3KCSA

Crystal structure of pamcherry1 in the dark state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
215
structure length
214
Chain Sequence
AIIKEFMRFKVHMEGSVNGHVFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFTWDILSPQFSNAYVKHPADIPDYFKLSFPEGFKWERVMKFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEALSERMYPEDGALKGEVKPRVKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNRKLDITSHNEDYTIVEQYERAEGRHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAmCherry1 protein
publication title Photoactivation mechanism of PAmCherry based on crystal structures of the protein in the dark and fluorescent states.
pubmed doi rcsb
source organism Discosoma sp.
molecule tags Fluorescent protein
total genus 63
structure length 214
sequence length 215
ec nomenclature
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3kcsA00
3SSTA 4HQCA 2DDCA 3DQFA 2H5OA 5DQMA 2OKYA 5DTYA 3I19A 4JC2A 2FL1A 3GJ1A 1CV7A 2A46A 2G6YA 5DTLA 3DQ3A 2Z6XA 4KA9A 3KCSA 1H4UA 3P28A 1JBYA 1EMCA 3SVNA 1YFPA 3DQ6A 4IK5A 4Q7RA 4KGFA 5BQLA 2GX2A 4JEOA 2DD9A 3CFAA 5EXUA 4OQWA 2YE1A 3CB9A 3SG7A 2C9JA 4LW5A 4DXIA 2VZXA 1Z1QA 2A47A 3DQIA 4TZAA 2OKWA 2G6EA 2ZMWA 3DQMA 2VVIA 4XVPA 2H5PA 5DPHA 3UFZA 1Q4EA 2G6XA 1QYQA 3ST2A 5HZTA 3O78A 3CBEA 1RRXA 2G3OA 4P1QA 1F0BA 4ZB1A 1RMPA 1H6RA 3VHTB 1EMMA 4LQTA 4L1IA 5EXCI 4H48A 1YJFA 3SSHA 2Z1OA 2ZO6A 1YHIA 4N3DA 2OJKA 2B3PA 2QLGB 5DQBA 3SVEA 1Z1PA 4W6CA 2O2BA 3E5TA 4EDSA 1W7TA 3WCKA 1ZGQA 3GL4A 3SG2A 2OGRA 4OHSA 1JC0A 3GB3A 3OSQA 3ST4A 4KGEA 3NF0A 4GESB 4HQ8A 3SS0A 2WSNA 3SSVA 4W76A 3U8AA 1EMFA 5HGEA 4EN1A 4W6GA 3W1CA 3BXCA 2IB6A 4Z4KA 4ZIOA 2GX0A 2YDZA 4ZF5A 2GW4B 5T3IA 2A52B 4KF5C 3LF4B 2EMNA 4W6UA 3DQUA 2QLHA 2WHSA 1XMZA 4W6HA 3W1DA 2IOVA 3U0LA 4L12A 3EVPA 2QLEA 5FVGA 1HUYA 2AWJA 4HE4A 1MOUA 5EB6A 1EMEA 2AWLA 5HZSA 2FWQA 4W6AA 3NEZA 3ZULA 4Q9WA 2Z6ZA 3SVSA 4PFEA 2VVHA 4B30B 1KP5A 2AWMA 2QU1A 2DDDA 3PJBA 4JRBA 3EVRA 4PPLA 3DPWA 3IR8A 3BX9A 2HGYA 4KPIA 4DKNA 1KYRA 2DD7A 5BTTA 2PXWA 2ICRA 3VK1A 4Q7UA 1JC1A 3CD9A 3ST0A 2C9IA 4KW9A 2HJOA 5H88A 5HZUA 3VICA 3DQJA 3H1OA 2P4MA 2WHTA 1KYPA 3EK4A 5FHVA 3DQCA 3DQ7A 1BFPA 1Q4DA 3WLDA 3E5WA 4ZINA 1XA9A 3ST3A 3ED8A 1QY3A 4H3MA 2V4EA 2GW3A 3NT3A 4W74A 2A56B 3GJ2A 3SVDA 4B5YA 4W7EA 5EXBA 5F9GA 1YHHA 3M22A 4R6DA 4ZBLA 3AI4A 2HRSA 2WISA 4R6BA 1KYSA 3EVVA 5DU0A 3LA1A 4W73A 4IK1A 5H87A 1GFLA 3SG3A 1QYOA 4GOBA 5DY6A 4GF6B 3LVAA 4W6BA 1ZGOA 4L13A 4XL5A 4LJDA 2H9WA 3NT9A 3DQKA 3U8CA 1S6ZA 5FVIA 2QRFA 4NWSA 1W7SA 2DUEA 1Q4AA 3DPXA 4DKMA 4W6LA 4XGYA 5EJUA 4W7AA 5DRGA 1MOVA 2G5ZB 3EKHA 4DXQA 3LSAA 3S05A 4W7DA 3DQEA 3U0KA 5LTPA 3DQLA 3SVRA 3OSRA 3SG5A 3DQ2A 3EK7A 3SSPA 1OXDA 4W75A 3DQ8A 4KEXA 5H89A 2HCGA 4ORNA 5AQBB 4W7FA 2VAEA 5DPGA 4PPJA 1JBZA 3RWTA 1RM9A 3SV5A 1QXTA 1YZWA 3AI5A 4IZNA 4JFGA 4IK3A 2EMOA 5HZOA 2YE0A 3OGOA 5EHUA 1GGXA 4IK4A 3LS3A 1ZUXA 3DQNA 1ZGPA 4RYSA 3VHTA 5J2OA 1QYFA 3SVBA 2ARLA 1MYWA 2EMDA 3BXAA 4OY4A 4DXMA 2BTJA 4UTSA 1RMOA 1Q73A 2AH8A 2QLIA 3SVCA 2DUFA 3U0MA 1Q4CA 1UISA 4HVFA 2WHUA 3P8UA 5LK4A 4W6RA 4J8AA 4PPKA 5DPIA 2B3QA 2QLGA 4J89A 2G16B 3SVUA 5KTGA 3SG6A 4H3NA 4BDUA 4W6SA 5DTXA 3PJ7A 4EULA 2WSOA 5DPJA 5BT0A 2ZO7A 2PXSA 4W6PA 3EVUA 5LTQA 2HQZA 1HCJA 3DQ4A 4ZFSA 3E5VA 1OXEA 4TZGA 2DUHA 2H5RA 3G9AA 4LQUA 2IE2A 4W6FA 3DQ9A 1G7KA 4AS8A 4Q9XA 4RYWA 3SSYA 3DQ1A 4W6NA 2O24A 4JGEA 4W72A 2O29A 1EMBA 3CD1A 4Q7TA 2Q6PA 2HGDA 4XOVA 2A50B 2A53B 5DRFA 4U2VA 3DQ5A 2RH7A 3CFFA 4JF9A 2Y0GA 1XQMA 4H3LA 1EMLA 2VADA 4XOWA 5EB7A 2G3DB 4W7CA 3DQDA 4W6JA 3PJ5A 2HQKA 3SG4A 4OJ0A 2IB5A 2DUIA 4W6IA 3BXBA 3ZUFA 2A54B 4KF4A 4B30A 4OGSA 4KAGA 2G2SB 2HPWA 2QT2A 1EMGA 4KF5A 4DXOA 4ZF4A 2VVJA 3H1RA 3DPZA 1GL4A 4ZF3A 1Q4BA 1RMMA 3DQAA 4W69A 1YJ2A 3TMRA 3K1KA 3V3DA 3SSLA 2OTBA 4IK8A 2Q57A 2AWKA 4KW4A 2H6VA 4DXPA 3ZUJA 5EBJA 4DXNA 3PIBA 3U8PA 3GEXA 2WIQA 3EKJA 1B9CA 4LJBA 2POXA 4W7XA 3UG0A 3A8SA 4H47A 1C4FA 3AKOA 3M24A 2V4EC 4W6MA 4RTCA 1XAEA 3CGLA 4HQ9A 3U0NA 2A48A 3CFHA 3SRYA 2QZ0A 2Z6YA 4Z4MA 3SSKA 4ANJA 2H5QA 5BTTB 5LTRA 3KCTA 2H8QA 1EMKA 3MGFA 1XSSA 4W6KA 4I2YA 2JADA 5DTZA 5FVFA 1OXFA 1YHGA 4LJDC 2AHAA 4EDOA 4W7RA 4W6TA 2FZUA 2WURA 2ZMUA 4AR7A 4EMQA 3EK8A 4J88A 3NEDA 5HW9A 3DQOA 3TMTA 2HFCA 3IP2A 3LVCA 4LJCA 3WLCA 2DUGA 3O77A 1EMAA 3SVOA 4KW8A 1W7UA 2V4EB 2OTEA 4P76A 4W77A 5HBDA 1F09A 3ADFA 3RWAA 3ZTFA 3LF3A 4W6DA 4W6OA 4IK9A 3DQHA 2YFPA 3LVDA
chains in the Genus database with same CATH superfamily
3SSTA 4HQCA 2DDCA 3DQFA 2H5OA 5DQMA 2OKYA 5DTYA 3I19A 4JC2A 2FL1A 3GJ1A 1CV7A 2A46A 2G6YA 5DTLA 3DQ3A 2Z6XA 4KA9A 3KCSA 1H4UA 3P28A 1JBYA 1EMCA 3SVNA 1YFPA 3DQ6A 4IK5A 4Q7RA 4KGFA 5BQLA 2GX2A 4JEOA 2DD9A 3CFAA 5EXUA 4OQWA 2YE1A 3CB9A 3SG7A 2C9JA 4LW5A 4DXIA 2VZXA 1Z1QA 2A47A 3DQIA 4TZAA 2OKWA 2G6EA 2ZMWA 3DQMA 2VVIA 4XVPA 2H5PA 5DPHA 3UFZA 1Q4EA 2G6XA 1QYQA 3ST2A 5HZTA 3O78A 3CBEA 1RRXA 2G3OA 4P1QA 1F0BA 4ZB1A 1RMPA 1H6RA 3VHTB 1EMMA 4LQTA 4L1IA 5EXCI 4H48A 1YJFA 3SSHA 2Z1OA 2ZO6A 1YHIA 4N3DA 2OJKA 2B3PA 2QLGB 5DQBA 3SVEA 1Z1PA 4W6CA 2O2BA 3E5TA 4EDSA 1W7TA 3WCKA 1ZGQA 3GL4A 3SG2A 2OGRA 4OHSA 1JC0A 3GB3A 3OSQA 3ST4A 4KGEA 3NF0A 4GESB 4HQ8A 3SS0A 2WSNA 3SSVA 4W76A 3U8AA 1EMFA 5HGEA 4EN1A 4W6GA 3W1CA 3BXCA 2IB6A 4Z4KA 4ZIOA 2GX0A 2YDZA 4ZF5A 2GW4B 5T3IA 2A52B 4KF5C 3LF4B 2EMNA 4W6UA 3DQUA 2QLHA 2WHSA 1XMZA 4W6HA 3W1DA 2IOVA 3U0LA 4L12A 3EVPA 2QLEA 5FVGA 1HUYA 2AWJA 4HE4A 1MOUA 5EB6A 1EMEA 2AWLA 5HZSA 2FWQA 4W6AA 3NEZA 3ZULA 4Q9WA 2Z6ZA 3SVSA 4PFEA 2VVHA 4B30B 1KP5A 2AWMA 2QU1A 2DDDA 3PJBA 4JRBA 3EVRA 4PPLA 3DPWA 3IR8A 3BX9A 2HGYA 4KPIA 4DKNA 1KYRA 2DD7A 5BTTA 2PXWA 2ICRA 3VK1A 4Q7UA 1JC1A 3CD9A 3ST0A 2C9IA 4KW9A 2HJOA 5H88A 5HZUA 3VICA 3DQJA 3H1OA 2P4MA 2WHTA 1KYPA 3EK4A 5FHVA 3DQCA 3DQ7A 1BFPA 1Q4DA 3WLDA 3E5WA 4ZINA 1XA9A 3ST3A 3ED8A 1QY3A 4H3MA 2V4EA 2GW3A 3NT3A 4W74A 2A56B 3GJ2A 3SVDA 4B5YA 4W7EA 5EXBA 5F9GA 1YHHA 3M22A 4R6DA 4ZBLA 3AI4A 2HRSA 2WISA 4R6BA 1KYSA 3EVVA 5DU0A 3LA1A 4W73A 4IK1A 5H87A 1GFLA 3SG3A 1QYOA 4GOBA 5DY6A 4GF6B 3LVAA 4W6BA 1ZGOA 4L13A 4XL5A 4LJDA 2H9WA 3NT9A 3DQKA 3U8CA 1S6ZA 5FVIA 2QRFA 4NWSA 1W7SA 2DUEA 1Q4AA 3DPXA 4DKMA 4W6LA 4XGYA 5EJUA 4W7AA 5DRGA 1MOVA 2G5ZB 3EKHA 4DXQA 3LSAA 3S05A 4W7DA 3DQEA 3U0KA 5LTPA 3DQLA 3SVRA 3OSRA 3SG5A 3DQ2A 3EK7A 3SSPA 1OXDA 4W75A 3DQ8A 4KEXA 5H89A 2HCGA 4ORNA 5AQBB 4W7FA 2VAEA 5DPGA 4PPJA 1JBZA 3RWTA 1RM9A 3SV5A 1QXTA 1YZWA 3AI5A 4IZNA 4JFGA 4IK3A 2EMOA 5HZOA 2YE0A 3OGOA 5EHUA 1GGXA 4IK4A 3LS3A 1ZUXA 3DQNA 1ZGPA 4RYSA 3VHTA 5J2OA 1QYFA 3SVBA 2ARLA 1MYWA 2EMDA 3BXAA 4OY4A 4DXMA 2BTJA 4UTSA 1RMOA 1Q73A 2AH8A 2QLIA 3SVCA 2DUFA 3U0MA 1Q4CA 1UISA 4HVFA 2WHUA 3P8UA 5LK4A 4W6RA 4J8AA 4PPKA 5DPIA 2B3QA 2QLGA 4J89A 2G16B 3SVUA 5KTGA 3SG6A 4H3NA 4BDUA 4W6SA 5DTXA 3PJ7A 4EULA 2WSOA 5DPJA 5BT0A 2ZO7A 2PXSA 4W6PA 3EVUA 5LTQA 2HQZA 1HCJA 3DQ4A 4ZFSA 3E5VA 1OXEA 4TZGA 2DUHA 2H5RA 3G9AA 4LQUA 2IE2A 4W6FA 3DQ9A 1G7KA 4AS8A 4Q9XA 4RYWA 3SSYA 3DQ1A 4W6NA 2O24A 4JGEA 4W72A 2O29A 1EMBA 3CD1A 4Q7TA 2Q6PA 2HGDA 4XOVA 2A50B 2A53B 5DRFA 4U2VA 3DQ5A 2RH7A 3CFFA 4JF9A 2Y0GA 1XQMA 4H3LA 1EMLA 2VADA 4XOWA 5EB7A 2G3DB 4W7CA 3DQDA 4W6JA 3PJ5A 2HQKA 3SG4A 4OJ0A 2IB5A 2DUIA 4W6IA 3BXBA 3ZUFA 2A54B 4KF4A 4B30A 4OGSA 4KAGA 2G2SB 2HPWA 2QT2A 1EMGA 4KF5A 4DXOA 4ZF4A 2VVJA 3H1RA 3DPZA 1GL4A 4ZF3A 1Q4BA 1RMMA 3DQAA 4W69A 1YJ2A 3TMRA 3K1KA 3V3DA 3SSLA 2OTBA 4IK8A 2Q57A 2AWKA 4KW4A 2H6VA 4DXPA 3ZUJA 5EBJA 4DXNA 3PIBA 3U8PA 3GEXA 2WIQA 3EKJA 1B9CA 4LJBA 2POXA 4W7XA 3UG0A 3A8SA 4H47A 1C4FA 3AKOA 3M24A 2V4EC 4W6MA 4RTCA 1XAEA 3CGLA 4HQ9A 3U0NA 2A48A 3CFHA 3SRYA 2QZ0A 2Z6YA 4Z4MA 3SSKA 4ANJA 2H5QA 5BTTB 5LTRA 3KCTA 2H8QA 1EMKA 3MGFA 1XSSA 4W6KA 4I2YA 2JADA 5DTZA 5FVFA 1OXFA 1YHGA 4LJDC 2AHAA 4EDOA 4W7RA 4W6TA 2FZUA 2WURA 2ZMUA 4AR7A 4EMQA 3EK8A 4J88A 3NEDA 5HW9A 3DQOA 3TMTA 2HFCA 3IP2A 3LVCA 4LJCA 3WLCA 2DUGA 3O77A 1EMAA 3SVOA 4KW8A 1W7UA 2V4EB 2OTEA 4P76A 4W77A 5HBDA 1F09A 3ADFA 3RWAA 3ZTFA 3LF3A 4W6DA 4W6OA 4IK9A 3DQHA 2YFPA 3LVDA
chains in the Genus database with same CATH topology
3SSTA 4HQCA 2DDCA 3DQFA 2H5OA 5DQMA 2OKYA 5DTYA 3I19A 4JC2A 2FL1A 3GJ1A 1CV7A 2A46A 2G6YA 5DTLA 3DQ3A 2Z6XA 4KA9A 3KCSA 1H4UA 3P28A 1JBYA 1EMCA 3SVNA 1YFPA 3DQ6A 4IK5A 4Q7RA 4KGFA 5BQLA 2GX2A 4JEOA 2DD9A 3CFAA 5EXUA 4OQWA 2YE1A 3CB9A 3SG7A 2C9JA 4LW5A 4DXIA 2VZXA 1Z1QA 2A47A 3DQIA 4TZAA 2OKWA 2G6EA 2ZMWA 3DQMA 2VVIA 4XVPA 2H5PA 5DPHA 3UFZA 1Q4EA 2G6XA 1QYQA 3ST2A 5HZTA 3O78A 3CBEA 1RRXA 2G3OA 4P1QA 1F0BA 4ZB1A 1RMPA 1H6RA 3VHTB 1EMMA 4LQTA 4L1IA 5EXCI 4H48A 1YJFA 3SSHA 2Z1OA 2ZO6A 1YHIA 4N3DA 2OJKA 2B3PA 2QLGB 5DQBA 3SVEA 1Z1PA 4W6CA 2O2BA 3E5TA 4EDSA 1W7TA 3WCKA 1ZGQA 3GL4A 3SG2A 2OGRA 4OHSA 1JC0A 3GB3A 3OSQA 3ST4A 4KGEA 3NF0A 4GESB 4HQ8A 3SS0A 2WSNA 3SSVA 4W76A 3U8AA 1EMFA 5HGEA 4EN1A 4W6GA 3W1CA 3BXCA 2IB6A 4Z4KA 4ZIOA 2GX0A 2YDZA 4ZF5A 2GW4B 5T3IA 2A52B 4KF5C 3LF4B 2EMNA 4W6UA 3DQUA 2QLHA 2WHSA 1XMZA 4W6HA 3W1DA 2IOVA 3U0LA 4L12A 3EVPA 2QLEA 5FVGA 1HUYA 2AWJA 4HE4A 1MOUA 5EB6A 1EMEA 2AWLA 5HZSA 2FWQA 4W6AA 3NEZA 3ZULA 4Q9WA 2Z6ZA 3SVSA 4PFEA 2VVHA 4B30B 1KP5A 2AWMA 2QU1A 2DDDA 3PJBA 4JRBA 3EVRA 4PPLA 3DPWA 3IR8A 3BX9A 2HGYA 4KPIA 4DKNA 1KYRA 2DD7A 5BTTA 2PXWA 2ICRA 3VK1A 4Q7UA 1JC1A 3CD9A 3ST0A 2C9IA 4KW9A 2HJOA 5H88A 5HZUA 3VICA 3DQJA 3H1OA 2P4MA 2WHTA 1KYPA 3EK4A 5FHVA 3DQCA 3DQ7A 1BFPA 1Q4DA 3WLDA 3E5WA 4ZINA 1XA9A 3ST3A 3ED8A 1QY3A 4H3MA 2V4EA 2GW3A 3NT3A 4W74A 2A56B 3GJ2A 3SVDA 4B5YA 4W7EA 5EXBA 5F9GA 1YHHA 3M22A 4R6DA 4ZBLA 3AI4A 2HRSA 2WISA 4R6BA 1KYSA 3EVVA 5DU0A 3LA1A 4W73A 4IK1A 5H87A 1GFLA 3SG3A 1QYOA 4GOBA 5DY6A 4GF6B 3LVAA 4W6BA 1ZGOA 4L13A 4XL5A 4LJDA 2H9WA 3NT9A 3DQKA 3U8CA 1S6ZA 5FVIA 2QRFA 4NWSA 1W7SA 2DUEA 1Q4AA 3DPXA 4DKMA 4W6LA 4XGYA 5EJUA 4W7AA 5DRGA 1MOVA 2G5ZB 3EKHA 4DXQA 3LSAA 3S05A 4W7DA 3DQEA 3U0KA 5LTPA 3DQLA 3SVRA 3OSRA 3SG5A 3DQ2A 3EK7A 3SSPA 1OXDA 4W75A 3DQ8A 4KEXA 5H89A 2HCGA 4ORNA 5AQBB 4W7FA 2VAEA 5DPGA 4PPJA 1JBZA 3RWTA 1RM9A 3SV5A 1QXTA 1YZWA 3AI5A 4IZNA 4JFGA 4IK3A 2EMOA 5HZOA 2YE0A 3OGOA 5EHUA 1GGXA 4IK4A 3LS3A 1ZUXA 3DQNA 1ZGPA 4RYSA 3VHTA 5J2OA 1QYFA 3SVBA 2ARLA 1MYWA 2EMDA 3BXAA 4OY4A 4DXMA 2BTJA 4UTSA 1RMOA 1Q73A 2AH8A 2QLIA 3SVCA 2DUFA 3U0MA 1Q4CA 1UISA 4HVFA 2WHUA 3P8UA 5LK4A 4W6RA 4J8AA 4PPKA 5DPIA 2B3QA 2QLGA 4J89A 2G16B 3SVUA 5KTGA 3SG6A 4H3NA 4BDUA 4W6SA 5DTXA 3PJ7A 4EULA 2WSOA 5DPJA 5BT0A 2ZO7A 2PXSA 4W6PA 3EVUA 5LTQA 2HQZA 1HCJA 3DQ4A 4ZFSA 3E5VA 1OXEA 4TZGA 2DUHA 2H5RA 3G9AA 4LQUA 2IE2A 4W6FA 3DQ9A 1G7KA 4AS8A 4Q9XA 4RYWA 3SSYA 3DQ1A 4W6NA 2O24A 4JGEA 4W72A 2O29A 1EMBA 3CD1A 4Q7TA 2Q6PA 2HGDA 4XOVA 2A50B 2A53B 5DRFA 4U2VA 3DQ5A 2RH7A 3CFFA 4JF9A 2Y0GA 1XQMA 4H3LA 1EMLA 2VADA 4XOWA 5EB7A 2G3DB 4W7CA 3DQDA 4W6JA 3PJ5A 2HQKA 3SG4A 4OJ0A 2IB5A 2DUIA 4W6IA 3BXBA 3ZUFA 2A54B 4KF4A 4B30A 4OGSA 4KAGA 2G2SB 2HPWA 2QT2A 1EMGA 4KF5A 4DXOA 4ZF4A 2VVJA 3H1RA 3DPZA 1GL4A 4ZF3A 1Q4BA 1RMMA 3DQAA 4W69A 1YJ2A 3TMRA 3K1KA 3V3DA 3SSLA 2OTBA 4IK8A 2Q57A 2AWKA 4KW4A 2H6VA 4DXPA 3ZUJA 5EBJA 4DXNA 3PIBA 3U8PA 3GEXA 2WIQA 3EKJA 1B9CA 4LJBA 2POXA 4W7XA 3UG0A 3A8SA 4H47A 1C4FA 3AKOA 3M24A 2V4EC 4W6MA 4RTCA 1XAEA 3CGLA 4HQ9A 3U0NA 2A48A 3CFHA 3SRYA 2QZ0A 2Z6YA 4Z4MA 3SSKA 4ANJA 2H5QA 5BTTB 5LTRA 3KCTA 2H8QA 1EMKA 3MGFA 1XSSA 4W6KA 4I2YA 2JADA 5DTZA 5FVFA 1OXFA 1YHGA 4LJDC 2AHAA 4EDOA 4W7RA 4W6TA 2FZUA 2WURA 2ZMUA 4AR7A 4EMQA 3EK8A 4J88A 3NEDA 5HW9A 3DQOA 3TMTA 2HFCA 3IP2A 3LVCA 4LJCA 3WLCA 2DUGA 3O77A 1EMAA 3SVOA 4KW8A 1W7UA 2V4EB 2OTEA 4P76A 4W77A 5HBDA 1F09A 3ADFA 3RWAA 3ZTFA 3LF3A 4W6DA 4W6OA 4IK9A 3DQHA 2YFPA 3LVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SST A;  4HQC A;  2DDC A;  3DQF A;  2H5O A;  5DQM A;  2OKY A;  5DTY A;  3I19 A;  4JC2 A;  2FL1 A;  3GJ1 A;  1CV7 A;  2A46 A;  2G6Y A;  5DTL A;  3DQ3 A;  2Z6X A;  4KA9 A;  3KCS A;  1H4U A;  3P28 A;  1JBY A;  1EMC A;  3SVN A;  1YFP A;  3DQ6 A;  4IK5 A;  4Q7R A;  4KGF A;  5BQL A;  2GX2 A;  4JEO A;  2DD9 A;  3CFA A;  5EXU A;  4OQW A;  2YE1 A;  3CB9 A;  3SG7 A;  2C9J A;  4LW5 A;  4DXI A;  2VZX A;  1Z1Q A;  2A47 A;  3DQI A;  4TZA A;  2OKW A;  2G6E A;  2ZMW A;  3DQM A;  2VVI A;  4XVP A;  2H5P A;  5DPH A;  3UFZ A;  1Q4E A;  2G6X A;  1QYQ A;  3ST2 A;  5HZT A;  3O78 A;  3CBE A;  1RRX A;  2G3O A;  4P1Q A;  1F0B A;  4ZB1 A;  1RMP A;  1H6R A;  3VHT B;  1EMM A;  4LQT A;  4L1I A;  5EXC I;  4H48 A;  1YJF A;  3SSH A;  2Z1O A;  2ZO6 A;  1YHI A;  4N3D A;  2OJK A;  2B3P A;  2QLG B;  5DQB A;  3SVE A;  1Z1P A;  4W6C A;  2O2B A;  3E5T A;  4EDS A;  1W7T A;  3WCK A;  1ZGQ A;  3GL4 A;  3SG2 A;  2OGR A;  4OHS A;  1JC0 A;  3GB3 A;  3OSQ A;  3ST4 A;  4KGE A;  3NF0 A;  4GES B;  4HQ8 A;  3SS0 A;  2WSN A;  3SSV A;  4W76 A;  3U8A A;  1EMF A;  5HGE A;  4EN1 A;  4W6G A;  3W1C A;  3BXC A;  2IB6 A;  4Z4K A;  4ZIO A;  2GX0 A;  2YDZ A;  4ZF5 A;  2GW4 B;  5T3I A;  2A52 B;  4KF5 C;  3LF4 B;  2EMN A;  4W6U A;  3DQU A;  2QLH A;  2WHS A;  1XMZ A;  4W6H A;  3W1D A;  2IOV A;  3U0L A;  4L12 A;  3EVP A;  2QLE A;  5FVG A;  1HUY A;  2AWJ A;  4HE4 A;  1MOU A;  5EB6 A;  1EME A;  2AWL A;  5HZS A;  2FWQ A;  4W6A A;  3NEZ A;  3ZUL A;  4Q9W A;  2Z6Z A;  3SVS A;  4PFE A;  2VVH A;  4B30 B;  1KP5 A;  2AWM A;  2QU1 A;  2DDD A;  3PJB A;  4JRB A;  3EVR A;  4PPL A;  3DPW A;  3IR8 A;  3BX9 A;  2HGY A;  4KPI A;  4DKN A;  1KYR A;  2DD7 A;  5BTT A;  2PXW A;  2ICR A;  3VK1 A;  4Q7U A;  1JC1 A;  3CD9 A;  3ST0 A;  2C9I A;  4KW9 A;  2HJO A;  5H88 A;  5HZU A;  3VIC A;  3DQJ A;  3H1O A;  2P4M A;  2WHT A;  1KYP A;  3EK4 A;  5FHV A;  3DQC A;  3DQ7 A;  1BFP A;  1Q4D A;  3WLD A;  3E5W A;  4ZIN A;  1XA9 A;  3ST3 A;  3ED8 A;  1QY3 A;  4H3M A;  2V4E A;  2GW3 A;  3NT3 A;  4W74 A;  2A56 B;  3GJ2 A;  3SVD A;  4B5Y A;  4W7E A;  5EXB A;  5F9G A;  1YHH A;  3M22 A;  4R6D A;  4ZBL A;  3AI4 A;  2HRS A;  2WIS A;  4R6B A;  1KYS A;  3EVV A;  5DU0 A;  3LA1 A;  4W73 A;  4IK1 A;  5H87 A;  1GFL A;  3SG3 A;  1QYO A;  4GOB A;  5DY6 A;  4GF6 B;  3LVA A;  4W6B A;  1ZGO A;  4L13 A;  4XL5 A;  4LJD A;  2H9W A;  3NT9 A;  3DQK A;  3U8C A;  1S6Z A;  5FVI A;  2QRF A;  4NWS A;  1W7S A;  2DUE A;  1Q4A A;  3DPX A;  4DKM A;  4W6L A;  4XGY A;  5EJU A;  4W7A A;  5DRG A;  1MOV A;  2G5Z B;  3EKH A;  4DXQ A;  3LSA A;  3S05 A;  4W7D A;  3DQE A;  3U0K A;  5LTP A;  3DQL A;  3SVR A;  3OSR A;  3SG5 A;  3DQ2 A;  3EK7 A;  3SSP A;  1OXD A;  4W75 A;  3DQ8 A;  4KEX A;  5H89 A;  2HCG A;  4ORN A;  5AQB B;  4W7F A;  2VAE A;  5DPG A;  4PPJ A;  1JBZ A;  3RWT A;  1RM9 A;  3SV5 A;  1QXT A;  1YZW A;  3AI5 A;  4IZN A;  4JFG A;  4IK3 A;  2EMO A;  5HZO A;  2YE0 A;  3OGO A;  5EHU A;  1GGX A;  4IK4 A;  3LS3 A;  1ZUX A;  3DQN A;  1ZGP A;  4RYS A;  3VHT A;  5J2O A;  1QYF A;  3SVB A;  2ARL A;  1MYW A;  2EMD A;  3BXA A;  4OY4 A;  4DXM A;  2BTJ A;  4UTS A;  1RMO A;  1Q73 A;  2AH8 A;  2QLI A;  3SVC A;  2DUF A;  3U0M A;  1Q4C A;  1UIS A;  4HVF A;  2WHU A;  3P8U A;  5LK4 A;  4W6R A;  4J8A A;  4PPK A;  5DPI A;  2B3Q A;  2QLG A;  4J89 A;  2G16 B;  3SVU A;  5KTG A;  3SG6 A;  4H3N A;  4BDU A;  4W6S A;  5DTX A;  3PJ7 A;  4EUL A;  2WSO A;  5DPJ A;  5BT0 A;  2ZO7 A;  2PXS A;  4W6P A;  3EVU A;  5LTQ A;  2HQZ A;  1HCJ A;  3DQ4 A;  4ZFS A;  3E5V A;  1OXE A;  4TZG A;  2DUH A;  2H5R A;  3G9A A;  4LQU A;  2IE2 A;  4W6F A;  3DQ9 A;  1G7K A;  4AS8 A;  4Q9X A;  4RYW A;  3SSY A;  3DQ1 A;  4W6N A;  2O24 A;  4JGE A;  4W72 A;  2O29 A;  1EMB A;  3CD1 A;  4Q7T A;  2Q6P A;  2HGD A;  4XOV A;  2A50 B;  2A53 B;  5DRF A;  4U2V A;  3DQ5 A;  2RH7 A;  3CFF A;  4JF9 A;  2Y0G A;  1XQM A;  4H3L A;  1EML A;  2VAD A;  4XOW A;  5EB7 A;  2G3D B;  4W7C A;  3DQD A;  4W6J A;  3PJ5 A;  2HQK A;  3SG4 A;  4OJ0 A;  2IB5 A;  2DUI A;  4W6I A;  3BXB A;  3ZUF A;  2A54 B;  4KF4 A;  4B30 A;  4OGS A;  4KAG A;  2G2S B;  2HPW A;  2QT2 A;  1EMG A;  4KF5 A;  4DXO A;  4ZF4 A;  2VVJ A;  3H1R A;  3DPZ A;  1GL4 A;  4ZF3 A;  1Q4B A;  1RMM A;  3DQA A;  4W69 A;  1YJ2 A;  3TMR A;  3K1K A;  3V3D A;  3SSL A;  2OTB A;  4IK8 A;  2Q57 A;  2AWK A;  4KW4 A;  2H6V A;  4DXP A;  3ZUJ A;  5EBJ A;  4DXN A;  3PIB A;  3U8P A;  3GEX A;  2WIQ A;  3EKJ A;  1B9C A;  4LJB A;  2POX A;  4W7X A;  3UG0 A;  3A8S A;  4H47 A;  1C4F A;  3AKO A;  3M24 A;  2V4E C;  4W6M A;  4RTC A;  1XAE A;  3CGL A;  4HQ9 A;  3U0N A;  2A48 A;  3CFH A;  3SRY A;  2QZ0 A;  2Z6Y A;  4Z4M A;  3SSK A;  4ANJ A;  2H5Q A;  5BTT B;  5LTR A;  3KCT A;  2H8Q A;  1EMK A;  3MGF A;  1XSS A;  4W6K A;  4I2Y A;  2JAD A;  5DTZ A;  5FVF A;  1OXF A;  1YHG A;  4LJD C;  2AHA A;  4EDO A;  4W7R A;  4W6T A;  2FZU A;  2WUR A;  2ZMU A;  4AR7 A;  4EMQ A;  3EK8 A;  4J88 A;  3NED A;  5HW9 A;  3DQO A;  3TMT A;  2HFC A;  3IP2 A;  3LVC A;  4LJC A;  3WLC A;  2DUG A;  3O77 A;  1EMA A;  3SVO A;  4KW8 A;  1W7U A;  2V4E B;  2OTE A;  4P76 A;  4W77 A;  5HBD A;  1F09 A;  3ADF A;  3RWA A;  3ZTF A;  3LF3 A;  4W6D A;  4W6O A;  4IK9 A;  3DQH A;  2YFP A;  3LVD A; 
#chains in the Genus database with same CATH topology
 3SST A;  4HQC A;  2DDC A;  3DQF A;  2H5O A;  5DQM A;  2OKY A;  5DTY A;  3I19 A;  4JC2 A;  2FL1 A;  3GJ1 A;  1CV7 A;  2A46 A;  2G6Y A;  5DTL A;  3DQ3 A;  2Z6X A;  4KA9 A;  3KCS A;  1H4U A;  3P28 A;  1JBY A;  1EMC A;  3SVN A;  1YFP A;  3DQ6 A;  4IK5 A;  4Q7R A;  4KGF A;  5BQL A;  2GX2 A;  4JEO A;  2DD9 A;  3CFA A;  5EXU A;  4OQW A;  2YE1 A;  3CB9 A;  3SG7 A;  2C9J A;  4LW5 A;  4DXI A;  2VZX A;  1Z1Q A;  2A47 A;  3DQI A;  4TZA A;  2OKW A;  2G6E A;  2ZMW A;  3DQM A;  2VVI A;  4XVP A;  2H5P A;  5DPH A;  3UFZ A;  1Q4E A;  2G6X A;  1QYQ A;  3ST2 A;  5HZT A;  3O78 A;  3CBE A;  1RRX A;  2G3O A;  4P1Q A;  1F0B A;  4ZB1 A;  1RMP A;  1H6R A;  3VHT B;  1EMM A;  4LQT A;  4L1I A;  5EXC I;  4H48 A;  1YJF A;  3SSH A;  2Z1O A;  2ZO6 A;  1YHI A;  4N3D A;  2OJK A;  2B3P A;  2QLG B;  5DQB A;  3SVE A;  1Z1P A;  4W6C A;  2O2B A;  3E5T A;  4EDS A;  1W7T A;  3WCK A;  1ZGQ A;  3GL4 A;  3SG2 A;  2OGR A;  4OHS A;  1JC0 A;  3GB3 A;  3OSQ A;  3ST4 A;  4KGE A;  3NF0 A;  4GES B;  4HQ8 A;  3SS0 A;  2WSN A;  3SSV A;  4W76 A;  3U8A A;  1EMF A;  5HGE A;  4EN1 A;  4W6G A;  3W1C A;  3BXC A;  2IB6 A;  4Z4K A;  4ZIO A;  2GX0 A;  2YDZ A;  4ZF5 A;  2GW4 B;  5T3I A;  2A52 B;  4KF5 C;  3LF4 B;  2EMN A;  4W6U A;  3DQU A;  2QLH A;  2WHS A;  1XMZ A;  4W6H A;  3W1D A;  2IOV A;  3U0L A;  4L12 A;  3EVP A;  2QLE A;  5FVG A;  1HUY A;  2AWJ A;  4HE4 A;  1MOU A;  5EB6 A;  1EME A;  2AWL A;  5HZS A;  2FWQ A;  4W6A A;  3NEZ A;  3ZUL A;  4Q9W A;  2Z6Z A;  3SVS A;  4PFE A;  2VVH A;  4B30 B;  1KP5 A;  2AWM A;  2QU1 A;  2DDD A;  3PJB A;  4JRB A;  3EVR A;  4PPL A;  3DPW A;  3IR8 A;  3BX9 A;  2HGY A;  4KPI A;  4DKN A;  1KYR A;  2DD7 A;  5BTT A;  2PXW A;  2ICR A;  3VK1 A;  4Q7U A;  1JC1 A;  3CD9 A;  3ST0 A;  2C9I A;  4KW9 A;  2HJO A;  5H88 A;  5HZU A;  3VIC A;  3DQJ A;  3H1O A;  2P4M A;  2WHT A;  1KYP A;  3EK4 A;  5FHV A;  3DQC A;  3DQ7 A;  1BFP A;  1Q4D A;  3WLD A;  3E5W A;  4ZIN A;  1XA9 A;  3ST3 A;  3ED8 A;  1QY3 A;  4H3M A;  2V4E A;  2GW3 A;  3NT3 A;  4W74 A;  2A56 B;  3GJ2 A;  3SVD A;  4B5Y A;  4W7E A;  5EXB A;  5F9G A;  1YHH A;  3M22 A;  4R6D A;  4ZBL A;  3AI4 A;  2HRS A;  2WIS A;  4R6B A;  1KYS A;  3EVV A;  5DU0 A;  3LA1 A;  4W73 A;  4IK1 A;  5H87 A;  1GFL A;  3SG3 A;  1QYO A;  4GOB A;  5DY6 A;  4GF6 B;  3LVA A;  4W6B A;  1ZGO A;  4L13 A;  4XL5 A;  4LJD A;  2H9W A;  3NT9 A;  3DQK A;  3U8C A;  1S6Z A;  5FVI A;  2QRF A;  4NWS A;  1W7S A;  2DUE A;  1Q4A A;  3DPX A;  4DKM A;  4W6L A;  4XGY A;  5EJU A;  4W7A A;  5DRG A;  1MOV A;  2G5Z B;  3EKH A;  4DXQ A;  3LSA A;  3S05 A;  4W7D A;  3DQE A;  3U0K A;  5LTP A;  3DQL A;  3SVR A;  3OSR A;  3SG5 A;  3DQ2 A;  3EK7 A;  3SSP A;  1OXD A;  4W75 A;  3DQ8 A;  4KEX A;  5H89 A;  2HCG A;  4ORN A;  5AQB B;  4W7F A;  2VAE A;  5DPG A;  4PPJ A;  1JBZ A;  3RWT A;  1RM9 A;  3SV5 A;  1QXT A;  1YZW A;  3AI5 A;  4IZN A;  4JFG A;  4IK3 A;  2EMO A;  5HZO A;  2YE0 A;  3OGO A;  5EHU A;  1GGX A;  4IK4 A;  3LS3 A;  1ZUX A;  3DQN A;  1ZGP A;  4RYS A;  3VHT A;  5J2O A;  1QYF A;  3SVB A;  2ARL A;  1MYW A;  2EMD A;  3BXA A;  4OY4 A;  4DXM A;  2BTJ A;  4UTS A;  1RMO A;  1Q73 A;  2AH8 A;  2QLI A;  3SVC A;  2DUF A;  3U0M A;  1Q4C A;  1UIS A;  4HVF A;  2WHU A;  3P8U A;  5LK4 A;  4W6R A;  4J8A A;  4PPK A;  5DPI A;  2B3Q A;  2QLG A;  4J89 A;  2G16 B;  3SVU A;  5KTG A;  3SG6 A;  4H3N A;  4BDU A;  4W6S A;  5DTX A;  3PJ7 A;  4EUL A;  2WSO A;  5DPJ A;  5BT0 A;  2ZO7 A;  2PXS A;  4W6P A;  3EVU A;  5LTQ A;  2HQZ A;  1HCJ A;  3DQ4 A;  4ZFS A;  3E5V A;  1OXE A;  4TZG A;  2DUH A;  2H5R A;  3G9A A;  4LQU A;  2IE2 A;  4W6F A;  3DQ9 A;  1G7K A;  4AS8 A;  4Q9X A;  4RYW A;  3SSY A;  3DQ1 A;  4W6N A;  2O24 A;  4JGE A;  4W72 A;  2O29 A;  1EMB A;  3CD1 A;  4Q7T A;  2Q6P A;  2HGD A;  4XOV A;  2A50 B;  2A53 B;  5DRF A;  4U2V A;  3DQ5 A;  2RH7 A;  3CFF A;  4JF9 A;  2Y0G A;  1XQM A;  4H3L A;  1EML A;  2VAD A;  4XOW A;  5EB7 A;  2G3D B;  4W7C A;  3DQD A;  4W6J A;  3PJ5 A;  2HQK A;  3SG4 A;  4OJ0 A;  2IB5 A;  2DUI A;  4W6I A;  3BXB A;  3ZUF A;  2A54 B;  4KF4 A;  4B30 A;  4OGS A;  4KAG A;  2G2S B;  2HPW A;  2QT2 A;  1EMG A;  4KF5 A;  4DXO A;  4ZF4 A;  2VVJ A;  3H1R A;  3DPZ A;  1GL4 A;  4ZF3 A;  1Q4B A;  1RMM A;  3DQA A;  4W69 A;  1YJ2 A;  3TMR A;  3K1K A;  3V3D A;  3SSL A;  2OTB A;  4IK8 A;  2Q57 A;  2AWK A;  4KW4 A;  2H6V A;  4DXP A;  3ZUJ A;  5EBJ A;  4DXN A;  3PIB A;  3U8P A;  3GEX A;  2WIQ A;  3EKJ A;  1B9C A;  4LJB A;  2POX A;  4W7X A;  3UG0 A;  3A8S A;  4H47 A;  1C4F A;  3AKO A;  3M24 A;  2V4E C;  4W6M A;  4RTC A;  1XAE A;  3CGL A;  4HQ9 A;  3U0N A;  2A48 A;  3CFH A;  3SRY A;  2QZ0 A;  2Z6Y A;  4Z4M A;  3SSK A;  4ANJ A;  2H5Q A;  5BTT B;  5LTR A;  3KCT A;  2H8Q A;  1EMK A;  3MGF A;  1XSS A;  4W6K A;  4I2Y A;  2JAD A;  5DTZ A;  5FVF A;  1OXF A;  1YHG A;  4LJD C;  2AHA A;  4EDO A;  4W7R A;  4W6T A;  2FZU A;  2WUR A;  2ZMU A;  4AR7 A;  4EMQ A;  3EK8 A;  4J88 A;  3NED A;  5HW9 A;  3DQO A;  3TMT A;  2HFC A;  3IP2 A;  3LVC A;  4LJC A;  3WLC A;  2DUG A;  3O77 A;  1EMA A;  3SVO A;  4KW8 A;  1W7U A;  2V4E B;  2OTE A;  4P76 A;  4W77 A;  5HBD A;  1F09 A;  3ADF A;  3RWA A;  3ZTF A;  3LF3 A;  4W6D A;  4W6O A;  4IK9 A;  3DQH A;  2YFP A;  3LVD A; 
#chains in the Genus database with same CATH homology
 3SST A;  4HQC A;  2DDC A;  3DQF A;  2H5O A;  5DQM A;  2OKY A;  5DTY A;  3I19 A;  4JC2 A;  2FL1 A;  3GJ1 A;  1CV7 A;  2A46 A;  2G6Y A;  5DTL A;  3DQ3 A;  2Z6X A;  4KA9 A;  3KCS A;  1H4U A;  3P28 A;  1JBY A;  1EMC A;  3SVN A;  1YFP A;  3DQ6 A;  4IK5 A;  4Q7R A;  4KGF A;  5BQL A;  2GX2 A;  4JEO A;  2DD9 A;  3CFA A;  5EXU A;  4OQW A;  2YE1 A;  3CB9 A;  3SG7 A;  2C9J A;  4LW5 A;  4DXI A;  2VZX A;  1Z1Q A;  2A47 A;  3DQI A;  4TZA A;  2OKW A;  2G6E A;  2ZMW A;  3DQM A;  2VVI A;  4XVP A;  2H5P A;  5DPH A;  3UFZ A;  1Q4E A;  2G6X A;  1QYQ A;  3ST2 A;  5HZT A;  3O78 A;  3CBE A;  1RRX A;  2G3O A;  4P1Q A;  1F0B A;  4ZB1 A;  1RMP A;  1H6R A;  3VHT B;  1EMM A;  4LQT A;  4L1I A;  5EXC I;  4H48 A;  1YJF A;  3SSH A;  2Z1O A;  2ZO6 A;  1YHI A;  4N3D A;  2OJK A;  2B3P A;  2QLG B;  5DQB A;  3SVE A;  1Z1P A;  4W6C A;  2O2B A;  3E5T A;  4EDS A;  1W7T A;  3WCK A;  1ZGQ A;  3GL4 A;  3SG2 A;  2OGR A;  4OHS A;  1JC0 A;  3GB3 A;  3OSQ A;  3ST4 A;  4KGE A;  3NF0 A;  4GES B;  4HQ8 A;  3SS0 A;  2WSN A;  3SSV A;  4W76 A;  3U8A A;  1EMF A;  5HGE A;  4EN1 A;  4W6G A;  3W1C A;  3BXC A;  2IB6 A;  4Z4K A;  4ZIO A;  2GX0 A;  2YDZ A;  4ZF5 A;  2GW4 B;  5T3I A;  2A52 B;  4KF5 C;  3LF4 B;  2EMN A;  4W6U A;  3DQU A;  2QLH A;  2WHS A;  1XMZ A;  4W6H A;  3W1D A;  2IOV A;  3U0L A;  4L12 A;  3EVP A;  2QLE A;  5FVG A;  1HUY A;  2AWJ A;  4HE4 A;  1MOU A;  5EB6 A;  1EME A;  2AWL A;  5HZS A;  2FWQ A;  4W6A A;  3NEZ A;  3ZUL A;  4Q9W A;  2Z6Z A;  3SVS A;  4PFE A;  2VVH A;  4B30 B;  1KP5 A;  2AWM A;  2QU1 A;  2DDD A;  3PJB A;  4JRB A;  3EVR A;  4PPL A;  3DPW A;  3IR8 A;  3BX9 A;  2HGY A;  4KPI A;  4DKN A;  1KYR A;  2DD7 A;  5BTT A;  2PXW A;  2ICR A;  3VK1 A;  4Q7U A;  1JC1 A;  3CD9 A;  3ST0 A;  2C9I A;  4KW9 A;  2HJO A;  5H88 A;  5HZU A;  3VIC A;  3DQJ A;  3H1O A;  2P4M A;  2WHT A;  1KYP A;  3EK4 A;  5FHV A;  3DQC A;  3DQ7 A;  1BFP A;  1Q4D A;  3WLD A;  3E5W A;  4ZIN A;  1XA9 A;  3ST3 A;  3ED8 A;  1QY3 A;  4H3M A;  2V4E A;  2GW3 A;  3NT3 A;  4W74 A;  2A56 B;  3GJ2 A;  3SVD A;  4B5Y A;  4W7E A;  5EXB A;  5F9G A;  1YHH A;  3M22 A;  4R6D A;  4ZBL A;  3AI4 A;  2HRS A;  2WIS A;  4R6B A;  1KYS A;  3EVV A;  5DU0 A;  3LA1 A;  4W73 A;  4IK1 A;  5H87 A;  1GFL A;  3SG3 A;  1QYO A;  4GOB A;  5DY6 A;  4GF6 B;  3LVA A;  4W6B A;  1ZGO A;  4L13 A;  4XL5 A;  4LJD A;  2H9W A;  3NT9 A;  3DQK A;  3U8C A;  1S6Z A;  5FVI A;  2QRF A;  4NWS A;  1W7S A;  2DUE A;  1Q4A A;  3DPX A;  4DKM A;  4W6L A;  4XGY A;  5EJU A;  4W7A A;  5DRG A;  1MOV A;  2G5Z B;  3EKH A;  4DXQ A;  3LSA A;  3S05 A;  4W7D A;  3DQE A;  3U0K A;  5LTP A;  3DQL A;  3SVR A;  3OSR A;  3SG5 A;  3DQ2 A;  3EK7 A;  3SSP A;  1OXD A;  4W75 A;  3DQ8 A;  4KEX A;  5H89 A;  2HCG A;  4ORN A;  5AQB B;  4W7F A;  2VAE A;  5DPG A;  4PPJ A;  1JBZ A;  3RWT A;  1RM9 A;  3SV5 A;  1QXT A;  1YZW A;  3AI5 A;  4IZN A;  4JFG A;  4IK3 A;  2EMO A;  5HZO A;  2YE0 A;  3OGO A;  5EHU A;  1GGX A;  4IK4 A;  3LS3 A;  1ZUX A;  3DQN A;  1ZGP A;  4RYS A;  3VHT A;  5J2O A;  1QYF A;  3SVB A;  2ARL A;  1MYW A;  2EMD A;  3BXA A;  4OY4 A;  4DXM A;  2BTJ A;  4UTS A;  1RMO A;  1Q73 A;  2AH8 A;  2QLI A;  3SVC A;  2DUF A;  3U0M A;  1Q4C A;  1UIS A;  4HVF A;  2WHU A;  3P8U A;  5LK4 A;  4W6R A;  4J8A A;  4PPK A;  5DPI A;  2B3Q A;  2QLG A;  4J89 A;  2G16 B;  3SVU A;  5KTG A;  3SG6 A;  4H3N A;  4BDU A;  4W6S A;  5DTX A;  3PJ7 A;  4EUL A;  2WSO A;  5DPJ A;  5BT0 A;  2ZO7 A;  2PXS A;  4W6P A;  3EVU A;  5LTQ A;  2HQZ A;  1HCJ A;  3DQ4 A;  4ZFS A;  3E5V A;  1OXE A;  4TZG A;  2DUH A;  2H5R A;  3G9A A;  4LQU A;  2IE2 A;  4W6F A;  3DQ9 A;  1G7K A;  4AS8 A;  4Q9X A;  4RYW A;  3SSY A;  3DQ1 A;  4W6N A;  2O24 A;  4JGE A;  4W72 A;  2O29 A;  1EMB A;  3CD1 A;  4Q7T A;  2Q6P A;  2HGD A;  4XOV A;  2A50 B;  2A53 B;  5DRF A;  4U2V A;  3DQ5 A;  2RH7 A;  3CFF A;  4JF9 A;  2Y0G A;  1XQM A;  4H3L A;  1EML A;  2VAD A;  4XOW A;  5EB7 A;  2G3D B;  4W7C A;  3DQD A;  4W6J A;  3PJ5 A;  2HQK A;  3SG4 A;  4OJ0 A;  2IB5 A;  2DUI A;  4W6I A;  3BXB A;  3ZUF A;  2A54 B;  4KF4 A;  4B30 A;  4OGS A;  4KAG A;  2G2S B;  2HPW A;  2QT2 A;  1EMG A;  4KF5 A;  4DXO A;  4ZF4 A;  2VVJ A;  3H1R A;  3DPZ A;  1GL4 A;  4ZF3 A;  1Q4B A;  1RMM A;  3DQA A;  4W69 A;  1YJ2 A;  3TMR A;  3K1K A;  3V3D A;  3SSL A;  2OTB A;  4IK8 A;  2Q57 A;  2AWK A;  4KW4 A;  2H6V A;  4DXP A;  3ZUJ A;  5EBJ A;  4DXN A;  3PIB A;  3U8P A;  3GEX A;  2WIQ A;  3EKJ A;  1B9C A;  4LJB A;  2POX A;  4W7X A;  3UG0 A;  3A8S A;  4H47 A;  1C4F A;  3AKO A;  3M24 A;  2V4E C;  4W6M A;  4RTC A;  1XAE A;  3CGL A;  4HQ9 A;  3U0N A;  2A48 A;  3CFH A;  3SRY A;  2QZ0 A;  2Z6Y A;  4Z4M A;  3SSK A;  4ANJ A;  2H5Q A;  5BTT B;  5LTR A;  3KCT A;  2H8Q A;  1EMK A;  3MGF A;  1XSS A;  4W6K A;  4I2Y A;  2JAD A;  5DTZ A;  5FVF A;  1OXF A;  1YHG A;  4LJD C;  2AHA A;  4EDO A;  4W7R A;  4W6T A;  2FZU A;  2WUR A;  2ZMU A;  4AR7 A;  4EMQ A;  3EK8 A;  4J88 A;  3NED A;  5HW9 A;  3DQO A;  3TMT A;  2HFC A;  3IP2 A;  3LVC A;  4LJC A;  3WLC A;  2DUG A;  3O77 A;  1EMA A;  3SVO A;  4KW8 A;  1W7U A;  2V4E B;  2OTE A;  4P76 A;  4W77 A;  5HBD A;  1F09 A;  3ADF A;  3RWA A;  3ZTF A;  3LF3 A;  4W6D A;  4W6O A;  4IK9 A;  3DQH A;  2YFP A;  3LVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...