4W9PA 3UI4A 4FN2A 4DRJA 2MLYA 3KACA 3O5RA 1NSGA 2ZR5A 3PA7A 2UZ5A 1QPLA 1ROUA 2RQSA 1JNSA 3JYMA 1YATA 3IHZA 3IKGA 1FKBA 2LGOA 2F4EA 2DG3A 1ROTA 2FAPA 4DRMA 3I6CA 2XPAA 5HW6A 2MDIA 1FD9A 3O5LA 2PPNA 3CNGA 2DG9A 2VCDA 5DITA 3NRKA 4E5RA 1D7HA 3JYJA 4QT2A 3O5DA 3L4HA 2XP4A 4DRHA 1F40A 2OFNA 3KABA 2PV3A 1NMVA 4DT4A 2KXQA 1L1PA 1T11A 1FKDA 3KAIA 5AHTA 2BA1A 2DG4A 2LAJA 2RE3A 4JFIA 2XP8A 2K8IA 3O5JA 4QT3A 4R0XA 3UQAA 3O5IA 1O6WA 2PV2A 4ODMA 2MLZA 5HTGA 2YSGA 4MSPA 3O5QA 2KR7A 2YSBA 5HW7A 2DMVA 4LAYA 2KI3A 1D7JA 1U79A 4BF8A 4JFJA 4ODQA 5D75A 2VN1A 4ODNA 2N87A 4N19A 3UI5A 3VAWA 2MNTA 3CGMA 3FAPA 4IQCA 3LE4A 1FKSA 1EG4A 1J4IA 2DJYA 1R9HA 4G2PA 1TK7A 2FKEA 2DK7A 1Q1CA 1QPFA 4IQ2A 2L2SA 3H9RB 5HT1A 1HXVA 4ITZA 2XP9A 3KAFA 2PBCA 5DIVA 4JFMA 2M3OW 5GPGA 4GGQA 3TCZA 2PV1A 1K9RA 3KCEA 2JMFA 2XP5A 1Q6UA 4C02B 2ZQUA 5CQ2A 5J6EA 1F8AB 4LAWA 4DRIA 4TW6A 2ZAJA 4JFLA 3UQIA 2RUDA 4ODRA 3ODKA 1EYMA 2M1IA 4U86A 2JV4A 2PPOA 2MPHA 1JMQA 1FKLA 4DRNA 2MLXA 3JXVA 2M08A 2MF9A 2RUQA 1ZK6A 2ZQVA 1FKJA 2LKNA 1EG3A 2EZ5W 2KGJA 1QZ2A 1K9QA 4GIVA 2M8JA 1Y0OA 2JX8A 2JXWA 3GPKA 3WH0A 2M2AA 2PPPA 2D9FA 3UI6A 2LJ4A 5DIUA 4JFKA 1FKHA 2KFWA 3IK8A 4TYOA 4DZ2A 5HW8A 1C9HA 2F2DA 1D7IA 1FKTA 4TW8A 2IF4A 2KE0A 2DWVA 3M85A 1KT1A 2ZR4A 3O5MA 5HWCA 3UF8A 1Q6HA 3TDBA 4DRPA 4TNSA 4W9OA 5HWBA 1JNTA 4O2TA 3RFWA 2YSHA 2XPBA 3RGCA 1ZCNA 1A7XA 4REXA 1PBKA 4DH0A 2L4JA 1FKGA 1EQ3A 4U84A 2YSIA 3LUOA 2DK1A 3PRBA 2JZVA
chains in the Genus database with same CATH superfamily
4ODLA 1FKFA 4S3KA 4IPXA 2Q5AA 4DRKA 4DZ3A 3WD0A 4DROA 1BL4A 1RD6A 2XP6A 3MDYB 3RM8A 3O5OA 1P5QA 1X6NA 3TC5A 4ZS6A 2RSEA 1D6OA 2ZQTA 5I98A 1GRJA 3O5EA 1I5HW 3PRAA 1KFWA 1YW5A 3ARUA 4ZPVR 2EULA 1W1VA 3AS3A 3BXWA 4U85A 4G50A 4LAVA 2O9OA 2RUCA 2F21A 5HUAA 3EY6A 1FLCA 2DSUA 3ALGA 3B7XA 1TFVA 1KT0A 4Q22A 4DIPA 4ODOA 1N1AA 2DSWA 1TCOC 1NMWA 3UQBA 4J4OA 1HJVA 1W1TA 1ZL1A 1XHGA 3RMEA 2G8ZA 3NTPA 5U47A 1LJYA 4KQZA 2LPVA 3KZ7A 3NI6A 1WR7A 3M7NA 1JVWA 3OOBA 1Q6IA 4LGXA 2Y78A 2ZR6A 1GUVA 1CTNA 2XP7A 3WL0A 3WQVA 4W9QA 2YSFA 1JNEA 1HKMA 4Q7NA 4FAPA 5B8IC 3KAHA 4ODKA 4JYSA 3MQHA 3RM9A 1FKIA 4MNJA 4GLXA 2DT1A 1LG1A 3IKDA 4J4NA 1FAPA 1O6IA 2WLZA 4ODPA 1B6CA 1HKKA 1WMVA 1EHNA 1OGGA 2RURA 4TX0A 1BKFA 2M8IA 1JCHB 5BXJA 2ZQSA 2ETNA 2XP3A 4LAXA 1W26A 5GQBA 4NNRA 2AWGA 3BMBA 1FJDA 3OA5A 1NH6A 2WADA 4NZCA 5HKGA 1FKRA 4NSBA 3W4RA 1J6YA 4DWSB 3KADA 4DWSC 1SYTA 4QIBA 2E45A 2OWOA 1J4HA 3AS1A 3O5GA 4DRQA 3PRDA 3O5PA 1EIBA 1K9TA 4TW7A 4WJXA 3KAGA 2G41A 4MGVA 2ITKA 1M5YA 1J4RA 1PINA 3LKXA 2B31A 3CGNA 3O5FA 4Z2IA 2KO7A 3AROA 3CHCA 3O5KA 1FKKA 4L3NA 4MPKA 3AQUA 4W9PA 3UI4A 4P8WA 4FN2A 4DRJA 1GOIA 4MAVA 4AY1A 3WQWA 4HARA 3ALFA 2MLYA 3KACA 1HJWA 3O5RA 5GPRA 1NSGA 2ZR5A 3WD4A 3RM4A 1H0IA 4XAKA 3PA7A 2UZ5A 1QPLA 1ROUA 3B8SA 3FS8A 3WKZA 2RQSA 1E9LA 1JNSA 3JYMA 5DO2A 4WKFA 4HBEA 2YBUA 1LG2A 1YATA 3GU0A 2PN0A 3IHZA 3IKGA 4IT6A 1FKBA 2A3CA 2LGOA 3WD1A 2F4EA 1LL6A 3ARQA 2DG3A 1ROTA 4MNKA 2FAPA 4DRMA 1SR0A 3I6CA 2WM0A 2XPAA 5HW6A 3PQHA 1HJXA 2MDIA 1ZBCA 4WK9A 1FD9A 3O5LA 2PPNA 1E6RA 3MQGA 3CNGA 2DG9A 2VCDA 5DITA 3NRKA 3ARWA 4E5RA 1D7HA 3MCBA 3JYJA 4QZVB 4QT2A 1RP5A 3O5DA 4ZPWR 3L4HA 5E62A 4P8UA 2DPEA 4W5UA 2XP4A 4DRHA 4R5EA 1F40A 2OFNA 3KABA 1ZBVA 3ARSA 2PV3A 1EDQA 1OGBA 1NMVA 3CHEA 4DT4A 2KXQA 1L1PA 1T11A 1JNDA 1FKDA 2PI6A 3KAIA 5AHTA 2BA1A 2DG4A 2LAJA 2RE3A 4JFIA 3WD2A 2XP8A 2K8IA 1NWSA 3O5JA 4QT3A 5DF0A 3AS2A 4R0XA 3UQAA 4Z2KA 2O92A 1NWRA 4WIWA 3O5IA 1O6WA 3ARVA 3G6LA 2PV2A 1WAWA 1NWTA 4A0UA 4KR0B 5E5WA 4ODMA 4DWSD 2MLZA 5HTGA 3ARTA 3ARZA 4S3JA 2YSGA 4WKHA 3B9AA 1E6NA 3ARPA 4MSPA 3O5QA 3GTYX 2KR7A 4DWSA 2YSBA 5HW7A 1UR9A 2DSVA 2DMVA 4LAYA 2KI3A 5JH8A 1D7JA 1U79A 3G6MA 4BF8A 3AS0A 3FXYA 4JFJA 4ODQA 3FSBA 5D75A 1OWQA 2DT0A 1UR8A 4IT4A 3CHFA 2ESCA 1E6PA 2VN1A 1FFRA 4ODNA 2N87A 4N19A 1XRVA 2YBTA 1W1PA 3UI5A 3VAWA 3LKXB 2MNTA 3CGMA 3FAPA 4IQCA 3LE4A 1FKSA 1ITXA 2B5UB 1EG4A 1J4IA 2DJYA 1R9HA 1LQ0A 1TK7A 2FDMA 4G2PA 3CH9A 4P8VA 2FKEA 1X6LA 2DK7A 3PR9A 1Q1CA 1QPFA 4IQ2A 2L2SA 1E44A 3H9RB 1VF8A 1ZU8A 5HT1A 1ZBWA 1HXVA 4ITZA 2XP9A 5E64A 4URIA 3KAFA 2PBCA 3QOKA 5DIVA 4JFMA 2M3OW 1W9PA 4GGQA 5GPGA 3TCZA 2P4VA 2PV1A 1W1YA 2A3EA 3WD3A 1K9RA 3KCEA 2JMFA 2XP5A 1Q6UA 3EIPA 4C02B 3ARRA 4P8XA 4HBOA 2ZQUA 4Z2JA 5CQ2A 1ZBKA 5J6EA 1IX5A 2QF8A 1F8AB 1HKJA 4LAWA 2ZAJA 4JFLA 4TW6A 4DRIA 3UQIA 1FFQA 2RUDA 2A3BA 4Z2HA 3ODKA 4ODRA 4MTVA 1EYMA 4MNMA 2M1IA 4U86A 2DT2A 2JV4A 2WAEA 2Y8NB 1WNOA 2PPOA 4ZPTR 3MCBB 2MPHA 1JMQA 1TR8A 1NWUA 1FKLA 1WB0A 4DRNA 2MLXA 3JXVA 2M08A 3CZ8A 2DSZA 2MF9A 3ARYA 2RUQA 1ZK6A 4WKAA 2ZQVA 1FKJA 2LKNA 4UDMA 1EG3A 2EZ5W 2KGJA 1QZ2A 1K9QA 4GIVA 2M8JA 3WL1A 2WLYA 2DT3A 1Y0OA 2JX8A 2JXWA 3GPKA 3WH0A 2M2AA 2PPPA 5HBFA 4MNLA 2AOSA 5E66A 2QRVA 2D9FA 3UI6A 2LJ4A 1LL7A 5DIUA 4JFKA 1FKHA 2KFWA 3IK8A 4TYOA 4Z2LA 4L72B 2IUZA 4DZ2A 5HW8A 1C9HA 2F2DA 1D7IA 3FSCA 1FKTA 1D2KA 4ML4A 3B9DA 2OLHA 4TW8A 2IF4A 1E15A 2A3AA 4PTMA 2KE0A 2DWVA 1H0GA 3M85A 3CHDA 1KT1A 2ZR4A 3B9EA 1LL4A 3O5MA 5HWCA 1Q6HA 3UF8A 3TDBA 4DRPA 2YAJB 4TNSA 5E65A 4W9OA 5HWBA 1E6ZA 1JNTA 4O2TA 3RFWA 2YSHA 1W9UA 2XPBA 3FY1A 3RGCA 1ZCNA 1HKIA 1A7XA 5DEZA 1W9VA 2WK2A 1ZB5A 4REXA 1PBKA 4DH0A 2L4JA 1FKGA 3ARXA 2F23A 1EQ3A 4U84A 4Z2GA 2YSIA 3LUOA 2DK1A 3PRBA 2JZVA 1GPFA 3WIJA 4A0TA
chains in the Genus database with same CATH topology
4ODLA 1FKFA 4S3KA 4IPXA 2Q5AA 4DRKA 4DZ3A 3WD0A 4DROA 1BL4A 1RD6A 2XP6A 3MDYB 3RM8A 3O5OA 1P5QA 1X6NA 3TC5A 4ZS6A 2RSEA 1D6OA 2ZQTA 5I98A 3O5EA 1I5HW 3PRAA 1KFWA 1YW5A 3ARUA 4ZPVR 1W1VA 3AS3A 3BXWA 4U85A 4G50A 4LAVA 2O9OA 2RUCA 2F21A 5HUAA 3EY6A 1FLCA 2DSUA 3ALGA 3B7XA 1TFVA 1KT0A 4Q22A 4DIPA 4ODOA 1N1AA 2DSWA 1TCOC 1NMWA 3UQBA 4J4OA 1HJVA 1W1TA 1ZL1A 1XHGA 3RMEA 2G8ZA 3NTPA 5U47A 1LJYA 4KQZA 2LPVA 3KZ7A 3NI6A 1WR7A 3M7NA 1JVWA 3OOBA 1Q6IA 4LGXA 2Y78A 2ZR6A 1GUVA 1CTNA 2XP7A 3WL0A 3WQVA 4W9QA 2YSFA 1JNEA 1HKMA 4Q7NA 4FAPA 5B8IC 3KAHA 4ODKA 4JYSA 3MQHA 3RM9A 1FKIA 4MNJA 4GLXA 2DT1A 1LG1A 3IKDA 4J4NA 1FAPA 1O6IA 2WLZA 4ODPA 1B6CA 1HKKA 1WMVA 1EHNA 1OGGA 2RURA 4TX0A 1BKFA 2M8IA 5BXJA 2ZQSA 2XP3A 4LAXA 1W26A 5GQBA 4NNRA 2AWGA 1FJDA 3OA5A 1NH6A 2WADA 4NZCA 5HKGA 1FKRA 4NSBA 3W4RA 1J6YA 4DWSB 3KADA 4DWSC 1SYTA 4QIBA 2E45A 2OWOA 1J4HA 3AS1A 3O5GA 4DRQA 3PRDA 3O5PA 1EIBA 1K9TA 4TW7A 4WJXA 3KAGA 2G41A 4MGVA 2ITKA 1M5YA 1J4RA 1PINA 3LKXA 2B31A 3CGNA 3O5FA 4Z2IA 2KO7A 3AROA 3CHCA 3O5KA 1FKKA 4L3NA 4MPKA 3AQUA 4W9PA 3UI4A 4P8WA 4FN2A 4DRJA 1GOIA 4MAVA 4AY1A 3WQWA 4HARA 3ALFA 2MLYA 3KACA 1HJWA 3O5RA 5GPRA 1NSGA 2ZR5A 3WD4A 3RM4A 1H0IA 4XAKA 3PA7A 2UZ5A 1QPLA 1ROUA 3B8SA 3FS8A 3WKZA 2RQSA 1E9LA 1JNSA 3JYMA 5DO2A 4WKFA 4HBEA 2YBUA 1LG2A 1YATA 3IHZA 3IKGA 4IT6A 1FKBA 2A3CA 2LGOA 3WD1A 2F4EA 1LL6A 3ARQA 2DG3A 1ROTA 4MNKA 2FAPA 4DRMA 1SR0A 3I6CA 2WM0A 2XPAA 5HW6A 3PQHA 1HJXA 2MDIA 1ZBCA 4WK9A 1FD9A 3O5LA 2PPNA 1E6RA 3MQGA 3CNGA 2DG9A 2VCDA 5DITA 3NRKA 3ARWA 4E5RA 1D7HA 3MCBA 3JYJA 4QZVB 4QT2A 1RP5A 3O5DA 4ZPWR 3L4HA 5E62A 4P8UA 2DPEA 4W5UA 2XP4A 4DRHA 4R5EA 1F40A 2OFNA 3KABA 1ZBVA 3ARSA 2PV3A 1EDQA 1OGBA 1NMVA 3CHEA 4DT4A 2KXQA 1L1PA 1T11A 1JNDA 1FKDA 2PI6A 3KAIA 5AHTA 2BA1A 2DG4A 2LAJA 2RE3A 4JFIA 3WD2A 2XP8A 2K8IA 1NWSA 3O5JA 4QT3A 5DF0A 3AS2A 4R0XA 3UQAA 4Z2KA 2O92A 1NWRA 4WIWA 3O5IA 1O6WA 3ARVA 3G6LA 2PV2A 1WAWA 1NWTA 4A0UA 4KR0B 5E5WA 4ODMA 4DWSD 2MLZA 5HTGA 3ARTA 3ARZA 4S3JA 2YSGA 4WKHA 3B9AA 1E6NA 3ARPA 4MSPA 3O5QA 2KR7A 4DWSA 2YSBA 5HW7A 1UR9A 2DSVA 2DMVA 4LAYA 2KI3A 5JH8A 1D7JA 1U79A 3G6MA 4BF8A 3AS0A 3FXYA 4JFJA 4ODQA 3FSBA 5D75A 1OWQA 2DT0A 1UR8A 4IT4A 3CHFA 2ESCA 1E6PA 2VN1A 1FFRA 4ODNA 2N87A 4N19A 1XRVA 2YBTA 1W1PA 3UI5A 3VAWA 3LKXB 2MNTA 3CGMA 3FAPA 4IQCA 3LE4A 1FKSA 1ITXA 1EG4A 1J4IA 2DJYA 1R9HA 1LQ0A 1TK7A 2FDMA 4G2PA 3CH9A 4P8VA 2FKEA 1X6LA 2DK7A 3PR9A 1Q1CA 1QPFA 4IQ2A 2L2SA 3H9RB 1VF8A 1ZU8A 5HT1A 1ZBWA 1HXVA 4ITZA 2XP9A 5E64A 4URIA 3KAFA 2PBCA 3QOKA 5DIVA 4JFMA 2M3OW 1W9PA 4GGQA 5GPGA 3TCZA 2PV1A 1W1YA 2A3EA 3WD3A 1K9RA 3KCEA 2JMFA 2XP5A 1Q6UA 4C02B 3ARRA 4P8XA 4HBOA 2ZQUA 4Z2JA 5CQ2A 1ZBKA 5J6EA 1IX5A 2QF8A 1F8AB 1HKJA 4LAWA 2ZAJA 4JFLA 4TW6A 4DRIA 3UQIA 1FFQA 2RUDA 2A3BA 4Z2HA 3ODKA 4ODRA 4MTVA 1EYMA 4MNMA 2M1IA 4U86A 2DT2A 2JV4A 2WAEA 2Y8NB 1WNOA 2PPOA 4ZPTR 3MCBB 2MPHA 1JMQA 1TR8A 1NWUA 1FKLA 1WB0A 4DRNA 2MLXA 3JXVA 2M08A 3CZ8A 2DSZA 2MF9A 3ARYA 2RUQA 1ZK6A 4WKAA 2ZQVA 1FKJA 2LKNA 1EG3A 2EZ5W 2KGJA 1QZ2A 1K9QA 4GIVA 2M8JA 3WL1A 2WLYA 2DT3A 1Y0OA 2JX8A 2JXWA 3GPKA 3WH0A 2M2AA 2PPPA 5HBFA 4MNLA 2AOSA 5E66A 2QRVA 2D9FA 3UI6A 2LJ4A 1LL7A 5DIUA 4JFKA 1FKHA 2KFWA 3IK8A 4TYOA 4Z2LA 4L72B 2IUZA 4DZ2A 5HW8A 1C9HA 2F2DA 1D7IA 3FSCA 1FKTA 1D2KA 4ML4A 3B9DA 2OLHA 4TW8A 2IF4A 1E15A 2A3AA 4PTMA 2KE0A 2DWVA 1H0GA 3M85A 3CHDA 1KT1A 2ZR4A 3B9EA 1LL4A 3O5MA 5HWCA 1Q6HA 3UF8A 3TDBA 4DRPA 2YAJB 4TNSA 5E65A 4W9OA 5HWBA 1E6ZA 1JNTA 4O2TA 3RFWA 2YSHA 1W9UA 2XPBA 3FY1A 3RGCA 1ZCNA 1HKIA 1A7XA 5DEZA 1W9VA 2WK2A 1ZB5A 4REXA 1PBKA 4DH0A 2L4JA 1FKGA 3ARXA 1EQ3A 4U84A 4Z2GA 2YSIA 3LUOA 2DK1A 3PRBA 2JZVA 1GPFA 3WIJA 4A0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODL A;  1FKF A;  4IPX A;  2Q5A A;  4DRK A;  4DZ3 A;  4DRO A;  1BL4 A;  2XP6 A;  3MDY B;  3O5O A;  1P5Q A;  3TC5 A;  2RSE A;  1D6O A;  2ZQT A;  5I98 A;  3O5E A;  1I5H W;  1YW5 A;  4U85 A;  4G50 A;  4LAV A;  5HUA A;  2RUC A;  2F21 A;  3EY6 A;  3B7X A;  1KT0 A;  4DIP A;  4ODO A;  1N1A A;  1TCO C;  1NMW A;  3UQB A;  4J4O A;  3NTP A;  2LPV A;  3KZ7 A;  3NI6 A;  1WR7 A;  3M7N A;  1JVW A;  3OOB A;  1Q6I A;  2Y78 A;  2ZR6 A;  2XP7 A;  4W9Q A;  2YSF A;  4FAP A;  5B8I C;  3KAH A;  4ODK A;  4JYS A;  1FKI A;  3IKD A;  4J4N A;  1FAP A;  4ODP A;  1B6C A;  1WMV A;  2RUR A;  4TX0 A;  1BKF A;  2M8I A;  5BXJ A;  2ZQS A;  2XP3 A;  4LAX A;  1W26 A;  4NNR A;  2AWG A;  1FJD A;  5HKG A;  1FKR A;  1J6Y A;  3KAD A;  4QIB A;  2E45 A;  1J4H A;  3O5G A;  4DRQ A;  3PRD A;  3O5P A;  4TW7 A;  3KAG A;  4MGV A;  2ITK A;  1M5Y A;  1J4R A;  1PIN A;  3CGN A;  3O5F A;  2KO7 A;  3O5K A;  1FKK A;  4W9P A;  3UI4 A;  4FN2 A;  4DRJ A;  2MLY A;  3KAC A;  3O5R A;  1NSG A;  2ZR5 A;  3PA7 A;  2UZ5 A;  1QPL A;  1ROU A;  2RQS A;  1JNS A;  3JYM A;  1YAT A;  3IHZ A;  3IKG A;  1FKB A;  2LGO A;  2F4E A;  2DG3 A;  1ROT A;  2FAP A;  4DRM A;  3I6C A;  2XPA A;  5HW6 A;  2MDI A;  1FD9 A;  3O5L A;  2PPN A;  3CNG A;  2DG9 A;  2VCD A;  5DIT A;  3NRK A;  4E5R A;  1D7H A;  3JYJ A;  4QT2 A;  3O5D A;  3L4H A;  2XP4 A;  4DRH A;  1F40 A;  2OFN A;  3KAB A;  2PV3 A;  1NMV A;  4DT4 A;  2KXQ A;  1L1P A;  1T11 A;  1FKD A;  3KAI A;  5AHT A;  2BA1 A;  2DG4 A;  2LAJ A;  2RE3 A;  4JFI A;  2XP8 A;  2K8I A;  3O5J A;  4QT3 A;  4R0X A;  3UQA A;  3O5I A;  1O6W A;  2PV2 A;  4ODM A;  2MLZ A;  5HTG A;  2YSG A;  4MSP A;  3O5Q A;  2KR7 A;  2YSB A;  5HW7 A;  2DMV A;  4LAY A;  2KI3 A;  1D7J A;  1U79 A;  4BF8 A;  4JFJ A;  4ODQ A;  5D75 A;  2VN1 A;  4ODN A;  2N87 A;  4N19 A;  3UI5 A;  3VAW A;  2MNT A;  3CGM A;  3FAP A;  4IQC A;  3LE4 A;  1FKS A;  1EG4 A;  1J4I A;  2DJY A;  1R9H A;  4G2P A;  1TK7 A;  2FKE A;  2DK7 A;  1Q1C A;  1QPF A;  4IQ2 A;  2L2S A;  3H9R B;  5HT1 A;  1HXV A;  4ITZ A;  2XP9 A;  3KAF A;  2PBC A;  5DIV A;  4JFM A;  2M3O W;  5GPG A;  4GGQ A;  3TCZ A;  2PV1 A;  1K9R A;  3KCE A;  2JMF A;  2XP5 A;  1Q6U A;  4C02 B;  2ZQU A;  5CQ2 A;  5J6E A;  1F8A B;  4LAW A;  4DRI A;  4TW6 A;  2ZAJ A;  4JFL A;  3UQI A;  2RUD A;  4ODR A;  3ODK A;  1EYM A;  2M1I A;  4U86 A;  2JV4 A;  2PPO A;  2MPH A;  1JMQ A;  1FKL A;  4DRN A;  2MLX A;  3JXV A;  2M08 A;  2MF9 A;  2RUQ A;  1ZK6 A;  2ZQV A;  1FKJ A;  2LKN A;  1EG3 A;  2EZ5 W;  2KGJ A;  1QZ2 A;  1K9Q A;  4GIV A;  2M8J A;  1Y0O A;  2JX8 A;  2JXW A;  3GPK A;  3WH0 A;  2M2A A;  2PPP A;  2D9F A;  3UI6 A;  2LJ4 A;  5DIU A;  4JFK A;  1FKH A;  2KFW A;  3IK8 A;  4TYO A;  4DZ2 A;  5HW8 A;  1C9H A;  2F2D A;  1D7I A;  1FKT A;  4TW8 A;  2IF4 A;  2KE0 A;  2DWV A;  3M85 A;  1KT1 A;  2ZR4 A;  3O5M A;  5HWC A;  3UF8 A;  1Q6H A;  3TDB A;  4DRP A;  4TNS A;  4W9O A;  5HWB A;  1JNT A;  4O2T A;  3RFW A;  2YSH A;  2XPB A;  3RGC A;  1ZCN A;  1A7X A;  4REX A;  1PBK A;  4DH0 A;  2L4J A;  1FKG A;  1EQ3 A;  4U84 A;  2YSI A;  3LUO A;  2DK1 A;  3PRB A;  2JZV A; 
#chains in the Genus database with same CATH topology
 4ODL A;  1FKF A;  4S3K A;  4IPX A;  2Q5A A;  4DRK A;  4DZ3 A;  3WD0 A;  4DRO A;  1BL4 A;  1RD6 A;  2XP6 A;  3MDY B;  3RM8 A;  3O5O A;  1P5Q A;  1X6N A;  3TC5 A;  4ZS6 A;  2RSE A;  1D6O A;  2ZQT A;  5I98 A;  1GRJ A;  3O5E A;  1I5H W;  3PRA A;  1KFW A;  1YW5 A;  3ARU A;  4ZPV R;  2EUL A;  1W1V A;  3AS3 A;  3BXW A;  4U85 A;  4G50 A;  4LAV A;  2O9O A;  2RUC A;  2F21 A;  5HUA A;  3EY6 A;  1FLC A;  2DSU A;  3ALG A;  3B7X A;  1TFV A;  1KT0 A;  4Q22 A;  4DIP A;  4ODO A;  1N1A A;  2DSW A;  1TCO C;  1NMW A;  3UQB A;  4J4O A;  1HJV A;  1W1T A;  1ZL1 A;  1XHG A;  3RME A;  2G8Z A;  3NTP A;  5U47 A;  1LJY A;  4KQZ A;  2LPV A;  3KZ7 A;  3NI6 A;  1WR7 A;  3M7N A;  1JVW A;  3OOB A;  1Q6I A;  4LGX A;  2Y78 A;  2ZR6 A;  1GUV A;  1CTN A;  2XP7 A;  3WL0 A;  3WQV A;  4W9Q A;  2YSF A;  1JNE A;  1HKM A;  4Q7N A;  4FAP A;  5B8I C;  3KAH A;  4ODK A;  4JYS A;  3MQH A;  3RM9 A;  1FKI A;  4MNJ A;  4GLX A;  2DT1 A;  1LG1 A;  3IKD A;  4J4N A;  1FAP A;  1O6I A;  2WLZ A;  4ODP A;  1B6C A;  1HKK A;  1WMV A;  1EHN A;  1OGG A;  2RUR A;  4TX0 A;  1BKF A;  2M8I A;  1JCH B;  5BXJ A;  2ZQS A;  2ETN A;  2XP3 A;  4LAX A;  1W26 A;  5GQB A;  4NNR A;  2AWG A;  3BMB A;  1FJD A;  3OA5 A;  1NH6 A;  2WAD A;  4NZC A;  5HKG A;  1FKR A;  4NSB A;  3W4R A;  1J6Y A;  4DWS B;  3KAD A;  4DWS C;  1SYT A;  4QIB A;  2E45 A;  2OWO A;  1J4H A;  3AS1 A;  3O5G A;  4DRQ A;  3PRD A;  3O5P A;  1EIB A;  1K9T A;  4TW7 A;  4WJX A;  3KAG A;  2G41 A;  4MGV A;  2ITK A;  1M5Y A;  1J4R A;  1PIN A;  3LKX A;  2B31 A;  3CGN A;  3O5F A;  4Z2I A;  2KO7 A;  3ARO A;  3CHC A;  3O5K A;  1FKK A;  4L3N A;  4MPK A;  3AQU A;  4W9P A;  3UI4 A;  4P8W A;  4FN2 A;  4DRJ A;  1GOI A;  4MAV A;  4AY1 A;  3WQW A;  4HAR A;  3ALF A;  2MLY A;  3KAC A;  1HJW A;  3O5R A;  5GPR A;  1NSG A;  2ZR5 A;  3WD4 A;  3RM4 A;  1H0I A;  4XAK A;  3PA7 A;  2UZ5 A;  1QPL A;  1ROU A;  3B8S A;  3FS8 A;  3WKZ A;  2RQS A;  1E9L A;  1JNS A;  3JYM A;  5DO2 A;  4WKF A;  4HBE A;  2YBU A;  1LG2 A;  1YAT A;  3GU0 A;  2PN0 A;  3IHZ A;  3IKG A;  4IT6 A;  1FKB A;  2A3C A;  2LGO A;  3WD1 A;  2F4E A;  1LL6 A;  3ARQ A;  2DG3 A;  1ROT A;  4MNK A;  2FAP A;  4DRM A;  1SR0 A;  3I6C A;  2WM0 A;  2XPA A;  5HW6 A;  3PQH A;  1HJX A;  2MDI A;  1ZBC A;  4WK9 A;  1FD9 A;  3O5L A;  2PPN A;  1E6R A;  3MQG A;  3CNG A;  2DG9 A;  2VCD A;  5DIT A;  3NRK A;  3ARW A;  4E5R A;  1D7H A;  3MCB A;  3JYJ A;  4QZV B;  4QT2 A;  1RP5 A;  3O5D A;  4ZPW R;  3L4H A;  5E62 A;  4P8U A;  2DPE A;  4W5U A;  2XP4 A;  4DRH A;  4R5E A;  1F40 A;  2OFN A;  3KAB A;  1ZBV A;  3ARS A;  2PV3 A;  1EDQ A;  1OGB A;  1NMV A;  3CHE A;  4DT4 A;  2KXQ A;  1L1P A;  1T11 A;  1JND A;  1FKD A;  2PI6 A;  3KAI A;  5AHT A;  2BA1 A;  2DG4 A;  2LAJ A;  2RE3 A;  4JFI A;  3WD2 A;  2XP8 A;  2K8I A;  1NWS A;  3O5J A;  4QT3 A;  5DF0 A;  3AS2 A;  4R0X A;  3UQA A;  4Z2K A;  2O92 A;  1NWR A;  4WIW A;  3O5I A;  1O6W A;  3ARV A;  3G6L A;  2PV2 A;  1WAW A;  1NWT A;  4A0U A;  4KR0 B;  5E5W A;  4ODM A;  4DWS D;  2MLZ A;  5HTG A;  3ART A;  3ARZ A;  4S3J A;  2YSG A;  4WKH A;  3B9A A;  1E6N A;  3ARP A;  4MSP A;  3O5Q A;  3GTY X;  2KR7 A;  4DWS A;  2YSB A;  5HW7 A;  1UR9 A;  2DSV A;  2DMV A;  4LAY A;  2KI3 A;  5JH8 A;  1D7J A;  1U79 A;  3G6M A;  4BF8 A;  3AS0 A;  3FXY A;  4JFJ A;  4ODQ A;  3FSB A;  5D75 A;  1OWQ A;  2DT0 A;  1UR8 A;  4IT4 A;  3CHF A;  2ESC A;  1E6P A;  2VN1 A;  1FFR A;  4ODN A;  2N87 A;  4N19 A;  1XRV A;  2YBT A;  1W1P A;  3UI5 A;  3VAW A;  3LKX B;  2MNT A;  3CGM A;  3FAP A;  4IQC A;  3LE4 A;  1FKS A;  1ITX A;  2B5U B;  1EG4 A;  1J4I A;  2DJY A;  1R9H A;  1LQ0 A;  1TK7 A;  2FDM A;  4G2P A;  3CH9 A;  4P8V A;  2FKE A;  1X6L A;  2DK7 A;  3PR9 A;  1Q1C A;  1QPF A;  4IQ2 A;  2L2S A;  1E44 A;  3H9R B;  1VF8 A;  1ZU8 A;  5HT1 A;  1ZBW A;  1HXV A;  4ITZ A;  2XP9 A;  5E64 A;  4URI A;  3KAF A;  2PBC A;  3QOK A;  5DIV A;  4JFM A;  2M3O W;  1W9P A;  4GGQ A;  5GPG A;  3TCZ A;  2P4V A;  2PV1 A;  1W1Y A;  2A3E A;  3WD3 A;  1K9R A;  3KCE A;  2JMF A;  2XP5 A;  1Q6U A;  3EIP A;  4C02 B;  3ARR A;  4P8X A;  4HBO A;  2ZQU A;  4Z2J A;  5CQ2 A;  1ZBK A;  5J6E A;  1IX5 A;  2QF8 A;  1F8A B;  1HKJ A;  4LAW A;  2ZAJ A;  4JFL A;  4TW6 A;  4DRI A;  3UQI A;  1FFQ A;  2RUD A;  2A3B A;  4Z2H A;  3ODK A;  4ODR A;  4MTV A;  1EYM A;  4MNM A;  2M1I A;  4U86 A;  2DT2 A;  2JV4 A;  2WAE A;  2Y8N B;  1WNO A;  2PPO A;  4ZPT R;  3MCB B;  2MPH A;  1JMQ A;  1TR8 A;  1NWU A;  1FKL A;  1WB0 A;  4DRN A;  2MLX A;  3JXV A;  2M08 A;  3CZ8 A;  2DSZ A;  2MF9 A;  3ARY A;  2RUQ A;  1ZK6 A;  4WKA A;  2ZQV A;  1FKJ A;  2LKN A;  4UDM A;  1EG3 A;  2EZ5 W;  2KGJ A;  1QZ2 A;  1K9Q A;  4GIV A;  2M8J A;  3WL1 A;  2WLY A;  2DT3 A;  1Y0O A;  2JX8 A;  2JXW A;  3GPK A;  3WH0 A;  2M2A A;  2PPP A;  5HBF A;  4MNL A;  2AOS A;  5E66 A;  2QRV A;  2D9F A;  3UI6 A;  2LJ4 A;  1LL7 A;  5DIU A;  4JFK A;  1FKH A;  2KFW A;  3IK8 A;  4TYO A;  4Z2L A;  4L72 B;  2IUZ A;  4DZ2 A;  5HW8 A;  1C9H A;  2F2D A;  1D7I A;  3FSC A;  1FKT A;  1D2K A;  4ML4 A;  3B9D A;  2OLH A;  4TW8 A;  2IF4 A;  1E15 A;  2A3A A;  4PTM A;  2KE0 A;  2DWV A;  1H0G A;  3M85 A;  3CHD A;  1KT1 A;  2ZR4 A;  3B9E A;  1LL4 A;  3O5M A;  5HWC A;  1Q6H A;  3UF8 A;  3TDB A;  4DRP A;  2YAJ B;  4TNS A;  5E65 A;  4W9O A;  5HWB A;  1E6Z A;  1JNT A;  4O2T A;  3RFW A;  2YSH A;  1W9U A;  2XPB A;  3FY1 A;  3RGC A;  1ZCN A;  1HKI A;  1A7X A;  5DEZ A;  1W9V A;  2WK2 A;  1ZB5 A;  4REX A;  1PBK A;  4DH0 A;  2L4J A;  1FKG A;  3ARX A;  2F23 A;  1EQ3 A;  4U84 A;  4Z2G A;  2YSI A;  3LUO A;  2DK1 A;  3PRB A;  2JZV A;  1GPF A;  3WIJ A;  4A0T A; 
#chains in the Genus database with same CATH homology
 4ODL A;  1FKF A;  4S3K A;  4IPX A;  2Q5A A;  4DRK A;  4DZ3 A;  3WD0 A;  4DRO A;  1BL4 A;  1RD6 A;  2XP6 A;  3MDY B;  3RM8 A;  3O5O A;  1P5Q A;  1X6N A;  3TC5 A;  4ZS6 A;  2RSE A;  1D6O A;  2ZQT A;  5I98 A;  3O5E A;  1I5H W;  3PRA A;  1KFW A;  1YW5 A;  3ARU A;  4ZPV R;  1W1V A;  3AS3 A;  3BXW A;  4U85 A;  4G50 A;  4LAV A;  2O9O A;  2RUC A;  2F21 A;  5HUA A;  3EY6 A;  1FLC A;  2DSU A;  3ALG A;  3B7X A;  1TFV A;  1KT0 A;  4Q22 A;  4DIP A;  4ODO A;  1N1A A;  2DSW A;  1TCO C;  1NMW A;  3UQB A;  4J4O A;  1HJV A;  1W1T A;  1ZL1 A;  1XHG A;  3RME A;  2G8Z A;  3NTP A;  5U47 A;  1LJY A;  4KQZ A;  2LPV A;  3KZ7 A;  3NI6 A;  1WR7 A;  3M7N A;  1JVW A;  3OOB A;  1Q6I A;  4LGX A;  2Y78 A;  2ZR6 A;  1GUV A;  1CTN A;  2XP7 A;  3WL0 A;  3WQV A;  4W9Q A;  2YSF A;  1JNE A;  1HKM A;  4Q7N A;  4FAP A;  5B8I C;  3KAH A;  4ODK A;  4JYS A;  3MQH A;  3RM9 A;  1FKI A;  4MNJ A;  4GLX A;  2DT1 A;  1LG1 A;  3IKD A;  4J4N A;  1FAP A;  1O6I A;  2WLZ A;  4ODP A;  1B6C A;  1HKK A;  1WMV A;  1EHN A;  1OGG A;  2RUR A;  4TX0 A;  1BKF A;  2M8I A;  5BXJ A;  2ZQS A;  2XP3 A;  4LAX A;  1W26 A;  5GQB A;  4NNR A;  2AWG A;  1FJD A;  3OA5 A;  1NH6 A;  2WAD A;  4NZC A;  5HKG A;  1FKR A;  4NSB A;  3W4R A;  1J6Y A;  4DWS B;  3KAD A;  4DWS C;  1SYT A;  4QIB A;  2E45 A;  2OWO A;  1J4H A;  3AS1 A;  3O5G A;  4DRQ A;  3PRD A;  3O5P A;  1EIB A;  1K9T A;  4TW7 A;  4WJX A;  3KAG A;  2G41 A;  4MGV A;  2ITK A;  1M5Y A;  1J4R A;  1PIN A;  3LKX A;  2B31 A;  3CGN A;  3O5F A;  4Z2I A;  2KO7 A;  3ARO A;  3CHC A;  3O5K A;  1FKK A;  4L3N A;  4MPK A;  3AQU A;  4W9P A;  3UI4 A;  4P8W A;  4FN2 A;  4DRJ A;  1GOI A;  4MAV A;  4AY1 A;  3WQW A;  4HAR A;  3ALF A;  2MLY A;  3KAC A;  1HJW A;  3O5R A;  5GPR A;  1NSG A;  2ZR5 A;  3WD4 A;  3RM4 A;  1H0I A;  4XAK A;  3PA7 A;  2UZ5 A;  1QPL A;  1ROU A;  3B8S A;  3FS8 A;  3WKZ A;  2RQS A;  1E9L A;  1JNS A;  3JYM A;  5DO2 A;  4WKF A;  4HBE A;  2YBU A;  1LG2 A;  1YAT A;  3IHZ A;  3IKG A;  4IT6 A;  1FKB A;  2A3C A;  2LGO A;  3WD1 A;  2F4E A;  1LL6 A;  3ARQ A;  2DG3 A;  1ROT A;  4MNK A;  2FAP A;  4DRM A;  1SR0 A;  3I6C A;  2WM0 A;  2XPA A;  5HW6 A;  3PQH A;  1HJX A;  2MDI A;  1ZBC A;  4WK9 A;  1FD9 A;  3O5L A;  2PPN A;  1E6R A;  3MQG A;  3CNG A;  2DG9 A;  2VCD A;  5DIT A;  3NRK A;  3ARW A;  4E5R A;  1D7H A;  3MCB A;  3JYJ A;  4QZV B;  4QT2 A;  1RP5 A;  3O5D A;  4ZPW R;  3L4H A;  5E62 A;  4P8U A;  2DPE A;  4W5U A;  2XP4 A;  4DRH A;  4R5E A;  1F40 A;  2OFN A;  3KAB A;  1ZBV A;  3ARS A;  2PV3 A;  1EDQ A;  1OGB A;  1NMV A;  3CHE A;  4DT4 A;  2KXQ A;  1L1P A;  1T11 A;  1JND A;  1FKD A;  2PI6 A;  3KAI A;  5AHT A;  2BA1 A;  2DG4 A;  2LAJ A;  2RE3 A;  4JFI A;  3WD2 A;  2XP8 A;  2K8I A;  1NWS A;  3O5J A;  4QT3 A;  5DF0 A;  3AS2 A;  4R0X A;  3UQA A;  4Z2K A;  2O92 A;  1NWR A;  4WIW A;  3O5I A;  1O6W A;  3ARV A;  3G6L A;  2PV2 A;  1WAW A;  1NWT A;  4A0U A;  4KR0 B;  5E5W A;  4ODM A;  4DWS D;  2MLZ A;  5HTG A;  3ART A;  3ARZ A;  4S3J A;  2YSG A;  4WKH A;  3B9A A;  1E6N A;  3ARP A;  4MSP A;  3O5Q A;  2KR7 A;  4DWS A;  2YSB A;  5HW7 A;  1UR9 A;  2DSV A;  2DMV A;  4LAY A;  2KI3 A;  5JH8 A;  1D7J A;  1U79 A;  3G6M A;  4BF8 A;  3AS0 A;  3FXY A;  4JFJ A;  4ODQ A;  3FSB A;  5D75 A;  1OWQ A;  2DT0 A;  1UR8 A;  4IT4 A;  3CHF A;  2ESC A;  1E6P A;  2VN1 A;  1FFR A;  4ODN A;  2N87 A;  4N19 A;  1XRV A;  2YBT A;  1W1P A;  3UI5 A;  3VAW A;  3LKX B;  2MNT A;  3CGM A;  3FAP A;  4IQC A;  3LE4 A;  1FKS A;  1ITX A;  1EG4 A;  1J4I A;  2DJY A;  1R9H A;  1LQ0 A;  1TK7 A;  2FDM A;  4G2P A;  3CH9 A;  4P8V A;  2FKE A;  1X6L A;  2DK7 A;  3PR9 A;  1Q1C A;  1QPF A;  4IQ2 A;  2L2S A;  3H9R B;  1VF8 A;  1ZU8 A;  5HT1 A;  1ZBW A;  1HXV A;  4ITZ A;  2XP9 A;  5E64 A;  4URI A;  3KAF A;  2PBC A;  3QOK A;  5DIV A;  4JFM A;  2M3O W;  1W9P A;  4GGQ A;  5GPG A;  3TCZ A;  2PV1 A;  1W1Y A;  2A3E A;  3WD3 A;  1K9R A;  3KCE A;  2JMF A;  2XP5 A;  1Q6U A;  4C02 B;  3ARR A;  4P8X A;  4HBO A;  2ZQU A;  4Z2J A;  5CQ2 A;  1ZBK A;  5J6E A;  1IX5 A;  2QF8 A;  1F8A B;  1HKJ A;  4LAW A;  2ZAJ A;  4JFL A;  4TW6 A;  4DRI A;  3UQI A;  1FFQ A;  2RUD A;  2A3B A;  4Z2H A;  3ODK A;  4ODR A;  4MTV A;  1EYM A;  4MNM A;  2M1I A;  4U86 A;  2DT2 A;  2JV4 A;  2WAE A;  2Y8N B;  1WNO A;  2PPO A;  4ZPT R;  3MCB B;  2MPH A;  1JMQ A;  1TR8 A;  1NWU A;  1FKL A;  1WB0 A;  4DRN A;  2MLX A;  3JXV A;  2M08 A;  3CZ8 A;  2DSZ A;  2MF9 A;  3ARY A;  2RUQ A;  1ZK6 A;  4WKA A;  2ZQV A;  1FKJ A;  2LKN A;  1EG3 A;  2EZ5 W;  2KGJ A;  1QZ2 A;  1K9Q A;  4GIV A;  2M8J A;  3WL1 A;  2WLY A;  2DT3 A;  1Y0O A;  2JX8 A;  2JXW A;  3GPK A;  3WH0 A;  2M2A A;  2PPP A;  5HBF A;  4MNL A;  2AOS A;  5E66 A;  2QRV A;  2D9F A;  3UI6 A;  2LJ4 A;  1LL7 A;  5DIU A;  4JFK A;  1FKH A;  2KFW A;  3IK8 A;  4TYO A;  4Z2L A;  4L72 B;  2IUZ A;  4DZ2 A;  5HW8 A;  1C9H A;  2F2D A;  1D7I A;  3FSC A;  1FKT A;  1D2K A;  4ML4 A;  3B9D A;  2OLH A;  4TW8 A;  2IF4 A;  1E15 A;  2A3A A;  4PTM A;  2KE0 A;  2DWV A;  1H0G A;  3M85 A;  3CHD A;  1KT1 A;  2ZR4 A;  3B9E A;  1LL4 A;  3O5M A;  5HWC A;  1Q6H A;  3UF8 A;  3TDB A;  4DRP A;  2YAJ B;  4TNS A;  5E65 A;  4W9O A;  5HWB A;  1E6Z A;  1JNT A;  4O2T A;  3RFW A;  2YSH A;  1W9U A;  2XPB A;  3FY1 A;  3RGC A;  1ZCN A;  1HKI A;  1A7X A;  5DEZ A;  1W9V A;  2WK2 A;  1ZB5 A;  4REX A;  1PBK A;  4DH0 A;  2L4J A;  1FKG A;  3ARX A;  1EQ3 A;  4U84 A;  4Z2G A;  2YSI A;  3LUO A;  2DK1 A;  3PRB A;  2JZV A;  1GPF A;  3WIJ A;  4A0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...