3KCXA

Factor inhibiting hif-1 alpha in complex with clioquinol
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human FIH-1 in complex with quinol family inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 102
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3kcxA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kcxA01
4AI8A 1H2MA 1H2KA 2XUMA 4B7EA 3P3PA 4BIOA 3KCYA 2W0XA 4Z2WA 2Y0IA 2CGNA 4Z1VA 2YDEA 2YC0A 1MZEA 2WA3A 5JWPA 3KCXA 2ILMA 3D8CA 4NR1A 1H2LA 3P3NA 2WA4A 3OD4A 4JAAA 1H2NA 1MZFA 4B7KA 1YCIA 4QU2A 1IZ3A 2CGOA
chains in the Genus database with same CATH superfamily
4AR2A 1U96A 4CS2A 1RUH3 3OT7A 3ZN6A 4IL7A 3LNMB 1YTFD 2WA3A 5KHGA 4F6RB 5I93A 4AQYO 3HAGA 5IVBA 1UFIA 1LNSA 2HWC3 2BOCC 2YBSA 2HWB1 4UT5A 1JUHA 1D0HA 2JENA 3BTAA 4QU1A 1N3QA 1NQJA 1X8MA 2Y0IA 1JYIA 3D3IA 2JKBA 1RUJ3 3UETA 3PIGA 1MNGA 2ORXA 3AMPA 5C3RA 4DO2A 3FB7C 3GWOA 2DFCA 1GU3A 2ZX0A 1RSOA 3N9NA 4N9HA 3LDBA 1RUI3 3WG2A 3HPNA 2DWRA 4ARXA 4MS2A 2JWPA 2VCBA 4FPCA 4JI6O 5EBMC 4ZZ5A 3ZLIA 2XL9A 2H0BA 5C4WC 3I2IA 2HWB2 1HLCA 3PUSA 3RYHB 3PMSA 4B29A 1OLME 2CTRA 2EXKA 3VBUC 3D3QA 3H50A 3JQXA 3SJAC 3RNSA 3UO3A 4QDRA 1ASJ1 4GIQA 3OTOO 3UYJA 1VQKV 2AACA 2ODMA 1OJHA 4P9WA 1CAXA 4MUVA 4GX0A 1DQ6A 1RL3A 4QM8A 1A8DA 1B04A 4JI1O 2QZ2A 5EC1C 1WNSA 1Z5VA 4PA3A 1S77D 1ZRIA 4DR3O 3MIGA 1FOD2 3MW2A 4DRXB 1P4RA 1CX4A 4GWIA 1FJGB 2OT7A 1GTOA 3ZYIB 4J7KA 1SQ4A 2CTQA 3WQBA 4BIZA 4QKDA 2WYFA 1V6OA 4XF3A 3POJA 2GMPA 2K9PA 5L3GA 2XJUA 4R9CA 1JJOA 4MGZE 3POGA 2EBOA 2FHRA 4JGZB 3WUDA 3IDCB 2OT5A 3ZSKA 1RUI1 3TB0A 4CUCA 4FPJA 3E6DA 4GB32 2HWF1 3OSDA 5FY8A 1QJX2 2WWUA 1VBA2 3I5DA 1PIV2 2HYXA 3WOGA 2JD9A 3BABA 2KA3A 3ORJA 2FDHA 4LBEC 3VBRB 3RVZA 1PK6B 1GK9A 1AILA 5LW9A 1PPJH 3UKNA 2VQEO 4AG4A 2UUAB 4DV3O 4LHKA 1FOD1 2DYCA 2PHRA 1AX2A 3KS7A 4UXAA 3D5OA 2UXNA 1SCSA 4CCKA 2ZOEB 2ZMLA 4EB6B 4BCUA 4UBGA 4TUYA 3I3MA 5LY2A 3RPQA 3CJHA 4OI1A 4RQPB 5A2QN 2R071 1FNYA 4B3TO 3CCLV 4FI9A 2YGMA 4HZ3A 1AYN3 4CCCA 3QBQA 3ZRSA 3RZMA 1GSLA 4XABA 1GWLA 3AXDA 3SGIA 4LF8B 3VDAA 4A44A 4YWAA 2QQPA 1VF7A 5GTHZ 5F2VO 1WZXA 2ZX2A 4R4XA 3VZMA 3ASNC 2YU2A 1W6PA 4ZOLA 4YGBA 5CFDB 3ME2A 3AG1C 2C9AA 1AR83 1UIJA 1W3VA 4OFGA 2XR4A 4OLLA 3AZXA 5IWFA 1FXKB 4NIGA 1DGSA 1X7NA 3ZEDA 2GZWA 1KQRA 3OBTA 5EFUA 3GCXA 4AYUA 4RR3C 4HBNA 2OIEA 1ZAUA 3JB8A 4MVTA 5EYPA 1FS0G 2DWDC 1ONAA 3BI3A 3LKJA 1QJX3 2ZGOA 1UN1A 1Z7S3 4K3AA 2EIGA 1EZJA 4QQ2A 4BZ4A 2BQPA 2BPA2 3PN1A 4YY3B 1R6NA 4H13B 1QXPA 1VB4A 3DPRA 1AJNA 2PY5A 1XI1A 5FYVA 2K46A 2XMLA 3I8TA 1Z7S1 1XHZA 1OCRC 2HBTA 3CS5A 4H55A 1LECA 3D6EA 4FO9A 2YXHA 3LA3A 2W1SA 3G80A 1CAWA 2X10A 4KH9A 3ZMTA 1VBD3 2R7EB 1K4DC 4XPVA 4Y24A 1VBB2 2E32A 1UYZA 1RMU1 4O7XA 1NA1B 5CAZA 4G4FA 3L9JT 3B9IA 3NKTA 1AI6A 5FYCA 1VF6A 1CPMA 2WPDG 3O0WA 5CKMA 4AEMA 3L9DA 1W2OA 4XDKA 2J1VA 4LR3A 5FUPA 5CYYA 4H33A 3N7KA 3ICXA 1OF4A 2JECA 4XJWA 2ITDC 3W59A 4DK0A 5DZFA 3V65A 3JD72 4XACA 1HB4A 1UX7A 4UCRA 1YLLA 3JAKA 1B09A 4CEWB 4ORFA 1QH7A 4OPAA 4GZRB 1HRI2 4E4DX 4QPGB 4MZUA 5LXTA 3KZ4C 3NKGA 5KAIZ 3KGLA 2FMLA 5DN6G 4UAPA 2O0OA 4LR4A 3CC7V 2FDIA 3I54A 5L9RA 2VU9A 2GALA 4M00A 1YHFA 2W52A 1SBEA 2OIIA 4WBNA 1RUF2 3EXUA 3FHIB 2NMOA 4J10A 2AZ0A 2XDVA 1UZZA 4QQHA 2Y6GA 1Q7YW 4XAEA 1OFNA 3W5MA 1LOAA 3RFRA 4Q4V3 3TAYA 5EBWC 3O1PA 1MOFA 2A3XA 5T54A 1US6A 2IZWA 2DYSB 4J1XA 4UFHA 2P3JA 3HR9A 2ZACA 1H1IA 1ULGA 4FOYA 3ZCCA 1FJGO 1J58A 3OM3B 1KBHA 2QQMA 4CCLA 1R3LC 5DAPA 3W20A 1GR3A 3BEHA 5A3NA 5FMOL 4DV4O 2HWF3 5CNAA 1HJGA 2WAOA 4YVWB 4LF9O 1YQ6A 3ZR5A 3ZYRA 4LF4B 3O9OA 4DNYA 4C8DA 4LITA 1EPWA 1D4VB 4IV3A 2PI4A 4YW6A 1RUC1 2Q1ZB 4IUGA 4W6XA 4K6BA 5FZMA 2BFUS 4R8HA 4JGSA 5HPOA 2VQUA 2AXTZ 4AE2A 1UY2A 2PZSA 1DTOA 4CPBA 1S5JA 2B9ZA 4H7LA 1DBNA 3AFGA 1XE0A 1LODA 4PELA 4B3SB 1PHMA 5C9AC 4UFZA 5EIBD 4JI2O 4R50A 2RDSA 1KP3A 3QO8A 4KGGA 4FFBB 4FLYA 4TZDA 5EWSA 3H1MA 4JZ2A 1AP5A 3HWJA 3C2UA 4PDLA 5IYBO 5FPOA 3MIFA 1NAEA 2IVIB 3BN6A 2L9LA 1NCRC 2XAQA 1Q8SA 4X89A 1MPXA 2UUAO 3KKYA 4GKJB 4AEKA 2HH9A 3WNXA 1BT8A 1H2LA 1MS0A 2B42B 1GLHA 3TJTA 1CN1A 1T2XA 3KV5A 4Z82A 2IJKA 3P32A 3DC5A 2WZ8A 2G19A 5IJ9A 1OMIA 1M06G 1QHTA 2ETNA 3UGGA 1TUBB 1GQHA 1P84F 4LF8O 4GLXA 1PIV1 3TXQA 4FOVA 4IEZA 4KWUA 1ODMA 3CL1A 1KITA 3B7MA 1KC8W 3RBZA 4QDSA 4HKWA 1KEXA 5FLHA 2GTSA 5CBHA 1YJLA 2QQOA 4O2AA 4F3JA 1AXKA 1R092 2P6JA 4UUJC 3ASIA 4B4QA 3FBYA 2D2CB 2HWD1 5JOZA 4CXXA 2UURA 1O9GA 1U5ZA 2AR6A 4E2GA 4BMBA 3ABUA 1EUTA 4XILA 4KU7A 1XXNA 1F7YA 1QJY2 2A6VA 5LBCA 3QVNA 3WDWA 3OD4A 5KX5A 1CIYA 2CE4A 4QXBA 4V2WA 3DSQA 5F39A 1SZXA 1BEV3 5A3WA 2B5HA 3WNLA 4Y1VA 2FDGA 1O5LA 5LXTB 4DV4B 1BHAA 2Y4TA 5CA1A 5LL6Y 5F3EA 2JDPA 2P06A 3T1HB 1PNMA 3FKSG 2P3IA 4HSJA 4EEQA 1RUF3 3L74H 1C8NA 4A7ZA 2G9ZA 2DTYA 2OCCC 1DK1A 4CDXC 2WNVC 4XFCA 2Q8CA 5FYUA 2AENA 1M56B 1PMIA 4NAMA 2R9AA 2KQXA 1GQPA 1NQDA 1IQDC 1VBD1 3IDEA 3I49A 5EP9A 3QNEA 1AYN1 1YQCA 3FYEB 3VGIA 4NPRA 3MIEA 2RS11 3WNOA 1SKVA 2ET7A 1ZZ6A 3ZN5A 3DN7A 1H4GA 1W0JG 1URXA 2ZHMA 1S5LZ 2G9GA 5BNPA 1V9PA 1OHHG 3OYWA 2UU9B 4IYHA 1UW8A 2CV6A 1BE3H 1QLEB 1D4M3 2Z4FA 1NVPB 1W6QB 2JKXA 2B5UA 5EK0A 4A2UA 4UYBA 1O59A 4UW3A 2EVXA 5F8PA 2P3KA 3LGRA 3BAAA 2E9QA 4U7OA 3CCSV 4S2HA 1ZZ7A 3DL3A 5CEHA 5LYJB 2BFUL 5F9TA 2AZ5A 1N1YA 1HNXB 1Y3TA 1BQZA 4NO4A 2IXIA 3WDUA 1AYN2 1VQPV 1IURA 1L7QA 3NAPB 3OAAG 1MA1A 5IFPA 2PAKA 4BW9A 2CGPA 1RXGA 1NZIA 2RMU2 2GN3A 1BGYH 5LA0A 1QNMA 4BLIA 1Z5WA 1F9KA 3LPFA 4KWJA 1SG3A 3JD71 2VGDA 1E1RG 4PDWC 5AVAA 1SBDA 1Q8PA 1IOAA 3KHCA 1RHI2 3RWKX 5M0TA 3MLJA 3WP4A 2X6BA 4BIUA 5HXMA 1LNQA 2ZGKA 3UJOA 4GMP1 1S2KA 4K3UA 4CCNA 4MW8A 3M3QA 4ZPIA 4MVSA 3CCJV 3SH5A 4OHVA 3A0NA 3AK3A 3VBOC 3MW3A 5FO9B 3ON7A 3WUCA 3IM0A 1VBA3 3HT1A 4YZ4A 1NCQA 4YW4A 1F4MA 1VMFA 5LRRA 4RUFA 1K45A 3VDCA 5BNQA 5B1AB 1X36A 4MXWA 2WLQA 3WF2A 1W6OB 2UYBA 1Y9GA 3WNKA 4W4ZA 3OJBA 2P5OA 2CSGA 4K8FA 4IEQA 3TN92 4LFBO 3WNPA 2VNVA 4AGVA 2ZM6B 1MS4A 1XNTA 2JIZG 1XMQB 4P9JA 3E8HA 1E5IA 1IBKO 2DW4A 4B3TB 1IG3A 1RMU2 3FN9A 5LA9A 2QVSB 1S0FA 4I5SA 5KX5B 3VBRA 1BJQA 5DUUA 3HMYA 2GUZA 2RG4A 5A7SA 2QQIA 4BB3A 1W8TA 3LFMA 1BZKA 3HKCB 2OTJV 4QB6A 2QM4A 3E6BA 4CEYA 3CP1A 1W04A 2AEZA 1RUC2 4P9IA 4GH4C 3CCMV 1WLTA 3HR0A 1O91A 2QDNA 2ZHLA 2D3RA 2IXCA 5FY0A 2QCSB 1SPPB 3OE7G 3W7TA 1HIXA 3V64A 2E75B 1SFPA 4I50A 2RS33 2WO2A 2RS32 5J2TA 1SA0A 2UY8A 3ETDA 1QJEA 2WLMA 2DYRC 3ABTA 3CJXA 5B3SB 1XU2A 3OPZA 5B1BB 1BS3A 3N9PA 4K0KB 2DN9A 1LESA 4HK9A 1B06A 3TGUH 4YVSC 1S0VA 1M5IA 4AVSA 4O2BB 1QGLA 3FB5C 5CA0B 1RUI2 3GVMA 3AL6A 1O9HA 4FFHA 4DR5O 1IS3A 2HHHO 2R042 2R9IA 2B9UA 1W8HA 2BDRA 3N7MA 4GT1A 3ZFFB 2RS53 3N9MA 5ITZA 1UKRA 4ISRA 1QOTA 3SNMA 2XNDG 2CAVA 2JEMA 3J8F1 4LA3A 2ZAHA 2V4DA 4Q4Y3 4FFBA 3E8BA 1VRBA 3D82A 3HN3A 4GWJA 4WVVA 5BY5A 5DG1A 3T2MA 1OCRB 4OMCA 5KLVH 2BWCA 1SLIA 4YRDA 3G71V 2JD4A 2CAZC 3E22A 3GZEA 2MPFA 4FFGA 1WWYA 3BIWE 5FPLA 3WCSA 2JEUA 4AI1A 4RA0A 1BMFG 2A73B 3I4IA 1IBMB 2DVDA 2TUNA 1LOBA 3BB6A 2L35A 2E5LB 4Y5SA 4YZ1A 3M3CA 4Z2WA 4JI7O 2N7GA 5FAXA 2G38A 4Y3OA 3SJBC 1GN2A 1TVGA 4NRPA 4NIAA 3ZM8A 5KXEA 1HXS3 3ACFA 4B4RA 2D40A 1DQ2A 4L99A 5JVDA 1FAFA 4P9PA 3ZIWA 4AFBA 2V7QG 1F23A 2CYFA 1XYNA 1K9MW 1XOUA 3CJIC 4NTYA 3RWRD 4QM9A 4DUYB 1CPNA 3I2DA 4K1YA 4LUMA 3NNGA 2NPIA 3H8RA 2SBAA 1N1SA 5IHRA 5IYCO 4A5UB 5J1XA 5T52A 4OI0A 4NXNO 5TISZ 5J2TB 2GNTA 1FXHA 5J36A 2AHZA 3R0RA 4BQ5A 1AR62 5EYYA 1V70A 4DW0A 4ET7A 2XHBA 1R1A3 4FP3A 1KXGA 5GKAC 3K4DA 2V73A 1PGW2 1OOPB 1PZ8A 3VBFC 4OGQB 3HD8B 1MQTC 1RUE3 3O5SA 5K0UC 4D94A 1RIRA 1AR73 3G67A 3ILNA 2XPJA 4R52A 3WG7C 2BEOA 3DEMA 3FX7A 2HHHB 3HBZA 3AC0A 3QD6A 2QR4A 3OUIA 5GTIZ 3O1VA 1Z78A 1VBB1 4XF9A 4Z1MG 4HKOA 2BTQA 4XHXA 3IFXA 1LOGA 4P08A 2W1QA 3OBRA 4CCEA 4M01A 4HNAA 4QXKA 1SDWA 2J22A 3K75B 1V00A 3G6BA 5HI0A 2MNGA 4OQ8A 2D6OX 5GLWA 4N43A 3AG2B 2FMDA 4MGQA 1R3JC 3X2QB 3W9AA 4AFMA 2VTXA 1CPYA 3R4DB 1YNAA 4LE4A 1QJU3 2KR2A 5CBFA 5F5IA 5IT6A 1WP8A 5CVRA 3ZIAG 4DR6O 4LF7B 3CXCU 3DV8A 2ZX1A 3PVEA 4TYSA 3S0MA 2N74A 4XJZA 3BOWA 1I1EA 2NN8A 4DV2O 2ZM6O 2WWJA 2ZBJA 4R6ZA 1WLEA 2LP7A 3MF6A 2FYUH 1GP6A 1HRI1 5JDBA 4FFFA 1E5SA 4H7MA 3H42B 4Y1ZA 2VZUA 1L7LA 4QB1A 4FCAA 4UVCA 1B35A 2OS2A 5BUVA 3TWIA 1W2AX 1RUE1 1AR72 2JB4A 2XKOA 4A45A 3PJSK 1JA8A 4P9GA 2WQ8A 3I3EA 4EJRA 4CH3A 1JOPA 1EFRG 3I3BA 3PNAA 3I2FA 4CDWB 4OI4A 2EJ7A 2F4LA 3WY6A 3NAPA 5KUKA 3IMMA 1NKDA 3FC0A 2Q7HA 1JOJA 4GZ9A 4M3CE 1YFYA 4QIWF 2R49A 3BYWA 1PVC2 4AFAA 5JZGA 3F2ZA 2RHPA 3A7QA 4DY5A 5HFLA 1OCOC 4YVSB 1R093 4OMDA 1EN6A 1GM9A 2Z42A 1NXD1 5BNOA 1RHI3 1QNWA 1HXS1 3KWVA 5J98B 1KD7A 4J25A 4ZI7B 1Q81W 1GZTA 4BWAA 4IV3B 1K7DA 1RUE2 1APNA 1YXWA 4DV6O 3CRAA 4JDOA 1WA8B 3ZXEA 1DCSA 1OV9A 1ULOA 4EFBA 4DUVA 1R6TA 1PVC1 2SLIA 5FZDA 4TUYB 2HWE1 3PURA 1K33A 3ES1A 3UGHA 2JEXA 2UXDO 4CP9B 3I3QA 1XSQA 5A1AA 1L1FA 3F7VC 3M2MA 4M4PA 2OUHA 1XDCA 4TSFG 2BBAA 4N90A 3T1CA 4AVVA 4K20A 1YJWV 1CIWA 3D0JA 3SCGA 3GB7C 4K8XA 3POWA 3PUAA 1UO9A 4Q1RA 5ISLA 2LALA 1AVBA 2EZPA 1HQWA 2H8PC 1W9TA 3O12A 3CEIA 2YI8A 2XXZA 5KA5A 3AG4C 3T0BA 1CAVB 3ZFGC 3N2GB 4H2AA 1OPMA 5FQ0B 5ABJA 1CZVA 1A32A 2JDKA 1CJPA 4WBNB 1OOPA 4EZHA 3RZGA 2ZDIC 4YIPA 2JDMA 4LH7A 4OULA 4BPZA 5B2GB 2YICA 3T0DA 3ZFEC 1QXRA 4X8AA 1ZBA2 4BXSV 2B46X 1S3JA 3Q8BA 5IVJA 4BAYA 4U3FH 1XJAA 4TN7A 3CZUA 2ZE8A 1RUH2 5FOJB 4PDMA 5FYYA 4XQ4A 1IDSA 4YJ3A 1OKQA 2HWC1 4AW7A 2JG9A 1FI2A 2LW1A 4TV9B 3SEEA 2VMDA 1TUEB 4K35A 3CWBH 3H01A 4YXWG 4IIJB 3B2EE 4RS5B 4PA7A 3N35A 2EILB 5GONB 2ZE7A 4TTGA 1MEC2 3QO7A 4PDWB 1IBLB 1HNWB 4IE0A 2JVDA 5HCFA 2ZNJA 4YJ2B 2VWJA 3A0KA 3K4AA 1H6YA 2WNUC 1G4YB 4GUNA 1ALYA 5H5NA 5JH7B 2RS52 4XBFA 2XVKA 3JQWA 3ZHTA 4BIOA 4A4AA 3PUHA 4GWNA 1J3QA 2C1FA 1SEFA 1F5FA 1UKGA 3NR7A 1UY1A 4NPMA 1VQ4V 2GSYA 1S0IA 1RTVA 3OPWA 1HP8A 1SMVA 4D7TA 2Z79A 3ILRA 2R062 3ABKB 1M4WA 4YG3A 2V4VA 2ES3A 2H3OA 4WFBV 3P6BA 3WP5A 1H2NA 3LOIA 2GDFA 1LRHA 3CCRV 1D4M1 2QE7G 2Q7EA 1XYPA 4ZKTB 2F6BA 4XIOA 2R72A 3U14A 3L71H 4MTOA 3ZSMA 2P4KA 4XJ8A 2UXBB 4ZONA 1V6LA 5L19A 4LF6B 4LF4O 5EJ3A 5FYZA 1W3XA 1FYJA 2ZQMA 4BU2A 5IUQA 4PA9A 1M56C 1WCQA 4Y5Z0 3LDEA 1QQP2 3ZSLA 5D21A 3N2KA 4DIQA 3AG7A 4ASUG 2W3JA 3URFA 4Y33A 1Y4MA 2ZKNA 4ZKIA 5I0SA 4PCRA 3H3UA 1KFXL 4M0HA 2HWB3 1Q5OA 5L73A 1J5EB 3I59B 3USUB 4I9WA 1ENVA 2X8KA 3ZX7A 1TE1B 1JYWA 2OPKA 4LCUC 3AKPA 2BP6A 1DU3D 1N0JA 5E1RA 4FPOB 3NNLA 3V0AA 1W28A 4OUSA 2JGDA 3EB7A 4COUA 2OYZA 4A6OA 4GX2A 5FREA 2FCVA 1VJ2A 2ZHNA 3CCEV 1RC6A 2JS5A 3V0AB 2AUYA 4UW5A 4Z8BA 2P3YA 2JG8A 2VW0A 4KWKA 3HIFA 4IEYA 5D8AB 3JAKB 4UVBA 1K5MB 3POFA 4D6SA 3CRQA 4GMP0 3ZFEB 5LGUA 3BU0A 3I59A 3K03A 3K58A 3TEYA 4IEPA 2VNRA 3CMGA 1UYYA 3MPPG 1W0OA 4WM8B 5AFBA 2DWEC 1VBC1 1FYUA 4UCUA 2VMHA 1C8M2 4Q4X3 4NTXA 3AG4B 1AX1A 4G27B 3ZXAC 1NE4A 3E8GA 4H37A 1J3RA 3K3OA 4OQ9A 1W0NA 3WZ1A 4X62B 2DURA 2CAUA 2RS13 3GZUC 5GLZA 5FZ4A 3R4UA 3B4SA 3T4HB 4COWA 4E2QA 2HP8A 1RM1B 1KJLA 1K5SA 2LGWA 3L2HA 1HRI3 1BBT1 5KWRA 5D2AA 4M0NA 3D0SA 3WG1A 4Q8LA 4KHPO 4AHZA 1TQ5A 1EM1A 2JJ2G 1JUIA 1I3HA 5IJRA 3U11A 5IW0A 3WW2A 3DC6A 4MSWC 2VOVA 3H1WA 3AP5A 5C6CA 3DPRB 5FBJA 4IHJA 1XBFA 2J1AA 4QPYA 3SYCA 1K3IA 2CTVA 4WM7B 1OCZC 4UW6A 1X82A 3DXUA 2OYQA 5DDJ3 3CU7A 2PFWA 1HN0A 4LA2A 1JPXA 5G04L 2PQSA 5LMNB 1VBE2 2XBO2 1YHQV 4DK1A 5FO8B 3ZYBA 1L7RA 1PGSA 1FOD3 1EAH1 1US3A 4GAZA 4Q2FA 1ULEA 3C7HA 4S2DA 3NL1A 2J1EA 1ZZBA 3VHNA 2Q68A 5IYZA 3H9VA 2HG5C 3B3QE 2CK3G 1HNZB 1HJFA 3AXEA 4ASMB 3SXWA 2F17A 4BQ1A 4KBZA 1SLTA 2BOBC 4J7JA 1BXHA 5FZ1A 4AVTA 1EN4A 3ZMUA 4CBCA 3ETQA 1DF0A 5I0DA 4UB8Z 4I30A 5FP4A 3NNFA 3ZO0B 4AQSA 2FCUA 3GHMA 5BR8O 2DF7A 4J6GA 1Q8QA 1XNKA 2ARXA 4FLVA 3IN9A 5FY5A 3U1XA 3CNAA 4XDOA 2VQFO 3OPTA 5GONA 1Y74B 3X29B 2YDEA 1MZEA 1UF2C 3S7IA 3JATA 2XBO1 2GNMA 5CU1A 1JYVA 3KQRA 5F6LB 3AG3B 5J48A 5FYIA 4MGYE 2A6YA 3RWNA 1VIWB 4X6RB 4OPHA 2RR13 4RGKA 4YJ3B 3EMRA 2HEWF 4QAWA 2Q6AA 4XMAA 1GP5A 4I50B 2CH7A 3VD5A 1JYXA 4UF0B 5LB6A 3SCFA 1F2NA 2YGLA 1AP6A 1SZTA 4AFDA 4Y5TA 3VB9A 4FTSA 1P7GA 4HETA 3U37A 2ERFA 4X8NA 4NXMB 2Q5ZA 4JI4B 1B6QA 2VZRA 4YFWA 4CDQA 4B3SO 1GRJA 1DQ5A 3IMNA 4N53C 3AK1A 1DGLA 3CIHA 4X88A 4XZPA 1QQCA 1UJWB 1ND3C 1X9TA 2EXHA 1GNYA 3N9OA 2C0ZA 4AEDA 3ABLB 1ENRA 1XQNA 1GFF2 1YWKA 1WLWA 2LFSA 4DUZB 2A06H 1WCKA 1BCXA 5FV3A 5EJ1B 3U0ZA 1CQ9A 5K0UB 4ES8A 2O1QA 4CYDA 1CP9A 3DTUB 4AQ2A 4NRQA 2AYHA 1H8TC 3H3ZA 4HL0A 1LB2A 1VBA1 5J09A 4GJZA 1OA2A 3GJAA 2WKKA 4LWSB 2JX9A 2OXBA 5EXOA 2HJFC 2QE3A 4IEXA 3VQVA 5H9RA 5IJ9B 2WNEA 3MHSC 3ZMNA 2ITCC 3KF5A 4O9EA 1VMGA 2IJJA 1GNHA 2ZEWA 2HYKA 2P7TC 5CKNA 4JAUA 2VO5A 3WLUA 5FZOA 1XOYA 5FZ9A 3CHXA 3AJZA 3K59A 1XRUA 1W03A 1UYXA 5CFCC 3KT7A 4IV1A 3RDIA 1UAIA 1GANA 5H6QA 3JU9A 3AX4A 2QKAA 5IYZB 5I8YA 3CRCA 3JD73 3B8MA 4MSVA 5CFCB 1ND2A 2ZCWA 4QGMA 5AC93 4BK5A 3JD3A 4ZHQA 4HAMA 4HPKB 4Y1UA 1XMQO 1TVKA 5LHGA 4NHMA 3B94A 1QDCA 1WMDA 4PF5A 4CRQA 5E88A 3IB3A 2J1TA 4TQDA 4QHZA 1GYKA 2R061 2QNKA 1ZBE2 4GB31 1AR93 4PBOA 4RQPC 3WDTA 3OEBA 3MIBA 1UY0A 2JB8A 5IY5C 1HV1A 4PIXA 3WF1A 2A71A 1JW6A 3UCSC 1ZRRA 4RS5A 5CISA 4PLNA 1VQLV 4KNCA 5TSWA 5BNPB 3AYCA 3MDPA 1UMIA 1M57B 4XYXA 5BNNB 2ZNIA 4YGCA 5L7OB 4TV9A 4RGGA 1XE7A 4N8MA 4ZY9A 3SMHA 1AI5A 5EHDA 2JDAA 2VMEA 1BQ0A 4FVVA 3NJVA 5FZAA 4EKWA 5JSOA 3PVNA 1ND3B 1W0PA 5HCHA 5FK7A 1AR4A 1TEIA 4I3GA 5C8YA 5E8AA 1V0AA 1S4CA 3LIGA 4JI0B 5C5TA 2VW2A 4QPGA 4UVAA 1AL23 3NJXA 4PBPA 4JGZC 4PJ0Z 1W9SA 4DR7O 2BTVC 2GH2A 2GC3A 1GAXA 1ZNPA 1LUVA 1UOGA 4AGRA 4XC9A 4W8JA 2Y6KA 4UCSA 3AKQA 3HT2A 2EICA 3LSQA 2WWSA 4SBVA 1WN7A 3VZKA 5C8WA 1DYPA 1ULFA 1WP7A 5JMCA 2RJZA 5IAVA 3S3WA 1Y67A 2CTPA 1K5JA 3UKVA 5FOBB 2QDRA 3G6JB 4Y22A 4MLOA 2WZR2 3FHAA 4CU8A 1ZZ9A 2EF6A 1AXYA 2K0GA 3J9SA 1ASJ3 1UXZA 4FZ0A 3R05A 1IBMO 5F6KA 1IHMA 4LFCB 2Y6FA 1NOVA 4X8PA 1VMJA 3C7OA 2GC0A 4DV6B 4QPIA 3SITA 4Y20A 1OLMA 3DGEA 4AXOA 4TT3G 3IKWA 2YXSA 3FHQA 4U7NA 2F93B 5LA2A 3ZPYA 3PUIA 3FLTA 3H3LA 3NVCA 4TQFA 5FYBA 1D2DA 4YLZA 4COYA 1MS8A 5FDBA 1VQMV 2Q8VA 4WCEV 5L3CA 3BIEA 3K08A 2OTLV 3H1LH 2AW9A 5FBZA 2DCTA 3EJKA 5LCWL 3B01A 1QXJA 1REFA 1WJZA 1BQPA 2P6HA 1H1AA 5FKBA 2RM23 4UFKA 3EBRA 3ZN0A 3T1HO 1UMZA 4YM2A 4XFAA 4WM7C 4Y4RA 2X5IA 2UXCB 2WS92 3VZOA 2WO3A 1QLNA 4P5YA 4LOTA 2IXLA 4JI5O 4XEZA 4COZA 3QG5A 2GC1A 5CFDA 4BYYA 2XLFA 3RYIA 4O61A 5A3UA 3ZYHA 3NWKA 3WNMA 1MSDA 1S76D 1RM1C 5EPAA 5A1LA 3ETEA 4LQRA 1GH6A 1GZCA 1I5PA 2WLKA 3ZVXA 4I9QA 3I55V 1NR1A 2EA7A 4CZSA 2ZEZA 4OHZA 4MW3A 4GKXA 2J42A 1BZWA 2Z69A 1OUXA 1IZ3A 1NS1A 4LF7O 3ZKYA 4Q27A 4UBHA 4GJYA 1DF5A 3PL0A 1PNKA 4LP8A 2P90A 3FLPA 5KXDA 4EN0A 4Q0QA 4K0KO 3VKMA 5KC5A 4AQTA 4FSJA 3CJHB 4JVAA 3BRCA 5CKQA 5LEJA 1W6MA 2BJSA 3T2PA 1REEA 4AI8A 2LROA 3JUUA 3POYA 3P3PA 3FBMA 2ADDA 1K5MC 3WG3A 1AL21 4Z1VA 4G9SB 4JTAB 3B8NA 2EIMB 4U36A 5HCBA 1PM7A 3NJYA 4XFFA 5LA6B 4F6EA 4KXRA 4RGAA 4J80A 1ZREA 1UPIA 4QPJA 4CU6A 1HNZO 2ZKOA 3OY8B 1AR92 5E1AC 1BYHA 2VOKA 5IT9N 2E53A 1PL0A 3IC7A 4ITCA 4JKMA 5FLIA 1NH2D 1GZWA 1KB9F 5T3NA 2X05A 2VMIA 1SQPH 1PO23 3CRRA 3TEZA 1KGYA 4NTWA 5DUVA 2ET1A 3ZIXA 1NCQC 4YW7A 3BVCA 2YC0A 1VQ7V 3RQ0A 2ILMA 1PD3A 2BV4A 4EV0A 5LATA 1L0NH 4XJUA 3HKDB 4KHPB 4WZCA 5FXVA 2WZPP 3RVHA 3BALA 2XTAA 5KMGB 1SRYA 5JXHA 1RVF3 2OVUA 4MXWB 4JI5B 1V54C 5CG8A 1CAVA 1P49A 4AFCA 4DV5B 1WD3A 3IPVA 1V55C 3MLLA 5D5PA 2DFBA 4RQFA 1NLSA 2ZIMA 2VQ0A 1IX9A 3T4VA 3ZHQA 2P22C 3BPZA 3FE5A 4PHZA 1G86A 1WCDJ 1JYCA 4OX9B 2P34A 1W6MB 5FZFA 3VBSA 2Q5TA 5F2WA 2R32A 2X53S 2DMXA 4Z92B 3M8AA 1WA8A 2E26A 1Q8IA 3OUFA 1GOFA 1M9NA 3KG2A 5FP8A 2ZINA 4DR2O 3RYCA 1NI8A 1ZZ8A 1E1QG 2WDBA 4GD4A 4BA6A 2OX0A 5K9YA 2R70A 4ARYA 1YEWA 3FJSA 4JASA 2UU8A 4KU8A 1X59A 1UZ0A 4I01A 1Z2GA 1JZ6A 1MS5A 1O4ZA 2EIJB 4XQDA 1KD1W 2PTMA 1C5IA 2CDPA 3D36C 3BFRA 3IAYA 3AVSA 3RYIB 1CAUB 4BQ2A 2ZE5A 1PGL1 4W4KA 5LYJA 3WW4A 1WMXA 2MEV3 4RYDA 4LBQB 2PHLA 2PLV1 2DVFA 5J3UA 4XZUG 3NNJA 4KQ7A 2PUSA 1FMD2 5E16A 5FYMA 3B09A 1RGSA 1YDXA 1AR71 2UUCB 3DYOA 4JC1A 3T0AA 1FFXB 1BBT2 4JZRA 5LRSA 1SQVH 4RHV1 2PF4E 3FWEA 3STZC 1VRH1 4NUBA 3TNQA 1W2UA 2Q0OC 3QH6A 1MACA 4QKFA 2WLJA 4ZZ8A 4X62O 5C4WA 4QE9A 1I6XA 1YO8A 2XAFA 3LE0A 3CRMA 4AQYB 2YXYA 3ABMC 4H44B 1COV3 3FAVA 2FDJA 4ZS2A 4EE2A 1A6CA 1OCCB 3NV2A 2J1RA 5F7UA 1HXS2 5J96B 1XUQA 2YPJA 1GKFA 1RUNA 5D8AA 4NMIA 2GUZB 3SYPA 2M6YA 1ZYBA 1Q6IA 1DGRA 1UWWA 5CA1B 3CC2V 2RS12 4BIFA 2Q4PA 3MBWA 3IDBB 4GKYA 3TXSA 4W65A 4A42A 2QJ1A 4RO2A 3WB2A 3K5MA 1MZ6A 4AZZA 3HVDA 3AK0A 4Q1PA 1KKCA 3FZ3A 4PT6A 1X4TA 3POSA 3ZXJA 1I5XA 5DZGA 3EO6A 1VBE3 3K57A 4DPNA 1LHUA 3RZJA 1LGCA 5C3OA 2FCTA 3J80N 2A79B 4EFEA 2B1IA 1W05A 5T5PA 4K21A 2WFF2 4FZ1A 4GMP3 1U5XA 3UT0A 1VLNA 1F4HA 4OUMA 4JGYA 2IC1A 3OGSA 2WWWA 3M8LA 2H94A 3NMBA 1XU1A 5FTTC 3R66A 2VW1A 1BMV2 3QLQA 2LW8A 5JR2A 1U0AA 5DAWA 2YC2A 5C8CC 3DYPA 3C3TA 1RPRA 3K46A 3GZTB 5DAXA 3LDRA 1OCOB 3JB4C 2EIMC 3J81N 2QSAA 1PIV3 5F3GA 4BHPA 1YIFA 4Q0VA 4LHLA 2PHFA 4IEOA 1OD5A 3VDDC 3C7FA 2RDQA 2VBBA 3I2HA 3WXPA 2HKXA 1UY3A 1P8JA 4CS4A 2W68A 3EXAA 2C26A 4E4SA 2NZ9A 4H14A 4QXHA 5G05L 3NV4A 2A75A 4E2LA 1UPGA 2A7AA 2MEV1 1ZZCA 3C3VA 5FFOC 1V9U2 4XCBA 4AI9A 3POIA 1VBB3 5FWJA 3LWCA 4FM2A 4AI2A 5A3TA 3E22B 4GCZA 3KQ4B 3O1SA 4BMEA 4UCOA 3RYCB 5LHIA 4JKKA 3ZHSA 4XF4A 1WLCA 3SH3A 2Y0OA 4RR3B 4FLXA 4AHYA 2VY0A 2LQTA 3K3NA 2WLIB 5CBGA 4AHWA 2KD7A 2RS51 1OD3A 1JQ0A 3A4UA 1WMFA 3K9AA 4D7YA 1A3KA 2E76B 3X2QC 4YW1A 3CX5F 1AI7A 4XUOA 3IT8A 5DEDA 2GAUA 3AKSA 5JIAA 2HEPA 5A70A 3WHUA 5FPUA 2BYVE 5JOWA 1WW5A 3LPGA 3RN4A 5DECA 1TME2 1RUOA 2EXIA 1C1FA 1B3QA 1FPN1 5CA0A 3S7EA 1F4NA 1VQNV 3PDQA 4KGQA 4CSWA 1UU5A 4JTDB 3CCUV 1T6BX 2VNOA 5HBAA 1MS3A 4ASLA 1NY71 4LT5A 5BNOC 4U3JB 1FPN3 5JXJA 5F3IA 4Q0UA 1LGBA 2E7AA 2HWD3 4WBBA 3WSOA 3VBHC 4LFAO 5JXIA 2H6BA 4LO5B 1ZRDA 2XJRA 2RN9A 2UXCO 2RS31 4CDUB 5FPRA 1G8WA 5FZ6A 4LK7A 1TME3 2WA4A 4AEDB 4O4HB 3M3EA 2OW4A 2WSSG 5FZ0A 1KKDA 1YXBA 3HKCA 3MYXA 2F43G 5C71A 4CCOA 3HKBB 4DEQA 4F83A 1AYM2 3HB3B 1S0DA 2RM21 1Q56A 1HQNA 2Y4UA 1YFXA 2WC2A 4HVRA 4C7UA 5H6RA 1DZRA 3W7WA 3UQ8A 3E97A 1GO3F 2OA2A 5FYSA 1STMA 4XVHA 5DZEA 3THCA 1JHJA 3GJBA 3PHMA 2ZDIA 1AJKA 2HEVF 5LP6C 2XBO3 4U2AA 3T08A 2VZ1A 3ZRWB 3LDCA 1QMJA 3DF0A 4K8RB 2CL2A 1NH2B 4FLTA 4Q4X2 2QKSA 4I0AA 3WQ0A 5IDJA 2IVJA 3JBG3 1HB1A 5JCOA 1FAYA 1AYM1 3BGAA 1RJ7A 2FB5A 4BM8A 1R3KC 2GSMB 2HWF2 3E6CC 1D7PM 2PYJA 1T5EA 5B4NA 2XJSA 1LHNA 2HJDA 5BNOB 2MK3A 5IVCA 3WB0A 2YROA 3Q9OA 5FMBA 3MZHA 3BOPA 4Q29A 1K97A 5KHKA 5L36A 4ZU5A 1M57C 4CU9A 3POBA 3M3IA 1C1LA 4TXWA 3NNMA 1LTEA 1J95A 2XAJA 3ABZA 5FP3A 4P9LA 3FD9A 1Y66A 4LK6A 3UKTA 2V72A 3LOBA 4NJ4A 3M3OA 2WZR1 4ZIBA 3ECQA 4OUEA 1PMHX 1SBFA 2EIDA 4CDWA 2VQFB 1QIQA 2ZGTA 1R082 1OA4A 4C91A 2D3SA 5BYNA 3F7YC 1N0NA 1FV3A 2F4VO 3LSDA 3E35A 1S0EA 1N36B 2FMYA 4LBQA 5IK4A 3HQRA 1OUSA 3WF0A 2JJ6A 2IU3A 2D43A 4NXMO 1CAUA 4XDJA 1C5HA 4QT6A 3IAQA 5KHIA 2WNOA 2OIGA 2WSUA 4YVWA 3GDBA 4ZS3A 1JI6A 1RYYA 3GALA 3E5QA 3MIHA 4IGQA 4RQEA 4JAVA 3SH4A 5A6YA 2DYRB 5FZCA 2RV9A 5FLJA 2ZR2A 4PI2A 3HQUA 1Y43B 4B3RO 4OCTA 1H4HA 3SPCA 4DEVA 3OBAA 3RMYA 3BA8A 4MTGA 4GH4B 4ZXKA 3VZNA 1VARA 1LOFA 1FMD3 2IXKA 1XILA 4AAPA 2ZXWC 5LK5A 2PXJA 4X66B 4HSLA 1HNXO 5IJ0A 2TEPA 1ZWIC 1OSGA 4XUPA 2XLAA 1Y9MA 2XVLA 4YNIA 3OUSA 1C4RA 2NM1A 2JDYA 2ZXQA 3L73H 1MMMA 4XAAA 1QJU2 5A6XA 5IATA 1RFYA 2BOJA 2YBPA 1UOBA 2QQUA 3N9QA 4K7JA 3OEEG 1R1BA 5KMGA 1WA6X 3APQA 4LNUB 4XXPA 5E89A 5FZLA 2V5DA 5B1AC 3IIIA 1OLRA 2JIJA 5B5EZ 3GWKC 2RDRA 1N3OA 1WCSA 5LZ6A 2EJRA 4WFHA 5FY4A 1NA1A 2QKCA 3WDXA 4AILC 5JLVA 3MHZA 2NN4A 1W06A 3UGFA 3VKOA 2ADPA 2W91A 4FFIA 2B45X 1I94O 2QQVA 1WGPA 4JQRA 3OD0A 4TOIA 4J11A 4A3ZA 2WQZC 4LORA 1JU3A 2A5ZA 1CXZB 4D6RA 2WFPA 1TMF1 4X1YA 2F23A 4M3CB 2RMU1 4Z07A 2JG8C 2HJIA 4Y1YA 4X1IB 1KFUL 5F2SA 5FO7B 5AC92 2ADEA 4P30A 1ODNA 2O14A 3TK1A 5CBLA 3GYDA 4AEJA 1W2NA 3KV9A 1FFTB 1Q90D 1CX1A 3OBZA 1YF2A 3E2EA 1Y76A 5GJ6A 2Y6JA 3K0DA 1CR7A 3ABMB 3JYCA 1TUBA 1OHFA 1WD4A 5CB7A 1K42A 2XJVA 1UQXA 1YIJV 1RUG3 1TME1 1R64A 1VF5B 1JTZX 3OG2A 1AF9A 2HKOA 4QKBA 4A6SA 5LOVB 5FXXA 2ZGSA 4PDRA 1GOGA 4BK4A 3I2GA 4M4RA 5CADA 2P67A 1CESA 1YYNA 5JR7B 2V5YA 2YHJA 4URTA 2YG0A 3IBMA 4DR6B 2TNFA 1OFSA 5FPVA 2Y33A 2AGAA 4LKSA 3ZSEA 3LIHA 2F95B 4F6RA 1UOJA 5IVFA 2RR12 5FMOS 1QR9A 2DCJA 3ZXLA 5IWAB 2YUAA 3ZFFA 4LLOA 4I2OA 1LHVA 4DXWA 5C8CB 1W8NA 3JD4A 4X9QA 2Z2SB 4JDNA 1JZ5A 3V56A 4ZU7A 1QCEA 2Y34A 1CZSA 4FMTA 4O2BA 2FTKA 4CCMA 4TV8B 3GCWA 3AJYA 3RS6A 1QJX1 3H1HH 2GH8A 1HV0A 1Y9QA 1OQ1A 5K7PA 3DPRC 1PV0A 2VPVA 2Q4SA 1BLZA 3WVJA 3EVKA 3S5AA 4YJ2A 2Z5UA 2PYLA 5LMNO 5FUNA 1V9U3 3VL9A 1AJPA 3CCQV 3VD4A 4IE4A 2AZ2A 3RI8A 3ACLA 1JZ8A 1WB7A 4ATFA 2Q73A 1OVPA 1SFNA 1C57A 1M4UA 1W2TA 2AEYA 2UU9O 2BRTA 2CUGA 3J26N 2WUHA 4JQTA 2ZAAA 1N1VA 3KLSA 4CUBA 2AC1A 3ZHUA 2F4VB 2AH2A 3NJZA 4IE7A 2GU9A 2YIAA 4QDQA 1GQGA 3O1TA 2CGOA 1H2GA 3RG0A 1SERA 1I7FA 1WB8A 1ZRFA 4CDUA 4OXSA 4FT8A 2XKPA 5D1IA 4MVZA 5KHJA 2R073 4CEYC 1V55B 4QQOA 2XAHA 1OCCC 1WW7A 2D7FA 1W59A 3ASOC 3UL2A 4XIKA 2YYOA 2ZS6B 4LF9B 1XHXA 1R73A 5FQ0A 1W8WA 3ZRXA 1HWYA 2ZGQA 5LMUO 1ZX3A 3HJRA 2ATFA 2WIIB 4TWKA 4X1KB 4AF9A 3Q8AA 3MO4A 3AK2A 1HB2A 2W6JG 1J3PA 5JSPA 4C0HA 1LKNA 2YS8A 1Y74A 4CDQC 2AHYA 1R081 2IH3C 1ZVFA 3WCRA 1S55A 1JODA 1VQ5V 5FPXA 2D6KA 4BXFA 1JHNA 2RMU3 2PHTA 5JIUA 1EAH3 3MUZ1 4KP4A 5J37A 5DAVA 2DVAA 4GH4A 2P4EA 2X6CA 1LULA 3EHKA 3Q8FA 1TGOA 2D3OW 4MG2A 4D6QA 3BODA 1G9BA 3H8OA 4DV0B 4HT1T 4LOSA 5GALA 2VD7A 2WINB 2XGXA 4YW5A 2Q8DA 3Q8CA 4ZI7A 2QQWA 4JDMA 3VN4A 2P17A 2WT2A 5ANNA 4BDVB 4AL9A 2W47A 3E83A 3I3DA 2EIJC 1UD1A 1W8UA 1XNBA 3RSJA 1F8VA 1KJRA 4IESA 3F95A 2YI9A 3SPGA 4B1LA 2FZ2A 4YARA 3AMHA 1SC5B 2DQ0A 5DAQA 3NXSA 4DV7O 1QY4A 3M7MX 3RT3C 2XB6C 1TA8A 4J9ZB 3TRSB 1I5YA 3OTFA 4FP2A 2ZGRA 3MW4A 2YMZA 3P1IA 1OURA 4DUYO 1JN2P 3W7XA 4RD7A 1OC1A 2LS6A 2GDSA 3MF9A 1W6QA 4L97A 4NWVA 4DUWA 1W90A 4LXLA 1W6NA 3M99B 3HNBM 3N7JA 2B8MA 3JD2A 2JDZA 1GZ9A 2RJKA 2ID4A 3OYWB 1IPJA 1SDDB 3H1IH 1B35B 1AUYA 2ZGLA 2WSVA 3BTXA 4ZOLB 4PQQA 5BMVA 4GKKO 2VQAA 3AKRA 2ZGMA 4W4LA 3ZDSA 1BVP1 4ISQA 4F8AA 4LFCO 2RVAA 5DQ0A 4CE8A 2YXLA 3IZOA 1GMMA 4N7UA 1S5HC 1ENXA 1JOBA 4RUEA 2YPDA 4Q4Y1 4BE3A 3AMQA 1S0JA 4DR2B 2VWKA 1OI6A 3KV6A 3IJ4A 2LGQA 3CSXA 1VQ6V 4WM8A 5BPXA 1AJQA 1BHBA 2XG3A 1N32B 2WNUB 5EIBC 4DV2B 4BR6A 1BSMA 4DB5A 4I0BA 1V6MA 4X20B 5KXCA 3FL7A 4O4LA 1Z7S2 2XT9A 3N7LA 3S6PA 2CNAA 1JS9A 1UYPA 4MTFA 4EB6A 5DDJ2 5IK8A 3STLC 4AVBA 4CEWC 3ZHRA 4RS5C 3W58A 3PU3A 2DV9A 2XWJB 3ZR6A 4Q8KA 3D4KA 2GN7A 3AP6A 2A1XA 1HKDA 2PHWA 2BWAA 3NRUA 1OKOA 1MR5A 3QH7A 4HOOA 3CC4V 2VVEA 1KRIA 4QQPA 1MZ5A 3B9CA 4COVA 3PTYA 3DCQA 5HFMA 2LM3A 1PL4A 3I97A 3LSUA 1O4TA 1I0HA 1PKXA 2WL1A 2W95A 3I56V 4FJCC 4NOTA 3USUA 1JZ3A 2DOSA 2W1UA 5A1FA 4MXVA 4B3MB 3HPLC 1I08A 2BU9A 2CH7B 4LEJA 4FLWA 1CD3G 2ZKLA 2VS0A 1R083 1COV1 1EAH2 2ENRA 4GKJO 4B8EA 1KECA 3FX3A 2UUBO 1O4YA 4FAHA 5FK8A 4UFLA 3MLKA 3UV9A 2ARHA 4DY3A 3RMXA 3H1YA 3KHBA 4NVPA 4K9SA 2VUJA 1JYTA 3W7SA 3I2JA 1ZL8B 2VM9A 5I91A 4QWNA 4BISA 1WUVA 2BSKA 4CVUA 4JI7B 5A7QA 4X65B 2NR5A 2W0FC 3K5OA 1UU4A 4NRMA 3TOJA 2XWBB 1SESA 3G6EV 1NJIW 2XASA 5BNNC 4CCDA 4H3WA 1ASJ2 1GICA 5BNPC 1ZX5A 1SFYA 2DUQA 2EIBA 1SHWB 2EAAA 1W9FA 5AC91 2X7RB 4KUMA 4FQZA 5IY5B 4BQXA 1JJ2U 2Y0PA 1N33O 1PM9A 2LRPA 2PELA 4WVZA 4ZU4A 2DCZA 3T1LA 4QQLA 5B4XA 1Q6HA 3S5QA 5GLVA 2VC9A 1YQ2A 2P4VA 5KR7A 2QWNB 1YUDA 1PX3A 4CUGA 4DV0O 1EYBA 4EWEA 2V4AA 4AAXA 1TNRA 4JYYA 3BCWA 2JE8A 3AZYA 3ZRVA 1VALA 1R3IC 2Y38A 3TEWA 2IFWA 1H8HG 4UCTA 3KVBA 4XHBA 5IE9A 3WX5A 2DU1A 4AI0A 2VMCA 4JI3O 2HWD2 1DLCA 2KB1A 5FP9A 2X6AA 5L3DA 3H1KH 4FPEA 4FAGA 3Q8EA 2E74B 2BSKB 2AREA 2XONA 3KVAA 4LBNA 1VF6C 1BEV1 2WABA 5SV8A 3RZKA 2IJIA 2Q8EA 2M7WA 3C8XA 2CWSA 3BY6A 3ZJZA 5SV5A 3O7OA 2D97A 1NG0A 2Q7GA 4ICGA 4YG6A 4QHOA 3ZMZA 1G6NA 2BERA 4DXTA 4R4ZA 2PLV2 1UCXA 3SQOA 3VBBA 3VBOA 3K0GA 4LTAA 4AK3A 3JBG1 3ZYJB 3HNYM 4LKDA 3K5LA 1RUG2 2IUWA 4AI3A 4UFMA 1YQ5A 4YW3A 1SPPA 5CMUA 4DXRA 3KM5A 3A0RA 1ENQA 2B1GA 3LEGA 1PX4A 1NTKH 4AHCA 5F3CA 3I7DA 1S0GA 1UU6A 2UUBB 3ZFEA 4RN5A 2DUOA 2W39A 3N2GA 3VBHB 2B7YA 1RUD2 4JX0A 3DXRA 2ZZJA 3VV1A 1VBD2 4IL6Z 1GP4A 1ACCA 2DBIA 4LF5B 1DG6A 1WPBA 3DGTA 3ZDVA 4JV4A 2KG7B 3CLPA 1M90W 1RUG1 3ABLC 1JH5A 4AGGA 3WG7B 3WF4A 4X6QB 3ZFGA 5LGTA 4FLUA 2ZE6A 4QE7A 3KZIZ 2E51A 3S30A 2R043 3OMIB 2B39A 3CEWA 3JCIA 4XURA 2GNBA 1NLQA 1OOPC 2C9KA 1BKZA 3OEAA 3ETPA 1OVSA 2CGNA 4FPYA 3MUY1 3JSNA 5LA1A 3JALA 1PVXA 2GP3A 3FAVB 1G7YA 4AHXA 5C3PA 4DW1A 3V0BB 4XBQA 4EN6B 4LBLA 1PGL2 2KXLA 2IH1C 3ZMSA 1QEXA 4HN0A 4R9AA 3AG3C 3C90A 1H8VA 2PGGA 2PHXA 3W7UA 2IU0A 4XTPA 2LTNA 1O3RA 3HKEB 1IKQA 1NLRA 4Q4V2 3T1YB 4PJYA 1PZ9A 3LAGA 1RUD3 3SKVA 1NKGA 1GOHA 1JYNA 3QCWA 4PIYA 5C9AA 3KGZA 4P00B 3MV11 2WZR3 1V6JA 3UM7A 3WR0A 1E5HA 3VBUA 3VBSC 2WLHA 1FXKA 3LSEA 1KS4A 2OQ6A 2BVBA 3ZHVA 3JXSA 4QGNA 2LW7A 3UNPA 3PUQA 4MVUA 2A3QA 4PQ9A 1PNFA 3C7EA 4MGSA 4IGOA 4N7IA 1PMJX 1H38A 4EQVA 5IVYA 3KD4A 4Q4V1 5LWBA 1J1TA 2D6LX 3DYMA 3EFFK 3RW0A 5E79Z 1UPSA 4ZHNA 1RUJ1 4XFIA 4B3MO 2R1DA 1O5UA 3H9AA 4JV5B 3PU8A 1GN6A 3AP7A 1H8TB 3V0BA 2K9ZA 2MEV2 2D6MA 4URAA 4MVMA 3QO5A 2YIDA 3CBNA 4P9YA 3ML0A 2IM9A 2VZSA 5JJJB 2QUOA 5IK7A 4YW2A 2K1EA 1YITV 3AZWA 4IGGA 2PAMA 3AL5A 2QDOA 4L87A 4RFT0 5EZYB 5LK7B 3ZXFA 5ACA1 3JD1A 1WKYA 4B08A 2LUWA 5GLUA 3U78A 4N53B 2CTWA 1GUIA 5L3BA 4D69A 1CWPA 4LH6A 1JCHA 2DQ3A 4C1WA 4O4IB 3THOA 2FBEA 1ORQC 5B1BC 1PK6A 4Q4Y2 3K06A 3SYAA 4JI3B 1BVVA 1XL6A 2ZEYA 3AB0A 1AR81 4I55A 2ZABA 2QTSA 2LO1A 5JUVA 3WG4A 5GM0A 3OFNG 1VQ8V 2G1MA 1RJ8A 2VRZA 1NVPD 2UWBA 3T1YO 3JASA 3VBFA 3VD3A 3KMHA 1H0BA 4H0LB 1UZWA 1M93A 1YJKA 3UJQA 2WAAA 5D8AC 4TLFA 2P1BA 3OTOB 1AR91 1OF3A 5C33A 1QVFU 1IVSA 3SC7X 5K4LA 2VH9A 2YFUA 3P30A 2V09A 1LU2A 4FXGB 2YEVB 1AB3A 1F4AA 4IE5A 4S2GA 2BVVA 1CJDA 1CONA 2VE1A 1SLBA 1TNFA 3VHOA 3GF6A 4CU7A 2E7QA 2AGSA 2R063 1G6UA 3VD9A 2UY9A 1TG7A 4JV5O 4IEWA 5JI7A 4N43C 3U4XA 4O65A 3ETGA 2E63A 5A33B 2WLIA 2P6CA 2VVFA 4JGYC 4WFGA 1NZ6A 1AZDA 3T4ZA 1XE8A 2UYAA 4FFKA 1OA3A 4ZBMA 2WLPA 2TBVA 1K73W 4A7KA 5C8CA 3JAWB 2Y48A 2YB7A 1OCZB 2PHDA 3GZAA 5H9QA 2D6NA 5F5CA 1BEV2 5DXDA 3N36A 1B35C 1RMU3 2XJTA 5A7WA 3WV6A 3LEIA 5JZGB 2W08A 1KDMA 5LBQA 5CB4B 1EP0A 1MEC1 2IW5A 3BA9A 3ACGA 4HK8A 5APAA 2R072 5A7WB 5FYTA 1QKQA 1Y7BA 2XOKG 3NAPC 1LHOA 2VCMA 2HVKC 3ENRA 4NB5A 1VP6A 5A80A 4QJFB 2D5FA 1IG0A 2KM2A 4P9XA 4V1PA 4FPFA 3OB8A 3B02A 4HMZA 5FCCA 2W94A 4N9IA 1U12A 3ZKUA 2DVGA 2PQQA 4ES9A 1E57A 3VZLA 4JRLA 5A33A 2XUMA 4DV3B 3N4MA 1GV9A 1XBLA 1WW6A 1T6GC 1D0GA 4IT5A 5DM6V 2A3WA 5JSRA 4CH5A 1Y6XA 3ZMVA 2F4PA 3VHPA 3ZXKA 5CG9A 3FB6C 2WN3A 4OYUA 3VUOA 2VBPA 4A7YA 5T55A 1JOYA 1K8AW 3RYFA 1OBNA 1IXMA 4OZOA 4JTOA 2CDYA 2FD8A 5JPMB 1EZVH 2YEVA 3N27A 4LE3A 4XE9A 1YVWA 4HNAB 4P5HA 4GYCB 3CPWU 1VB2A 4QB2A 4CDQB 1IS5A 2QBXA 2EILC 3WDVA 2A6XA 2C6SA 4FOWA 3HBKA 1NQTA 3JASB 4QX8A 1VBC2 2VR4A 4DUXA 2VCAA 4YY3O 5GZGA 1EV11 2RE9A 4LNUA 1RPOA 3PIJA 3BVOA 2D98A 5ABJC 3ASOB 5EQUA 2UWCA 4K8ZA 3MHHC 2NLRA 3CB2A 1LGNA 4CH6A 3CDZB 1AHSA 1S1AA 4J42A 2CDOA 4UW4A 5IJ0B 2WAMA 2B4KA 1HR0O 2VCCA 2W5FA 5IWAO 2W92A 3LDDA 1ND3A 2QEXV 2R0HA 4ATEA 4QX1A 4MVQA 1RP3B 3ZX6A 1RUC3 1G1XB 2VJXA 1ULCA 5A3LA 2P37A 3LEKA 5CIRA 5H9CA 3ZS8C 2XH6A 3NV3A 5H9PA 1V6KA 3KSCA 3WNNA 4MH0E 3U10A 2CU5A 4I0XB 1EV12 1LAJA 4Y26A 1XC6A 3CO2A 4L2NA 3ZYGA 1BK1A 2GHYA 4P14A 4PIZA 5LASA 5JVDB 3JARB 2R16A 4IDZA 4MGTA 4JYAB 3ZOIA 4DQAA 3MFCA 2QWRB 5BR8B 4HVOA 3OUHA 4IEUA 2Y6LA 4RFRB 2E7TA 1A34A 1SZBA 4GB33 1XL4A 4BOWA 3H1JH 4FIPC 1UY4A 2WYSA 3DXTA 3JZVA 1TVKB 1I9RA 1HQLA 1KU9A 3E8FA 2IJHA 1NCRB 1COV2 1X33A 4HYOA 4NPLA 3RZHA 1JMKC 3K4ZA 1XB9A 4MTXA 3POEA 4QGPA 2VAUA 5CFCA 4LLFA 4RHV3 4I0XA 4KG8A 1R6KA 1JBCA 5JPNB 3HKEA 1ZUQA 5FZ7A 4PF1A 1IQAA 1BBT3 1LEMA 2R6QA 4CDWC 5JQGB 1DFQA 3TCUA 4XW3A 2VTXJ 3FMGA 2O57A 4YGDA 5ITZB 3SKJE 2WO7A 1TZOA 1LJ7A 2ZPXA 4LJHA 3FFZA 3SYOA 1VIBA 4G2KA 4JKLA 1FKAO 1IBLO 2FQPA 5C93A 1JU4A 2ARBA 1FATA 1SQQH 4E4EA 4CC6A 5JJEB 1RINA 4YVWC 4Q0PA 2R1BA 1POV3 4RQPA 4X1KA 2ZJCA 1VPHA 3PTRB 1G9DA 3ZRWA 2A3YA 4FPHA 4GALA 4L8JA 5FY7A 4MVOA 1JMUB 2O8OA 3BCCH 2RR11 1SA0B 3H0OA 3A8TA 3HKDA 1MQTA 2WFF1 2BGCA 1YI9A 1QNYA 5K0UA 3ZFGB 4J41A 1EPZA 3AG2C 1GBGA 2YY1A 4DRVA 2HFEC 4LBJA 4LBKA 4NHLA 4UFJA 3BPSA 2JE9A 3D3AA 2GBOA 4E8CA 4W6YA 1IPSA 1PZ7A 5FR3A 1XMOB 4PI0A 2R041 4YZ5A 3RYKA 4W6WA 1GZWB 5FZKA 2VQTA 4JI2B 2C24A 4LULA 1VR3A 3N9LA 3OY8A 2WQ4A 2V1DA 1SQFA 1C3HA 4QPGC 1ZLZA 2Z0AA 4LBOA 2W1WA 4UV9A 5L7OC 1E79G 4UF0A 2XVGA 4UWDA 2GTAA 3MDSA 5FJHA 4O2AB 1MQTB 3ILFA 2BCCH 1D2SA 4XETA 5EBLC 2YZ4A 3IAPA 2WO1A 5IYDO 2UXDB 3BKZA 1XNRO 1OH4A 1KDKA 2EALA 3JCUZ 2WNVA 4L8QA 4O4LB 4X20A 4BQWA 1NYWA 3JCZA 1L3JA 1EY2A 2LFRA 3LCPA 2NNUA 2EINB 2WRAA 2Y64A 2RNBA 3GXUA 5GZFA 3J7MA 1SETA 3OOXA 4RL7A 2QWPB 1NA1C 1XNDA 2ARAA 1NZCA 3M4FA 4FPPA 4QX2A 2I2SA 1UX6A 4D6TH 1GM7A 1H2KA 3ZXGA 1D4M2 4P02B 4R9DA 3K48A 4XF0A 4SLIA 4QXCA 1DYKA 5J2UB 1QQP1 3FLRA 2QTOA 4GKKB 2YUEA 4QPIC 3RYHA 4Q4X1 1IBKB 1HR0B 4CXWA 1YIPA 2JICA 2KKWA 5LOVA 5FKCA 1DGRN 2FDKA 4WVMA 4DV1B 1RSOB 1QJFA 5C3QA 1AR5A 3OR6C 4DS0A 5FY1A 5L9VA 4MGIE 2XHKA 4JI4O 4CZZA 1RITA 1N3PA 1LUWA 1HRV3 3RRDA 1N8RW 1L0LH 2Y26A 5JH7A 1W9YA 4OZXA 4FTBA 5ANQA 1BK0A 4QPWA 1PGW1 2BNNA 3QF7A 4FLZA 3UK9A 4QX0A 3CMEV 5FJKA 4IHJB 3MGUA 3LZZA 2XAGA 3JARA 2ZGUA 4X1IA 5ACA3 4PDWA 3WT3A 4XJAA 4QPIB 4JRAA 1SLAA 3PMEA 2ZIOA 4IIJA 4KWLA 4IE6A 4XUQA 5KC6A 3FUQA 1PVC3 1LENA 1Z0HA 2PYTA 3BU7A 2XOMA 1VMHA 2C5DA 3SJCC 5KUMA 2OUJA 3OF1A 4YYOA 1HDJA 3APBA 5F32A 1FXZA 4OI2A 3LSSA 3INAA 4I3PA 3T30A 1BL8A 1UOFA 1L8DA 1YI2V 3A0HZ 3VKFC 4OHWA 4L0PA 4DXSA 5F5QA 2E6VA 4D3WA 2RM22 3F5TA 4D7SA 3VBFB 2JS3A 3K2OA 5LP6B 2YV8A 4Q4W2 1O3QA 4FPLA 3SJQC 5A3OA 1Q3EA 4EN7B 4B3NA 4I55B 3ZMOA 3CF6E 1RUJ2 3WP6A 1VAKA 1DHKB 3ACHA 3K77A 4ABMA 4OX9O 4KMQA 2KSDA 1W39A 3T1MA 5JAXA 2WLNA 4MVRA 3CZJA 3VBRC 2EXJA 5FL7G 4N53A 3LB9A 4N23A 3CJIB 5LBEA 2JGDB 4QMAA 3NO8A 2EAKA 4AWDA 4NXNB 3LA2A 2VVDA 1QDOA 1ROPA 2RQ6A 4CDUC 3M7AA 2Q1MA 2PAEA 3B5LB 3K9SA 4LO6B 5A7PA 1QWRA 5FPAA 1RXFA 5DDJ1 2CWMA 4QHBA 1DQ0A 3WW3A 5IVEA 5KHHA 1U97A 2VZ3A 1H8TA 4GA9A 2OWOA 1ZBA3 5GZCA 1H9PA 4QNHB 4IGPA 1NXMA 3O65A 4YVSA 1U5YA 3UT5B 4LHNA 1BHGA 1AJOA 4PA6A 4J1WA 4Y1XA 2W0XA 1YC61 3RZZA 3ZN4A 1C8M1 3ZPOA 1FFXA 3RVYA 3T3YA 4HPKA 5JMOA 4ZHQB 1Q43A 2ZTNA 1TMF2 4QGLA 2XJQA 3CE2A 4DO0A 1ND2B 1X8EA 3VBUB 1DGWA 3GBWA 5LBBA 4WVMB 1C8M3 2VQEB 4JI1B 2XHNA 2XQRA 4NKGB 5LBFA 2QZ3A 5I8TA 3LQCA 1DGWX 3KCCA 1O6UA 2WT0A 3SPIA 1PO11 1U5IA 3KB5A 1Q82W 4HANA 2Z5WA 5J2UA 1SF9A 3E5XA 1EBOA 1QVGU 1W2BU 2Q69A 1ENSA 4LC1A 5DN2A 3UKMA 3D36A 4NAOA 3MI8A 4HG6B 2VUDA 3OGCC 4B7EA 1LR1A 3WB1A 5LHHA 1ZBE3 2QTWB 2QQLA 4RWUA 4DRRA 1YJNV 1MG1A 1JZ2A 4DR4B 2JJ1G 3ROUA 3RI9A 1CZTA 4I02A 3K04A 4E27A 1QJU1 1N4CA 1PO12 2HLEA 5HCAA 3KCYA 3OGIB 2PA7A 1I94B 5F37A 5FZ3A 5AVPA 1LHWA 4EZ4A 3GBGA 2DUPA 3CJIA 5JCTA 4QU2A 3WFVA 2ZX4A 3OW2U 2FDFA 2GMMA 4HZFA 1DQ1A 2DDUA 2HWE3 1VQOV 4TWTA 1SQXH 4XDQA 1PP9H 3EHBB 3DXRB 1AR1B 3A2FA 1AROP 1J83A 4O4JB 4O9GA 3R65A 3K79A 4GULA 3WQ1A 3DKQA 1FX5A 1PNGA 2UXBO 3L2YA 1JZ4A 2EIEA 1NU1H 3BHPA 4CDXB 3VDBA 3ZBHA 4NR1A 2OCCB 4JGZA 4HKLA 3F5WC 3FFQA 5IVVA 5A3PA 1IXBA 2VECA 3BTYA 2YU1A 4A3XA 3VBOB 1R1A1 5ABJB 1N32O 3IC9A 1G8MA 2P2KA 3AZZA 4CEWA 4I09A 2Q9LA 2ZMKA 2QQJA 5F1RA 1H2SB 1W99A 2R0FA 2A0LA 5GZEA 1FD9A 4KBBA 4OHYA 4IYIA 1NT0A 4LF6O 2OZJA 1R091 1O3SA 4XUNA 2BGPA 2F1MA 3ZSJA 3G7DA 4XQWA 1VP7A 4C0BA 4PA4A 1EUUA 4Y4YA 5LA6A 5FYHA 4P9OA 4FPKA 4NROA 2ZEXA 5EZYA 3QOPA 5HXVA 4WF9V 4LIVA 3EYPA 3SLIA 2WS93 4MADA 1S0CA 1S2EA 4RR3A 2OQ7A 3A0BZ 1EV13 4YHHO 2PI5A 1KP2A 2VL4A 1I5ZA 1UZVA 1V6NA 4LBMA 5K1XA 4NHYA 3AEIA 1S2BA 3ABKC 1DYOA 2BUKA 2ZR3A 4UCVA 4NYKA 3LD8A 5B1NA 1YZBA 1UMHA 4NN0A 1ZSPA 3SYQA 4L9BA 3L75H 4IW3A 1K12A 2HVJC 4ONUA 2Y60A 3S57A 3SHRA 4LHSA 5HV0A 1QBZA 3B69A 1QLEC 5H2FZ 2PHUA 2VOTA 4WM7A 1V6IA 3DECA 1H30A 1NX9A 1PNLA 3RYRA 3ZN6B 2PLV3 2BGOA 3LDKA 5FY9A 3H8XA 2ARCA 3BTZA 5IFTA 5FZEA 4WFAV 1QU7A 2VMFA 4RAIA 5BZBA 5L9BA 5C9AB 2L6LA 5FP7A 2YIBD 4HN1A 4V2VA 5KA6A 1POV1 3J7NA 1HRV1 4X64O 5C70A 5CA3A 3TETA 4XF1A 4YZ3A 4WFEA 1MZFA 3KT1A 2QFEA 2E33A 4E9KA 1LEDA 1X50A 3R6SA 3OMAB 3WQ7A 1M1KW 2D6PA 4M3CA 2QWQB 1AI4A 1IPKA 4JGYB 1G9AA 2QKDA 2NQYA 1DLLA 5J9PC 1FT9A 1PM4A 1COWG 1YI7A 4N43B 3O1UA 5E6HA 3NV1A 3LUTB 4CEYB 3AYEA 1GNZA 1K5MA 1NR7A 2ZGNA 1QQP3 3CXHF 5FPZA 4GX5A 4I0WB 3RYPA 2Q0AA 3NQHA 2ETEA 3LF7A 1QOSA 3WW1A 4JZGA 3O0XA 1JR9A 5D5QA 2UUCO 1N1TA 3K5NA 2KG7A 1XNQB 1UZYA 2Y6HA 3WHTA 2NYYA 4FQ4A 2A6WA 1AL0G 1ULPA 4LO8A 1NCQB 3NSTA 4R8CA 5LP6A 2WNUA 3ACIA 3P3NA 1JXNA 3APOA 2VXRA 2RJ2A 1MS1A 4UXNA 1IKPA 1H2MA 1ZA4A 2VZTA 5FZIA 1MSWD 2JDIG 2BZDA 4IV3C 5K1PA 2VXJA 2D44A 3VOUA 4NE9A 4YM1A 4B3RB 2VUCA 1DF4A 5IYYA 4JTCB 4DR1B 1LOCA 1XMOO 3J8F3 1R1ZA 4META 2WT1A 5BMVB 1CEZA 3P5BA 2N05A 2QQKA 1N34O 4AOCA 4NHXA 1OQDA 4DMIA 1THZA 1H1MA 3IIAA 4BQ4A 1W6NB 3W21A 4JTNA 3VLBB 1AXZA 3SDLA 2N04A 2LJ2A 4DR7B 4BJ0A 1ZBA1 3K51A 4Q4W3 1FPOA 4YSFA 4NIDA 1NCRA 1NUKA 4LIUA 4XFHA 4PLOA 5JCOC 1ND2C 4W50A 3H7YA 4LF5O 1NBMG 2MW2B 5GZDA 4D0QA 4XDPA 2QA4V 3AYAA 4FM0A 1RHI1 2GV9A 5BY1A 4E4ZA 5DPNA 3OEHG 1BMV1 1Q8OA 3NW4A 3OGJA 3M70A 2WJSA 3JAMN 2XUEA 5EZWA 5JJNB 1EN5A 1DLBA 5F5AA 3TNPB 3ALQA 1K34A 5FXWA 2JXAA 1H8EG 4INDA 3GM8A 4EYUA 2W46A 3L72H 4LKEA 2YSUB 4MGKE 3SPHA 4IV1B 4K1ZA 3VBSB 2DYSC 2YC4A 1HDKA 1ZA7A 3J7LA 2A7WA 3J4UH 1FXKC 1JX9A 1D5AA 1SLCA 5JOYA 1VBC3 4CUAA 2WLLB 4CP0A 1QF3A 1FV2A 4IETA 3B77A 1XSRA 5I0UA 2VUAA 4P2ZA 1QH6A 4LUKA 1H9WA 5BV6A 3WINE 3AG1B 5B1OA 1X9PA 4JF3A 3ATGA 1QJZA 5EV7A 1LOFC 5A7OA 1ZL8A 1JFFB 4CH4A 1AR63 2EIKC 1YJ9V 3IPVB 1N36O 1Q6UA 5DMYA 4LWSA 3LA7A 2OKXA 2W2IA 3FUOA 4JYAO 3B40A 5CA6A 3T2QA 4PD4F 1UXXX 2ZMNA 2OCHA 4FXKB 1H6XA 1WA4A 4LPLA 4CCJA 5LY1A 1Y4WA 2ATKC 4UV8A 5FMCA 1W0KG 1YQ8A 4Q5OA 5HV4A 1KYOF 4CDXA 2GMEA 4KFMA 2RCVA 2OPWA 5K8SA 2DCKA 4CTEA 2G4IA 3E89A 4O4JA 3IGAC 3THTA 1VQ9V 5L3FA 4O4HA 4IEVA 3A21A 2D93A 4OVEA 5DABA 4HVQA 3HNMA 3JBG2 2VZPA 2IWGB 1PK6C 3EQEA 4X64B 4DR4O 3MIDA 4L92A 1Q86W 1A78A 4Q20A 4GXLA 1O7FA 1QJY1 2JE7A 4FOQA 4QPKA 4Q0SA 1GWMA 2HBUA 4NIHA 4CP9A 2E31A 3J8F2 2I74A 4U3JA 2ZZQA 4KI5M 3AM2A 3Q4HA 4ASKA 1MEC3 3M1HA 2EZOA 4LKFA 2XJPA 3USSA 3JATB 3THPA 3ITQA 1W9WA 4NHKA 5DUXA 2WZEA 2X29A 2WFF3 4HONA 5T5OA 4JI6B 3HN1A 1ZBE1 1ULDA 2WLLA 2F66C 3AYDA 4XFGA 1J5EO 1O8PA 1RVF2 1XQ8A 4LO4B 4XBNA 4CXYA 5JQGA 3HOBA 1K4CC 1VRH2 1IS6A 2VG9A 1SCRA 5CB4A 3MD0A 3VDDA 2VOXA 5I8SA 1PO13 1RB8G 3QACA 3PVOA 4IERA 1YFUA 2JDNA 2ZCEA 5CFDC 3CQOA 1PO22 2ZX3A 3ASNB 5GLTA 4R7CA 1UIKA 3JAWA 1P7BA 2BTOA 5A32B 1YSCA 3U4SA 4HFSA 5GW7A 4EN8B 3ZFFC 5A9GA 3MAQA 1IGOA 3VQXA 4QKNA 1HW5A 5FZBA 2X0LA 3S3XA 5IK5A 1TAEA 1LR5A 4JYBA 2VNGA 5EJZB 1NTZH 4DV5O 1AYM3 2OZ6A 2EINC 5L3EA 5FZGA 2ZT9B 3ES4A 1XNQO 3VD7A 2QJVA 4LFBB 1K92A 2JRIA 4OHXA 5FZHA 3PJYA 4CA9A 3OGGA 4X1YB 5B3SC 4KG0A 4N21A 4Y20B 5AG2A 4DZGA 5LMUB 1D5NA 2RDCA 1DP0A 1O3TA 3CMAV 1OLQA 3THDA 3E5UA 3D8CA 3OGVA 4YHHB 1OZ0A 2R30A 4B7KA 2HLDG 5H9SA 3WEZA 3JSLA 2VOWA 4AVCA 1XYOA 4XTMA 4Y22B 3WDYA 2R9RB 4RHV2 2BTQB 1QU0A 3WD5A 2DU0A 5LEKA 1HRV2 5EC2C 5LGNA 4E4HA 4IQPA 2Y8KA 4AEDC 4HXCA 3TEXA 2QWOB 4AQ6A 1OXCA 1WAZA 2K2SA 1VRH3 1YFWA 3AP9A 4BWOA 3C3SA 1N34B 3E1F1 3ZXDA 3VQWA 1Q8VA 3PJQA 5FPBA 1VAVA 4QX7A 3VBHA 3B00A 5EYXA 4PLMA 1OH3A 5FNVB 3FYIB 1POQA 2FZ1A 5T5JA 5FIXA 4E8DA 4O4IA 3UESA 3SISA 2C4XA 3H8UA 1VAMA 1LCLA 1US2A 3OCPA 4FBFA 4JAAA 3AVRA 1YTFB 1SLLA 4FVMA 1KQSU 1K5QA 1XNAA 1QHDA 2IXJA 3VKLA 4FK5C 2E3CA 2J1SA 2EX3A 1AR82 4CP2A 4JI8O 4DOUA 1SACA 3CD6V 4MT8A 3WF3A 3HEIA 2ZD9A 4LBQD 1CAWB 2Q67A 1YRZA 3RZLA 2WS91 4GQ7A 2WR9A 1OQEA 4DR3B 4MX3A 4EWAA 3VQYA 5KAFZ 3U75A 3RYFB 2HR3A 3WP3A 2B9VA 1GWKA 2Q1FA 1DQ4A 5J7MA 3U07A 3PLQA 1F51A 5C4WB 4LO7A 1JZ7A 1WBLA 4QX5A 5C3SA 2EIKB 2QM8A 1WCUA 1GN3A 2GNDA 5FMDA 3RJRA 1MS9A 3IWZA 4NWWA 3PVBB 3N2KB 1FNZA 2WN2A 3TYJA 2HEYF 1F31A 1DIWA 2XQXA 4XJ9A 5T50A 2CHHA 2RJLA 2RDNA 4C90A 1R1A2 4R9BA 1C28A 5A32A 3TBDA 1LU1A 4C1XA 4UFIA 1MABG 4G28B 5FRAA 1MVEA 3GNEA 4YZ2A 1HX6A 4IV1C 2GC2A 3MV01 4MYEA 2DE0X 1HN1A 3WU2Z 5ACA2 1AL22 1MVQA 4X66O 3VDDB 3T09A 2I07B 2A6ZA 4I4TB 3VHRA 4I4TA 1W6PB 4KL1A 3N3HA 5BXZA 4XUTA 2HWE2 2IBZH 1FPN2 3TN91 4DYLA 3UO2A 1IS4A 2UWAA 5FZOB 2RMKB 1LOEA 2NMNA 4E2SA 2Y69C 3ST7A 2VULA 2ORZA 3TN93 5FUIA 1WLDA 2DTWA 4YIOA 3JALB 4NIIA 3I2OA 2UXXA 2QM7A 4JHTA 1Y76B 4YM0A 3Q4HB 4JPRA 2YFZA 2WNVB 4GWMA 4GX1A 1SQGA 2D5HA 3ELNA 1WMEA 1W8FA 2XL7A 4DXZA 4Q26A 3LFIA 4XMIA 4JCKA 1OPOA 1J84A 5JOXA 1WW4A 1WBFA 2QQNA 1V9U1 3KT4A 4WVWA 1GN4A 4FPGA 1KUQA 2Q8OA 4DFSA 3O0VA 1OT5A 3KCXA 4XOGA 2BBVA 3CCVV 4LNVA 5DUWA 3OR7C 1YCIA 1K3EA 2VZQA 2JG9B 2HWC2 3E86A 1DDLA 1ZTEA 3KV4A 4MHUA 1QOOA 2WBKA 5AFEA 2A70A 1S0BA 2VBDA 4WM8C 2JIGA 4B1MA 4A41A 2C2AA 1NY72 3R4SA 3T2OA 1E5RA 1CVNA 1SS3A 2ZHKA 4I7ZB 1HW7A 1KS5A 1N47A 5I0RA 2VZVA 1RVF1 3LNNA 3I2KA 2BOIA 5B66Z 4BW5A 1G9CA 5FNVA 2DBNA 2E5LO 1W6OA 1KMIZ 1SQBH 2H0VA 2NLJC 4DRXA 4J9YB 4MHRA 2ZGPA 4Q4W1 4FM1A 4F7ZA 3A23A 1ZRCA 4WV8A 4DV7B 5JXGA 3ZN1A 3AFKA 5FLXN 1CAXB 4UI9L 2BE3A 2NP0A 1W8ZA 1TMF3 1D2QA 3O1MA 1W8OA 1REDA 1XREA 4LFAB 2X5IC 2FKXA 3GGLA 3ZYFA 5L7OA 3O1RA 5A3MA 4D8MA 5BNNA 3GBFA 1HB3A 5FXZA 4DUZO 2PN5A 3A22A 3FB8C 4ZXEA 5C7GA 1DZQA 4EWDA 1DZTA 5JZGC 4IXLA 3CKHA 4B4PA 2EULA 3LEMA 5CZKA 2ZA9A 3B93A 2CY6A 3CYOA 3AZVA 2GP5A 5A6QA 2BNOA 3O1OA 1XPWA 4HLTA 5EYPB 5FZ8A 4CS3A 3DKWA 1G9FA 4TSVA 3O14A 3BUCA 1HNWO 4F4LA 1XEQA 3OUJA 2VTFA 4JI8B 2X5IB 1AR61 3MPBA 1AVMA 1VE0A 4XDLA 4XCAA 4G3YC 5CN0A 1XNRB 2ADQB 4JYCA 3OGRA 4BQYA 4L11A 4M3CF 4UB6Z 5EIYB 3MFAA 1F15A 4DR1O 1XNCA 3VKNA 2A9HA 5IAXA 3GHNA 4EN9B 1JVMA 1PO21 1QJY3 3AMMA 3OMNB 1NE6A 1A8MA 4XFBA 1RUD1 2O8QA 3J7HA 3ZYPA 1F35A 4WZFA 4DR5B 1VBE1 5ERLA 4QD2A 1FXVA 2DJVA 2W6IG 1BCCH 4XXAA 3UT5A 4X65O 4RSUA 4MOAA 1V54B 4WFFA 4BH9A 4YM3A 3T4DA 3L70H 1FMD1 3H7JA 2I45A 3AKTA 4DINB 1URFA 2W87A 1ZM1A 4J7ZA 2J1UA 2YIBA 4TLGA 4DV1O 2J7MA 1POV0 2JDUA 4CC5A 3MICA 4AVAA 1GMGA 3AP4A 5JI9A 2JDHA 4LMFA 1F5JA 5T5LA 1J59A 2BNMA 3J7AU 5JVVA 3W5NA 4YGEA 4PV1B 5A6ZA 4YG0A 2H6CA 2JG8B 5KXBA 3G4SV 4K40A 5KBFA 4BQ3A 1RUF1 5A7NA 2FL4A 5C5UA 2DVBA 2DCYA 2JG9C 3HQXA 2D3PA 4UOJA 2JK5C 2VMGA 3VZJA 2G9FA 1VEWA 1CGPA 4CP1A 2YBKA 3RJ2X 3HKBA 3SCHA 4FTEA 1UNBA 3RGBA 3KF3A 4YFZA 4MV2A 4Z2AA 3SPJA 3C7GA 3MEPA 3QTCA 4MO3M 1N33B 5I0TA 4PDVA 4QX3A 1WPXA 2BW8A 2XLGA 4CPBD 4S2FA 2MHFA 1UL9A 4Q6GA 3JD0A 3T2TA 2X09A 5C8YB 4JI0O 3SEPA 2P5BA 3SR2C 4BLJA 4YPJA 4EROA 2VZOA 2JGUA 4JHZA 2Y69B 1GKBA 5DG2A 1ST8A 2W9XA 1S72V 1QR8A 1O8SA 4XBLA 3AMNA 2Z3YA 1NT2B 3VL8A 1AX0A 2IXHA 5FWEA 1J1LA 1GM8A 3IDAA 5JWPA 2Q30A 1RUH1 4TV8A 1JFFA 2IFRA 2ZXWB 2PMWB 1NTMH 3K3WA 5BXXA 3DUIA 2QGNA
chains in the Genus database with same CATH topology
1Q5OA 5L73A 5GJ6A 4OJ8A 1CR7A 3I59B 3USUB 1RUH3 2X8KA 3ZN6A 4IL7A 3VKFC 1TE1B 1OHFA 3ZX7A 1WD4A 4OHWA 2WA3A 2OPKA 5CB7A 5F5QA 2E6VA 5KHGA 4D3WA 2RM22 3AKPA 4D7SA 3VBFB 2XJVA 5I93A 1DU3D 3HAGA 2HWC3 5E1RA 1RUG3 4FPOB 2HWB1 1JUHA 1D0HA 2JENA 1TME1 3BTAA 1N3QA 3V0AA 2YV8A 4Q4W2 4OUSA 1O3QA 4FPLA 1NQJA 1JTZX 1X8MA 1AF9A 2Y0IA 1JYIA 1Q3EA 4EN7B 4COUA 4B3NA 2OYZA 2JKBA 1RUJ3 3ZMOA 3CF6E 4CVYA 2ZGSA 1RUJ2 3WP6A 3AMPA 1VAKA 2DFCA 1DHKB 5CADA 1CESA 5FREA 1YYNA 5JR7B 2ZX0A 2V5YA 4M2IA 2YHJA 1VJ2A 2ZHNA 4N9HA 4URTA 1RUI3 1RC6A 1GVGA 3WG2A 3IBMA 2TNFA 2DWRA 3V0AB 1W39A 1OFSA 3T1MA 5JAXA 2AUYA 4UW5A 4Z8BA 3R1JA 3ZSEA 2JG8A 2VW0A 4FPCA 4KWKA 3HIFA 4IEYA 3VBRC 5D8AB 2EXJA 2XL9A 2H0BA 2RR12 5FMOS 1K5MB 5C4WC 1OTJA 4N53A 2DCJA 3LB9A 3ZXLA 2HWB2 1HLCA 4GMP0 3ZFEB 3ZFFA 3CJIB 4LLOA 4QMAA 3NO8A 2EAKA 4I2OA 1LHVA 3I59A 5C8CB 4IEPA 3PMSA 4AWDA 2VNRA 3MPPG 4B29A 1W0OA 3LA2A 2VVDA 2EXKA 2Z2SB 1QDOA 4JDNA 3N6WA 4WM8B 3VBUC 4CDUC 3M7AA 5AFBA 3V56A 3H50A 4ZU7A 2Q1MA 3JQXA 1VBC1 1OIJA 1FYUA 2PAEA 3B5LB 3RNSA 4LO6B 3PVJA 2VMHA 3AJYA 3RS6A 1QJX1 1QWRA 2GH8A 1ASJ1 1HV0A 1Y9QA 4GIQA 5DDJ1 1OQ1A 5K7PA 2CWMA 1C8M2 3DPRC 4Q4X3 1DQ0A 4QHBA 4P9WA 1AX1A 1CAXA 4MUVA 3ZXAC 1NE4A 3WW3A 1DQ6A 1J3RA 2VPVA 5KHHA 1RL3A 4QM8A 2Q4SA 3WZ1A 1A8DA 2DURA 2CAUA 2RS13 3GZUC 5GLZA 3WVJA 3R4UA 1H8TA 4GA9A 1ZBA3 2QZ2A 4COWA 1V9U3 4E2QA 5GZCA 3VL9A 3MIGA 1H9PA 1FOD2 1KJLA 3MW2A 1NXMA 3L2HA 1HRI3 1BBT1 4YVSA 5KWRA 4M0NA 3D0SA 1U5YA 3WG1A 1CX4A 4Q8LA 4AHZA 3RI8A 1TQ5A 4YLMX 4LHNA 1AJOA 3ACLA 4ATFA 3ZYIB 4J1WA 1JUIA 1SFNA 1SQ4A 1C57A 4Y1XA 1I3HA 2W0XA 3U11A 3WW2A 2VOVA 3H1WA 3J26N 1V6OA 3RZZA 3ZN4A 2ZAAA 3AP5A 5C6CA 1C8M1 1N1VA 3KLSA 4XF3A 3DPRB 2GMPA 4QPYA 2XJUA 4R9CA 4HPKA 2AH2A 2CTVA 3NJZA 2GU9A 4WM7B 4MGZE 1GQGA 2FHRA 4JGZB 4UW6A 1Q43A 2ZTNA 3WUDA 1TMF2 1X82A 2CGOA 4QGLA 3IDCB 5DDJ3 3CU7A 2XJQA 2PFWA 3RG0A 4LA2A 3ZSKA 1RUI1 3TB0A 1ND2B 1X8EA 3VBUB 4FPJA 1DGWA 1ZRFA 3GBWA 3E6DA 4GB32 4CDUA 4WVMB 1C8M3 2HWF1 4FT8A 2XKPA 5D1IA 5KHJA 1VBE2 2R073 1QJX2 2XBO2 4CEYC 4QQOA 1VBA2 1OIKA 5FO8B 1PGSA 1FOD3 1PIV2 1EAH1 3WOGA 2KA3A 1OIHA 2QZ3A 1WW7A 4Q2FA 1ULEA 5I8TA 4S2DA 3NL1A 2D7FA 1ZZBA 3VBRB 3VHNA 1PK6B 1DGWX 3KCCA 2WT0A 3UL2A 4XIKA 3UKNA 2YYOA 2ZS6B 1PO11 1U5IA 3KB5A 5FQ0A 4AG4A 4HANA 2Z5WA 3B3QE 4LHKA 1FOD1 2ZGQA 3E5XA 2ATFA 2DYCA 2WIIB 2PHRA 1AX2A 3KS7A 4UXAA 1ENSA 3D5OA