3KCXA

Factor inhibiting hif-1 alpha in complex with clioquinol
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human FIH-1 in complex with quinol family inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 102
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3kcxA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kcxA01
1YCIA 3KCXA 4B7EA 3OD4A 2WA4A 4AI8A 2XUMA 1H2KA 3D8CA 1MZEA 3KCYA 2W0XA 1MZFA 1IZ3A 4JAAA 2CGOA 2YC0A 2Y0IA 5JWPA 4Z1VA 2CGNA 4Z2WA 2ILMA 3P3PA 4QU2A 4NR1A 3P3NA 1H2LA 2YDEA 4BIOA 2WA3A 4B7KA 1H2NA 1H2MA
chains in the Genus database with same CATH superfamily
3TN91 4D6SA 5GM0A 3DPRB 4JI8O 1NA1C 4AI2A 1JQ0A 1V55C 2DYSC 3MIGA 1VQ6V 5FYVA 2LS6A 3H1HH 5GLTA 5CNAA 1JR9A 1GMMA 4YHHO 4MGIE 3JD72 5CYYA 5FL7G 1D4M1 1OCZB 3ZRWA 5A3PA 5FZOA 2FCTA 4PIXA 1MS3A 1B35B 3JBG1 1CN1A 1UIKA 3MV11 3RPQA 3HQXA 4XVHA 1QXJA 2AEZA 4ASLA 2WO1A 5IT6A 1AHSA 1WMDA 4BE3A 4XHBA 4WVVA 4X66B 4LF6O 4AVTA 1FS0G 1UZZA 4CPBA 2QDOA 2WWJA 5JDBA 1UU4A 5B1NA 5AFBA 4JI6B 1KECA 1N3QA 2OYQA 1ONAA 2UY8A 4LA2A 2W2IA 1QOSA 4K0KB 4AVBA 4RGGA 3O1SA 2JDZA 2HVKC 2A1XA 2UXBB 1C5IA 3E22B 2AXTZ 1O3QA 1HLCA 5FZ9A 3VBUB 1NQDA 1F4HA 1RP3B 3L73H 4HFSA 5FWJA 4LWSB 2EICA 4JI3B 2DE0X 2QTWB 3DXTA 2VZ1A 1LHOA 4DXTA 1IS5A 1CAVB 4FOVA 5A3NA 1FOD3 3K3NA 4IL7A 3T0BA 2NYYA 4D94A 1SFPA 1IGOA 3J81N 2A3QA 2AW9A 5DZGA 3ZS8C 2WUHA 4IE0A 3JSLA 2WWSA 4GKKO 4Q8KA 1QVFU 2WFF2 3WQBA 5IT9N 4LULA 3ZHSA 4P5HA 3M99B 2D7FA 1M57B 3QVNA 1DYPA 1K97A 4RN5A 4GMP3 1M56B 2X6AA 1MS5A 5EQUA 3IDBB 4AFCA 4HNAA 2VWKA 4RUEA 2XMLA 2YGMA 3C90A 2JD4A 4Q0QA 2VNGA 3JAWB 2VXJA 3VKNA 3UK9A 1VAKA 2PHDA 1VMFA 5DEDA 4QE7A 2IFRA 4FI9A 4GKYA 3N2GB 4DXZA 2OTLV 1TME1 3WB2A 5E6HA 4C7UA 3G6JB 1CAUB 4B3SB 2P4VA 5JCTA 2AHZA 3K5NA 2CGPA 4ASUG 3IDEA 3RZZA 3POIA 1NXMA 2LTNA 2W1UA 1LOBA 3P32A 2VQUA 2E3CA 3WP3A 3MBWA 2CTQA 1DGWX 4YFZA 3CZUA 3E8HA 4TSFG 4CH3A 2D40A 1DYOA 4RUFA 4GQ7A 2WLQA 2ZIMA 1ULEA 1ODMA 4LMFA 3WP6A 3T2QA 3VZKA 2CTPA 5HV0A 3H8XA 1UMHA 4KGQA 3KZIZ 3N2KB 4A41A 3B00A 3GM8A 1AXYA 1VPHA 4Y1YA 2WAMA 2XL7A 1ZLZA 5GTHZ 1NCRB 5LP6B 4QX5A 4D7YA 2VQEB 2CAZC 1KBHA 1QHDA 2YFUA 4NXNB 1YIPA 1IQAA 2BJSA 4TTGA 1GN4A 3BU7A 3O1MA 4U36A 5GZCA 5JIAA 1LUVA 1I7FA 1LCLA 3L2YA 4XMIA 4EWAA 5FXWA 5EHDA 3EHBB 5BMVB 3BN6A 2WLIB 1FOD1 3BPZA 2WO7A 4Y26A 2KB1A 5BY5A 3F95A 1Z0HA 4RQPA 1K7DA 1E5HA 1XE0A 3FHAA 1ZZ8A 4FOQA 1POQA 3ZCCA 4XUNA 4Y22B 2VWJA 1QBZA 1GN2A 4JI5O 4XJAA 4IDZA 5JOXA 1AR93 1CIYA 3WD5A 3AYDA 5I0DA 3J9SA 5BNOC 2WLPA 1MZEA 1POV0 4PLOA 1O3RA 1UU5A 4G4FA 1VBB3 4AHCA 3WW4A 4SLIA 1CD3G 1G8MA 1SACA 1YQ8A 4JGZC 2NMOA 4BISA 1XNRO 1QLEC 5F39A 1V9PA 4LP8A 2DVBA 2ZGPA 1OBNA 4MW3A 4IEVA 1AP5A 4X65B 3ZVXA 1X9PA 1REEA 2PY5A 2B5HA 4XUPA 2AZ0A 3DYMA 2D3OW 4NE9A 1AI5A 3FB5C 3AMPA 2JWPA 1W8FA 4YJ3B 4DV3O 1V70A 5BNNA 1QH6A 4QQ2A 4XFAA 4LUMA 3ZMNA 1S0GA 2BBVA 1CAXB 2VMDA 1VBC2 1YTFD 3SDLA 5F7UA 1J3RA 1X9TA 4XUOA 4XFFA 3SYQA 4Q0VA 2B46X 3WZ1A 4BMEA 1JS9A 2ZGSA 3M3OA 3N9MA 4MYEA 3JD0A 1AL21 2ZX3A 4UFZA 1VRH2 4LF5B 3WP5A 4FVMA 1RFYA 1N36O 3CEIA 4E4EA 4JGZB 1C8M3 4PI2A 3PVEA 5FBZA 1HNXO 5F32A 2C9AA 1ZBE2 4ISRA 2WZEA 2WQ8A 3D0SA 3K0GA 1XSQA 4FTEA 3A0KA 2H0VA 4FLWA 4XCBA 4DUYB 1HX6A 4AE2A 1SRYA 1KGYA 3IC7A 1RMU2 3K4AA 1PIV1 3L2HA 4MGYE 1W59A 4CS4A 1ZRFA 1G6UA 5ANQA 4JYBA 1L7QA 2A6VA 3F2ZA 1VBE3 1YJNV 3U4SA 4RHV1 4COUA 1WUVA 4CVUA 3TEYA 4E8CA 1UXZA 2EIDA 2EZPA 5F2SA 1C3HA 5EYYA 3K03A 1FAFA 1TVKB 5FNVB 2P6CA 4GB31 2D97A 3J8F1 3I59A 4AILC 1SLLA 4DYLA 5GZGA 5JJNB 3IAPA 1MG1A 1O59A 4H0LB 4ET7A 1LENA 3TNQA 1PNGA 3W59A 3GWKC 5FY7A 1RL3A 2VUDA 2W95A 4PA9A 1VQPV 1YCIA 3SISA 4FK5C 3FUQA 3OB8A 2NM1A 2YIDA 3VZLA 4EFBA 2JENA 1LTEA 1YZBA 5FK8A 1J58A 1OCRC 3RI9A 2R043 2X0LA 3FN9A 1OKQA 4Z92B 5IVFA 4NXMO 5FZOB 3AK3A 4ZPIA 1IXBA 3JD2A 1Q7YW 1UPSA 3LSQA 4UVCA 2YC0A 1U12A 5A3UA 2A7AA 2EXHA 5EFUA 3VBFC 2K0GA 5CA1B 4A4AA 2QWNB 2Y60A 5DDJ2 4CCEA 3CCJV 1YITV 4EB6A 4LBJA 4PF5A 2JX9A 1EV11 2ATKC 1QJX1 1XNTA 1XI1A 4AK3A 2RS51 3AFKA 1JOYA 1FYJA 5FZ6A 1PGW1 3O0VA 2GZWA 1HB2A 2Z42A 2GN3A 5DUVA 4O9EA 5F1RA 1W2UA 3E5UA 2WYFA 1MSWD 4FPHA 1LU2A 2NZ9A 3K5LA 2OT7A 5ABJA 4F83A 2F93B 3WCRA 2VZSA 3B40A 1HDKA 2VW1A 3OJBA 5FZAA 2WQZC 1YIJV 2R72A 5BUVA 4N9IA 3AKQA 4M3CE 4Z82A 2G9GA 5LP6A 1EPZA 2BU9A 2JGDA 2JKXA 5IK4A 1US6A 2R30A 3ICXA 3I3QA 4Q5OA 3D3AA 1WZXA 3RVHA 3I56V 1VQ5V 1B09A 5DAQA 1V9U3 4LORA 2R7EB 2ORXA 2D93A 4OMCA 1W2AX 4RO2A 3AJYA 5FPOA 1W03A 4LH6A 2OTJV 1ZBA1 4X1KA 2D44A 2BZDA 1BEV3 2HWC3 4LR4A 3E5QA 3BALA 2NPIA 1ASJ1 1JYIA 5F5CA 3SJQC 2IZWA 1VQ8V 4WBNB 3HD8B 1SBEA 3I54A 5FZMA 1TUBB 1PO13 3VBHA 2PHWA 4XZUG 2DVFA 2EIMB 3K9AA 2MEV3 2Y38A 3P3NA 2WNVC 3RYCB 2DWEC 1AL23 2ZGKA 4CZSA 1LRHA 1D4M2 1JZ7A 3W7TA 4YM1A 4O4IA 3POJA 2FKXA 3LEKA 3MW3A 1HR0O 2BDRA 4IL6Z 4DUZB 4C0BA 5CEHA 4W6WA 2VC9A 2CDYA 3BCCH 1DQ2A 4URTA 1LOAA 3IM0A 1GQGA 3T09A 3VQWA 1VMGA 1IPSA 1DK1A 5L7OA 1Y74B 3AVSA 1J5EO 1CZSA 5FZIA 4CDWC 4JPRA 1U5YA 4XJUA 1SQFA 4Y5TA 3D82A 1UCXA 2P6HA 2ZKOA 1GOGA 5KA6A 3B7MA 1SLBA 3JBG3 3D3IA 4WVWA 2DUQA 2JG9B 3IAYA 1WLTA 5LXTB 3FHIB 3GWOA 1ZYBA 3T1YO 5H2FZ 4DV4O 4JI1O 1SZXA 1OSGA 2EIBA 3APQA 3RJ2X 4CP0A 4I0AA 3VDDC 5FR3A 1LU1A 3ILFA 3JXSA 3GDBA 3LPFA 2V09A 4MZUA 4GWNA 2YICA 2XXZA 4A42A 2E5LO 1AJOA 1NKDA 1REDA 2RM21 2QKSA 1L7LA 4IV1B 1QJU3 2CY6A 1S5LZ 5FMOL 2XL9A 4X8PA 4Q1RA 5HV4A 4FLYA 3VZMA 3JD3A 3K3WA 2D5HA 2YIAA 1YJLA 2EF6A 3QBQA 4OULA 1HN0A 5L7OC 2NR5A 4UFHA 1U0AA 3DF0A 4NIAA 1H6XA 2D6KA 1RUD2 5JLVA 5KWRA 4Q6GA 4YY3O 2PLV1 4LO4B 4Y1ZA 4CA9A 2JS3A 1SLAA 2HWD2 4I01A 4Y4RA 2G19A 3NMBA 3WNLA 2J7MA 2HHHB 4B8EA 1UU6A 4XCAA 1HV0A 1OD3A 3JZVA 4KHPO 2RNBA 2WNVA 2NLRA 1NTMH 3SITA 3AMQA 4AAPA 1BS3A 4CEWC 1BSMA 2CL2A 4XABA 1RUJ2 5T3NA 1US2A 2UWCA 4KFMA 4O4HA 3FLTA 5IWAB 3SGIA 5FREA 2JK5C 1B04A 4UB8Z 3UESA 4HT1T 5FLHA 1OPOA 3AP7A 1KKDA 1WN7A 1VBB2 1W8OA 3KVAA 4M4RA 4LIUA 4BIFA 4DV6B 1XNAA 1W2TA 4IV1C 3IMMA 4H14A 4EN6B 4NJ4A 2A06H 3A22A 2VOXA 3KF3A 2OIEA 1UYYA 1DCSA 3NJZA 1R1A3 4WZCA 1DF4A 1WCUA 4QM8A 5C70A 1BYHA 3JD1A 3H42B 2VG9A 3N9LA 3A0RA 3SYOA 4PF1A 1CGPA 3VD9A 3Q8BA 4IEQA 1C28A 3A4UA 2OIGA 1AR81 2GDSA 1C8M2 3MW2A 1QJU2 1WMEA 4RQEA 4F7ZA 1DQ6A 1OMIA 2G1MA 1W9FA 1NTKH 1WW5A 2MHFA 4XDKA 3GCXA 5JH7B 4UWDA 3RMXA 4CXXA 4M0NA 1G4YB 2Q9LA 4Y20A 4DUXA 5BR8B 2NN8A 3ZSKA 1WKYA 3VKOA 3NJYA 1F5JA 1JXNA 2D6LX 4YW7A 4U7NA 3VB9A 4WCEV 3CF6E 4JI7B 3DKWA 1JN2P 3OYWB 4XZPA 3LNMB 4FBFA 1Z7S3 2EXIA 5LEKA 4AHZA 1BVP1 4QB1A 4XBLA 2VTFA 1AILA 3MHHC 4WM8C 5C3QA 1W05A 3SCHA 3OE7G 3AJZA 4W6XA 1LJ7A 4X6RB 2NLJC 2WAAA 1R3JC 4KP4A 5DZEA 4YGBA 3GHMA 1POV1 3LA3A 2LJ2A 5CBLA 4LNVA 1BBT1 2RR12 3DV8A 2RHPA 2UXNA 2DV9A 1H8TB 4DR6B 4AYUA 2DW4A 4FFKA 1E5IA 4JV4A 2LROA 1D7PM 2W0XA 4JV5B 5L3BA 5A70A 3E8BA 4AWDA 3VBOB 1QNYA 2Q8CA 2PYLA 4DINB 1GKFA 2RQ6A 3W7SA 4K40A 1WLEA 4IGGA 4U2AA 3FX7A 1UKRA 1IBMO 4LKFA 4LF5O 2CWSA 4XDOA 1H9WA 4KXRA 3TOJA 1LULA 4E2LA 3CO2A 3E97A 4GT1A 2HYKA 3OY8B 5A6QA 3A2FA 1H2NA 5KXDA 3ABKC 2DQ3A 5E8AA 2P4KA 4YIPA 4H7MA 1KJRA 2FMDA 5CBFA 4AEDB 2UXDO 2FYUH 4WM8B 4QX7A 5CFDA 3WDTA 3CRRA 3OF1A 1OA4A 2A3XA 2VQEO 5EZWA 2KM2A 4I3PA 1V6MA 1CZVA 5LHGA 3AG2B 3NRUA 3S7EA 2A6ZA 2HJDA 2P06A 3K75B 5KR7A 4JDOA 1EAH2 2OX0A 2DFBA 2AACA 2ETEA 4CBCA 1QEXA 1Q6UA 4QPYA 2A0LA 5H5NA 4HK8A 3D36C 1JOBA 1Q3EA 1AUYA 5C9AC 1LOCA 2Q7HA 3K57A 1M06G 1BQZA 4A3XA 5IJ0B 3VOUA 1WLCA 1LODA 5DUUA 1BHAA 3JCUZ 1KS5A 4CPBD 2OQ6A 4MVQA 3ZHTA 4H55A 3TN92 1V54B 1OZ0A 3K51A 1F7YA 3UGFA 3JALB 3WV6A 4TV8A 2QA4V 2YGLA 4OLLA 3ABUA 1QQP2 4PDLA 1JZ6A 5GLWA 1EM1A 3FB8C 1HRV3 2RG4A 2BBAA 4CDUA 2X5IB 2X7RB 2VBBA 5A3OA 5LL6Y 4DQAA 3IIAA 2B5UA 1Q8QA 3AG1C 1S2EA 4GH4C 5GTIZ 4QXKA 4GD4A 3WG2A 1R1ZA 1A8DA 1BGYH 1RHI3 4FTSA 4DEVA 1NCQC 1UYZA 4GXLA 1N8RW 2VZRA 1A78A 5J2TB 1YFXA 3RZLA 3PHMA 2YHJA 4QDSA 3PUQA 3RT3C 1IBLB 3GF6A 5ACA3 5FV3A 4ZU5A 5T52A 1CZTA 3ZXAC 1GP4A 1LNQA 2PI4A 2IXIA 4QX0A 2WLNA 4LFAO 3WB0A 2KQXA 5A6ZA 4QPGC 1TVGA 3RVZA 1OHHG 2V1DA 4BWAA 4RQPC 3WDUA 3DC5A 2QVSB 4Y20B 3UL2A 1BXHA 2E32A 5FUPA 3MUY1 4CSWA 4K1YA 4QD2A 1ZRRA 4MG2A 2C9KA 1WW4A 3IJ4A 5HCFA 1XQ8A 2FHRA 3ZDVA 2UU9B 3OM3B 3D5OA 4UT5A 3SJBC 2ZX1A 1BMV2 3ZX7A 3WLUA 1XYOA 4M00A 1K3EA 2X10A 2PELA 2OVUA 1R1A2 4BDVB 1FXKA 3H3LA 2GV9A 4E8DA 4AW7A 3ZOIA 3OSDA 4WFHA 2W0FC 1GZCA 1NH2D 5LK7B 1K4CC 4FPKA 2HR3A 2GNMA 5FUNA 1K73W 3ZKUA 2DCTA 2WLMA 4GJZA 2RS33 1ENRA 4A7KA 5HXVA 1GP5A 5B1AC 3GYDA 1SPPA 5EXOA 3CMGA 1PK6B 4X1IB 2WL1A 1V55B 3ZN5A 5A1AA 4JI5B 1SC5B 1FNZA 3HKDB 4LEJA 4QJFB 1UX7A 2EIJC 2WZ8A 2JG8C 1XNBA 4BQ2A 5A2QN 2Q0OC 2GTSA 1NJIW 4Q4Y1 4PIYA 1NX9A 1SLTA 4LHNA 1VF7A 3HKDA 1LAJA 4LXLA 1MPXA 1OV9A 3VD5A 3WF0A 1SERA 2DWDC 1EYBA 1NYWA 2EVXA 3LDKA 2OQ7A 3POEA 4RS5B 1WPBA 1QQP1 5FYTA 2E76B 2YS8A 3OTFA 5JQGB 3DSQA 4P9WA 4FLTA 3UO2A 4FPFA 2J1TA 2HWD1 1EAH1 5CADA 3K4ZA 1NXD1 3A21A 1XL6A 5K8SA 1F4AA 5L3GA 1NS1A 3F7YC 1IHMA 1SZTA 4OHYA 1MACA 1N36B 3RW0A 5J37A 5DUXA 5FTTC 1XEQA 1OFNA 4RGKA 2P3JA 3BY6A 4KG0A 3VBUC 2B9VA 4I0XA 3MDPA 3ZYIB 4QQHA 3W5MA 1S0JA 1COV1 5KBFA 1GFF2 2PAEA 2W91A 1I3HA 4YGEA 3S3WA 1VEWA 4BLJA 2Q1MA 2PYJA 1VRBA 4AQSA 1CESA 2GMPA 3D8CA 2C0ZA 1AJPA 1DHKB 5IFPA 1J83A 4O4HB 1UZVA 1V9U2 1UW8A 4E4ZA 4DMIA 4PBPA 4CH5A 2DVDA 4MGTA 2PUSA 2GSMB 5CA1A 1UOGA 2DYRB 2YI8A 3C7OA 3UV9A 3AG2C 1M57C 3EFFK 1PO22 4EWDA 1K33A 4MXVA 4NHLA 1JZ2A 2BNMA 5JAXA 3POYA 3H01A 2JKBA 4Q8LA 2ZXQA 3CYOA 3VBOA 1G86A 2QR4A 4OI0A 4LF4O 4NIHA 1D4VB 3CC4V 2PN5A 4ZXKA 3V64A 3G7DA 1WCSA 5JPMB 3SPGA 5FFOC 4TN7A 5I0UA 1Y4MA 4D3WA 3GJBA 5FMDA 2DMXA 4ES8A 3O1TA 1A34A 3SQOA 4UI9L 2YBKA 3DECA 2Q68A 2ZGUA 2XPJA 3UJQA 3ZMVA 1R6NA 3T2MA 1H6YA 1OC1A 2DF7A 1QIQA 2DUOA 4Y5SA 3FUOA 2DTYA 2ARHA 3IPVA 4YW3A 4BW5A 2XJQA 4E2SA 4WFGA 5IK8A 1G6NA 1J59A 3ACFA 1RC6A 3MIHA 2ZTNA 1VQLV 3E86A 4WBNA 4BM8A 5FLIA 5DDJ3 4FZ0A 1RB8G 1D2QA 1BL8A 4N43A 4RR3A 4XOGA 1S2BA 3LFMA 3IKWA 4QX8A 3BIEA 4FP3A 3HWJA 3N2GA 1YFWA 3T2PA 4K20A 3HBKA 2OXBA 1IURA 1R6TA 3WW3A 1BCXA 1SQGA 4KBBA 3OTOO 4NHXA 2XR4A 3E6CC 5J2TA 5J96B 4O4IB 1H8EG 2ZHMA 4FFBB 3GZEA 2E5LB 1RSOA 5D8AA 4CDWB 1XL4A 3T30A 3BFRA 4IHJA 2BSKA 4MHUA 4XTMA 2QWQB 4EEQA 4FP2A 1OFSA 4JX0A 3KM5A 5EYPB 2WN3A 4CCNA 1BJQA 1SLIA 1KITA 3A23A 3ILNA 4W6YA 4TZDA 5CA0A 3RYIA 5KHJA 1W6OA 5LB6A 2HJIA 4HPKA 1PVXA 1R64A 1TUBA 2WFF1 4DR2B 1XSRA 4PV1B 4EZHA 3OPWA 5IVYA 4N7UA 2JDIG 2P3IA 4X64O 3O12A 2VUAA 2VQFO 1Z7S2 2DFCA 2IM9A 3RJRA 5HCHA 1YJWV 2G9FA 2VE1A 1LHNA 5L73A 3UGHA 4RHV3 1A6CA 2JGDB 1QU7A 5L36A 3U78A 4FCAA 4W65A 4LK6A 3JAMN 1TGOA 3MHZA 2AC1A 4P02B 3LA7A 5FP8A 2O8OA 5L7OB 1XNDA 4AEJA 3BUCA 3OBRA 3TN93 3MZHA 5FXXA 2CSGA 1VE0A 1RUF1 2B45X 3PNAA 4L8QA 3ZXLA 4UVAA 4JTNA 5JVDA 4KWUA 2EIJB 4AHXA 4EN0A 3AG7A 2V4DA 2ZE6A 2EA7A 3AG3C 4Y3OA 5LGUA 3AYCA 1NQJA 3NV4A 4B4PA 3ZLIA 5C3OA 2HBTA 2GSYA 2WNOA 1VARA 4YYOA 4QU2A 1YUDA 1H2LA 4JI6O 3H1LH 2N7GA 1B6QA 5JZGA 2C26A 2IH3C 2J22A 3ZSEA 3AZYA 1EV13 2JIZG 2XG3A 5IJ0A 3B2EE 3WF1A 4RWUA 4DY5A 2ZMLA 3U75A 1FFXA 1W04A 1RVF3 1XREA 2GC3A 1H2MA 2ZJCA 4P9YA 1ZRIA 4QPJA 1Y4WA 3KLSA 4UCSA 1W8WA 1ZSPA 4EN8B 1M93A 3EO6A 1U5XA 4GUNA 4BIUA 5FXZA 3USUB 2HWF1 1JFFA 1HWYA 1IVSA 1N1TA 3L70H 4OHWA 4XDJA 4LKDA 3Q8FA 1OLME 4ZS3A 3J7AU 1DYKA 2ZIOA 3I8TA 3RNSA 1BEV1 2HWC1 1AR73 2Y6GA 2W1SA 3APBA 1E5RA 3ZIWA 2O57A 2BW8A 1HNWB 3FE5A 2UXCB 4E4HA 1MOFA 3NW4A 5IYCO 5FYUA 2OYZA 1YIFA 2QE3A 1GZ9A 1PM9A 1W6NB 3K5MA 3ACGA 4LNUA 3QNEA 4L2NA 2YSUB 4LQRA 4TLGA 2G38A 3GVMA 4NIIA 1BQPA 2B1GA 2ZHLA 3MICA 4DXRA 4QGMA 2QQJA 4UCRA 1QJFA 3WG7C 3ZXKA 1AJKA 2W92A 2IU3A 1D2DA 3N9PA 2HWE2 2YBPA 2GNTA 4WM7A 3N35A 3WUCA 2YXLA 2VZ3A 2WN2A 3O1OA 3ZYGA 1H2SB 1EY2A 1RHI1 3ACLA 4PDWC 1BK0A 5EBMC 5E88A 5KA5A 4I0XB 4L9BA 5A3MA 3X2QC 3PUSA 1Z5WA 2JJ6A 4WVZA 1H9PA 5GLUA 5LCWL 2VR4A 1PO11 3JYCA 3AK2A 4XILA 2VBDA 2B4KA 3H1MA 5JUVA 4I4TA 3E2EA 3PUAA 1H8TC 5DAXA 2V4VA 4XIOA 1S4CA 1IX9A 2BOCC 1VMHA 4XJ9A 4NYKA 3MPPG 3BHPA 3N7KA 4B3NA 2XLFA 2A79B 2MK3A 3SKJE 2PLV3 2XTAA 3VL8A 5C8CB 4ISQA 4YM2A 1GNYA 1O8PA 4DUYO 2I74A 1P49A 4JI4O 1ND2A 1SESA 1DP0A 4B1MA 4OXSA 5FXVA 1DF0A 4AI1A 4X1IA 4J1WA 2YXYA 5FP9A 2DVGA 1S2KA 1SQQH 4NWWA 5CB7A 1AR5A 2EIKC 1NQTA 3AL6A 1J1LA 4M01A 1HNZB 1LGCA 2RS52 4LHLA 2E7QA 2WA4A 3RS6A 2O1QA 2B1IA 3CC2V 4DR4O 3USSA 2AUYA 4QDRA 1QMJA 3MFAA 4QB6A 2WWUA 4KWKA 1C4RA 1RUD1 3W7WA 2XHKA 1EZJA 1OUSA 3UM7A 1Y9QA 4EZ4A 4CCLA 4LKSA 5FQ0A 5JQGA 2ZX2A 2IJKA 4MTOA 2P6JA 4YVSA 1FKAO 4R4XA 3AM2A 5I0TA 2RR13 1HRI3 4GALA 1OVPA 2FMLA 4QWNA 1D0HA 4HVRA 2LW7A 5C8CC 3B3QE 2XOMA 1KDKA 4LBEC 3T08A 1P8JA 1RUI2 3H1YA 2TNFA 1YWKA 4HPKB 3CRCA 1KMIZ 5FZKA 2YC2A 3K79A 1AR92 2F95B 4DEQA 5FUIA 4B29A 4OZOA 1HB3A 3SH5A 4QKBA 4LK7A 2LGWA 5ANNA 1HXS2 2WSVA 5K4LA 2GUZB 1RHI2 2GH8A 2LP7A 4XTPA 3C3TA 5D8AC 4DV3B 1OF4A 4MVUA 3ZRVA 5HXMA 3J7LA 4CH6A 3VHPA 2Q73A 4BXFA 3IAQA 2JEUA 3TXQA 1MA1A 2Q8OA 1PNMA 4UAPA 1RJ7A 5A33A 3CX5F 4RAIA 1BCCH 3F5TA 2HWD3 5IJ9B 4Q0UA 3ZIXA 3RYFB 4E4DX 2ZA9A 2YBSA 4N7IA 3ZPOA 5ACA2 4N21A 4MVSA 3CCLV 4R4ZA 4FPLA 5DAPA 2OCHA 5FY0A 1GBGA 2W3JA 1EN6A 1WB7A 4YJ2B 5FZDA 2JDAA 4H2AA 2WINB 4CDQC 3GGLA 3C2UA 3VBBA 3IMNA 3ZDSA 2PF4E 4O61A 1T5EA 2A75A 4QPGB 1GNZA 5LHIA 4F8AA 2QSAA 3WNXA 3FB6C 4YW5A 5A32A 4XDLA 1HKDA 1ENSA 5IW0A 3BTXA 1HRV2 4G28B 4FLUA 2ZX0A 1M90W 4LO7A 5D8AB 4QAWA 4HNAB 1R6KA 1QQP3 2DCZA 2R16A 2CYFA 3FD9A 1PZ7A 1D4M3 4JKMA 1BMFG 1E57A 4QKFA 3BVCA 3HQUA 4S2GA 3ZFFB 3CIHA 4QPIC 2Q1FA 2HEPA 2LUWA 2HBUA 3C7FA 3ETGA 2B9ZA 1LNSA 5FKCA 1QNMA 3AK0A 3K77A 1AYN1 2VULA 3ZR5A 1XMQB 1KEXA 2QQWA 4QNHB 2KR2A 4MHRA 4JGSA 4GJYA 3BTZA 2JDHA 5T5LA 2YPJA 1BLZA 3JARA 5IVEA 4FFIA 2OPKA 3NV3A 4JDMA 2ZR2A 3PU8A 2E33A 4NHMA 4C8DA 1ZM1A 3Q8EA 1UFIA 2DURA 2GAUA 3JALA 1PK6C 4AI0A 1W9TA 5L19A 3WG7B 2IXCA 1QHTA 1QLNA 3P1IA 3OMNB 4DV2O 3JU9A 2BUKA 3WF4A 4OHZA 3MF6A 4N9HA 3D3QA 1ST8A 4UOJA 3WG3A 4Z2AA 1X59A 4V2VA 2BOBC 3WUDA 1Z7S1 5DMYA 3LKJA 1SKVA 5L3FA 2R70A 4QT6A 3KT4A 4PDWB 2PTMA 4X1YB 1HRI2 1I9RA 3WQ1A 2QQVA 3INAA 2OZJA 2JB4A 3UQ8A 3CRAA 3K3OA 2VMFA 3TYJA 1RUD3 5GALA 4K8FA 2CAVA 4FFFA 3C7EA 2BQPA 3NNFA 4MVOA 5JOWA 1R081 4ZI7A 5FLJA 4AQ2A 2QQLA 5FPAA 3OBAA 1JYWA 2F66C 4KGGA 2BTQA 1H30A 4AF9A 4RS5A 3FLPA 2ARBA 3STLC 1R093 1RXFA 5CFDC 2FDGA 2A6XA 3J80N 2FBEA 3AXDA 3ETDA 4CH4A 5FPZA 3C8XA 2XT9A 3MDSA 3OGIB 4KNCA 1NA1B 1W6NA 2IXKA 4XQ4A 1ZRDA 3WEZA 1JMUB 2R042 2XASA 1JU3A 5JH7A 3RFRA 1ZZ7A 3ASNC 2VTXA 4Q4V1 2GTAA 1WA8A 3VBHB 4W8JA 1Q6HA 4OGQB 1TZOA 3DL3A 4L99A 2R49A 1CAVA 1PHMA 4FQ4A 2IJJA 2ZMNA 1PO12 1S3JA 3CU7A 5JR2A 1HRV1 1PX3A 4BHPA 3LDEA 3BPSA 4PHZA 1VBA1 4XPVA 4IV3B 1BEV2 2HWC2 2XQXA 4FM0A 3DGEA 1X8MA 4R8CA 4TSVA 2WIIB 2YXHA 2D2CB 2H6BA 3VDAA 2Y4UA 3TEXA 3P3PA 4AL9A 4DNYA 3R65A 4LE4A 4WM8A 1G7YA 3ZFEC 4Q20A 3H1IH 2MEV2 3TETA 1IS4A 1GKBA 1NY72 1GQHA 4H44B 2EAAA 3O65A 3RWRD 4UBGA 4LNUB 5LY2A 4YW6A 2HLDG 2EXJA 1HXS3 4LBOA 2BTVC 1RUE3 5BNPA 1T6GC 1KYOF 2JECA 5CZKA 2BOJA 1K9MW 2PHTA 3JB4C 5F6KA 5FYBA 1RUH1 1C1FA 5LBQA 1VJ2A 3PJQA 4QPGA 3WX5A 1KUQA 1F8VA 1CVNA 1HIXA 2AGAA 2FQPA 4AVAA 4RFRB 3ZN1A 5JI7A 4B7EA 1OOPA 3T1LA 4YRDA 3TEWA 2R32A 5LOVA 1RPRA 2RM22 2XQRA 3I3BA 3NKGA 4EN7B 3HB3B 4P5YA 1Y66A 5L9BA 3DXUA 3HKEB 3ETQA 4K3AA 2XJPA 1IBLO 2V72A 5LA0A 3UT5B 1ROPA 4P9XA 1Y74A 4DK1A 2LW1A 5FKBA 1EPWA 3ABTA 1RUJ3 1NCQA 2HHHO 1AR91 5FOBB 3T1HB 5CFCB 3H9VA 1AYN2 5FLXN 3DXRB 4NAOA 4FLZA 2GALA 3M7MX 1XMOO 1CXZB 2UUCO 3ZMTA 1SG3A 2UUAO 5C9AB 3TK1A 1XNQB 3EVKA 4JZ2A 1JI6A 4CDQB 2QKDA 1NT0A 4F6RB 1IKQA 4JGYA 1OA3A 3I2KA 2IXHA 5H9RA 1K5MB 3ASOC 3UKVA 4QIWF 5F5QA 4FJCC 1W3XA 4X64B 2XAGA 4LFBB 1YSCA 4B1LA 1M4UA 4M3CA 3I59B 2ZHKA 5FYIA 1VB4A 1V54C 1W3VA 2IFWA 2WNEA 4HK9A 4NTXA 2X05A 5A32B 2ZX4A 3CLPA 1V0AA 1FV2A 1ZX5A 2Y6FA 1K5QA 1AXKA 1LEMA 1VQ4V 3LDDA 2VZUA 3S57A 2RDRA 1VBD3 3AC0A 4L11A 2R061 5LYJB 4I5SA 3BKZA 1ZL8B 4COYA 5FZ8A 3AG1B 3JUUA 3OUHA 1ZZCA 3L9DA 3J8F2 4UCUA 1Z78A 1ZZBA 4IQPA 3BA8A 1BQ0A 2ADDA 4GH4B 4QPIA 4J9ZB 1XE7A 4RFT0 5HFLA 4JGYB 3T2OA 2BTOA 5C4WB 2FL4A 2Y0OA 1Y67A 3AXEA 1LKNA 2N05A 3I7DA 5D2AA 3UNPA 5HCBA 1NLQA 5J2UB 4XURA 4CC6A 2XBO1 3GXUA 1AR82 4MVRA 1N1YA 2ZGNA 4IUGA 4WBBA 4GYCB 3CE2A 2VQTA 2RJKA 3LAGA 4QHBA 2ZT9B 5B4XA 5IYZB 5DXDA 4DW1A 3VDDB 3WSOA 5CBHA 1SA0A 1CP9A 4EJRA 2SBAA 4Q4X1 2YROA 1LUWA 3GALA 4QPKA 2A3YA 2DCYA 1W0KG 3RVYA 1IS6A 4B3TB 5BR8O 4AQTA 1JUHA 4BR6A 5BMVA 3R05A 3BVOA 1ENQA 2LW8A 4XAAA 2R073 1W99A 4DV5B 5FMOS 1VAMA 1APNA 3ZYBA 1AR1B 2A73B 4C1XA 5BNQA 3M3CA 2YY1A 5HI0A 3G71V 1VBE2 2EALA 1G9AA 4JYAO 5E89A 2D6NA 4MTXA 1QR8A 2HJFC 5BYNA 5FDBA 4LO5B 3E8FA 4I7ZB 1X8EA 1AVMA 1I5ZA 1LHWA 1EZVH 1WD4A 2HWE1 3EMRA 5F2WA 3H8OA 5A9GA 3BOWA 2ET1A 1F23A 1U5IA 3H50A 1MS4A 4HVOA 2LALA 3MV01 4N43B 4RR3B 4D6RA 4XFCA 3SYCA 1QH7A 4NB5A 1VRH1 5B1AB 5BXXA 1W8UA 3T0DA 2WWWA 5GZDA 4PD4F 4PIZA 2PHXA 1QJZA 2OZ6A 2QWOB 5H9QA 2ILMA 2XONA 3OBTA 4IXLA 4JF3A 1BE3H 2X5IA 1ENVA 1FPOA 1WP8A 1GZWB 1X33A 2C2AA 1NKGA 3W58A 4LLFA 3T4HB 4CUGA 4C91A 3VBHC 1AP6A 3TEZA 1VQKV 2P17A 1OI6A 1Q5OA 1S76D 2ZHNA 2WA3A 4NO4A 1W6MB 2VAUA 5LMNB 5D1IA 4OFGA 4COWA 2R9AA 1RUG1 1TE1B 1UZ0A 3WF2A 4I4TB 1Q8VA 4LF7B 4YVSC 4Z07A 3ZX6A 1GP6A 5T50A 3JSNA 1O4TA 4PJYA 4MT8A 2Y0PA 5LBEA 1U97A 4ZHNA 4XF0A 3WU2Z 1ORQC 3T1MA 5FZ7A 1YJ9V 1N3PA 2WFF3 4JC1A 3S30A 3ZFEB 3RYKA 2NN4A 4NRQA 3U0ZA 3E1F1 4IEPA 5EC1C 3WNKA 3S3XA 5KHKA 1H2GA 3IIIA 3LF7A 2OIIA 1OCCB 3S7IA 4QGPA 5EYXA 1WLDA 5T5OA 3WP4A 4CP2A 4BCUA 2GP5A 3RYCA 4IESA 4LUKA 2VCAA 4YLZA 4B3MB 1KP3A 4LBQB 4LBMA 1SFNA 3THDA 3LZZA 3WW1A 2RMU3 1U96A 3E8GA 4NMIA 1E5SA 3SEPA 5FPBA 2A6WA 4AQ6A 3AVRA 2BP6A 1IG0A 3FFZA 2MEV1 4BWOA 2P67A 4CE8A 1E1RG 1W28A 1FXZA 2VCMA 4YVSB 4CDXB 5FZ4A 5L9VA 3APOA 1ZBE3 4AZZA 1I0HA 3OTOB 4TUYA 1PZ9A 1QR9A 1SQBH 2XJUA 1SF9A 4NHYA 3VHRA 4NXMB 4BQ3A 2H94A 2D6OX 3K04A 1EUUA 1CX4A 3OGGA 1GM7A 5J9PC 2MPFA 4I3GA 1DZTA 4A7YA 5FMCA 4OQ8A 1H8HG 1O3TA 3M8LA 1UJWB 2RVAA 4MX3A 2B9UA 1K4DC 4J10A 1FAYA 2D3PA 4PDWA 3T0AA 5DDJ1 2ADQB 1F15A 2ITCC 2CU5A 1ZZ9A 1JYNA 1HP8A 3CQOA 5DAWA 5FYHA 3VZNA 4DRVA 3L9JT 1IPKA 4UUJC 1QXRA 2VZOA 5FY9A 3A0HZ 3QLQA 2UXBO 3HKCB 2UU8A 1H4GA 1W2OA 1REFA 4QGLA 3IC9A 1J1TA 1NVPB 2R071 2EXKA 1SBFA 3VBFB 3AG4C 3VDDA 4M4PA 4YNIA 2Y0IA 4GZRB 2UXCO 3MO4A 3E83A 2G9ZA 3R6SA 4BB3A 4D7TA 3E22A 4E4SA 1F4NA 3ATGA 4AR2A 2OWOA 3MLJA 5LHHA 4XFHA 4NWVA 2VECA 3O7OA 4OYUA 4X20A 3QTCA 4XXAA 1NE6A 1OJHA 2C1FA 5IY5B 3JQWA 5F3CA 1OURA 2O0OA 1NG0A 2EIEA 3ACIA 2XJTA 2BWAA 2A3WA 1DGLA 2JB8A 2K9PA 1S0VA 1MVEA 1UYPA 1I6XA 4XFGA 5JVVA 4FPGA 2WZPP 5L9RA 4RQFA 4YWAA 2RDSA 1N0NA 5T5PA 3TGUH 2UUBB 5J36A 4CEYB 3Q8AA 1GM9A 1AYN3 2BVVA 3WNMA 2V7QG 4JTAB 4O2BA 3J7MA 3B93A 2P2KA 3NXSA 1OOPB 4O9GA 1XUQA 2EJRA 4Y1XA 2XVKA 3K4DA 2FDHA 1AX1A 2DCJA 5J1XA 5BNNC 2E51A 4BQXA 3I2IA 3K9SA 1PM4A 4M3CB 5LA2A 1CAWA 2WRAA 3AMNA 4D7SA 4R9BA 3WQ7A 2IXLA 3LDCA 1WLWA 3JARB 4J7KA 1CAUA 1Y3TA 4ZU7A 2WNVB 2P90A 5EPAA 4P9PA 2BOIA 3OCPA 4JI2O 1I94B 5B5EZ 4O4JA 4JGZA 2ARAA 4LOSA 4YW4A 1HNWO 5BPXA 4L0PA 5LP6C 3E6BA 4W4ZA 1JZ8A 1N0JA 1MVQA 1H0BA 3BTAA 1TAEA 4I9QA 1QVGU 2TUNA 4CEYC 1SQ4A 5LY1A 4S2DA 2RDCA 1WA4A 3ZXJA 1R091 3T2TA 5I0RA 3WXPA 1MZ6A 4YHHB 1LR1A 2WS93 2XAFA 1GANA 4K8ZA 3LFIA 2H6CA 2CNAA 3FHQA 1AI7A 2P34A 1Q8OA 4DR7B 1AR71 2AREA 1ND2C 3CS5A 4P08A 2J1EA 3AEIA 1UAIA 5CU1A 1F9KA 2K9ZA 4NAMA 4AI3A 4COZA 1PL0A 2E74B 4ICGA 5LGTA 3ZSMA 2VXRA 4L97A 3ZFGB 1XMOB 4Q4Y2 3VN4A 3UETA 1LECA 3VBFA 4PLMA 3VD4A 4X62B 1LESA 4TV9A 3FAVB 1F35A 1K92A 4R9AA 3CCEV 5JMCA 4Y5Z0 4XFBA 1KFUL 1XILA 3D6EA 4R7CA 1UX6A 4JTOA 2VZQA 3O9OA 3F7VC 2WR9A 1L7RA 3PUHA 5FPUA 3HQRA 1Q8PA 1PVC3 2JIJA 4LFBO 4XBQA 3ZXFA 5M0TA 3HR0A 1QJY3 2XUEA 1LHUA 4UW5A 1GTOA 3IGAC 2Z0AA 4NVPA 5IVBA 5CB4B 2O8QA 4LR3A 2J1AA 5EZYA 1I08A 4AEKA 1R1BA 3LEIA 3HPNA 3JQXA 3H7JA 1OQDA 2B39A 1R082 3W21A 4OCTA 5FIXA 2ZD9A 4LA3A 1RUG2 4DUWA 1FFXB 2ZE8A 4EQVA 5IE9A 1CONA 4EN9B 1YO8A 5KAIZ 1XU1A 2E31A 1UZWA 5J7MA 1QQCA 4FT8A 1GO3F 1N32B 3V56A 3LIGA 4JHTA 5GLZA 2W1WA 1HB4A 3N7LA 2UYAA 3PIJA 2C5DA 4LLOA 2WT1A 1DQ5A 2B8MA 1FMD1 3RWNA 4QDQA 2KG7B 1Q56A 2VOTA 1LOGA 1MQTC 3H7YA 3CKHA 4DO0A 1SEFA 1H1AA 2RJZA 1XNRB 2MNGA 4GAZA 2IW5A 3NNJA 3X2QB 1DQ0A 1NT2B 5IYYA 2XBO3 3CCQV 4MXWB 1NU1H 1LR5A 3CJHA 3P6BA 1V6NA 2ZDIA 4PA3A 2BVBA 3JB8A 1RUC1 3A0NA 4B3RO 4O65A 5FZBA 4I55B 1AX0A 2AH2A 2TBVA 3VHOA 3JBG2 5C33A 3UO3A 5A1LA 1W06A 4CXYA 1M4WA 1FMD2 1S0DA 3TAYA 1CWPA 4NROA 5F5AA 3LEMA 1A3KA 1RMU3 4A2UA 2WPDG 2ID4A 4FM1A 3USUA 2ATFA 3POWA 2R0HA 4IEZA 4QPWA 3CHXA 3VBRA 3POBA 3AX4A 1GNHA 4Y1VA 1L0NH 2DYRC 2OCCC 2WJSA 3B8NA 4QXHA 5IYZA 1CPNA 2W9XA 3UJOA 2GHYA 3CJHB 3KQ4B 3ILRA 3GBWA 2EIKB 1AL22 5JR7B 5FZGA 1WB8A 4XMAA 1FPN1 2AZ2A 1IS3A 3PTRB 1P7BA 2PHFA 2ZDIC 5CBGA 5I8YA 1TQ5A 2YEVA 5A7WB 2JDKA 4IEXA 3T3YA 4HZ3A 5GZFA 1G9BA 2ZGTA 4A7ZA 1JHNA 1MR5A 2ZE7A 1QY4A 3OPTA 1B35A 2ZGOA 2R062 3I2OA 4CP1A 3ECQA 1W8ZA 2XHBA 1CJDA 4Z8BA 1VQ9V 3TRSB 4LF9B 1E79G 4DOUA 4DY3A 2VJXA 5CFCC 3O5SA 1SHWB 2VMGA 2BFUL 4UXNA 4WF9V 1NAEA 3MHSC 4X9QA 2J1SA 3MI8A 1K34A 3RI8A 3ZBHA 1YRZA 1FJGB 3FFQA 4JZRA 1O91A 4JYYA 3TB0A 1VP7A 1OCOC 3RYIB 5CA0B 4LITA 2JG8A 2J42A 1DZQA 2UU9O 4LF8B 3AKTA 4ZHQA 4AVCA 3J4UH 4XBNA 3FC0A 3AKSA 4N53C 4Z2WA 3MGUA 3HEIA 5DZFA 1XE8A 4FIPC 4P9IA 4AFDA 4AG4A 2QNKA 4IYIA 1LOFA 4FFBA 3TNPB 4AQYB 3FAVA 4RYDA 2JDNA 2WLHA 2BE3A 1PGL2 3LB9A 5FP4A 3AP4A 3HKEA 1OLRA 3ROUA 1AR63 2Y6JA 1IBKO 1IPJA 2HH9A 2Q69A 2VOVA 2JGUA 4FPEA 3VQYA 4KWLA 3FBYA 3HN1A 1ND3A 1OD5A 1VR3A 5EJZB 1X7NA 4LFCO 4P9GA 3O1RA 1LOFC 3BODA 1UF2C 3B8MA 1SLCA 2ZEYA 3QH7A 5FYMA 5LA9A 4E2GA 4ITCA 1FXKB 5IVJA 5KUKA 1DDLA 5BNPB 2LQTA 3K0DA 2W6IG 2WO3A 2JICA 3KV5A 2ITDC 2IC1A 2QQIA 1RUC3 3CJIA 3OD0A 5LASA 1AYM1 1HV1A 2C24A 4NPRA 3OUSA 5F2VO 3CZJA 4CU6A 5GW7A 3S6PA 1P7GA 3WR0A 4EROA 3M70A 3VBRB 2FZ1A 4PA7A 2F4VO 2AEYA 1W90A 2IVJA 2WABA 4UW4A 5A1FA 5AFEA 5FYSA 5K1XA 4XQWA 4CEYA 2BCCH 1GM8A 1AJNA 2YB7A 1GWMA 3RYFA 1YYNA 4QX2A 5JCOC 4G27B 2F4LA 4IE4A 4ORFA 3M7AA 2FZ2A 1VBA2 4D6QA 4YZ2A 3ZN4A 2UYBA 3AG3B 5CMUA 4GH4A 3PLQA 4QPIB 1QDCA 1GN3A 2HWB3 2EINB 4CCMA 3WF3A 1JW6A 4CCKA 2W46A 3DC6A 4X20B 3ZYHA 4UB6Z 4ASMB 1W6OB 3MIBA 2RS12 2VVEA 3TJTA 3OGCC 4XETA 4MW8A 3OGVA 2QQNA 4B7KA 4R52A 4KHPB 2PHUA 1RGSA 3DYOA 2ARXA 3DPRC 3I2GA 1WW7A 3NV1A 2Y26A 1ASJ2 1SA0B 2HYXA 3EXUA 4AHYA 3MEPA 5JSPA 2QUOA 3THOA 1XHZA 3IBMA 3OUFA 2A5ZA 1WA8B 3CBNA 1RJ8A 4UFMA 3AFGA 5IVCA 1UMIA 3VBRC 4JI1B 5K1PA 1KC8W 3IZOA 3G80A 3ZYJB 1COV3 4QKNA 2RE9A 5C6CA 1LHVA 2ADPA 3VBUA 3HMYA 3L74H 3K58A 4NUBA 5B3SB 4LBNA 1PIV2 1KDMA 3SXWA 4O4JB 5EJ3A 1QJEA 3NNMA 1R3KC 2XLGA 1AJQA 1W0PA 5A7WA 4H3WA 4U3JA 4YIOA 1PPJH 2EBOA 5LRSA 5E16A 1XMQO 5FBJA 3SYPA 4CZZA 1FOD2 2BGCA 4ZI7B 3THCA 2RR11 3KCCA 2NP0A 1MQTA 2ZXWC 4HXCA 1PKXA 2CH7B 4XDPA 4PLNA 2YI9A 2FDFA 3NKTA 4HKWA 3K46A 1W2BU 5J98B 5JOZA 2VY0A 4K3UA 1PIV3 4CU7A 1N33B 4YPJA 1XC6A 2FDKA 3QO7A 1CAXA 3LIHA 5L3EA 2ORZA 1VBE1 5GLVA 2Y33A 4UCTA 1R1A1 4IT5A 4JI7O 2D5FA 3PDQA 1ZTEA 5CB4A 3SYAA 1NA1A 1SQPH 1G1XB 4XBFA 1TA8A 1RUE1 2BNNA 4G3YC 1JUIA 1GWKA 4DR6O 1KD7A 1XB9A 4DV1B 4HG6B 4CDXC 5JSRA 1Y43B 4A5UB 4XDQA 2WKKA 2WT2A 3UT5A 2ZR3A 4YY3B 3OMAB 1F2NA 1TUEB 4P9JA 3M3EA 2XWBB 3NWKA 1FI2A 3KHCA 2R063 5FZ1A 2GH2A 3IT8A 1JOJA 5L3CA 1OH3A 3JD73 2LM3A 5FP7A 3N27A 4BQ1A 1MEC3 4YFWA 4TOIA 2HEVF 4O2AB 3GJAA 4QXCA 4FVVA 4GWJA 1A32A 4DO2A 3ZXEA 4WVMA 3OYWA 3V65A 3EHKA 4Q27A 3CWBH 5K9YA 2ZNIA 3CRQA 3UKTA 1O3SA 2D6MA 1ULDA 2OW4A 4WVMB 2BGPA 2AZ5A 2SLIA 5FMBA 3BU0A 1AI6A 4NRPA 2C6SA 1QOTA 4NXNO 3SPHA 2AR6A 1H1IA 3IFXA 4Q0PA 2OS2A 1KJLA 3FJSA 4FPJA 1J3PA 4ABMA 4QQPA 5LMUO 3OGRA 5JPNB 1JJOA 2M7WA 1W6PB 4JI0O 5B1BC 3GZTB 1NTZH 1CIWA 3FL7A 1HW7A 3LEGA 1XYPA 4ZY9A 5J09A 1UOBA 5G05L 1O4YA 2ZPXA 1HJFA 2VW2A 3D4KA 3TXSA 2DCKA 4WZFA 3URFA 2BNOA 1JHJA 1EN4A 2ZGQA 4ZKIA 4E2QA 3PN1A 4LT5A 1YHQV 5I93A 4YVWA 2BFUS 4RD7A 2CV6A 3OG2A 1JZ3A 1JZ4A 3I2JA 4AGRA 3SPCA 1VF5B 4DR5B 3H1JH 1PGSA 1W6MA 4HAMA 2LGQA 3BCWA 3J7NA 1URFA 4DXWA 3FWEA 4ZZ5A 1IQDC 4B4RA 3CCMV 1AX2A 2QM8A 1GR3A 1SFYA 1W6QA 3KKYA 2JDYA 1R092 4B3SO 3RYHA 4AEDC 2CGNA 4CEWA 4UW3A 2WAOA 3N9QA 4FFHA 4BLIA 4MV2A 3WB1A 1AR72 1JMKC 1OXCA 5FZLA 1WBFA 4JI8B 4C1WA 2EULA 3B09A 4H7LA 2W1QA 5C9AA 2IJHA 2QGNA 1X36A 5C8WA 2RMKB 3D36A 3JASB 5BNOB 3M4FA 4FFGA 4OX9B 1SDWA 4L8JA 1ZREA 1PZ8A 3FZ3A 3ZFGA 5KMGA 1PD3A 3POFA 2KD7A 4P14A 1NE4A 3TCUA 5HCAA 5JSOA 4CC5A 5GONB 2W08A 3PL0A 3BYWA 1NLRA 3OUIA 2Q7EA 1ULPA 3SJCC 1GAXA 4AGGA 5C5TA 1XDCA 1T2XA 1Y9MA 2FDIA 1PM7A 1ULGA 4KG8A 5KUMA 1DF5A 4KH9A 2P3KA 4GMP0 2HKOA 4DXSA 3CXCU 1DGWA 3AP9A 3ABMC 4YJ2A 2P5OA 5F8PA 3MUZ1 4GB32 4UV9A 1GN6A 2M6YA 3VKFC 3POGA 4E27A 3FYIB 2ADEA 3NJVA 2VBPA 1NH2B 5FZHA 1WJZA 2FCVA 3AMMA 4L92A 2XGXA 3BB6A 5DQ0A 4UFIA 3ZFGC 1FV3A 3OW2U 3ELNA 5C3PA 1W0OA 4UF0A 2AENA 2IJIA 2XDVA 1LOEA 1DQ1A 1MEC1 5LEJA 1UKGA 4CUCA 1K42A 3JATA 2V73A 2VNOA 3GNEA 4QB2A 2WT0A 3RQ0A 3VD7A 2KG7A 1YXWA 4I50A 1X50A 4JI3O 4CDUB 4PA6A 3ZIAG 4CU9A 4ATEA 2Z79A 2ZZJA 1VRH3 3UT0A 1XOYA 5AC91 4AHWA 5KXBA 2FMYA 4ARXA 3KVBA 1MS8A 3KQRA 4YM0A 5FZ0A 1TNFA 1ACCA 1AZDA 4DB5A 5LMUB 4JI0B 4XIKA 4HONA 1RUF3 5E79Z 1OF3A 4YZ4A 4UXAA 2WBKA 2QKAA 4RA0A 3K08A 5KX5B 2WZR3 3QACA 4LE3A 3QOPA 3ML0A 3J8F3 3T4DA 4ZZ8A 2GC0A 3ORJA 3AMHA 3ALQA 3OR7C 1VB2A 2RMU1 5LK5A 3RRDA 4HKLA 4Q0SA 4P9OA 4HKOA 1JODA 5LBCA 5EYPA 1MS1A 5EIBD 1PNFA 3K5OA 3NO8A 4IEOA 5KAFZ 3JAWA 1XBFA 2DWRA 4ZKTB 3LCPA 1WA6X 5FOJB 3ES4A 4HETA 4IETA 2JIGA 2V5YA 4LTAA 3LOIA 1OVSA 2OKXA 2ZABA 2Z5UA 1DIWA 3RZHA 5A6YA 3VBSB 2CK3G 4PELA 3RZMA 3DN7A 5IDJA 1MQTB 3J26N 3M3QA 2LFRA 2VH9A 4GIQA 2Q30A 4HSJA 1K45A 1OCCC 1Q90D 1GK9A 2BYVE 1RUI3 1JYTA 2UWAA 5ABJC 3ZHRA 1ZNPA 2HP8A 5E1AC 2N04A 3N7JA 1VBC3 4YW2A 5EBWC 3VDCA 2L35A 3CSXA 4QQLA 1YLLA 3RZKA 3VZOA 1ZWIC 1AYM3 3KT1A 2YU2A 2UY9A 3I4IA 3OEBA 3O1VA 1YHFA 4CRQA 1WPXA 5LMNO 4ATFA 2R1BA 1VQOV 1BMV1 4PI0A 1ALYA 2YC4A 3VL9A 5FY4A 4JDNA 1V6JA 5FQ0B 5H6RA 1UWWA 4GKJB 1VF6A 1O9GA 2Q8EA 2QJ1A 4EB6B 1X82A 3PMEA 4LO6B 5CG8A 3GCWA 1H38A 4O7XA 3SHRA 4K21A 3KV4A 3V0AB 2R9IA 3IDCB 5FJKA 4YG6A 5GKAC 4I02A 3ON7A 2JE8A 1RUH2 3CJXA 4NPMA 4A45A 3EYPA 4LF7O 1YQ2A 3ZSLA 3POSA 4OUEA 4MXWA 2LO1A 2ZEWA 4RHV2 2D3SA 3RYRA 2CGOA 1TEIA 2JJ1G 4HYOA 2E63A 2CTWA 3SKVA 2VQAA 3E35A 1ASJ3 5BXZA 4NOTA 3ZRSA 1YF2A 2A7WA 3AG4B 2RN9A 1J95A 1UZYA 2PFWA 1C5HA 3AP6A 4FM2A 5EBLC 1Y9GA 5FY5A 2LFSA 4NRMA 4X1YA 3CEWA 1PNLA 1SPPB 2Z3YA 3U07A 4OPAA 1GZWA 5SV5A 1HR0B 4QQOA 2CH7A 3IDAA 5IATA 2RJ2A 4GZ9A 2EILC 4JTDB 2RMU2 2XAJA 4BQWA 4U7OA 3GB7C 2WS91 5FPLA 1QJY1 1OLMA 5IY5C 4YZ1A 2JVDA 1L3JA 4Z1VA 4XF4A 5G04L 4PQ9A 3FYEB 4CDWA 1DTOA 5J2UA 1O5UA 3I2FA 4K1ZA 3LGRA 1XRUA 3H1WA 3HN3A 2VMEA 4JV5O 4AVVA 5LBBA 1GLHA 4RSUA 1RTVA 3WG4A 3FBMA 2ZZQA 1MEC2 3BRCA 1UY2A 2WLLB 3HPLC 1WMFA 4EWEA 1K5MC 3U14A 2CUGA 1RUOA 3OUJA 4P00B 1X4TA 4X66O 4IEUA 1GOFA 4QHZA 1CEZA 2FTKA 4FTBA 2R041 2QWPB 3MLKA 2AHYA 4IIJB 2WFPA 1QJX3 2JG9C 3A8TA 3N4MA 5AC93 4BPZA 4MS2A 4DR1O 3LD8A 5BZBA 3LSSA 4EE2A 2VCCA 4BK5A 5DABA 2R9RB 3DPRA 1LB2A 4X88A 5CN0A 2ZE5A 3ENRA 4OI2A 2Q1ZB 2YXSA 3KF5A 4V2WA 4J42A 4W50A 5EK0A 2ODMA 4AVSA 4BMBA 5LXTA 1D2SA 1YQ6A 4XFIA 2Q8DA 4BYYA 1G9FA 4JGYC 1BBT2 5H9CA 4MTFA 2ZNJA 4UFJA 2GNBA 3HR9A 2QE7G 1FXHA 4MLOA 2A71A 5A7OA 4IHJB 5ISLA 3UCSC 4FO9A 4EV0A 4IE5A 1TME3 1AF9A 5JXGA 5IWAO 1FD9A 4GCZA 1SCSA 1WBLA 5C4WA 3Q4HB 1LGNA 2PMWB 4FOYA 2PYTA 2XAQA 5J48A 2HWF2 3LOBA 1NZ6A 2Y8KA 2H0BA 3SPJA 5C3SA 2EINC 2Y6KA 3KG2A 5KHIA 2XLAA 2QJVA 1SQXH 1QU0A 3LQCA 1V6IA 1HB1A 3H8UA 2QBXA 1ND2B 3CJIC 2FCUA 3T4VA 1XNKA 2YUAA 4W4KA 1SS3A 3R4DB 2ENRA 1COV2 4MVZA 3LDRA 4LBQD 3HNBM 1PO21 4CXWA 1CX1A 4Q4W1 4CUBA 1K12A 3WDWA 1I5XA 3VHNA 3PTYA 2L9LA 5DM6V 4F6RA 2QEXV 2Q7GA 5C71A 2JDUA 4BQ4A 3VD3A 5A6XA 3SLIA 4FMTA 4Q4Y3 3BGAA 4J9YB 3M8AA 4H33A 5CA3A 3E5XA 3MLLA 4JRLA 4FLXA 2CDOA 2PZSA 4NIGA 1ND3B 5BY1A 3UKNA 1N34B 1NOVA 4JTCB 1O9HA 5CAZA 3ZFFC 1GZTA 4KMQA 3UYJA 4ARYA 1L8DA 2ZKLA 1V6KA 4EKWA 2HVJC 2WO2A 3SNMA 4N53A 4DV1O 3RZJA 5LZ6A 5CISA 3NV2A 3QO8A 4UV8A 3G67A 2QQOA 1NZIA 3U37A 1TNRA 1AB3A 3A7QA 3ZRWB 5JI9A 3CJIB 5FZCA 3WOGA 1CQ9A 2VGDA 5H9PA 4XAEA 3CCUV 2Q67A 3N9OA 4COVA 5D5QA 3HOBA 5EV7A 2JE7A 2XVGA 1GV9A 4MO3M 2E75B 1QGLA 4IEWA 5KX5A 2H3OA 4X62O 5CFCA 4K8XA 1COWG 5CKNA 3RSJA 2P7TC 1DG6A 5EZYB 3ME2A 4XC9A 1B35C 1RUH3 3V0AA 2OT5A 2ZEXA 4AEMA 4DK0A 3NSTA 3NNGA 5FJHA 5JJJB 1XU2A 3HKBB 2F4PA 1VMJA 3AB0A 5DUWA 2DU0A 1DLBA 5C5UA 1TMF2 4OZXA 1XYNA 3W9AA 3ETEA 3OEAA 1KQSU 1FJGO 5F37A 5LA6A 3ST7A 4QX3A 1FPN3 2CHHA 2GBOA 3AP5A 2P22C 5A80A 4J25A 4DUZO 1QXPA 5CFDB 3H9AA 3QF7A 5I91A 5FZEA 5FNVA 3STZC 4JI4B 3C3VA 1ENXA 1Y7BA 4Q4W2 1VIBA 2OUJA 2P3YA 4KI5M 4WM7B 2ZAHA 5FYYA 3THTA 2EJ7A 3VQVA 3X29B 2Y64A 2X6CA 3JAKA 1WP7A 1AYM2 2K46A 3MIDA 2UURA 4K9SA 3I5DA 4F6EA 1STMA 2GC2A 3QCWA 2F17A 3SPIA 3ABKB 5FPXA 5F3GA 4QE9A 3KSCA 4JHZA 4BXSV 2XNDG 4Q29A 2ZQMA 1S1AA 5C8YA 3L71H 1W2NA 4XJ8A 2RDNA 5CKMA 5EIBC 2IUWA 1S0BA 2HWB1 2D98A 1ULOA 5FY1A 5IFTA 1I1EA 1V9U1 2B7YA 3ZSJA 1EP0A 2EIGA 4PDMA 5C8YB 4JI2B 3H3UA 4LKEA 1RM1B 5B1BB 1EUTA 2VUJA 3DEMA 2QQUA 5JCOA 3V0BA 1GMGA 1WWYA 4IYHA 4HN0A 2D43A 5IAVA 1W9YA 3PVNA 2JS5A 2I07B 2QWRB 1B06A 5DG1A 3MW4A 2XWJB 2Z2SB 3UGGA 5LA1A 5HFMA 4JCKA 4DR2O 4JRAA 3CL1A 4UFKA 4BH9A 2WZR2 2EX3A 2NNUA 1HQLA 1OCOB 3RBZA 4O4LA 4GKXA 2XB6C 3HBZA 4XHXA 2BGOA 1UD1A 5IVVA 1N4CA 1VBD2 3SCFA 5GONA 4DRXB 1L0LH 4CS3A 5H9SA 4V1PA 3PMSA 1POV3 3KV9A 3E89A 4I55A 5IYBO 4OPHA 5BV6A 4LBQA 4I0WB 2V4AA 5I0SA 1Y76A 3HAGA 3SMHA 1K5JA 4OVEA 5KC5A 2W47A 1MZ5A 3GBGA 4YSFA 4LF4B 2V5DA 2WDBA 5LATA 1Y6XA 1NCRA 3I3MA 5JXIA 1PVC1 4WFAV 3CPWU 4LBLA 3W7UA 2ETNA 1YC61 4NTWA 2Y48A 1RM1C 4I2OA 3Q4HA 1ZL8A 2TEPA 4R6ZA 2HEYF 1Q86W 4X8NA 1MABG 1XPWA 5FP3A 5IK5A 4NR1A 3N9NA 3N2KA 1MSDA 2Y69C 3HKBA 5B66Z 3ZHUA 4RL7A 4XXPA 3R0RA 4PBOA 2QM4A 3CMEV 4Q1PA 3F5WC 2XBO2 1GU3A 2ERFA 5JZGC 5CIRA 4DS0A 1UXXX 4OHXA 2DN9A 4I50B 1W6QB 3LDBA 4GWMA 1BZKA 1UIJA 5KXCA 4JASA 4Z1MG 2EZOA 3LE0A 1FPN2 3ABMB 2VM9A 2K1EA 1NBMG 1RUNA 4TWKA 3NAPC 1O8SA 2D3RA 2P1BA 5CVRA 1Q43A 4IGPA 4HANA 1W9SA 1BVVA 1UN1A 3WDXA 1Q82W 3AKPA 3ZM8A 1YXBA 4IGOA 1UOFA 3Q8CA 2VRZA 2CDPA 2W6JG 5A7SA 3CMAV 1R083 2JDMA 3HNMA 3DKQA 4YZ5A 4QX1A 4ZU4A 1N1SA 2BERA 3NAPA 4GA9A 4N23A 3DUIA 3R4SA 4UF0B 5KC6A 4N8MA 3WDYA 1RUI1 3PUIA 2WNUA 5K0UA 2CTRA 5AVPA 1YI9A 4KU8A 1PMHX 2WZR1 2QQKA 3VV1A 3AYEA 2BPA2 2PQSA 1SCRA 4C90A 1ULCA 3RZGA 1JX9A 2ET7A 3T1CA 1S77D 1OQEA 3ZMSA 4ZOLA 1JYVA 1JA8A 4J1XA 2RJLA 3ZHVA 2VMHA 4BK4A 4CCDA 4LH7A 1PMIA 3B5LB 2BSKB 3MFCA 3NAPB 2Y4TA 4O2AA 1WNSA 1IBMB 1AI4A 1P84F 4MGSA 4R9DA 2YFZA 4ES9A 3CCVV 5KHGA 3NL1A 4K6BA 1ZVFA 3ETPA 2QZ2A 1E1QG 3MF9A 4ZS2A 3B9IA 3LNNA 2VZVA 4GX0A 3ZYPA 1VAVA 5FO9B 5K7PA 2YEVB 4E9KA 3PVBB 2UXDB 2HG5C 2KA3A 1C57A 1VBA3 1V6OA 4JKKA 5CKQA 3OMIB 2DUPA 2ZKNA 4N43C 4RR3C 3I55V 2F43G 2CTVA 4AFAA 1ULFA 1UPIA 4H37A 2GMEA 2GMMA 4PCRA 5F5IA 2Z5WA 4WM7C 4I0BA 3J7HA 1NZCA 5FYZA 3W20A 1BK1A 5ABJB 5J3UA 1H1MA 1YQCA 4IEYA 3NNLA 2DOSA 4GKJO 4INDA 3JAKB 4X1KB 1PX4A 4Q4V3 2VUCA 1OPMA 1FFTB 1OCZC 1G8WA 3PIGA 3OGSA 5EP9A 3H3ZA 4B4QA 3KCYA 1EAH3 4HBNA 3C7GA 2YG0A 4LWSA 2Q6AA 2QDRA 2JJ2G 3DXRA 4DW0A 3B69A 4XQDA 1UY3A 4XJWA 1FYUA 3T1YB 4XF9A 1KU9A 5LA6B 1GQPA 2RV9A 1P4RA 1FNYA 1Z5VA 4HOOA 5FWEA 3HVDA 3WT3A 3ZXGA 1SMVA 1HXS1 4LF8O 2X6BA 3DGTA 1BHGA 3VBOC 4BU2A 2QTSA 4PA4A 4YM3A 4Q4V2 1ODNA 1N1VA 1IBKB 4NHKA 1WAZA 2VVFA 3S0MA 2XJSA 5T55A 4Q4X2 3PVOA 1OT5A 5FPRA 5ITZB 2NMNA 5E1RA 3RGBA 3PU3A 1DBNA 4X65O 1Z2GA 1OUXA 2RS31 2R1DA 3U1XA 5FZFA 3SCGA 4P30A 3O0XA 1MS9A 1K3IA 5A3TA 5ITZA 5IAXA 2Q4SA 4MGZE 3H1KH 4IERA 2E53A 2HWB2 2EAKA 2PI5A 3MIEA 3ZRXA 2WQ4A 4UW6A 3HIFA 1PO23 4KUMA 2P5BA 1ZUQA 2DYCA 5IK7A 5APAA 2LRPA 4FPPA 4QU1A 2FDJA 4Y4YA 4AXOA 3S5QA 1OKOA 1HRI1 5SV8A 1XNCA 2WNUC 5K0UC 2F4VB 4I30A 1LEDA 1URXA 3T4ZA 2W5FA 1WGPA 2EILB 2X8KA 4C0HA 4OQ9A 2Y69B 2E7TA 5EWSA 2YYOA 5C3RA 2FD8A 3LSUA 4KQ7A 1NLSA 1QKQA 1SBDA 4BOWA 5KMGB 1KQRA 5GZEA 2ZINA 2J1VA 3CB2A 1KFXL 3OBZA 2BV4A 3O1PA 1KD1W 2UUBO 3RG0A 2YU1A 2Q0AA 3M2MA 3AZVA 3FX3A 2WSUA 3ABLB 5T54A 2Z4FA 1YVWA 3OGJA 3OOXA 2QZ3A 3G6BA 4UCVA 5LGNA 2AGSA 2L6LA 4ZXEA 1V00A 3ACHA 4CUAA 5B2GB 1W8NA 4KBZA 4KU7A 4YG3A 3JCZA 2ZAAA 2X5IC 5FK7A 4YARA 4BW9A 4IIJA 2B42B 3LA2A 5JOYA 4PDVA 3GHNA 2VS0A 1UQXA 2E9QA 3U11A 4JKLA 5FPVA 4BA6A 1RUC2 1TME2 2GU9A 4DR4B 2IXJA 4FAGA 2QQMA 4B3MO 5FY8A 1SDDB 5D21A 3U4XA 1R3IC 4IGQA 1TMF3 1VP6A 3I97A 1V6LA 4X89A 3ZEDA 4HLTA 3JATB 1N32O 4QM9A 1HNZO 3LUTB 1J5EB 1NCRC 1MNGA 1FXKC 4K8RB 1C8NA 4PDRA 4TQDA 4FZ1A 2QCSB 4JZGA 2H8PC 2PGGA 3JCIA 4Q4X3 4CP9A 4K35A 4RQPB 4MH0E 3QH6A 3L72H 1OA2A 1H4HA 4A6OA 2VTXJ 4YGCA 3RDIA 2DTWA 2JDPA 1QJX2 1WCKA 4SBVA 5F6LB 1PGW2 1B3QA 3AL5A 4ZOLB 2WSSG 2ZMKA 1N34O 4DV4B 2VPVA 4O4LB 2JEXA 1VQMV 5LWBA 1EV12 4KL1A 2WYSA 1S0CA 1MMMA 4FAHA 3PJSK 1TG7A 4MADA 3GBFA 3P30A 2E26A 3DYPA 3N36A 1QJY2 2XVLA 1RITA 1PVC2 3ZKYA 3E6DA 2WLKA 5B1OA 4U3FH 1K8AW 1RUF2 4JYAB 4YW1A 5C4WC 1R73A 4CP9B 1N47A 1H8VA 4BZ4A 2YZ4A 1W0JG 3CC7V 1GSLA 1H2KA 1GWLA 2UUCB 2BEOA 4URAA 1UNBA 2XHNA 2HFEC 3CNAA 4NN0A 3DTUB 1S0IA 4A44A 3ZMUA 5A7NA 4CDUC 1TMF1 1ZA7A 5LRRA 5EIYB 4CYDA 1Q8IA 2WC2A 4PQQA 4DZGA 3ZO0B 4DV0O 2DQ0A 2JG8B 4TUYB 4DV7B 4HMZA 1QDOA 1WD3A 1FT9A 1G9DA 2VZTA 4XF3A 4QXBA 1GUIA 2HLEA 1MZFA 4J7JA 1NR1A 3RYPA 4EFEA 4BJ0A 3WDVA 3KB5A 1QOOA 4F3JA 5B3SC 1ZBA3 4O2BB 2HWE3 3SEEA 4LF6B 4HVQA 5JXHA 4BIZA 4FOWA 1RMU1 3ABZA 2KXLA 1S5HC 4CTEA 1K5MA 4OUMA 2ZM6O 3NQHA 4D6TH 3MD0A 2ZBJA 1KS4A 2AYHA 2QFEA 3KHBA 4LPLA 2J1UA 1W9WA 3VKMA 3VBSC 1G9CA 4XJZA 1D5NA 4IV3A 2D6PA 2GDFA 5A33B 2ZGLA 2VMCA 2PA7A 4CCJA 1FMD3 1CPMA 2DBNA 1DGRN 3PURA 2X29A 3SC7X 1ZBA2 2DYSB 4YZ3A 1GICA 5DPNA 5ACA1 4DUVA 2P37A 3WHTA 4DR3B 1RUG3 4HSLA 4OUSA 5LOVB 4AGVA 4D69A 2I45A 1W0NA 1MS0A 4MOAA 1QNWA 4S2FA 5FCCA 1XXNA 3ZN6A 2XKPA 2Y6LA 3SH4A 4D0QA 2GC1A 3CCRV 3IPVB 3ZPYA 4MSVA 3V0BB 2WNUB 5K0UB 4Q2FA 3VKLA 2O14A 1QCEA 1YJKA 3ZFEA 2VQ0A 4NIDA 1F4MA 2DVAA 1DQ4A 1Q81W 2VZPA 1BKZA 4OX9O 2ZCWA 1VQNV 2E7AA 4TQFA 1C1LA 3ZFFA 5DG2A 5FRAA 2UUAB 4LO8A 5HPOA 2IVIB 3LPGA 4CS2A 1HQWA 3WQ0A 2KKWA 4LHKA 1DU3D 3ABLC 3ZJZA 1OCRB 2VOWA 3OR6C 5F9TA 1KKCA 4P9LA 2JXAA 3I2DA 4LCUC 4BIOA 1NUKA 2WLJA 1EFRG 2VQFB 2Q4PA 3OD4A 4UCOA 3UKMA 3K06A 5DECA 1DZRA 3A0BZ 1VLNA 5AVAA 2WS92 4J41A 2CE4A 4FXGB 4LF9O 1RUJ1 1NI8A 4G2KA 4QGNA 1VBB1 2OA2A 4FPOB 5FAXA 1CJPA 3EJKA 4LJHA 2YMZA 1XHXA 5A7QA 1DLCA 1HJGA 5C93A 2RS13 1BHBA 3SR2C 2Y6HA 4DV7O 1D0GA 5JWPA 1IKPA 2C4XA 2BTQB 3B4SA 2X53S 2G4IA 4GKKB 1AXZA 1OQ1A 3SH3A 1I5YA 3DCQA 3AYAA 2PQQA 3R4UA 4GX1A 2ARCA 3KMHA 4XACA 2A9HA 4NKGB 3QD6A 1JFFB 2PLV2 3SJAC 4FPYA 3ASIA 4OHVA 3OAAG 4IV1A 3W7XA 1F5FA 4G9SB 2VW0A 4AFBA 3WFVA 3NJXA 3EQEA 4WFBV 4JVAA 4XYXA 4I09A 1CAWB 4J7ZA 1PK6A 4LFCB 1O4ZA 1QWRA 1PL4A 3BIWE 4D8MA 2UXXA 3M3IA 3O0WA 4J11A 3BEHA 3OT7A 4AQYO 5JZGB 2VVDA 4OI1A 4CCOA 2JG9A 4J6GA 2PXJA 4M3CF 3RYHB 4HL0A 5FYCA 1S0FA 1JTZX 4Q26A 3CP1A 4AI9A 4LOTA 4YGDA 4N53B 1JZ5A 4DR3O 4KWJA 5IUQA 1YNAA 4BQ5A 4XUQA 5KHHA 1BBT3 2N74A 1VBC1 2QDNA 4LBKA 2Y34A 3BAAA 4UVBA 3T1HO 2ZACA 1AR62 3OPZA 3WG1A 3C3SA 3L75H 2ZOEB 1NY71 1NVPD 1HW5A 5KXEA 3K59A 2YV8A 4DFSA 2XH6A 4DRRA 2PAMA 2GP3A 1AL0G 1T6BX 3OFNG 1KB9F 4Y24A 4FSJA 4I9WA 3W5NA 4DV0B 1OOPC 2FB5A 1CR7A 5IYDO 1GYKA 4META 3WCSA 4W4LA 4R50A 1JVMA 4MVTA 4FXKB 4MVMA 3HT1A 5BNNB 1AR4A 2VNRA 5LBFA 4XW3A 5F3IA 3WNPA 1ZA4A 3NR7A 2F1MA 3WY6A 5IHRA 3VDBA 2RS11 3N3HA 5BNPC 4WFFA 2DU1A 1OH4A 1AROP 3ZXDA 3CXHF 2JEMA 2RS32 4A6SA 3ZN6B 3KS7A 5KLVH 1IZ3A 1J3QA 4TT3G 3HT2A 1RSOB 2HWF3 3THPA 4FLVA 1N3OA 1RINA 4BAYA 1EBOA 1YFUA 3BABA 2I2SA 1RVF2 1A8MA 1XOUA 4B08A 1QLEB 3HNYM 2VD7A 1PNKA 1ZX3A 4GMP1 4ZIBA 2W94A 5JVDB 3KGLA 4JAVA 1FATA 1XJAA 1RUE2 4YVWB 3IWZA 4ZBMA 1K5SA 3Q9OA 4PT6A 1J84A 2ES3A 1PMJX 1KXGA 2YPDA 2GUZA 5A3WA 2QM7A 4XUTA 1YTFB 5JMOA 1VIWB 3WVJA 2VL4A 5LYJA 2J1RA 2XAHA 3H8RA 5D5PA 1VF6C 1ZBE1 1DFQA 1WW6A 2RM23 4AEDA 4CEWB 1WMXA 5A7PA 3ES1A 1TVKA 1SETA 4TV8B 2XOKG 2R072 3RMYA 4XF1A 1N33O 2UWBA 4IW3A 4LC1A 5C8CA 4P2ZA 2PHLA 3LSDA 3G4SV 4CU8A 3ZHQA 4MSWC 2X09A 3O14A 3OEHG 3B94A 2DBIA 4R9CA 3ASNB 3CCSV 1EN5A 1UMZA 1WCQA 2W87A 2YDEA 1I94O 2Q5ZA 3PJYA 4K7JA 4H13B 3CD6V 3KZ4C 1JPXA 4DR7O 1JJ2U 2Q5TA 5JJEB 2PAKA 3D0JA 1XBLA 1AR83 2VNVA 1GOHA 3BTYA 4RS5C 5EC2C 3N7MA 4F4LA 2E6VA 3ZR6A 3B01A 1IDSA 3FLRA 4IV3C 1W8HA 3VBSA 2HKXA 2YIBD 5FO8B 5T5JA 3VLBB 1M5IA 1HN1A 1IXMA 4R8HA 1PGL1 1JU4A 5FZ3A 1Q8SA 3U10A 5EJ1B 2DDUA 2F23A 5JIUA 3OEEG 1YFYA 3KT7A 4ASKA 3KWVA 5F3EA 5ERLA 1OHFA 3NVCA 4AFMA 2XJVA 4FPCA 4L87A 2W52A 2ZXWB 4JQTA 4TLFA 1GRJA 3G6EV 3VGIA 1ZRCA 3ZMZA 2IWGB 1RVF1 4UFLA 2RCVA 3WNOA 2ZGMA 1THZA 3MPBA 3ZN0A 4LIVA 1JOPA 1C8M1 4ZHQB 2JE9A 1Q6IA 1GH6A 1HNXB 5C7GA 1YI2V 4JAUA 2XUMA 5LW9A 3B9CA 2A6YA 4GULA 1UY0A 2VCBA 3QG5A 2VMIA 4JQRA 5JXJA 5I8TA 4NPLA 3EXAA 2W39A 4OI4A 4GX5A 3KGZA 1JH5A 1YEWA 4DR1B 1QJU1 1S55A 2IU0A 1O7FA 1OLQA 4U3JB 1FXVA 2W68A 5AC92 1XNQO 1KRIA 4MUVA 1VQ7V 5A3LA 4TV9B 1AR61 5AG2A 4DPNA 1S0EA 4M0HA 3AZZA 3ZYFA 4AAXA 3AKRA 4Y22A 1I5PA 2Q8VA 4B3RB 2NQYA 1UPGA 1FX5A 4MTGA 1D5AA 2ZCEA 2OCCB 2F6BA 3MYXA 1M9NA 3IN9A 1F51A 2CWMA 1UL9A 4NTYA 3WINE 1RPOA 3P5BA 3ASOB 3K2OA 4EYUA 4CDQA 3WHUA 4DR5O 4ONUA 3TWIA 4YJ3A 5HBAA 3FB7C 4CCCA 5H6QA 4B3TO 1IG3A 3VZJA 1ZZ6A 1QF3A 2PHRA 4X6QB 2MW2B 4X8AA 2Z69A 2GNDA 4YG0A 3R66A 5CG9A 2A70A 1UO9A 1US3A 1CPYA 1AVBA 3I3DA 3B02A 4A3ZA 4QMAA 3LSEA 3KCXA 4DV2B 1PV0A 4LFAB 2XKOA 5TISZ 2KSDA 2VU9A 1VBD1 4Y1UA 4HZFA 2ZGRA 1ZAUA 4IE7A 4XE9A 1DGSA 1SQVH 5IJ9A 2RDQA 1M56C 2RS53 5FO7B 5DN6G 1YQ5A 4DV5O 1LGBA 3RWKX 5B4NA 2ZS6B 3C7HA 4GLXA 2R0FA 3B77A 2QKCA 2R6QA 1W8TA 1JCHA 4DRXA 3I2HA 4MGKE 2JRIA 2DJVA 1RIRA 4DV6O 2VO5A 2EIMC 1Y76B 3EBRA 5GJ6A 4TXWA 2BWCA 4S2HA 3FKSG 1SZBA 2QTOA 1WCDJ 4K0KO 3OY8A 2JD9A 4TWTA 2BRTA 1DGRA 4GB33 1RYYA 2K2SA 4OMDA 1R3LC 3KD4A 3AZWA 3MIFA 4ZONA 4WFEA 3HKCA 1HDJA 1JYXA 2OPWA 4YVWC 4Q4W3 4QHOA 5TSWA 1S72V 3BOPA 3FMGA 4N90A 4Y33A 3VQXA 4J80A 3S5AA 1DLLA 3H0OA 5IWFA 3AK1A 1UY4A 3BI3A 3CRMA 1NCQB 3HJRA 4PJ0Z 1JYCA 3CDZB 1UOJA 1HQNA 1UY1A 1YDXA 4BQYA 2HEWF 3WW2A 1VALA 5BNOA 4MGQA 3M1HA 1U5ZA 4DIQA 3RN4A 1W6PA 3GZAA 4AI8A 4GWIA 3ZMOA 3IB3A 4JAAA 2YUEA 4HN1A 3ITQA 3GZUC 1NR7A 1O6UA 4GX2A 1BZWA 4TYSA 4UBHA 4RGAA 3QO5A 1PP9H 2P4EA 1O5LA 2IH1C 4LHSA 1S5JA 2WLIA 2IBZH 4YXWG 2ZM6B 2QQPA 5L3DA 4XEZA 1JBCA 1F31A 2YIBA 4JYCA 4UYBA 3ZYRA 2VOKA 1KP2A 2XJRA 5CA6A 5IJRA 3KV6A 1H8TA 1W39A 1BT8A 2ZEZA 1ND3C 5DN2A 1XQNA 3LWCA 3TBDA 3JASA 3I49A 3K48A 3JD71 4IE6A 1RXGA 4AOCA 2CAUA 3EB7A 3AZXA 3WNNA 1UYXA 3I3EA 2WLLA 5I8SA 2OUHA 4WV8A 1L1FA 2GN7A 4FQZA 3MAQA 3BA9A 3O1UA 1IOAA 1YI7A 5DAVA 1M1KW 4CDXA 3VUOA 3JD4A 4QKDA
chains in the Genus database with same CATH topology
1RB8G 1D2QA 3TN91 5BV6A 4LBQA 4N43A 4RR3A 1R082 4I0WB 4XOGA 1S2BA 5I0SA 3HAGA 3IKWA 5GM0A 3SMHA 3DPRB 4LA3A 1RUG2 4OVEA 4FP3A 1NA1C 3HWJA 4AI2A 5KC5A 1YFWA 4K20A 3MIGA 1MZ5A 3GBGA 4YSFA 5GLTA 3WW3A 1CONA 4EN9B 1BCXA 5CNAA 1YO8A 2WBOA 1NCRA 1XU1A 1PVC1 4MGIE 4LBLA 3JD72 4KBBA 5J7MA 4FT8A 3V56A 3E6CC 1D4M1 4I2OA 5GLZA 5J96B 2TEPA 2HEYF 3N7LA 2UYAA 4X8NA 4PIXA 1MS3A 1B35B 2C5DA 2ZHMA 3JBG1 1CN1A 1UIKA 4LLOA 3RPQA 5IK5A 2WT1A 3HQXA 4NR1A 5KEUA 1DQ5A 2B8MA 1QXJA 1FMD1 4ASLA 3RWNA 5D8AA 4CDWB 1Q56A 5IT6A 4RL7A 3V17A 1AHSA 4XXPA 1WMDA 3R0RA 4BE3A 4XHBA 1LOGA 1MQTC 4WVVA 3H7YA 4PBOA 4XTMA 4AVTA 1UZZA 4FP2A 1OFSA 1SEFA 4Q1PA 3KM5A 1H1AA 2XBO2 5JDBA 1BJQA 2ERFA 2MNGA 5JZGC 5CIRA 4DS0A 1DQ0A 4OHXA 1UU4A 1SLIA 2XBO3 1KITA 5AFBA 1N3QA 3ILNA 4W6YA 4TZDA 1ONAA 4MXWB 2UY8A 5KHJA 1LR5A 4LA2A 1W6OA 2HJIA 4HPKA 1PVXA 1V6NA 1QOSA 2BVBA 1W6QB 3JB8A 1RUC1 4RGGA 4AVBA 2WFF1 3A0NA 4GWMA 1UIJA 5KXCA 2JDZA 1AX0A 2AH2A 1C5IA 2TBVA 4N7UA 3VHOA 1FPN2 3JBG2 5C33A 1O3QA 1HLCA 2P3IA 3VBUB 1NQDA 3O12A 2VUAA 1M4WA 1FMD2 1RUNA 1S0DA 3TAYA 4HFSA 1Z7S2 3NAPC 1A3KA 2D3RA 1RMU3 4A2UA 3USUA 2DFCA 3RJRA 1OS7A 5CVRA 1LHOA 1Q43A 2ATFA 3POWA 4HANA 2R0HA 4IEZA 1IS5A 1BVVA 1CAVB 2G9FA 4FOVA 1UN1A 3VBRA 3WDXA 1LHNA 1FOD3 5L73A 3AX4A 1GNHA 4Y1VA 3AKPA 4IL7A 4RHV3 1A6CA 5L36A 2NYYA 4FCAA 4W65A 2WJSA 4D94A 1IGOA 5DZGA 1R083 1CPNA 3LA7A 4YZ5A 2O8OA 5L7OB 1XNDA 3UJOA 4AEJA 3MZHA 3OBRA 4ZU4A 2WWSA 3TN93 1N1SA 3ILRA 3NAPA 4GA9A 3DUIA 3PNAA 1RUF1 2B45X 3ZXLA 4L8QA 3R4SA 4Q8KA 3GBWA 4JTNA 4AHXA 4EN0A 2WFF2 5KC6A 3WDYA 1RUI1 1AL22 5JR7B 2EA7A 2WNUA 5K0UA 4LULA 4M2GA 5AVPA 4XMAA 1YI9A 4P5HA 1FPN1 3AYCA 1NQJA 2D7FA 1IS3A 3NV4A 4B4PA 1DYPA 2PHFA 4KU8A 2WZR1 2GSYA 3VV1A 4GMP3 1MS5A 3AYEA 4YYOA 2BPA2 4QU2A 1SCRA 4C90A 1ULCA 1YUDA 1H2LA 5I8YA 1TQ5A 2N7GA 3IDBB 4AFCA 4IEXA 2ET7A 5GZFA 1G9BA 2ZGTA 4A7ZA 1OQEA 2YGMA 5JZGA 2JD4A 4Q0QA 1JHNA 1MR5A 4C5WA 1QY4A 2VNGA 1B35A 2ZGOA 4J1XA 3ZSEA 2RJLA 3AZYA 1EV13 2R062 4CP1A 3ECQA 3VKNA 3UK9A 1VAKA 2VMHA 2PHDA 1CJDA 2XG3A 4Z8BA 3TRSB 1PMIA 2IFRA 3B5LB 4DY5A 2ZMLA 4GKYA 4DXZA 4DOUA 3MFCA 3NAPB 1RVF3 1TME1 4DY3A 5CFCC 3O5SA 2VMGA 2BFUL 2Q4AA 2GC3A 1CAUB 3G6JB 5JCTA 1H2MA 2ZJCA 4P9YA 2CGPA 4R9DA 3MI8A 3KLSA 4ES9A 3IDEA 1OIIA 1YRZA 3NL1A 3RI8A 3RZZA 5KHGA 1NXMA 4EN8B 3FFQA 3EO6A 4K6BA 1U5XA 1ZVFA 2LTNA 1O91A 4M2EA 3USUB 2QZ2A 2HWF1 3MF9A