3KCMA

The crystal structure of thioredoxin protein from geobacter metallireducens
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
139
structure length
139
Chain Sequence
b'LEENPAPDFTLNTLNGEVVKLSDLKGQVVIVNFWATWCPPCREEIPSMMRLNAAMAGKPFRMLCVSIDEGGKVAVEEFFRKTGFTLPVLLDADKRVGKLYGTTGVPETFVIDRHGVILKKVVGAMEWDHPEVIAFLNNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin family protein
publication title The crystal structure of thioredoxin protein from Geobacter metallireducens
rcsb
source organism Geobacter metallireducens gs-15
molecule tags Oxidoreductase
total genus 36
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kcmA00
4OCFA 4YAPA 2GLRA 2JADA 3L0HA 3DIEA 5JCUA 2IIYA 3VWUA 3V1WA 3DVWA 4MJEA 3GUSA 3DYRA 2DLXA 2HXKA 5B6MA 1YKAA 2IN3A 5DAKB 2B1LA 5CNWA 4G19A 4L0UA 2E7PA 4JU5A 2HNLA 1TRVA 1T4ZA 1MTCA 2XBIA 4PQIA 1S3AA 4NXIA 4CHSA 1BEDA 4OO4A 2FWGA 1GSFA 4D73B 1V57A 2NBSA 3F9UA 3HXSA 4POBA 5CRGA 4EDZA 1ON4A 2HZFA 1ZZYA 4KH7A 3MNGA 5DJLA 3Q18A 2H76A 2VLTA 1MDJA 4LL1B 1OC3A 3OR5A 3FK8A 1M0UA 2CX3A 1EZKA 4RI6A 5ECKB 3DGQA 2F3MA 1F2EA 4V2MA 5CYYA 3F4SA 3LYKA 4Q5NA 1XWAA 2LUSA 2N5FA 1TW9A 2R2JA 2LQQA 1AQWA 1M9AA 13GSA 2H0GA 1YY7A 3C1RA 3IAS2 3M0FA 4FO5A 1TKDB 1TI1A 4EE0A 1TK5B 3DVXA 3GIXA 2HI7A 1TTZA 4KX4A 3C73A 4RUVA 2A2RA 1FAAA 2PUKC 1V9WA 2IPAA 2FY6A 4TXOB 4WEYA 1KBNA 3VWVA 3GKNA 2LQOA 4WR4A 2I9HA 1ZL9A 1BYEA 5IOXA 2R6KA 2DSAA 1B4PA 1IYIA 2FLSA 1O6JA 3CSJA 4X43A 2YN1A 5D96A 1EGRA 1SYRA 1XVQA 3BCIA 1F3AA 4ECJA 5COHA 3TOTA 2C0DA 4KNDA 3ZRDA 2PWJA 1PX7A 1GUKA 2L6DA 3K8NA 2H6ZA 4TW5A 3S9FA 1FOVA 4NMUA 5KEJA 5EL8A 4JR4A 2QGVA 1K0NA 3SWLA 4KSOA 1EOHA 4BPYA 2N5AA 4GWRA 2VLVA 2I4AA 2P0GA 5J3RA 2X64A 1SL2B 1T1VA 3QDNA 4EVMA 1T7PB 1V98A 3GV1A 5G2ZA 3J7Yk 3DXBA 3US3A 1BAYA 2K8SA 2YWIA 2AJQB 2F8FA 4LA1A 2CT6A 2LRTA 2YV7A 3I9V2 4HI7A 3APSA 1DBYA 5DCHA 1O81A 2X8HA 3QOUA 2B7KA 1X9WB 4TR1A 2HFDA 2R4VA 3I6AA 1SK1A 3KCMA 4OCEA 2H75A 3D4MA 1BQ7A 1YEXA 2EIQA 2C0FA 1XW5A 5F05A 2JL4A 1G6YA 3FYGA 1WPIA 3D5JA 2LRNA 3EMPA 3N9JA 4L8EA 3KXOA 2IFQB 3GL3A 1GP1A 4BWSA 2GZPA 1NM3A 5ECPB 3KH9A 1SYXA 1HNCA 4AJ8A 2WDUA 5ECMB 1DE2A 1BX9A 4OD7A 3VWXA 4EC0A 2VCQA 2PGTA 2C0EA 4HUAA 4HU9A 4V1Ag 5AIXA 3ZIJA 3UJ1A 2CZ2A 4MMMA 4TVEA 2YCDA 1S3DA 3GH6A 3M1GA 1A0RP 1ERUA 3F6FA 3RPPA 4DEJA 1GLQA 3DD3A 4MF7A 5A5KA 3HVSA 2PU9C 3VPTA 4F0CA 1Q98A 1GLPA 4OO5A 2JU5A 3FZ9A 1ILOA 3TKRA 2AYTA 1JZDA 1F37A 5IMVA 2YJHA 4IW9A 4ZXGA 5HR2A 4MPGA 4F03A 4EL1A 1O85A 4MZWA 2L5LA 2VM2A 3ZMLA 5IM9A 1SD8A 2QKEA 3MAKA 5A4WA 2X99A 3TJFA 5DBQA 5CAXA 5ECQB 1LJRA 1GSUA 3H4KA 1VF2A 5G1KA 2HZEA 1HNAA 2K9FA 1AAZA 3LXTA 4TR1B 2HE3A 4HDEA 1A2MA 3KTLA 4K7OA 1EWXA 4XRDA 1AXDA 2D2ZA 2IMKA 5ECLB 5J5NA 5B8AA 4FH8A 1SU9A 4YQVA 1ACVA 3W8SA 4N0ZA 1AW9A 3H1NA 4GXZA 3EVIA 2J23A 11GSA 2B5YA 5F8BA 1HQOA 1XZOA 4N10A 2GGTA 3G9BA 3WT2A 8GSSA 5J9BA 4PUAA 4QL7A 4PURA 4NV2A 3QR6A 1U87A 4WKWA 2J9HA 1MD3A 1TOFA 2B6MA 2H0IA 1K0DA 2BMXA 1DUGA 2MMOA 5AISA 2VIMA 5L71A 5G1LA 2O85A 3D4TA 1PSQA 2VCVA 3F3QA 4FIWA 1A8LA 2OE3A 5GAPD 2C8UA 4TRXA 4EUYA 3RHBA 2V2GA 5KN1A 3FEUA 1ERTA 1YDKA 3ZFLA 5HFGA 4F82A 2RUFA 3GTUB 5GSTA 1QUWA 2CZ3A 2VOCA 3EU3A 4EO3A 3LORA 1PD21 2ZUPA 2LJAA 2F9SA 4ZB9A 2FGXA 3FW2A 4AGSA 1EV9A 2LV3A 4AF2A 2HZEB 5ELGA 5C00A 3ZYWA 2HYXA 3W8JA 5G5FA 4KGIA 3LG6A 1W89A 2RIIA 4XIHA 3L9UA 4HQZA 2JACA 5DQYA 3A2XA 2LNSA 4XS4B 2F8AA 3HD5A 1V2AA 2YWNA 4X1UA 4O7HA 2HRFA 2PVQA 2DJ3A 4O5RA 4GF0A 3TUEA 2KLXA 1X5EA 4N0VA 1EGOA 5DAKA 3ZTLA 4WETA 4NV5A 4TN8A 4EXJA 2AHEA 1PKWA 4J2FA 1AQVA 4ZB6A 1XXUA 2WS2A 1VF1A 4D73A 4JZQA 3APQA 3P8WA 3UVHA 1EP8A 1UVZA 2XBQA 5HQPA 3Q6OA 2DBCA 4MH3A 2YV9A 2DIYA 19GSA 5D9TA 4MLYA 1OC9B 4XHMA 4RQRA 3H8QA 1ZYEA 4ILFA 1QFNA 3LYPA 2NTOA 2QSIA 4HS1A 2EIRA 4YQUA 3D21A 4IP6A 3E3EA 4PUFC 3LWAA 3F0IA 5EPFA 2GTUA 3EWLA 4GSNA 1BJXA 5J9CA 2VUPA 3EC3A 5ECOB 3IDVA 2EIOA 4MDCA 5IPHA 2RM5A 3PR8A 2C4JA 1OE8A 5D73A 1TJDA 2A2SA 4TXOA 5KN3A 3GX0A 1GH2A 1I9DA 4JE1A 3IBHA 2CQ9A 1ZMAA 3ME7A 5DALB 4GSSA 1XOBA 5GSSA 3A3TA 3GHAA 4MA9A 4K0NA 3KIJA 18GSA 3VI5A 5CRWA 2FA4A 3ERGA 1AQXA 4LMWA 2YNXA 1G7EA 1Z3EA 4Q5FA 1KTEA 5B8BA 3HJPA 2I81A 1TRUA 4YAVA 5CRHA 1M7TA 1NHYA 1SD9A 4ID0A 3ZITA 1R4WA 4F9ZA 3FR3A 2OACA 4GLTA 2XC2A 4G2EA 5CRDA 2AAWA 1EEMA 4AJ7A 2FCHA 1OC8A 4DSRA 1J08A 4BVYA 3GFKA 4HOJA 2R3XA 4FYCA 2DMLA 2NVLA 5IMCA 4XTSA 4HZ2A 4PGTA 2VL2A 2R37A 1QMVA 3CXGA 3DMLA 1PA3A 1H75A 4ACSA 1Z9HA 3GRXA 2DJ2A 12GSA 2FUG2 2O89A 4TR4A 4ECIA 4RQXA 5D8IA 4GQCA 2K6VA 1T4YA 3NOFA 3ME8A 3U6VA 3D0ZA 1LBKA 4IP1A 4G9HA 4HJ2A 3UOMA 5JCWA 2IFQA 1TRSA 3KD0A 2YANA 3Q19A 2H19A 3ZVJA 3EE2A 4HQSA 2ES7A 1S3CA 3IA1A 1OKTA 5J4UA 3FRCA 1YF0A 2VCTA 3VWWA 1DSBA 4EKZA 4I2UA 5CO3A 4J56E 1UN2A 2H6YA 2IMFA 1QGVA 4N30A 5ECRB 1XIYA 2LJRA 2OKAA 2CVKA 4CW9A 3LFLA 1E6BA 5EVOA 5F0GA 3KH7A 2GS3A 3GA4A 4I2TA 6GSVA 4L5LA 1A0FA 2H1GA 2KP1A 2CVBA 1X9MB 3HJOA 3BD2A 2H0HA 3HJMA 4ZL7A 2FA8A 1E2YA 1XVWA 2O87A 5H5SA 2C0GA 1Z5YE 1C72A 1EP7A 1SL0B 3QFBC 1YEPA 3HZ8A 3AY8A 4NHWA 2P5RA 4DVCA 2ON7A 2YJ7A 3IK7A 3IXRA 4MJCA 2C80A 4NPBA 3QD9A 4ML6A 1AUCA 1XFLA 5JWRB 1PL1A 2LNTA 3ZL5A 2YP6A 4IVFA 4MABA 5HFKA 3GSTA 3BOAA 2KUCA 4PNFA 3HKRA 1M9BA 4BWQA 2ON5A 1FB6A 2DJJA 2TRCP 3A2VA 4ZBAA 3H93A 2DJ0A 1I5GA 3HYPA 3UVTA 2E2MA 4IQAA 5IMDA 3TJGA 3WT1A 3IV4A 1NHOA 1U88A 3WGEA 3WGXA 2NDOA 4MZCA 4X0XA 5B7CA 3W6GA 3PINA 2PERA 2AUVA 1O8XA 2PN8A 1V58A 1OAZA 2REMA 2BJXA 4KDUA 5DVBA 5F07A 2VD0A 4K1FA 5B6NA 1Z6NA 3UAPA 4H86A 2DJKA 2FWEA 2GQKA 2WCIA 1GTIA 1T3BA 1PRXA 3GTUA 3GL5A 5IQYA 4YQMA 2GQLA 3HHVA 4WBRD 5IMZA 4ZL8A 2RM6A 1GUHA 3TKSC 3ERWA 3IR4A 1ABAA 3IAM2 4ZIJA 4DSSB 1G6WA 2CA8A 3G7YA 3GKXA 1A2LA 5FHIA 1T8EB 3F63A 1WRYA 3MSZA 5D9XA 22GSA 1HD2A 4WF4A 2G0FA 5LCZA 4XS4A 3DRNA 5A4UA 4RI7A 1J0FA 1PGTA 3TCOA 3HDCA 4KUNA 3WGDA 1F9MA 5AN1A 1O8WA 2E0QA 4IJ3A 2V32A 4TXVA 4MJAA 3HCZA 4NHZA 3IPZA 1K0AA 5IPGA 3FY7A 3QAGA 5DDLA 4ML1A 3LGCA 2OADA 3IOSA 5ECHB 2L57A 5ELAA 3RHCA 3TGZA 4HJMA 1PMTA 2Z9SA 4KW6A 3QAVA 1USBA 2VCZA 4MPFA 5HFIA 1A2JA 2GVPA 4JR6A 4O92A 1HNBA 1G0TA 4Q5QA 1OC9A 1WP0A 5JWOB 2OBKA 2JZSA 3FHKA 1SENA 4HZ4A 4ISDA 3NZNA 1B8XA 4GSTA 3GKMA 2H8LA 2OE0A 2YWOA 5INYA 1PX6A 3RDWA 3G7IA 1IYHA 2R5GA 1TI3A 16GSA 1T00A 3P7XA 3KMNA 2TIRA 2CX4A 2FWFA 3L9SA 4LLRA 2GT5A 5IOWA 3TJKA 1CQHA 1YZXA 1Y25A 3M9KA 2H1DA 1RK4A 5D93A 2AV4A 4K9ZA 5DCGA 1URMA 4PXOA 3ZLPA 1PN9A 1PQNA 2MMNA 5DALA 2IJYA 2L59A 1B48A 2C1YA 1EV4A 2B5XA 3TKQA 2I3YA 4XCSA 1YJ6A 2A4VA 6GSTA 5F06A 2L5OA 1XWKA 2C3NA 1EEJA 1DE1A 1Z7PA 5KN0A 2H72A 3EYTA 3GH9A 4TKYA 3IHQA 1F3BA 1VF3A 1K3LA 2H66A 9GSSA 1QQ2A 4I8BA 4E8HA 1JZOA 3HVVA 1ZYQB 4IQ1A 5HR3A 1R5PA 3KP9A 4MCUA 3LEFA 3L78A 2DC5A 2TRXA 4KDXA 2EC4A 2VM1A 2GDRA 4QQ7A 2JZTA 2FHEA 4NAXA 4KA0A 3ZIVA 2JSZA 1R7HA 1QXHA 1N8JA 3F3RA 1AC1A 1GSYA 1SK0A 2I1UA 3CMIA 1XW6A 1XOAA 1R5AA 2RLIA 3P2AA 3TJBA 4K2DA 2ZNMA 2K8VA 2H73A 3BBYA 1H4OA 3EMXA 1GUMA 2WB9A 3C7MA 1OYJA 5ECNB 2M46A 3DKSA 2BTOT 4QL9A 2M80A 3A5WA 4KE3A 3G7JA 4KCEA 3UEMA 5J41A 4I97A 1K0CA 5G31A 5A4VA 4ZBDA 3I43A 4K8MA 2L4CA 2VO4A 1PKZA 1TP9A 2HT9A 2ZCTA 4TR0A 4LL4B 5E59A 4KB3A 2B7JA 1K0OA 3DWVA 3ERFA 5ECSA 1N2AA 1MD4A 2OA7A 3D22A 2K18A 1MDIA 1MDKA 3L4NA 4MZBA 1XPVA 2GSSA 1TK0B 4BL7A 1W4VA 3O6TA 2NPBA 5IO2A 5C04A 1JHBA 2CV4A 4K0GA 1GTUA 2GSTA 1J9BA 1R26A 1FG4A 2E2GA 2JZRA 3MDKA 3TRPA 2M72A 3UMAA 3FZAA 1GTAA 4IS0A 4WXTA 3KM6A 1TU8A 4WF5A 3VFIA 4PQHA 4ZB8A 6GSYA 2HLSA 3RBTA 3M3MA 3IK9A 4IHUA 5FWGA 3TB2A 4OMVA 1ST9A 4L5OA 3A2WA 2OBIA 5IMFA 2MMZA 3C71A 2XPDA 3UBKA 3F6DA 4KCAA 3GSSA 2MYGA 3TKPA 3O76A 3GN3A 4LMVA 4ZILA 1Q4JA 1Z6MA 5D9WA 4V2NA 2GSQA 2DJ1A 1GULA 2V6KA 3KGKA 2IMEA 3KJYA 1XW9A 1ERWA 1PL2A 1SKWB 1ZOFA 1G7OA 1GWCA 1GTBA 5LD0A 3UL3A 3JCML 4ZBBA 4OFTA 4CDOA 3DEXA 4POLA 3GKKA 2X8GA 1YQ1A 3TJJA 3LJRA 4ULXA 3QMXA 2GZYA 3E0UA 1CQGA 1THOA 2HRNA 1A24A 1TK8B 3ZFBA 4XS6A 2KP2A 3ISOA 2H1BA 2HSYA 1M2AA 1B4QA 1K0BA 4K7NA 3IC4A 1TDIA 1SK2A 2H70A 3VPQA 1XWBA 3CTFA 3QFAC 2PMTA 4BVXA 1A8YA 5H5RA 2N5BA 1TRWA 2YOIA 3IE3A 1WOUA 5AGYA 5IIZA 1U3AA 14GSA 3MWHA 3LXZA 2C3TA 6GSSA 3BCKA 4DSSA 4K6XA 5E4WA 3HVXA 1GRXA 4O32A 3FZ5A 3UIWA 5ECIB 10GSA 3E9JB 1UC7A 4G10A 2PBJA 3GX8A 4WBJA 2B5EA 2IMDA 1JFUA 3UBLA 2IWTA 4Q5RA 1JZWA 4MH2A 4L0WA 3LSZA 2DMMA 3D6IA 4GCIA 2G2QA 4IGJA 3HA9A 3F8UA 3M8NA 1ML6A 3EINA 1WMJA 1SJZA 1O73A 2LKUA 2YZHA 4N11A 3RPNA 5ID2A 3UARA 1SKSB 3J7Yb 2IMIA 4Z7XA 17GSA 2B1KA 2O8VB 3PGTA 2YPMA 4V2LA 3F4TA 4GQFA 1X5DA 3FZ4A 1XCCA 1VRSD 1YKCA 1GNEA 4PQ1A 5EY6A 2VCWA 2LRCA 1OE7A 2H74A 2GSRA 4OWYA 2PPTA 3VK9A 2L6CA 1V40A 2V41A 1FB0A 5H5QA 2VCXA 3EURA 3H79A 4FYUA 1SJ6A 3CSHA 1M2BA 1UA5A 1XBSA 4ECBA 5IMAA 4JRRA 1RW1A 2XPEA 1FW1A 4EDYA 3F4RA 1B9XC 1JLVA 2L4QA 1YF1A 1TXXA 2LEGA 4PNGA 4KDYA 4XRAA 3VI7A 1WE0A 2P5QA 2O7KA 5CREA 1VGLA 5G30A 2CAQA 1FHEA 2XHFA 3WYWA 2MBSA 2GZZA 3PH9A 4IBPA 3WD6A 3TRQA 1THXA 1OVNA 1FVKA 4POMA 2DIZA 2V1MA 2PVOC 4F0BA 1JLWA 4DSQA 6GSUA 4JEDA 2H71A 4ZL9A 1VF4A 3QPMA 4TOPA 4MF5A 2RUEA 1X5CA 2CAIA 4F2IA 3APOA 4HEA2 2OJLA 3VURA 1WWJA 5HR1A 1FVJA 4J57E 2HSHA 3TDGA 5LNKe 1KNGA 2P31A 5ID2B 1NW2A 3FKFA 5JWQB 6GSXA 1LU4A 5FT3A 1KEBA 4P3YB 1X9SB 4I6XA 4NWYA 4V1Ap 1F6MC 2X8CA 1GL8A 3RAZA 4YH2A 3KEBA 1QK8A 4GTUA 1GNWA 4I5QA 1U6TA 2WGRA 2WJUA 3GYKA 2H1AA 4E8EA 1ERVA 3CRUA 3CBUA 1GSDA 5HR0A 4WR5A 2AB6A 3ED3A 3Q74A 1SL1B 4OFMA 1XWCA 1NSWA 1RQMA 1OKDA 1GSEA 1JZRA 3M9JA 4IN0A 4MK3A 1HYUA 2GT6A 4POKA 2WRTA 4HU7A 2LSTA 2MBTA 2MMAA 6GSWA 1ZCPA 2WZ9A 5IO0A 4MP4A 2V6OA 2WFCA 5KN2A 2LS5A 3KP8A 2WULA 2LTKA 2GQMA 1XWGA 2FWHA 5DQSA 2VL2C 4BA7A 2VAFA 5GAND 1SKRB 4XS1A 3I69A 2QC7A 1Y6EA 5CP1A 3CYNA 3GMFA 4KSMA 2YWMA 4KAEA 3CTGA 3LQ7A 5ENUA 1K3OA 3FR9A 4OFNA 1GSSA 3GURA 3N5OA 4PX1A 2IL3A 3KZQA 3VLNA 2VLUA 2F51A 3GNJA 1B9YC 20GSA 2JSYA 3R2QA 3SBCA 1U3IA 2B3SA 4K7IA 4IELA 2YZUA 1MEKA 1K0MA 2CVDA 3ZZXA 3BJ5A 3C1SA 5DJMA 3L9VA 1EOGA 4IJIA 1SJIA 1GSQA 1FO5A 1TU7A 3TKSA 4TR3A 3TKSE 2C3QA 3O3TA 4MF6A 1Z7RA 3HZ4A 5D9VA 3TOUA 1AIUA 3P90A 1BG5A 3C8EA 1M99A 1M2DA 5JCGA 1O7UA 5GZZB 4GRFA 3NIVA 3ZMKA 2VL9A 2MZCA 2VL3A 3U5RE 4MJBA 3CRTA 2KHPA 2ALBA 3ZVJD 3HY2A 1K3YA 7GSSA 3ZREA 1ZGNA 3IRAA 2LJKA 5ABRA 3KTBA 3EU4A 1WJKA 4JBBA 2VD1A 3FR6A 5AIVA 3TRXA 4FYBA 4IKHA 3KMOA 2H01A 3CSIA 4EF0A 3QAWA 4AJ6A 2FD3A 2H6XA 4ECCA 5G5EA 2H30A 1X0RA 1WIKA 2OE1A 3QCPA 2KOKA 1A23A 2FNOA
chains in the Genus database with same CATH superfamily
4OCFA 4YAPA 2GLRA 2JADA 3L0HA 3DIEA 5JCUA 2IIYA 3VWUA 3V1WA 3DVWA 4MJEA 3GUSA 3DYRA 2DLXA 4EIPA 2HXKA 5B6MA 1YKAA 2IN3A 5DAKB 2B1LA 5CNWA 4G19A 4L0UA 2E7PA 4JU5A 2HNLA 1TRVA 1T4ZA 1MTCA 2XBIA 4PQIA 1S3AA 4NXIA 4CHSA 1BEDA 4OO4A 2FWGA 1GSFA 4D73B 1V57A 2NBSA 3F9UA 3HXSA 4POBA 5CRGA 4EDZA 3FMWA 1ON4A 2HZFA 1ZZYA 4KH7A 3MNGA 5DJLA 3Q18A 2H76A 2VLTA 1MDJA 4LL1B 1OC3A 3OR5A 3FK8A 1M0UA 2CX3A 1EZKA 4RI6A 5ECKB 3DGQA 2F3MA 1F2EA 4V2MA 5CYYA 4YKFA 3F4SA 3LYKA 4Q5NA 1XWAA 2LUSA 2N5FA 1TW9A 2R2JA 2LQQA 1AQWA 1M9AA 13GSA 2H0GA 1YY7A 3C1RA 3IAS2 3M0FA 2HSMA 4FO5A 1TKDB 1TI1A 4EE0A 1TK5B 3DVXA 3GIXA 2HI7A 2HRKA 1TTZA 4KX4A 3C73A 4RUVA 2A2RA 1FAAA 2PUKC 1V9WA 2IPAA 2FY6A 4TXOB 4WEYA 1KBNA 3EPTA 3VWVA 3GKNA 4G0LA 2LQOA 4WR4A 2I9HA 1ZL9A 1BYEA 5IOXA 2R6KA 2DSAA 1B4PA 1IYIA 2FLSA 1O6JA 3CSJA 4X43A 4CY8A 2YN1A 5D96A 1EGRA 1SYRA 1XVQA 3BCIA 1F3AA 4ECJA 5COHA 3TOTA 2C0DA 4KNDA 3ZRDA 2PWJA 1PX7A 1GUKA 2L6DA 3K8NA 2H6ZA 4TW5A 3S9FA 1FOVA 4NMUA 5KEJA 5EL8A 4JR4A 2QGVA 4BVYB 1K0NA 2DKIA 3SWLA 4KSOA 1EOHA 4BPYA 2N5AA 4GWRA 2VLVA 2I4AA 2P0GA 5J3RA 2X64A 1SL2B 1T1VA 3QDNA 4EVMA 1T7PB 1V98A 3GV1A 5G2ZA 3J7Yk 3DXBA 3US3A 1BAYA 2K8SA 2YWIA 2AJQB 2F8FA 4LA1A 2CT6A 2LRTA 2YV7A 3R3EA 3I9V2 4HI7A 3APSA 1DBYA 5DCHA 1O81A 2X8HA 3QOUA 2B7KA 1X9WB 4TR1A 2HFDA 2R4VA 3I6AA 1SK1A 3KCMA 4OCEA 2H75A 3D4MA 1BQ7A 1YEXA 2EIQA 2C0FA 1XW5A 1ZYNA 5F05A 2JL4A 1G6YA 3FYGA 1WPIA 3D5JA 2LRNA 3EMPA 3N9JA 4L8EA 3KXOA 2IFQB 3GL3A 1GP1A 4BWSA 2GZPA 1NM3A 5ECPB 3KH9A 1SYXA 1HNCA 4AJ8A 2WDUA 5ECMB 1DE2A 1BX9A 4OD7A 3VWXA 4EC0A 2VCQA 2PGTA 2C0EA 4HUAA 4HU9A 4V1Ag 5AIXA 3ZIJA 3HVNA 3UJ1A 2CZ2A 4MMMA 4TVEA 1XG8A 2YCDA 1S3DA 3GH6A 3M1GA 1A0RP 1ERUA 3F6FA 3RPPA 4DEJA 1GLQA 3DD3A 4MF7A 5A5KA 3HVSA 2PU9C 3VPTA 4F0CA 1Q98A 1GLPA 4OO5A 2JU5A 3FZ9A 1ILOA 3TKRA 2AYTA 1JZDA 1F37A 5IMVA 2YJHA 4IW9A 4ZXGA 5HR2A 4MPGA 4F03A 4EL1A 1O85A 4MZWA 2L5LA 2VM2A 3ZMLA 5IM9A 1SD8A 2QKEA 3MAKA 5A4WA 2X99A 3TJFA 5DBQA 5CAXA 5ECQB 1LJRA 1GSUA 3H4KA 1VF2A 5G1KA 2HZEA 1HNAA 2K9FA 1AAZA 3LXTA 4TR1B 2HE3A 4HDEA 1A2MA 3KTLA 4K7OA 1EWXA 4XRDA 1AXDA 2D2ZA 2IMKA 5ECLB 5J5NA 5B8AA 4FH8A 1SU9A 4YQVA 1ACVA 2QA2A 3W8SA 3A5IA 4N0ZA 1AW9A 3H1NA 4KF9A 5KOWA 4GXZA 3EVIA 2J23A 11GSA 2B5YA 5F8BA 1HQOA 1XZOA 4N10A 2GGTA 3G9BA 3WT2A 8GSSA 5J9BA 4PUAA 4QL7A 4PURA 4NV2A 3QR6A 1U87A 4WKWA 2J9HA 1MD3A 1TOFA 2B6MA 2H0IA 1K0DA 2BMXA 1DUGA 2MMOA 5AISA 2VIMA 5L71A 5G1LA 2O85A 3D4TA 1PSQA 2VCVA 3F3QA 4FIWA 1A8LA 2OE3A 5GAPD 2C8UA 4TRXA 4EUYA 3RHBA 2A4HA 2V2GA 5KN1A 3FEUA 1ERTA 1YDKA 3ZFLA 5HFGA 4F82A 2RUFA 3GTUB 5GSTA 1QUWA 2CZ3A 2VOCA 3EU3A 4EO3A 3LORA 1PD21 2ZUPA 2LJAA 2F9SA 4ZB9A 2FGXA 3FW2A 4AGSA 1EV9A 2LV3A 4AF2A 2HZEB 5ELGA 5C00A 3ZYWA 2HYXA 3W8JA 5G5FA 4KGIA 3LG6A 1W89A 2RIIA 4XIHA 3L9UA 4HQZA 2JACA 5DQYA 3A2XA 2LNSA 4XS4B 2F8AA 3HD5A 1V2AA 2YWNA 4PTSA 4O7HA 4X1UA 2HRFA 2PVQA 2DJ3A 4O5RA 1ZYPA 4GF0A 3TUEA 2KLXA 1X5EA 4N0VA 1EGOA 5DAKA 3ZTLA 4WETA 4NV5A 4TN8A 4EXJA 2AHEA 1PKWA 4J2FA 1AQVA 4ZB6A 1XXUA 2WS2A 1VF1A 4D73A 4JZQA 4HSCX 3APQA 3P8WA 3UVHA 1EP8A 1UVZA 2XBQA 5HQPA 3Q6OA 2DBCA 4MH3A 2R0CA 2YV9A 2DIYA 19GSA 5D9TA 4MLYA 1OC9B 4XHMA 4RQRA 3H8QA 1ZYEA 4ILFA 1QFNA 3LYPA 2NTOA 2QSIA 4HS1A 2EIRA 4YQUA 3D21A 4IP6A 3E3EA 4PUFC 3LWAA 3F0IA 5EPFA 2GTUA 3EWLA 4GSNA 1BJXA 5J9CA 2VUPA 3EC3A 5ECOB 3IDVA 2EIOA 4MDCA 5IPHA 2RM5A 3PR8A 2C4JA 3LW9A 1OE8A 5D73A 1TJDA 2A2SA 4TXOA 5KN3A 3GX0A 1GH2A 1I9DA 4JE1A 3IBHA 2CQ9A 1ZMAA 3ME7A 5DALB 4GSSA 1XOBA 5GSSA 3A3TA 3GHAA 4MA9A 4K0NA 3KIJA 18GSA 3VI5A 5CRWA 2FA4A 3ERGA 1AQXA 4LMWA 2YNXA 1G7EA 1Z3EA 4Q5FA 1KTEA 5B8BA 3HJPA 2I81A 1TRUA 4YAVA 5CRHA 1M7TA 1NHYA 1SD9A 4ID0A 3ZITA 1R4WA 4F9ZA 3FR3A 2OACA 4GLTA 2XC2A 4G2EA 5CRDA 2AAWA 1EEMA 4AJ7A 2FCHA 1OC8A 4DSRA 1J08A 4BVYA 4BIKA 3GFKA 4HOJA 2R3XA 4FYCA 2DMLA 2NVLA 5IMCA 4XTSA 4HZ2A 4PGTA 2VL2A 2R37A 1QMVA 3CXGA 3DMLA 1PA3A 1H75A 4ACSA 1Z9HA 3GRXA 2DJ2A 12GSA 2FUG2 2O89A 4TR4A 4ECIA 4RQXA 5D8IA 4GQCA 2K6VA 1T4YA 3NOFA 3ME8A 4Z2RA 3U6VA 3D0ZA 1LBKA 4IP1A 4G9HA 4HJ2A 3UOMA 5JCWA 2IFQA 1TRSA 3KD0A 2YANA 3Q19A 2H19A 3ZVJA 3EE2A 4HQSA 2ES7A 1S3CA 1PN0A 3IA1A 1OKTA 5J4UA 3FRCA 1YF0A 2VCTA 3VWWA 1DSBA 4EKZA 4I2UA 5CO3A 4J56E 1UN2A 2H6YA 2IMFA 1QGVA 4N30A 5ECRB 1XIYA 2LJRA 2OKAA 2CVKA 4CW9A 3LFLA 1E6BA 5EVOA 5F0GA 3KH7A 2GS3A 3GA4A 4I2TA 6GSVA 4L5LA 1A0FA 2H1GA 2KP1A 2CVBA 1X9MB 3HJOA 4BL7B 4G0KA 3BD2A 2H0HA 3HJMA 4ZL7A 2FA8A 1E2YA 1XVWA 2O87A 5H5SA 2C0GA 1Z5YE 1C72A 1EP7A 1SL0B 3QFBC 1YEPA 3HZ8A 3AY8A 4NHWA 2P5RA 4DVCA 2ON7A 2YJ7A 3IK7A 3IXRA 4MJCA 2C80A 4NPBA 3QD9A 4ML6A 1AUCA 1XFLA 5JWRB 1PL1A 2LNTA 3ZL5A 2YP6A 4IVFA 4MABA 5HFKA 3GSTA 3BOAA 2KUCA 4PNFA 3HKRA 1M9BA 4BWQA 2ON5A 1FB6A 2DJJA 2TRCP 3A2VA 4ZBAA 3H93A 2DJ0A 1I5GA 2R0GA 3HYPA 3UVTA 2E2MA 4IQAA 5IMDA 3TJGA 4O5QA 3WT1A 3IV4A 1NHOA 1U88A 3WGEA 3WGXA 2NDOA 4MZCA 4X0XA 5B7CA 3W6GA 3PINA 2PERA 2AUVA 1O8XA 2PN8A 1V58A 1OAZA 2REMA 2BJXA 4KDUA 5DVBA 5F07A 2VD0A 3IC8A 4K1FA 5B6NA 1Z6NA 3UAPA 4H86A 2DJKA 2FWEA 2GQKA 2WCIA 1GTIA 1T3BA 1PRXA 3GTUA 3GL5A 4BVXB 4YQMA 5IQYA 2GQLA 3HHVA 4WBRD 4K2XA 5IMZA 4ZL8A 2RM6A 1GUHA 3TKSC 3ERWA 3IR4A 1ABAA 3IAM2 4ZIJA 4DSSB 1G6WA 2CA8A 3G7YA 3GKXA 1A2LA 5FHIA 1T8EB 3F63A 1WRYA 3MSZA 5D9XA 22GSA 1HD2A 4WF4A 2G0FA 5LCZA 4XS4A 3DRNA 5A4UA 4RI7A 1J0FA 1PGTA 3TCOA 3HDCA 4KUNA 3WGDA 1F9MA 5AN1A 1O8WA 2E0QA 4IJ3A 2V32A 4TXVA 4MJAA 3HCZA 4NHZA 3IPZA 1K0AA 5IPGA 3FY7A 3QAGA 5DDLA 4ML1A 3LGCA 2OADA 3IOSA 5ECHB 2L57A 5ELAA 3RHCA 3TGZA 4HJMA 1PMTA 2Z9SA 4KW6A 3QAVA 1USBA 2VCZA 4MPFA 5HFIA 1A2JA 2GVPA 4JR6A 1PFOA 4O92A 1HNBA 1G0TA 4Q5QA 1OC9A 1WP0A 5JWOB 2OBKA 2JZSA 3FHKA 1SENA 4HZ4A 4ISDA 3NZNA 1B8XA 4GSTA 3GKMA 2H8LA 2OE0A 2YWOA 5INYA 1PX6A 3RDWA 3G7IA 1IYHA 2R5GA 1TI3A 16GSA 1T00A 3P7XA 3KMNA 2TIRA 2CX4A 2FWFA 3L9SA 4LLRA 2GT5A 5IOWA 3TJKA 1CQHA 1YZXA 1Y25A 3M9KA 2H1DA 1RK4A 5D93A 2AV4A 4K9ZA 5DCGA 1URMA 4PXOA 3ZLPA 1PN9A 1PQNA 2MMNA 5DALA 2IJYA 2L59A 1B48A 2C1YA 1EV4A 2B5XA 3TKQA 2I3YA 4Z2UA 4XCSA 1YJ6A 2A4VA 6GSTA 5F06A 2L5OA 1XWKA 2C3NA 1EEJA 1DE1A 1Z7PA 5KN0A 2H72A 3EYTA 3GH9A 4TKYA 3IHQA 1F3BA 1VF3A 1K3LA 2H66A 9GSSA 1QQ2A 4I8BA 4E8HA 1JZOA 3HVVA 1ZYQB 4IQ1A 5HR3A 1R5PA 3KP9A 4MCUA 3LEFA 3L78A 2DC5A 2TRXA 4KDXA 2EC4A 2VM1A 2GDRA 4QQ7A 2JZTA 2FHEA 4NAXA 4KA0A 3ZIVA 2JSZA 1R7HA 1QXHA 1N8JA 3F3RA 1AC1A 1GSYA 1SK0A 2I1UA 3CMIA 1XW6A 3IHGA 1XOAA 1R5AA 2RLIA 3P2AA 3TJBA 4K2DA 2ZNMA 2K8VA 5BRTA 2H73A 3BBYA 1H4OA 3EMXA 1GUMA 2WB9A 3C7MA 1OYJA 5ECNB 2M46A 3DKSA 2BTOT 4QL9A 2M80A 3A5WA 4KE3A 3G7JA 4KCEA 3UEMA 5J41A 4I97A 1K0CA 5G31A 5A4VA 4ZBDA 2R0PA 3I43A 4K8MA 2L4CA 2VO4A 1PKZA 1TP9A 2HT9A 2ZCTA 4TR0A 4K5SA 4LL4B 5E59A 4KB3A 2B7JA 1K0OA 3DWVA 3ERFA 5ECSA 1N2AA 1MD4A 2OA7A 3D22A 2K18A 1MDIA 1MDKA 3L4NA 4MZBA 1XPVA 2GSSA 1TK0B 4BL7A 1W4VA 4X4JA 3O6TA 2NPBA 4Z2TA 5IO2A 5C04A 1JHBA 2CV4A 4K0GA 1GTUA 2GSTA 1J9BA 1R26A 1FG4A 2E2GA 2JZRA 3MDKA 3TRPA 2M72A 4EIQA 3UMAA 3FZAA 1GTAA 4IS0A 4WXTA 3KM6A 1TU8A 4WF5A 3VFIA 4PQHA 4ZB8A 6GSYA 2HLSA 3RBTA 3M3MA 3IK9A 4IHUA 5FWGA 3TB2A 4OMVA 1ST9A 4L5OA 3A2WA 2OBIA 5IMFA 2MMZA 3C71A 2XPDA 3UBKA 3F6DA 4KCAA 3GSSA 2MYGA 3TKPA 3O76A 3GN3A 4LMVA 4ZILA 1Q4JA 1Z6MA 5D9WA 4V2NA 2GSQA 2DJ1A 1GULA 2V6KA 3KGKA 2IMEA 3KJYA 3CQFA 1XW9A 1ERWA 1PL2A 1SKWB 1ZOFA 1G7OA 1GWCA 1GTBA 5LD0A 3UL3A 3JCML 4ZBBA 4O5UA 4OFTA 4CDOA 3DEXA 4POLA 3GKKA 2X8GA 1YQ1A 3TJJA 3LJRA 4ULXA 2A2PA 3QMXA 2GZYA 3E0UA 1CQGA 1THOA 2HRNA 1A24A 1TK8B 3ZFBA 4XS6A 2KP2A 3ISOA 2H1BA 2HSYA 1M2AA 1B4QA 1K0BA 4K7NA 3IC4A 1TDIA 1SK2A 2H70A 3VPQA 1XWBA 3CTFA 3QFAC 2PMTA 4BVXA 1A8YA 5H5RA 2N5BA 4CY6A 1TRWA 2YOIA 3IE3A 1WOUA 5AGYA 5IIZA 1U3AA 14GSA 3MWHA 3LXZA 2C3TA 6GSSA 3BCKA 4DSSA 4K6XA 5E4WA 3HVXA 1GRXA 4O32A 3FZ5A 3UIWA 5ECIB 4K5RA 10GSA 3E9JB 1UC7A 4G10A 2PBJA 3GX8A 4WBJA 2B5EA 2IMDA 1JFUA 3UBLA 2IWTA 4Q5RA 1JZWA 4MH2A 4L0WA 3LSZA 2DMMA 3D6IA 4GCIA 2G2QA 4IGJA 3HA9A 3F8UA 3M8NA 1ML6A 3EINA 1WMJA 1SJZA 1O73A 2LKUA 4FQUA 2YZHA 4N11A 3RPNA 5ID2A 3UARA 1SKSB 3J7Yb 2IMIA 4Z7XA 17GSA 2B1KA 2O8VB 3PGTA 2YPMA 4V2LA 3F4TA 4GQFA 1X5DA 3FZ4A 1XCCA 3MIXA 1VRSD 1YKCA 1GNEA 4PQ1A 5EY6A 2VCWA 2LRCA 1OE7A 2H74A 2GSRA 4G0IA 4OWYA 2PPTA 3VK9A 4ICYA 2QA1A 2L6CA 1V40A 2V41A 1FB0A 5H5QA 2VCXA 3EURA 3H79A 4FYUA 1SJ6A 3CSHA 1M2BA 1UA5A 1XBSA 4ECBA 5IMAA 4JRRA 1RW1A 2XPEA 1FW1A 2UZ8A 4EDYA 3F4RA 1B9XC 1JLVA 2L4QA 1YF1A 1TXXA 2LEGA 4PNGA 4KDYA 4XRAA 3VI7A 2DKHA 1WE0A 2P5QA 2O7KA 5CREA 1VGLA 5G30A 2CAQA 1FHEA 2XHFA 3WYWA 2MBSA 2GZZA 3PH9A 4IBPA 3WD6A 4USSA 3TRQA 1THXA 1OVNA 1M3IA 1FVKA 4POMA 2DIZA 3PPUA 2V1MA 2PVOC 3MYDA 4F0BA 1JLWA 4DSQA 6GSUA 4JEDA 2H71A 4ZL9A 1VF4A 3QPMA 4TOPA 4MF5A 2RUEA 1X5CA 2X4AA 2CAIA 4F2IA 3APOA 4HEA2 2OJLA 4A5PA 3VURA 1WWJA 5HR1A 1M3JA 1FVJA 4J57E 2HSHA 3TDGA 5LNKe 1KNGA 2P31A 5ID2B 1NW2A 3FKFA 5JWQB 6GSXA 1LU4A 5FT3A 1KEBA 4P3YB 1X9SB 4I6XA 4NWYA 4V1Ap 1F6MC 2X8CA 1GL8A 3RAZA 4YH2A 3KEBA 1QK8A 4GTUA 1GNWA 4I5QA 1U6TA 2WGRA 2WJUA 3GYKA 2H1AA 4E8EA 1ERVA 3CRUA 3CBUA 1GSDA 5HR0A 4WR5A 2AB6A 3ED3A 3Q74A 1SL1B 4OFMA 1XWCA 1NSWA 1RQMA 1OKDA 2X49A 1GSEA 4MNNA 1JZRA 3M9JA 2HRAA 4IN0A 4MK3A 1HYUA 2GT6A 4POKA 2WRTA 4HU7A 2LSTA 2MBTA 2MMAA 6GSWA 1ZCPA 2WZ9A 5IO0A 4YKGA 4MP4A 2V6OA 2WFCA 5KN2A 2LS5A 3KP8A 2WULA 2LTKA 2GQMA 1XWGA 2FWHA 5DQSA 2VL2C 4BA7A 2VAFA 5GAND 1SKRB 4XS1A 3I69A 2QC7A 1Y6EA 5CP1A 3CYNA 3GMFA 4KSMA 2YWMA 4KAEA 3CTGA 3LQ7A 5ENUA 1S3RA 1K3OA 3FR9A 4OFNA 1GSSA 3GURA 3N5OA 4PX1A 2IL3A 3KZQA 3VLNA 2VLUA 2F51A 3GNJA 1B9YC 20GSA 5KOXA 2JSYA 3R2QA 3SBCA 1U3IA 2B3SA 4K7IA 4IELA 2YZUA 1MEKA 1K0MA 2CVDA 3ZZXA 3BJ5A 3C1SA 5DJMA 5BMUA 1FOHA 3L9VA 1EOGA 4IJIA 1SJIA 1GSQA 1FO5A 1TU7A 3TKSA 4TR3A 3TKSE 2C3QA 3O3TA 4MF6A 1Z7RA 3HZ4A 5D9VA 3TOUA 1AIUA 3P90A 1BG5A 3C8EA 1M99A 1M2DA 5JCGA 1O7UA 5GZZB 4GRFA 3NIVA 3ZMKA 2VL9A 2MZCA 2VL3A 3U5RE 4MJBA 3CRTA 2KHPA 2ALBA 3ZVJD 3HY2A 1K3YA 7GSSA 3ZREA 1ZGNA 3IRAA 2LJKA 5ABRA 3KTBA 3EU4A 1WJKA 4JBBA 2VD1A 3FR6A 5AIVA 3TRXA 4FYBA 4IKHA 3KMOA 2H01A 3CSIA 4EF0A 3QAWA 4AJ6A 2FD3A 2H6XA 4ECCA 5G5EA 2H30A 1X0RA 1WIKA 2OE1A 3QCPA 2KOKA 1A23A 2FNOA
chains in the Genus database with same CATH topology
4OCFA 4YAPA 2GLRA 2JADA 3L0HA 3DIEA 5JCUA 2IIYA 3VWUA 3V1WA 3DVWA 4MJEA 3GUSA 3DYRA 2DLXA 4EIPA 2HXKA 5B6MA 1YKAA 2IN3A 5DAKB 2B1LA 5CNWA 4G19A 4L0UA 2E7PA 4JU5A 2HNLA 1TRVA 1T4ZA 1MTCA 2XBIA 4PQIA 1S3AA 4NXIA 4CHSA 1BEDA 4OO4A 2FWGA 1GSFA 4D73B 1V57A 2NBSA 3F9UA 3HXSA 4POBA 5CRGA 4EDZA 3FMWA 1ON4A 2HZFA 1ZZYA 4KH7A 3MNGA 5DJLA 3Q18A 2H76A 2VLTA 1MDJA 4LL1B 1OC3A 3OR5A 3FK8A 1M0UA 2CX3A 1EZKA 4RI6A 5ECKB 3DGQA 2F3MA 1F2EA 4V2MA 5CYYA 4YKFA 3F4SA 3LYKA 4Q5NA 1XWAA 2LUSA 2N5FA 1TW9A 2R2JA 2LQQA 1AQWA 1M9AA 13GSA 2H0GA 1YY7A 3C1RA 3IAS2 3M0FA 2HSMA 4FO5A 1TKDB 1TI1A 4EE0A 1TK5B 3DVXA 3GIXA 2HI7A 2HRKA 1TTZA 4KX4A 3C73A 4RUVA 2A2RA 1FAAA 2PUKC 1V9WA 2IPAA 2FY6A 4TXOB 4WEYA 1KBNA 3EPTA 3VWVA 3GKNA 4G0LA 2LQOA 4WR4A 2I9HA 1ZL9A 1BYEA 5IOXA 2R6KA 2DSAA 1B4PA 1IYIA 2FLSA 1O6JA 3CSJA 4X43A 4CY8A 2YN1A 5D96A 1EGRA 1SYRA 1XVQA 3BCIA 1F3AA 4ECJA 5COHA 3TOTA 2C0DA 4KNDA 3ZRDA 2PWJA 1PX7A 1GUKA 2L6DA 3K8NA 2H6ZA 4TW5A 3S9FA 1FOVA 4NMUA 5KEJA 5EL8A 4JR4A 2QGVA 4BVYB 1K0NA 2DKIA 3SWLA 4KSOA 1EOHA 4BPYA 2N5AA 4GWRA 2VLVA 2I4AA 2P0GA 5J3RA 2X64A 1SL2B 1T1VA 3QDNA 4EVMA 1T7PB 1V98A 3GV1A 5G2ZA 3J7Yk 3DXBA 3US3A 1BAYA 2K8SA 2YWIA 2AJQB 2F8FA 4LA1A 2CT6A 2LRTA 2YV7A 3R3EA 3I9V2 4HI7A 3APSA 1DBYA 5DCHA 1O81A 2X8HA 3QOUA 2B7KA 1X9WB 4TR1A 2HFDA 2R4VA 3I6AA 1SK1A 3KCMA 4OCEA 2H75A 3D4MA 1BQ7A 1YEXA 2EIQA 2C0FA 1XW5A 1ZYNA 5F05A 2JL4A 1G6YA 3FYGA 1WPIA 3D5JA 2LRNA 3EMPA 3N9JA 4L8EA 3KXOA 2IFQB 3GL3A 1GP1A 4BWSA 2GZPA 1NM3A 5ECPB 3KH9A 1SYXA 1HNCA 4AJ8A 2WDUA 5ECMB 1DE2A 1BX9A 4OD7A 3VWXA 4EC0A 2VCQA 2PGTA 2C0EA 4HUAA 4HU9A 4V1Ag 5AIXA 3ZIJA 3UJ1A 2CZ2A 4MMMA 4TVEA 2YCDA 1S3DA 3GH6A 3M1GA 1A0RP 1ERUA 3F6FA 3RPPA 4DEJA 1GLQA 3DD3A 4MF7A 5A5KA 3HVSA 2PU9C 3VPTA 4F0CA 1Q98A 1GLPA 4OO5A 2JU5A 3FZ9A 1ILOA 3TKRA 2AYTA 1JZDA 1F37A 5IMVA 2YJHA 4IW9A 4ZXGA 5HR2A 4MPGA 4F03A 4EL1A 1O85A 4MZWA 2L5LA 2VM2A 3ZMLA 5IM9A 1SD8A 2QKEA 3MAKA 5A4WA 2X99A 3TJFA 5DBQA 5CAXA 5ECQB 1LJRA 1GSUA 3H4KA 1VF2A 5G1KA 2HZEA 1HNAA 2K9FA 1AAZA 3LXTA 4TR1B 2HE3A 4HDEA 1A2MA 3KTLA 4K7OA 1EWXA 4XRDA 1AXDA 2D2ZA 2IMKA 5ECLB 5J5NA 5B8AA 4FH8A 1SU9A 4YQVA 1ACVA 2QA2A 3W8SA 3A5IA 4N0ZA 1AW9A 3H1NA 4KF9A 5KOWA 4GXZA 3EVIA 2J23A 11GSA 2B5YA 5F8BA 1HQOA 1XZOA 4N10A 2GGTA 3G9BA 3WT2A 8GSSA 5J9BA 4PUAA 4QL7A 4PURA 4NV2A 3QR6A 1U87A 4WKWA 2J9HA 1MD3A 1TOFA 2B6MA 2H0IA 1K0DA 2BMXA 1DUGA 2MMOA 5AISA 2VIMA 5L71A 5G1LA 2O85A 3D4TA 1PSQA 2VCVA 3F3QA 4FIWA 1A8LA 2OE3A 5GAPD 2C8UA 4TRXA 4EUYA 3RHBA 2A4HA 2V2GA 5KN1A 3FEUA 1ERTA 1YDKA 3ZFLA 5HFGA 4F82A 2RUFA 3GTUB 5GSTA 1QUWA 2CZ3A 2VOCA 3EU3A 4EO3A 3LORA 1PD21 2ZUPA 2LJAA 2F9SA 4ZB9A 2FGXA 3FW2A 4AGSA 1EV9A 2LV3A 4AF2A 2HZEB 5ELGA 5C00A 3ZYWA 2HYXA 3W8JA 5G5FA 4KGIA 3LG6A 1W89A 2RIIA 4XIHA 3L9UA 4HQZA 2JACA 5DQYA 3A2XA 2LNSA 4XS4B 2F8AA 3HD5A 1V2AA 2YWNA 4PTSA 4O7HA 4X1UA 2HRFA 2PVQA 2DJ3A 4O5RA 1ZYPA 4GF0A 3TUEA 2KLXA 1X5EA 4N0VA 1EGOA 5DAKA 3ZTLA 4WETA 4NV5A 4TN8A 4EXJA 2AHEA 1PKWA 4J2FA 1AQVA 4ZB6A 1XXUA 2WS2A 1VF1A 4D73A 4JZQA 3APQA 3P8WA 3UVHA 1EP8A 1UVZA 2XBQA 5HQPA 3Q6OA 2DBCA 4MH3A 2R0CA 2YV9A 2DIYA 19GSA 5D9TA 4MLYA 1OC9B 4XHMA 4RQRA 3H8QA 1ZYEA 4ILFA 1QFNA 3LYPA 2NTOA 2QSIA 4HS1A 2EIRA 4YQUA 3D21A 4IP6A 3E3EA 4PUFC 3LWAA 3F0IA 5EPFA 2GTUA 3EWLA 4GSNA 1BJXA 5J9CA 2VUPA 3EC3A 5ECOB 3IDVA 2EIOA 4MDCA 5IPHA 2RM5A 3PR8A 2C4JA 3LW9A 1OE8A 5D73A 1TJDA 2A2SA 4TXOA 5KN3A 3GX0A 1GH2A 1I9DA 4JE1A 3IBHA 2CQ9A 1ZMAA 3ME7A 5DALB 4GSSA 1XOBA 5GSSA 3A3TA 3GHAA 4MA9A 4K0NA 3KIJA 18GSA 3VI5A 5CRWA 2FA4A 3ERGA 1AQXA 4LMWA 2YNXA 1G7EA 1Z3EA 4Q5FA 1KTEA 5B8BA 3HJPA 2I81A 1TRUA 4YAVA 5CRHA 1M7TA 1NHYA 1SD9A 4ID0A 3ZITA 1R4WA 4F9ZA 3FR3A 2OACA 4GLTA 2XC2A 4G2EA 5CRDA 2AAWA 1EEMA 4AJ7A 2FCHA 1OC8A 4DSRA 1J08A 4BVYA 3GFKA 4HOJA 2R3XA 4FYCA 2DMLA 2NVLA 5IMCA 4XTSA 4HZ2A 4PGTA 2VL2A 2R37A 1QMVA 3CXGA 3DMLA 1PA3A 1H75A 4ACSA 1Z9HA 3GRXA 2DJ2A 12GSA 2FUG2 2O89A 4TR4A 4ECIA 4RQXA 5D8IA 4GQCA 2K6VA 1T4YA 3NOFA 3ME8A 4Z2RA 3U6VA 3D0ZA 1LBKA 4IP1A 4G9HA 4HJ2A 3UOMA 5JCWA 2IFQA 1TRSA 3KD0A 2YANA 3Q19A 2H19A 3ZVJA 3EE2A 4HQSA 2ES7A 1S3CA 1PN0A 3IA1A 1OKTA 5J4UA 3FRCA 1YF0A 2VCTA 3VWWA 1DSBA 4EKZA 4I2UA 5CO3A 4J56E 1UN2A 2H6YA 2IMFA 1QGVA 4N30A 5ECRB 1XIYA 2LJRA 2OKAA 2CVKA 4CW9A 3LFLA 1E6BA 5EVOA 5F0GA 3KH7A 2GS3A 3GA4A 4I2TA 6GSVA 4L5LA 1A0FA 2H1GA 2KP1A 2CVBA 1X9MB 3HJOA 4BL7B 4G0KA 3BD2A 2H0HA 3HJMA 4ZL7A 2FA8A 1E2YA 1XVWA 2O87A 5H5SA 2C0GA 1Z5YE 1C72A 1EP7A 1SL0B 3QFBC 1YEPA 3HZ8A 3AY8A 4NHWA 2P5RA 4DVCA 2ON7A 2YJ7A 3IK7A 3IXRA 4MJCA 2C80A 4NPBA 3QD9A 4ML6A 1AUCA 1XFLA 5JWRB 1PL1A 2LNTA 3ZL5A 2YP6A 4IVFA 4MABA 5HFKA 3GSTA 3BOAA 2KUCA 4PNFA 3HKRA 1M9BA 4BWQA 2ON5A 1FB6A 2DJJA 2TRCP 3A2VA 4ZBAA 3H93A 2DJ0A 1I5GA 2R0GA 3HYPA 3UVTA 2E2MA 4IQAA 5IMDA 3TJGA 4O5QA 3WT1A 3IV4A 1NHOA 1U88A 3WGEA 3WGXA 2NDOA 4MZCA 4X0XA 5B7CA 3W6GA 3PINA 2PERA 2AUVA 1O8XA 2PN8A 1V58A 1OAZA 2REMA 2BJXA 4KDUA 5DVBA 5F07A 2VD0A 3IC8A 4K1FA 5B6NA 1Z6NA 3UAPA 4H86A 2DJKA 2FWEA 2GQKA 2WCIA 1GTIA 1T3BA 1PRXA 3GTUA 3GL5A 4BVXB 4YQMA 5IQYA 2GQLA 3HHVA 4WBRD 4K2XA 5IMZA 4ZL8A 2RM6A 1GUHA 3TKSC 3ERWA 3IR4A 1ABAA 3IAM2 4ZIJA 4DSSB 1G6WA 2CA8A 3G7YA 3GKXA 1A2LA 5FHIA 1T8EB 3F63A 1WRYA 3MSZA 5D9XA 22GSA 1HD2A 4WF4A 2G0FA 5LCZA 4XS4A 3DRNA 5A4UA 4RI7A 1J0FA 1PGTA 3TCOA 3HDCA 4KUNA 3WGDA 1F9MA 5AN1A 1O8WA 2E0QA 4IJ3A 2V32A 4TXVA 4MJAA 3HCZA 4NHZA 3IPZA 1K0AA 5IPGA 3FY7A 3QAGA 5DDLA 4ML1A 3LGCA 2OADA 3IOSA 5ECHB 2L57A 5ELAA 3RHCA 3TGZA 4HJMA 1PMTA 2Z9SA 4KW6A 3QAVA 1USBA 2VCZA 4MPFA 5HFIA 1A2JA 2GVPA 4JR6A 4O92A 1HNBA 1G0TA 4Q5QA 1OC9A 1WP0A 5JWOB 2OBKA 2JZSA 3FHKA 1SENA 4HZ4A 4ISDA 3NZNA 1B8XA 4GSTA 3GKMA 2H8LA 2OE0A 2YWOA 5INYA 1PX6A 3RDWA 3G7IA 1IYHA 2R5GA 1TI3A 16GSA 1T00A 3P7XA 3KMNA 2TIRA 2CX4A 2FWFA 3L9SA 4LLRA 2GT5A 5IOWA 3TJKA 1CQHA 1YZXA 1Y25A 3M9KA 2H1DA 1RK4A 5D93A 2AV4A 4K9ZA 5DCGA 1URMA 4PXOA 3ZLPA 1PN9A 1PQNA 2MMNA 5DALA 2IJYA 2L59A 1B48A 2C1YA 1EV4A 2B5XA 3TKQA 2I3YA 4Z2UA 4XCSA 1YJ6A 2A4VA 6GSTA 5F06A 2L5OA 1XWKA 2C3NA 1EEJA 1DE1A 1Z7PA 5KN0A 2H72A 3EYTA 3GH9A 4TKYA 3IHQA 1F3BA 1VF3A 1K3LA 2H66A 9GSSA 1QQ2A 4I8BA 4E8HA 1JZOA 3HVVA 1ZYQB 4IQ1A 5HR3A 1R5PA 3KP9A 4MCUA 3LEFA 3L78A 2DC5A 2TRXA 4KDXA 2EC4A 2VM1A 2GDRA 4QQ7A 2JZTA 2FHEA 4NAXA 4KA0A 3ZIVA 2JSZA 1R7HA 1QXHA 1N8JA 3F3RA 1AC1A 1GSYA 1SK0A 2I1UA 3CMIA 1XW6A 3IHGA 1XOAA 1R5AA 2RLIA 3P2AA 3TJBA 4K2DA 2ZNMA 2K8VA 5BRTA 2H73A 3BBYA 1H4OA 3EMXA 1GUMA 2WB9A 3C7MA 1OYJA 5ECNB 2M46A 3DKSA 2BTOT 4QL9A 2M80A 3A5WA 4KE3A 3G7JA 4KCEA 3UEMA 5J41A 4I97A 1K0CA 5G31A 5A4VA 4ZBDA 2R0PA 3I43A 4K8MA 2L4CA 2VO4A 1PKZA 1TP9A 2HT9A 2ZCTA 4TR0A 4K5SA 4LL4B 5E59A 4KB3A 2B7JA 1K0OA 3DWVA 3ERFA 5ECSA 1N2AA 1MD4A 2OA7A 3D22A 2K18A 1MDIA 1MDKA 3L4NA 4MZBA 1XPVA 2GSSA 1TK0B 4BL7A 1W4VA 4X4JA 3O6TA 2NPBA 4Z2TA 5IO2A 5C04A 1JHBA 2CV4A 4K0GA 1GTUA 2GSTA 1J9BA 1R26A 1FG4A 2E2GA 2JZRA 3MDKA 3TRPA 2M72A 4EIQA 3UMAA 3FZAA 1GTAA 4IS0A 4WXTA 3KM6A 1TU8A 4WF5A 3VFIA 4PQHA 4ZB8A 6GSYA 2HLSA 3RBTA 3M3MA 3IK9A 4IHUA 5FWGA 3TB2A 4OMVA 1ST9A 4L5OA 3A2WA 2OBIA 5IMFA 2MMZA 3C71A 2XPDA 3UBKA 3F6DA 4KCAA 3GSSA 2MYGA 3TKPA 3O76A 3GN3A 4LMVA 4ZILA 1Q4JA 1Z6MA 5D9WA 4V2NA 2GSQA 2DJ1A 1GULA 2V6KA 3KGKA 2IMEA 3KJYA 1XW9A 1ERWA 1PL2A 1SKWB 1ZOFA 1G7OA 1GWCA 1GTBA 5LD0A 3UL3A 3JCML 4ZBBA 4O5UA 4OFTA 4CDOA 3DEXA 4POLA 3GKKA 2X8GA 1YQ1A 3TJJA 3LJRA 4ULXA 2A2PA 3QMXA 2GZYA 3E0UA 1CQGA 1THOA 2HRNA 1A24A 1TK8B 3ZFBA 4XS6A 2KP2A 3ISOA 2H1BA 2HSYA 1M2AA 1B4QA 1K0BA 4K7NA 3IC4A 1TDIA 1SK2A 2H70A 3VPQA 1XWBA 3CTFA 3QFAC 2PMTA 4BVXA 1A8YA 5H5RA 2N5BA 4CY6A 1TRWA 2YOIA 3IE3A 1WOUA 5AGYA 5IIZA 1U3AA 14GSA 3MWHA 3LXZA 2C3TA 6GSSA 3BCKA 4DSSA 4K6XA 5E4WA 3HVXA 1GRXA 4O32A 3FZ5A 3UIWA 5ECIB 4K5RA 10GSA 3E9JB 1UC7A 4G10A 2PBJA 3GX8A 4WBJA 2B5EA 2IMDA 1JFUA 3UBLA 2IWTA 4Q5RA 1JZWA 4MH2A 4L0WA 3LSZA 2DMMA 3D6IA 4GCIA 2G2QA 4IGJA 3HA9A 3F8UA 3M8NA 1ML6A 3EINA 1WMJA 1SJZA 1O73A 2LKUA 4FQUA 2YZHA 4N11A 3RPNA 5ID2A 3UARA 1SKSB 3J7Yb 2IMIA 4Z7XA 17GSA 2B1KA 2O8VB 3PGTA 2YPMA 4V2LA 3F4TA 4GQFA 1X5DA 3FZ4A 1XCCA 3MIXA 1VRSD 1YKCA 1GNEA 4PQ1A 5EY6A 2VCWA 2LRCA 1OE7A 2H74A 2GSRA 4G0IA 4OWYA 2PPTA 3VK9A 4ICYA 2QA1A 2L6CA 1V40A 2V41A 1FB0A 5H5QA 2VCXA 3EURA 3H79A 4FYUA 1SJ6A 3CSHA 1M2BA 1UA5A 1XBSA 4ECBA 5IMAA 4JRRA 1RW1A 2XPEA 1FW1A 2UZ8A 4EDYA 3F4RA 1B9XC 1JLVA 2L4QA 1YF1A 1TXXA 2LEGA 4PNGA 4KDYA 4XRAA 3VI7A 2DKHA 1WE0A 2P5QA 2O7KA 5CREA 1VGLA 5G30A 2CAQA 1FHEA 2XHFA 3WYWA 2MBSA 2GZZA 3PH9A 4IBPA 3WD6A 4USSA 3TRQA 1THXA 1OVNA 1FVKA 4POMA 2DIZA 3PPUA 2V1MA 2PVOC 3MYDA 4F0BA 1JLWA 4DSQA 6GSUA 4JEDA 2H71A 4ZL9A 1VF4A 3QPMA 4TOPA 4MF5A 2RUEA 1X5CA 2X4AA 2CAIA 4F2IA 3APOA 4HEA2 2OJLA 4A5PA 3VURA 1WWJA 5HR1A 1FVJA 4J57E 2HSHA 3TDGA 5LNKe 1KNGA 2P31A 5ID2B 1NW2A 3FKFA 5JWQB 6GSXA 1LU4A 5FT3A 1KEBA 4P3YB 1X9SB 4I6XA 4NWYA 4V1Ap 1F6MC 2X8CA 1GL8A 3RAZA 4YH2A 3KEBA 1QK8A 4GTUA 1GNWA 4I5QA 1U6TA 2WGRA 2WJUA 3GYKA 2H1AA 4E8EA 1ERVA 3CRUA 3CBUA 1GSDA 5HR0A 4WR5A 2AB6A 3ED3A 3Q74A 1SL1B 4OFMA 1XWCA 1NSWA 1RQMA 1OKDA 2X49A 1GSEA 4MNNA 1JZRA 3M9JA 2HRAA 4IN0A 4MK3A 1HYUA 2GT6A 4POKA 2WRTA 4HU7A 2LSTA 2MBTA 2MMAA 6GSWA 1ZCPA 2WZ9A 5IO0A 4YKGA 4MP4A 2V6OA 2WFCA 5KN2A 2LS5A 3KP8A 2WULA 2LTKA 2GQMA 1XWGA 2FWHA 5DQSA 2VL2C 4BA7A 2VAFA 5GAND 1SKRB 4XS1A 3I69A 2QC7A 1Y6EA 5CP1A 3CYNA 3GMFA 4KSMA 2YWMA 4KAEA 3CTGA 3LQ7A 5ENUA 1K3OA 3FR9A 4OFNA 1GSSA 3GURA 3N5OA 4PX1A 2IL3A 3KZQA 3VLNA 2VLUA 2F51A 3GNJA 1B9YC 20GSA 5KOXA 2JSYA 3R2QA 3SBCA 1U3IA 2B3SA 4K7IA 4IELA 2YZUA 1MEKA 1K0MA 2CVDA 3ZZXA 3BJ5A 3C1SA 5DJMA 5BMUA 1FOHA 3L9VA 1EOGA 4IJIA 1SJIA 1GSQA 1FO5A 1TU7A 3TKSA 4TR3A 3TKSE 2C3QA 3O3TA 4MF6A 1Z7RA 3HZ4A 5D9VA 3TOUA 1AIUA 3P90A 1BG5A 3C8EA 1M99A 1M2DA 5JCGA 1O7UA 5GZZB 4GRFA 3NIVA 3ZMKA 2VL9A 2MZCA 2VL3A 3U5RE 4MJBA 3CRTA 2KHPA 2ALBA 3ZVJD 3HY2A 1K3YA 7GSSA 3ZREA 1ZGNA 3IRAA 2LJKA 5ABRA 3KTBA 3EU4A 1WJKA 4JBBA 2VD1A 3FR6A 5AIVA 3TRXA 4FYBA 4IKHA 3KMOA 2H01A 3CSIA 4EF0A 3QAWA 4AJ6A 2FD3A 2H6XA 4ECCA 5G5EA 2H30A 1X0RA 1WIKA 2OE1A 3QCPA 2KOKA 1A23A 2FNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OCF A;  4YAP A;  2GLR A;  2JAD A;  3L0H A;  3DIE A;  5JCU A;  2IIY A;  3VWU A;  3V1W A;  3DVW A;  4MJE A;  3GUS A;  3DYR A;  2DLX A;  2HXK A;  5B6M A;  1YKA A;  2IN3 A;  5DAK B;  2B1L A;  5CNW A;  4G19 A;  4L0U A;  2E7P A;  4JU5 A;  2HNL A;  1TRV A;  1T4Z A;  1MTC A;  2XBI A;  4PQI A;  1S3A A;  4NXI A;  4CHS A;  1BED A;  4OO4 A;  2FWG A;  1GSF A;  4D73 B;  1V57 A;  2NBS A;  3F9U A;  3HXS A;  4POB A;  5CRG A;  4EDZ A;  1ON4 A;  2HZF A;  1ZZY A;  4KH7 A;  3MNG A;  5DJL A;  3Q18 A;  2H76 A;  2VLT A;  1MDJ A;  4LL1 B;  1OC3 A;  3OR5 A;  3FK8 A;  1M0U A;  2CX3 A;  1EZK A;  4RI6 A;  5ECK B;  3DGQ A;  2F3M A;  1F2E A;  4V2M A;  5CYY A;  3F4S A;  3LYK A;  4Q5N A;  1XWA A;  2LUS A;  2N5F A;  1TW9 A;  2R2J A;  2LQQ A;  1AQW A;  1M9A A;  13GS A;  2H0G A;  1YY7 A;  3C1R A;  3IAS 2;  3M0F A;  4FO5 A;  1TKD B;  1TI1 A;  4EE0 A;  1TK5 B;  3DVX A;  3GIX A;  2HI7 A;  1TTZ A;  4KX4 A;  3C73 A;  4RUV A;  2A2R A;  1FAA A;  2PUK C;  1V9W A;  2IPA A;  2FY6 A;  4TXO B;  4WEY A;  1KBN A;  3VWV A;  3GKN A;  2LQO A;  4WR4 A;  2I9H A;  1ZL9 A;  1BYE A;  5IOX A;  2R6K A;  2DSA A;  1B4P A;  1IYI A;  2FLS A;  1O6J A;  3CSJ A;  4X43 A;  2YN1 A;  5D96 A;  1EGR A;  1SYR A;  1XVQ A;  3BCI A;  1F3A A;  4ECJ A;  5COH A;  3TOT A;  2C0D A;  4KND A;  3ZRD A;  2PWJ A;  1PX7 A;  1GUK A;  2L6D A;  3K8N A;  2H6Z A;  4TW5 A;  3S9F A;  1FOV A;  4NMU A;  5KEJ A;  5EL8 A;  4JR4 A;  2QGV A;  1K0N A;  3SWL A;  4KSO A;  1EOH A;  4BPY A;  2N5A A;  4GWR A;  2VLV A;  2I4A A;  2P0G A;  5J3R A;  2X64 A;  1SL2 B;  1T1V A;  3QDN A;  4EVM A;  1T7P B;  1V98 A;  3GV1 A;  5G2Z A;  3J7Y k;  3DXB A;  3US3 A;  1BAY A;  2K8S A;  2YWI A;  2AJQ B;  2F8F A;  4LA1 A;  2CT6 A;  2LRT A;  2YV7 A;  3I9V 2;  4HI7 A;  3APS A;  1DBY A;  5DCH A;  1O81 A;  2X8H A;  3QOU A;  2B7K A;  1X9W B;  4TR1 A;  2HFD A;  2R4V A;  3I6A A;  1SK1 A;  3KCM A;  4OCE A;  2H75 A;  3D4M A;  1BQ7 A;  1YEX A;  2EIQ A;  2C0F A;  1XW5 A;  5F05 A;  2JL4 A;  1G6Y A;  3FYG A;  1WPI A;  3D5J A;  2LRN A;  3EMP A;  3N9J A;  4L8E A;  3KXO A;  2IFQ B;  3GL3 A;  1GP1 A;  4BWS A;  2GZP A;  1NM3 A;  5ECP B;  3KH9 A;  1SYX A;  1HNC A;  4AJ8 A;  2WDU A;  5ECM B;  1DE2 A;  1BX9 A;  4OD7 A;  3VWX A;  4EC0 A;  2VCQ A;  2PGT A;  2C0E A;  4HUA A;  4HU9 A;  4V1A g;  5AIX A;  3ZIJ A;  3UJ1 A;  2CZ2 A;  4MMM A;  4TVE A;  2YCD A;  1S3D A;  3GH6 A;  3M1G A;  1A0R P;  1ERU A;  3F6F A;  3RPP A;  4DEJ A;  1GLQ A;  3DD3 A;  4MF7 A;  5A5K A;  3HVS A;  2PU9 C;  3VPT A;  4F0C A;  1Q98 A;  1GLP A;  4OO5 A;  2JU5 A;  3FZ9 A;  1ILO A;  3TKR A;  2AYT A;  1JZD A;  1F37 A;  5IMV A;  2YJH A;  4IW9 A;  4ZXG A;  5HR2 A;  4MPG A;  4F03 A;  4EL1 A;  1O85 A;  4MZW A;  2L5L A;  2VM2 A;  3ZML A;  5IM9 A;  1SD8 A;  2QKE A;  3MAK A;  5A4W A;  2X99 A;  3TJF A;  5DBQ A;  5CAX A;  5ECQ B;  1LJR A;  1GSU A;  3H4K A;  1VF2 A;  5G1K A;  2HZE A;  1HNA A;  2K9F A;  1AAZ A;  3LXT A;  4TR1 B;  2HE3 A;  4HDE A;  1A2M A;  3KTL A;  4K7O A;  1EWX A;  4XRD A;  1AXD A;  2D2Z A;  2IMK A;  5ECL B;  5J5N A;  5B8A A;  4FH8 A;  1SU9 A;  4YQV A;  1ACV A;  3W8S A;  4N0Z A;  1AW9 A;  3H1N A;  4GXZ A;  3EVI A;  2J23 A;  11GS A;  2B5Y A;  5F8B A;  1HQO A;  1XZO A;  4N10 A;  2GGT A;  3G9B A;  3WT2 A;  8GSS A;  5J9B A;  4PUA A;  4QL7 A;  4PUR A;  4NV2 A;  3QR6 A;  1U87 A;  4WKW A;  2J9H A;  1MD3 A;  1TOF A;  2B6M A;  2H0I A;  1K0D A;  2BMX A;  1DUG A;  2MMO A;  5AIS A;  2VIM A;  5L71 A;  5G1L A;  2O85 A;  3D4T A;  1PSQ A;  2VCV A;  3F3Q A;  4FIW A;  1A8L A;  2OE3 A;  5GAP D;  2C8U A;  4TRX A;  4EUY A;  3RHB A;  2V2G A;  5KN1 A;  3FEU A;  1ERT A;  1YDK A;  3ZFL A;  5HFG A;  4F82 A;  2RUF A;  3GTU B;  5GST A;  1QUW A;  2CZ3 A;  2VOC A;  3EU3 A;  4EO3 A;  3LOR A;  1PD2 1;  2ZUP A;  2LJA A;  2F9S A;  4ZB9 A;  2FGX A;  3FW2 A;  4AGS A;  1EV9 A;  2LV3 A;  4AF2 A;  2HZE B;  5ELG A;  5C00 A;  3ZYW A;  2HYX A;  3W8J A;  5G5F A;  4KGI A;  3LG6 A;  1W89 A;  2RII A;  4XIH A;  3L9U A;  4HQZ A;  2JAC A;  5DQY A;  3A2X A;  2LNS A;  4XS4 B;  2F8A A;  3HD5 A;  1V2A A;  2YWN A;  4X1U A;  4O7H A;  2HRF A;  2PVQ A;  2DJ3 A;  4O5R A;  4GF0 A;  3TUE A;  2KLX A;  1X5E A;  4N0V A;  1EGO A;  5DAK A;  3ZTL A;  4WET A;  4NV5 A;  4TN8 A;  4EXJ A;  2AHE A;  1PKW A;  4J2F A;  1AQV A;  4ZB6 A;  1XXU A;  2WS2 A;  1VF1 A;  4D73 A;  4JZQ A;  3APQ A;  3P8W A;  3UVH A;  1EP8 A;  1UVZ A;  2XBQ A;  5HQP A;  3Q6O A;  2DBC A;  4MH3 A;  2YV9 A;  2DIY A;  19GS A;  5D9T A;  4MLY A;  1OC9 B;  4XHM A;  4RQR A;  3H8Q A;  1ZYE A;  4ILF A;  1QFN A;  3LYP A;  2NTO A;  2QSI A;  4HS1 A;  2EIR A;  4YQU A;  3D21 A;  4IP6 A;  3E3E A;  4PUF C;  3LWA A;  3F0I A;  5EPF A;  2GTU A;  3EWL A;  4GSN A;  1BJX A;  5J9C A;  2VUP A;  3EC3 A;  5ECO B;  3IDV A;  2EIO A;  4MDC A;  5IPH A;  2RM5 A;  3PR8 A;  2C4J A;  1OE8 A;  5D73 A;  1TJD A;  2A2S A;  4TXO A;  5KN3 A;  3GX0 A;  1GH2 A;  1I9D A;  4JE1 A;  3IBH A;  2CQ9 A;  1ZMA A;  3ME7 A;  5DAL B;  4GSS A;  1XOB A;  5GSS A;  3A3T A;  3GHA A;  4MA9 A;  4K0N A;  3KIJ A;  18GS A;  3VI5 A;  5CRW A;  2FA4 A;  3ERG A;  1AQX A;  4LMW A;  2YNX A;  1G7E A;  1Z3E A;  4Q5F A;  1KTE A;  5B8B A;  3HJP A;  2I81 A;  1TRU A;  4YAV A;  5CRH A;  1M7T A;  1NHY A;  1SD9 A;  4ID0 A;  3ZIT A;  1R4W A;  4F9Z A;  3FR3 A;  2OAC A;  4GLT A;  2XC2 A;  4G2E A;  5CRD A;  2AAW A;  1EEM A;  4AJ7 A;  2FCH A;  1OC8 A;  4DSR A;  1J08 A;  4BVY A;  3GFK A;  4HOJ A;  2R3X A;  4FYC A;  2DML A;  2NVL A;  5IMC A;  4XTS A;  4HZ2 A;  4PGT A;  2VL2 A;  2R37 A;  1QMV A;  3CXG A;  3DML A;  1PA3 A;  1H75 A;  4ACS A;  1Z9H A;  3GRX A;  2DJ2 A;  12GS A;  2FUG 2;  2O89 A;  4TR4 A;  4ECI A;  4RQX A;  5D8I A;  4GQC A;  2K6V A;  1T4Y A;  3NOF A;  3ME8 A;  3U6V A;  3D0Z A;  1LBK A;  4IP1 A;  4G9H A;  4HJ2 A;  3UOM A;  5JCW A;  2IFQ A;  1TRS A;  3KD0 A;  2YAN A;  3Q19 A;  2H19 A;  3ZVJ A;  3EE2 A;  4HQS A;  2ES7 A;  1S3C A;  3IA1 A;  1OKT A;  5J4U A;  3FRC A;  1YF0 A;  2VCT A;  3VWW A;  1DSB A;  4EKZ A;  4I2U A;  5CO3 A;  4J56 E;  1UN2 A;  2H6Y A;  2IMF A;  1QGV A;  4N30 A;  5ECR B;  1XIY A;  2LJR A;  2OKA A;  2CVK A;  4CW9 A;  3LFL A;  1E6B A;  5EVO A;  5F0G A;  3KH7 A;  2GS3 A;  3GA4 A;  4I2T A;  6GSV A;  4L5L A;  1A0F A;  2H1G A;  2KP1 A;  2CVB A;  1X9M B;  3HJO A;  3BD2 A;  2H0H A;  3HJM A;  4ZL7 A;  2FA8 A;  1E2Y A;  1XVW A;  2O87 A;  5H5S A;  2C0G A;  1Z5Y E;  1C72 A;  1EP7 A;  1SL0 B;  3QFB C;  1YEP A;  3HZ8 A;  3AY8 A;  4NHW A;  2P5R A;  4DVC A;  2ON7 A;  2YJ7 A;  3IK7 A;  3IXR A;  4MJC A;  2C80 A;  4NPB A;  3QD9 A;  4ML6 A;  1AUC A;  1XFL A;  5JWR B;  1PL1 A;  2LNT A;  3ZL5 A;  2YP6 A;  4IVF A;  4MAB A;  5HFK A;  3GST A;  3BOA A;  2KUC A;  4PNF A;  3HKR A;  1M9B A;  4BWQ A;  2ON5 A;  1FB6 A;  2DJJ A;  2TRC P;  3A2V A;  4ZBA A;  3H93 A;  2DJ0 A;  1I5G A;  3HYP A;  3UVT A;  2E2M A;  4IQA A;  5IMD A;  3TJG A;  3WT1 A;  3IV4 A;  1NHO A;  1U88 A;  3WGE A;  3WGX A;  2NDO A;  4MZC A;  4X0X A;  5B7C A;  3W6G A;  3PIN A;  2PER A;  2AUV A;  1O8X A;  2PN8 A;  1V58 A;  1OAZ A;  2REM A;  2BJX A;  4KDU A;  5DVB A;  5F07 A;  2VD0 A;  4K1F A;  5B6N A;  1Z6N A;  3UAP A;  4H86 A;  2DJK A;  2FWE A;  2GQK A;  2WCI A;  1GTI A;  1T3B A;  1PRX A;  3GTU A;  3GL5 A;  5IQY A;  4YQM A;  2GQL A;  3HHV A;  4WBR D;  5IMZ A;  4ZL8 A;  2RM6 A;  1GUH A;  3TKS C;  3ERW A;  3IR4 A;  1ABA A;  3IAM 2;  4ZIJ A;  4DSS B;  1G6W A;  2CA8 A;  3G7Y A;  3GKX A;  1A2L A;  5FHI A;  1T8E B;  3F63 A;  1WRY A;  3MSZ A;  5D9X A;  22GS A;  1HD2 A;  4WF4 A;  2G0F A;  5LCZ A;  4XS4 A;  3DRN A;  5A4U A;  4RI7 A;  1J0F A;  1PGT A;  3TCO A;  3HDC A;  4KUN A;  3WGD A;  1F9M A;  5AN1 A;  1O8W A;  2E0Q A;  4IJ3 A;  2V32 A;  4TXV A;  4MJA A;  3HCZ A;  4NHZ A;  3IPZ A;  1K0A A;  5IPG A;  3FY7 A;  3QAG A;  5DDL A;  4ML1 A;  3LGC A;  2OAD A;  3IOS A;  5ECH B;  2L57 A;  5ELA A;  3RHC A;  3TGZ A;  4HJM A;  1PMT A;  2Z9S A;  4KW6 A;  3QAV A;  1USB A;  2VCZ A;  4MPF A;  5HFI A;  1A2J A;  2GVP A;  4JR6 A;  4O92 A;  1HNB A;  1G0T A;  4Q5Q A;  1OC9 A;  1WP0 A;  5JWO B;  2OBK A;  2JZS A;  3FHK A;  1SEN A;  4HZ4 A;  4ISD A;  3NZN A;  1B8X A;  4GST A;  3GKM A;  2H8L A;  2OE0 A;  2YWO A;  5INY A;  1PX6 A;  3RDW A;  3G7I A;  1IYH A;  2R5G A;  1TI3 A;  16GS A;  1T00 A;  3P7X A;  3KMN A;  2TIR A;  2CX4 A;  2FWF A;  3L9S A;  4LLR A;  2GT5 A;  5IOW A;  3TJK A;  1CQH A;  1YZX A;  1Y25 A;  3M9K A;  2H1D A;  1RK4 A;  5D93 A;  2AV4 A;  4K9Z A;  5DCG A;  1URM A;  4PXO A;  3ZLP A;  1PN9 A;  1PQN A;  2MMN A;  5DAL A;  2IJY A;  2L59 A;  1B48 A;  2C1Y A;  1EV4 A;  2B5X A;  3TKQ A;  2I3Y A;  4XCS A;  1YJ6 A;  2A4V A;  6GST A;  5F06 A;  2L5O A;  1XWK A;  2C3N A;  1EEJ A;  1DE1 A;  1Z7P A;  5KN0 A;  2H72 A;  3EYT A;  3GH9 A;  4TKY A;  3IHQ A;  1F3B A;  1VF3 A;  1K3L A;  2H66 A;  9GSS A;  1QQ2 A;  4I8B A;  4E8H A;  1JZO A;  3HVV A;  1ZYQ B;  4IQ1 A;  5HR3 A;  1R5P A;  3KP9 A;  4MCU A;  3LEF A;  3L78 A;  2DC5 A;  2TRX A;  4KDX A;  2EC4 A;  2VM1 A;  2GDR A;  4QQ7 A;  2JZT A;  2FHE A;  4NAX A;  4KA0 A;  3ZIV A;  2JSZ A;  1R7H A;  1QXH A;  1N8J A;  3F3R A;  1AC1 A;  1GSY A;  1SK0 A;  2I1U A;  3CMI A;  1XW6 A;  1XOA A;  1R5A A;  2RLI A;  3P2A A;  3TJB A;  4K2D A;  2ZNM A;  2K8V A;  2H73 A;  3BBY A;  1H4O A;  3EMX A;  1GUM A;  2WB9 A;  3C7M A;  1OYJ A;  5ECN B;  2M46 A;  3DKS A;  2BTO T;  4QL9 A;  2M80 A;  3A5W A;  4KE3 A;  3G7J A;  4KCE A;  3UEM A;  5J41 A;  4I97 A;  1K0C A;  5G31 A;  5A4V A;  4ZBD A;  3I43 A;  4K8M A;  2L4C A;  2VO4 A;  1PKZ A;  1TP9 A;  2HT9 A;  2ZCT A;  4TR0 A;  4LL4 B;  5E59 A;  4KB3 A;  2B7J A;  1K0O A;  3DWV A;  3ERF A;  5ECS A;  1N2A A;  1MD4 A;  2OA7 A;  3D22 A;  2K18 A;  1MDI A;  1MDK A;  3L4N A;  4MZB A;  1XPV A;  2GSS A;  1TK0 B;  4BL7 A;  1W4V A;  3O6T A;  2NPB A;  5IO2 A;  5C04 A;  1JHB A;  2CV4 A;  4K0G A;  1GTU A;  2GST A;  1J9B A;  1R26 A;  1FG4 A;  2E2G A;  2JZR A;  3MDK A;  3TRP A;  2M72 A;  3UMA A;  3FZA A;  1GTA A;  4IS0 A;  4WXT A;  3KM6 A;  1TU8 A;  4WF5 A;  3VFI A;  4PQH A;  4ZB8 A;  6GSY A;  2HLS A;  3RBT A;  3M3M A;  3IK9 A;  4IHU A;  5FWG A;  3TB2 A;  4OMV A;  1ST9 A;  4L5O A;  3A2W A;  2OBI A;  5IMF A;  2MMZ A;  3C71 A;  2XPD A;  3UBK A;  3F6D A;  4KCA A;  3GSS A;  2MYG A;  3TKP A;  3O76 A;  3GN3 A;  4LMV A;  4ZIL A;  1Q4J A;  1Z6M A;  5D9W A;  4V2N A;  2GSQ A;  2DJ1 A;  1GUL A;  2V6K A;  3KGK A;  2IME A;  3KJY A;  1XW9 A;  1ERW A;  1PL2 A;  1SKW B;  1ZOF A;  1G7O A;  1GWC A;  1GTB A;  5LD0 A;  3UL3 A;  3JCM L;  4ZBB A;  4OFT A;  4CDO A;  3DEX A;  4POL A;  3GKK A;  2X8G A;  1YQ1 A;  3TJJ A;  3LJR A;  4ULX A;  3QMX A;  2GZY A;  3E0U A;  1CQG A;  1THO A;  2HRN A;  1A24 A;  1TK8 B;  3ZFB A;  4XS6 A;  2KP2 A;  3ISO A;  2H1B A;  2HSY A;  1M2A A;  1B4Q A;  1K0B A;  4K7N A;  3IC4 A;  1TDI A;  1SK2 A;  2H70 A;  3VPQ A;  1XWB A;  3CTF A;  3QFA C;  2PMT A;  4BVX A;  1A8Y A;  5H5R A;  2N5B A;  1TRW A;  2YOI A;  3IE3 A;  1WOU A;  5AGY A;  5IIZ A;  1U3A A;  14GS A;  3MWH A;  3LXZ A;  2C3T A;  6GSS A;  3BCK A;  4DSS A;  4K6X A;  5E4W A;  3HVX A;  1GRX A;  4O32 A;  3FZ5 A;  3UIW A;  5ECI B;  10GS A;  3E9J B;  1UC7 A;  4G10 A;  2PBJ A;  3GX8 A;  4WBJ A;  2B5E A;  2IMD A;  1JFU A;  3UBL A;  2IWT A;  4Q5R A;  1JZW A;  4MH2 A;  4L0W A;  3LSZ A;  2DMM A;  3D6I A;  4GCI A;  2G2Q A;  4IGJ A;  3HA9 A;  3F8U A;  3M8N A;  1ML6 A;  3EIN A;  1WMJ A;  1SJZ A;  1O73 A;  2LKU A;  2YZH A;  4N11 A;  3RPN A;  5ID2 A;  3UAR A;  1SKS B;  3J7Y b;  2IMI A;  4Z7X A;  17GS A;  2B1K A;  2O8V B;  3PGT A;  2YPM A;  4V2L A;  3F4T A;  4GQF A;  1X5D A;  3FZ4 A;  1XCC A;  1VRS D;  1YKC A;  1GNE A;  4PQ1 A;  5EY6 A;  2VCW A;  2LRC A;  1OE7 A;  2H74 A;  2GSR A;  4OWY A;  2PPT A;  3VK9 A;  2L6C A;  1V40 A;  2V41 A;  1FB0 A;  5H5Q A;  2VCX A;  3EUR A;  3H79 A;  4FYU A;  1SJ6 A;  3CSH A;  1M2B A;  1UA5 A;  1XBS A;  4ECB A;  5IMA A;  4JRR A;  1RW1 A;  2XPE A;  1FW1 A;  4EDY A;  3F4R A;  1B9X C;  1JLV A;  2L4Q A;  1YF1 A;  1TXX A;  2LEG A;  4PNG A;  4KDY A;  4XRA A;  3VI7 A;  1WE0 A;  2P5Q A;  2O7K A;  5CRE A;  1VGL A;  5G30 A;  2CAQ A;  1FHE A;  2XHF A;  3WYW A;  2MBS A;  2GZZ A;  3PH9 A;  4IBP A;  3WD6 A;  3TRQ A;  1THX A;  1OVN A;  1FVK A;  4POM A;  2DIZ A;  2V1M A;  2PVO C;  4F0B A;  1JLW A;  4DSQ A;  6GSU A;  4JED A;  2H71 A;  4ZL9 A;  1VF4 A;  3QPM A;  4TOP A;  4MF5 A;  2RUE A;  1X5C A;  2CAI A;  4F2I A;  3APO A;  4HEA 2;  2OJL A;  3VUR A;  1WWJ A;  5HR1 A;  1FVJ A;  4J57 E;  2HSH A;  3TDG A;  5LNK e;  1KNG A;  2P31 A;  5ID2 B;  1NW2 A;  3FKF A;  5JWQ B;  6GSX A;  1LU4 A;  5FT3 A;  1KEB A;  4P3Y B;  1X9S B;  4I6X A;  4NWY A;  4V1A p;  1F6M C;  2X8C A;  1GL8 A;  3RAZ A;  4YH2 A;  3KEB A;  1QK8 A;  4GTU A;  1GNW A;  4I5Q A;  1U6T A;  2WGR A;  2WJU A;  3GYK A;  2H1A A;  4E8E A;  1ERV A;  3CRU A;  3CBU A;  1GSD A;  5HR0 A;  4WR5 A;  2AB6 A;  3ED3 A;  3Q74 A;  1SL1 B;  4OFM A;  1XWC A;  1NSW A;  1RQM A;  1OKD A;  1GSE A;  1JZR A;  3M9J A;  4IN0 A;  4MK3 A;  1HYU A;  2GT6 A;  4POK A;  2WRT A;  4HU7 A;  2LST A;  2MBT A;  2MMA A;  6GSW A;  1ZCP A;  2WZ9 A;  5IO0 A;  4MP4 A;  2V6O A;  2WFC A;  5KN2 A;  2LS5 A;  3KP8 A;  2WUL A;  2LTK A;  2GQM A;  1XWG A;  2FWH A;  5DQS A;  2VL2 C;  4BA7 A;  2VAF A;  5GAN D;  1SKR B;  4XS1 A;  3I69 A;  2QC7 A;  1Y6E A;  5CP1 A;  3CYN A;  3GMF A;  4KSM A;  2YWM A;  4KAE A;  3CTG A;  3LQ7 A;  5ENU A;  1K3O A;  3FR9 A;  4OFN A;  1GSS A;  3GUR A;  3N5O A;  4PX1 A;  2IL3 A;  3KZQ A;  3VLN A;  2VLU A;  2F51 A;  3GNJ A;  1B9Y C;  20GS A;  2JSY A;  3R2Q A;  3SBC A;  1U3I A;  2B3S A;  4K7I A;  4IEL A;  2YZU A;  1MEK A;  1K0M A;  2CVD A;  3ZZX A;  3BJ5 A;  3C1S A;  5DJM A;  3L9V A;  1EOG A;  4IJI A;  1SJI A;  1GSQ A;  1FO5 A;  1TU7 A;  3TKS A;  4TR3 A;  3TKS E;  2C3Q A;  3O3T A;  4MF6 A;  1Z7R A;  3HZ4 A;  5D9V A;  3TOU A;  1AIU A;  3P90 A;  1BG5 A;  3C8E A;  1M99 A;  1M2D A;  5JCG A;  1O7U A;  5GZZ B;  4GRF A;  3NIV A;  3ZMK A;  2VL9 A;  2MZC A;  2VL3 A;  3U5R E;  4MJB A;  3CRT A;  2KHP A;  2ALB A;  3ZVJ D;  3HY2 A;  1K3Y A;  7GSS A;  3ZRE A;  1ZGN A;  3IRA A;  2LJK A;  5ABR A;  3KTB A;  3EU4 A;  1WJK A;  4JBB A;  2VD1 A;  3FR6 A;  5AIV A;  3TRX A;  4FYB A;  4IKH A;  3KMO A;  2H01 A;  3CSI A;  4EF0 A;  3QAW A;  4AJ6 A;  2FD3 A;  2H6X A;  4ECC A;  5G5E A;  2H30 A;  1X0R A;  1WIK A;  2OE1 A;  3QCP A;  2KOK A;  1A23 A;  2FNO A; 
#chains in the Genus database with same CATH topology
 4OCF A;  4YAP A;  2GLR A;  2JAD A;  3L0H A;  3DIE A;  5JCU A;  2IIY A;  3VWU A;  3V1W A;  3DVW A;  4MJE A;  3GUS A;  3DYR A;  2DLX A;  4EIP A;  2HXK A;  5B6M A;  1YKA A;  2IN3 A;  5DAK B;  2B1L A;  5CNW A;  4G19 A;  4L0U A;  2E7P A;  4JU5 A;  2HNL A;  1TRV A;  1T4Z A;  1MTC A;  2XBI A;  4PQI A;  1S3A A;  4NXI A;  4CHS A;  1BED A;  4OO4 A;  2FWG A;  1GSF A;  4D73 B;  1V57 A;  2NBS A;  3F9U A;  3HXS A;  4POB A;  5CRG A;  4EDZ A;  3FMW A;  1ON4 A;  2HZF A;  1ZZY A;  4KH7 A;  3MNG A;  5DJL A;  3Q18 A;  2H76 A;  2VLT A;  1MDJ A;  4LL1 B;  1OC3 A;  3OR5 A;  3FK8 A;  1M0U A;  2CX3 A;  1EZK A;  4RI6 A;  5ECK B;  3DGQ A;  2F3M A;  1F2E A;  4V2M A;  5CYY A;  4YKF A;  3F4S A;  3LYK A;  4Q5N A;  1XWA A;  2LUS A;  2N5F A;  1TW9 A;  2R2J A;  2LQQ A;  1AQW A;  1M9A A;  13GS A;  2H0G A;  1YY7 A;  3C1R A;  3IAS 2;  3M0F A;  2HSM A;  4FO5 A;  1TKD B;  1TI1 A;  4EE0 A;  1TK5 B;  3DVX A;  3GIX A;  2HI7 A;  2HRK A;  1TTZ A;  4KX4 A;  3C73 A;  4RUV A;  2A2R A;  1FAA A;  2PUK C;  1V9W A;  2IPA A;  2FY6 A;  4TXO B;  4WEY A;  1KBN A;  3EPT A;  3VWV A;  3GKN A;  4G0L A;  2LQO A;  4WR4 A;  2I9H A;  1ZL9 A;  1BYE A;  5IOX A;  2R6K A;  2DSA A;  1B4P A;  1IYI A;  2FLS A;  1O6J A;  3CSJ A;  4X43 A;  4CY8 A;  2YN1 A;  5D96 A;  1EGR A;  1SYR A;  1XVQ A;  3BCI A;  1F3A A;  4ECJ A;  5COH A;  3TOT A;  2C0D A;  4KND A;  3ZRD A;  2PWJ A;  1PX7 A;  1GUK A;  2L6D A;  3K8N A;  2H6Z A;  4TW5 A;  3S9F A;  1FOV A;  4NMU A;  5KEJ A;  5EL8 A;  4JR4 A;  2QGV A;  4BVY B;  1K0N A;  2DKI A;  3SWL A;  4KSO A;  1EOH A;  4BPY A;  2N5A A;  4GWR A;  2VLV A;  2I4A A;  2P0G A;  5J3R A;  2X64 A;  1SL2 B;  1T1V A;  3QDN A;  4EVM A;  1T7P B;  1V98 A;  3GV1 A;  5G2Z A;  3J7Y k;  3DXB A;  3US3 A;  1BAY A;  2K8S A;  2YWI A;  2AJQ B;  2F8F A;  4LA1 A;  2CT6 A;  2LRT A;  2YV7 A;  3R3E A;  3I9V 2;  4HI7 A;  3APS A;  1DBY A;  5DCH A;  1O81 A;  2X8H A;  3QOU A;  2B7K A;  1X9W B;  4TR1 A;  2HFD A;  2R4V A;  3I6A A;  1SK1 A;  3KCM A;  4OCE A;  2H75 A;  3D4M A;  1BQ7 A;  1YEX A;  2EIQ A;  2C0F A;  1XW5 A;  1ZYN A;  5F05 A;  2JL4 A;  1G6Y A;  3FYG A;  1WPI A;  3D5J A;  2LRN A;  3EMP A;  3N9J A;  4L8E A;  3KXO A;  2IFQ B;  3GL3 A;  1GP1 A;  4BWS A;  2GZP A;  1NM3 A;  5ECP B;  3KH9 A;  1SYX A;  1HNC A;  4AJ8 A;  2WDU A;  5ECM B;  1DE2 A;  1BX9 A;  4OD7 A;  3VWX A;  4EC0 A;  2VCQ A;  2PGT A;  2C0E A;  4HUA A;  4HU9 A;  4V1A g;  5AIX A;  3ZIJ A;  3HVN A;  3UJ1 A;  2CZ2 A;  4MMM A;  4TVE A;  1XG8 A;  2YCD A;  1S3D A;  3GH6 A;  3M1G A;  1A0R P;  1ERU A;  3F6F A;  3RPP A;  4DEJ A;  1GLQ A;  3DD3 A;  4MF7 A;  5A5K A;  3HVS A;  2PU9 C;  3VPT A;  4F0C A;  1Q98 A;  1GLP A;  4OO5 A;  2JU5 A;  3FZ9 A;  1ILO A;  3TKR A;  2AYT A;  1JZD A;  1F37 A;  5IMV A;  2YJH A;  4IW9 A;  4ZXG A;  5HR2 A;  4MPG A;  4F03 A;  4EL1 A;  1O85 A;  4MZW A;  2L5L A;  2VM2 A;  3ZML A;  5IM9 A;  1SD8 A;  2QKE A;  3MAK A;  5A4W A;  2X99 A;  3TJF A;  5DBQ A;  5CAX A;  5ECQ B;  1LJR A;  1GSU A;  3H4K A;  1VF2 A;  5G1K A;  2HZE A;  1HNA A;  2K9F A;  1AAZ A;  3LXT A;  4TR1 B;  2HE3 A;  4HDE A;  1A2M A;  3KTL A;  4K7O A;  1EWX A;  4XRD A;  1AXD A;  2D2Z A;  2IMK A;  5ECL B;  5J5N A;  5B8A A;  4FH8 A;  1SU9 A;  4YQV A;  1ACV A;  2QA2 A;  3W8S A;  3A5I A;  4N0Z A;  1AW9 A;  3H1N A;  4KF9 A;  5KOW A;  4GXZ A;  3EVI A;  2J23 A;  11GS A;  2B5Y A;  5F8B A;  1HQO A;  1XZO A;  4N10 A;  2GGT A;  3G9B A;  3WT2 A;  8GSS A;  5J9B A;  4PUA A;  4QL7 A;  4PUR A;  4NV2 A;  3QR6 A;  1U87 A;  4WKW A;  2J9H A;  1MD3 A;  1TOF A;  2B6M A;  2H0I A;  1K0D A;  2BMX A;  1DUG A;  2MMO A;  5AIS A;  2VIM A;  5L71 A;  5G1L A;  2O85 A;  3D4T A;  1PSQ A;  2VCV A;  3F3Q A;  4FIW A;  1A8L A;  2OE3 A;  5GAP D;  2C8U A;  4TRX A;  4EUY A;  3RHB A;  2A4H A;  2V2G A;  5KN1 A;  3FEU A;  1ERT A;  1YDK A;  3ZFL A;  5HFG A;  4F82 A;  2RUF A;  3GTU B;  5GST A;  1QUW A;  2CZ3 A;  2VOC A;  3EU3 A;  4EO3 A;  3LOR A;  1PD2 1;  2ZUP A;  2LJA A;  2F9S A;  4ZB9 A;  2FGX A;  3FW2 A;  4AGS A;  1EV9 A;  2LV3 A;  4AF2 A;  2HZE B;  5ELG A;  5C00 A;  3ZYW A;  2HYX A;  3W8J A;  5G5F A;  4KGI A;  3LG6 A;  1W89 A;  2RII A;  4XIH A;  3L9U A;  4HQZ A;  2JAC A;  5DQY A;  3A2X A;  2LNS A;  4XS4 B;  2F8A A;  3HD5 A;  1V2A A;  2YWN A;  4PTS A;  4O7H A;  4X1U A;  2HRF A;  2PVQ A;  2DJ3 A;  4O5R A;  1ZYP A;  4GF0 A;  3TUE A;  2KLX A;  1X5E A;  4N0V A;  1EGO A;  5DAK A;  3ZTL A;  4WET A;  4NV5 A;  4TN8 A;  4EXJ A;  2AHE A;  1PKW A;  4J2F A;  1AQV A;  4ZB6 A;  1XXU A;  2WS2 A;  1VF1 A;  4D73 A;  4JZQ A;  4HSC X;  3APQ A;  3P8W A;  3UVH A;  1EP8 A;  1UVZ A;  2XBQ A;  5HQP A;  3Q6O A;  2DBC A;  4MH3 A;  2R0C A;  2YV9 A;  2DIY A;  19GS A;  5D9T A;  4MLY A;  1OC9 B;  4XHM A;  4RQR A;  3H8Q A;  1ZYE A;  4ILF A;  1QFN A;  3LYP A;  2NTO A;  2QSI A;  4HS1 A;  2EIR A;  4YQU A;  3D21 A;  4IP6 A;  3E3E A;  4PUF C;  3LWA A;  3F0I A;  5EPF A;  2GTU A;  3EWL A;  4GSN A;  1BJX A;  5J9C A;  2VUP A;  3EC3 A;  5ECO B;  3IDV A;  2EIO A;  4MDC A;  5IPH A;  2RM5 A;  3PR8 A;  2C4J A;  3LW9 A;  1OE8 A;  5D73 A;  1TJD A;  2A2S A;  4TXO A;  5KN3 A;  3GX0 A;  1GH2 A;  1I9D A;  4JE1 A;  3IBH A;  2CQ9 A;  1ZMA A;  3ME7 A;  5DAL B;  4GSS A;  1XOB A;  5GSS A;  3A3T A;  3GHA A;  4MA9 A;  4K0N A;  3KIJ A;  18GS A;  3VI5 A;  5CRW A;  2FA4 A;  3ERG A;  1AQX A;  4LMW A;  2YNX A;  1G7E A;  1Z3E A;  4Q5F A;  1KTE A;  5B8B A;  3HJP A;  2I81 A;  1TRU A;  4YAV A;  5CRH A;  1M7T A;  1NHY A;  1SD9 A;  4ID0 A;  3ZIT A;  1R4W A;  4F9Z A;  3FR3 A;  2OAC A;  4GLT A;  2XC2 A;  4G2E A;  5CRD A;  2AAW A;  1EEM A;  4AJ7 A;  2FCH A;  1OC8 A;  4DSR A;  1J08 A;  4BVY A;  4BIK A;  3GFK A;  4HOJ A;  2R3X A;  4FYC A;  2DML A;  2NVL A;  5IMC A;  4XTS A;  4HZ2 A;  4PGT A;  2VL2 A;  2R37 A;  1QMV A;  3CXG A;  3DML A;  1PA3 A;  1H75 A;  4ACS A;  1Z9H A;  3GRX A;  2DJ2 A;  12GS A;  2FUG 2;  2O89 A;  4TR4 A;  4ECI A;  4RQX A;  5D8I A;  4GQC A;  2K6V A;  1T4Y A;  3NOF A;  3ME8 A;  4Z2R A;  3U6V A;  3D0Z A;  1LBK A;  4IP1 A;  4G9H A;  4HJ2 A;  3UOM A;  5JCW A;  2IFQ A;  1TRS A;  3KD0 A;  2YAN A;  3Q19 A;  2H19 A;  3ZVJ A;  3EE2 A;  4HQS A;  2ES7 A;  1S3C A;  1PN0 A;  3IA1 A;  1OKT A;  5J4U A;  3FRC A;  1YF0 A;  2VCT A;  3VWW A;  1DSB A;  4EKZ A;  4I2U A;  5CO3 A;  4J56 E;  1UN2 A;  2H6Y A;  2IMF A;  1QGV A;  4N30 A;  5ECR B;  1XIY A;  2LJR A;  2OKA A;  2CVK A;  4CW9 A;  3LFL A;  1E6B A;  5EVO A;  5F0G A;  3KH7 A;  2GS3 A;  3GA4 A;  4I2T A;  6GSV A;  4L5L A;  1A0F A;  2H1G A;  2KP1 A;  2CVB A;  1X9M B;  3HJO A;  4BL7 B;  4G0K A;  3BD2 A;  2H0H A;  3HJM A;  4ZL7 A;  2FA8 A;  1E2Y A;  1XVW A;  2O87 A;  5H5S A;  2C0G A;  1Z5Y E;  1C72 A;  1EP7 A;  1SL0 B;  3QFB C;  1YEP A;  3HZ8 A;  3AY8 A;  4NHW A;  2P5R A;  4DVC A;  2ON7 A;  2YJ7 A;  3IK7 A;  3IXR A;  4MJC A;  2C80 A;  4NPB A;  3QD9 A;  4ML6 A;  1AUC A;  1XFL A;  5JWR B;  1PL1 A;  2LNT A;  3ZL5 A;  2YP6 A;  4IVF A;  4MAB A;  5HFK A;  3GST A;  3BOA A;  2KUC A;  4PNF A;  3HKR A;  1M9B A;  4BWQ A;  2ON5 A;  1FB6 A;  2DJJ A;  2TRC P;  3A2V A;  4ZBA A;  3H93 A;  2DJ0 A;  1I5G A;  2R0G A;  3HYP A;  3UVT A;  2E2M A;  4IQA A;  5IMD A;  3TJG A;  4O5Q A;  3WT1 A;  3IV4 A;  1NHO A;  1U88 A;  3WGE A;  3WGX A;  2NDO A;  4MZC A;  4X0X A;  5B7C A;  3W6G A;  3PIN A;  2PER A;  2AUV A;  1O8X A;  2PN8 A;  1V58 A;  1OAZ A;  2REM A;  2BJX A;  4KDU A;  5DVB A;  5F07 A;  2VD0 A;  3IC8 A;  4K1F A;  5B6N A;  1Z6N A;  3UAP A;  4H86 A;  2DJK A;  2FWE A;  2GQK A;  2WCI A;  1GTI A;  1T3B A;  1PRX A;  3GTU A;  3GL5 A;  4BVX B;  4YQM A;  5IQY A;  2GQL A;  3HHV A;  4WBR D;  4K2X A;  5IMZ A;  4ZL8 A;  2RM6 A;  1GUH A;  3TKS C;  3ERW A;  3IR4 A;  1ABA A;  3IAM 2;  4ZIJ A;  4DSS B;  1G6W A;  2CA8 A;  3G7Y A;  3GKX A;  1A2L A;  5FHI A;  1T8E B;  3F63 A;  1WRY A;  3MSZ A;  5D9X A;  22GS A;  1HD2 A;  4WF4 A;  2G0F A;  5LCZ A;  4XS4 A;  3DRN A;  5A4U A;  4RI7 A;  1J0F A;  1PGT A;  3TCO A;  3HDC A;  4KUN A;  3WGD A;  1F9M A;  5AN1 A;  1O8W A;  2E0Q A;  4IJ3 A;  2V32 A;  4TXV A;  4MJA A;  3HCZ A;  4NHZ A;  3IPZ A;  1K0A A;  5IPG A;  3FY7 A;  3QAG A;  5DDL A;  4ML1 A;  3LGC A;  2OAD A;  3IOS A;  5ECH B;  2L57 A;  5ELA A;  3RHC A;  3TGZ A;  4HJM A;  1PMT A;  2Z9S A;  4KW6 A;  3QAV A;  1USB A;  2VCZ A;  4MPF A;  5HFI A;  1A2J A;  2GVP A;  4JR6 A;  1PFO A;  4O92 A;  1HNB A;  1G0T A;  4Q5Q A;  1OC9 A;  1WP0 A;  5JWO B;  2OBK A;  2JZS A;  3FHK A;  1SEN A;  4HZ4 A;  4ISD A;  3NZN A;  1B8X A;  4GST A;  3GKM A;  2H8L A;  2OE0 A;  2YWO A;  5INY A;  1PX6 A;  3RDW A;  3G7I A;  1IYH A;  2R5G A;  1TI3 A;  16GS A;  1T00 A;  3P7X A;  3KMN A;  2TIR A;  2CX4 A;  2FWF A;  3L9S A;  4LLR A;  2GT5 A;  5IOW A;  3TJK A;  1CQH A;  1YZX A;  1Y25 A;  3M9K A;  2H1D A;  1RK4 A;  5D93 A;  2AV4 A;  4K9Z A;  5DCG A;  1URM A;  4PXO A;  3ZLP A;  1PN9 A;  1PQN A;  2MMN A;  5DAL A;  2IJY A;  2L59 A;  1B48 A;  2C1Y A;  1EV4 A;  2B5X A;  3TKQ A;  2I3Y A;  4Z2U A;  4XCS A;  1YJ6 A;  2A4V A;  6GST A;  5F06 A;  2L5O A;  1XWK A;  2C3N A;  1EEJ A;  1DE1 A;  1Z7P A;  5KN0 A;  2H72 A;  3EYT A;  3GH9 A;  4TKY A;  3IHQ A;  1F3B A;  1VF3 A;  1K3L A;  2H66 A;  9GSS A;  1QQ2 A;  4I8B A;  4E8H A;  1JZO A;  3HVV A;  1ZYQ B;  4IQ1 A;  5HR3 A;  1R5P A;  3KP9 A;  4MCU A;  3LEF A;  3L78 A;  2DC5 A;  2TRX A;  4KDX A;  2EC4 A;  2VM1 A;  2GDR A;  4QQ7 A;  2JZT A;  2FHE A;  4NAX A;  4KA0 A;  3ZIV A;  2JSZ A;  1R7H A;  1QXH A;  1N8J A;  3F3R A;  1AC1 A;  1GSY A;  1SK0 A;  2I1U A;  3CMI A;  1XW6 A;  3IHG A;  1XOA A;  1R5A A;  2RLI A;  3P2A A;  3TJB A;  4K2D A;  2ZNM A;  2K8V A;  5BRT A;  2H73 A;  3BBY A;  1H4O A;  3EMX A;  1GUM A;  2WB9 A;  3C7M A;  1OYJ A;  5ECN B;  2M46 A;  3DKS A;  2BTO T;  4QL9 A;  2M80 A;  3A5W A;  4KE3 A;  3G7J A;  4KCE A;  3UEM A;  5J41 A;  4I97 A;  1K0C A;  5G31 A;  5A4V A;  4ZBD A;  2R0P A;  3I43 A;  4K8M A;  2L4C A;  2VO4 A;  1PKZ A;  1TP9 A;  2HT9 A;  2ZCT A;  4TR0 A;  4K5S A;  4LL4 B;  5E59 A;  4KB3 A;  2B7J A;  1K0O A;  3DWV A;  3ERF A;  5ECS A;  1N2A A;  1MD4 A;  2OA7 A;  3D22 A;  2K18 A;  1MDI A;  1MDK A;  3L4N A;  4MZB A;  1XPV A;  2GSS A;  1TK0 B;  4BL7 A;  1W4V A;  4X4J A;  3O6T A;  2NPB A;  4Z2T A;  5IO2 A;  5C04 A;  1JHB A;  2CV4 A;  4K0G A;  1GTU A;  2GST A;  1J9B A;  1R26 A;  1FG4 A;  2E2G A;  2JZR A;  3MDK A;  3TRP A;  2M72 A;  4EIQ A;  3UMA A;  3FZA A;  1GTA A;  4IS0 A;  4WXT A;  3KM6 A;  1TU8 A;  4WF5 A;  3VFI A;  4PQH A;  4ZB8 A;  6GSY A;  2HLS A;  3RBT A;  3M3M A;  3IK9 A;  4IHU A;  5FWG A;  3TB2 A;  4OMV A;  1ST9 A;  4L5O A;  3A2W A;  2OBI A;  5IMF A;  2MMZ A;  3C71 A;  2XPD A;  3UBK A;  3F6D A;  4KCA A;  3GSS A;  2MYG A;  3TKP A;  3O76 A;  3GN3 A;  4LMV A;  4ZIL A;  1Q4J A;  1Z6M A;  5D9W A;  4V2N A;  2GSQ A;  2DJ1 A;  1GUL A;  2V6K A;  3KGK A;  2IME A;  3KJY A;  3CQF A;  1XW9 A;  1ERW A;  1PL2 A;  1SKW B;  1ZOF A;  1G7O A;  1GWC A;  1GTB A;  5LD0 A;  3UL3 A;  3JCM L;  4ZBB A;  4O5U A;  4OFT A;  4CDO A;  3DEX A;  4POL A;  3GKK A;  2X8G A;  1YQ1 A;  3TJJ A;  3LJR A;  4ULX A;  2A2P A;  3QMX A;  2GZY A;  3E0U A;  1CQG A;  1THO A;  2HRN A;  1A24 A;  1TK8 B;  3ZFB A;  4XS6 A;  2KP2 A;  3ISO A;  2H1B A;  2HSY A;  1M2A A;  1B4Q A;  1K0B A;  4K7N A;  3IC4 A;  1TDI A;  1SK2 A;  2H70 A;  3VPQ A;  1XWB A;  3CTF A;  3QFA C;  2PMT A;  4BVX A;  1A8Y A;  5H5R A;  2N5B A;  4CY6 A;  1TRW A;  2YOI A;  3IE3 A;  1WOU A;  5AGY A;  5IIZ A;  1U3A A;  14GS A;  3MWH A;  3LXZ A;  2C3T A;  6GSS A;  3BCK A;  4DSS A;  4K6X A;  5E4W A;  3HVX A;  1GRX A;  4O32 A;  3FZ5 A;  3UIW A;  5ECI B;  4K5R A;  10GS A;  3E9J B;  1UC7 A;  4G10 A;  2PBJ A;  3GX8 A;  4WBJ A;  2B5E A;  2IMD A;  1JFU A;  3UBL A;  2IWT A;  4Q5R A;  1JZW A;  4MH2 A;  4L0W A;  3LSZ A;  2DMM A;  3D6I A;  4GCI A;  2G2Q A;  4IGJ A;  3HA9 A;  3F8U A;  3M8N A;  1ML6 A;  3EIN A;  1WMJ A;  1SJZ A;  1O73 A;  2LKU A;  4FQU A;  2YZH A;  4N11 A;  3RPN A;  5ID2 A;  3UAR A;  1SKS B;  3J7Y b;  2IMI A;  4Z7X A;  17GS A;  2B1K A;  2O8V B;  3PGT A;  2YPM A;  4V2L A;  3F4T A;  4GQF A;  1X5D A;  3FZ4 A;  1XCC A;  3MIX A;  1VRS D;  1YKC A;  1GNE A;  4PQ1 A;  5EY6 A;  2VCW A;  2LRC A;  1OE7 A;  2H74 A;  2GSR A;  4G0I A;  4OWY A;  2PPT A;  3VK9 A;  4ICY A;  2QA1 A;  2L6C A;  1V40 A;  2V41 A;  1FB0 A;  5H5Q A;  2VCX A;  3EUR A;  3H79 A;  4FYU A;  1SJ6 A;  3CSH A;  1M2B A;  1UA5 A;  1XBS A;  4ECB A;  5IMA A;  4JRR A;  1RW1 A;  2XPE A;  1FW1 A;  2UZ8 A;  4EDY A;  3F4R A;  1B9X C;  1JLV A;  2L4Q A;  1YF1 A;  1TXX A;  2LEG A;  4PNG A;  4KDY A;  4XRA A;  3VI7 A;  2DKH A;  1WE0 A;  2P5Q A;  2O7K A;  5CRE A;  1VGL A;  5G30 A;  2CAQ A;  1FHE A;  2XHF A;  3WYW A;  2MBS A;  2GZZ A;  3PH9 A;  4IBP A;  3WD6 A;  4USS A;  3TRQ A;  1THX A;  1OVN A;  1M3I A;  1FVK A;  4POM A;  2DIZ A;  3PPU A;  2V1M A;  2PVO C;  3MYD A;  4F0B A;  1JLW A;  4DSQ A;  6GSU A;  4JED A;  2H71 A;  4ZL9 A;  1VF4 A;  3QPM A;  4TOP A;  4MF5 A;  2RUE A;  1X5C A;  2X4A A;  2CAI A;  4F2I A;  3APO A;  4HEA 2;  2OJL A;  4A5P A;  3VUR A;  1WWJ A;  5HR1 A;  1M3J A;  1FVJ A;  4J57 E;  2HSH A;  3TDG A;  5LNK e;  1KNG A;  2P31 A;  5ID2 B;  1NW2 A;  3FKF A;  5JWQ B;  6GSX A;  1LU4 A;  5FT3 A;  1KEB A;  4P3Y B;  1X9S B;  4I6X A;  4NWY A;  4V1A p;  1F6M C;  2X8C A;  1GL8 A;  3RAZ A;  4YH2 A;  3KEB A;  1QK8 A;  4GTU A;  1GNW A;  4I5Q A;  1U6T A;  2WGR A;  2WJU A;  3GYK A;  2H1A A;  4E8E A;  1ERV A;  3CRU A;  3CBU A;  1GSD A;  5HR0 A;  4WR5 A;  2AB6 A;  3ED3 A;  3Q74 A;  1SL1 B;  4OFM A;  1XWC A;  1NSW A;  1RQM A;  1OKD A;  2X49 A;  1GSE A;  4MNN A;  1JZR A;  3M9J A;  2HRA A;  4IN0 A;  4MK3 A;  1HYU A;  2GT6 A;  4POK A;  2WRT A;  4HU7 A;  2LST A;  2MBT A;  2MMA A;  6GSW A;  1ZCP A;  2WZ9 A;  5IO0 A;  4YKG A;  4MP4 A;  2V6O A;  2WFC A;  5KN2 A;  2LS5 A;  3KP8 A;  2WUL A;  2LTK A;  2GQM A;  1XWG A;  2FWH A;  5DQS A;  2VL2 C;  4BA7 A;  2VAF A;  5GAN D;  1SKR B;  4XS1 A;  3I69 A;  2QC7 A;  1Y6E A;  5CP1 A;  3CYN A;  3GMF A;  4KSM A;  2YWM A;  4KAE A;  3CTG A;  3LQ7 A;  5ENU A;  1S3R A;  1K3O A;  3FR9 A;  4OFN A;  1GSS A;  3GUR A;  3N5O A;  4PX1 A;  2IL3 A;  3KZQ A;  3VLN A;  2VLU A;  2F51 A;  3GNJ A;  1B9Y C;  20GS A;  5KOX A;  2JSY A;  3R2Q A;  3SBC A;  1U3I A;  2B3S A;  4K7I A;  4IEL A;  2YZU A;  1MEK A;  1K0M A;  2CVD A;  3ZZX A;  3BJ5 A;  3C1S A;  5DJM A;  5BMU A;  1FOH A;  3L9V A;  1EOG A;  4IJI A;  1SJI A;  1GSQ A;  1FO5 A;  1TU7 A;  3TKS A;  4TR3 A;  3TKS E;  2C3Q A;  3O3T A;  4MF6 A;  1Z7R A;  3HZ4 A;  5D9V A;  3TOU A;  1AIU A;  3P90 A;  1BG5 A;  3C8E A;  1M99 A;  1M2D A;  5JCG A;  1O7U A;  5GZZ B;  4GRF A;  3NIV A;  3ZMK A;  2VL9 A;  2MZC A;  2VL3 A;  3U5R E;  4MJB A;  3CRT A;  2KHP A;  2ALB A;  3ZVJ D;  3HY2 A;  1K3Y A;  7GSS A;  3ZRE A;  1ZGN A;  3IRA A;  2LJK A;  5ABR A;  3KTB A;  3EU4 A;  1WJK A;  4JBB A;  2VD1 A;  3FR6 A;  5AIV A;  3TRX A;  4FYB A;  4IKH A;  3KMO A;  2H01 A;  3CSI A;  4EF0 A;  3QAW A;  4AJ6 A;  2FD3 A;  2H6X A;  4ECC A;  5G5E A;  2H30 A;  1X0R A;  1WIK A;  2OE1 A;  3QCP A;  2KOK A;  1A23 A;  2FNO A; 
#chains in the Genus database with same CATH homology
 4OCF A;  4YAP A;  2GLR A;  2JAD A;  3L0H A;  3DIE A;  5JCU A;  2IIY A;  3VWU A;  3V1W A;  3DVW A;  4MJE A;  3GUS A;  3DYR A;  2DLX A;  4EIP A;  2HXK A;  5B6M A;  1YKA A;  2IN3 A;  5DAK B;  2B1L A;  5CNW A;  4G19 A;  4L0U A;  2E7P A;  4JU5 A;  2HNL A;  1TRV A;  1T4Z A;  1MTC A;  2XBI A;  4PQI A;  1S3A A;  4NXI A;  4CHS A;  1BED A;  4OO4 A;  2FWG A;  1GSF A;  4D73 B;  1V57 A;  2NBS A;  3F9U A;  3HXS A;  4POB A;  5CRG A;  4EDZ A;  3FMW A;  1ON4 A;  2HZF A;  1ZZY A;  4KH7 A;  3MNG A;  5DJL A;  3Q18 A;  2H76 A;  2VLT A;  1MDJ A;  4LL1 B;  1OC3 A;  3OR5 A;  3FK8 A;  1M0U A;  2CX3 A;  1EZK A;  4RI6 A;  5ECK B;  3DGQ A;  2F3M A;  1F2E A;  4V2M A;  5CYY A;  4YKF A;  3F4S A;  3LYK A;  4Q5N A;  1XWA A;  2LUS A;  2N5F A;  1TW9 A;  2R2J A;  2LQQ A;  1AQW A;  1M9A A;  13GS A;  2H0G A;  1YY7 A;  3C1R A;  3IAS 2;  3M0F A;  2HSM A;  4FO5 A;  1TKD B;  1TI1 A;  4EE0 A;  1TK5 B;  3DVX A;  3GIX A;  2HI7 A;  2HRK A;  1TTZ A;  4KX4 A;  3C73 A;  4RUV A;  2A2R A;  1FAA A;  2PUK C;  1V9W A;  2IPA A;  2FY6 A;  4TXO B;  4WEY A;  1KBN A;  3EPT A;  3VWV A;  3GKN A;  4G0L A;  2LQO A;  4WR4 A;  2I9H A;  1ZL9 A;  1BYE A;  5IOX A;  2R6K A;  2DSA A;  1B4P A;  1IYI A;  2FLS A;  1O6J A;  3CSJ A;  4X43 A;  4CY8 A;  2YN1 A;  5D96 A;  1EGR A;  1SYR A;  1XVQ A;  3BCI A;  1F3A A;  4ECJ A;  5COH A;  3TOT A;  2C0D A;  4KND A;  3ZRD A;  2PWJ A;  1PX7 A;  1GUK A;  2L6D A;  3K8N A;  2H6Z A;  4TW5 A;  3S9F A;  1FOV A;  4NMU A;  5KEJ A;  5EL8 A;  4JR4 A;  2QGV A;  4BVY B;  1K0N A;  2DKI A;  3SWL A;  4KSO A;  1EOH A;  4BPY A;  2N5A A;  4GWR A;  2VLV A;  2I4A A;  2P0G A;  5J3R A;  2X64 A;  1SL2 B;  1T1V A;  3QDN A;  4EVM A;  1T7P B;  1V98 A;  3GV1 A;  5G2Z A;  3J7Y k;  3DXB A;  3US3 A;  1BAY A;  2K8S A;  2YWI A;  2AJQ B;  2F8F A;  4LA1 A;  2CT6 A;  2LRT A;  2YV7 A;  3R3E A;  3I9V 2;  4HI7 A;  3APS A;  1DBY A;  5DCH A;  1O81 A;  2X8H A;  3QOU A;  2B7K A;  1X9W B;  4TR1 A;  2HFD A;  2R4V A;  3I6A A;  1SK1 A;  3KCM A;  4OCE A;  2H75 A;  3D4M A;  1BQ7 A;  1YEX A;  2EIQ A;  2C0F A;  1XW5 A;  1ZYN A;  5F05 A;  2JL4 A;  1G6Y A;  3FYG A;  1WPI A;  3D5J A;  2LRN A;  3EMP A;  3N9J A;  4L8E A;  3KXO A;  2IFQ B;  3GL3 A;  1GP1 A;  4BWS A;  2GZP A;  1NM3 A;  5ECP B;  3KH9 A;  1SYX A;  1HNC A;  4AJ8 A;  2WDU A;  5ECM B;  1DE2 A;  1BX9 A;  4OD7 A;  3VWX A;  4EC0 A;  2VCQ A;  2PGT A;  2C0E A;  4HUA A;  4HU9 A;  4V1A g;  5AIX A;  3ZIJ A;  3UJ1 A;  2CZ2 A;  4MMM A;  4TVE A;  2YCD A;  1S3D A;  3GH6 A;  3M1G A;  1A0R P;  1ERU A;  3F6F A;  3RPP A;  4DEJ A;  1GLQ A;  3DD3 A;  4MF7 A;  5A5K A;  3HVS A;  2PU9 C;  3VPT A;  4F0C A;  1Q98 A;  1GLP A;  4OO5 A;  2JU5 A;  3FZ9 A;  1ILO A;  3TKR A;  2AYT A;  1JZD A;  1F37 A;  5IMV A;  2YJH A;  4IW9 A;  4ZXG A;  5HR2 A;  4MPG A;  4F03 A;  4EL1 A;  1O85 A;  4MZW A;  2L5L A;  2VM2 A;  3ZML A;  5IM9 A;  1SD8 A;  2QKE A;  3MAK A;  5A4W A;  2X99 A;  3TJF A;  5DBQ A;  5CAX A;  5ECQ B;  1LJR A;  1GSU A;  3H4K A;  1VF2 A;  5G1K A;  2HZE A;  1HNA A;  2K9F A;  1AAZ A;  3LXT A;  4TR1 B;  2HE3 A;  4HDE A;  1A2M A;  3KTL A;  4K7O A;  1EWX A;  4XRD A;  1AXD A;  2D2Z A;  2IMK A;  5ECL B;  5J5N A;  5B8A A;  4FH8 A;  1SU9 A;  4YQV A;  1ACV A;  2QA2 A;  3W8S A;  3A5I A;  4N0Z A;  1AW9 A;  3H1N A;  4KF9 A;  5KOW A;  4GXZ A;  3EVI A;  2J23 A;  11GS A;  2B5Y A;  5F8B A;  1HQO A;  1XZO A;  4N10 A;  2GGT A;  3G9B A;  3WT2 A;  8GSS A;  5J9B A;  4PUA A;  4QL7 A;  4PUR A;  4NV2 A;  3QR6 A;  1U87 A;  4WKW A;  2J9H A;  1MD3 A;  1TOF A;  2B6M A;  2H0I A;  1K0D A;  2BMX A;  1DUG A;  2MMO A;  5AIS A;  2VIM A;  5L71 A;  5G1L A;  2O85 A;  3D4T A;  1PSQ A;  2VCV A;  3F3Q A;  4FIW A;  1A8L A;  2OE3 A;  5GAP D;  2C8U A;  4TRX A;  4EUY A;  3RHB A;  2A4H A;  2V2G A;  5KN1 A;  3FEU A;  1ERT A;  1YDK A;  3ZFL A;  5HFG A;  4F82 A;  2RUF A;  3GTU B;  5GST A;  1QUW A;  2CZ3 A;  2VOC A;  3EU3 A;  4EO3 A;  3LOR A;  1PD2 1;  2ZUP A;  2LJA A;  2F9S A;  4ZB9 A;  2FGX A;  3FW2 A;  4AGS A;  1EV9 A;  2LV3 A;  4AF2 A;  2HZE B;  5ELG A;  5C00 A;  3ZYW A;  2HYX A;  3W8J A;  5G5F A;  4KGI A;  3LG6 A;  1W89 A;  2RII A;  4XIH A;  3L9U A;  4HQZ A;  2JAC A;  5DQY A;  3A2X A;  2LNS A;  4XS4 B;  2F8A A;  3HD5 A;  1V2A A;  2YWN A;  4PTS A;  4O7H A;  4X1U A;  2HRF A;  2PVQ A;  2DJ3 A;  4O5R A;  1ZYP A;  4GF0 A;  3TUE A;  2KLX A;  1X5E A;  4N0V A;  1EGO A;  5DAK A;  3ZTL A;  4WET A;  4NV5 A;  4TN8 A;  4EXJ A;  2AHE A;  1PKW A;  4J2F A;  1AQV A;  4ZB6 A;  1XXU A;  2WS2 A;  1VF1 A;  4D73 A;  4JZQ A;  3APQ A;  3P8W A;  3UVH A;  1EP8 A;  1UVZ A;  2XBQ A;  5HQP A;  3Q6O A;  2DBC A;  4MH3 A;  2R0C A;  2YV9 A;  2DIY A;  19GS A;  5D9T A;  4MLY A;  1OC9 B;  4XHM A;  4RQR A;  3H8Q A;  1ZYE A;  4ILF A;  1QFN A;  3LYP A;  2NTO A;  2QSI A;  4HS1 A;  2EIR A;  4YQU A;  3D21 A;  4IP6 A;  3E3E A;  4PUF C;  3LWA A;  3F0I A;  5EPF A;  2GTU A;  3EWL A;  4GSN A;  1BJX A;  5J9C A;  2VUP A;  3EC3 A;  5ECO B;  3IDV A;  2EIO A;  4MDC A;  5IPH A;  2RM5 A;  3PR8 A;  2C4J A;  3LW9 A;  1OE8 A;  5D73 A;  1TJD A;  2A2S A;  4TXO A;  5KN3 A;  3GX0 A;  1GH2 A;  1I9D A;  4JE1 A;  3IBH A;  2CQ9 A;  1ZMA A;  3ME7 A;  5DAL B;  4GSS A;  1XOB A;  5GSS A;  3A3T A;  3GHA A;  4MA9 A;  4K0N A;  3KIJ A;  18GS A;  3VI5 A;  5CRW A;  2FA4 A;  3ERG A;  1AQX A;  4LMW A;  2YNX A;  1G7E A;  1Z3E A;  4Q5F A;  1KTE A;  5B8B A;  3HJP A;  2I81 A;  1TRU A;  4YAV A;  5CRH A;  1M7T A;  1NHY A;  1SD9 A;  4ID0 A;  3ZIT A;  1R4W A;  4F9Z A;  3FR3 A;  2OAC A;  4GLT A;  2XC2 A;  4G2E A;  5CRD A;  2AAW A;  1EEM A;  4AJ7 A;  2FCH A;  1OC8 A;  4DSR A;  1J08 A;  4BVY A;  3GFK A;  4HOJ A;  2R3X A;  4FYC A;  2DML A;  2NVL A;  5IMC A;  4XTS A;  4HZ2 A;  4PGT A;  2VL2 A;  2R37 A;  1QMV A;  3CXG A;  3DML A;  1PA3 A;  1H75 A;  4ACS A;  1Z9H A;  3GRX A;  2DJ2 A;  12GS A;  2FUG 2;  2O89 A;  4TR4 A;  4ECI A;  4RQX A;  5D8I A;  4GQC A;  2K6V A;  1T4Y A;  3NOF A;  3ME8 A;  4Z2R A;  3U6V A;  3D0Z A;  1LBK A;  4IP1 A;  4G9H A;  4HJ2 A;  3UOM A;  5JCW A;  2IFQ A;  1TRS A;  3KD0 A;  2YAN A;  3Q19 A;  2H19 A;  3ZVJ A;  3EE2 A;  4HQS A;  2ES7 A;  1S3C A;  1PN0 A;  3IA1 A;  1OKT A;  5J4U A;  3FRC A;  1YF0 A;  2VCT A;  3VWW A;  1DSB A;  4EKZ A;  4I2U A;  5CO3 A;  4J56 E;  1UN2 A;  2H6Y A;  2IMF A;  1QGV A;  4N30 A;  5ECR B;  1XIY A;  2LJR A;  2OKA A;  2CVK A;  4CW9 A;  3LFL A;  1E6B A;  5EVO A;  5F0G A;  3KH7 A;  2GS3 A;  3GA4 A;  4I2T A;  6GSV A;  4L5L A;  1A0F A;  2H1G A;  2KP1 A;  2CVB A;  1X9M B;  3HJO A;  4BL7 B;  4G0K A;  3BD2 A;  2H0H A;  3HJM A;  4ZL7 A;  2FA8 A;  1E2Y A;  1XVW A;  2O87 A;  5H5S A;  2C0G A;  1Z5Y E;  1C72 A;  1EP7 A;  1SL0 B;  3QFB C;  1YEP A;  3HZ8 A;  3AY8 A;  4NHW A;  2P5R A;  4DVC A;  2ON7 A;  2YJ7 A;  3IK7 A;  3IXR A;  4MJC A;  2C80 A;  4NPB A;  3QD9 A;  4ML6 A;  1AUC A;  1XFL A;  5JWR B;  1PL1 A;  2LNT A;  3ZL5 A;  2YP6 A;  4IVF A;  4MAB A;  5HFK A;  3GST A;  3BOA A;  2KUC A;  4PNF A;  3HKR A;  1M9B A;  4BWQ A;  2ON5 A;  1FB6 A;  2DJJ A;  2TRC P;  3A2V A;  4ZBA A;  3H93 A;  2DJ0 A;  1I5G A;  2R0G A;  3HYP A;  3UVT A;  2E2M A;  4IQA A;  5IMD A;  3TJG A;  4O5Q A;  3WT1 A;  3IV4 A;  1NHO A;  1U88 A;  3WGE A;  3WGX A;  2NDO A;  4MZC A;  4X0X A;  5B7C A;  3W6G A;  3PIN A;  2PER A;  2AUV A;  1O8X A;  2PN8 A;  1V58 A;  1OAZ A;  2REM A;  2BJX A;  4KDU A;  5DVB A;  5F07 A;  2VD0 A;  3IC8 A;  4K1F A;  5B6N A;  1Z6N A;  3UAP A;  4H86 A;  2DJK A;  2FWE A;  2GQK A;  2WCI A;  1GTI A;  1T3B A;  1PRX A;  3GTU A;  3GL5 A;  4BVX B;  4YQM A;  5IQY A;  2GQL A;  3HHV A;  4WBR D;  4K2X A;  5IMZ A;  4ZL8 A;  2RM6 A;  1GUH A;  3TKS C;  3ERW A;  3IR4 A;  1ABA A;  3IAM 2;  4ZIJ A;  4DSS B;  1G6W A;  2CA8 A;  3G7Y A;  3GKX A;  1A2L A;  5FHI A;  1T8E B;  3F63 A;  1WRY A;  3MSZ A;  5D9X A;  22GS A;  1HD2 A;  4WF4 A;  2G0F A;  5LCZ A;  4XS4 A;  3DRN A;  5A4U A;  4RI7 A;  1J0F A;  1PGT A;  3TCO A;  3HDC A;  4KUN A;  3WGD A;  1F9M A;  5AN1 A;  1O8W A;  2E0Q A;  4IJ3 A;  2V32 A;  4TXV A;  4MJA A;  3HCZ A;  4NHZ A;  3IPZ A;  1K0A A;  5IPG A;  3FY7 A;  3QAG A;  5DDL A;  4ML1 A;  3LGC A;  2OAD A;  3IOS A;  5ECH B;  2L57 A;  5ELA A;  3RHC A;  3TGZ A;  4HJM A;  1PMT A;  2Z9S A;  4KW6 A;  3QAV A;  1USB A;  2VCZ A;  4MPF A;  5HFI A;  1A2J A;  2GVP A;  4JR6 A;  4O92 A;  1HNB A;  1G0T A;  4Q5Q A;  1OC9 A;  1WP0 A;  5JWO B;  2OBK A;  2JZS A;  3FHK A;  1SEN A;  4HZ4 A;  4ISD A;  3NZN A;  1B8X A;  4GST A;  3GKM A;  2H8L A;  2OE0 A;  2YWO A;  5INY A;  1PX6 A;  3RDW A;  3G7I A;  1IYH A;  2R5G A;  1TI3 A;  16GS A;  1T00 A;  3P7X A;  3KMN A;  2TIR A;  2CX4 A;  2FWF A;  3L9S A;  4LLR A;  2GT5 A;  5IOW A;  3TJK A;  1CQH A;  1YZX A;  1Y25 A;  3M9K A;  2H1D A;  1RK4 A;  5D93 A;  2AV4 A;  4K9Z A;  5DCG A;  1URM A;  4PXO A;  3ZLP A;  1PN9 A;  1PQN A;  2MMN A;  5DAL A;  2IJY A;  2L59 A;  1B48 A;  2C1Y A;  1EV4 A;  2B5X A;  3TKQ A;  2I3Y A;  4Z2U A;  4XCS A;  1YJ6 A;  2A4V A;  6GST A;  5F06 A;  2L5O A;  1XWK A;  2C3N A;  1EEJ A;  1DE1 A;  1Z7P A;  5KN0 A;  2H72 A;  3EYT A;  3GH9 A;  4TKY A;  3IHQ A;  1F3B A;  1VF3 A;  1K3L A;  2H66 A;  9GSS A;  1QQ2 A;  4I8B A;  4E8H A;  1JZO A;  3HVV A;  1ZYQ B;  4IQ1 A;  5HR3 A;  1R5P A;  3KP9 A;  4MCU A;  3LEF A;  3L78 A;  2DC5 A;  2TRX A;  4KDX A;  2EC4 A;  2VM1 A;  2GDR A;  4QQ7 A;  2JZT A;  2FHE A;  4NAX A;  4KA0 A;  3ZIV A;  2JSZ A;  1R7H A;  1QXH A;  1N8J A;  3F3R A;  1AC1 A;  1GSY A;  1SK0 A;  2I1U A;  3CMI A;  1XW6 A;  3IHG A;  1XOA A;  1R5A A;  2RLI A;  3P2A A;  3TJB A;  4K2D A;  2ZNM A;  2K8V A;  5BRT A;  2H73 A;  3BBY A;  1H4O A;  3EMX A;  1GUM A;  2WB9 A;  3C7M A;  1OYJ A;  5ECN B;  2M46 A;  3DKS A;  2BTO T;  4QL9 A;  2M80 A;  3A5W A;  4KE3 A;  3G7J A;  4KCE A;  3UEM A;  5J41 A;  4I97 A;  1K0C A;  5G31 A;  5A4V A;  4ZBD A;  2R0P A;  3I43 A;  4K8M A;  2L4C A;  2VO4 A;  1PKZ A;  1TP9 A;  2HT9 A;  2ZCT A;  4TR0 A;  4K5S A;  4LL4 B;  5E59 A;  4KB3 A;  2B7J A;  1K0O A;  3DWV A;  3ERF A;  5ECS A;  1N2A A;  1MD4 A;  2OA7 A;  3D22 A;  2K18 A;  1MDI A;  1MDK A;  3L4N A;  4MZB A;  1XPV A;  2GSS A;  1TK0 B;  4BL7 A;  1W4V A;  4X4J A;  3O6T A;  2NPB A;  4Z2T A;  5IO2 A;  5C04 A;  1JHB A;  2CV4 A;  4K0G A;  1GTU A;  2GST A;  1J9B A;  1R26 A;  1FG4 A;  2E2G A;  2JZR A;  3MDK A;  3TRP A;  2M72 A;  4EIQ A;  3UMA A;  3FZA A;  1GTA A;  4IS0 A;  4WXT A;  3KM6 A;  1TU8 A;  4WF5 A;  3VFI A;  4PQH A;  4ZB8 A;  6GSY A;  2HLS A;  3RBT A;  3M3M A;  3IK9 A;  4IHU A;  5FWG A;  3TB2 A;  4OMV A;  1ST9 A;  4L5O A;  3A2W A;  2OBI A;  5IMF A;  2MMZ A;  3C71 A;  2XPD A;  3UBK A;  3F6D A;  4KCA A;  3GSS A;  2MYG A;  3TKP A;  3O76 A;  3GN3 A;  4LMV A;  4ZIL A;  1Q4J A;  1Z6M A;  5D9W A;  4V2N A;  2GSQ A;  2DJ1 A;  1GUL A;  2V6K A;  3KGK A;  2IME A;  3KJY A;  1XW9 A;  1ERW A;  1PL2 A;  1SKW B;  1ZOF A;  1G7O A;  1GWC A;  1GTB A;  5LD0 A;  3UL3 A;  3JCM L;  4ZBB A;  4O5U A;  4OFT A;  4CDO A;  3DEX A;  4POL A;  3GKK A;  2X8G A;  1YQ1 A;  3TJJ A;  3LJR A;  4ULX A;  2A2P A;  3QMX A;  2GZY A;  3E0U A;  1CQG A;  1THO A;  2HRN A;  1A24 A;  1TK8 B;  3ZFB A;  4XS6 A;  2KP2 A;  3ISO A;  2H1B A;  2HSY A;  1M2A A;  1B4Q A;  1K0B A;  4K7N A;  3IC4 A;  1TDI A;  1SK2 A;  2H70 A;  3VPQ A;  1XWB A;  3CTF A;  3QFA C;  2PMT A;  4BVX A;  1A8Y A;  5H5R A;  2N5B A;  4CY6 A;  1TRW A;  2YOI A;  3IE3 A;  1WOU A;  5AGY A;  5IIZ A;  1U3A A;  14GS A;  3MWH A;  3LXZ A;  2C3T A;  6GSS A;  3BCK A;  4DSS A;  4K6X A;  5E4W A;  3HVX A;  1GRX A;  4O32 A;  3FZ5 A;  3UIW A;  5ECI B;  4K5R A;  10GS A;  3E9J B;  1UC7 A;  4G10 A;  2PBJ A;  3GX8 A;  4WBJ A;  2B5E A;  2IMD A;  1JFU A;  3UBL A;  2IWT A;  4Q5R A;  1JZW A;  4MH2 A;  4L0W A;  3LSZ A;  2DMM A;  3D6I A;  4GCI A;  2G2Q A;  4IGJ A;  3HA9 A;  3F8U A;  3M8N A;  1ML6 A;  3EIN A;  1WMJ A;  1SJZ A;  1O73 A;  2LKU A;  4FQU A;  2YZH A;  4N11 A;  3RPN A;  5ID2 A;  3UAR A;  1SKS B;  3J7Y b;  2IMI A;  4Z7X A;  17GS A;  2B1K A;  2O8V B;  3PGT A;  2YPM A;  4V2L A;  3F4T A;  4GQF A;  1X5D A;  3FZ4 A;  1XCC A;  3MIX A;  1VRS D;  1YKC A;  1GNE A;  4PQ1 A;  5EY6 A;  2VCW A;  2LRC A;  1OE7 A;  2H74 A;  2GSR A;  4G0I A;  4OWY A;  2PPT A;  3VK9 A;  4ICY A;  2QA1 A;  2L6C A;  1V40 A;  2V41 A;  1FB0 A;  5H5Q A;  2VCX A;  3EUR A;  3H79 A;  4FYU A;  1SJ6 A;  3CSH A;  1M2B A;  1UA5 A;  1XBS A;  4ECB A;  5IMA A;  4JRR A;  1RW1 A;  2XPE A;  1FW1 A;  2UZ8 A;  4EDY A;  3F4R A;  1B9X C;  1JLV A;  2L4Q A;  1YF1 A;  1TXX A;  2LEG A;  4PNG A;  4KDY A;  4XRA A;  3VI7 A;  2DKH A;  1WE0 A;  2P5Q A;  2O7K A;  5CRE A;  1VGL A;  5G30 A;  2CAQ A;  1FHE A;  2XHF A;  3WYW A;  2MBS A;  2GZZ A;  3PH9 A;  4IBP A;  3WD6 A;  4USS A;  3TRQ A;  1THX A;  1OVN A;  1FVK A;  4POM A;  2DIZ A;  3PPU A;  2V1M A;  2PVO C;  3MYD A;  4F0B A;  1JLW A;  4DSQ A;  6GSU A;  4JED A;  2H71 A;  4ZL9 A;  1VF4 A;  3QPM A;  4TOP A;  4MF5 A;  2RUE A;  1X5C A;  2X4A A;  2CAI A;  4F2I A;  3APO A;  4HEA 2;  2OJL A;  4A5P A;  3VUR A;  1WWJ A;  5HR1 A;  1FVJ A;  4J57 E;  2HSH A;  3TDG A;  5LNK e;  1KNG A;  2P31 A;  5ID2 B;  1NW2 A;  3FKF A;  5JWQ B;  6GSX A;  1LU4 A;  5FT3 A;  1KEB A;  4P3Y B;  1X9S B;  4I6X A;  4NWY A;  4V1A p;  1F6M C;  2X8C A;  1GL8 A;  3RAZ A;  4YH2 A;  3KEB A;  1QK8 A;  4GTU A;  1GNW A;  4I5Q A;  1U6T A;  2WGR A;  2WJU A;  3GYK A;  2H1A A;  4E8E A;  1ERV A;  3CRU A;  3CBU A;  1GSD A;  5HR0 A;  4WR5 A;  2AB6 A;  3ED3 A;  3Q74 A;  1SL1 B;  4OFM A;  1XWC A;  1NSW A;  1RQM A;  1OKD A;  2X49 A;  1GSE A;  4MNN A;  1JZR A;  3M9J A;  2HRA A;  4IN0 A;  4MK3 A;  1HYU A;  2GT6 A;  4POK A;  2WRT A;  4HU7 A;  2LST A;  2MBT A;  2MMA A;  6GSW A;  1ZCP A;  2WZ9 A;  5IO0 A;  4YKG A;  4MP4 A;  2V6O A;  2WFC A;  5KN2 A;  2LS5 A;  3KP8 A;  2WUL A;  2LTK A;  2GQM A;  1XWG A;  2FWH A;  5DQS A;  2VL2 C;  4BA7 A;  2VAF A;  5GAN D;  1SKR B;  4XS1 A;  3I69 A;  2QC7 A;  1Y6E A;  5CP1 A;  3CYN A;  3GMF A;  4KSM A;  2YWM A;  4KAE A;  3CTG A;  3LQ7 A;  5ENU A;  1K3O A;  3FR9 A;  4OFN A;  1GSS A;  3GUR A;  3N5O A;  4PX1 A;  2IL3 A;  3KZQ A;  3VLN A;  2VLU A;  2F51 A;  3GNJ A;  1B9Y C;  20GS A;  5KOX A;  2JSY A;  3R2Q A;  3SBC A;  1U3I A;  2B3S A;  4K7I A;  4IEL A;  2YZU A;  1MEK A;  1K0M A;  2CVD A;  3ZZX A;  3BJ5 A;  3C1S A;  5DJM A;  5BMU A;  1FOH A;  3L9V A;  1EOG A;  4IJI A;  1SJI A;  1GSQ A;  1FO5 A;  1TU7 A;  3TKS A;  4TR3 A;  3TKS E;  2C3Q A;  3O3T A;  4MF6 A;  1Z7R A;  3HZ4 A;  5D9V A;  3TOU A;  1AIU A;  3P90 A;  1BG5 A;  3C8E A;  1M99 A;  1M2D A;  5JCG A;  1O7U A;  5GZZ B;  4GRF A;  3NIV A;  3ZMK A;  2VL9 A;  2MZC A;  2VL3 A;  3U5R E;  4MJB A;  3CRT A;  2KHP A;  2ALB A;  3ZVJ D;  3HY2 A;  1K3Y A;  7GSS A;  3ZRE A;  1ZGN A;  3IRA A;  2LJK A;  5ABR A;  3KTB A;  3EU4 A;  1WJK A;  4JBB A;  2VD1 A;  3FR6 A;  5AIV A;  3TRX A;  4FYB A;  4IKH A;  3KMO A;  2H01 A;  3CSI A;  4EF0 A;  3QAW A;  4AJ6 A;  2FD3 A;  2H6X A;  4ECC A;  5G5E A;  2H30 A;  1X0R A;  1WIK A;  2OE1 A;  3QCP A;  2KOK A;  1A23 A;  2FNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...