3KCMA

The crystal structure of thioredoxin protein from geobacter metallireducens
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
139
structure length
139
Chain Sequence
LEENPAPDFTLNTLNGEVVKLSDLKGQVVIVNFWATWCPPCREEIPSMMRLNAAMAGKPFRMLCVSIDEGGKVAVEEFFRKTGFTLPVLLDADKRVGKLYGTTGVPETFVIDRHGVILKKVVGAMEWDHPEVIAFLNNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin family protein
publication title The crystal structure of thioredoxin protein from Geobacter metallireducens
rcsb
source organism Geobacter metallireducens gs-15
molecule tags Oxidoreductase
total genus 36
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kcmA00
3EURA 4I6XA 3VLNA 3VWVA 1PSQA 1VRSD 4POBA 1ZYEA 4NWYA 4K6XA 1YF0A 3KGKA 2YJ7A 1GSQA 4GXZA 4DVCA 1B4QA 4CHSA 3WGXA 2R3XA 2A2RA 2MYGA 1I5GA 2DJ1A 2E2MA 3HVSA 4HJ2A 10GSA 4N0VA 4NXIA 5HR2A 3RBTA 4D73B 1A23A 1AIUA 4I97A 3ZVJA 1TRSA 2CAIA 1K3YA 1MDKA 2WS2A 4XS1A 5DCHA 3TRXA 2WB9A 3LG6A 2VLVA 3M0FA 1BG5A 1Y25A 3PGTA 2GS3A 1UC7A 2C8UA 2FD3A 2C3QA 4F9ZA 4PUAA 1URMA 1EOHA 3ED3A 4N11A 4MPGA 5ABRA 3NZNA 5KN1A 1PX6A 4KH7A 2TRCP 2B5XA 1B9XC 2AV4A 2P0GA 3UL3A 3WD6A 2XPEA 1PMTA 5A4VA 1TU8A 1OC9A 2DIZA 4F0BA 3WGDA 2C0FA 2VCXA 1EP7A 1B4PA 3F4SA 3EE2A 4MJAA 5DCGA 2K6VA 5D9VA 2X8HA 4K0GA 1AW9A 2H70A 2WCIA 3LSZA 5KN2A 2O8VB 5IMDA 2VUPA 1E6BA 1TJDA 2MBSA 2PU9C 1XW9A 2C4JA 2VCVA 4MZWA 2VIMA 5AIVA 1MDIA 5IOWA 3N9JA 5HFIA 2GDRA 1G7OA 1YY7A 2H73A 5HR1A 4ZB9A 3IAS2 4OFTA 3IK7A 3M1GA 4BWSA 5ID2A 2MMZA 12GSA 2VL2C 3LFLA 5IO2A 4MABA 1NW2A 1T3BA 4RQXA 2OE1A 2GSSA 4XCSA 2LJRA 2WJUA 4RI7A 4K9ZA 2HXKA 5B6MA 4XS4A 1TP9A 2YWNA 1Z7RA 5JCGA 1G0TA 1Q98A 2H72A 5ECSA 2GTUA 3KZQA 4I2TA 5F07A 1ERVA 2LJAA 4ZIJA 1V98A 1A2LA 2YNXA 3R2QA 1Z7PA 3TKSA 2H8LA 4EF0A 4TN8A 3GSTA 3MDKA 4X0XA 8GSSA 1ZMAA 2GVPA 5H5SA 2E7PA 1FG4A 1S3DA 3FKFA 3GV1A 1C72A 5COHA 2IL3A 1XZOA 4IW9A 3L78A 4YAPA 4K7IA 4WR5A 4IP1A 2YP6A 4AGSA 2FNOA 2CAQA 1YZXA 2PVQA 1QUWA 2LRNA 4K7NA 2YWIA 4ZB8A 4CW9A 2LKUA 4XRDA 2RM6A 3L0HA 4KDYA 5HQPA 1F37A 4QL7A 4MJCA 1AQWA 2C1YA 1F6MC 1SD8A 4LL4B 6GSWA 4JZQA 1JHBA 1GNEA 4JBBA 2H75A 2VL9A 5F8BA 2R2JA 3A2WA 5AN1A 1G7EA 2GQMA 1KBNA 2PGTA 4YH2A 4KB3A 1M2DA 5AIXA 5D9TA 1G6YA 2M80A 3VI7A 2YV7A 3ZRDA 3QMXA 3C71A 4OFMA 3GIXA 5CRDA 2DLXA 3C1RA 4POLA 5B8BA 1GSSA 3TJBA 3UBKA 4DSQA 3LWAA 4F2IA 2R37A 20GSA 1DBYA 3F3RA 3M8NA 3CBUA 2F8AA 5B7CA 1EP8A 3KP8A 4KW6A 2H6XA 3I69A 4TR3A 2I1UA 2KOKA 1K0BA 4GQFA 5DQSA 1QGVA 1O6JA 4POMA 2H0HA 4ZBBA 4ECCA 4G2EA 2LUSA 2OACA 2PERA 3O3TA 4HJMA 1TRVA 4AJ7A 5LNKe 1M2AA 2OBIA 4XHMA 2LRTA 1YKCA 4WETA 3D4MA 4IKHA 1PX7A 1X5EA 4ISDA 2AAWA 1ZYQB 2HYXA 4HUAA 4TRXA 4IVFA 2CQ9A 5IMCA 5LCZA 2DMMA 3DIEA 3MWHA 1G6WA 4FIWA 2HZEA 2DJKA 4EDZA 2IFQB 5J9CA 4XRAA 5GSTA 3ZL5A 4K7OA 3WT1A 3KMOA 5G5FA 2X64A 2YWOA 5CO3A 1TRWA 3ZTLA 2X8GA 3BOAA 3GL3A 4K1FA 1EOGA 2OKAA 2EIQA 3IRAA 1M9AA 5KN0A 4MF7A 2H0GA 3BCKA 4FH8A 1FB0A 4OFNA 1N8JA 1LJRA 3FZAA 1T1VA 5IMFA 1U87A 2CT6A 4BVYA 1HNBA 4HU9A 4ZB6A 3IOSA 3TKQA 4BA7A 1K0NA 2GGTA 1CQGA 4J2FA 2FWGA 4O7HA 2F3MA 2C3NA 4DSSB 1SJ6A 3GYKA 3IPZA 4N0ZA 1R26A 2R5GA 2GT5A 3FEUA 2I9HA 2GZYA 1GSFA 3KJYA 1S3AA 1OKDA 5JWQB 4PQIA 1T4ZA 2REMA 1OC8A 3LYPA 2HZFA 1XFLA 3H79A 2QSIA 4HDEA 2DJ0A 2YV9A 3HCZA 4TW5A 5ECQB 2DJJA 2LNSA 2V32A 1SJZA 2I3YA 2V1MA 3CYNA 1DE1A 5FWGA 3UEMA 2H1GA 3FYGA 2H6ZA 3UBLA 4ECIA 6GSUA 4X43A 1JZRA 2FWEA 3IR4A 2FWFA 4IP6A 1GTBA 5IQYA 5D73A 4N10A 3VPQA 4O32A 1B9YC 4E8EA 3F3QA 3APQA 1A8YA 2JZSA 4WBRD 5CRHA 1M7TA 4KSOA 2LRCA 3TB2A 2KLXA 3I43A 1T4YA 5F06A 3G7JA 2R6KA 1Z6NA 2FY6A 4IQ1A 5CNWA 1N2AA 4WXTA 1ZGNA 1QMVA 4MF5A 2LNTA 4LMVA 6GSYA 3DD3A 1ML6A 3ERWA 1M0UA 1W89A 4K2DA 2B1KA 1A24A 1V40A 4I5QA 1LU4A 4MZCA 2HLSA 3RPNA 4MDCA 1SYRA 1RW1A 3F6FA 2JU5A 1ON4A 3HJOA 3P90A 6GSXA 1GUHA 2B5YA 1V57A 1F2EA 4IJIA 1SK1A 3IDVA 1GSUA 2RLIA 2KP1A 3VWXA 4YAVA 1ZZYA 2C3TA 3ME8A 3IA1A 1QFNA 5CP1A 3NOFA 4KCAA 3DVWA 1WRYA 3CSHA 5KEJA 4DSSA 1XCCA 2VAFA 3ZYWA 4BVXA 3PR8A 1J0FA 2ES7A 3KD0A 3FZ4A 3ZVJD 2GSRA 3HJMA 1NHYA 5E4WA 3VWWA 1AUCA 1F3AA 1GH2A 1SKSB 1MDJA 1YDKA 1BQ7A 4PNFA 1SJIA 5A5KA 4LA1A 4BWQA 3FY7A 4JR4A 3CSIA 19GSA 4NHZA 4NPBA 2C0GA 3TGZA 1TXXA 2B5EA 3RHBA 3D5JA 3TOUA 1XWBA 5G31A 4AJ6A 4EC0A 5AGYA 2LTKA 5ELGA 2FCHA 2G0FA 3LGCA 2MMNA 2F51A 1ACVA 2OE0A 3VURA 1GUMA 2DBCA 4K0NA 4TR1B 2H19A 4GSNA 2MMOA 2FHEA 2NTOA 1OE8A 2H76A 3FR3A 4JRRA 2PPTA 5ELAA 3RAZA 2F8FA 3ZLPA 3CRTA 5C04A 1JFUA 16GSA 2P5QA 3KTBA 3US3A 3W8SA 5JCUA 5EL8A 1TKDB 3HZ4A 2D2ZA 1PKZA 3KXOA 4OO4A 2FA8A 5J5NA 1SL1B 3HD5A 5INYA 2VCQA 3HY2A 5CYYA 4YQMA 1KNGA 5DBQA 2FWHA 5KN3A 2HSHA 3IHQA 4J56E 3WGEA 4I2UA 3KIJA 3G7IA 4F0CA 3LYKA 4JU5A 5AISA 5J4UA 2K8VA 5DAKB 1Z5YE 2N5FA 1T00A 4ZXGA 1YF1A 1XW6A 2C0EA 4L5LA 4EXJA 1GLQA 1AXDA 3EWLA 1WPIA 2H01A 4LL1B 3DYRA 3G7YA 5GZZB 1U6TA 2O85A 3D21A 2BMXA 5F0GA 1FVKA 3SBCA 2B1LA 2OJLA 4MF6A 5JCWA 3W6GA 4KNDA 1I9DA 3F9UA 3TJKA 4AF2A 2K18A 2VCTA 2LV3A 2HRFA 3E0UA 4N30A 2JL4A 2XHFA 3LEFA 5A4UA 4IELA 4D73A 4LMWA 1TW9A 2WDUA 2AYTA 3EINA 2VLTA 1GTUA 2IMIA 4TVEA 2LQOA 4GF0A 1MTCA 3J7Yb 1NHOA 4L0WA 1SYXA 3HVXA 1DE2A 2J23A 4TR1A 2YJHA 3FR9A 2NPBA 3ERGA 1K0AA 6GSTA 1GL8A 4L5OA 2YZUA 1TI1A 4RUVA 5IPHA 1SL2B 1O73A 3GHAA 4NV2A 2MMAA 1RK4A 2OA7A 1VF2A 1EEMA 4FYCA 1X5DA 4TXVA 1XXUA 2HSYA 3IC4A 2DSAA 2ON7A 3LJRA 5IM9A 3KEBA 5E59A 1GUKA 1XVWA 4TXOB 2GSQA 3F8UA 3QD9A 4ID0A 17GSA 1FW1A 3UARA 4EKZA 4IN0A 4ZBAA 1VF3A 3S9FA 3QPMA 1XVQA 3WYWA 3QFBC 4WEYA 1U3AA 3CRUA 3GKNA 1R7HA 1SK2A 1X9MB 1EZKA 4EE0A 2DJ2A 2H30A 1Z6MA 4OCFA 4GSTA 2B3SA 5J3RA 2FGXA 1CQHA 4KDUA 2EIOA 5ECMB 1WP0A 4OWYA 2EIRA 2CVDA 3RPPA 4QQ7A 1ST9A 1ILOA 1Q4JA 1SK0A 3DEXA 1PN9A 1R5AA 3GX0A 4FYUA 3EMPA 3KH9A 2GZZA 3A5WA 2WULA 3A2XA 4V2NA 5GAND 2HT9A 3UJ1A 2DJ3A 4DSRA 3GSSA 3H93A 4BPYA 1UVZA 2VOCA 5CRGA 3TRQA 4EDYA 2TIRA 3CMIA 1A0FA 2B7JA 1YEXA 4MZBA 3HDCA 3TOTA 3LXZA 2QKEA 1J08A 3ZIVA 2M46A 4EL1A 1VGLA 3ZMKA 2WRTA 4GWRA 3BJ5A 4GTUA 4YQUA 1PKWA 5A4WA 3HJPA 3JCML 5IOXA 3UMAA 1SKRB 4ZBDA 3KP9A 2GQLA 1GSEA 1GLPA 2FA4A 4KGIA 1O8XA 3D4TA 2YZHA 3TRPA 2C0DA 4IJ3A 1H75A 2KHPA 4ILFA 4KCEA 4PX1A 7GSSA 2H6YA 3CTFA 1BEDA 3EU3A 1OKTA 4PQ1A 4ML1A 3GKKA 2QGVA 4J57E 2V2GA 2DC5A 1ZOFA 1ERUA 2HI7A 5G1KA 5H5RA 2PMTA 1SD9A 2VM2A 5GAPD 5ECPB 1GTAA 3GUSA 3O76A 1X9SB 3A3TA 3TCOA 1USBA 5D9WA 5GSSA 2L57A 1EGRA 2VD0A 1U88A 2YANA 4JR6A 4HQZA 4NAXA 1QK8A 1TOFA 4O5RA 1HD2A 1W4VA 1DUGA 1JLWA 2RUEA 3QDNA 1FOVA 2VL3A 4JEDA 2HRNA 5DDLA 1K0MA 4GQCA 5IPGA 2OADA 4MCUA 2X8CA 4XS6A 2ZUPA 3F0IA 4FYBA 5L71A 1M99A 5LD0A 3NIVA 4HOJA 3KH7A 4XTSA 1UN2A 3FZ5A 4ML6A 5IO0A 1GNWA 2VM1A 4L0UA 3MNGA 3CSJA 3Q19A 5EPFA 3I6AA 1AC1A 1PQNA 2QC7A 1H4OA 2L4CA 2CV4A 2H66A 2P5RA 2AUVA 1XWCA 3D22A 1YQ1A 1R5PA 2O7KA 4PXOA 4ZL8A 5IMZA 2YOIA 2RUFA 3QFAC 2X99A 2IFQA 4ZL9A 1GSYA 2XC2A 1K3OA 3QAWA 1WJKA 4Q5QA 2V6KA 4MH3A 2YWMA 1F9MA 3EMXA 4KUNA 2PWJA 3KM6A 1O7UA 3L9VA 5G30A 3ZREA 2CX3A 4V1Ag 2N5AA 3OR5A 2L59A 1GULA 1TDIA 3DMLA 4PGTA 3KMNA 2IJYA 3LQ7A 2C80A 1V2AA 1AQVA 2GQKA 4HI7A 1XWAA 1OC9B 4Z7XA 3QOUA 2V41A 1T8EB 1HQOA 5ECOB 2G2QA 2P31A 3P8WA 2I4AA 2OE3A 1SKWB 3DWVA 4E8HA 5B6NA 2IMKA 3EU4A 4RI6A 3V1WA 4BL7A 3M3MA 3GKMA 3TKSC 5D8IA 2CZ3A 1AQXA 3DGQA 2CA8A 1V9WA 4MMMA 2BTOT 1PA3A 1THXA 2ON5A 3GNJA 3IK9A 2I81A 4ACSA 2H0IA 3C1SA 4HS1A 1TK0B 3GTUB 5ID2B 4PUFC 3P2AA 2OBKA 4HZ4A 2ZNMA 1PL2A 1X5CA 2NDOA 2B6MA 5DQYA 2AB6A 2JZRA 2H71A 5IMAA 3DRNA 4XS4B 3TKRA 3IXRA 2BJXA 1JZOA 1K3LA 4KA0A 4IGJA 2CX4A 4QL9A 4PNGA 3O6TA 4PQHA 1VF4A 3UVTA 1HNAA 2HFDA 4MP4A 4Q5RA 3GFKA 3H8QA 5D93A 1SENA 1WOUA 2HNLA 4GLTA 4V2LA 3BBYA 1JZWA 2LJKA 2V6OA 1BJXA 3KCMA 3GX8A 2MZCA 1YJ6A 1BX9A 2XPDA 3FW2A 1S3CA 9GSSA 5H5QA 14GSA 3F6DA 3WT2A 1FHEA 2A4VA 1O81A 2WZ9A 1JZDA 2PUKC 2JSZA 3PINA 4ZL7A 2H1DA 4NMUA 5EVOA 1EGOA 5DALB 1PRXA 5D9XA 2YCDA 1K0DA 2VO4A 3APSA 2XBIA 2PBJA 1TI3A 1TK5B 4WR4A 13GSA 2J9HA 4I8BA 3F4RA 2VCWA 5G1LA 3ZFLA 1GWCA 5CRWA 1A8LA 1E2YA 3HYPA 1TRUA 4HEA2 3FR6A 3RHCA 2JACA 3MSZA 2O89A 5B8AA 4Q5FA 3LXTA 3K8NA 2M72A 1ERWA 1RQMA 2H74A 4HZ2A 1EV4A 1O8WA 2O87A 3ZIJA 4GCIA 3ZMLA 5HR0A 3GTUA 3U5RE 3U6VA 2PN8A 5D96A 3N5OA 1OC3A 3BCIA 2WGRA 3Q74A 1B48A 1KTEA 5F05A 3HXSA 2IWTA 1XOBA 4HU7A 3VI5A 2F9SA 1OYJA 1A2JA 1Y6EA 4IHUA 1U3IA 2DIYA 2HE3A 4F82A 3DKSA 2L6DA 2GSTA 1OVNA 4TOPA 1NM3A 5DVBA 3FRCA 4G10A 3RDWA 3F63A 2NBSA 4ZILA 4TR0A 5CAXA 3GL5A 2VLUA 4XIHA 3VK9A 4WF4A 2H1AA 1MD4A 2HZEB 3IAM2 3E3EA 3UVHA 5DJLA 1HYUA 1O85A 3GMFA 2IIYA 3EVIA 2CZ2A 3QAVA 2NVLA 2A2SA 4NV5A 4EUYA 3F4TA 2JSYA 4GSSA 11GSA 2FUG2 2K9FA 4MPFA 3APOA 1K0OA 5DAKA 2JZTA 5C00A 4HQSA 3LORA 5DALA 2MBTA 5G2ZA 3SWLA 1FO5A 2JADA 4AJ8A 3BD2A 1HNCA 5HFKA 1F3BA 1MD3A 4K8MA 5HFGA 1WE0A 3C73A 4MLYA 3J7Yk 1QXHA 2L6CA 3D0ZA 3UOMA 1BAYA 3L4NA 2IMDA 4KE3A 5EY6A 3GURA 3UIWA 4YQVA 1XW5A 1GSDA 1TU7A 4POKA 1DSBA 2KP2A 1EWXA 2LEGA 4MH2A 4WKWA 4KDXA 1NSWA 1GTIA 1SU9A 4PURA 1Z3EA 5JWOB 1GRXA 1M9BA 3FK8A 2WFCA 3CTGA 3IBHA 3ISOA 2CVBA 4OCEA 4GRFA 1OE7A 5IIZA 5IMVA 1ABAA 3QAGA 3VFIA 3GKXA 3GN3A 1XOAA 2EC4A 1XWKA 5CREA 4IBPA 5G5EA 2VD1A 2RM5A 3VPTA 1XPVA 4MK3A 4ULXA 1R4WA 1WMJA 4FO5A 4MJBA 5ECIB 1Z9HA 1PL1A 3GRXA 4WF5A 1LBKA 4OO5A 3ZFBA 1THOA 4WBJA 1A0RP 3H4KA 2GZPA 2VL2A 2B7KA 1VF1A 3HZ8A 2IMEA 4G9HA 1AAZA 5ECRB 4TXOA 3AY8A 1T7PB 4V1Ap 4EVMA 4RQRA 3VWUA 5FHIA 2R4VA 2DMLA 2IMFA 2N5BA 2ALBA 3ME7A 2IPAA 4KAEA 5HR3A 3ZZXA 4IQAA 5JWRB 22GSA 3GA4A 1SL0B 1V58A 1JLVA 3TJJA 3C8EA 3HKRA 1IYIA 5FT3A 1PGTA 4G19A 3ZITA 3P7XA 2LSTA 4MJEA 4KSMA 2E0QA 5DJMA 2E2GA 2LS5A 1M2BA 2GLRA 5J9BA 2ZCTA 1FVJA 1MEKA 3TUEA 1X9WB 1EV9A 2L4QA 1EEJA 4P3YB 5ECNB 3FZ9A 1WIKA 3TKPA 3TJFA 1TK8B 4EO3A 1TTZA 5ECKB 4LLRA 1PD21 3GH9A 3IE3A 2KUCA 2IN3A 4Q5NA 4TR4A 4TKYA 4MA9A 2LQQA 2XBQA 1KEBA 3HA9A 3GH6A 3TKSE 1GP1A 3DVXA 1FAAA 1XWGA 3PH9A 1YEPA 4ECJA 4DEJA 18GSA 1WWJA 3D6IA 3C7MA 3M9KA 1ZCPA 1B8XA 2PVOC 5ENUA 3H1NA 1QQ2A 3E9JB 1FB6A 5J41A 1IYHA 3L9SA 4NHWA 3HHVA 3ERFA 1UA5A 1OAZA 4ECBA 2K8SA 4X1UA 3KTLA 1XBSA 3IV4A 3Q6OA 1J9BA 1XIYA 1ERTA 4H86A 3HVVA 4V2MA 2AHEA 1BYEA 2Z9SA 2FLSA 3EC3A 4L8EA 2VCZA 3UAPA 2H1BA 2AJQB 3MAKA 5ECLB 2GT6A 3TDGA 2TRXA 1YKAA 3I9V2 4OD7A 3TJGA 3L9UA 1X0RA 4JE1A 2L5LA 2RIIA 6GSSA 1ZL9A 3FHKA 1K0CA 1A2MA 2CVKA 3QR6A 2YN1A 4OMVA 3CXGA 6GSVA 3EYTA 3QCPA 3A2VA 4CDOA 5ECHB 4O92A 4F03A 3M9JA 4IS0A 3W8JA 3G9BA 2L5OA 4KX4A 3DXBA 3Q18A 2YPMA
chains in the Genus database with same CATH superfamily
3EURA 4I6XA 3VLNA 3VWVA 1PSQA 1VRSD 4POBA 1ZYEA 4NWYA 4K6XA 1YF0A 3KGKA 2YJ7A 1GSQA 4GXZA 4DVCA 1B4QA 4CHSA 3WGXA 2R3XA 2A2RA 2MYGA 1I5GA 2DJ1A 2E2MA 3HVSA 4HJ2A 10GSA 4N0VA 4NXIA 1M3JA 3R3EA 5HR2A 3RBTA 4D73B 1A23A 1AIUA 4I97A 3ZVJA 1TRSA 2CAIA 1K3YA 1MDKA 2WS2A 4XS1A 5DCHA 3TRXA 1M3IA 2WB9A 3LG6A 2VLVA 3M0FA 1BG5A 1Y25A 3PGTA 2GS3A 1UC7A 2C8UA 2FD3A 2C3QA 4F9ZA 4PUAA 1URMA 1EOHA 3ED3A 4N11A 4MPGA 5ABRA 3NZNA 5KN1A 1PX6A 4KH7A 2TRCP 3A5IA 2QA1A 2B5XA 1B9XC 2AV4A 2P0GA 3UL3A 3WD6A 2XPEA 1PMTA 5A4VA 1TU8A 1OC9A 3MYDA 2DIZA 4F0BA 3WGDA 2C0FA 2VCXA 1EP7A 1B4PA 3F4SA 1XG8A 3EE2A 4MJAA 5DCGA 2K6VA 5D9VA 2X8HA 4K0GA 2A4HA 1AW9A 2H70A 2WCIA 3LSZA 5KN2A 2O8VB 5IMDA 2VUPA 1E6BA 1TJDA 2MBSA 2PU9C 1XW9A 2C4JA 2VCVA 4MZWA 2VIMA 5AIVA 1MDIA 5IOWA 3N9JA 5HFIA 2GDRA 1G7OA 1YY7A 2H73A 5HR1A 4ZB9A 3IAS2 4OFTA 3IK7A 3M1GA 4BWSA 5ID2A 2MMZA 12GSA 2VL2C 3LFLA 5IO2A 4MABA 1NW2A 1T3BA 4RQXA 2OE1A 2GSSA 4XCSA 2LJRA 2WJUA 4RI7A 4K9ZA 2HXKA 5B6MA 4XS4A 1TP9A 2YWNA 1Z7RA 5JCGA 1G0TA 1Q98A 2H72A 5ECSA 2GTUA 3KZQA 4I2TA 5F07A 1ERVA 2LJAA 4ZIJA 1V98A 1A2LA 2YNXA 3R2QA 1Z7PA 3TKSA 2H8LA 2QA2A 4EF0A 4TN8A 3GSTA 3HVNA 3MDKA 4X0XA 8GSSA 1ZMAA 2GVPA 5H5SA 2E7PA 1FG4A 1S3DA 3FKFA 3GV1A 1C72A 5COHA 2IL3A 1XZOA 4IW9A 3L78A 4YAPA 4K7IA 4WR5A 4IP1A 2YP6A 4AGSA 2FNOA 2CAQA 1YZXA 2PVQA 1QUWA 2LRNA 4K7NA 2YWIA 4ZB8A 4CW9A 4Z2TA 2LKUA 4XRDA 2RM6A 3L0HA 4KDYA 5HQPA 1F37A 4QL7A 4MJCA 1AQWA 2C1YA 1F6MC 1SD8A 4LL4B 6GSWA 3IHGA 4JZQA 1JHBA 1GNEA 4JBBA 2H75A 2VL9A 5F8BA 2R2JA 3A2WA 5AN1A 1G7EA 2GQMA 1KBNA 2PGTA 4YH2A 4KB3A 1M2DA 5AIXA 5D9TA 1G6YA 2M80A 3VI7A 2YV7A 3ZRDA 3QMXA 3C71A 4OFMA 3GIXA 5CRDA 2DLXA 3C1RA 4POLA 5B8BA 1GSSA 3TJBA 3UBKA 4DSQA 3LWAA 4F2IA 2R37A 20GSA 1DBYA 3F3RA 3M8NA 3CBUA 2F8AA 5B7CA 1EP8A 3KP8A 4KW6A 2H6XA 3I69A 4TR3A 2I1UA 2KOKA 1K0BA 4GQFA 5DQSA 1QGVA 1O6JA 4POMA 2H0HA 4ZBBA 4ECCA 4G2EA 2LUSA 2OACA 2PERA 3O3TA 4O5UA 4HJMA 1TRVA 4AJ7A 5LNKe 1M2AA 2OBIA 4XHMA 2LRTA 1YKCA 4WETA 3D4MA 4IKHA 1PX7A 1X5EA 4ISDA 2AAWA 1ZYQB 2HYXA 4HUAA 4TRXA 4IVFA 2CQ9A 5IMCA 5LCZA 2DMMA 3DIEA 3MWHA 1G6WA 4FIWA 2HZEA 2DJKA 4EDZA 2IFQB 5J9CA 4XRAA 5GSTA 3ZL5A 4K7OA 3WT1A 3KMOA 5G5FA 2X64A 2YWOA 5CO3A 1TRWA 3ZTLA 4FQUA 2X8GA 3BOAA 3GL3A 4K1FA 1EOGA 2OKAA 2EIQA 3IRAA 1M9AA 5KN0A 4MF7A 2H0GA 3BCKA 4FH8A 1FB0A 4OFNA 1N8JA 1LJRA 3FZAA 1T1VA 5IMFA 1U87A 2CT6A 4BVYA 4EIQA 1HNBA 4HU9A 4ZB6A 3IOSA 3TKQA 2R0PA 4BA7A 1K0NA 2GGTA 1CQGA 4J2FA 2FWGA 4O7HA 2F3MA 2C3NA 4DSSB 1SJ6A 3GYKA 3IPZA 4N0ZA 1R26A 2R5GA 1S3RA 2GT5A 3FEUA 2I9HA 2GZYA 1GSFA 3KJYA 1S3AA 1OKDA 5JWQB 4PQIA 1T4ZA 2REMA 1OC8A 3LYPA 2HZFA 1XFLA 3H79A 4PTSA 2QSIA 4HDEA 4BL7B 2DJ0A 2YV9A 3HCZA 4TW5A 5ECQB 2DJJA 2LNSA 2V32A 1SJZA 2I3YA 2V1MA 3CYNA 1DE1A 4G0KA 5FWGA 3UEMA 2H1GA 3FYGA 2H6ZA 3UBLA 4ECIA 6GSUA 4X43A 4KF9A 1JZRA 2FWEA 3IR4A 2FWFA 4IP6A 1GTBA 5IQYA 5D73A 4N10A 3VPQA 4O32A 1B9YC 4E8EA 3F3QA 3APQA 1A8YA 2JZSA 4WBRD 5CRHA 1M7TA 4KSOA 2LRCA 3TB2A 2KLXA 3I43A 1T4YA 5F06A 3G7JA 2R6KA 1Z6NA 2FY6A 4IQ1A 5CNWA 1N2AA 4WXTA 1ZGNA 1QMVA 4MF5A 2LNTA 4LMVA 6GSYA 3DD3A 1ML6A 3ERWA 1M0UA 1W89A 4K2DA 2B1KA 1A24A 1V40A 4I5QA 1LU4A 4MZCA 2HLSA 3RPNA 4MDCA 1SYRA 1RW1A 3F6FA 2JU5A 1ON4A 3HJOA 3P90A 6GSXA 1GUHA 2B5YA 1V57A 1F2EA 4IJIA 1SK1A 3IDVA 1GSUA 2RLIA 2KP1A 3VWXA 4YAVA 1ZZYA 2C3TA 3ME8A 3IA1A 1QFNA 5CP1A 3NOFA 4KCAA 3DVWA 1WRYA 3CSHA 5KEJA 4DSSA 1XCCA 2VAFA 3ZYWA 4BVXA 3PR8A 1J0FA 2ES7A 3KD0A 3FZ4A 3ZVJD 2GSRA 3HJMA 1NHYA 5E4WA 4Z2RA 3VWWA 1AUCA 1F3AA 1GH2A 1SKSB 1MDJA 1BQ7A 1YDKA 4PNFA 1SJIA 5A5KA 4LA1A 4BWQA 3FY7A 4JR4A 3CSIA 19GSA 4NHZA 4NPBA 2C0GA 3TGZA 1TXXA 2B5EA 3RHBA 3D5JA 3TOUA 1XWBA 5G31A 4AJ6A 4EC0A 5AGYA 2LTKA 5ELGA 2FCHA 2G0FA 3LGCA 2MMNA 2F51A 1ACVA 2OE0A 3VURA 1GUMA 2DBCA 4K0NA 4TR1B 2H19A 4GSNA 2MMOA 2FHEA 2NTOA 1OE8A 2H76A 3FR3A 4JRRA 2PPTA 5ELAA 3RAZA 2F8FA 3ZLPA 3CRTA 5C04A 1JFUA 16GSA 2P5QA 3KTBA 3US3A 3W8SA 5JCUA 5EL8A 1TKDB 3HZ4A 2D2ZA 1PKZA 3KXOA 4OO4A 2FA8A 5J5NA 1SL1B 3HD5A 5INYA 2VCQA 3HY2A 5CYYA 4YQMA 1KNGA 5DBQA 2FWHA 5KN3A 2HSHA 3IHQA 4J56E 3WGEA 4I2UA 3KIJA 3G7IA 4F0CA 3LYKA 4JU5A 5AISA 5J4UA 2K8VA 5DAKB 1Z5YE 2N5FA 1T00A 4ZXGA 1YF1A 1XW6A 2C0EA 4L5LA 4EXJA 1GLQA 1AXDA 3EWLA 1WPIA 2H01A 4LL1B 3DYRA 3G7YA 5GZZB 1U6TA 2O85A 3D21A 2BMXA 5F0GA 1FVKA 3SBCA 2B1LA 2OJLA 4MF6A 5JCWA 3W6GA 4KNDA 1I9DA 3F9UA 3TJKA 4AF2A 2K18A 2R0CA 4USSA 2VCTA 2LV3A 2HRFA 3E0UA 4N30A 2JL4A 2XHFA 2HSMA 3LEFA 5A4UA 4IELA 4D73A 4LMWA 1TW9A 2WDUA 2AYTA 3EINA 2R0GA 2VLTA 1GTUA 2IMIA 4TVEA 2A2PA 2LQOA 4GF0A 1MTCA 3J7Yb 1NHOA 4L0WA 1SYXA 3HVXA 1DE2A 2J23A 4TR1A 2YJHA 3FR9A 2NPBA 3ERGA 1K0AA 6GSTA 5BMUA 1GL8A 4L5OA 2YZUA 1TI1A 4RUVA 5IPHA 1SL2B 1O73A 3GHAA 4NV2A 2MMAA 1RK4A 2OA7A 1VF2A 1EEMA 4FYCA 1X5DA 3IC8A 4TXVA 1XXUA 2HSYA 3IC4A 2DSAA 2ON7A 3LJRA 5IM9A 3KEBA 5E59A 1GUKA 1XVWA 4TXOB 2GSQA 3F8UA 3QD9A 4ID0A 17GSA 1FW1A 3UARA 4EKZA 4IN0A 4ZBAA 1VF3A 3S9FA 3QPMA 1XVQA 3WYWA 3QFBC 4WEYA 1U3AA 3CRUA 3GKNA 1R7HA 1SK2A 1X9MB 1EZKA 4EE0A 2DJ2A 2H30A 1Z6MA 4OCFA 4GSTA 2B3SA 5J3RA 2FGXA 1CQHA 4KDUA 2EIOA 5ECMB 1WP0A 4OWYA 2EIRA 2CVDA 3RPPA 4QQ7A 1ST9A 1ILOA 1Q4JA 1SK0A 3DEXA 1PN9A 4CY6A 1R5AA 3GX0A 4FYUA 3EMPA 3KH9A 2GZZA 3A5WA 2WULA 3A2XA 4V2NA 5GAND 2HT9A 3UJ1A 2DJ3A 4DSRA 3GSSA 3H93A 4BPYA 1UVZA 2VOCA 5CRGA 3TRQA 4EDYA 2TIRA 3CMIA 1A0FA 2B7JA 1YEXA 4G0LA 4MZBA 3HDCA 3TOTA 3LXZA 2QKEA 1J08A 3ZIVA 2M46A 4EL1A 1PN0A 1VGLA 3ZMKA 2WRTA 4K2XA 4GWRA 3BJ5A 1ZYNA 4GTUA 4YQUA 1PKWA 5A4WA 3HJPA 3JCML 5IOXA 3UMAA 1SKRB 4ZBDA 3KP9A 4EIPA 2GQLA 1GSEA 1GLPA 2FA4A 4KGIA 1O8XA 3D4TA 2YZHA 2DKHA 3TRPA 2C0DA 2X49A 4IJ3A 1H75A 2KHPA 4ILFA 4KCEA 4PX1A 7GSSA 2H6YA 3CTFA 1BEDA 3EU3A 1OKTA 4PQ1A 4ML1A 3GKKA 2QGVA 4J57E 2V2GA 2DC5A 1ZOFA 1ERUA 2HI7A 5G1KA 5H5RA 2PMTA 1SD9A 2VM2A 5GAPD 5ECPB 1GTAA 3GUSA 3O76A 1X9SB 3A3TA 3TCOA 1USBA 5D9WA 5GSSA 2L57A 1EGRA 2VD0A 1U88A 2YANA 4JR6A 4HQZA 4NAXA 1QK8A 1TOFA 4O5RA 1HD2A 1W4VA 1DUGA 1JLWA 2RUEA 3QDNA 1FOVA 2VL3A 4JEDA 2HRNA 5DDLA 1K0MA 4GQCA 5IPGA 2OADA 4MCUA 2X8CA 4XS6A 2ZUPA 3F0IA 4FYBA 5L71A 1M99A 5LD0A 3NIVA 4HOJA 3KH7A 4XTSA 1UN2A 3FZ5A 4ML6A 5IO0A 1GNWA 2VM1A 4L0UA 3MNGA 3CSJA 3Q19A 5EPFA 3I6AA 1AC1A 1PQNA 2QC7A 1H4OA 2L4CA 2CV4A 1ZYPA 2H66A 2P5RA 2AUVA 1XWCA 3D22A 1YQ1A 1R5PA 4G0IA 2O7KA 4PXOA 4ZL8A 5IMZA 2YOIA 2RUFA 3QFAC 2X99A 2IFQA 4ZL9A 1GSYA 2XC2A 1K3OA 5KOXA 3QAWA 1WJKA 4Q5QA 2V6KA 4MH3A 2YWMA 1F9MA 3EMXA 4KUNA 2PWJA 3KM6A 1O7UA 3L9VA 5G30A 3ZREA 2CX3A 4V1Ag 2N5AA 3OR5A 2L59A 1GULA 1TDIA 3DMLA 4PGTA 3KMNA 2IJYA 3LQ7A 2C80A 1V2AA 1AQVA 2GQKA 4HI7A 1XWAA 1OC9B 4Z7XA 3QOUA 2V41A 1T8EB 1HQOA 3FMWA 5ECOB 2G2QA 2P31A 3P8WA 2I4AA 2OE3A 1SKWB 3DWVA 4E8HA 4K5SA 5B6NA 1FOHA 2IMKA 3EU4A 4RI6A 3V1WA 4BL7A 3M3MA 3GKMA 3PPUA 3TKSC 5D8IA 2CZ3A 1AQXA 3DGQA 2CA8A 1V9WA 4MMMA 2BTOT 1PA3A 1THXA 2ON5A 4MNNA 3GNJA 3IK9A 4K5RA 2I81A 4ACSA 5BRTA 2H0IA 3C1SA 4HS1A 1TK0B 3GTUB 5ID2B 5KOWA 4PUFC 3P2AA 2OBKA 4HZ4A 2ZNMA 1PL2A 1X5CA 2NDOA 2B6MA 5DQYA 2AB6A 2JZRA 2H71A 5IMAA 3DRNA 4XS4B 4BIKA 3TKRA 3IXRA 2BJXA 1JZOA 1K3LA 4KA0A 4IGJA 2CX4A 4QL9A 4PNGA 3O6TA 4PQHA 1VF4A 3UVTA 1HNAA 2HFDA 4MP4A 4Q5RA 3GFKA 3H8QA 5D93A 1SENA 1WOUA 2HNLA 4GLTA 4V2LA 3BBYA 1JZWA 2LJKA 2V6OA 4A5PA 1BJXA 3KCMA 3GX8A 2MZCA 1YJ6A 1BX9A 2XPDA 3FW2A 1S3CA 9GSSA 4CY8A 5H5QA 14GSA 3F6DA 3WT2A 1FHEA 2A4VA 1O81A 2WZ9A 1JZDA 2PUKC 2JSZA 3PINA 4ZL7A 2H1DA 4NMUA 5EVOA 1EGOA 5DALB 1PRXA 4O5QA 5D9XA 2YCDA 1K0DA 3MIXA 2VO4A 2UZ8A 3APSA 2XBIA 2PBJA 1TI3A 1TK5B 4ICYA 4WR4A 13GSA 2J9HA 4I8BA 3F4RA 2VCWA 5G1LA 3ZFLA 1GWCA 5CRWA 1A8LA 1E2YA 3HYPA 1TRUA 4HEA2 3FR6A 3RHCA 2JACA 3MSZA 2O89A 5B8AA 4Q5FA 3LXTA 3K8NA 2M72A 1ERWA 1RQMA 2H74A 4HZ2A 1EV4A 1O8WA 2O87A 3ZIJA 4GCIA 3ZMLA 5HR0A 3GTUA 3U5RE 3U6VA 2PN8A 5D96A 3N5OA 1OC3A 3BCIA 2WGRA 3Q74A 1B48A 1KTEA 5F05A 3HXSA 2IWTA 1XOBA 4HU7A 3VI5A 2F9SA 1OYJA 1A2JA 1Y6EA 4IHUA 1U3IA 2DIYA 2HE3A 4F82A 3DKSA 2L6DA 2GSTA 1OVNA 4TOPA 4YKFA 1NM3A 2HRAA 5DVBA 3FRCA 4G10A 3RDWA 3F63A 2NBSA 4ZILA 4TR0A 5CAXA 3GL5A 2VLUA 4XIHA 3VK9A 4WF4A 4HSCX 2H1AA 1MD4A 2HZEB 3IAM2 3E3EA 3UVHA 5DJLA 1HYUA 1O85A 3GMFA 2IIYA 3EVIA 2CZ2A 3QAVA 2NVLA 2A2SA 4NV5A 4EUYA 3F4TA 2JSYA 4GSSA 11GSA 2FUG2 2K9FA 4MPFA 3APOA 1K0OA 5DAKA 2JZTA 5C00A 4HQSA 3LORA 5DALA 2MBTA 5G2ZA 3SWLA 1FO5A 2JADA 4AJ8A 3BD2A 1HNCA 5HFKA 1F3BA 4X4JA 1MD3A 4BVYB 3EPTA 4K8MA 5HFGA 1WE0A 3C73A 4MLYA 3J7Yk 1QXHA 2L6CA 3D0ZA 3UOMA 1BAYA 3L4NA 2IMDA 4KE3A 5EY6A 3GURA 3UIWA 4YQVA 1XW5A 1GSDA 1TU7A 4POKA 1DSBA 2KP2A 1EWXA 2LEGA 4MH2A 4WKWA 4KDXA 1NSWA 1GTIA 1SU9A 4PURA 1Z3EA 5JWOB 1GRXA 1M9BA 3FK8A 2WFCA 3CTGA 3IBHA 3ISOA 2CVBA 4OCEA 4GRFA 1OE7A 5IIZA 5IMVA 1ABAA 3QAGA 3VFIA 3GKXA 3GN3A 1XOAA 2EC4A 1XWKA 5CREA 4IBPA 5G5EA 2VD1A 2RM5A 3VPTA 1XPVA 4MK3A 4ULXA 1R4WA 1WMJA 4FO5A 4MJBA 5ECIB 1Z9HA 1PL1A 3GRXA 4WF5A 1LBKA 4OO5A 3ZFBA 1THOA 4WBJA 1A0RP 3H4KA 2GZPA 2VL2A 3LW9A 2B7KA 1VF1A 3HZ8A 2IMEA 4G9HA 1AAZA 5ECRB 4TXOA 3AY8A 1T7PB 4V1Ap 4EVMA 4RQRA 2HRKA 3VWUA 5FHIA 2R4VA 3CQFA 2DMLA 2IMFA 2N5BA 2ALBA 3ME7A 2IPAA 4KAEA 5HR3A 3ZZXA 4IQAA 5JWRB 22GSA 3GA4A 1SL0B 1V58A 2X4AA 1JLVA 3TJJA 3C8EA 3HKRA 1IYIA 5FT3A 1PGTA 4G19A 3ZITA 3P7XA 2LSTA 4MJEA 4KSMA 2E0QA 5DJMA 2E2GA 2LS5A 1M2BA 2GLRA 5J9BA 2ZCTA 1FVJA 1MEKA 3TUEA 1X9WB 1EV9A 2L4QA 1EEJA 4P3YB 4BVXB 5ECNB 3FZ9A 1WIKA 3TKPA 3TJFA 1TK8B 4EO3A 1TTZA 5ECKB 4LLRA 2DKIA 1PD21 3GH9A 3IE3A 2KUCA 2IN3A 4Q5NA 4TR4A 4TKYA 4MA9A 2LQQA 2XBQA 1KEBA 3HA9A 3GH6A 3TKSE 1GP1A 3DVXA 1FAAA 1XWGA 3PH9A 1YEPA 4Z2UA 4ECJA 4DEJA 18GSA 1WWJA 3D6IA 3C7MA 3M9KA 1ZCPA 1B8XA 2PVOC 5ENUA 3H1NA 1QQ2A 1PFOA 3E9JB 1FB6A 5J41A 1IYHA 3L9SA 4NHWA 3HHVA 3ERFA 1UA5A 1OAZA 4ECBA 2K8SA 4X1UA 3KTLA 1XBSA 3IV4A 3Q6OA 1J9BA 1XIYA 4YKGA 1ERTA 4H86A 3HVVA 4V2MA 2AHEA 1BYEA 2Z9SA 2FLSA 3EC3A 4L8EA 2VCZA 3UAPA 2H1BA 2AJQB 3MAKA 5ECLB 2GT6A 3TDGA 2TRXA 1YKAA 3I9V2 4OD7A 3TJGA 3L9UA 1X0RA 4JE1A 2L5LA 2RIIA 6GSSA 1ZL9A 3FHKA 1K0CA 1A2MA 2CVKA 3QR6A 2YN1A 4OMVA 3CXGA 6GSVA 3EYTA 3QCPA 3A2VA 4CDOA 5ECHB 4O92A 4F03A 3M9JA 4IS0A 3W8JA 3G9BA 2L5OA 4KX4A 3DXBA 3Q18A 2YPMA
chains in the Genus database with same CATH topology
3EURA 4I6XA 3VLNA 3VWVA 1PSQA 1VRSD 4POBA 1ZYEA 4NWYA 4K6XA 1YF0A 3KGKA 2YJ7A 1GSQA 4GXZA 4DVCA 1B4QA 4CHSA 3WGXA 2R3XA 2A2RA 2MYGA 1I5GA 2DJ1A 2E2MA 3HVSA 4HJ2A 10GSA 4N0VA 4NXIA 3R3EA 5HR2A 3RBTA 4D73B 1A23A 1AIUA 4I97A 3ZVJA 1TRSA 2CAIA 1K3YA 1MDKA 2WS2A 4XS1A 5DCHA 3TRXA 2WB9A 3LG6A 2VLVA 3M0FA 1BG5A 1Y25A 3PGTA 2GS3A 1UC7A 2C8UA 2FD3A 2C3QA 4F9ZA 4PUAA 1URMA 1EOHA 3ED3A 4N11A 4MPGA 5ABRA 3NZNA 5KN1A 1PX6A 4KH7A 2TRCP 3A5IA 2QA1A 2B5XA 1B9XC 2AV4A 2P0GA 3UL3A 3WD6A 2XPEA 1PMTA 5A4VA 1TU8A 1OC9A 3MYDA 2DIZA 4F0BA 3WGDA 2C0FA 2VCXA 1EP7A 1B4PA 3F4SA 3EE2A 4MJAA 5DCGA 2K6VA 5D9VA 2X8HA 4K0GA 2A4HA 1AW9A 2H70A 2WCIA 3LSZA 5KN2A 2O8VB 5IMDA 2VUPA 1E6BA 1TJDA 2MBSA 2PU9C 1XW9A 2C4JA 2VCVA 4MZWA 2VIMA 5AIVA 1MDIA 5IOWA 3N9JA 5HFIA 2GDRA 1G7OA 1YY7A 2H73A 5HR1A 4ZB9A 3IAS2 4OFTA 3IK7A 3M1GA 4BWSA 5ID2A 2MMZA 12GSA 2VL2C 3LFLA 5IO2A 4MABA 1NW2A 1T3BA 4RQXA 2OE1A 2GSSA 4XCSA 2LJRA 2WJUA 4RI7A 4K9ZA 2HXKA 5B6MA 4XS4A 1TP9A 2YWNA 1Z7RA 5JCGA 1G0TA 1Q98A 2H72A 5ECSA 2GTUA 3KZQA 4I2TA 5F07A 1ERVA 2LJAA 4ZIJA 1V98A 1A2LA 2YNXA 3R2QA 1Z7PA 3TKSA 2H8LA 2QA2A 4EF0A 4TN8A 3GSTA 3MDKA 4X0XA 8GSSA 1ZMAA 2GVPA 5H5SA 2E7PA 1FG4A 1S3DA 3FKFA 3GV1A 1C72A 5COHA 2IL3A 1XZOA 4IW9A 3L78A 4YAPA 4K7IA 4WR5A 4IP1A 2YP6A 4AGSA 2FNOA 2CAQA 1YZXA 2PVQA 1QUWA 2LRNA 4K7NA 2YWIA 4ZB8A 4CW9A 4Z2TA 2LKUA 4XRDA 2RM6A 3L0HA 4KDYA 5HQPA 1F37A 4QL7A 4MJCA 1AQWA 2C1YA 1F6MC 1SD8A 4LL4B 6GSWA 3IHGA 4JZQA 1JHBA 1GNEA 4JBBA 2H75A 2VL9A 5F8BA 2R2JA 3A2WA 5AN1A 1G7EA 2GQMA 1KBNA 2PGTA 4YH2A 4KB3A 1M2DA 5AIXA 5D9TA 1G6YA 2M80A 3VI7A 2YV7A 3ZRDA 3QMXA 3C71A 4OFMA 3GIXA 5CRDA 2DLXA 3C1RA 4POLA 5B8BA 1GSSA 3TJBA 3UBKA 4DSQA 3LWAA 4F2IA 2R37A 20GSA 1DBYA 3F3RA 3M8NA 3CBUA 2F8AA 5B7CA 1EP8A 3KP8A 4KW6A 2H6XA 3I69A 4TR3A 2I1UA 2KOKA 1K0BA 4GQFA 5DQSA 1QGVA 1O6JA 4POMA 2H0HA 4ZBBA 4ECCA 4G2EA 2LUSA 2OACA 2PERA 3O3TA 4O5UA 4HJMA 1TRVA 4AJ7A 5LNKe 1M2AA 2OBIA 4XHMA 2LRTA 1YKCA 4WETA 3D4MA 4IKHA 1PX7A 1X5EA 4ISDA 2AAWA 1ZYQB 2HYXA 4HUAA 4TRXA 4IVFA 2CQ9A 5IMCA 5LCZA 2DMMA 3DIEA 3MWHA 1G6WA 4FIWA 2HZEA 2DJKA 4EDZA 2IFQB 5J9CA 4XRAA 5GSTA 3ZL5A 4K7OA 3WT1A 3KMOA 5G5FA 2X64A 2YWOA 5CO3A 1TRWA 3ZTLA 4FQUA 2X8GA 3BOAA 3GL3A 4K1FA 1EOGA 2OKAA 2EIQA 3IRAA 1M9AA 5KN0A 4MF7A 2H0GA 3BCKA 4FH8A 1FB0A 4OFNA 1N8JA 1LJRA 3FZAA 1T1VA 5IMFA 1U87A 2CT6A 4BVYA 4EIQA 1HNBA 4HU9A 4ZB6A 3IOSA 3TKQA 2R0PA 4BA7A 1K0NA 2GGTA 1CQGA 4J2FA 2FWGA 4O7HA 2F3MA 2C3NA 4DSSB 1SJ6A 3GYKA 3IPZA 4N0ZA 1R26A 2R5GA 2GT5A 3FEUA 2I9HA 2GZYA 1GSFA 3KJYA 1S3AA 1OKDA 5JWQB 4PQIA 1T4ZA 2REMA 1OC8A 3LYPA 2HZFA 1XFLA 3H79A 4PTSA 2QSIA 4HDEA 4BL7B 2DJ0A 2YV9A 3HCZA 4TW5A 5ECQB 2DJJA 2LNSA 2V32A 1SJZA 2I3YA 2V1MA 3CYNA 1DE1A 4G0KA 5FWGA 3UEMA 2H1GA 3FYGA 2H6ZA 3UBLA 4ECIA 6GSUA 4X43A 4KF9A 1JZRA 2FWEA 3IR4A 2FWFA 4IP6A 1GTBA 5IQYA 5D73A 4N10A 3VPQA 4O32A 1B9YC 4E8EA 3F3QA 3APQA 1A8YA 2JZSA 4WBRD 5CRHA 1M7TA 4KSOA 2LRCA 3TB2A 2KLXA 3I43A 1T4YA 5F06A 3G7JA 2R6KA 1Z6NA 2FY6A 4IQ1A 5CNWA 1N2AA 4WXTA 1ZGNA 1QMVA 4MF5A 2LNTA 4LMVA 6GSYA 3DD3A 1ML6A 3ERWA 1M0UA 1W89A 4K2DA 2B1KA 1A24A 1V40A 4I5QA 1LU4A 4MZCA 2HLSA 3RPNA 4MDCA 1SYRA 1RW1A 3F6FA 2JU5A 1ON4A 3HJOA 3P90A 6GSXA 1GUHA 2B5YA 1V57A 1F2EA 4IJIA 1SK1A 3IDVA 1GSUA 2RLIA 2KP1A 3VWXA 4YAVA 1ZZYA 2C3TA 3ME8A 3IA1A 1QFNA 5CP1A 3NOFA 4KCAA 3DVWA 1WRYA 3CSHA 5KEJA 4DSSA 1XCCA 2VAFA 3ZYWA 4BVXA 3PR8A 1J0FA 2ES7A 3KD0A 3FZ4A 3ZVJD 2GSRA 3HJMA 1NHYA 5E4WA 4Z2RA 3VWWA 1AUCA 1F3AA 1GH2A 1SKSB 1MDJA 1YDKA 1BQ7A 4PNFA 1SJIA 5A5KA 4LA1A 4BWQA 3FY7A 4JR4A 3CSIA 19GSA 4NHZA 4NPBA 2C0GA 3TGZA 1TXXA 2B5EA 3RHBA 3D5JA 3TOUA 1XWBA 5G31A 4AJ6A 4EC0A 5AGYA 2LTKA 5ELGA 2FCHA 2G0FA 3LGCA 2MMNA 2F51A 1ACVA 2OE0A 3VURA 1GUMA 2DBCA 4K0NA 4TR1B 2H19A 4GSNA 2MMOA 2FHEA 2NTOA 1OE8A 2H76A 3FR3A 4JRRA 2PPTA 5ELAA 3RAZA 2F8FA 3ZLPA 3CRTA 5C04A 1JFUA 16GSA 2P5QA 3KTBA 3US3A 3W8SA 5JCUA 5EL8A 1TKDB 3HZ4A 2D2ZA 1PKZA 3KXOA 4OO4A 2FA8A 5J5NA 1SL1B 3HD5A 5INYA 2VCQA 3HY2A 5CYYA 4YQMA 1KNGA 5DBQA 2FWHA 5KN3A 2HSHA 3IHQA 4J56E 3WGEA 4I2UA 3KIJA 3G7IA 4F0CA 3LYKA 4JU5A 5AISA 5J4UA 2K8VA 5DAKB 1Z5YE 2N5FA 1T00A 4ZXGA 1YF1A 1XW6A 2C0EA 4L5LA 4EXJA 1GLQA 1AXDA 3EWLA 1WPIA 2H01A 4LL1B 3DYRA 3G7YA 5GZZB 1U6TA 2O85A 3D21A 2BMXA 5F0GA 1FVKA 3SBCA 2B1LA 2OJLA 4MF6A 5JCWA 3W6GA 4KNDA 1I9DA 3F9UA 3TJKA 4AF2A 2K18A 2R0CA 4USSA 2VCTA 2LV3A 2HRFA 3E0UA 4N30A 2JL4A 2XHFA 2HSMA 3LEFA 5A4UA 4IELA 4D73A 4LMWA 1TW9A 2WDUA 2AYTA 3EINA 2R0GA 2VLTA 1GTUA 2IMIA 4TVEA 2A2PA 2LQOA 4GF0A 1MTCA 3J7Yb 1NHOA 4L0WA 1SYXA 3HVXA 1DE2A 2J23A 4TR1A 2YJHA 3FR9A 2NPBA 3ERGA 1K0AA 6GSTA 5BMUA 1GL8A 4L5OA 2YZUA 1TI1A 4RUVA 5IPHA 1SL2B 1O73A 3GHAA 4NV2A 2MMAA 1RK4A 2OA7A 1VF2A 1EEMA 4FYCA 1X5DA 3IC8A 4TXVA 1XXUA 2HSYA 3IC4A 2DSAA 2ON7A 3LJRA 5IM9A 3KEBA 5E59A 1GUKA 1XVWA 4TXOB 2GSQA 3F8UA 3QD9A 4ID0A 17GSA 1FW1A 3UARA 4EKZA 4IN0A 4ZBAA 1VF3A 3S9FA 3QPMA 1XVQA 3WYWA 3QFBC 4WEYA 1U3AA 3CRUA 3GKNA 1R7HA 1SK2A 1X9MB 1EZKA 4EE0A 2DJ2A 2H30A 1Z6MA 4OCFA 4GSTA 2B3SA 5J3RA 2FGXA 1CQHA 4KDUA 2EIOA 5ECMB 1WP0A 4OWYA 2EIRA 2CVDA 3RPPA 4QQ7A 1ST9A 1ILOA 1Q4JA 1SK0A 3DEXA 1PN9A 4CY6A 1R5AA 3GX0A 4FYUA 3EMPA 3KH9A 2GZZA 3A5WA 2WULA 3A2XA 4V2NA 5GAND 2HT9A 3UJ1A 2DJ3A 4DSRA 3GSSA 3H93A 4BPYA 1UVZA 2VOCA 5CRGA 3TRQA 4EDYA 2TIRA 3CMIA 1A0FA 2B7JA 1YEXA 4G0LA 4MZBA 3HDCA 3TOTA 3LXZA 2QKEA 1J08A 3ZIVA 2M46A 4EL1A 1PN0A 1VGLA 3ZMKA 2WRTA 4K2XA 4GWRA 3BJ5A 1ZYNA 4GTUA 4YQUA 1PKWA 5A4WA 3HJPA 3JCML 5IOXA 3UMAA 1SKRB 4ZBDA 3KP9A 4EIPA 2GQLA 1GSEA 1GLPA 2FA4A 4KGIA 1O8XA 3D4TA 2YZHA 2DKHA 3TRPA 2C0DA 2X49A 4IJ3A 1H75A 2KHPA 4ILFA 4KCEA 4PX1A 7GSSA 2H6YA 3CTFA 1BEDA 3EU3A 1OKTA 4PQ1A 4ML1A 3GKKA 2QGVA 4J57E 2V2GA 2DC5A 1ZOFA 1ERUA 2HI7A 5G1KA 5H5RA 2PMTA 1SD9A 2VM2A 5GAPD 5ECPB 1GTAA 3GUSA 3O76A 1X9SB 3A3TA 3TCOA 1USBA 5D9WA 5GSSA 2L57A 1EGRA 2VD0A 1U88A 2YANA 4JR6A 4HQZA 4NAXA 1QK8A 1TOFA 4O5RA 1HD2A 1W4VA 1DUGA 1JLWA 2RUEA 3QDNA 1FOVA 2VL3A 4JEDA 2HRNA 5DDLA 1K0MA 4GQCA 5IPGA 2OADA 4MCUA 2X8CA 4XS6A 2ZUPA 3F0IA 4FYBA 5L71A 1M99A 5LD0A 3NIVA 4HOJA 3KH7A 4XTSA 1UN2A 3FZ5A 4ML6A 5IO0A 1GNWA 2VM1A 4L0UA 3MNGA 3CSJA 3Q19A 5EPFA 3I6AA 1AC1A 1PQNA 2QC7A 1H4OA 2L4CA 2CV4A 1ZYPA 2H66A 2P5RA 2AUVA 1XWCA 3D22A 1YQ1A 1R5PA 4G0IA 2O7KA 4PXOA 4ZL8A 5IMZA 2YOIA 2RUFA 3QFAC 2X99A 2IFQA 4ZL9A 1GSYA 2XC2A 1K3OA 5KOXA 3QAWA 1WJKA 4Q5QA 2V6KA 4MH3A 2YWMA 1F9MA 3EMXA 4KUNA 2PWJA 3KM6A 1O7UA 3L9VA 5G30A 3ZREA 2CX3A 4V1Ag 2N5AA 3OR5A 2L59A 1GULA 1TDIA 3DMLA 4PGTA 3KMNA 2IJYA 3LQ7A 2C80A 1V2AA 1AQVA 2GQKA 4HI7A 1XWAA 1OC9B 4Z7XA 3QOUA 2V41A 1T8EB 1HQOA 3FMWA 5ECOB 2G2QA 2P31A 3P8WA 2I4AA 2OE3A 1SKWB 3DWVA 4E8HA 4K5SA 5B6NA 1FOHA 2IMKA 3EU4A 4RI6A 3V1WA 4BL7A 3M3MA 3GKMA 3PPUA 3TKSC 5D8IA 2CZ3A 1AQXA 3DGQA 2CA8A 1V9WA 4MMMA 2BTOT 1PA3A 1THXA 2ON5A 4MNNA 3GNJA 3IK9A 4K5RA 2I81A 4ACSA 5BRTA 2H0IA 3C1SA 4HS1A 1TK0B 3GTUB 5ID2B 5KOWA 4PUFC 3P2AA 2OBKA 4HZ4A 2ZNMA 1PL2A 1X5CA 2NDOA 2B6MA 5DQYA 2AB6A 2JZRA 2H71A 5IMAA 3DRNA 4XS4B 3TKRA 3IXRA 2BJXA 1JZOA 1K3LA 4KA0A 4IGJA 2CX4A 4QL9A 4PNGA 3O6TA 4PQHA 1VF4A 3UVTA 1HNAA 2HFDA 4MP4A 4Q5RA 3GFKA 3H8QA 5D93A 1SENA 1WOUA 2HNLA 4GLTA 4V2LA 3BBYA 1JZWA 2LJKA 2V6OA 4A5PA 1BJXA 3KCMA 3GX8A 2MZCA 1YJ6A 1BX9A 2XPDA 3FW2A 1S3CA 9GSSA 4CY8A 5H5QA 14GSA 3F6DA 3WT2A 1FHEA 2A4VA 1O81A 2WZ9A 1JZDA 2PUKC 2JSZA 3PINA 4ZL7A 2H1DA 4NMUA 5EVOA 1EGOA 5DALB 1PRXA 4O5QA 5D9XA 2YCDA 1K0DA 3MIXA 2VO4A 2UZ8A 3APSA 2XBIA 2PBJA 1TI3A 1TK5B 4ICYA 4WR4A 13GSA 2J9HA 4I8BA 3F4RA 2VCWA 5G1LA 3ZFLA 1GWCA 5CRWA 1A8LA 1E2YA 3HYPA 1TRUA 4HEA2 3FR6A 3RHCA 2JACA 3MSZA 2O89A 5B8AA 4Q5FA 3LXTA 3K8NA 2M72A 1ERWA 1RQMA 2H74A 4HZ2A 1EV4A 1O8WA 2O87A 3ZIJA 4GCIA 3ZMLA 5HR0A 3GTUA 3U5RE 3U6VA 2PN8A 5D96A 3N5OA 1OC3A 3BCIA 2WGRA 3Q74A 1B48A 1KTEA 5F05A 3HXSA 2IWTA 1XOBA 4HU7A 3VI5A 2F9SA 1OYJA 1A2JA 1Y6EA 4IHUA 1U3IA 2DIYA 2HE3A 4F82A 3DKSA 2L6DA 2GSTA 1OVNA 4TOPA 4YKFA 1NM3A 2HRAA 5DVBA 3FRCA 4G10A 3RDWA 3F63A 2NBSA 4ZILA 4TR0A 5CAXA 3GL5A 2VLUA 4XIHA 3VK9A 4WF4A 2H1AA 1MD4A 2HZEB 3IAM2 3E3EA 3UVHA 5DJLA 1HYUA 1O85A 3GMFA 2IIYA 3EVIA 2CZ2A 3QAVA 2NVLA 2A2SA 4NV5A 4EUYA 3F4TA 2JSYA 4GSSA 11GSA 2FUG2 2K9FA 4MPFA 3APOA 1K0OA 5DAKA 2JZTA 5C00A 4HQSA 3LORA 5DALA 2MBTA 5G2ZA 3SWLA 1FO5A 2JADA 4AJ8A 3BD2A 1HNCA 5HFKA 1F3BA 4X4JA 1MD3A 4BVYB 3EPTA 4K8MA 5HFGA 1WE0A 3C73A 4MLYA 3J7Yk 1QXHA 2L6CA 3D0ZA 3UOMA 1BAYA 3L4NA 2IMDA 4KE3A 5EY6A 3GURA 3UIWA 4YQVA 1XW5A 1GSDA 1TU7A 4POKA 1DSBA 2KP2A 1EWXA 2LEGA 4MH2A 4WKWA 4KDXA 1NSWA 1GTIA 1SU9A 4PURA 1Z3EA 5JWOB 1GRXA 1M9BA 3FK8A 2WFCA 3CTGA 3IBHA 3ISOA 2CVBA 4OCEA 4GRFA 1OE7A 5IIZA 5IMVA 1ABAA 3QAGA 3VFIA 3GKXA 3GN3A 1XOAA 2EC4A 1XWKA 5CREA 4IBPA 5G5EA 2VD1A 2RM5A 3VPTA 1XPVA 4MK3A 4ULXA 1R4WA 1WMJA 4FO5A 4MJBA 5ECIB 1Z9HA 1PL1A 3GRXA 4WF5A 1LBKA 4OO5A 3ZFBA 1THOA 4WBJA 1A0RP 3H4KA 2GZPA 2VL2A 3LW9A 2B7KA 1VF1A 3HZ8A 2IMEA 4G9HA 1AAZA 5ECRB 4TXOA 3AY8A 1T7PB 4V1Ap 4EVMA 4RQRA 2HRKA 3VWUA 5FHIA 2R4VA 2DMLA 2IMFA 2N5BA 2ALBA 3ME7A 2IPAA 4KAEA 5HR3A 3ZZXA 4IQAA 5JWRB 22GSA 3GA4A 1SL0B 1V58A 2X4AA 1JLVA 3TJJA 3C8EA 3HKRA 1IYIA 5FT3A 1PGTA 4G19A 3ZITA 3P7XA 2LSTA 4MJEA 4KSMA 2E0QA 5DJMA 2E2GA 2LS5A 1M2BA 2GLRA 5J9BA 2ZCTA 1FVJA 1MEKA 3TUEA 1X9WB 1EV9A 2L4QA 1EEJA 4P3YB 4BVXB 5ECNB 3FZ9A 1WIKA 3TKPA 3TJFA 1TK8B 4EO3A 1TTZA 5ECKB 4LLRA 2DKIA 1PD21 3GH9A 3IE3A 2KUCA 2IN3A 4Q5NA 4TR4A 4TKYA 4MA9A 2LQQA 2XBQA 1KEBA 3HA9A 3GH6A 3TKSE 1GP1A 3DVXA 1FAAA 1XWGA 3PH9A 1YEPA 4Z2UA 4ECJA 4DEJA 18GSA 1WWJA 3D6IA 3C7MA 3M9KA 1ZCPA 1B8XA 2PVOC 5ENUA 3H1NA 1QQ2A 3E9JB 1FB6A 5J41A 1IYHA 3L9SA 4NHWA 3HHVA 3ERFA 1UA5A 1OAZA 4ECBA 2K8SA 4X1UA 3KTLA 1XBSA 3IV4A 3Q6OA 1J9BA 1XIYA 4YKGA 1ERTA 4H86A 3HVVA 4V2MA 2AHEA 1BYEA 2Z9SA 2FLSA 3EC3A 4L8EA 2VCZA 3UAPA 2H1BA 2AJQB 3MAKA 5ECLB 2GT6A 3TDGA 2TRXA 1YKAA 3I9V2 4OD7A 3TJGA 3L9UA 1X0RA 4JE1A 2L5LA 2RIIA 6GSSA 1ZL9A 3FHKA 1K0CA 1A2MA 2CVKA 3QR6A 2YN1A 4OMVA 3CXGA 6GSVA 3EYTA 3QCPA 3A2VA 4CDOA 5ECHB 4O92A 4F03A 3M9JA 4IS0A 3W8JA 3G9BA 2L5OA 4KX4A 3DXBA 3Q18A 2YPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EUR A;  4I6X A;  3VLN A;  3VWV A;  1PSQ A;  1VRS D;  4POB A;  1ZYE A;  4NWY A;  4K6X A;  1YF0 A;  3KGK A;  2YJ7 A;  1GSQ A;  4GXZ A;  4DVC A;  1B4Q A;  4CHS A;  3WGX A;  2R3X A;  2A2R A;  2MYG A;  1I5G A;  2DJ1 A;  2E2M A;  3HVS A;  4HJ2 A;  10GS A;  4N0V A;  4NXI A;  5HR2 A;  3RBT A;  4D73 B;  1A23 A;  1AIU A;  4I97 A;  3ZVJ A;  1TRS A;  2CAI A;  1K3Y A;  1MDK A;  2WS2 A;  4XS1 A;  5DCH A;  3TRX A;  2WB9 A;  3LG6 A;  2VLV A;  3M0F A;  1BG5 A;  1Y25 A;  3PGT A;  2GS3 A;  1UC7 A;  2C8U A;  2FD3 A;  2C3Q A;  4F9Z A;  4PUA A;  1URM A;  1EOH A;  3ED3 A;  4N11 A;  4MPG A;  5ABR A;  3NZN A;  5KN1 A;  1PX6 A;  4KH7 A;  2TRC P;  2B5X A;  1B9X C;  2AV4 A;  2P0G A;  3UL3 A;  3WD6 A;  2XPE A;  1PMT A;  5A4V A;  1TU8 A;  1OC9 A;  2DIZ A;  4F0B A;  3WGD A;  2C0F A;  2VCX A;  1EP7 A;  1B4P A;  3F4S A;  3EE2 A;  4MJA A;  5DCG A;  2K6V A;  5D9V A;  2X8H A;  4K0G A;  1AW9 A;  2H70 A;  2WCI A;  3LSZ A;  5KN2 A;  2O8V B;  5IMD A;  2VUP A;  1E6B A;  1TJD A;  2MBS A;  2PU9 C;  1XW9 A;  2C4J A;  2VCV A;  4MZW A;  2VIM A;  5AIV A;  1MDI A;  5IOW A;  3N9J A;  5HFI A;  2GDR A;  1G7O A;  1YY7 A;  2H73 A;  5HR1 A;  4ZB9 A;  3IAS 2;  4OFT A;  3IK7 A;  3M1G A;  4BWS A;  5ID2 A;  2MMZ A;  12GS A;  2VL2 C;  3LFL A;  5IO2 A;  4MAB A;  1NW2 A;  1T3B A;  4RQX A;  2OE1 A;  2GSS A;  4XCS A;  2LJR A;  2WJU A;  4RI7 A;  4K9Z A;  2HXK A;  5B6M A;  4XS4 A;  1TP9 A;  2YWN A;  1Z7R A;  5JCG A;  1G0T A;  1Q98 A;  2H72 A;  5ECS A;  2GTU A;  3KZQ A;  4I2T A;  5F07 A;  1ERV A;  2LJA A;  4ZIJ A;  1V98 A;  1A2L A;  2YNX A;  3R2Q A;  1Z7P A;  3TKS A;  2H8L A;  4EF0 A;  4TN8 A;  3GST A;  3MDK A;  4X0X A;  8GSS A;  1ZMA A;  2GVP A;  5H5S A;  2E7P A;  1FG4 A;  1S3D A;  3FKF A;  3GV1 A;  1C72 A;  5COH A;  2IL3 A;  1XZO A;  4IW9 A;  3L78 A;  4YAP A;  4K7I A;  4WR5 A;  4IP1 A;  2YP6 A;  4AGS A;  2FNO A;  2CAQ A;  1YZX A;  2PVQ A;  1QUW A;  2LRN A;  4K7N A;  2YWI A;  4ZB8 A;  4CW9 A;  2LKU A;  4XRD A;  2RM6 A;  3L0H A;  4KDY A;  5HQP A;  1F37 A;  4QL7 A;  4MJC A;  1AQW A;  2C1Y A;  1F6M C;  1SD8 A;  4LL4 B;  6GSW A;  4JZQ A;  1JHB A;  1GNE A;  4JBB A;  2H75 A;  2VL9 A;  5F8B A;  2R2J A;  3A2W A;  5AN1 A;  1G7E A;  2GQM A;  1KBN A;  2PGT A;  4YH2 A;  4KB3 A;  1M2D A;  5AIX A;  5D9T A;  1G6Y A;  2M80 A;  3VI7 A;  2YV7 A;  3ZRD A;  3QMX A;  3C71 A;  4OFM A;  3GIX A;  5CRD A;  2DLX A;  3C1R A;  4POL A;  5B8B A;  1GSS A;  3TJB A;  3UBK A;  4DSQ A;  3LWA A;  4F2I A;  2R37 A;  20GS A;  1DBY A;  3F3R A;  3M8N A;  3CBU A;  2F8A A;  5B7C A;  1EP8 A;  3KP8 A;  4KW6 A;  2H6X A;  3I69 A;  4TR3 A;  2I1U A;  2KOK A;  1K0B A;  4GQF A;  5DQS A;  1QGV A;  1O6J A;  4POM A;  2H0H A;  4ZBB A;  4ECC A;  4G2E A;  2LUS A;  2OAC A;  2PER A;  3O3T A;  4HJM A;  1TRV A;  4AJ7 A;  5LNK e;  1M2A A;  2OBI A;  4XHM A;  2LRT A;  1YKC A;  4WET A;  3D4M A;  4IKH A;  1PX7 A;  1X5E A;  4ISD A;  2AAW A;  1ZYQ B;  2HYX A;  4HUA A;  4TRX A;  4IVF A;  2CQ9 A;  5IMC A;  5LCZ A;  2DMM A;  3DIE A;  3MWH A;  1G6W A;  4FIW A;  2HZE A;  2DJK A;  4EDZ A;  2IFQ B;  5J9C A;  4XRA A;  5GST A;  3ZL5 A;  4K7O A;  3WT1 A;  3KMO A;  5G5F A;  2X64 A;  2YWO A;  5CO3 A;  1TRW A;  3ZTL A;  2X8G A;  3BOA A;  3GL3 A;  4K1F A;  1EOG A;  2OKA A;  2EIQ A;  3IRA A;  1M9A A;  5KN0 A;  4MF7 A;  2H0G A;  3BCK A;  4FH8 A;  1FB0 A;  4OFN A;  1N8J A;  1LJR A;  3FZA A;  1T1V A;  5IMF A;  1U87 A;  2CT6 A;  4BVY A;  1HNB A;  4HU9 A;  4ZB6 A;  3IOS A;  3TKQ A;  4BA7 A;  1K0N A;  2GGT A;  1CQG A;  4J2F A;  2FWG A;  4O7H A;  2F3M A;  2C3N A;  4DSS B;  1SJ6 A;  3GYK A;  3IPZ A;  4N0Z A;  1R26 A;  2R5G A;  2GT5 A;  3FEU A;  2I9H A;  2GZY A;  1GSF A;  3KJY A;  1S3A A;  1OKD A;  5JWQ B;  4PQI A;  1T4Z A;  2REM A;  1OC8 A;  3LYP A;  2HZF A;  1XFL A;  3H79 A;  2QSI A;  4HDE A;  2DJ0 A;  2YV9 A;  3HCZ A;  4TW5 A;  5ECQ B;  2DJJ A;  2LNS A;  2V32 A;  1SJZ A;  2I3Y A;  2V1M A;  3CYN A;  1DE1 A;  5FWG A;  3UEM A;  2H1G A;  3FYG A;  2H6Z A;  3UBL A;  4ECI A;  6GSU A;  4X43 A;  1JZR A;  2FWE A;  3IR4 A;  2FWF A;  4IP6 A;  1GTB A;  5IQY A;  5D73 A;  4N10 A;  3VPQ A;  4O32 A;  1B9Y C;  4E8E A;  3F3Q A;  3APQ A;  1A8Y A;  2JZS A;  4WBR D;  5CRH A;  1M7T A;  4KSO A;  2LRC A;  3TB2 A;  2KLX A;  3I43 A;  1T4Y A;  5F06 A;  3G7J A;  2R6K A;  1Z6N A;  2FY6 A;  4IQ1 A;  5CNW A;  1N2A A;  4WXT A;  1ZGN A;  1QMV A;  4MF5 A;  2LNT A;  4LMV A;  6GSY A;  3DD3 A;  1ML6 A;  3ERW A;  1M0U A;  1W89 A;  4K2D A;  2B1K A;  1A24 A;  1V40 A;  4I5Q A;  1LU4 A;  4MZC A;  2HLS A;  3RPN A;  4MDC A;  1SYR A;  1RW1 A;  3F6F A;  2JU5 A;  1ON4 A;  3HJO A;  3P90 A;  6GSX A;  1GUH A;  2B5Y A;  1V57 A;  1F2E A;  4IJI A;  1SK1 A;  3IDV A;  1GSU A;  2RLI A;  2KP1 A;  3VWX A;  4YAV A;  1ZZY A;  2C3T A;  3ME8 A;  3IA1 A;  1QFN A;  5CP1 A;  3NOF A;  4KCA A;  3DVW A;  1WRY A;  3CSH A;  5KEJ A;  4DSS A;  1XCC A;  2VAF A;  3ZYW A;  4BVX A;  3PR8 A;  1J0F A;  2ES7 A;  3KD0 A;  3FZ4 A;  3ZVJ D;  2GSR A;  3HJM A;  1NHY A;  5E4W A;  3VWW A;  1AUC A;  1F3A A;  1GH2 A;  1SKS B;  1MDJ A;  1YDK A;  1BQ7 A;  4PNF A;  1SJI A;  5A5K A;  4LA1 A;  4BWQ A;  3FY7 A;  4JR4 A;  3CSI A;  19GS A;  4NHZ A;  4NPB A;  2C0G A;  3TGZ A;  1TXX A;  2B5E A;  3RHB A;  3D5J A;  3TOU A;  1XWB A;  5G31 A;  4AJ6 A;  4EC0 A;  5AGY A;  2LTK A;  5ELG A;  2FCH A;  2G0F A;  3LGC A;  2MMN A;  2F51 A;  1ACV A;  2OE0 A;  3VUR A;  1GUM A;  2DBC A;  4K0N A;  4TR1 B;  2H19 A;  4GSN A;  2MMO A;  2FHE A;  2NTO A;  1OE8 A;  2H76 A;  3FR3 A;  4JRR A;  2PPT A;  5ELA A;  3RAZ A;  2F8F A;  3ZLP A;  3CRT A;  5C04 A;  1JFU A;  16GS A;  2P5Q A;  3KTB A;  3US3 A;  3W8S A;  5JCU A;  5EL8 A;  1TKD B;  3HZ4 A;  2D2Z A;  1PKZ A;  3KXO A;  4OO4 A;  2FA8 A;  5J5N A;  1SL1 B;  3HD5 A;  5INY A;  2VCQ A;  3HY2 A;  5CYY A;  4YQM A;  1KNG A;  5DBQ A;  2FWH A;  5KN3 A;  2HSH A;  3IHQ A;  4J56 E;  3WGE A;  4I2U A;  3KIJ A;  3G7I A;  4F0C A;  3LYK A;  4JU5 A;  5AIS A;  5J4U A;  2K8V A;  5DAK B;  1Z5Y E;  2N5F A;  1T00 A;  4ZXG A;  1YF1 A;  1XW6 A;  2C0E A;  4L5L A;  4EXJ A;  1GLQ A;  1AXD A;  3EWL A;  1WPI A;  2H01 A;  4LL1 B;  3DYR A;  3G7Y A;  5GZZ B;  1U6T A;  2O85 A;  3D21 A;  2BMX A;  5F0G A;  1FVK A;  3SBC A;  2B1L A;  2OJL A;  4MF6 A;  5JCW A;  3W6G A;  4KND A;  1I9D A;  3F9U A;  3TJK A;  4AF2 A;  2K18 A;  2VCT A;  2LV3 A;  2HRF A;  3E0U A;  4N30 A;  2JL4 A;  2XHF A;  3LEF A;  5A4U A;  4IEL A;  4D73 A;  4LMW A;  1TW9 A;  2WDU A;  2AYT A;  3EIN A;  2VLT A;  1GTU A;  2IMI A;  4TVE A;  2LQO A;  4GF0 A;  1MTC A;  3J7Y b;  1NHO A;  4L0W A;  1SYX A;  3HVX A;  1DE2 A;  2J23 A;  4TR1 A;  2YJH A;  3FR9 A;  2NPB A;  3ERG A;  1K0A A;  6GST A;  1GL8 A;  4L5O A;  2YZU A;  1TI1 A;  4RUV A;  5IPH A;  1SL2 B;  1O73 A;  3GHA A;  4NV2 A;  2MMA A;  1RK4 A;  2OA7 A;  1VF2 A;  1EEM A;  4FYC A;  1X5D A;  4TXV A;  1XXU A;  2HSY A;  3IC4 A;  2DSA A;  2ON7 A;  3LJR A;  5IM9 A;  3KEB A;  5E59 A;  1GUK A;  1XVW A;  4TXO B;  2GSQ A;  3F8U A;  3QD9 A;  4ID0 A;  17GS A;  1FW1 A;  3UAR A;  4EKZ A;  4IN0 A;  4ZBA A;  1VF3 A;  3S9F A;  3QPM A;  1XVQ A;  3WYW A;  3QFB C;  4WEY A;  1U3A A;  3CRU A;  3GKN A;  1R7H A;  1SK2 A;  1X9M B;  1EZK A;  4EE0 A;  2DJ2 A;  2H30 A;  1Z6M A;  4OCF A;  4GST A;  2B3S A;  5J3R A;  2FGX A;  1CQH A;  4KDU A;  2EIO A;  5ECM B;  1WP0 A;  4OWY A;  2EIR A;  2CVD A;  3RPP A;  4QQ7 A;  1ST9 A;  1ILO A;  1Q4J A;  1SK0 A;  3DEX A;  1PN9 A;  1R5A A;  3GX0 A;  4FYU A;  3EMP A;  3KH9 A;  2GZZ A;  3A5W A;  2WUL A;  3A2X A;  4V2N A;  5GAN D;  2HT9 A;  3UJ1 A;  2DJ3 A;  4DSR A;  3GSS A;  3H93 A;  4BPY A;  1UVZ A;  2VOC A;  5CRG A;  3TRQ A;  4EDY A;  2TIR A;  3CMI A;  1A0F A;  2B7J A;  1YEX A;  4MZB A;  3HDC A;  3TOT A;  3LXZ A;  2QKE A;  1J08 A;  3ZIV A;  2M46 A;  4EL1 A;  1VGL A;  3ZMK A;  2WRT A;  4GWR A;  3BJ5 A;  4GTU A;  4YQU A;  1PKW A;  5A4W A;  3HJP A;  3JCM L;  5IOX A;  3UMA A;  1SKR B;  4ZBD A;  3KP9 A;  2GQL A;  1GSE A;  1GLP A;  2FA4 A;  4KGI A;  1O8X A;  3D4T A;  2YZH A;  3TRP A;  2C0D A;  4IJ3 A;  1H75 A;  2KHP A;  4ILF A;  4KCE A;  4PX1 A;  7GSS A;  2H6Y A;  3CTF A;  1BED A;  3EU3 A;  1OKT A;  4PQ1 A;  4ML1 A;  3GKK A;  2QGV A;  4J57 E;  2V2G A;  2DC5 A;  1ZOF A;  1ERU A;  2HI7 A;  5G1K A;  5H5R A;  2PMT A;  1SD9 A;  2VM2 A;  5GAP D;  5ECP B;  1GTA A;  3GUS A;  3O76 A;  1X9S B;  3A3T A;  3TCO A;  1USB A;  5D9W A;  5GSS A;  2L57 A;  1EGR A;  2VD0 A;  1U88 A;  2YAN A;  4JR6 A;  4HQZ A;  4NAX A;  1QK8 A;  1TOF A;  4O5R A;  1HD2 A;  1W4V A;  1DUG A;  1JLW A;  2RUE A;  3QDN A;  1FOV A;  2VL3 A;  4JED A;  2HRN A;  5DDL A;  1K0M A;  4GQC A;  5IPG A;  2OAD A;  4MCU A;  2X8C A;  4XS6 A;  2ZUP A;  3F0I A;  4FYB A;  5L71 A;  1M99 A;  5LD0 A;  3NIV A;  4HOJ A;  3KH7 A;  4XTS A;  1UN2 A;  3FZ5 A;  4ML6 A;  5IO0 A;  1GNW A;  2VM1 A;  4L0U A;  3MNG A;  3CSJ A;  3Q19 A;  5EPF A;  3I6A A;  1AC1 A;  1PQN A;  2QC7 A;  1H4O A;  2L4C A;  2CV4 A;  2H66 A;  2P5R A;  2AUV A;  1XWC A;  3D22 A;  1YQ1 A;  1R5P A;  2O7K A;  4PXO A;  4ZL8 A;  5IMZ A;  2YOI A;  2RUF A;  3QFA C;  2X99 A;  2IFQ A;  4ZL9 A;  1GSY A;  2XC2 A;  1K3O A;  3QAW A;  1WJK A;  4Q5Q A;  2V6K A;  4MH3 A;  2YWM A;  1F9M A;  3EMX A;  4KUN A;  2PWJ A;  3KM6 A;  1O7U A;  3L9V A;  5G30 A;  3ZRE A;  2CX3 A;  4V1A g;  2N5A A;  3OR5 A;  2L59 A;  1GUL A;  1TDI A;  3DML A;  4PGT A;  3KMN A;  2IJY A;  3LQ7 A;  2C80 A;  1V2A A;  1AQV A;  2GQK A;  4HI7 A;  1XWA A;  1OC9 B;  4Z7X A;  3QOU A;  2V41 A;  1T8E B;  1HQO A;  5ECO B;  2G2Q A;  2P31 A;  3P8W A;  2I4A A;  2OE3 A;  1SKW B;  3DWV A;  4E8H A;  5B6N A;  2IMK A;  3EU4 A;  4RI6 A;  3V1W A;  4BL7 A;  3M3M A;  3GKM A;  3TKS C;  5D8I A;  2CZ3 A;  1AQX A;  3DGQ A;  2CA8 A;  1V9W A;  4MMM A;  2BTO T;  1PA3 A;  1THX A;  2ON5 A;  3GNJ A;  3IK9 A;  2I81 A;  4ACS A;  2H0I A;  3C1S A;  4HS1 A;  1TK0 B;  3GTU B;  5ID2 B;  4PUF C;  3P2A A;  2OBK A;  4HZ4 A;  2ZNM A;  1PL2 A;  1X5C A;  2NDO A;  2B6M A;  5DQY A;  2AB6 A;  2JZR A;  2H71 A;  5IMA A;  3DRN A;  4XS4 B;  3TKR A;  3IXR A;  2BJX A;  1JZO A;  1K3L A;  4KA0 A;  4IGJ A;  2CX4 A;  4QL9 A;  4PNG A;  3O6T A;  4PQH A;  1VF4 A;  3UVT A;  1HNA A;  2HFD A;  4MP4 A;  4Q5R A;  3GFK A;  3H8Q A;  5D93 A;  1SEN A;  1WOU A;  2HNL A;  4GLT A;  4V2L A;  3BBY A;  1JZW A;  2LJK A;  2V6O A;  1BJX A;  3KCM A;  3GX8 A;  2MZC A;  1YJ6 A;  1BX9 A;  2XPD A;  3FW2 A;  1S3C A;  9GSS A;  5H5Q A;  14GS A;  3F6D A;  3WT2 A;  1FHE A;  2A4V A;  1O81 A;  2WZ9 A;  1JZD A;  2PUK C;  2JSZ A;  3PIN A;  4ZL7 A;  2H1D A;  4NMU A;  5EVO A;  1EGO A;  5DAL B;  1PRX A;  5D9X A;  2YCD A;  1K0D A;  2VO4 A;  3APS A;  2XBI A;  2PBJ A;  1TI3 A;  1TK5 B;  4WR4 A;  13GS A;  2J9H A;  4I8B A;  3F4R A;  2VCW A;  5G1L A;  3ZFL A;  1GWC A;  5CRW A;  1A8L A;  1E2Y A;  3HYP A;  1TRU A;  4HEA 2;  3FR6 A;  3RHC A;  2JAC A;  3MSZ A;  2O89 A;  5B8A A;  4Q5F A;  3LXT A;  3K8N A;  2M72 A;  1ERW A;  1RQM A;  2H74 A;  4HZ2 A;  1EV4 A;  1O8W A;  2O87 A;  3ZIJ A;  4GCI A;  3ZML A;  5HR0 A;  3GTU A;  3U5R E;  3U6V A;  2PN8 A;  5D96 A;  3N5O A;  1OC3 A;  3BCI A;  2WGR A;  3Q74 A;  1B48 A;  1KTE A;  5F05 A;  3HXS A;  2IWT A;  1XOB A;  4HU7 A;  3VI5 A;  2F9S A;  1OYJ A;  1A2J A;  1Y6E A;  4IHU A;  1U3I A;  2DIY A;  2HE3 A;  4F82 A;  3DKS A;  2L6D A;  2GST A;  1OVN A;  4TOP A;  1NM3 A;  5DVB A;  3FRC A;  4G10 A;  3RDW A;  3F63 A;  2NBS A;  4ZIL A;  4TR0 A;  5CAX A;  3GL5 A;  2VLU A;  4XIH A;  3VK9 A;  4WF4 A;  2H1A A;  1MD4 A;  2HZE B;  3IAM 2;  3E3E A;  3UVH A;  5DJL A;  1HYU A;  1O85 A;  3GMF A;  2IIY A;  3EVI A;  2CZ2 A;  3QAV A;  2NVL A;  2A2S A;  4NV5 A;  4EUY A;  3F4T A;  2JSY A;  4GSS A;  11GS A;  2FUG 2;  2K9F A;  4MPF A;  3APO A;  1K0O A;  5DAK A;  2JZT A;  5C00 A;  4HQS A;  3LOR A;  5DAL A;  2MBT A;  5G2Z A;  3SWL A;  1FO5 A;  2JAD A;  4AJ8 A;  3BD2 A;  1HNC A;  5HFK A;  1F3B A;  1MD3 A;  4K8M A;  5HFG A;  1WE0 A;  3C73 A;  4MLY A;  3J7Y k;  1QXH A;  2L6C A;  3D0Z A;  3UOM A;  1BAY A;  3L4N A;  2IMD A;  4KE3 A;  5EY6 A;  3GUR A;  3UIW A;  4YQV A;  1XW5 A;  1GSD A;  1TU7 A;  4POK A;  1DSB A;  2KP2 A;  1EWX A;  2LEG A;  4MH2 A;  4WKW A;  4KDX A;  1NSW A;  1GTI A;  1SU9 A;  4PUR A;  1Z3E A;  5JWO B;  1GRX A;  1M9B A;  3FK8 A;  2WFC A;  3CTG A;  3IBH A;  3ISO A;  2CVB A;  4OCE A;  4GRF A;  1OE7 A;  5IIZ A;  5IMV A;  1ABA A;  3QAG A;  3VFI A;  3GKX A;  3GN3 A;  1XOA A;  2EC4 A;  1XWK A;  5CRE A;  4IBP A;  5G5E A;  2VD1 A;  2RM5 A;  3VPT A;  1XPV A;  4MK3 A;  4ULX A;  1R4W A;  1WMJ A;  4FO5 A;  4MJB A;  5ECI B;  1Z9H A;  1PL1 A;  3GRX A;  4WF5 A;  1LBK A;  4OO5 A;  3ZFB A;  1THO A;  4WBJ A;  1A0R P;  3H4K A;  2GZP A;  2VL2 A;  2B7K A;  1VF1 A;  3HZ8 A;  2IME A;  4G9H A;  1AAZ A;  5ECR B;  4TXO A;  3AY8 A;  1T7P B;  4V1A p;  4EVM A;  4RQR A;  3VWU A;  5FHI A;  2R4V A;  2DML A;  2IMF A;  2N5B A;  2ALB A;  3ME7 A;  2IPA A;  4KAE A;  5HR3 A;  3ZZX A;  4IQA A;  5JWR B;  22GS A;  3GA4 A;  1SL0 B;  1V58 A;  1JLV A;  3TJJ A;  3C8E A;  3HKR A;  1IYI A;  5FT3 A;  1PGT A;  4G19 A;  3ZIT A;  3P7X A;  2LST A;  4MJE A;  4KSM A;  2E0Q A;  5DJM A;  2E2G A;  2LS5 A;  1M2B A;  2GLR A;  5J9B A;  2ZCT A;  1FVJ A;  1MEK A;  3TUE A;  1X9W B;  1EV9 A;  2L4Q A;  1EEJ A;  4P3Y B;  5ECN B;  3FZ9 A;  1WIK A;  3TKP A;  3TJF A;  1TK8 B;  4EO3 A;  1TTZ A;  5ECK B;  4LLR A;  1PD2 1;  3GH9 A;  3IE3 A;  2KUC A;  2IN3 A;  4Q5N A;  4TR4 A;  4TKY A;  4MA9 A;  2LQQ A;  2XBQ A;  1KEB A;  3HA9 A;  3GH6 A;  3TKS E;  1GP1 A;  3DVX A;  1FAA A;  1XWG A;  3PH9 A;  1YEP A;  4ECJ A;  4DEJ A;  18GS A;  1WWJ A;  3D6I A;  3C7M A;  3M9K A;  1ZCP A;  1B8X A;  2PVO C;  5ENU A;  3H1N A;  1QQ2 A;  3E9J B;  1FB6 A;  5J41 A;  1IYH A;  3L9S A;  4NHW A;  3HHV A;  3ERF A;  1UA5 A;  1OAZ A;  4ECB A;  2K8S A;  4X1U A;  3KTL A;  1XBS A;  3IV4 A;  3Q6O A;  1J9B A;  1XIY A;  1ERT A;  4H86 A;  3HVV A;  4V2M A;  2AHE A;  1BYE A;  2Z9S A;  2FLS A;  3EC3 A;  4L8E A;  2VCZ A;  3UAP A;  2H1B A;  2AJQ B;  3MAK A;  5ECL B;  2GT6 A;  3TDG A;  2TRX A;  1YKA A;  3I9V 2;  4OD7 A;  3TJG A;  3L9U A;  1X0R A;  4JE1 A;  2L5L A;  2RII A;  6GSS A;  1ZL9 A;  3FHK A;  1K0C A;  1A2M A;  2CVK A;  3QR6 A;  2YN1 A;  4OMV A;  3CXG A;  6GSV A;  3EYT A;  3QCP A;  3A2V A;  4CDO A;  5ECH B;  4O92 A;  4F03 A;  3M9J A;  4IS0 A;  3W8J A;  3G9B A;  2L5O A;  4KX4 A;  3DXB A;  3Q18 A;  2YPM A; 
#chains in the Genus database with same CATH topology
 3EUR A;  4I6X A;  3VLN A;  3VWV A;  1PSQ A;  1VRS D;  4POB A;  1ZYE A;  4NWY A;  4K6X A;  1YF0 A;  3KGK A;  2YJ7 A;  1GSQ A;  4GXZ A;  4DVC A;  1B4Q A;  4CHS A;  3WGX A;  2R3X A;  2A2R A;  2MYG A;  1I5G A;  2DJ1 A;  2E2M A;  3HVS A;  4HJ2 A;  10GS A;  4N0V A;  4NXI A;  1M3J A;  3R3E A;  5HR2 A;  3RBT A;  4D73 B;  1A23 A;  1AIU A;  4I97 A;  3ZVJ A;  1TRS A;  2CAI A;  1K3Y A;  1MDK A;  2WS2 A;  4XS1 A;  5DCH A;  3TRX A;  1M3I A;  2WB9 A;  3LG6 A;  2VLV A;  3M0F A;  1BG5 A;  1Y25 A;  3PGT A;  2GS3 A;  1UC7 A;  2C8U A;  2FD3 A;  2C3Q A;  4F9Z A;  4PUA A;  1URM A;  1EOH A;  3ED3 A;  4N11 A;  4MPG A;  5ABR A;  3NZN A;  5KN1 A;  1PX6 A;  4KH7 A;  2TRC P;  3A5I A;  2QA1 A;  2B5X A;  1B9X C;  2AV4 A;  2P0G A;  3UL3 A;  3WD6 A;  2XPE A;  1PMT A;  5A4V A;  1TU8 A;  1OC9 A;  3MYD A;  2DIZ A;  4F0B A;  3WGD A;  2C0F A;  2VCX A;  1EP7 A;  1B4P A;  3F4S A;  1XG8 A;  3EE2 A;  4MJA A;  5DCG A;  2K6V A;  5D9V A;  2X8H A;  4K0G A;  2A4H A;  1AW9 A;  2H70 A;  2WCI A;  3LSZ A;  5KN2 A;  2O8V B;  5IMD A;  2VUP A;  1E6B A;  1TJD A;  2MBS A;  2PU9 C;  1XW9 A;  2C4J A;  2VCV A;  4MZW A;  2VIM A;  5AIV A;  1MDI A;  5IOW A;  3N9J A;  5HFI A;  2GDR A;  1G7O A;  1YY7 A;  2H73 A;  5HR1 A;  4ZB9 A;  3IAS 2;  4OFT A;  3IK7 A;  3M1G A;  4BWS A;  5ID2 A;  2MMZ A;  12GS A;  2VL2 C;  3LFL A;  5IO2 A;  4MAB A;  1NW2 A;  1T3B A;  4RQX A;  2OE1 A;  2GSS A;  4XCS A;  2LJR A;  2WJU A;  4RI7 A;  4K9Z A;  2HXK A;  5B6M A;  4XS4 A;  1TP9 A;  2YWN A;  1Z7R A;  5JCG A;  1G0T A;  1Q98 A;  2H72 A;  5ECS A;  2GTU A;  3KZQ A;  4I2T A;  5F07 A;  1ERV A;  2LJA A;  4ZIJ A;  1V98 A;  1A2L A;  2YNX A;  3R2Q A;  1Z7P A;  3TKS A;  2H8L A;  2QA2 A;  4EF0 A;  4TN8 A;  3GST A;  3HVN A;  3MDK A;  4X0X A;  8GSS A;  1ZMA A;  2GVP A;  5H5S A;  2E7P A;  1FG4 A;  1S3D A;  3FKF A;  3GV1 A;  1C72 A;  5COH A;  2IL3 A;  1XZO A;  4IW9 A;  3L78 A;  4YAP A;  4K7I A;  4WR5 A;  4IP1 A;  2YP6 A;  4AGS A;  2FNO A;  2CAQ A;  1YZX A;  2PVQ A;  1QUW A;  2LRN A;  4K7N A;  2YWI A;  4ZB8 A;  4CW9 A;  4Z2T A;  2LKU A;  4XRD A;  2RM6 A;  3L0H A;  4KDY A;  5HQP A;  1F37 A;  4QL7 A;  4MJC A;  1AQW A;  2C1Y A;  1F6M C;  1SD8 A;  4LL4 B;  6GSW A;  3IHG A;  4JZQ A;  1JHB A;  1GNE A;  4JBB A;  2H75 A;  2VL9 A;  5F8B A;  2R2J A;  3A2W A;  5AN1 A;  1G7E A;  2GQM A;  1KBN A;  2PGT A;  4YH2 A;  4KB3 A;  1M2D A;  5AIX A;  5D9T A;  1G6Y A;  2M80 A;  3VI7 A;  2YV7 A;  3ZRD A;  3QMX A;  3C71 A;  4OFM A;  3GIX A;  5CRD A;  2DLX A;  3C1R A;  4POL A;  5B8B A;  1GSS A;  3TJB A;  3UBK A;  4DSQ A;  3LWA A;  4F2I A;  2R37 A;  20GS A;  1DBY A;  3F3R A;  3M8N A;  3CBU A;  2F8A A;  5B7C A;  1EP8 A;  3KP8 A;  4KW6 A;  2H6X A;  3I69 A;  4TR3 A;  2I1U A;  2KOK A;  1K0B A;  4GQF A;  5DQS A;  1QGV A;  1O6J A;  4POM A;  2H0H A;  4ZBB A;  4ECC A;  4G2E A;  2LUS A;  2OAC A;  2PER A;  3O3T A;  4O5U A;  4HJM A;  1TRV A;  4AJ7 A;  5LNK e;  1M2A A;  2OBI A;  4XHM A;  2LRT A;  1YKC A;  4WET A;  3D4M A;  4IKH A;  1PX7 A;  1X5E A;  4ISD A;  2AAW A;  1ZYQ B;  2HYX A;  4HUA A;  4TRX A;  4IVF A;  2CQ9 A;  5IMC A;  5LCZ A;  2DMM A;  3DIE A;  3MWH A;  1G6W A;  4FIW A;  2HZE A;  2DJK A;  4EDZ A;  2IFQ B;  5J9C A;  4XRA A;  5GST A;  3ZL5 A;  4K7O A;  3WT1 A;  3KMO A;  5G5F A;  2X64 A;  2YWO A;  5CO3 A;  1TRW A;  3ZTL A;  4FQU A;  2X8G A;  3BOA A;  3GL3 A;  4K1F A;  1EOG A;  2OKA A;  2EIQ A;  3IRA A;  1M9A A;  5KN0 A;  4MF7 A;  2H0G A;  3BCK A;  4FH8 A;  1FB0 A;  4OFN A;  1N8J A;  1LJR A;  3FZA A;  1T1V A;  5IMF A;  1U87 A;  2CT6 A;  4BVY A;  4EIQ A;  1HNB A;  4HU9 A;  4ZB6 A;  3IOS A;  3TKQ A;  2R0P A;  4BA7 A;  1K0N A;  2GGT A;  1CQG A;  4J2F A;  2FWG A;  4O7H A;  2F3M A;  2C3N A;  4DSS B;  1SJ6 A;  3GYK A;  3IPZ A;  4N0Z A;  1R26 A;  2R5G A;  1S3R A;  2GT5 A;  3FEU A;  2I9H A;  2GZY A;  1GSF A;  3KJY A;  1S3A A;  1OKD A;  5JWQ B;  4PQI A;  1T4Z A;  2REM A;  1OC8 A;  3LYP A;  2HZF A;  1XFL A;  3H79 A;  4PTS A;  2QSI A;  4HDE A;  4BL7 B;  2DJ0 A;  2YV9 A;  3HCZ A;  4TW5 A;  5ECQ B;  2DJJ A;  2LNS A;  2V32 A;  1SJZ A;  2I3Y A;  2V1M A;  3CYN A;  1DE1 A;  4G0K A;  5FWG A;  3UEM A;  2H1G A;  3FYG A;  2H6Z A;  3UBL A;  4ECI A;  6GSU A;  4X43 A;  4KF9 A;  1JZR A;  2FWE A;  3IR4 A;  2FWF A;  4IP6 A;  1GTB A;  5IQY A;  5D73 A;  4N10 A;  3VPQ A;  4O32 A;  1B9Y C;  4E8E A;  3F3Q A;  3APQ A;  1A8Y A;  2JZS A;  4WBR D;  5CRH A;  1M7T A;  4KSO A;  2LRC A;  3TB2 A;  2KLX A;  3I43 A;  1T4Y A;  5F06 A;  3G7J A;  2R6K A;  1Z6N A;  2FY6 A;  4IQ1 A;  5CNW A;  1N2A A;  4WXT A;  1ZGN A;  1QMV A;  4MF5 A;  2LNT A;  4LMV A;  6GSY A;  3DD3 A;  1ML6 A;  3ERW A;  1M0U A;  1W89 A;  4K2D A;  2B1K A;  1A24 A;  1V40 A;  4I5Q A;  1LU4 A;  4MZC A;  2HLS A;  3RPN A;  4MDC A;  1SYR A;  1RW1 A;  3F6F A;  2JU5 A;  1ON4 A;  3HJO A;  3P90 A;  6GSX A;  1GUH A;  2B5Y A;  1V57 A;  1F2E A;  4IJI A;  1SK1 A;  3IDV A;  1GSU A;  2RLI A;  2KP1 A;  3VWX A;  4YAV A;  1ZZY A;  2C3T A;  3ME8 A;  3IA1 A;  1QFN A;  5CP1 A;  3NOF A;  4KCA A;  3DVW A;  1WRY A;  3CSH A;  5KEJ A;  4DSS A;  1XCC A;  2VAF A;  3ZYW A;  4BVX A;  3PR8 A;  1J0F A;  2ES7 A;  3KD0 A;  3FZ4 A;  3ZVJ D;  2GSR A;  3HJM A;  1NHY A;  5E4W A;  4Z2R A;  3VWW A;  1AUC A;  1F3A A;  1GH2 A;  1SKS B;  1MDJ A;  1BQ7 A;  1YDK A;  4PNF A;  1SJI A;  5A5K A;  4LA1 A;  4BWQ A;  3FY7 A;  4JR4 A;  3CSI A;  19GS A;  4NHZ A;  4NPB A;  2C0G A;  3TGZ A;  1TXX A;  2B5E A;  3RHB A;  3D5J A;  3TOU A;  1XWB A;  5G31 A;  4AJ6 A;  4EC0 A;  5AGY A;  2LTK A;  5ELG A;  2FCH A;  2G0F A;  3LGC A;  2MMN A;  2F51 A;  1ACV A;  2OE0 A;  3VUR A;  1GUM A;  2DBC A;  4K0N A;  4TR1 B;  2H19 A;  4GSN A;  2MMO A;  2FHE A;  2NTO A;  1OE8 A;  2H76 A;  3FR3 A;  4JRR A;  2PPT A;  5ELA A;  3RAZ A;  2F8F A;  3ZLP A;  3CRT A;  5C04 A;  1JFU A;  16GS A;  2P5Q A;  3KTB A;  3US3 A;  3W8S A;  5JCU A;  5EL8 A;  1TKD B;  3HZ4 A;  2D2Z A;  1PKZ A;  3KXO A;  4OO4 A;  2FA8 A;  5J5N A;  1SL1 B;  3HD5 A;  5INY A;  2VCQ A;  3HY2 A;  5CYY A;  4YQM A;  1KNG A;  5DBQ A;  2FWH A;  5KN3 A;  2HSH A;  3IHQ A;  4J56 E;  3WGE A;  4I2U A;  3KIJ A;  3G7I A;  4F0C A;  3LYK A;  4JU5 A;  5AIS A;  5J4U A;  2K8V A;  5DAK B;  1Z5Y E;  2N5F A;  1T00 A;  4ZXG A;  1YF1 A;  1XW6 A;  2C0E A;  4L5L A;  4EXJ A;  1GLQ A;  1AXD A;  3EWL A;  1WPI A;  2H01 A;  4LL1 B;  3DYR A;  3G7Y A;  5GZZ B;  1U6T A;  2O85 A;  3D21 A;  2BMX A;  5F0G A;  1FVK A;  3SBC A;  2B1L A;  2OJL A;  4MF6 A;  5JCW A;  3W6G A;  4KND A;  1I9D A;  3F9U A;  3TJK A;  4AF2 A;  2K18 A;  2R0C A;  4USS A;  2VCT A;  2LV3 A;  2HRF A;  3E0U A;  4N30 A;  2JL4 A;  2XHF A;  2HSM A;  3LEF A;  5A4U A;  4IEL A;  4D73 A;  4LMW A;  1TW9 A;  2WDU A;  2AYT A;  3EIN A;  2R0G A;  2VLT A;  1GTU A;  2IMI A;  4TVE A;  2A2P A;  2LQO A;  4GF0 A;  1MTC A;  3J7Y b;  1NHO A;  4L0W A;  1SYX A;  3HVX A;  1DE2 A;  2J23 A;  4TR1 A;  2YJH A;  3FR9 A;  2NPB A;  3ERG A;  1K0A A;  6GST A;  5BMU A;  1GL8 A;  4L5O A;  2YZU A;  1TI1 A;  4RUV A;  5IPH A;  1SL2 B;  1O73 A;  3GHA A;  4NV2 A;  2MMA A;  1RK4 A;  2OA7 A;  1VF2 A;  1EEM A;  4FYC A;  1X5D A;  3IC8 A;  4TXV A;  1XXU A;  2HSY A;  3IC4 A;  2DSA A;  2ON7 A;  3LJR A;  5IM9 A;  3KEB A;  5E59 A;  1GUK A;  1XVW A;  4TXO B;  2GSQ A;  3F8U A;  3QD9 A;  4ID0 A;  17GS A;  1FW1 A;  3UAR A;  4EKZ A;  4IN0 A;  4ZBA A;  1VF3 A;  3S9F A;  3QPM A;  1XVQ A;  3WYW A;  3QFB C;  4WEY A;  1U3A A;  3CRU A;  3GKN A;  1R7H A;  1SK2 A;  1X9M B;  1EZK A;  4EE0 A;  2DJ2 A;  2H30 A;  1Z6M A;  4OCF A;  4GST A;  2B3S A;  5J3R A;  2FGX A;  1CQH A;  4KDU A;  2EIO A;  5ECM B;  1WP0 A;  4OWY A;  2EIR A;  2CVD A;  3RPP A;  4QQ7 A;  1ST9 A;  1ILO A;  1Q4J A;  1SK0 A;  3DEX A;  1PN9 A;  4CY6 A;  1R5A A;  3GX0 A;  4FYU A;  3EMP A;  3KH9 A;  2GZZ A;  3A5W A;  2WUL A;  3A2X A;  4V2N A;  5GAN D;  2HT9 A;  3UJ1 A;  2DJ3 A;  4DSR A;  3GSS A;  3H93 A;  4BPY A;  1UVZ A;  2VOC A;  5CRG A;  3TRQ A;  4EDY A;  2TIR A;  3CMI A;  1A0F A;  2B7J A;  1YEX A;  4G0L A;  4MZB A;  3HDC A;  3TOT A;  3LXZ A;  2QKE A;  1J08 A;  3ZIV A;  2M46 A;  4EL1 A;  1PN0 A;  1VGL A;  3ZMK A;  2WRT A;  4K2X A;  4GWR A;  3BJ5 A;  1ZYN A;  4GTU A;  4YQU A;  1PKW A;  5A4W A;  3HJP A;  3JCM L;  5IOX A;  3UMA A;  1SKR B;  4ZBD A;  3KP9 A;  4EIP A;  2GQL A;  1GSE A;  1GLP A;  2FA4 A;  4KGI A;  1O8X A;  3D4T A;  2YZH A;  2DKH A;  3TRP A;  2C0D A;  2X49 A;  4IJ3 A;  1H75 A;  2KHP A;  4ILF A;  4KCE A;  4PX1 A;  7GSS A;  2H6Y A;  3CTF A;  1BED A;  3EU3 A;  1OKT A;  4PQ1 A;  4ML1 A;  3GKK A;  2QGV A;  4J57 E;  2V2G A;  2DC5 A;  1ZOF A;  1ERU A;  2HI7 A;  5G1K A;  5H5R A;  2PMT A;  1SD9 A;  2VM2 A;  5GAP D;  5ECP B;  1GTA A;  3GUS A;  3O76 A;  1X9S B;  3A3T A;  3TCO A;  1USB A;  5D9W A;  5GSS A;  2L57 A;  1EGR A;  2VD0 A;  1U88 A;  2YAN A;  4JR6 A;  4HQZ A;  4NAX A;  1QK8 A;  1TOF A;  4O5R A;  1HD2 A;  1W4V A;  1DUG A;  1JLW A;  2RUE A;  3QDN A;  1FOV A;  2VL3 A;  4JED A;  2HRN A;  5DDL A;  1K0M A;  4GQC A;  5IPG A;  2OAD A;  4MCU A;  2X8C A;  4XS6 A;  2ZUP A;  3F0I A;  4FYB A;  5L71 A;  1M99 A;  5LD0 A;  3NIV A;  4HOJ A;  3KH7 A;  4XTS A;  1UN2 A;  3FZ5 A;  4ML6 A;  5IO0 A;  1GNW A;  2VM1 A;  4L0U A;  3MNG A;  3CSJ A;  3Q19 A;  5EPF A;  3I6A A;  1AC1 A;  1PQN A;  2QC7 A;  1H4O A;  2L4C A;  2CV4 A;  1ZYP A;  2H66 A;  2P5R A;  2AUV A;  1XWC A;  3D22 A;  1YQ1 A;  1R5P A;  4G0I A;  2O7K A;  4PXO A;  4ZL8 A;  5IMZ A;  2YOI A;  2RUF A;  3QFA C;  2X99 A;  2IFQ A;  4ZL9 A;  1GSY A;  2XC2 A;  1K3O A;  5KOX A;  3QAW A;  1WJK A;  4Q5Q A;  2V6K A;  4MH3 A;  2YWM A;  1F9M A;  3EMX A;  4KUN A;  2PWJ A;  3KM6 A;  1O7U A;  3L9V A;  5G30 A;  3ZRE A;  2CX3 A;  4V1A g;  2N5A A;  3OR5 A;  2L59 A;  1GUL A;  1TDI A;  3DML A;  4PGT A;  3KMN A;  2IJY A;  3LQ7 A;  2C80 A;  1V2A A;  1AQV A;  2GQK A;  4HI7 A;  1XWA A;  1OC9 B;  4Z7X A;  3QOU A;  2V41 A;  1T8E B;  1HQO A;  3FMW A;  5ECO B;  2G2Q A;  2P31 A;  3P8W A;  2I4A A;  2OE3 A;  1SKW B;  3DWV A;  4E8H A;  4K5S A;  5B6N A;  1FOH A;  2IMK A;  3EU4 A;  4RI6 A;  3V1W A;  4BL7 A;  3M3M A;  3GKM A;  3PPU A;  3TKS C;  5D8I A;  2CZ3 A;  1AQX A;  3DGQ A;  2CA8 A;  1V9W A;  4MMM A;  2BTO T;  1PA3 A;  1THX A;  2ON5 A;  4MNN A;  3GNJ A;  3IK9 A;  4K5R A;  2I81 A;  4ACS A;  5BRT A;  2H0I A;  3C1S A;  4HS1 A;  1TK0 B;  3GTU B;  5ID2 B;  5KOW A;  4PUF C;  3P2A A;  2OBK A;  4HZ4 A;  2ZNM A;  1PL2 A;  1X5C A;  2NDO A;  2B6M A;  5DQY A;  2AB6 A;  2JZR A;  2H71 A;  5IMA A;  3DRN A;  4XS4 B;  4BIK A;  3TKR A;  3IXR A;  2BJX A;  1JZO A;  1K3L A;  4KA0 A;  4IGJ A;  2CX4 A;  4QL9 A;  4PNG A;  3O6T A;  4PQH A;  1VF4 A;  3UVT A;  1HNA A;  2HFD A;  4MP4 A;  4Q5R A;  3GFK A;  3H8Q A;  5D93 A;  1SEN A;  1WOU A;  2HNL A;  4GLT A;  4V2L A;  3BBY A;  1JZW A;  2LJK A;  2V6O A;  4A5P A;  1BJX A;  3KCM A;  3GX8 A;  2MZC A;  1YJ6 A;  1BX9 A;  2XPD A;  3FW2 A;  1S3C A;  9GSS A;  4CY8 A;  5H5Q A;  14GS A;  3F6D A;  3WT2 A;  1FHE A;  2A4V A;  1O81 A;  2WZ9 A;  1JZD A;  2PUK C;  2JSZ A;  3PIN A;  4ZL7 A;  2H1D A;  4NMU A;  5EVO A;  1EGO A;  5DAL B;  1PRX A;  4O5Q A;  5D9X A;  2YCD A;  1K0D A;  3MIX A;  2VO4 A;  2UZ8 A;  3APS A;  2XBI A;  2PBJ A;  1TI3 A;  1TK5 B;  4ICY A;  4WR4 A;  13GS A;  2J9H A;  4I8B A;  3F4R A;  2VCW A;  5G1L A;  3ZFL A;  1GWC A;  5CRW A;  1A8L A;  1E2Y A;  3HYP A;  1TRU A;  4HEA 2;  3FR6 A;  3RHC A;  2JAC A;  3MSZ A;  2O89 A;  5B8A A;  4Q5F A;  3LXT A;  3K8N A;  2M72 A;  1ERW A;  1RQM A;  2H74 A;  4HZ2 A;  1EV4 A;  1O8W A;  2O87 A;  3ZIJ A;  4GCI A;  3ZML A;  5HR0 A;  3GTU A;  3U5R E;  3U6V A;  2PN8 A;  5D96 A;  3N5O A;  1OC3 A;  3BCI A;  2WGR A;  3Q74 A;  1B48 A;  1KTE A;  5F05 A;  3HXS A;  2IWT A;  1XOB A;  4HU7 A;  3VI5 A;  2F9S A;  1OYJ A;  1A2J A;  1Y6E A;  4IHU A;  1U3I A;  2DIY A;  2HE3 A;  4F82 A;  3DKS A;  2L6D A;  2GST A;  1OVN A;  4TOP A;  4YKF A;  1NM3 A;  2HRA A;  5DVB A;  3FRC A;  4G10 A;  3RDW A;  3F63 A;  2NBS A;  4ZIL A;  4TR0 A;  5CAX A;  3GL5 A;  2VLU A;  4XIH A;  3VK9 A;  4WF4 A;  4HSC X;  2H1A A;  1MD4 A;  2HZE B;  3IAM 2;  3E3E A;  3UVH A;  5DJL A;  1HYU A;  1O85 A;  3GMF A;  2IIY A;  3EVI A;  2CZ2 A;  3QAV A;  2NVL A;  2A2S A;  4NV5 A;  4EUY A;  3F4T A;  2JSY A;  4GSS A;  11GS A;  2FUG 2;  2K9F A;  4MPF A;  3APO A;  1K0O A;  5DAK A;  2JZT A;  5C00 A;  4HQS A;  3LOR A;  5DAL A;  2MBT A;  5G2Z A;  3SWL A;  1FO5 A;  2JAD A;  4AJ8 A;  3BD2 A;  1HNC A;  5HFK A;  1F3B A;  4X4J A;  1MD3 A;  4BVY B;  3EPT A;  4K8M A;  5HFG A;  1WE0 A;  3C73 A;  4MLY A;  3J7Y k;  1QXH A;  2L6C A;  3D0Z A;  3UOM A;  1BAY A;  3L4N A;  2IMD A;  4KE3 A;  5EY6 A;  3GUR A;  3UIW A;  4YQV A;  1XW5 A;  1GSD A;  1TU7 A;  4POK A;  1DSB A;  2KP2 A;  1EWX A;  2LEG A;  4MH2 A;  4WKW A;  4KDX A;  1NSW A;  1GTI A;  1SU9 A;  4PUR A;  1Z3E A;  5JWO B;  1GRX A;  1M9B A;  3FK8 A;  2WFC A;  3CTG A;  3IBH A;  3ISO A;  2CVB A;  4OCE A;  4GRF A;  1OE7 A;  5IIZ A;  5IMV A;  1ABA A;  3QAG A;  3VFI A;  3GKX A;  3GN3 A;  1XOA A;  2EC4 A;  1XWK A;  5CRE A;  4IBP A;  5G5E A;  2VD1 A;  2RM5 A;  3VPT A;  1XPV A;  4MK3 A;  4ULX A;  1R4W A;  1WMJ A;  4FO5 A;  4MJB A;  5ECI B;  1Z9H A;  1PL1 A;  3GRX A;  4WF5 A;  1LBK A;  4OO5 A;  3ZFB A;  1THO A;  4WBJ A;  1A0R P;  3H4K A;  2GZP A;  2VL2 A;  3LW9 A;  2B7K A;  1VF1 A;  3HZ8 A;  2IME A;  4G9H A;  1AAZ A;  5ECR B;  4TXO A;  3AY8 A;  1T7P B;  4V1A p;  4EVM A;  4RQR A;  2HRK A;  3VWU A;  5FHI A;  2R4V A;  3CQF A;  2DML A;  2IMF A;  2N5B A;  2ALB A;  3ME7 A;  2IPA A;  4KAE A;  5HR3 A;  3ZZX A;  4IQA A;  5JWR B;  22GS A;  3GA4 A;  1SL0 B;  1V58 A;  2X4A A;  1JLV A;  3TJJ A;  3C8E A;  3HKR A;  1IYI A;  5FT3 A;  1PGT A;  4G19 A;  3ZIT A;  3P7X A;  2LST A;  4MJE A;  4KSM A;  2E0Q A;  5DJM A;  2E2G A;  2LS5 A;  1M2B A;  2GLR A;  5J9B A;  2ZCT A;  1FVJ A;  1MEK A;  3TUE A;  1X9W B;  1EV9 A;  2L4Q A;  1EEJ A;  4P3Y B;  4BVX B;  5ECN B;  3FZ9 A;  1WIK A;  3TKP A;  3TJF A;  1TK8 B;  4EO3 A;  1TTZ A;  5ECK B;  4LLR A;  2DKI A;  1PD2 1;  3GH9 A;  3IE3 A;  2KUC A;  2IN3 A;  4Q5N A;  4TR4 A;  4TKY A;  4MA9 A;  2LQQ A;  2XBQ A;  1KEB A;  3HA9 A;  3GH6 A;  3TKS E;  1GP1 A;  3DVX A;  1FAA A;  1XWG A;  3PH9 A;  1YEP A;  4Z2U A;  4ECJ A;  4DEJ A;  18GS A;  1WWJ A;  3D6I A;  3C7M A;  3M9K A;  1ZCP A;  1B8X A;  2PVO C;  5ENU A;  3H1N A;  1QQ2 A;  1PFO A;  3E9J B;  1FB6 A;  5J41 A;  1IYH A;  3L9S A;  4NHW A;  3HHV A;  3ERF A;  1UA5 A;  1OAZ A;  4ECB A;  2K8S A;  4X1U A;  3KTL A;  1XBS A;  3IV4 A;  3Q6O A;  1J9B A;  1XIY A;  4YKG A;  1ERT A;  4H86 A;  3HVV A;  4V2M A;  2AHE A;  1BYE A;  2Z9S A;  2FLS A;  3EC3 A;  4L8E A;  2VCZ A;  3UAP A;  2H1B A;  2AJQ B;  3MAK A;  5ECL B;  2GT6 A;  3TDG A;  2TRX A;  1YKA A;  3I9V 2;  4OD7 A;  3TJG A;  3L9U A;  1X0R A;  4JE1 A;  2L5L A;  2RII A;  6GSS A;  1ZL9 A;  3FHK A;  1K0C A;  1A2M A;  2CVK A;  3QR6 A;  2YN1 A;  4OMV A;  3CXG A;  6GSV A;  3EYT A;  3QCP A;  3A2V A;  4CDO A;  5ECH B;  4O92 A;  4F03 A;  3M9J A;  4IS0 A;  3W8J A;  3G9B A;  2L5O A;  4KX4 A;  3DXB A;  3Q18 A;  2YPM A; 
#chains in the Genus database with same CATH homology
 3EUR A;  4I6X A;  3VLN A;  3VWV A;  1PSQ A;  1VRS D;  4POB A;  1ZYE A;  4NWY A;  4K6X A;  1YF0 A;  3KGK A;  2YJ7 A;  1GSQ A;  4GXZ A;  4DVC A;  1B4Q A;  4CHS A;  3WGX A;  2R3X A;  2A2R A;  2MYG A;  1I5G A;  2DJ1 A;  2E2M A;  3HVS A;  4HJ2 A;  10GS A;  4N0V A;  4NXI A;  3R3E A;  5HR2 A;  3RBT A;  4D73 B;  1A23 A;  1AIU A;  4I97 A;  3ZVJ A;  1TRS A;  2CAI A;  1K3Y A;  1MDK A;  2WS2 A;  4XS1 A;  5DCH A;  3TRX A;  2WB9 A;  3LG6 A;  2VLV A;  3M0F A;  1BG5 A;  1Y25 A;  3PGT A;  2GS3 A;  1UC7 A;  2C8U A;  2FD3 A;  2C3Q A;  4F9Z A;  4PUA A;  1URM A;  1EOH A;  3ED3 A;  4N11 A;  4MPG A;  5ABR A;  3NZN A;  5KN1 A;  1PX6 A;  4KH7 A;  2TRC P;  3A5I A;  2QA1 A;  2B5X A;  1B9X C;  2AV4 A;  2P0G A;  3UL3 A;  3WD6 A;  2XPE A;  1PMT A;  5A4V A;  1TU8 A;  1OC9 A;  3MYD A;  2DIZ A;  4F0B A;  3WGD A;  2C0F A;  2VCX A;  1EP7 A;  1B4P A;  3F4S A;  3EE2 A;  4MJA A;  5DCG A;  2K6V A;  5D9V A;  2X8H A;  4K0G A;  2A4H A;  1AW9 A;  2H70 A;  2WCI A;  3LSZ A;  5KN2 A;  2O8V B;  5IMD A;  2VUP A;  1E6B A;  1TJD A;  2MBS A;  2PU9 C;  1XW9 A;  2C4J A;  2VCV A;  4MZW A;  2VIM A;  5AIV A;  1MDI A;  5IOW A;  3N9J A;  5HFI A;  2GDR A;  1G7O A;  1YY7 A;  2H73 A;  5HR1 A;  4ZB9 A;  3IAS 2;  4OFT A;  3IK7 A;  3M1G A;  4BWS A;  5ID2 A;  2MMZ A;  12GS A;  2VL2 C;  3LFL A;  5IO2 A;  4MAB A;  1NW2 A;  1T3B A;  4RQX A;  2OE1 A;  2GSS A;  4XCS A;  2LJR A;  2WJU A;  4RI7 A;  4K9Z A;  2HXK A;  5B6M A;  4XS4 A;  1TP9 A;  2YWN A;  1Z7R A;  5JCG A;  1G0T A;  1Q98 A;  2H72 A;  5ECS A;  2GTU A;  3KZQ A;  4I2T A;  5F07 A;  1ERV A;  2LJA A;  4ZIJ A;  1V98 A;  1A2L A;  2YNX A;  3R2Q A;  1Z7P A;  3TKS A;  2H8L A;  2QA2 A;  4EF0 A;  4TN8 A;  3GST A;  3MDK A;  4X0X A;  8GSS A;  1ZMA A;  2GVP A;  5H5S A;  2E7P A;  1FG4 A;  1S3D A;  3FKF A;  3GV1 A;  1C72 A;  5COH A;  2IL3 A;  1XZO A;  4IW9 A;  3L78 A;  4YAP A;  4K7I A;  4WR5 A;  4IP1 A;  2YP6 A;  4AGS A;  2FNO A;  2CAQ A;  1YZX A;  2PVQ A;  1QUW A;  2LRN A;  4K7N A;  2YWI A;  4ZB8 A;  4CW9 A;  4Z2T A;  2LKU A;  4XRD A;  2RM6 A;  3L0H A;  4KDY A;  5HQP A;  1F37 A;  4QL7 A;  4MJC A;  1AQW A;  2C1Y A;  1F6M C;  1SD8 A;  4LL4 B;  6GSW A;  3IHG A;  4JZQ A;  1JHB A;  1GNE A;  4JBB A;  2H75 A;  2VL9 A;  5F8B A;  2R2J A;  3A2W A;  5AN1 A;  1G7E A;  2GQM A;  1KBN A;  2PGT A;  4YH2 A;  4KB3 A;  1M2D A;  5AIX A;  5D9T A;  1G6Y A;  2M80 A;  3VI7 A;  2YV7 A;  3ZRD A;  3QMX A;  3C71 A;  4OFM A;  3GIX A;  5CRD A;  2DLX A;  3C1R A;  4POL A;  5B8B A;  1GSS A;  3TJB A;  3UBK A;  4DSQ A;  3LWA A;  4F2I A;  2R37 A;  20GS A;  1DBY A;  3F3R A;  3M8N A;  3CBU A;  2F8A A;  5B7C A;  1EP8 A;  3KP8 A;  4KW6 A;  2H6X A;  3I69 A;  4TR3 A;  2I1U A;  2KOK A;  1K0B A;  4GQF A;  5DQS A;  1QGV A;  1O6J A;  4POM A;  2H0H A;  4ZBB A;  4ECC A;  4G2E A;  2LUS A;  2OAC A;  2PER A;  3O3T A;  4O5U A;  4HJM A;  1TRV A;  4AJ7 A;  5LNK e;  1M2A A;  2OBI A;  4XHM A;  2LRT A;  1YKC A;  4WET A;  3D4M A;  4IKH A;  1PX7 A;  1X5E A;  4ISD A;  2AAW A;  1ZYQ B;  2HYX A;  4HUA A;  4TRX A;  4IVF A;  2CQ9 A;  5IMC A;  5LCZ A;  2DMM A;  3DIE A;  3MWH A;  1G6W A;  4FIW A;  2HZE A;  2DJK A;  4EDZ A;  2IFQ B;  5J9C A;  4XRA A;  5GST A;  3ZL5 A;  4K7O A;  3WT1 A;  3KMO A;  5G5F A;  2X64 A;  2YWO A;  5CO3 A;  1TRW A;  3ZTL A;  4FQU A;  2X8G A;  3BOA A;  3GL3 A;  4K1F A;  1EOG A;  2OKA A;  2EIQ A;  3IRA A;  1M9A A;  5KN0 A;  4MF7 A;  2H0G A;  3BCK A;  4FH8 A;  1FB0 A;  4OFN A;  1N8J A;  1LJR A;  3FZA A;  1T1V A;  5IMF A;  1U87 A;  2CT6 A;  4BVY A;  4EIQ A;  1HNB A;  4HU9 A;  4ZB6 A;  3IOS A;  3TKQ A;  2R0P A;  4BA7 A;  1K0N A;  2GGT A;  1CQG A;  4J2F A;  2FWG A;  4O7H A;  2F3M A;  2C3N A;  4DSS B;  1SJ6 A;  3GYK A;  3IPZ A;  4N0Z A;  1R26 A;  2R5G A;  2GT5 A;  3FEU A;  2I9H A;  2GZY A;  1GSF A;  3KJY A;  1S3A A;  1OKD A;  5JWQ B;  4PQI A;  1T4Z A;  2REM A;  1OC8 A;  3LYP A;  2HZF A;  1XFL A;  3H79 A;  4PTS A;  2QSI A;  4HDE A;  4BL7 B;  2DJ0 A;  2YV9 A;  3HCZ A;  4TW5 A;  5ECQ B;  2DJJ A;  2LNS A;  2V32 A;  1SJZ A;  2I3Y A;  2V1M A;  3CYN A;  1DE1 A;  4G0K A;  5FWG A;  3UEM A;  2H1G A;  3FYG A;  2H6Z A;  3UBL A;  4ECI A;  6GSU A;  4X43 A;  4KF9 A;  1JZR A;  2FWE A;  3IR4 A;  2FWF A;  4IP6 A;  1GTB A;  5IQY A;  5D73 A;  4N10 A;  3VPQ A;  4O32 A;  1B9Y C;  4E8E A;  3F3Q A;  3APQ A;  1A8Y A;  2JZS A;  4WBR D;  5CRH A;  1M7T A;  4KSO A;  2LRC A;  3TB2 A;  2KLX A;  3I43 A;  1T4Y A;  5F06 A;  3G7J A;  2R6K A;  1Z6N A;  2FY6 A;  4IQ1 A;  5CNW A;  1N2A A;  4WXT A;  1ZGN A;  1QMV A;  4MF5 A;  2LNT A;  4LMV A;  6GSY A;  3DD3 A;  1ML6 A;  3ERW A;  1M0U A;  1W89 A;  4K2D A;  2B1K A;  1A24 A;  1V40 A;  4I5Q A;  1LU4 A;  4MZC A;  2HLS A;  3RPN A;  4MDC A;  1SYR A;  1RW1 A;  3F6F A;  2JU5 A;  1ON4 A;  3HJO A;  3P90 A;  6GSX A;  1GUH A;  2B5Y A;  1V57 A;  1F2E A;  4IJI A;  1SK1 A;  3IDV A;  1GSU A;  2RLI A;  2KP1 A;  3VWX A;  4YAV A;  1ZZY A;  2C3T A;  3ME8 A;  3IA1 A;  1QFN A;  5CP1 A;  3NOF A;  4KCA A;  3DVW A;  1WRY A;  3CSH A;  5KEJ A;  4DSS A;  1XCC A;  2VAF A;  3ZYW A;  4BVX A;  3PR8 A;  1J0F A;  2ES7 A;  3KD0 A;  3FZ4 A;  3ZVJ D;  2GSR A;  3HJM A;  1NHY A;  5E4W A;  4Z2R A;  3VWW A;  1AUC A;  1F3A A;  1GH2 A;  1SKS B;  1MDJ A;  1YDK A;  1BQ7 A;  4PNF A;  1SJI A;  5A5K A;  4LA1 A;  4BWQ A;  3FY7 A;  4JR4 A;  3CSI A;  19GS A;  4NHZ A;  4NPB A;  2C0G A;  3TGZ A;  1TXX A;  2B5E A;  3RHB A;  3D5J A;  3TOU A;  1XWB A;  5G31 A;  4AJ6 A;  4EC0 A;  5AGY A;  2LTK A;  5ELG A;  2FCH A;  2G0F A;  3LGC A;  2MMN A;  2F51 A;  1ACV A;  2OE0 A;  3VUR A;  1GUM A;  2DBC A;  4K0N A;  4TR1 B;  2H19 A;  4GSN A;  2MMO A;  2FHE A;  2NTO A;  1OE8 A;  2H76 A;  3FR3 A;  4JRR A;  2PPT A;  5ELA A;  3RAZ A;  2F8F A;  3ZLP A;  3CRT A;  5C04 A;  1JFU A;  16GS A;  2P5Q A;  3KTB A;  3US3 A;  3W8S A;  5JCU A;  5EL8 A;  1TKD B;  3HZ4 A;  2D2Z A;  1PKZ A;  3KXO A;  4OO4 A;  2FA8 A;  5J5N A;  1SL1 B;  3HD5 A;  5INY A;  2VCQ A;  3HY2 A;  5CYY A;  4YQM A;  1KNG A;  5DBQ A;  2FWH A;  5KN3 A;  2HSH A;  3IHQ A;  4J56 E;  3WGE A;  4I2U A;  3KIJ A;  3G7I A;  4F0C A;  3LYK A;  4JU5 A;  5AIS A;  5J4U A;  2K8V A;  5DAK B;  1Z5Y E;  2N5F A;  1T00 A;  4ZXG A;  1YF1 A;  1XW6 A;  2C0E A;  4L5L A;  4EXJ A;  1GLQ A;  1AXD A;  3EWL A;  1WPI A;  2H01 A;  4LL1 B;  3DYR A;  3G7Y A;  5GZZ B;  1U6T A;  2O85 A;  3D21 A;  2BMX A;  5F0G A;  1FVK A;  3SBC A;  2B1L A;  2OJL A;  4MF6 A;  5JCW A;  3W6G A;  4KND A;  1I9D A;  3F9U A;  3TJK A;  4AF2 A;  2K18 A;  2R0C A;  4USS A;  2VCT A;  2LV3 A;  2HRF A;  3E0U A;  4N30 A;  2JL4 A;  2XHF A;  2HSM A;  3LEF A;  5A4U A;  4IEL A;  4D73 A;  4LMW A;  1TW9 A;  2WDU A;  2AYT A;  3EIN A;  2R0G A;  2VLT A;  1GTU A;  2IMI A;  4TVE A;  2A2P A;  2LQO A;  4GF0 A;  1MTC A;  3J7Y b;  1NHO A;  4L0W A;  1SYX A;  3HVX A;  1DE2 A;  2J23 A;  4TR1 A;  2YJH A;  3FR9 A;  2NPB A;  3ERG A;  1K0A A;  6GST A;  5BMU A;  1GL8 A;  4L5O A;  2YZU A;  1TI1 A;  4RUV A;  5IPH A;  1SL2 B;  1O73 A;  3GHA A;  4NV2 A;  2MMA A;  1RK4 A;  2OA7 A;  1VF2 A;  1EEM A;  4FYC A;  1X5D A;  3IC8 A;  4TXV A;  1XXU A;  2HSY A;  3IC4 A;  2DSA A;  2ON7 A;  3LJR A;  5IM9 A;  3KEB A;  5E59 A;  1GUK A;  1XVW A;  4TXO B;  2GSQ A;  3F8U A;  3QD9 A;  4ID0 A;  17GS A;  1FW1 A;  3UAR A;  4EKZ A;  4IN0 A;  4ZBA A;  1VF3 A;  3S9F A;  3QPM A;  1XVQ A;  3WYW A;  3QFB C;  4WEY A;  1U3A A;  3CRU A;  3GKN A;  1R7H A;  1SK2 A;  1X9M B;  1EZK A;  4EE0 A;  2DJ2 A;  2H30 A;  1Z6M A;  4OCF A;  4GST A;  2B3S A;  5J3R A;  2FGX A;  1CQH A;  4KDU A;  2EIO A;  5ECM B;  1WP0 A;  4OWY A;  2EIR A;  2CVD A;  3RPP A;  4QQ7 A;  1ST9 A;  1ILO A;  1Q4J A;  1SK0 A;  3DEX A;  1PN9 A;  4CY6 A;  1R5A A;  3GX0 A;  4FYU A;  3EMP A;  3KH9 A;  2GZZ A;  3A5W A;  2WUL A;  3A2X A;  4V2N A;  5GAN D;  2HT9 A;  3UJ1 A;  2DJ3 A;  4DSR A;  3GSS A;  3H93 A;  4BPY A;  1UVZ A;  2VOC A;  5CRG A;  3TRQ A;  4EDY A;  2TIR A;  3CMI A;  1A0F A;  2B7J A;  1YEX A;  4G0L A;  4MZB A;  3HDC A;  3TOT A;  3LXZ A;  2QKE A;  1J08 A;  3ZIV A;  2M46 A;  4EL1 A;  1PN0 A;  1VGL A;  3ZMK A;  2WRT A;  4K2X A;  4GWR A;  3BJ5 A;  1ZYN A;  4GTU A;  4YQU A;  1PKW A;  5A4W A;  3HJP A;  3JCM L;  5IOX A;  3UMA A;  1SKR B;  4ZBD A;  3KP9 A;  4EIP A;  2GQL A;  1GSE A;  1GLP A;  2FA4 A;  4KGI A;  1O8X A;  3D4T A;  2YZH A;  2DKH A;  3TRP A;  2C0D A;  2X49 A;  4IJ3 A;  1H75 A;  2KHP A;  4ILF A;  4KCE A;  4PX1 A;  7GSS A;  2H6Y A;  3CTF A;  1BED A;  3EU3 A;  1OKT A;  4PQ1 A;  4ML1 A;  3GKK A;  2QGV A;  4J57 E;  2V2G A;  2DC5 A;  1ZOF A;  1ERU A;  2HI7 A;  5G1K A;  5H5R A;  2PMT A;  1SD9 A;  2VM2 A;  5GAP D;  5ECP B;  1GTA A;  3GUS A;  3O76 A;  1X9S B;  3A3T A;  3TCO A;  1USB A;  5D9W A;  5GSS A;  2L57 A;  1EGR A;  2VD0 A;  1U88 A;  2YAN A;  4JR6 A;  4HQZ A;  4NAX A;  1QK8 A;  1TOF A;  4O5R A;  1HD2 A;  1W4V A;  1DUG A;  1JLW A;  2RUE A;  3QDN A;  1FOV A;  2VL3 A;  4JED A;  2HRN A;  5DDL A;  1K0M A;  4GQC A;  5IPG A;  2OAD A;  4MCU A;  2X8C A;  4XS6 A;  2ZUP A;  3F0I A;  4FYB A;  5L71 A;  1M99 A;  5LD0 A;  3NIV A;  4HOJ A;  3KH7 A;  4XTS A;  1UN2 A;  3FZ5 A;  4ML6 A;  5IO0 A;  1GNW A;  2VM1 A;  4L0U A;  3MNG A;  3CSJ A;  3Q19 A;  5EPF A;  3I6A A;  1AC1 A;  1PQN A;  2QC7 A;  1H4O A;  2L4C A;  2CV4 A;  1ZYP A;  2H66 A;  2P5R A;  2AUV A;  1XWC A;  3D22 A;  1YQ1 A;  1R5P A;  4G0I A;  2O7K A;  4PXO A;  4ZL8 A;  5IMZ A;  2YOI A;  2RUF A;  3QFA C;  2X99 A;  2IFQ A;  4ZL9 A;  1GSY A;  2XC2 A;  1K3O A;  5KOX A;  3QAW A;  1WJK A;  4Q5Q A;  2V6K A;  4MH3 A;  2YWM A;  1F9M A;  3EMX A;  4KUN A;  2PWJ A;  3KM6 A;  1O7U A;  3L9V A;  5G30 A;  3ZRE A;  2CX3 A;  4V1A g;  2N5A A;  3OR5 A;  2L59 A;  1GUL A;  1TDI A;  3DML A;  4PGT A;  3KMN A;  2IJY A;  3LQ7 A;  2C80 A;  1V2A A;  1AQV A;  2GQK A;  4HI7 A;  1XWA A;  1OC9 B;  4Z7X A;  3QOU A;  2V41 A;  1T8E B;  1HQO A;  3FMW A;  5ECO B;  2G2Q A;  2P31 A;  3P8W A;  2I4A A;  2OE3 A;  1SKW B;  3DWV A;  4E8H A;  4K5S A;  5B6N A;  1FOH A;  2IMK A;  3EU4 A;  4RI6 A;  3V1W A;  4BL7 A;  3M3M A;  3GKM A;  3PPU A;  3TKS C;  5D8I A;  2CZ3 A;  1AQX A;  3DGQ A;  2CA8 A;  1V9W A;  4MMM A;  2BTO T;  1PA3 A;  1THX A;  2ON5 A;  4MNN A;  3GNJ A;  3IK9 A;  4K5R A;  2I81 A;  4ACS A;  5BRT A;  2H0I A;  3C1S A;  4HS1 A;  1TK0 B;  3GTU B;  5ID2 B;  5KOW A;  4PUF C;  3P2A A;  2OBK A;  4HZ4 A;  2ZNM A;  1PL2 A;  1X5C A;  2NDO A;  2B6M A;  5DQY A;  2AB6 A;  2JZR A;  2H71 A;  5IMA A;  3DRN A;  4XS4 B;  3TKR A;  3IXR A;  2BJX A;  1JZO A;  1K3L A;  4KA0 A;  4IGJ A;  2CX4 A;  4QL9 A;  4PNG A;  3O6T A;  4PQH A;  1VF4 A;  3UVT A;  1HNA A;  2HFD A;  4MP4 A;  4Q5R A;  3GFK A;  3H8Q A;  5D93 A;  1SEN A;  1WOU A;  2HNL A;  4GLT A;  4V2L A;  3BBY A;  1JZW A;  2LJK A;  2V6O A;  4A5P A;  1BJX A;  3KCM A;  3GX8 A;  2MZC A;  1YJ6 A;  1BX9 A;  2XPD A;  3FW2 A;  1S3C A;  9GSS A;  4CY8 A;  5H5Q A;  14GS A;  3F6D A;  3WT2 A;  1FHE A;  2A4V A;  1O81 A;  2WZ9 A;  1JZD A;  2PUK C;  2JSZ A;  3PIN A;  4ZL7 A;  2H1D A;  4NMU A;  5EVO A;  1EGO A;  5DAL B;  1PRX A;  4O5Q A;  5D9X A;  2YCD A;  1K0D A;  3MIX A;  2VO4 A;  2UZ8 A;  3APS A;  2XBI A;  2PBJ A;  1TI3 A;  1TK5 B;  4ICY A;  4WR4 A;  13GS A;  2J9H A;  4I8B A;  3F4R A;  2VCW A;  5G1L A;  3ZFL A;  1GWC A;  5CRW A;  1A8L A;  1E2Y A;  3HYP A;  1TRU A;  4HEA 2;  3FR6 A;  3RHC A;  2JAC A;  3MSZ A;  2O89 A;  5B8A A;  4Q5F A;  3LXT A;  3K8N A;  2M72 A;  1ERW A;  1RQM A;  2H74 A;  4HZ2 A;  1EV4 A;  1O8W A;  2O87 A;  3ZIJ A;  4GCI A;  3ZML A;  5HR0 A;  3GTU A;  3U5R E;  3U6V A;  2PN8 A;  5D96 A;  3N5O A;  1OC3 A;  3BCI A;  2WGR A;  3Q74 A;  1B48 A;  1KTE A;  5F05 A;  3HXS A;  2IWT A;  1XOB A;  4HU7 A;  3VI5 A;  2F9S A;  1OYJ A;  1A2J A;  1Y6E A;  4IHU A;  1U3I A;  2DIY A;  2HE3 A;  4F82 A;  3DKS A;  2L6D A;  2GST A;  1OVN A;  4TOP A;  4YKF A;  1NM3 A;  2HRA A;  5DVB A;  3FRC A;  4G10 A;  3RDW A;  3F63 A;  2NBS A;  4ZIL A;  4TR0 A;  5CAX A;  3GL5 A;  2VLU A;  4XIH A;  3VK9 A;  4WF4 A;  2H1A A;  1MD4 A;  2HZE B;  3IAM 2;  3E3E A;  3UVH A;  5DJL A;  1HYU A;  1O85 A;  3GMF A;  2IIY A;  3EVI A;  2CZ2 A;  3QAV A;  2NVL A;  2A2S A;  4NV5 A;  4EUY A;  3F4T A;  2JSY A;  4GSS A;  11GS A;  2FUG 2;  2K9F A;  4MPF A;  3APO A;  1K0O A;  5DAK A;  2JZT A;  5C00 A;  4HQS A;  3LOR A;  5DAL A;  2MBT A;  5G2Z A;  3SWL A;  1FO5 A;  2JAD A;  4AJ8 A;  3BD2 A;  1HNC A;  5HFK A;  1F3B A;  4X4J A;  1MD3 A;  4BVY B;  3EPT A;  4K8M A;  5HFG A;  1WE0 A;  3C73 A;  4MLY A;  3J7Y k;  1QXH A;  2L6C A;  3D0Z A;  3UOM A;  1BAY A;  3L4N A;  2IMD A;  4KE3 A;  5EY6 A;  3GUR A;  3UIW A;  4YQV A;  1XW5 A;  1GSD A;  1TU7 A;  4POK A;  1DSB A;  2KP2 A;  1EWX A;  2LEG A;  4MH2 A;  4WKW A;  4KDX A;  1NSW A;  1GTI A;  1SU9 A;  4PUR A;  1Z3E A;  5JWO B;  1GRX A;  1M9B A;  3FK8 A;  2WFC A;  3CTG A;  3IBH A;  3ISO A;  2CVB A;  4OCE A;  4GRF A;  1OE7 A;  5IIZ A;  5IMV A;  1ABA A;  3QAG A;  3VFI A;  3GKX A;  3GN3 A;  1XOA A;  2EC4 A;  1XWK A;  5CRE A;  4IBP A;  5G5E A;  2VD1 A;  2RM5 A;  3VPT A;  1XPV A;  4MK3 A;  4ULX A;  1R4W A;  1WMJ A;  4FO5 A;  4MJB A;  5ECI B;  1Z9H A;  1PL1 A;  3GRX A;  4WF5 A;  1LBK A;  4OO5 A;  3ZFB A;  1THO A;  4WBJ A;  1A0R P;  3H4K A;  2GZP A;  2VL2 A;  3LW9 A;  2B7K A;  1VF1 A;  3HZ8 A;  2IME A;  4G9H A;  1AAZ A;  5ECR B;  4TXO A;  3AY8 A;  1T7P B;  4V1A p;  4EVM A;  4RQR A;  2HRK A;  3VWU A;  5FHI A;  2R4V A;  2DML A;  2IMF A;  2N5B A;  2ALB A;  3ME7 A;  2IPA A;  4KAE A;  5HR3 A;  3ZZX A;  4IQA A;  5JWR B;  22GS A;  3GA4 A;  1SL0 B;  1V58 A;  2X4A A;  1JLV A;  3TJJ A;  3C8E A;  3HKR A;  1IYI A;  5FT3 A;  1PGT A;  4G19 A;  3ZIT A;  3P7X A;  2LST A;  4MJE A;  4KSM A;  2E0Q A;  5DJM A;  2E2G A;  2LS5 A;  1M2B A;  2GLR A;  5J9B A;  2ZCT A;  1FVJ A;  1MEK A;  3TUE A;  1X9W B;  1EV9 A;  2L4Q A;  1EEJ A;  4P3Y B;  4BVX B;  5ECN B;  3FZ9 A;  1WIK A;  3TKP A;  3TJF A;  1TK8 B;  4EO3 A;  1TTZ A;  5ECK B;  4LLR A;  2DKI A;  1PD2 1;  3GH9 A;  3IE3 A;  2KUC A;  2IN3 A;  4Q5N A;  4TR4 A;  4TKY A;  4MA9 A;  2LQQ A;  2XBQ A;  1KEB A;  3HA9 A;  3GH6 A;  3TKS E;  1GP1 A;  3DVX A;  1FAA A;  1XWG A;  3PH9 A;  1YEP A;  4Z2U A;  4ECJ A;  4DEJ A;  18GS A;  1WWJ A;  3D6I A;  3C7M A;  3M9K A;  1ZCP A;  1B8X A;  2PVO C;  5ENU A;  3H1N A;  1QQ2 A;  3E9J B;  1FB6 A;  5J41 A;  1IYH A;  3L9S A;  4NHW A;  3HHV A;  3ERF A;  1UA5 A;  1OAZ A;  4ECB A;  2K8S A;  4X1U A;  3KTL A;  1XBS A;  3IV4 A;  3Q6O A;  1J9B A;  1XIY A;  4YKG A;  1ERT A;  4H86 A;  3HVV A;  4V2M A;  2AHE A;  1BYE A;  2Z9S A;  2FLS A;  3EC3 A;  4L8E A;  2VCZ A;  3UAP A;  2H1B A;  2AJQ B;  3MAK A;  5ECL B;  2GT6 A;  3TDG A;  2TRX A;  1YKA A;  3I9V 2;  4OD7 A;  3TJG A;  3L9U A;  1X0R A;  4JE1 A;  2L5L A;  2RII A;  6GSS A;  1ZL9 A;  3FHK A;  1K0C A;  1A2M A;  2CVK A;  3QR6 A;  2YN1 A;  4OMV A;  3CXG A;  6GSV A;  3EYT A;  3QCP A;  3A2V A;  4CDO A;  5ECH B;  4O92 A;  4F03 A;  3M9J A;  4IS0 A;  3W8J A;  3G9B A;  2L5O A;  4KX4 A;  3DXB A;  3Q18 A;  2YPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...