3KCXA

Factor inhibiting hif-1 alpha in complex with clioquinol
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Crystal structures of human FIH-1 in complex with quinol family inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 102
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3kcxA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kcxA01
4B7KA 3KCYA 3P3NA 2ILMA 3KCXA 1H2NA 2WA4A 2CGNA 1H2KA 2YC0A 3P3PA 2CGOA 2YDEA 4AI8A 4B7EA 1IZ3A 4Z1VA 1YCIA 4JAAA 2W0XA 1H2LA 1MZEA 4NR1A 4BIOA 5JWPA 1H2MA 3D8CA 3OD4A 4Z2WA 2WA3A 2Y0IA 2XUMA 4QU2A 1MZFA
chains in the Genus database with same CATH superfamily
3ZSJA 4RQFA 4EKWA 4J41A 2UXCB 4MOAA 4YZ4A 3K58A 1AYM1 3MHSC 1JBCA 1XYNA 4I3GA 3VBRA 1ND2A 3CMEV 2EXHA 2ADPA 1JZ2A 3ZN6A 1JR9A 4H44B 1HB3A 2D93A 4Q27A 1FD9A 1KQRA 3KT7A 5D1IA 1NLRA 1FPOA 4LBQB 5GM0A 4PHZA 5IY5C 1F7YA 1FATA 1XNQO 3RT3C 4O4HA 2XR4A 4LIUA 3VDDB 4PA3A 3CQOA 4YGCA 2ZKNA 1Y43B 4Q4X1 4DV5B 1JPXA 3I3QA 4E4SA 5CG9A 1AILA 5JOXA 2QQOA 5KUKA 2JEUA 4J80A 5F32A 1NQDA 1VBA2 3VBFB 2R1BA 3I2OA 3LDBA 4RO2A 1SPPB 2VQ0A 3SH4A 3VBOC 2C2AA 1SBEA 4O2AA 4I4TA 1REFA 2OQ6A 3QO5A 1GFF2 1MZFA 1B04A 4UFJA 3AZZA 2Y60A 3AKPA 4JGYA 3K57A 1R1ZA 3V0AA 3CL1A 4GX2A 1A6CA 4J9YB 1MS3A 4YHHO 4YIPA 4S2DA 2IBZH 5CA3A 3FUOA 2V5YA 2YPJA 2E6VA 3N35A 1DQ0A 2HVJC 2RS51 4LCUC 4EN9B 1RTVA 5HCFA 5BMVB 4CZZA 4Z82A 4J7JA 1CAUB 2A7AA 1VQ9V 1MPXA 2D43A 2HWB2 4E2QA 1AVBA 3LIGA 4MXWA 5A7WA 5KX5A 2A6ZA 4FPYA 4CU7A 3VN4A 2DYCA 2WFF3 4EE2A 4X8NA 5FBJA 3RMYA 3ZPYA 2DYRC 5LMUO 3TCUA 3HNYM 1BVVA 5LASA 3OTOO 2VZPA 5EBWC 2A6WA 1E5IA 4E4ZA 5FRAA 3T0BA 3LEKA 3MV01 2RJ2A 4ZZ8A 5JXHA 1G6NA 3KQ4B 2ZEZA 1GZ9A 1DFQA 2WINB 1R3IC 1VQLV 4QGMA 1HNWO 1NZCA 2J1VA 5CA0A 3OJBA 4RYDA 3T4DA 2OT7A 4XBLA 5FZ8A 1VMHA 3O1PA 4CSWA 5CKQA 5LA6B 4TV9A 1Z5VA 1DF4A 1LULA 1ZZ9A 4A6OA 1L0NH 5DAQA 2KD7A 4N9HA 1JOYA 4Y1VA 3VQWA 5E1AC 5HV4A 2Y26A 2CHHA 2NZ9A 4LJHA 4NB5A 5IY5B 2UY8A 2KG7A 4UCRA 2DBIA 2VZVA 1CN1A 2JG9A 5CKMA 2BSKB 1O8PA 3JBG2 5C9AA 1D2DA 4RHV2 3MFCA 2VQUA 2WPDG 1F23A 3MBWA 1YQ5A 4MTOA 4LF6O 4CP9A 3ZKUA 1NCRA 3GJAA 2B4KA 4PLMA 1JS9A 1W6MB 3CEWA 1R1A1 2Q7HA 3VL9A 5FZFA 3NRUA 4AHCA 3OGJA 1YFWA 1WLEA 1PV0A 4Q4V3 3K4AA 4RGAA 4FVVA 3MDPA 5DM6V 3N9OA 3VBOB 4UFIA 1S0BA 2FMYA 4BCUA 3LDRA 4C8DA 4Y4RA 1H6XA 5HI0A 1ENVA 4ZU5A 1EN4A 1W8ZA 3PHMA 3H3LA 2GNDA 1SCRA 3WNPA 3ZXLA 3OBRA 5D8AC 4N90A 1FV3A 5LXTB 4J25A 1BZWA 1N1VA 2WSSG 5T50A 4YVWC 1OCZC 4D0QA 3MW2A 3AC0A 4WVVA 3HT2A 1LAJA 3AYEA 3GALA 1VQ6V 3S30A 3C7HA 3UT5A 5AC93 4QKFA 4TV8A 5IT6A 3T1HB 1W2TA 1CAXA 4FP3A 4XAAA 1RGSA 5FPXA 3BODA 5L3BA 1XYOA 3LDDA 1F51A 2XONA 1RUH1 5JZGA 1STMA 3PURA 3W5NA 1OOPA 4B08A 3VKFC 3B02A 4FIPC 1H2NA 2GN7A 3KCCA 1EPWA 4IE4A 4DXTA 1FPN2 5CZKA 3D5OA 3FD9A 1QJY2 5LA2A 3P32A 1T5EA 3H1MA 3ZRSA 2HJIA 4JKMA 1X9TA 2BGPA 3I2JA 1EUUA 3I3BA 4JZGA 1PO21 1VMFA 2IU3A 4XIOA 5LBFA 3RYFB 4CXYA 2F1MA 1VPHA 4YM3A 4RWUA 3T1YO 3S0MA 4N43C 2EIGA 4CYDA 5B1NA 1CX1A 1G1XB 3WF1A 4EN7B 1QR9A 2CWMA 5IATA 1JZ6A 1R091 1RUF1 3KVAA 1AJPA 4DRXA 2IW5A 1VBE1 2QQKA 3POWA 1TVKB 2OYQA 2IVJA 2ZGTA 3I7DA 2R9AA 5LB6A 4IV3A 4AVCA 2UU9O 1J5EB 2P5BA 3DECA 1N36O 2XHNA 1BLZA 4AI2A 2ZEWA 1K3EA 4YJ2A 1YITV 4DUVA 4LFBO 3RG0A 1H8EG 1CEZA 1PX3A 1M4WA 5J96B 3WW4A 5B1OA 1WPXA 1CIWA 4LF4O 1RM1C 1GP5A 2XJSA 2X6CA 3PVNA 1H9WA 5ANQA 1B35B 1FNZA 3QACA 3O1RA 4NN0A 4CDUA 2NPIA 4HT1T 3ZKYA 4AVAA 1RIRA 5FY5A 1OPMA 5TISZ 3Q8BA 2VGDA 2FD8A 2CK3G 1NA1C 1LHVA 4FPOB 5A3TA 4KNCA 4CPBD 1ZA4A 2OUHA 3ZVXA 3IAYA 4XDPA 4XDKA 1NH2B 1OLRA 3O0XA 4U7NA 4DUZB 1KMIZ 2HHHO 2KR2A 4YVWB 5FZOB 1GN4A 1OCZB 4WCEV 3VLBB 4GH4A 5FMBA 1IURA 1Q8PA 4SBVA 4LA2A 1W6OA 1XREA 3NVCA 3A7QA 2P6CA 1D2SA 5CFDA 4LUMA 4KU7A 4GJYA 2IXLA 2YSUB 2Y6LA 1ULCA 4I3PA 5JMOA 1PMHX 3SPCA 1H8HG 4UCTA 4KWKA 3OGSA 4Q4W2 2EVXA 1MS5A 1GH6A 2VMIA 3P5BA 4Y22A 3FB5C 2G9ZA 2ZR2A 3CDZB 3ECQA 2D6KA 2MEV1 5L7OB 4HMZA 2E75B 4QX2A 3UV9A 2Q8OA 1HXS2 3WG1A 4I09A 2HKOA 5L3DA 3Q8CA 3JAWA 4GZRB 2ZTNA 3SR2C 4ET7A 2ILMA 3AXEA 2IC1A 4JI3O 3IDEA 2VVFA 2EAKA 3LKJA 1ZX3A 3RI9A 1GOHA 2AENA 2BOIA 4N43B 4UOJA 3LSEA 3N36A 1UFIA 2PGGA 3B9CA 1KQSU 3LCPA 2ZKLA 1OZ0A 1VMGA 3AP7A 2XAHA 4AYUA 2ARXA 1NLQA 3JAKB 2WLHA 5K9YA 2OVUA 3VKNA 1V9U3 1AI5A 3V56A 1GZWB 1FYJA 3K3OA 5I91A 2CYFA 3K04A 3TNPB 4X66B 4CU9A 5F2SA 5LY1A 4WM7C 2RS12 2ZHMA 1W6QA 1FOD1 4B4QA 4HN1A 1VF7A 3QO8A 4XW3A 3RZMA 4ZXEA 3OE7G 2FBEA 3VBSA 3JD1A 4OZOA 4LF5O 4BXSV 3RVHA 4RFT0 4W6YA 5CA1A 2W94A 1ZRDA 3KB5A 1YJWV 4HVRA 4C1WA 3ZDSA 5CAZA 2W52A 4YZ2A 2G9GA 4JKLA 1RM1B 3NJZA 4G28B 2DQ3A 2H0VA 3VKLA 3J9SA 5KHJA 2XLFA 3CJIA 2EJ7A 3L75H 4PELA 5B1AC 2UUBO 3H7JA 3CCUV 1XPWA 5LHGA 4B3MO 1XMOO 1WZXA 4JZ2A 4YG0A 1WBLA 1NA1B 2LROA 5FP7A 2WNUA 1IOAA 3F7VC 1CESA 1I6XA 5BY1A 5J2TB 5LATA 2AHZA 4X20A 3HVDA 3PTRB 4LUKA 4X8PA 3PIJA 1QU0A 4UCVA 1CX4A 2RMU1 1ZRFA 1AR93 3R65A 3IPVA 1ZL8A 1XU2A 4DUWA 3PUAA 2QWRB 5H9PA 1NCQB 2ZM6O 2XKOA 3M4FA 1AR83 4QKNA 1O7FA 2RCVA 4CS3A 2HWE3 3E35A 1S76D 4YZ3A 1NKDA 4UFZA 3TEYA 4J7KA 2WNEA 5IVVA 4JI4O 1Q6HA 4QB1A 1N32O 4DR3B 1PNKA 3ZYIB 3J4UH 4QHZA 4XE9A 1IX9A 4DW1A 2VZOA 1OCRB 3EHKA 4CEYA 2ZR3A 4BOWA 4NXMO 2W47A 3RYIB 1RUD3 5FOBB 3WB1A 4DR2B 1TEIA 4HANA 1RJ7A 3ZO0B 1QLEC 2ZGRA 4IHJA 2WWJA 2GP3A 3TN91 5GZCA 1W0JG 1LU2A 3BABA 2R49A 4RL7A 1XEQA 2DFCA 2KB1A 2C1FA 3RGBA 3HKCA 2ZCWA 3CE2A 2B39A 2ZHNA 5FPRA 3ZFFA 1SLTA 2CSGA 5JI9A 1PMJX 3V0BA 4AI9A 1BJQA 5A2QN 4AR2A 1AR62 3POSA 3W9AA 4PA6A 1IPSA 5KC6A 3MDSA 1RUE1 1XNAA 1RUG3 1NZ6A 1VBC3 1PX4A 1HX6A 4WM7B 5HFMA 2LO1A 4XJ8A 1LOAA 4GKYA 3U11A 2EA7A 2WC2A 4X89A 1DDLA 1F8VA 2W9XA 4M4RA 1WBFA 2XJRA 3FB6C 3CBNA 3WDWA 1PGW1 2FCVA 3MIDA 4Y24A 2JIGA 1W8WA 3GZTB 1IDSA 4L0PA 4NRQA 3OGIB 4JI5O 5LMNB 4LH6A 4NO4A 3T4ZA 3NJXA 1QJX1 1AZDA 5B1AB 1DHKB 1PVC2 3E86A 4X6RB 4HPKA 5JCTA 4IGPA 1E1QG 3DXRA 2WLQA 5L73A 2NQYA 4NXNO 5HPOA 3A0RA 1TMF2 2XVLA 2FCUA 3ZN0A 1OURA 3LE0A 1YHFA 1JJ2U 3CC2V 3KZ4C 2Q8DA 3OTFA 5A7QA 4ZHQA 4QX5A 1JYVA 2FQPA 2QDRA 1AL22 2HWF3 2VE1A 2PQSA 3DYOA 4JASA 3RRDA 1RMU2 1XOUA 3DV8A 1MQTC 1GTOA 1QJZA 3GHMA 3GVMA 2W1QA 4MT8A 3JD72 4JV5O 5FPOA 4ZXKA 2YEVA 1RVF3 4CP1A 1W2BU 1SQFA 5EYYA 2A75A 4CCJA 4OGQB 4LFAO 3ZYFA 1OBNA 3JUUA 4JI2B 5LGUA 3LDCA 5LA1A 1G9AA 1QLEB 4X1IA 1DK1A 2X53S 2Q8CA 4MVZA 4O4JA 4BW5A 2VD7A 1LHNA 4Q20A 1RC6A 3KV6A 1B6QA 3AJZA 1IKQA 3PJYA 3S3XA 3WINE 3AG7A 5DAWA 3RZKA 1QLNA 3E5UA 4HL0A 1XOYA 1LODA 1TME3 3FB7C 3WQ0A 4RA0A 1Z5WA 3VZMA 4UUJC 3NNJA 1K9MW 3DPRA 2E76B 2P6JA 5LOVB 5LBQA 1MEC2 3H8OA 3SEEA 3UGFA 5GLTA 1QVFU 4YW2A 4B3NA 1A8DA 1Z7S2 2VG9A 2DTYA 1W9WA 1CPNA 1AR71 2VZQA 1EN5A 5JOYA 2ZMKA 5FNVA 1ZAUA 2Y4TA 2VWJA 2ID4A 5B2GB 5FYMA 4IE6A 3I2DA 3AL5A 3PVEA 1YVWA 4FJCC 4FT8A 3T1MA 4PA9A 3AK3A 5F6KA 1ULFA 3LNNA 4XBFA 3JB8A 1WJZA 1HB4A 5LBCA 1O3QA 4GQ7A 1D2QA 4OMCA 1SS3A 3CNAA 4BIFA 3LZZA 3R66A 2VMFA 5IWFA 3ABMC 1I1EA 2JJ2G 4LH7A 5FYIA 2A3XA 1QR8A 2AXTZ 4Z1VA 4PJYA 4ONUA 3D3AA 1HRI1 3WX5A 4IUGA 2LFRA 1SDWA 1FMD3 3LPGA 3THCA 2DW4A 1PZ7A 3KCYA 1W9FA 5JXIA 2Q67A 3LWCA 3ZIWA 2ZE6A 3ZIAG 1OKQA 1W8OA 5JJJB 4LP8A 1MQTB 4E4EA 4HVQA 2RR12 3OEBA 3TXSA 1BEV1 5H5NA 1OPOA 4K3AA 4FLXA 2W1UA 1QIQA 2OQ7A 3VD9A 2QQMA 4P2ZA 3J8F1 3WG2A 3SCHA 3I3DA 3WG4A 5GONB 1D0GA 3QOPA 3P1IA 4MTFA 1YEWA 4JC1A 2XBO2 1KEXA 2BV4A 3I4IA 3L2HA 3K5NA 1S77D 1ACCA 4UWDA 5BNOC 2MK3A 2VVEA 3V64A 5HCHA 3VBHB 1Y76B 3PJSK 3ZHTA 4CH5A 3JALA 2VQFO 2JD4A 2WT0A 3LFIA 3ACIA 4FMTA 4A7ZA 4QAWA 4AW7A 2DCJA 4A7YA 3HKBB 5JQGB 1WB7A 3RYHA 4XYXA 4AG4A 2TNFA 3ZYGA 2WWUA 1UOFA 5G05L 1AI7A 5T54A 3M7MX 1E57A 5ACA2 3BIEA 3A4UA 3T08A 3QBQA 1DZTA 4OUEA 2EINC 4UV9A 1I94O 1ZBE3 2IXCA 2IXKA 2PHTA 3K03A 1WLCA 4YW3A 2PYTA 4S2GA 4DV0B 2ZNIA 4Z1MG 1C3HA 4JI1B 4LBJA 3GCWA 5F3IA 2RDSA 2ZZQA 1H38A 2WAOA 2IUWA 2WSUA 3DYMA 3T2TA 1VRH1 2WO7A 4NYKA 2VZSA 4ZZ5A 3BN6A 1LHUA 3JD3A 4QX1A 1LGBA 2QM7A 3ABUA 2GTSA 1UZYA 5C93A 4DPNA 5FYBA 3NWKA 1LGCA 3KV9A 5F3CA 3RDIA 3ZXDA 3MW4A 2DUQA 4CC5A 1MA1A 2CDOA 3OR6C 3T09A 3R4DB 4K8ZA 3CO2A 4YY3B 1Z0HA 1QWRA 5FP3A 4EN8B 3ILRA 3GBWA 4JGZA 2WBKA 3ABMB 3KM5A 1R6KA 2FYUH 2EILC 1PL4A 1QMJA 4GB33 2DN9A 4D7TA 5F3GA 2P17A 5J48A 1WD4A 4JKKA 2JDYA 4RSUA 1YWKA 1J84A 2XHKA 4TQFA 1O9HA 3OGCC 3ZJZA 3KCXA 2PI5A 4FQ4A 2ZHKA 3D36A 4FLZA 3CZUA 3GZEA 4MVUA 2FDKA 1UMHA 2BFUL 2BWAA 2JENA 2D98A 4P9IA 1H1AA 1P49A 1SQXH 3CCJV 4FOWA 1YZBA 5LYJB 2Z3YA 5A1AA 1IQAA 5JCOC 2O0OA 3WW3A 2B9VA 1SZXA 1H2SB 4A3ZA 3JCIA 2ZX2A 1UXZA 5FYHA 1MS8A 3ZBHA 1QQCA 3AFKA 5CFCC 5LW9A 3ZRXA 5A70A 3U0ZA 1EV11 3W59A 2W95A 4PDMA 4ZOLA 1QKQA 1OLMA 2WLKA 4LBMA 5BNOB 3OPZA 3OR7C 5EFUA 2YXLA 4FAGA 3ZDVA 4BDVB 3PTYA 5BYNA 3NV3A 2ZAAA 4FFFA 3A0HZ 2VUAA 2ADDA 4UBHA 1VJ2A 5KBFA 3S3WA 2XJUA 3NJVA 4CUBA 3OYWB 4YW7A 1ZTEA 4AGVA 3AXDA 2AZ5A 5BNNC 3RYPA 2I07B 3T2MA 4OHWA 1SA0A 2XWBB 3DN7A 2GH8A 4PDRA 3B9IA 1H1MA 3MLKA 3WQBA 5H9CA 2EINB 3NAPA 2PHFA 2XLAA 3OEEG 5CU1A 3ACHA 4AEDC 5ITZA 1OT5A 1HB1A 3ZYJB 4MXVA 4BQ4A 3I2IA 3ZFEC 5KAFZ 3UESA 3OMAB 4DV3B 2JS3A 2GU9A 2VRZA 1UL9A 1VBB2 4CH6A 2PMWB 2OT5A 1R082 4JAUA 1YTFD 4E8DA 1QU7A 4P5YA 5C8CA 2BTOA 1K5MA 1UYPA 4CEWC 5A7NA 1AB3A 2VC9A 2JWPA 2CU5A 2VQEB 2ZT9B 5HXMA 4LA3A 3O1OA 5D8AA 1JOPA 3X29B 2HBUA 2ZHLA 3IAPA 2E5LO 4BH9A 1RP3B 5DDJ1 2HWC1 1PO12 2JDKA 1N33B 1RUI3 1VB2A 1DQ4A 2FDFA 4R9BA 5FR3A 3K0GA 5FY9A 2W6JG 1QQP1 4AQ2A 1XBFA 1KU9A 3WDVA 3OMIB 2JRIA 1V0AA 3LA3A 3M8LA 4LF7B 3BA9A 5CB4A 1ULPA 5DN2A 5FYSA 5L9BA 2AH2A 4JTCB 1GWMA 2UXNA 1IBMO 4GJZA 2IFWA 5IK5A 5J2UA 1PNMA 4KUMA 3V65A 4CCLA 4JI0B 2FTKA 2P7TC 4QHBA 4HYOA 5K4LA 2C5DA 2EF6A 4P9OA 4BQXA 3N4MA 5GLWA 3E8FA 5IK8A 3J7LA 1Y66A 1Z2GA 2WJSA 3AG3C 3QO7A 3Q9OA 1AR1B 5EZYB 2ZDIA 1H1IA 2X7RB 1VB4A 5FXXA 5FK8A 5IYZA 2QKCA 3CRCA 2PN5A 1OH3A 1DIWA 3ABKC 3VBRC 1XE7A 1TAEA 2ZX1A 1ND2C 4BMBA 4G3YC 2O8QA 4MGZE 5CFCB 1C8M2 4JDMA 3DCQA 1DGSA 4TT3G 2R061 3SGIA 2GAUA 1Q6UA 4PDVA 5FKCA 3JATA 4CC6A 4KWJA 1SEFA 4E27A 2CDYA 3R4UA 1LOCA 2MPFA 2RS31 3IN9A 4QDSA 3CXHF 3L74H 2H8PC 4B4PA 2PZSA 4DEQA 1N34O 4LORA 2YIDA 5BNNB 5FQ0A 3PVBB 2EX3A 4UF0B 4UVBA 2QBXA 4GLXA 2F4VB 4OX9O 1RHI1 2XOMA 4B3SB 2J1AA 5A3UA 5IYCO 2D3SA 1QJU1 1LKNA 4JV4A 1NS1A 2EXJA 1DGWX 3N9LA 4U3FH 2W0FC 4LF9O 5KWRA 1LR1A 4MGTA 2JIJA 3QCWA 1CZTA 4LBKA 4DR5O 2JG8A 4L8JA 4JGYC 3I59A 3E5XA 2E53A 1R3LC 1QEXA 1W59A 4O61A 2KSDA 5D5QA 3E22A 4CEWB 3WNOA 3FX7A 5DAXA 1AYN2 1YJ9V 2ADQB 2XJPA 1PK6A 3H3UA 2M6YA 5DUXA 5AC92 3WZ1A 2UUCB 3BVCA 3UT0A 3AKTA 4GWIA 4LO7A 4DR1O 2QEXV 1J3QA 3HPLC 5A33B 2DU0A 3JAMN 2L6LA 3AB0A 1LUWA 5BY5A 2LM3A 1QDOA 1TNFA 2VXRA 2Q1ZB 1UX7A 3JASA 1HLCA 1BQZA 3N2GB 5CBFA 3AG2C 4CA9A 2D5HA 2KM2A 3IWZA 3FX3A 1AYM2 1X33A 5EP9A 2CTRA 1L7QA 3W7XA 4DV5O 3ASNC 1CAVA 2Y38A 1XC6A 3AKQA 2QFEA 1GN6A 1KGYA 3E8BA 1BMV2 2R0HA 2OTLV 4BIOA 1H4GA 5FZHA 5C5TA 3AG3B 4FLWA 4FOVA 4LBOA 1ZBA3 3R05A 2DVFA 1FAYA 1IG3A 3C7EA 3ABKB 3VBRB 4YW6A 2RM23 1ND2B 4E9KA 3STLC 2JD9A 3ZN6B 1ND3A 1K42A 3B8MA 1HQLA 2PUSA 4LO5B 3K75B 5TSWA 1I0HA 4Q4X2 5JXJA 3OPWA 2KKWA 4FOYA 4IGGA 3VHRA 1L0LH 4KI5M 2JG9C 4IE5A 2XVKA 2XAGA 4P14A 5C9AC 1E5RA 3FLTA 4O4HB 1XNKA 1CXZB 4AWDA 5HBAA 2AEYA 4O9EA 5T5JA 1TZOA 3LFMA 3USUA 2JDIG 2QQPA 1NCRC 3JU9A 3JCZA 2AC1A 1S0FA 1G9DA 3B4SA 1K5QA 1YCIA 5EHDA 2JJ1G 3KMHA 5A3NA 3MI8A 3BIWE 2P67A 2UUAB 3GGLA 3F2ZA 1WN7A 1JU3A 2V5DA 5F2VO 4IE0A 3WUDA 3NKGA 2RS52 1BBT1 2BPA2 3MF6A 3TYJA 4O2AB 4I4TB 3TAYA 2VNGA 3AZYA 2FDIA 5LL6Y 4EQVA 4JGYB 3V0AB 4OI1A 2A6VA 2L9LA 2FDHA 4EEQA 3ZRWA 4FPHA 3WB2A 1YI2V 4GWMA 4I5SA 1HRV3 3ZYBA 3IFXA 4LOSA 1S0GA 4TWKA 2OWOA 2RG4A 4PDLA 5L19A 1ODMA 4MXWB 5A7WB 1SKVA 5KX5B 4OHYA 2JVDA 1K5SA 4ZPIA 4I0AA 5JZGC 1YJKA 4EZHA 3ES4A 2QZ3A 4FLTA 1OOPC 4MH0E 5JSOA 1W6NA 4JYYA 2X09A 3B3QE 3RVZA 2WS93 4KWLA 4AF9A 2XNDG 3PUHA 2O14A 3OD4A 1KD7A 1RUC1 4XFHA 5FJHA 3FJSA 4UCOA 4KGQA 5AFEA 1C1FA 2VBPA 5CA0B 1BL8A 1LOFA 1EZJA 2WLJA 1Y4MA 2NNUA 1NVPB 4QPYA 5C8YA 4DV2O 4TSVA 3L9JT 4DR4B 2XWJB 2ZZJA 4TV9B 2ENRA 3G6EV 4BQ5A 2J1TA 3H1JH 2C6SA 3RYKA 2ZE5A 2WLPA 4PT6A 4L9BA 1XILA 1AXKA 3POFA 4P00B 5FPBA 1CD3G 1PM7A 4WZCA 4Q5OA 4LHKA 2LUWA 2XJQA 3KWVA 1L1FA 2VUDA 4OQ9A 1F4HA 2B8MA 4IV3C 4YM1A 2FZ2A 2YXHA 5GTIZ 1OJHA 2GC2A 1PIV1 1R1A2 2KG7B 3RNSA 3AMHA 1KRIA 1GOGA 2Q4SA 1JYCA 1FFXA 1V6IA 3VD4A 1S5JA 1YFYA 2OUJA 4EN6B 4MGYE 4RN5A 3LUTB 4CP9B 4XJZA 2J7MA 2WZR1 1NCRB 3BPZA 2GNTA 3IMNA 3NNFA 1CPMA 1JN2P 4LFCB 3UK9A 2YBPA 4NKGB 3LSSA 4XCAA 1XB9A 1TE1B 4CDUC 3OY8A 1O6UA 4OI4A 4DRVA 1IS4A 1MOFA 2VTXJ 1VF6A 2IFRA 1K12A 5CADA 2GDSA 1F35A 4MGKE 3VBUA 1V6KA 5C8WA 1PM9A 3ZMZA 1PZ9A 2P90A 4YLZA 4WBNA 1N1YA 4B1MA 3D8CA 2HKXA 3L70H 3N9PA 1WWYA 3DGTA 4W4LA 4A3XA 5JR7B 5JVVA 2ATFA 4UXNA 1OLME 4YM0A 4WVZA 4IW3A 4YZ5A 1J1TA 1RUH2 4GH4C 4B3RB 3IKWA 2JE7A 1UPGA 1ULGA 1WKYA 1XMQB 3UT5B 1R1BA 2TUNA 3KT1A 4TV8B 4BQWA 4WFHA 3ZXKA 1CAXB 5CFDC 2Q1MA 4XF9A 2XAFA 4XBQA 4HOOA 2N04A 2W92A 2CGOA 3RZHA 2N7GA 4BK5A 5JZGB 1EP0A 4Q2FA 1J5EO 1O4TA 1OOPB 1UAIA 4FK5C 1PO22 1WLTA 4MVSA 5H6QA 1OA2A 5FY4A 2DCYA 1CZSA 1G7YA 1P7BA 2VOVA 4UV8A 3SHRA 4LKEA 4XUNA 2GALA 1TQ5A 3ZMVA 1SPPA 1RUF2 4W65A 4C90A 5EYXA 1VBE2 3O0VA 4J9ZB 4K8RB 1I3HA 2NM1A 2JGDB 4CDQA 1SQPH 3KV4A 4CDXA 3R4SA 3WT3A 3C3VA 4IDZA 1V6JA 2QCSB 1ASJ1 3I97A 4DRXB 2WQ4A 3GNEA 4AVTA 4Q0QA 5IYDO 2V72A 2E26A 2A3YA 5KHKA 1W2UA 2P3KA 1V54C 2WLLA 1X8EA 4UXAA 2JE8A 4E2LA 4IV3B 5DXDA 3AL6A 1GZTA 4XILA 3AEIA 4DUZO 2VL4A 4IEVA 4ASMB 2YFUA 3VL8A 1ULDA 4AZZA 3ME2A 2ZE7A 2CDPA 2W3JA 4IEWA 3VBSC 1G9BA 1N4CA 1GNZA 4YJ2B 4WVMB 2JDAA 3SKVA 3UKVA 2YY1A 3RWKX 4ATEA 3O65A 1BHBA 2SBAA 2ZEXA 2A79B 1V55B 1EN6A 2E33A 3ZYHA 1DGLA 4DR7B 3M2MA 4NRPA 2AACA 1ZRCA 1SLAA 2QGNA 1D4M3 2YBSA 1RXFA 4CDUB 4GWJA 5FOJB 2B46X 3LOBA 1VQOV 4GKKB 4YHHB 2JICA 1WUVA 2VNVA 3H0OA 1GOFA 2PAMA 2ZGNA 4FOQA 4CPBA 3I2HA 1JA8A 1YHQV 3SNMA 2WNUC 3T3YA 3ILNA 2HEYF 2HJFC 4LEJA 2WQZC 4MTXA 4ZHNA 1VRBA 4EB6A 4JYAO 1QHTA 1XQ8A 4DV1B 1WNSA 5KHIA 3O0WA 1DCSA 1G86A 4TQDA 1EAH3 4LTAA 1W6OB 1QOTA 1Y74A 1CVNA 1ZX5A 2W1WA 2D3OW 3FHQA 5CFDB 3LSUA 2NLJC 4Q4Y1 3W58A 1ENSA 4EJRA 4QGNA 4CCKA 5A6YA 2BQPA 5LMUB 3CCMV 1QGLA 2MEV2 1RUJ1 4LHNA 5IHRA 3M70A 3OTOB 1VAVA 1W8NA 3O1TA 1GKFA 2YG0A 4X66O 5FYTA 3VHOA 4JI8B 1GKBA 1H0BA 1M9NA 1ZYBA 4CEYC 5KAIZ 1I08A 3H9VA 4I01A 1C8NA 4Y22B 3WFVA 1W6MA 2CTWA 1QCEA 1US6A 3RFRA 4QJFB 5GLZA 1VAKA 4FLVA 2QQWA 5DEDA 3JAWB 2PLV3 3A0NA 3U1XA 5DUVA 2ETNA 4X1KA 4IERA 5FZCA 3BCWA 1JMKC 2YUEA 5A1LA 3B40A 3Q8FA 2E31A 5LP6A 4GWNA 1FOD2 1DQ6A 5EIBD 3BTAA 3ZFFC 2C0ZA 4BQYA 2LRPA 1U5ZA 2UU8A 1X59A 5B4XA 5AVPA 1AJQA 1V54B 2D97A 1W6QB 2LQTA 3MO4A 4AVSA 4LF6B 3ILFA 1W90A 1I5PA 3VBSB 4KH9A 4OULA 2QQVA 3VZOA 1S0DA 2QJVA 2P5OA 2M7WA 1DBNA 2EIDA 3WP5A 4F4LA 5LRSA 1VBD3 1US3A 3RZZA 3HQXA 5CA1B 5E88A 4UW5A 4FFIA 3S7IA 4K1YA 4WVWA 2R6QA 3ACGA 4XDQA 3ASOC 4NHXA 4FVMA 4GAZA 5FO8B 1W9TA 2WO3A 5E79Z 3HMYA 2R16A 3CJIB 3HNMA 4WFAV 4D7YA 2RMU2 1RJ8A 3CLPA 1AXZA 3VZJA 2OCCC 2DOSA 2X6AA 1DGRN 2Y6GA 2HYKA 2WNUB 4JRLA 4LNUA 4F8AA 1GV9A 4GA9A 3FE5A 1S2EA 4X20B 5DUUA 3SXWA 4FO9A 1WA6X 3K9SA 1AUYA 4CUGA 2P2KA 5A80A 2EIKC 3LQCA 3KHBA 5M0TA 3AKSA 3IPVB 1ZL8B 4GYCB 4D6TH 1UY1A 3H1LH 3T0AA 4O65A 1NY71 1JZ7A 1YUDA 1UU4A 2WO1A 3UO2A 3G6JB 4UT5A 1PNGA 3MGUA 1N3OA 1D7PM 2RE9A 5E89A 2A5ZA 2JDHA 1PHMA 1Q82W 3RYCA 3NW4A 3U10A 5FZ1A 1AR5A 3KHCA 2RN9A 1DYKA 4YARA 4HAMA 3TN92 4M4PA 1OSGA 5KUMA 2AW9A 4ICGA 5LCWL 1XSRA 2WFF1 1K3IA 2BDRA 1BKZA 4CEYB 4I50A 3N2KA 1IG0A 4HKLA 2A06H 4Y1XA 5FO7B 1HQWA 2ET7A 5JCOA 3SQOA 4IHJB 4M01A 3N7JA 3HKEA 1Q3EA 2QR4A 4K8FA 4F7ZA 1OQDA 5F5QA 3ETPA 4NR1A 3OEHG 4ZI7A 1T6BX 2WA3A 2DF7A 4BPZA 5BNPA 3BALA 5C70A 5LMNO 1A78A 3HKCB 2RJLA 1RUE2 4XURA 2JIZG 3SCFA 2XASA 4HZ3A 2Y48A 2PELA 2UU9B 3ZFFB 3SYCA 3B8NA 3WW2A 3S5QA 1XNDA 3DPRC 4OCTA 5FZEA 2W39A 3V0BB 1X9PA 5F37A 4RS5C 1PGW2 5F5IA 5EBLC 1LRHA 1VQKV 4FFKA 2HWB3 2VMHA 1BYHA 1F2NA 1UN1A 1E5SA 4Q0SA 2LP7A 4N53B 1K8AW 3EXAA 1MS9A 2IJIA 2VPVA 3KQRA 4DYLA 2ZKOA 5FZBA 2LGQA 4LOTA 2XXZA 4NOTA 1WGPA 4NHKA 3KLSA 3QG5A 3T1CA 2Q4PA 1YF2A 2A6YA 3I3MA 4A2UA 2VTFA 1NR7A 1ZNPA 1CJDA 5FP9A 2Y4UA 4Q4V1 2OCCB 4HPKB 1RPRA 4JI2O 3WG3A 4HK8A 1GLHA 3DXRB 3VDCA 2D3PA 2Z0AA 1GANA 4NVPA 4NHMA 3QH7A 4ZU7A 2EIKB 5B1BC 4K3UA 4JQRA 1YC61 2JEXA 4O9GA 4DB5A 1QXJA 3BA8A 1YLLA 2XLGA 4ZHQB 2Z69A 5BR8B 5I0UA 5KA6A 2DE0X 1YDXA 1IS5A 1UY3A 2ET1A 5AC91 4LWSB 5FLIA 1NT0A 3W7UA 1GMMA 5FPLA 3ZXEA 4M00A 1N47A 3JBG3 4RHV3 3T0DA 4UCUA 1S5HC 1HW5A 1JYNA 3KVBA 3LB9A 3WD5A 2PHXA 4FPLA 4DUXA 1VP7A 3ZXAC 2HEWF 2YPDA 3PLQA 3ETGA 1UWWA 5FO9B 4X6QB 4YW1A 4AEJA 3I2GA 3E8GA 2VY0A 5IWAB 4X1IB 1XQNA 1K4DC 4EV0A 2X8KA 2EZPA 4O4JB 2DVGA 2Q69A 2R72A 1LR5A 3CCQV 4G4FA 3IB3A 1AJKA 4KG8A 3CRQA 5CISA 2RNBA 2JDUA 2ETEA 2UWBA 1NG0A 3E6DA 3WP4A 1BMV1 2JK5C 2GSYA 4YGBA 4XTMA 1MNGA 2GN3A 2F93B 2IXJA 3ACLA 1AR72 1UOJA 4HG6B 4BAYA 4QM8A 3AP4A 3ZN5A 3K08A 1ZRRA 3ES1A 3M1HA 4INDA 5FL7G 4DOUA 3DKWA 2C9KA 1P4RA 3UQ8A 1F31A 1F4AA 2E7QA 1N8RW 2WLNA 4NPRA 2L35A 1FT9A 3TB0A 4K9SA 2H6BA 2A7WA 2ZGOA 5FNVB 3SJAC 2UUBB 4U2AA 4HBNA 1FPN3 4B3MB 2YMZA 4BWAA 3L2YA 1QJY3 2HFEC 4HETA 1H2GA 4FPEA 4BHPA 1TUBB 2RDQA 4LQRA 4QM9A 5I0DA 1L8DA 1HRI2 1OMIA 1OA3A 5FK7A 1JYXA 4O2BA 2V4AA 3CCSV 1UJWB 5FPZA 2QTSA 5AG2A 1SBFA 2IM9A 5K1XA 4FPFA 4AI1A 5CMUA 3K2OA 4JGZC 2XJTA 1QHDA 3PNAA 2P22C 1O59A 4UFHA 4FPGA 1P7GA 1GM9A 4DV7B 1BEV2 5B1BB 1OD3A 4Z2AA 3I3EA 5F5AA 5IJRA 2NN4A 1QNYA 3EMRA 4RGGA 2OA2A 3D36C 2P4KA 4D7SA 5J36A 2B7YA 2QWOB 3J8F2 2YUAA 4XJ9A 2VUJA 4HSLA 3LGRA 1H2MA 1E5HA 2H3OA 1FXHA 4Q29A 3H3ZA 4ZKTB 2XT9A 3D6EA 4Y5Z0 1KDKA 1OCCC 2W91A 4JTNA 1UNBA 2WFPA 3INAA 4O4IA 4DV0O 1KJRA 4ZS3A 3ZX7A 4AI8A 1TVGA 2FDGA 1SETA 2XQXA 3U14A 3LEMA 1J3PA 1W2NA 3SH5A 2QM4A 1ZZ8A 2Q8EA 2B5HA 4J1WA 4CUCA 1Q43A 3PL0A 3HWJA 5C3OA 1NTMH 1XHXA 4AGRA 1JH5A 5KXDA 2BFUS 5F1RA 2QA4V 2P1BA 3JALB 3ZMUA 3A2FA 4I30A 3LA2A 4XZPA 4CVUA 3N3HA 3KS7A 3RYHB 5GZDA 3UO3A 2PQQA 1KUQA 2WKKA 3W7WA 1WMDA 5T5PA 1AROP 4I55A 3TBDA 1T6GC 1VRH2 5BPXA 4DEVA 3D82A 2YYOA 1V9U1 2XUEA 3NAPC 2ADEA 4IEZA 3NKTA 2TBVA 4LC1A 3HPNA 4GULA 4YGDA 3ENRA 3UGGA 1BK0A 1RSOA 4NRMA 1OF3A 2ZOEB 4Q4W3 3WNLA 2BCCH 2Q0AA 4R50A 2IH3C 4Y1YA 3EBRA 5DAPA 1MABG 2AGAA 4RUFA 1Q5OA 5C8CC 1K5MC 1CIYA 2PAKA 1GAXA 1HXS3 3K79A 1YJNV 1XNCA 2C4XA 2BOBC 2R30A 1NU1H 1LTEA 4NXNB 4BU2A 2ZGSA 5GKAC 1O9GA 3H9AA 3J26N 2ARAA 3WG7C 2Z4FA 5H9SA 4JTDB 5JVDA 4TOIA 4XC9A 4HXCA 4Q8LA 3AMNA 1SQGA 4PQ9A 5J9PC 4UW3A 1NKGA 1KECA 2A71A 4XBNA 4XETA 4MV2A 1WMXA 5DZFA 5BUVA 4AAPA 2ZBJA 4FXKB 3A0BZ 5DZEA 1AR91 4QMAA 4JV5B 2EIMC 2QDOA 2Y6KA 3LOIA 2RS13 1AR81 2IH1C 2DYRB 1SZBA 2HWE1 2QNKA 3POIA 5JLVA 1EV12 2ZMLA 2QZ2A 1UXXX 5JH7A 4CS4A 1K45A 3LSDA 4D94A 2ZDIC 5IDJA 5JOZA 1OCCB 1GQPA 4RD7A 4QPIA 4NE9A 2DWEC 2E32A 3CU7A 1PGL1 1Q56A 1JHNA 1FXKA 4DV3O 1YQ2A 2HEPA 4ISQA 1RUD1 3DL3A 4ZOLB 3OT7A 1M06G 1LNQA 2D6NA 3WXPA 1AI4A 5CN0A 3ZXGA 4OUSA 3I49A 1HIXA 1JZ3A 4I7ZB 1BVP1 5JXGA 1G8WA 2VQEO 2QQNA 1C1LA 3IM0A 5LK7B 1Q8IA 3APQA 5IK4A 4K1ZA 3THOA 5EXOA 1FXVA 2ZGPA 2DWRA 5GJ6A 5T5LA 1N33O 2JB8A 5A3OA 2PF4E 4DQAA 3C7OA 4BWOA 5C6CA 4SLIA 4FM1A 3NAPB 4NMIA 2DV9A 3MPPG 1IBLO 4P9WA 1JYWA 5ITZB 1RUG1 4UYBA 1VBC1 1N0JA 4LF7O 4UAPA 3CYOA 2JG8C 3AK1A 1NR1A 5C3RA 1YQCA 4QQHA 1UW8A 2I2SA 4R6ZA 2BRTA 2Y69C 1JJOA 3KF3A 5DDJ2 2HWC2 3BU0A 5KMGA 4IV1A 1BQ0A 1OF4A 5C8CB 1K5MB 3GJBA 3RVYA 2QDNA 1ORQC 1W03A 1QQP2 1PK6C 4D6QA 4IETA 4BE3A 3MIHA 1XI1A 5D8AB 1IS6A 1W04A 1SFPA 1AVMA 3HQRA 2JDNA 1Y7BA 3WG7B 3AVRA 1F5FA 5FPVA 4JAAA 2WNVA 2DVAA 1CQ9A 2VTXA 3KG2A 1Y3TA 2GHYA 2Y0IA 3WLUA 4TLFA 4TWTA 4XMAA 3CF6E 3ZHQA 4GALA 1KFUL 3WNNA 3A8TA 2HWD3 1SFYA 2VR4A 2VAUA 3ZYPA 1AR63 1W0OA 1QXRA 2EIMB 5CB4B 1YFXA 4GD4A 1SDDB 1AXYA 5J2UB 5FYYA 1RL3A 2WYSA 5JAXA 2HWF1 3ZR5A 4J7ZA 4WV8A 4OHXA 3TXQA 4AHYA 1UOGA 3PJQA 4B3SO 5FY8A 1HV0A 3VZNA 3WDUA 2ITCC 2R062 1K34A 4AVBA 3N9MA 3QH6A 3H8XA 5IYZB 1NJIW 1GZCA 2GUZA 1RVF1 2RHPA 4IQPA 1W3VA 3C8XA 2RS32 1Q8OA 4L8QA 2F6BA 2WABA 2WA4A 2LGWA 1ND3C 2W87A 2VQFB 4GCZA 2P4VA 2WAAA 1YXBA 3O1MA 2Z5WA 1PVC3 3K46A 3JATB 1NBMG 1XSQA 5L36A 1DQ2A 2I45A 4MVRA 3H50A 1FV2A 1RHI2 4Y4YA 4FFBA 1X50A 4OI2A 1K7DA 5FYZA 1QJU2 2A0LA 4RR3A 5HCAA 4JTAB 2Y6JA 1WW7A 1DTOA 1TMF3 1U0AA 4AI0A 2CH7A 5FQ0B 1TME1 3IC7A 2AEZA 3K59A 1HJFA 4J6GA 5K0UC 2C24A 4DY5A 3FN9A 2VZTA 1AL23 3FYIB 3JD4A 5SV8A 1RMU3 4B1LA 2ITDC 3JD73 2P37A 4Q1RA 2EXKA 5IVYA 4GZ9A 2JG8B 1BT8A 3I59B 4KG0A 3APOA 2VULA 3ETDA 4R52A 4DK0A 1ENRA 3E22B 4MADA 4BB3A 1IPJA 1PK6B 3HIFA 1KITA 3KV5A 5DABA 1JZ8A 2VCMA 5CIRA 4TUYA 3AZXA 5CYYA 1WCDJ 1YQ6A 2XL9A 1JTZX 1ONAA 1WW5A 2GNBA 3B69A 2V4VA 3K06A 4MVTA 2DYSC 2AYHA 4YVSA 1W0NA 5B66Z 2D7FA 3WCRA 3AP9A 3S57A 1HN0A 3I8TA 1VE0A 2IXHA 1U5IA 3EXUA 1YJLA 5GTHZ 3ZMNA 5C71A 1JFFA 2Q1FA 3JASB 4P9PA 2JX9A 1MEC3 3F95A 2BTQA 1FMD1 3HN1A 5FXVA 5C4WC 2QUOA 3OEAA 3CWBH 5EQUA 1UZZA 1K4CC 1Z7S3 4KHPB 2XUMA 1H4HA 2D3RA 1CAVB 2VVDA 2BOJA 4OPAA 4QKBA 2QSAA 1LOFC 1B3QA 1KD1W 2VBDA 2QTOA 4XQ4A 3DGEA 2UUAO 5FZ7A 1YO8A 1MS4A 3VGIA 3BOWA 3M3IA 4I9QA 2J1EA 2JB4A 4ASKA 1EPZA 4CDWA 4M3CA 5C7GA 2JGUA 1WCSA 2NR5A 4QPKA 1ND3B 2JECA 2BZDA 3MYXA 2GV9A 3ZIXA 1U96A 4QQPA 4X62O 4KXRA 4JI7O 1XE8A 1DLLA 3NNLA 4LE4A 3OGGA 1NH2D 4AQYB 5K1PA 2VUCA 2NLRA 2WT1A 3RWRD 1U5XA 4NAOA 4AK3A 2BP6A 1M93A 4CCOA 4COUA 4PBOA 1AL0G 3POEA 3E1F1 3BPSA 1BBT2 4CU8A 3MAQA 3USUB 2D2CB 2JDMA 4LLOA 4IGQA 5I8YA 3RJRA 1VQNV 1ZZCA 3ZEDA 3H7YA 3CJHA 4QGPA 4JRAA 2RDNA 2R9IA 2PA7A 1MZ6A 5DMYA 2VOTA 4DV4O 3H01A 1VF6C 2RR13 3VBUC 1ZBE1 3BGAA 2BYVE 1WMEA 5DUWA 2WN3A 2GP5A 3BY6A 1H2KA 1WP8A 1VQ7V 3BOPA 1IVSA 3DF0A 4BQ1A 2QVSB 2Z5UA 4MZUA 2FCTA 5H6RA 3C3SA 1PMIA 3ZRWB 2V09A 4FPKA 1BCCH 1HV1A 3R0RA 4AFCA 4LT5A 5JDBA 4XUPA 4EFBA 2B1IA 2XBO3 1EAH2 4DR4O 1YXWA 4MGQA 3DC5A 3ZPOA 1WPBA 4WFGA 5IT9N 1S55A 3TETA 1KC8W 4IIJA 2CL2A 3WF2A 1RFYA 3D3IA 5IJ0A 4UCSA 3ML0A 3B94A 2DYSB 1IQDC 2Z79A 3GHNA 1RUC2 4PIXA 4QGLA 4UW6A 1W6NB 3WSOA 4UB8Z 4IT5A 1NUKA 4GB31 4J10A 2YIBA 1GM7A 4BXFA 4OYUA 3P6BA 2VS0A 2P34A 4C0HA 2BE3A 2QJ1A 2DUPA 5FZ4A 2WQ8A 4C1XA 3F7YC 4NPLA 1VARA 2GDFA 4XFFA 5FTTC 1V70A 2G9FA 1M1KW 3FB8C 2EBOA 3QVNA 3FAVA 2BBVA 4XDJA 1GWKA 4CDQC 5C8YB 3KGZA 5C3QA 4BMEA 2VZUA 4HNAA 3LA7A 3LDEA 4Q0VA 4CDXC 1K92A 5KR7A 1PIV2 3T2OA 3IAQA 1VALA 2X05A 2HVKC 3UKMA 4QIWF 4FXGB 2HBTA 3NV1A 3CMAV 3OB8A 4D69A 1ZZ6A 2IJJA 2HJDA 1RITA 2WRAA 3AKRA 5A3LA 3UETA 1D5AA 5F7UA 1GICA 3ORJA 2WZR2 4I0WB 1Y9GA 3FHAA 2DQ0A 4JAVA 1FJGB 2F43G 4B3RO 4GUNA 1JHJA 1FFXB 4RS5A 1VBD2 3B5LB 3ROUA 3VKMA 5FZKA 4IXLA 4NTWA 3OUIA 4C7UA 1RPOA 1MZEA 3OBTA 4LF9B 1HNZB 1GQHA 2ZACA 3SYOA 3M8AA 4MW8A 4TZDA 2EICA 3AZWA 2XPJA 4JI6B 3ITQA 1SLCA 4DR5B 4DXRA 4JCKA 1SF9A 3G71V 5A32B 3ZS8C 1UZVA 3VZLA 1QVGU 3OY8B 1JI6A 2R073 3CC4V 5EYPA 4RQPA 2XH6A 3E97A 3VBUB 1HDKA 5GZFA 2IXIA 2RJKA 3E6CC 1KBHA 1KS5A 3HR0A 4N23A 2XG3A 4AVVA 2UY9A 4PF1A 5I8TA 4WBNB 3LEIA 2VOKA 4YG3A 1I5YA 2YBKA 5FLJA 4Y5SA 5H9RA 4GMP3 4AQTA 1CR7A 1LOEA 3BB6A 5L3FA 2R043 1TA8A 4W4KA 3OPTA 4DR1B 3H1IH 3OFNG 2P3YA 1G8MA 3K5MA 3A21A 1WW4A 4H13B 4X8AA 4YJ3A 2YXSA 5LZ6A 1BE3H 2CAZC 4GX5A 1UD1A 2PHDA 4NTXA 2DURA 1S0IA 4YM2A 2OXBA 1Q81W 5LHIA 1ALYA 1RUI1 5FDBA 2YC0A 4QQOA 3NNMA 3M3CA 1C4RA 4R4XA 4QNHB 2RJZA 1C57A 3EO6A 4QPJA 1VQ8V 3IDAA 4ES8A 3SPHA 1K33A 2XTAA 5EPAA 1WA8A 1ASJ2 3EFFK 2FL4A 4HSJA 4DR7O 4P30A 1A32A 2PYJA 5F9TA 4CDQB 4BM8A 5LP6C 1VBB3 4CDXB 4CUAA 2QKAA 4F6EA 4GKKO 1R083 4Z8BA 2MW2B 3NMBA 2XDVA 2Y34A 5GZGA 1VQ4V 4LHLA 2E9QA 4XHXA 2EZOA 4LBEC 5APAA 1RUNA 3AK0A 4PIYA 2WLLB 2YGLA 4QPGA 2BBAA 3P3PA 2ZGKA 3MF9A 4DV1O 1W06A 2ZEYA 5A3PA 3G4SV 1Q7YW 3JXSA 1PO13 4E2GA 3PN1A 3K48A 3CHXA 3B77A 4B7KA 3OF1A 4YYOA 3JD2A 2D6OX 5CB7A 4EWDA 3MV11 1SACA 1KKDA 4F6RA 4JDOA 2XJVA 1COWG 1QOSA 3I54A 2X5IA 2VECA 3H8RA 3RN4A 4A41A 2JDZA 1NZIA 4JI8O 1DGRA 1N0NA 4IEXA 4QKDA 1ZVFA 4LO6B 1SQVH 4XJUA 1VLNA 4BIUA 1WCUA 1HNXB 4BISA 3IDBB 3TNQA 4X64B 1OVSA 1JCHA 1D0HA 4Q4Y2 3VB9A 1B06A 3IIAA 2ZX0A 4EB6B 1RUJ2 1W3XA 1XL6A 3FC0A 1K97A 1C8M3 4XOGA 4J1XA 3E6BA 1Y74B 1UQXA 4IYHA 1J1LA 3W20A 4X1YA 1POV3 4YSFA 3G80A 4A45A 1Q8QA 3MUZ1 2J1SA 4LKFA 3KT4A 1NAEA 4EWEA 4XFBA 3UGHA 4OHVA 5KXEA 2E7TA 2ZGQA 3L9DA 4QX0A 1Y67A 3ACFA 3OOXA 4LF8B 2CWSA 5KC5A 1ZREA 4XUTA 5G04L 4GKXA 3LNMB 3H42B 1AI6A 1B35C 2A1XA 4DV2B 4YWAA 2IWGB 1IBKB 3RQ0A 3M3EA 1REDA 1GR3A 3A0KA 3K3WA 2F4LA 4X1KB 5BNPC 4TYSA 5IAVA 2B42B 2CTQA 3E2EA 1AR4A 5LHHA 1O4YA 5LP6B 2ZD9A 1WMFA 3OBAA 4S2HA 4QU1A 3SDLA 1ZBA1 3W5MA 1EYBA 1RUOA 2ZQMA 1Q86W 1YIJV 4ARXA 3VZKA 2N74A 1PZ8A 1UU5A 2WSVA 2AZ0A 1AYN3 2RM21 3ALQA 4PI0A 4XABA 4EYUA 4DR6B 5ABJA 1FFTB 2A3QA 1O8SA 1O3SA 3Q4HA 2YC2A 1OVPA 3THDA 2Y0OA 1BMFG 2UYAA 2FZ1A 3OM3B 2WYFA 4AHZA 3GDBA 1H2LA 4LKSA 1WCKA 2F17A 5JI7A 1LOBA 3MUY1 3ABZA 3ABTA 3RJ2X 5FZ0A 1OQ1A 4OMDA 4LIVA 2WLMA 4AFMA 1C5IA 1IGOA 4MG2A 1OD5A 3WQ1A 3ZMOA 2UXDO 2H94A 2ZPXA 3GBFA 1JU4A 5L7OC 2QTWB 3ZR6A 1AYM3 3KSCA 2DWDC 1HR0B 2DVBA 4CU6A 1YI9A 4QX7A 4QXHA 1MS0A 5ANNA 3RW0A 2XGXA 3CRAA 1XJAA 2R9RB 1KXGA 3SPGA 3RZGA 1NY72 4R9CA 4LO4B 4Y3OA 4M3CE 5FZGA 2JGDA 4LNUB 3D0SA 3FL7A 1AHSA 1SCSA 3MIFA 5IVJA 1GP4A 3C2UA 3ON7A 5AFBA 1KKCA 1OV9A 2C26A 1GQGA 3M3OA 3NNGA 2DFBA 3GB7C 2ZA9A 1NI8A 3VD7A 4HVOA 4IYIA 3WNKA 3UJQA 1H8TA 1XBLA 4OFGA 1YIFA 2EILB 2WFF2 1HRV1 4Q4X3 1O5UA 4QE7A 2WL1A 2R1DA 3FHIB 2NP0A 5C5UA 4A7KA 3RYCB 5CNAA 4J42A 4WVMA 3LPFA 4FM0A 4PI2A 1G9FA 4O4LA 4AL9A 3CKHA 5BZBA 4AEMA 1XUQA 3U07A 4X65O 3RS6A 1ULOA 4I50B 4H37A 3GF6A 5SV5A 4LR3A 3N2KB 4U3JB 2UXBB 2RDCA 2GMEA 2WS91 1DGWA 1T2XA 1KDMA 3HKEB 1MR5A 5CG8A 5EK0A 4F3JA 1I5XA 1GRJA 4ZI7B 2QQLA 2RS53 1CZVA 1ENQA 5BNPB 4D6SA 5FZ6A 1S0JA 4COZA 1QNWA 3VD5A 2WLIA 1EFRG 3UYJA 1QNMA 1GK9A 2VCCA 4TXWA 2VMDA 3LIHA 4GKJB 4B4RA 2XB6C 4KU8A 5GLUA 2LW8A 4N8MA 1UPIA 4XCBA 1SLLA 1NCQC 2GMPA 4FBFA 1NQJA 3VUOA 5B5EZ 1P8JA 4ZKIA 2CAUA 4X9QA 3OUSA 2WIIB 2QQUA 3HKDA 4EWAA 2Y33A 1MSWD 3ATGA 1XU1A 3AYCA 3IDCB 4IL7A 5BR8O 1CP9A 2BGOA 2B5UA 3POGA 4Y1ZA 1ZRIA 5A7SA 4Q4V2 3HAGA 3L73H 1OCRC 1DYOA 4LNVA 4AEDB 1W6PB 3UCSC 1W9YA 3MIBA 3IBMA 3HNBM 3ZFEB 3KF5A 3SKJE 1CAWA 2GMMA 2BUKA 3IMMA 4L87A 1EZVH 3H1YA 2YC4A 4B3TB 3AJYA 5IVFA 2WWSA 2JS5A 4JHTA 4AGGA 5LRRA 1S4CA 1M56C 4JYAB 3IZOA 3F5TA 4I9WA 1OC1A 3U78A 4NIDA 5IWAO 2VQTA 1FI2A 2UXCO 3JYCA 3O5SA 4XJAA 5JR2A 4YIOA 3USSA 5EJ3A 4KMQA 1NYWA 2ZXQA 5HXVA 2JXAA 5IJ9A 4EFEA 3ELNA 4Y5TA 5C33A 2W0XA 2CY6A 4BW9A 2YICA 5C3SA 2A6XA 4QX8A 2KA3A 2XAQA 1R1A3 4C91A 3JARA 5EV7A 1COV1 2VZ3A 2VWKA 3J7NA 5JJNB 4HZFA 2W46A 3DC6A 1ZA7A 1W8FA 4LE3A 1JMUB 1YSCA 2Q30A 4XACA 2R70A 3JSNA 1BSMA 3O1VA 5JWPA 3OBZA 2GNMA 3PUSA 2WT2A 3WNMA 1GN3A 2GC3A 1R6NA 4DW0A 1AJOA 4UFMA 1J95A 1PD3A 4UW4A 2E74B 3B01A 2HG5C 3GM8A 4NHYA 1LOGA 5DQ0A 2LW1A 2EIJC 4ZS2A 2VXJA 4W6XA 4QU2A 2VZ1A 2ZGLA 1XNRB 4MW3A 4DXSA 4CZSA 1RUH3 2PYLA 1J59A 4PDWA 3EHBB 2OIIA 3IGAC 1NXD1 5HFLA 5LBBA 2Y64A 2AUYA 3HQUA 4DV7O 4MSWC 5KA5A 3UM7A 2DJVA 4U7OA 4AFBA 1TUEB 2HYXA 5K0UA 2V7QG 3BTYA 1OCOC 1R73A 1S3JA 3ZN4A 1VAMA 3G67A 3BTZA 3TEXA 2KQXA 4XXPA 1PO23 3RYRA 1PL0A 2CGPA 2ZAHA 1JOBA 1TG7A 4XDOA 3RZJA 1ODNA 1TGOA 3T1LA 3ZHSA 2TEPA 1FXZA 2W2IA 1FS0G 4O2BB 3MZHA 1R093 1D4M1 1RUF3 2D5FA 3K4DA 3S6PA 2G19A 3JCUZ 1OQEA 1M56B 4R9DA 5AVAA 1VBE3 3J80N 5LA0A 3EB7A 4UFKA 2EAAA 3CCVV 5JPNB 1J3RA 3OMNB 5K8SA 3BEHA 4LULA 1D5NA 1KFXL 2D6MA 1XXNA 4K8XA 5IFPA 4CCDA 1US2A 2LTNA 3GWOA 3I2FA 1L7LA 4IEOA 3B93A 2FMDA 2QQJA 4H7MA 5A1FA 4DUYB 2HWD2 4L2NA 4FFHA 1AJNA 2BERA 2CUGA 1EAH1 5FMOS 4JDNA 1YIPA 4JQTA 4N53A 2GTAA 2HLEA 2JJ6A 4I02A 3HBKA 4MO3M 4BLIA 3GXUA 1Z78A 4LBLA 3AG2B 2NMOA 1S72V 4I0XA 1QXPA 5C4WA 3G6BA 2YIBD 5LY2A 1SESA 4WFEA 3ICXA 2LS6A 1WD3A 4BR6A 4QPIC 2PI4A 5B3SC 4WM8A 4O4IB 1VIBA 2X29A 3ASNB 4K0KB 4R4ZA 1W28A 4D6RA 1FXKC 2P3IA 3SPIA 3RI8A 4Y20A 4P9LA 3U37A 3SJCC 2HLDG 1N1TA 4FTSA 4RQEA 1GBGA 3SLIA 5A6ZA 5ISLA 1VQPV 1DF0A 2BU9A 4ASUG 2CV6A 3T4VA 2PLV1 5IVBA 5D2AA 4A44A 3ZFGA 3I2KA 1LUVA 3K51A 2Q7GA 3JB4C 5J1XA 1V9U2 5B4NA 2VH9A 2OCHA 2EIJB 4MGIE 4YNIA 4IEQA 4BLJA 4I55B 1W39A 2JG9B 3VDBA 4KQ7A 5FZIA 4DV6B 5C9AB 3QLQA 4HFSA 1LNSA 3N9QA 3T1HO 3AZVA 2V1DA 4JX0A 4WZFA 4LWSA 1M90W 1H30A 3QTCA 2MEV3 4LHSA 2VCBA 5IAXA 4HLTA 4GT1A 3ZHRA 2ORXA 4UVAA 1H8VA 1OCOB 1RSOB 3PMSA 3U4XA 4CP2A 1VBD1 3J7AU 3VBBA 3SYQA 2ZS6B 3HEIA 4K35A 3ZHUA 1NOVA 3KD4A 1RB8G 4IV1C 4JF3A 1LEMA 3LD8A 4AHXA 5JUVA 5J3UA 2RVAA 1S2BA 1ZWIC 3WV6A 3ZN1A 3MIEA 2FMLA 3UKTA 1XNTA 4P9YA 3VBHC 1AR92 1AP6A 5LWBA 5JVDB 3PDQA 2DDUA 1Y9QA 4IEPA 2WNVC 1O5LA 5A3WA 1FOD3 1NQTA 4XIKA 1AR82 4CXXA 4OI0A 2VU9A 2HWE2 2O1QA 3O14A 1Q8SA 1COV3 5EC1C 4LBQA 1RINA 2OW4A 2FHRA 2VMCA 3IJ4A 4KWUA 5FPAA 1BHGA 3AX4A 4UBGA 3VDDA 4DK1A 1S0CA 1QH7A 2AR6A 1PGL2 4XJWA 5EIYB 4XF3A 5JPMB 4URAA 1UIJA 1RUD2 2ZABA 3F5WC 5JH7B 4GMP0 1JZ4A 3DXTA 4V2VA 3VBFA 1LU1A 5DPNA 4QPIB 5B3SB 1OKOA 2VNRA 5L3CA 1FXKB 2A73B 1BS3A 2G4IA 5CA6A 4A42A 4U36A 2ZINA 1UMIA 1TUBA 5FP8A 3IIIA 4W6WA 1AX0A 1S0VA 2RMU3 4AAXA 1VBA1 3BAAA 1UCXA 2EIEA 3AYDA 2IZWA 4P02B 4WFFA 1MG1A 1LECA 1DP0A 1KYOF 4YZ1A 4CRQA 3BKZA 1SQ4A 1XNQB 4RR3C 5BMVA 4IL6Z 4KBZA 1N1SA 3PVOA 1CAUA 3BRCA 1JQ0A 1RUG2 1VBC2 5F39A 3ZYRA 2OX0A 2YZ4A 3N27A 4CCCA 3IC9A 2QWPB 1QJFA 4NAMA 3E83A 3SC7X 1GO3F 5D5PA 3SJBC 1XYPA 1Y9MA 1HW7A 1R64A 4OPHA 2LJ2A 2HWB1 1YRZA 4QB2A 3D4KA 3MD0A 1O91A 1BK1A 1UKGA 1QBZA 3WNXA 2EIBA 4XFGA 4E2SA 3MHZA 3TN93 1YTFB 4BYYA 4L97A 2PHUA 4ZONA 1APNA 3WB0A 4H2AA 3BUCA 1XL4A 4GIQA 3OUHA 3H1HH 3ASIA 4QX3A 2DU1A 5KMGB 2VMGA 4IV1B 5CBGA 4DZGA 5LA6A 4FFGA 3POBA 1HP8A 3FFZA 2WZ8A 4Y26A 5FWJA 1NVPD 2AGSA 4L92A 2B9ZA 5I0TA 3CCEV 1A3KA 3RMXA 1LHWA 1DQ1A 4GH4B 1RUE3 3TJTA 4QD2A 2WNVB 1ULEA 4YVSC 5FZAA 4KP4A 2DBNA 4QDQA 4FAHA 2HWF2 4OLLA 1OUSA 2J1RA 4PD4F 1ZZ7A 3SYAA 3CD6V 3TGUH 2DCKA 3NQHA 1ROPA 2BSKA 3HN3A 2DTWA 1FNYA 4JTOA 1RVF2 2K1EA 2PFWA 5CBLA 3UJOA 4YW4A 3ZLIA 1I7FA 3AM2A 1HNWB 1U97A 1CONA 1JX9A 4A5UB 1IHMA 1W8UA 2VNOA 4N21A 1QJX3 1U12A 1H6YA 5L9VA 2ZIMA 3JBG1 3UKNA 4AILC 4RHV1 2Q73A 2ZIOA 4N7IA 3KKYA 4PF5A 2GUZB 4XXAA 5DG1A 4CDWC 3DEMA 3VBOA 2NMNA 1POV0 1K5JA 4QQ2A 1CPYA 3I55V 4MLOA 1SQBH 1GNHA 1MMMA 4BQ3A 1SZTA 4AQSA 1VR3A 3STZC 3APBA 2WAMA 3LSQA 5T5OA 4LKDA 3O1UA 3SYPA 3BFRA 3WHUA 1TME2 4MGSA 4XFAA 3ZSKA 1OH4A 4J11A 3CB2A 5LXTA 4W8JA 1JYTA 3NJYA 3I56V 4LLFA 4FFBB 1EM1A 3LEGA 2BNNA 4LBNA 1UY4A 1UX6A 4DMIA 3GWKC 4RR3B 1MVQA 2IJKA 2X0LA 1BGYH 3NXSA 3BYWA 4IEYA 2CH7B 2R32A 4NTYA 5DZGA 1VIWB 2Q0OC 3W21A 5BXXA 1GMGA 4JZRA 5EC2C 5E16A 2P4EA 3JSLA 1V9PA 5DECA 3CPWU 1FKAO 2R072 3UNPA 2YS8A 4HK9A 3A22A 2DCTA 3N7KA 1W2AX 4S2FA 4K7JA 2QE3A 4UI9L 5FJKA 3EYPA 3J7MA 4DR3O 1PPJH 2JDPA 1C5HA 2F95B 3VQXA 4P08A 4KHPO 3WR0A 1LCLA 1SRYA 1N3QA 1MS1A 2P06A 5FMDA 4DR2O 2R042 3RPQA 4CCNA 3RYFA 1TNRA 1FPN1 1AP5A 3K77A 4XF4A 1M4UA 5IVEA 1QJY1 2XVGA 2KXLA 3IT8A 5A3MA 2WZEA 2OZ6A 4TUYB 3PIGA 4K21A 4XDLA 2HR3A 1S2KA 4FQZA 2GC1A 3ETQA 4AI3A 1FMD2 3CS5A 3EQEA 1TVKA 3GZAA 4LXLA 4YVSB 3K4ZA 4ARYA 1XNBA 1A34A 4ZU4A 3SPJA 2GC0A 4FPPA 4QE9A 1JFFB 1HDJA 3ZM8A 1AR73 4I2OA 1KJLA 4LK6A 3A23A 2FDJA 4QXBA 4TN7A 1W99A 4AQYO 2YROA 2BTQB 3QF7A 4QQLA 2GH2A 4ASLA 1F9KA 2Q5ZA 3AP5A 1Y4WA 5HV0A 3AG4C 1URXA 2RDRA 1W8TA 3Q8AA 3VQYA 5FUIA 2WR9A 3ST7A 3DYPA 3X2QC 1OUXA 4XF1A 1KP3A 1QJEA 1VBA3 1B35A 2J22A 4PV1B 1K73W 3T1YB 4DXZA 4Q6GA 4CDWB 4ZY9A 4M3CB 3HB3B 5EWSA 1NLSA 4NHLA 3U4SA 4YFZA 2BGCA 4UVCA 1UZ0A 2ZJCA 3K3NA 1A8MA 1HRI3 3SEPA 5J7MA 1JOJA 2W1SA 4FP2A 3FUQA 3AP6A 1LESA 1GNYA 1SMVA 4YVWA 5FZOA 4MVMA 1N36B 5C3PA 4M0NA 5FREA 2E51A 3FYEB 5FZMA 4BA6A 1THZA 4CH3A 4LFBB 5GLVA 4NUBA 5GW7A 1ZBE2 1BEV3 1IZ3A 1IBLB 3ZX6A 1YFUA 1SLBA 3ZHVA 4LF4B 2QM8A 1F5JA 1JW6A 3CJHB 4H33A 4OHZA 3VHNA 5HCBA 3J8F3 2LW7A 3CCRV 3ZMSA 5LGTA 4CCMA 2K9PA 4RQPC 3B7MA 5FZLA 5FUPA 2WDBA 2E7AA 4MHUA 4RFRB 3ASOB 1J83A 3CRRA 5GZEA 5IYBO 2VM9A 4HONA 2W6IG 5L7OA 3ZXFA 1X82A 5IK7A 1G6UA 3FLRA 1XRUA 3U75A 2A70A 4Q4W1 2G1MA 4AFDA 3WW1A 5JOWA 1W8HA 4NWWA 4IE7A 1URFA 2HHHB 4GX1A 2QWNB 2PXJA 1WLDA 2W08A 2FB5A 2X6BA 4LMFA 4N43A 3WVJA 4Q0PA 1E1RG 1HXS1 3KGLA 1DQ5A 4GB32 1OHHG 1YYNA 4K20A 1O3RA 1QH6A 4MHRA 4IIJB 3KZIZ 2RMKB 3WP6A 2YB7A 3JAKA 3NSTA 1NTKH 4AHWA 5IJ0B 5IVCA 1GZWA 4MVQA 1S5LZ 2BW8A 4QXCA 5LEJA 3GCXA 3DTUB 2VJXA 4MS2A 5IE9A 1FJGO 3MLJA 4PIZA 2P3JA 1LJ7A 4W4ZA 3AYAA 1VRH3 4PJ0Z 1ZSPA 5EBMC 1B09A 3DSQA 2YEVB 2I74A 4XUOA 3J81N 5I0RA 1UPSA 4IESA 1JXNA 5F3EA 4E8CA 3AG4B 4LPLA 2FKXA 1ENXA 3MPBA 5FMCA 1HNZO 2RS11 3R6SA 4QHOA 5EJZB 4H14A 2JE9A 1UZWA 1R6TA 3FAVB 4JI6O 3X2QB 4JI3B 4K6BA 1POQA 1PVXA 4H55A 4HNAB 2O8OA 3FBMA 4GXLA 3DXUA 1Q8VA 2DUOA 1RXGA 2D40A 4NWVA 3BCCH 1X4TA 1NA1A 1X36A 4QDRA 3OGRA 5F8PA 3WOGA 5JJEB 1BQPA 5J2TA 4WBBA 2OS2A 4YW5A 4QPGC 2Q6AA 2K2SA 1OLQA 4HN0A 4Q8KA 2YIAA 2ODMA 4W50A 1OA4A 4CBCA 1DLCA 2CTVA 4YG6A 3DPRB 2XL7A 3NO8A 1GP6A 5DN6G 3ZCCA 3CZJA 4LF5B 1NCQA 3EJKA 4RS5B 3POJA 4XFIA 3SMHA 3VKOA 4QT6A 3RWNA 1DYPA 1MVEA 4HKOA 4DIQA 5FPUA 2K46A 1JYIA 3FZ3A 5I0SA 3SJQC 4NIIA 2X5IC 4MYEA 1EBOA 1M57C 2YFZA 3ZSLA 3ZSEA 1N3PA 2AZ2A 2ATKC 2OTJV 2D6PA 3UL2A 1HB2A 1VP6A 2N05A 2YV8A 5EYPB 1OFSA 4RQPB 2VZRA 3OG2A 1IXBA 3RYIA 1W9SA 1EV13 1CJPA 1XMOB 5CEHA 1V6NA 4EN0A 2YGMA 3CJXA 2BWCA 4B8EA 3C7GA 4CE8A 4JYCA 4PCRA 3C90A 2YDEA 3C7FA 1SERA 5A7PA 4O7XA 2WO2A 2CE4A 1RUI2 3PUIA 2ZM6B 3B2EE 2UWAA 3FWEA 1SFNA 3WF0A 1R3KC 4DO2A 3L71H 1LEDA 4PQQA 1MSDA 4BJ0A 4YJ3B 4G2KA 3CRMA 5FP4A 4DFSA 4JI4B 1N32B 4CH4A 5FUNA 2Z2SB 3L72H 3CEIA 2UYBA 4YGEA 4WM7A 5CKNA 4XHBA 4D3WA 1GM8A 1NE4A 4NIGA 2OZJA 3TOJA 5FFOC 3ZOIA 1PP9H 1SQQH 4NXMB 2XMLA 4D8MA 3FFQA 4TSFG 3WEZA 3T2QA 4XAEA 2HWD1 3FLPA 1X8MA 2VOXA 1AR61 3WCSA 3E5QA 2YHJA 1WA8B 2X10A 1QY4A 1MACA 4JI1O 1AF9A 5EIBC 4NJ4A 4M3CF 1ZLZA 3SH3A 5FYUA 3BVOA 3H1KH 1V00A 4DXWA 4LO8A 1IKPA 3PU3A 4X62B 5FY7A 4JI7B 5DDJ3 1HNXO 2HWC3 4B7EA 5IUQA 4X64O 1L3JA 5DAVA 1QQP3 5ABJC 1JUHA 2D44A 3AMPA 2ZX3A 2ARHA 4QPGB 3MFAA 4A4AA 3HT1A 5CVRA 1Q6IA 3OAAG 3TEWA 4YY3O 1PVC1 4COYA 2LFSA 2WZPP 2PHLA 3VHPA 5H2FZ 3I5DA 4YPJA 4A6SA 2XOKG 4LR4A 1V6LA 1YNAA 5T3NA 3H1WA 5A6XA 1UKRA 4JPRA 4KFMA 5L9RA 4GX0A 4P9XA 4ZBMA 2ORZA 1G4YB 2LALA 1LB2A 3FKSG 4URTA 4DV4B 3GYDA 4F6RB 2ZE8A 2A9HA 1TMF1 1AX1A 2X5IB 1M57B 3B00A 2VCAA 2PTMA 2BOCC 4JI5B 1UYXA 2IU0A 1JZ5A 2Z42A 5LK5A 5E1RA 2E63A 1AL21 4LF8O 1XE0A 4P9JA 1DG6A 2F66C 4PA4A 1C28A 1RMU1 4HKWA 3WF4A 4FPCA 1F4MA 2OYZA 4H0LB 2R063 5A9GA 4H3WA 3MW3A 3BHPA 3JD71 1LENA 3K9AA 2Q8VA 1IBKO 3OCPA 1DZRA 2WN2A 4AQ6A 5FMOL 4LK7A 2H6CA 4Z07A 3WHTA 2G38A 2RS33 2WWWA 4R8CA 2CGNA 1V6OA 3CX5F 1H8TC 4JGZB 3WY6A 3CIHA 2JKBA 3WDTA 3N7LA 2Q68A 4X1YB 3VOUA 5FY0A 3W7SA 4V1PA 3T30A 1RHI3 4WFBV 4Q26A 3TK1A 2B45X 5LOVA 1VQ5V 1LGNA 5FXZA 5FLXN 1QJU3 4DR6O 1PM4A 2VMEA 3HBZA 4OQ8A 5LA9A 4LBQD 5LBEA 1OHFA 2D6LX 2CNAA 3AVSA 1XHZA 4FSJA 4KBBA 4Q1PA 1V55C 3P3NA 3WU2Z 4LFAB 4MSVA 1JVMA 1DF5A 4OUMA 2NYYA 5KHGA 1R3JC 2EULA 3LF7A 4FZ0A 1HWYA 2V4DA 4QB6A 2BJSA 1MEC1 3J7HA 5A32A 1H9PA 3WQ7A 1GN2A 2SLIA 1HN1A 1ZBA2 5T52A 4R9AA 5IYYA 4MTGA 1Z7S1 2RM22 4E4DX 5KXCA 4F83A 3WUCA 3G7DA 1HR0O 4XQDA 4EZ4A 1Y6XA 4K40A 1BCXA 2VW0A 4DO0A 1QDCA 2VBBA 4RGKA 1O3TA 4PLNA 4XTPA 2XQRA 4DINB 2PY5A 4FI9A 2ZGUA 4XPVA 5ABJB 3URFA 3CCLV 2Y0PA 5KXBA 3Q4HB 5JIAA 1KS4A 1DU3D 2ERFA 2VO5A 1SG3A 1VQMV 2BNOA 1SA0B 2Y6HA 1KP2A 4TLGA 3VV1A 1VEWA 1MQTA 3N9NA 1WB8A 3CMGA 3VQVA 1GSLA 2J42A 5LEKA 4AXOA 2B1GA 1HJGA 1REEA 4B29A 5BNQA 1F4NA 1O4ZA 3O12A 5A7OA 4JVAA 4FTBA 1X7NA 1R092 4JI0O 1FAFA 5FZ3A 2UXBO 2RR11 5GONA 2EALA 1M5IA 3MEPA 1HRV2 2CTPA 3NV4A 1PGSA 2MHFA 4EROA 5FBZA 2YU2A 3VBHA 1Y76A 3POYA 2ZXWC 2QKSA 1H8TB 1L7RA 4XQWA 3LAGA 3HKBA 5JQGA 2XBO1 4IEUA 2Q7EA 3CSXA 4GKJO 4PBPA 2BVBA 1UYYA 2Y8KA 1VMJA 2C9AA 2XHBA 1J58A 2WS92 5FYVA 5ERLA 4O4LB 3CC7V 3K5OA 1ZZBA 1UO9A 4NIHA 1HQNA 4CS2A 1ST8A 3QNEA 4ORFA 1WAZA 5L3EA 1NXMA 1SLIA 1BBT3 3FMGA 3OUJA 3CP1A 2B9UA 1VF5B 4BIZA 2F4VO 2UURA 4ATFA 1BXHA 3CJIC 2RV9A 3WDYA 2OPWA 4XUQA 5ACA1 4H7LA 5H9QA 4PA7A 2OPKA 4N9IA 2GSMB 4MVOA 2MNGA 2VQAA 2UWCA 2YI8A 4DNYA 2WLIB 5FAXA 4CP0A 4C0BA 4B3TO 3GBGA 3MHHC 4MX3A 1WW6A 1DZQA 2F23A 3WF3A 4OZXA 3OGVA 1OXCA 5F5CA 2VOWA 5FWEA 5GALA 5E8AA 2A3WA 3EVKA 4G27B 4Z92B 4PDWC 2DCZA 1EY2A 4ISRA 2W68A 1OFNA 3OW2U 3OUFA 3JQXA 2K0GA 1WCQA 5I93A 5JIUA 2UUCO 4Z2WA 1DLBA 1I94B 3VD3A 1W05A 4LITA 3HKDB 1BHAA 4P9GA 5FLHA 4FPJA 5FIXA 2YU1A 2BEOA 3RBZA 2ZGMA 2BTVC 1RUC3 2AREA 4L99A 4JGSA 1NE6A 3ETEA 3HJRA 5T55A 1XDCA 5KHHA 1GUIA 5FZ9A 2VW1A 4KGGA 5CBHA 2W5FA 2NN8A 1Q90D 2ES3A 1CAWB 5LYJA 2YXYA 5FYCA 1UYZA 4R8HA 2BNMA 4UB6Z 4Y33A 3ABLC 3TWIA 2Y69B 3E89A 4DS0A 2R071 2QE7G 3DUIA 3K5LA 2PHWA 2Q5TA 1LHOA 5FCCA 2O57A 4Q0UA 2F4PA 3SITA 1UMZA 1PIV3 1E79G 2J1UA 3PU8A 4PLOA 2JEMA 2ZMNA 3HOBA 5BNOA 4FLUA 4ABMA 1COV2 5IJ9B 4DY3A 1WA4A 4GMP1 1GYKA 2ZXWB 2R041 1NX9A 4R7CA 5FV3A 2WZR3 2XAJA 1XNRO 3OYWA 2Y6FA 4N53C 1GU3A 4L11A 3S5AA 4KL1A 3JARB 3THPA 4CCEA 1PNLA 5FZDA 2AHYA 4BK4A 1F15A 2DVDA 3AMMA 4WM8C 4TTGA 3H8UA 2IJHA 5J98B 2WNOA 1S0EA 1GWLA 4MUVA 3O7OA 4FCAA 3GZUC 3BI3A 1IPKA 2YI9A 4AOCA 1PKXA 3M3QA 5JMCA 4N7UA 4OVEA 4YFWA 4XFCA 2ZX4A 4UFLA 5L3GA 1MZ5A 3ZFGC 5FXWA 5JSRA 1NTZH 4OXSA 3SISA 1I5ZA 4XZUG 5F2WA 5FKBA 1I9RA 3CXCU 5E6HA 4WF9V 1UU6A 3AFGA 1YI7A 1D4VB 4XVHA 2GBOA 4COVA 1VBB1 3K0DA 2ARCA 1R081 3HD8B 3T4HB 2HEVF 3WDXA 4PDWB 3NR7A 1QOOA 4BQ2A 1UY2A 3VDAA 2HH9A 3O9OA 1W2OA 4COWA 3B09A 3JZVA 4CTEA 3NL1A 3OD0A 2EJRA 4AFAA 3T2PA 2UXDB 4DUYO 1PNFA 3TEZA 4NROA 2OKXA 1CGPA 4I0BA 3AMQA 1WLWA 2HP8A 5K0UB 2ZCEA 1PO11 1D4M2 2QQIA 3S7EA 3MLLA 3M99B 3MIGA 4P5HA 3RZLA 1JUIA 3TRSB 2BVVA 2EXIA 2PAEA 4ITCA 4U3JA 5JSPA 1FYUA 1IS3A 3AG1C 1CWPA 5A6QA 3O1SA 2IVIB 5EZYA 3QD6A 2UXXA 4BZ4A 1U5YA 2ZNJA 3ABLB 1ASJ3 4K0KO 1W0PA 5BXZA 2XKPA 1NT2B 4ES9A 4JYBA 1EUTA 3D3QA 5CFCA 2E5LB 1KB9F 3ZRVA 1AX2A 5IW0A 4RAIA 1SHWB 3RSJA 1BZKA 4FM2A 3NV2A 3N7MA 2CAVA 1ZM1A 5LGNA 4QWNA 2V73A 1C8M1 1WP7A 3SCGA 3VDDC 2WUHA 3P30A 1IBMB 3Q8EA 4META 4G9SB 3BTXA 1ZUQA 2R0FA 1POV1 3HR9A 5BNNA 4X65B 4FTEA 4UF0A 2OIEA 3FBYA 2VW2A 4DV6O 4QPWA 5F6LB 4I0XB 1QJX2 1RYYA 5C4WB 5ACA3 3VBFC 1SBDA 4WM8B 4AEKA 3D0JA 5IFTA 4IGOA 1P84F 4AEDA 2PLV2 1W6PA 4XF0A 3ZFEA 4Y20B 3MICA 2QWQB 2ARBA 3BU7A 4LFCO 3ZSMA 5J09A 2H0BA 3PUQA 3OSDA 3W7TA 2OIGA 4V2WA 4X88A 4M0HA 5J37A 3THTA 4Y1UA 3ZFGB 1HKDA 5EJ1B 4CEWA 4ZIBA 1OI6A 4Q4Y3 2JKXA 4CXWA 2GZWA 4NPMA 3E8HA 3M7AA 1RUJ3 1N34B 5D21A 1YQ8A 5BV6A 4NIAA 4RUEA 4YXWG 1S1AA 4OX9B 3JQWA 2DMXA 5K7PA 1UF2C 5A33A 1XMQO 1UIKA 1AYN1 1W0KG 3LDKA 1FX5A 1IXMA 5I8SA 2P6HA 2PHRA 4DRRA 3JD0A 1V6MA 2K9ZA 4XMIA 2RQ6A 4FZ1A 3N2GA 4XEZA 1UOBA 3ZXJA 4FLYA 2QKDA 4QXKA 1G9CA 4AE2A 2Q9LA 3ZMTA 3DKQA 1SC5B 3AK2A 5DG2A 5KLVH 1QF3A 4JHZA 4E4HA 1UY0A 4YRDA 1JODA 2R7EB 3C3TA 3WP3A 3AG1B 2E3CA 5EZWA 5FY1A 3PMEA
chains in the Genus database with same CATH topology
3ZSJA 2EXJA 4GALA 1KFUL 1DGWX 4YZ4A 1LECA 4YZ1A 2HWD3 4CRQA 1AYM1 1SFYA 1SQ4A 4RR3C 1JBCA 1AR63 1W0OA 1XYNA 3ZYPA 1QXRA 5KWRA 4I3GA 1N1SA 3PVOA 1CAUA 3VBRA 1YFXA 1RUG2 1ND2A 1VBC2 3QCWA 2EXHA 4LBKA 3ZYRA 1AXYA 2YZ4A 3ZN6A 4CWDA 2JG8A 1RL3A 5JAXA 4JGYC 2D93A 3I59A 4Q27A 2HWF1 3E5XA 4WV8A 1KQRA 2E53A 4OHXA 3KT7A 4AHYA 5D1IA 3PJQA 1HV0A 3VZNA 1NLRA 3WDUA 2R062 4LBQB 4AVBA 5GM0A 1XYPA 4CEWB 4CDXA 3QH6A 1AYN2 1GZCA 2HWB1 1FATA 1YRZA 3D4KA 2XJPA 1PK6A 1RVF1 3H3UA 5DUXA 5AC92 1O91A 2RHPA 4IQPA 1BK1A 1UKGA 3WZ1A 2RS32 1Q8OA 3WNXA 4XFGA 4L8QA 3VDDB 4E2SA 2F6BA 2WA4A 1ND3C 3TN93 4BYYA 4YGCA 4L97A 2PHUA 2ZKNA 1Y43B 3AKTA 4LO7A 4Q4X1 3PVJA 1J3QA 1APNA 4E4SA 5CG9A 5JOXA 2Z5WA 4GIQA 5A33B 1PVC3 2DU0A 5L36A 1DQ2A 3V17A 2I45A 3ASIA 2DU1A 2VMGA 4IV1B 1NQDA 3AB0A 5BY5A 3H50A 1FV2A 1VBA2 3VBFB 2R1BA 2LM3A 1RHI2 1QDOA 1TNFA 2VXRA 4Y4YA 1X50A 2Q1ZB 4OI2A 4DZGA 1HLCA 1QJU2 2VQ0A 3SH4A 3VBOC 4RR3A 3FFZA 4Y26A 2D5HA 5HCAA 1SBEA 2AGSA 1WW7A 4L92A 2KM2A 3IWZA 3FX3A 1AYM2 1REFA 1TMF3 1U0AA 1GFF2 1X33A 5I0TA 1MZFA 4AI0A 1A3KA 3AZZA 5FQ0B 1TME1 3RMXA 1LHWA 1DQ1A 4GH4B 3AKPA 1RUE3 4JGYA 1R1ZA 4QD2A 1CAVA 3V0AA 2WNVB 4J6GA 1ULEA 3CL1A 4YVSC 2Y38A 3AKQA 1A6CA 2QFEA 1MS3A 5K0UC 4FAHA 4DY5A 2HWF2 4S2DA 1AL23 3FUOA 4OLLA 4BHFA 1BMV2 2V5YA 2R0HA 1H4GA 4BIOA 1ZZ7A 2YPJA 2E6VA 3N35A 1DQ0A 5SV8A 1RMU3 2RS51 4FOVA 4LBOA 1ZBA3 4EN9B 2DCKA 3R05A 1RTVA 2DVFA 5HCFA 1FAYA 4Z82A 1CAUB 3JD73 2A7AA 2P37A 3VBRB 2RM23 2D43A 2HWB2 2DTWA 1FNYA 1ND2B 4E9KA 4JTOA 4E2QA 1RVF2 1AVBA 4Q1RA 3ZN6B 2EXKA 1ND3A 2PFWA 2JG8B 3I59B 1HQLA 4KG0A 5CBLA 3UJOA 4YW4A 4MXWA 4LO5B 2A6ZA 4FPYA 3AM2A 3VN4A 1CONA 5TSWA 1IHMA 2DYCA 2VULA 4R52A 4Q4X2 2VNOA 2WFF3 4X8NA 3RMYA 1QJX3 3ZPYA 1U12A 1ENRA 4FOYA 3VHRA 5HSXA 3JBG1 3UKNA 4RHV1 1IPJA 4N7IA 4PF5A 2JG9C 4XXAA 5DG1A 4CDWC 1PK6B 2XVKA 1BVVA 3HIFA 4P14A 5C9AC 3FLTA 3VBOA 1KITA 2NMNA 1POV0 1XNKA 2A6WA 4QQ2A 4MLOA 5CIRA 4E4ZA 5FRAA 4AWDA 1GNHA 5HBAA 3AZXA 4O9EA 5T5JA 1WCDJ 1G6NA 2XL9A 1VR3A 1GZ9A 1JTZX 1DFQA 1ONAA 1WW5A 1NCRC 2GNBA 3APBA 2QQPA 3B69A 3JU9A 5T5OA 2WINB 4MVTA 4QGMA 1S0FA 2AYHA 4YVSA 1G9DA 1NZCA 1YCIA 1TME2 2D7FA 3WCRA 3WHUA 4XFAA 3ZSKA 3AP9A 3I8TA 2IXHA 3KMHA 3OJBA 1U5IA 3EXUA 3MI8A 1YJLA 3BIWE 4XBLA 3ZMNA 4LLFA 1OIJC 2BNNA 4LBNA 2JX9A 1MEC3 1UX6A 3WUDA 4DMIA 4RR3B 1MVQA 1LULA 3NKGA 2RS52 1BBT1 1ZZ9A 2BPA2 1FMD1 3HN1A 5C4WC </