3KCXA

Factor inhibiting hif-1 alpha in complex with clioquinol
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
335
structure length
332
Chain Sequence
b'EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Crystal structures of human FIH-1 in complex with quinol family inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 102
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3kcxA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kcxA01
2WA4A 2CGNA 3KCXA 5JWPA 1YCIA 3P3NA 3D8CA 1H2MA 4AI8A 4B7KA 3OD4A 4B7EA 4BIOA 2ILMA 2W0XA 4NR1A 4Z2WA 2YC0A 1IZ3A 2WA3A 2YDEA 1H2KA 2XUMA 3KCYA 3P3PA 4JAAA 2Y0IA 4Z1VA 1H2NA 1H2LA 1MZFA 4QU2A 2CGOA 1MZEA
chains in the Genus database with same CATH superfamily
3JB4C 2WLLA 2FDFA 5JOXA 2VCAA 4YJ3B 1SCSA 3CJHB 1EUTA 5EWSA 2BYVE 3O5SA 3SR2C 4XJAA 2DURA 2XJTA 2XOKG 2HEVF 4RHV3 5L7OA 3CWBH 2HEWF 3FHAA 1NE6A 5CYYA 1Q8PA 1X9PA 5CBGA 4UFHA 2ORZA 4ZS3A 3VKOA 4E4EA 3HVDA 3DKWA 3VL8A 2WQZC 5A32A 1K97A 1W8FA 3ZHRA 4LO8A 3WNXA 3IPVA 4V2WA 4BHPA 5IVVA 1NT0A 4XBFA 1C8M3 4D3WA 4PDWB 4QD2A 1OH3A 4IV1A 5FXZA 4WFGA 1S0IA 1BQPA 1PIV1 1H8TB 1PK6B 1AL0G 5C3OA 3SYCA 5APAA 3WQ1A 1W3XA 1I94O 1E79G 3VBSB 4DXSA 1B06A 4CXWA 5FLIA 5J2UB 1KJLA 5JJNB 3E8HA 3H3UA 5JI7A 4AEDB 1US6A 4GD4A 1OC1A 3HMYA 1O91A 1FXKC 5EJ3A 3IC7A 4RQEA 1O59A 2DU1A 4BQ4A 5DUXA 5F3IA 3IAPA 4WM8C 2R6QA 3H3ZA 4EZ4A 1S0GA 4LH6A 2HWB1 3B09A 1NI8A 4YY3B 2HH9A 4M00A 3FFZA 4LHLA 3OUJA 1UU4A 1UYXA 5LGUA 3I4IA 3LWCA 2VVFA 2NN4A 3KT4A 3HD8B 3BU7A 3TNPB 3DGTA 3MUY1 2FYUH 4MGYE 1PNFA 1QQP3 4Y1VA 1AYM3 3ZMTA 1UY2A 5LXTA 3WCRA 4UFLA 2ZGMA 4DOUA 3SJAC 1N36O 3ETGA 3QD6A 2XJVA 2WSSG 4WFFA 4DRRA 1CAXA 4MSWC 3SJCC 1R1A3 5E6HA 4JGSA 1UOFA 4QKFA 3ILFA 3DV8A 3T4ZA 3SKJE 4MYEA 4Q4Y3 3J26N 1F2NA 1DYPA 5JLVA 5A1AA 2ZXWC 4M3CF 3VL9A 4I0BA 3KQ4B 2XUMA 1S2BA 4QDQA 4PV1B 3ZYHA 1W6MB 2WO2A 2K46A 3J8F3 1H8HG 1RMU1 1H1MA 5CA1A 3K3OA 3RZKA 1AJQA 1TME3 4O2BB 1ZBA2 4OI2A 5AFEA 2FDKA 4A41A 4B3SO 3T2QA 4MXWB 5LA6A 1M5IA 4H3WA 2O8QA 2JDKA 3OTFA 4ZKIA 2NMOA 2BW8A 3R4UA 3SKVA 1X82A 1W6QB 3ZR6A 3QACA 3SH4A 1ULFA 4Q8LA 2Z3YA 2A3YA 2XAHA 2VG9A 5T5PA 1IQAA 5JPMB 1KC8W 2ZR2A 2UU9O 2ENRA 4RN5A 1Z78A 4XDLA 5LBFA 2WRAA 1PL4A 4CH5A 1OCRC 4J11A 1I08A 3T1HB 3DEMA 4JI7O 1SLLA 5A7QA 3ZHQA 4W6YA 2VMCA 1V70A 2PHXA 1FPN2 5ANQA 3IDCB 2WZ8A 4GB33 1GQHA 1I9RA 3AKPA 2CTVA 2F95B 2WS93 4EB6B 2VUAA 4E4SA 4PQQA 2I45A 1I1EA 5KXCA 1JYTA 1YUDA 4X1KB 2DV9A 1D4M2 3USUB 3RYKA 3HKBB 1K8AW 5D21A 1QQCA 4O65A 3LD8A 2F66C 3M7AA 1M56C 4LMFA 2Y4TA 3D3AA 4KI5M 3ITQA 3PDQA 5JVDA 1PM7A 4FPFA 3W7WA 2QQKA 5T5LA 1URXA 1UU5A 2EXKA 3VBRC 2YI8A 3MO4A 3FYEB 1BE3H 4MW3A 3BGAA 4DO0A 4X65O 5IJ9B 1Q8OA 3UL2A 4PD4F 3ZFFA 2GSYA 3LAGA 1RTVA 2CTRA 2KB1A 4QPGA 4L92A 4NKGB 4NROA 2P5BA 1KBHA 4I2OA 5DDJ2 1AJKA 2GMPA 1QLEC 1G9FA 3KLSA 5KA5A 2R041 2BE3A 1UYPA 4QE9A 4ZHQB 4F7ZA 4UCOA 3Q8BA 2XDVA 1WCUA 1EN5A 4HSLA 5A3UA 1N0JA 2WLMA 3MZHA 3T4DA 3NSTA 1DLBA 3O65A 4HXCA 3TWIA 4JI4B 4XYXA 2BTQA 1PIV3 2YUAA 1THZA 2Y6GA 1RUE1 3AMMA 4IYHA 3G67A 1Y74B 3FD9A 2GUZA 4OPHA 2D5HA 1X7NA 3TRSB 1VQ5V 1PZ9A 1H0BA 2PZSA 2JIGA 4X1YA 1AR62 4YIOA 1VR3A 2IFRA 3DCQA 4NJ4A 2XVKA 2QCSB 3JARA 1JZ7A 2YHJA 1GAXA 1PM4A 2PHTA 4EWEA 4Q8KA 3ILRA 5C9AC 3ZMOA 2HWB3 3VDDA 3E6CC 3SCFA 1RM1B 3AZXA 5LMUO 3RMXA 1MS5A 3V0AB 1PO13 2ILMA 5FDBA 4C1WA 4XOGA 5B5EZ 2XXZA 4Y1UA 4QE7A 5FBZA 1OXCA 2YY1A 4AW7A 3CCVV 3H8XA 2WAOA 4TUYB 2WL1A 2XLGA 3C3VA 1PGSA 3OUFA 3AG2B 4DXWA 2UU8A 1OJHA 2HBUA 4F6EA 2W1WA 1LOFC 5FY0A 4W4ZA 3TN92 3ZLIA 1XSRA 3E5QA 2LW8A 3CEWA 4CDXA 2DJVA 1O5UA 3PN1A 3ZN0A 4JDMA 2ERFA 3UCSC 5FYTA 4CUCA 3H3LA 1GH6A 2E33A 1NXD1 3WQ7A 1DYOA 1YFXA 1O4YA 1NOVA 1GKFA 4UUJC 1XOUA 3PTRB 3T09A 1W39A 4BK4A 3U78A 4YVSC 2OT5A 1HNXB 3ZDSA 5TISZ 2WSUA 1HIXA 2W3JA 4EYUA 1S5HC 1VBD2 4X6RB 1MSDA 2QKCA 4HK8A 4WBNB 3I56V 5A70A 5IVYA 3I3QA 2BNMA 4K3AA 5JQGB 4JGZB 3UKNA 4EN0A 1JZ2A 2WWWA 2F1MA 3AG1B 1OHFA 1ZL8B 4LLFA 3OJBA 4MXVA 4XDPA 5JZGA 3SYOA 2B46X 4MTXA 4YW4A 1W6NA 1ULCA 1QJY2 5KAIZ 2ADDA 2RVAA 2NM1A 3WDUA 3ZR5A 1ZZBA 4CS4A 4CEWB 2XMLA 4XXAA 3L2HA 2CGOA 3WB1A 2V73A 2JJ6A 2OWOA 1HB3A 3ES4A 2HJIA 4X64B 4ARYA 3TXQA 5DAXA 2EINB 3LDDA 3JASA 1IZ3A 3OGIB 2ZIMA 5EBLC 4WM7C 2GHYA 3ZBHA 3W5NA 4JGYC 2Q0OC 4IE7A 3WP4A 2GSMB 5FNVA 1GP5A 4PIYA 2HWF3 4LOTA 1YDXA 3HJRA 5D8AB 4LKFA 2PF4E 3WUDA 2X6BA 3B4SA 4YZ2A 4DV5O 2R16A 1XRUA 3PJQA 2W6IG 5E88A 2CV6A 3AXEA 4PDVA 3FL7A 3N36A 3AG3C 2D44A 4RSUA 5FR3A 4PDLA 4JI6O 2P34A 4RUEA 2GC0A 4XC9A 2R072 4N8MA 4JVAA 2XBO1 3DC5A 3JAWB 2ZABA 1B35B 3W7UA 5C4WA 1Z5WA 4CUAA 1DQ0A 3JALB 5SV8A 1G8MA 4K7JA 1RUI1 4NTYA 2WFPA 1IBKB 1DF0A 2VUJA 5CADA 1DQ2A 1DU3D 1OLQA 3DYPA 1GNZA 2GNBA 3JD71 2XLFA 3ZXAC 1NVPB 5FZEA 4FXKB 2XAQA 3GVMA 4R7CA 1I94B 1O9GA 3WF4A 2J1SA 5D5PA 1XE8A 5M0TA 2BJSA 2HKXA 2PI4A 5IW0A 2G4IA 1L8DA 1OSGA 3N9NA 2E9QA 4Q27A 2Z69A 5DAVA 4XABA 3ZFEC 4GIQA 1LOCA 1PNLA 2EAKA 5LHHA 2UXBO 1OOPB 2WYFA 4MV2A 1VIWB 1CXZB 2YMZA 4RS5A 3CC2V 1Q8IA 2NLJC 2YIBD 4QT6A 3WDXA 1IQDC 1E57A 4H14A 1YIPA 1VQKV 1SEFA 4JI5O 5T50A 1R092 2QQUA 1E5HA 1FKAO 2FDIA 4URTA 2DOSA 2FTKA 3LSQA 4HBNA 4P9JA 5FYHA 3PMSA 5K0UB 1H4HA 5F39A 2JGUA 3WG7C 1MS8A 1RUG3 1AB3A 1IS5A 2RCVA 2RR12 1JXNA 4Q1RA 4FM1A 1N36B 4XJ9A 2Q67A 4OHXA 2IVJA 3RWKX 3BABA 5T54A 5FIXA 4JHZA 3VKMA 4XFCA 4M3CA 4QHBA 1OA2A 2ZAAA 3RYPA 3H1YA 2Q8VA 3K48A 5C5UA 2PTMA 4FZ0A 1OQ1A 4NE9A 1JZ4A 2X10A 1RHI3 4XACA 3AG4B 4GAZA 1JN2P 2O1QA 3A7QA 1MACA 1Z5VA 1WUVA 3RYFA 2JG8C 4V1PA 2Y6FA 4F6RB 2DCZA 1WWYA 1YTFD 4EN6B 5KHGA 3EHBB 4BQ3A 1WA8A 4DXTA 1BXHA 1DLLA 4Y4YA 4B3SB 3GWKC 3P3NA 1M1KW 3KV6A 3ETEA 3JD2A 2EIDA 2ETEA 3OY8B 2RQ6A 1CIYA 1UOGA 2L6LA 2UY8A 2EIMC 1W8WA 3OPZA 5FP7A 3ZN6A 3EXAA 2WYSA 2WNUC 3AL6A 3O1OA 4O2AA 3J7AU 1YFYA 1GOFA 5FZOB 3AP5A 4TQDA 2E6VA 3JATB 2JXAA 3C7HA 2KG7A 1ND2A 1B3QA 2P6CA 4YW2A 3C3TA 3DPRB 2ZS6B 2RS12 5IJ0A 1GWLA 1K45A 3HR0A 1UOJA 3OB8A 3AK2A 4NWWA 3ABKB 1WKYA 1RUH1 2H0BA 3LDKA 2F43G 3SCHA 5H9CA 4BB3A 5H5NA 5CG8A 3GALA 1V6KA 4CYDA 1D4VB 4JTDB 1SF9A 4NPRA 4X8AA 5C3RA 4LF8O 1QU0A 1U5IA 5LEJA 3U0ZA 3KD4A 1O6UA 3T2TA 3RQ0A 2VNVA 5H9SA 3TNQA 4IE5A 2N74A 4GX5A 2LJ2A 3WFVA 1JYXA 5IATA 4BU2A 5JSRA 4QU1A 3GYDA 3AM2A 5E1AC 1HV0A 2LM3A 4X65B 1C5IA 5GLWA 4MVSA 4LO4B 4UW3A 2JDIG 2YUEA 4WFHA 3TEXA 1W06A 3K03A 1HLCA 3IFXA 2WWUA 4CA9A 5KR7A 3KHBA 1GWMA 3FB7C 1AR91 2WLLB 4KUMA 3AFGA 5GKAC 1POV1 1PL0A 4AYUA 1W0OA 1RUI3 4XCBA 1GV9A 1DGSA 3A0BZ 4Y1XA 5L7OB 4P9OA 5JIAA 3FYIB 2FB5A 1OVPA 4K35A 2ET7A 3I2FA 4BZ4A 1GUIA 1K5SA 3JD73 5DG1A 3ASOC 2J1VA 3OEHG 5G05L 4Y22A 1G4YB 1R6TA 3BIEA 2WKKA 5A32B 1KGYA 1AHSA 4TLFA 2EIBA 4EJRA 3INAA 1ULEA 5HCHA 3Q8CA 4OMDA 4QPIA 5KXBA 2WJSA 5GTIZ 4X89A 2R7EB 1I5YA 2B4KA 1R082 4Z1MG 2P06A 3NJZA 1MQTA 1BHAA 4IV1B 4DINB 1W9SA 4LF7B 2PYJA 4SBVA 2WFF1 4URAA 2PHFA 5AC93 2GNMA 3UT5B 3NQHA 3ACHA 3GGLA 1G6NA 4PA4A 2JGDA 1K4DC 4H7MA 4UI9L 3J7HA 4DV2O 2NNUA 3AK3A 4Q26A 4BXFA 5FYMA 5JXGA 1PGW2 4HKLA 4IEPA 4YZ4A 1ZZ6A 4DO2A 5J3UA 1GTOA 3AMPA 5A6ZA 2OIIA 2QE7G 1O4ZA 3URFA 2A70A 3LIGA 4ARXA 2W0FC 4XDKA 4J9ZB 1AZDA 3HIFA 1L3JA 1SZTA 5I91A 2AEYA 4FPGA 5LGNA 1W0JG 4L99A 5HI0A 3DYOA 5JCOC 1VRH1 5CU1A 2MEV1 2VWKA 2FCVA 1C5HA 4GCZA 1R3LC 4A7KA 2W0XA 1LULA 1FAFA 4K8XA 1PGL2 4I0XA 4LHKA 3RVHA 3M8AA 1WMEA 3IM0A 5EYYA 1F8VA 3I2IA 4ISRA 1YJKA 4XAEA 1O3QA 4Q4W1 3P32A 2EIEA 3WG2A 1VBA2 2JRIA 1DBNA 1CAXB 4JZRA 4DRVA 5JI9A 1O3RA 2EIJB 4TT3G 5FREA 5LRSA 2ZR3A 5AVAA 2WINB 1QR8A 1XE7A 1XEQA 5HV0A 4FQZA 4NXMB 4GZ9A 2A75A 3WB2A 4G9SB 1V55C 1BVVA 2WNVC 4BCUA 2ATFA 4A4AA 5FZ7A 4KWJA 4XF3A 5FY5A 2N04A 4GJYA 2PHWA 3K0GA 4PA7A 4C7UA 1ZBE2 1MS0A 5C33A 4JCKA 5CA1B 3ZYJB 1JYIA 2E76B 4IETA 4EN7B 3OUSA 3AYAA 2PAEA 5CB4B 2K1EA 1FV3A 4QDRA 3UV9A 4B4PA 1AX2A 4TV8A 4IEYA 3CYOA 3BB6A 3TAYA 4G27B 1QJU2 5LBBA 4CUBA 2PUSA 1EP0A 4CCKA 5EPAA 1KECA 1CIWA 4YM2A 4LKSA 2A7WA 1GM8A 2VCMA 4B3NA 5CN0A 3H1KH 4ZIBA 1RUH3 4KP4A 3QTCA 4DY3A 3CL1A 3AXDA 3OBRA 2EULA 1QR9A 5IK5A 2DYSB 1JOBA 5LBQA 4JI0O 1LHOA 4QPYA 3H8OA 2H6CA 2R70A 3A0NA 2XVGA 1ULDA 1NZ6A 1SKVA 2XPJA 2QFEA 1P4RA 4DV7O 5B2GB 5K7PA 5C8CA 4I3GA 4EFBA 5EIBD 3RI9A 4AQYB 3L9JT 5B1AB 1RUC2 4NUBA 1UF2C 4LJHA 1WW6A 1QVGU 5A3MA 5FJKA 1R6NA 2CDOA 1KEXA 4ZU7A 2PAKA 2XGXA 5JH7A 4IV3A 1XXNA 1XNRO 3RI8A 3ZN4A 3MDPA 2VZPA 2E7AA 1Y7BA 4IHJA 3FE5A 1AX1A 5JVDB 3JD3A 4CCDA 4CC6A 3ECQA 3BU0A 1AR93 2G9FA 3ORJA 3OEAA 3MHZA 5FMOL 1POV3 3FX3A 3PNAA 2UXDO 3LF7A 2BTVC 4GYCB 5KMGB 1NE4A 4XFIA 4N23A 1FNYA 4CH4A 3LGRA 4Q4X3 1ULGA 4NIGA 3ZFFB 2R9IA 3H1JH 1UMZA 4OXSA 4YW3A 1BLZA 4K9SA 1OV9A 4QPGB 3B00A 1RP3B 4RQPB 2BOJA 2UXNA 3M3CA 1VF6A 1LKNA 4AWDA 4YG0A 1K33A 1H6XA 2F4VO 2H0VA 4RHV2 1MMMA 2RS52 1SDDB 4ZOLA 3DSQA 3S5AA 1VEWA 4LBMA 3KS7A 5CFDC 4X20B 2ADPA 3VD4A 3GBFA 4Y20A 4O4HB 3ASNC 1TZOA 2P3IA 1SBEA 1ST8A 3F5WC 3J4UH 2E7QA 1JZ8A 3VD7A 2WDBA 2YBPA 4JI5B 4FLXA 2GN3A 2QUOA 3HWJA 2RDNA 1ACCA 3A23A 1MEC2 1OZ0A 3O1RA 2ZGQA 3AYCA 1OD5A 3G6EV 3I49A 2JD9A 3GBWA 4FFIA 3CRMA 3IB3A 3HKDB 1OMIA 1IS6A 2D6PA 1NCQC 3TETA 3RYIA 2ARAA 4LEJA 1HN0A 1ZBA1 3JARB 5DAWA 4OX9B 3HNMA 5KLVH 3J7MA 5A3LA 5DUWA 4ES9A 4G2KA 3VDDB 1VRH3 4ABMA 2X6AA 4BQ5A 2MEV3 1QXRA 5HBAA 3D0SA 1VRBA 4QB1A 1KS4A 5IYYA 3C7GA 1RFYA 2D2CB 4OZOA 1GSLA 4GWNA 2FZ2A 1ORQC 2HR3A 3GZEA 3N9PA 4Q2FA 2W92A 2FDJA 2B9ZA 2HWD2 4Q4W3 4ZI7B 2Q68A 4MTOA 1FPN1 4LC1A 1LAJA 2D7FA 1QNWA 5GZFA 1BL8A 1PMHX 4JAAA 5KUMA 1A32A 4TN7A 4XJUA 4A45A 3LE0A 2Z2SB 4JC1A 1AYM2 2ZGTA 2HJDA 2P4VA 2V4AA 1R6KA 5B1BB 1AJPA 4MOAA 4I55A 1WBLA 4DUVA 5BR8O 4H7LA 4GWIA 5LCWL 1QXJA 1R1A2 4HETA 2AGAA 3ZIAG 3GHNA 5LOVB 3K04A 1DLCA 4QMAA 2Y64A 2QM4A 1UZZA 4W50A 4LO7A 5FUIA 1YFWA 3OF1A 1YVWA 1SERA 1OCCB 3W5MA 1ND3C 4YZ1A 1GOHA 2CWMA 4AZZA 5H6QA 4OI1A 3ZEDA 3IDEA 2P4EA 5JZGB 2VPVA 1F4AA 3PUHA 2H94A 1DQ5A 4M0HA 1CZTA 4KNCA 1JU4A 4GH4B 2DYCA 1KU9A 1LR5A 1C4RA 2V09A 2P1BA 2W1SA 1EBOA 4C90A 2BTOA 3WT3A 1IBMO 3MDSA 5DDJ1 2VQUA 5ABJA 3VBUA 2LQTA 4WVWA 4O9GA 4R52A 4XF4A 2UUBO 4OI0A 3JASB 1K4CC 5FZ3A 1XYPA 3KT7A 2ZX2A 4FPLA 1JU3A 3K06A 2XB6C 1VBC2 5C3QA 4E27A 1GP6A 3OD4A 2ATKC 1WBFA 4LIUA 4WVVA 3CJIA 1V0AA 2B7YA 2LS6A 3BALA 1W90A 2E75B 4HAMA 4XPVA 3OGJA 3ZYGA 2M7WA 4YFZA 3NKGA 4XTPA 2D3PA 3U11A 1AR61 2WN2A 4CDWC 1YIFA 1ZRRA 3VKLA 4UYBA 4LBQB 5JPNB 4LLOA 4B3MB 2P4KA 4FPOB 2QWQB 4HANA 1DF4A 1YQCA 1M9NA 4LF5O 5C4WB 2UY9A 4LULA 4TWKA 1PP9H 3M4FA 1ZZ7A 1JZ6A 3SC7X 3NWKA 2OUHA 1W04A 3VHOA 3H42B 4DV3O 1YJWV 3I2OA 2HWC2 4S2DA 3OOXA 2YSUB 3TN91 2Y69C 3GZUC 3QG5A 3O1SA 4Q5OA 4OHVA 4W6WA 4DV2B 1EV12 1IHMA 1LOEA 5FZ1A 4QQPA 2OS2A 2GBOA 3HN1A 3C90A 1Y4WA 4L2NA 2ZE8A 2C4XA 4CUGA 3SCGA 3ABLB 4P30A 3I3EA 3ACGA 2Q1MA 4GKJB 4WFAV 5F5QA 4A7YA 1VBD1 1H30A 1LTEA 3PMEA 4AFCA 1GN6A 2WLJA 2YEVA 3VBFC 3RW0A 1YITV 4OHZA 2GMMA 3RZHA 3OSDA 4DR1O 4AHXA 4CCOA 1GZWB 3RT3C 1KRIA 1OVSA 2UUAB 1W8HA 4CCNA 4H33A 2JG9C 1QJY1 4IGOA 4TTGA 3D36A 3STLC 4XMAA 1UPIA 4NPMA 4OYUA 5HXVA 1ENSA 1CAVA 2QQNA 1MSWD 1C1FA 1ZM1A 2PYLA 3BODA 1PO12 1FPN3 1KDMA 4CP9A 3BRCA 1V9U2 3KGZA 4EKWA 1ASJ2 4RGGA 1HXS2 5ANNA 2QQMA 4DS0A 4DB5A 3RN4A 4DV1O 1KD1W 3POIA 4LKDA 5C6CA 4P9PA 2VZSA 3HKEA 1D4M3 5IFTA 1M06G 3U4SA 2DBIA 3LDBA 1HDKA 3ELNA 2OQ7A 2V4VA 4UAPA 1Q56A 4BQYA 4JTCB 1WA8B 1NKDA 1TG7A 3PJYA 4GA9A 2ZJCA 5BUVA 3T1MA 1ZLZA 3OT7A 4L8JA 2JDYA 3VHPA 3N9MA 3I2JA 4JDOA 2GDSA 1F35A 5IY5C 4FLYA 2QGNA 3N9LA 1FNZA 3G7DA 4OZXA 3H7YA 3E5UA 4FPEA 1B09A 3IMNA 3ZN6B 4JI1B 4KU7A 3JSLA 4EFEA 3CX5F 1POV0 4I7ZB 4O2AB 4JI0B 2R071 4B08A 3CJHA 4X66B 2LW1A 3OGSA 2P2KA 4NR1A 2ZM6O 2KG7B 2Y0IA 4I50A 1ND2B 3MLLA 4DV7B 5DDJ3 3LSSA 1RUJ2 4X9QA 1GZ9A 5IJ0B 1BS3A 5EIBC 2JKBA 3ZRXA 1US2A 3K5NA 2XONA 4K6BA 1AP5A 5FPUA 2AR6A 4I01A 1W0PA 5BMVA 4AI1A 4CP0A 5IWAO 5GLUA 1Q8VA 5D5QA 4P9XA 1US3A 2V5YA 1N1SA 5I0TA 3PURA 4DK1A 1H4GA 2Q7GA 4LK6A 1MZ5A 1LEDA 2P5OA 5IT6A 4W6XA 3FC0A 3DXRA 5JOZA 2E5LO 2UXDB 1OCZB 2VR4A 1HWYA 1STMA 2AYHA 2BRTA 2F4PA 4CPBA 3STZC 1JUHA 4FK5C 1EN4A 1AR63 5KUKA 2C26A 4I0AA 4DR7O 2HWF2 1NTZH 4LBNA 3VBSA 2ADQB 1GN3A 1VP7A 1VQ9V 1R091 4Q0PA 4JYCA 4HFSA 4Y1ZA 3H1IH 4GKKO 4AEDA 1M57B 3K9AA 4DPNA 1FYUA 3ML0A 4LF9O 1DGRN 1AL22 1S0FA 2RR11 1CR7A 1X33A 3CIHA 3U37A 2VMDA 1WMXA 1COWG 4MSVA 3BTZA 3BCWA 4Y22B 1K3IA 4UCVA 1OPOA 2RMU2 1CPYA 3UJOA 3ZIWA 3L74H 4IGGA 4KXRA 4XJWA 4AVCA 4JTOA 2FQPA 4HVQA 4FTBA 1UFIA 3OGVA 3QO5A 3T1YB 1S2KA 2IC1A 4UCTA 5DAQA 5KWRA 5FZLA 5FYUA 4XJZA 1SRYA 4QQ2A 3DTUB 1W05A 5ERLA 3ZYIB 4NIIA 1VPHA 1X9TA 2B39A 5A7NA 3ACFA 2R1BA 2QBXA 1SCRA 1VQ4V 4S2GA 1MVQA 4MT8A 2ZTNA 3SPIA 3MF9A 1Z7S2 3ZSJA 5FY8A 3VUOA 4XF1A 3WNPA 1DF5A 4CTEA 5FMOS 4U3FH 4GT1A 2BNNA 3CZUA 3KCXA 4HONA 5EFUA 4P08A 1UPGA 1IBLB 3OCPA 3WNKA 3T2OA 1K34A 1LRHA 4FLZA 4NHYA 3CJXA 4CXXA 1H8VA 2VZ3A 2HEYF 4XFAA 1XPWA 2ZAHA 2CY6A 2WLHA 2DVDA 4I0XB 4FFKA 1BCCH 3ZRWB 4L9BA 4L0PA 4K20A 1WCQA 4WVMA 5BR8B 4DEQA 3THDA 3WW2A 3PL0A 5L3EA 5LRRA 3OAAG 3QVNA 3K58A 2OVUA 3E1F1 4DW1A 5E16A 2J1RA 4YGEA 2YICA 1KP2A 1DP0A 2A3WA 1RHI2 4YVSA 2VJXA 4EB6A 3GBGA 1J1LA 2VTFA 3KV9A 4RR3C 1Q43A 4Y4RA 2RM22 4X1KA 3USUA 3CC7V 2IH3C 3HKBA 4JV5O 2VW1A 3IGAC 5C7GA 2EICA 2VMIA 2DFBA 1SFPA 2OZ6A 1SDWA 5FMCA 2GTAA 1IBMB 4AQTA 2R073 3MFCA 3W7SA 2QDNA 2Y48A 4U2AA 4HOOA 3ZMZA 4N43C 1NH2B 1B04A 4XETA 1SA0A 4PQ9A 2WT0A 2ZOEB 2CL2A 1QHDA 5IJ9A 4MLOA 1AR5A 4BE3A 2Y8KA 1IVSA 2XG3A 1L7QA 1YI9A 4E4HA 4JQRA 4IEVA 1VMJA 4W4KA 3W58A 2QQWA 3ABZA 2QWNB 3D82A 1FFTB 4CS3A 1BVP1 5C8CB 2RG4A 1R081 4MHRA 1VJ2A 1ZZ9A 5JXHA 3DPRC 4FPKA 1XREA 3APBA 4PDMA 3E6BA 1SG3A 5EYPA 4UFJA 5EC1C 4C8DA 2X5IC 2DCTA 4R9BA 4IEQA 4IHJB 1LB2A 4HT1T 3BEHA 1HN1A 4DR5O 4UXAA 4LF5B 3MW4A 1PGW1 4YHHB 3BN6A 1R093 5F2WA 2FDGA 2CGNA 2BGOA 1AF9A 1Y3TA 2CK3G 4FVVA 1BT8A 1TGOA 3ATGA 4CU9A 3R4DB 3HN3A 4BLIA 3K5LA 4P9LA 1ZRFA 1MS4A 4XFHA 1V6MA 4G4FA 3FFQA 1JHJA 1XBFA 1WD3A 2IXLA 2V4DA 1GYKA 2GP3A 3L2YA 4CDUC 1I6XA 1O7FA 3JBG2 4ZOLB 5B1OA 4QKBA 1WNSA 4Y20B 1HW7A 1XL4A 4GKXA 2OTJV 2LO1A 4D6SA 3VDBA 4IT5A 1LGBA 3AP6A 2HHHB 1VBA1 2R0FA 1GM7A 3OUIA 2F4LA 2P17A 5JXIA 1JA8A 3GJBA 5DEDA 5FRAA 4ASUG 3AKSA 4M4PA 3L75H 1QOSA 1UWWA 1XU1A 1KUQA 1SBDA 4MGIE 3ZHTA 3F7VC 2CHHA 2DUPA 1UMIA 5IYBO 4S2FA 3CNAA 5AC92 2YC2A 1R3JC 1ZBE1 4J1XA 2WWJA 3RYIB 1VBE3 4I9QA 4K0KB 2B8MA 4XBLA 1Q8SA 5LZ6A 2LGQA 1IKQA 5HFLA 1V6NA 2B5HA 4FLUA 2D3RA 2N7GA 1UY0A 1N4CA 4MVTA 4JGZA 4B3RB 4AHCA 1L1FA 2JE7A 3IT8A 1QJU1 3MIDA 5F5CA 2E7TA 3RYRA 2HP8A 1ZL8A 3QNEA 2RS13 2ARCA 4AHYA 2ARBA 1N1YA 1AI5A 4DV1B 4PA3A 1RUOA 5DZGA 2HLDG 2ADEA 1O3SA 3HQRA 4UB8Z 1COV2 3D3IA 4RGAA 1W8TA 2A6XA 4IESA 3B5LB 2HG5C 1NUKA 2VH9A 4CU7A 1YF2A 1W6PB 4X8PA 3WSOA 5I0RA 4DR2B 1SLTA 1SMVA 1XHZA 2A73B 5B3SC 2X53S 2W95A 2DN9A 4D7YA 2LRPA 5TSWA 1RUC1 1FD9A 2XQXA 3BIWE 1UMHA 4HKOA 3BCCH 5FPVA 4BMBA 4OI4A 5L3BA 4AXOA 2RDSA 2FCTA 1YQ5A 1JS9A 2YIAA 3NR7A 1ZUQA 3POBA 4JASA 1SFNA 4XXPA 3PIJA 2ZM6B 4K8ZA 3IAYA 5D8AA 2QJ1A 1FXZA 3AVSA 2DVGA 3KMHA 3J7LA 4QAWA 4AFDA 1W8ZA 4NAOA 1XJAA 4TXWA 4WBBA 3S57A 2CGPA 3ZXFA 2EBOA 3BAAA 1JYCA 2HFEC 1EYBA 2VMFA 1REEA 4XUTA 5CFCC 1JPXA 2GALA 3FB8C 3P5BA 2EXHA 5A6XA 3MLJA 5JOWA 1B35A 2XOMA 3JALA 3IWZA 5KXDA 3LA7A 4RHV1 5JVVA 2RS51 3VBUB 3WXPA 4D0QA 2PFWA 5LMNO 3L70H 4HVOA 3PUQA 1AR82 4KG0A 1SQXH 4DUYO 3K46A 3BOPA 4A44A 5KHHA 4JV4A 4KGGA 4QDSA 4DR7B 1JOJA 4E2LA 3TYJA 5DXDA 3E8FA 4CVUA 3MF6A 3CJIB 4E8CA 4FPCA 3HPLC 1YLLA 2PQQA 1X50A 2KA3A 2EAAA 3R6SA 1MEC1 4DEVA 4JI8B 1OOPA 1WJZA 1F4HA 3AVRA 2A9HA 3ZYBA 2V7QG 4FSJA 3OR6C 3IN9A 4XHBA 1G1XB 5I0SA 2XT9A 1AI4A 1S0BA 2YB7A 5FYCA 1LNSA 2VZRA 3RWNA 2IJJA 1IG0A 4HK9A 1MR5A 4N53C 4XQDA 2Y4UA 1NLRA 1O8SA 4LFCO 1WLCA 1JOPA 3M1HA 1NG0A 2WN3A 4Q4X2 5F37A 3TEZA 5K0UA 4NIDA 4FFHA 4IE0A 3WVJA 2D3SA 1QIQA 2Y6JA 5IHRA 2VZTA 2Y34A 1ZSPA 1QJZA 4NB5A 1SQ4A 5EJ1B 2VW0A 1WMDA 4J25A 4OFGA 3OTOO 2HWD1 1XI1A 3AB0A 3Q4HA 4LNUA 1RB8G 1VBA3 4P5HA 3EO6A 3KSCA 3T0AA 3VD3A 4BWOA 4Z1VA 5FXVA 4ES8A 1LJ7A 1FFXA 3WW4A 4QXCA 4LFAO 2JDPA 2ODMA 1AYM1 1NT2B 5LHGA 3IMMA 5B4NA 4FO9A 4PA6A 3FBMA 2QJVA 3IC9A 4NTWA 3WW1A 3ZYPA 3LOIA 3ACIA 3DECA 5A1FA 4YG6A 4NIHA 1UKRA 3UKVA 2EIKB 1R1A1 2ZGRA 1CVNA 2V1DA 3N35A 4DK0A 1LCLA 4FP2A 1ZBE3 4AE2A 3BPSA 1VQOV 1XE0A 5AG2A 2EILB 1OKOA 3VBBA 4QIWF 1VQNV 1FXKB 1Y76A 2BFUL 2JB8A 2XUEA 1QNYA 1AX0A 1SQBH 1QJU3 3OBAA 4QX2A 3J8F1 4WM8B 4CCJA 2DVFA 5LY1A 1RVF2 2UUCB 1CX1A 3PVNA 1DCSA 1YZBA 3CP1A 3E8GA 3BYWA 2KM2A 2YFUA 4BQ2A 1SPPA 4LNVA 1CAVB 4MVMA 4DRXA 2W1UA 3CCQV 3GHMA 3S5QA 4R9DA 3LNNA 5JJJB 1WMFA 1M90W 2AZ0A 1JJOA 1DGWA 3UGHA 3WD5A 4CP9B 4GJZA 4CSWA 4I09A 5LYJA 5IFPA 4Y1YA 1D5AA 1RUC3 2Y6LA 5CBHA 3VDDC 4UF0A 5FBJA 4A7ZA 1RSOA 1WCKA 2E32A 5L19A 4EEQA 3ZMUA 3HKEB 5IT9N 4FFBA 4FBFA 4AI9A 2XL9A 2YPJA 1HQLA 3K08A 3V56A 4J42A 3BPZA 3CKHA 3V64A 2XKPA 2ZXWB 2VM9A 2VOVA 1IPSA 1ENVA 1Q5OA 4J1WA 4JHTA 4NTXA 3GCWA 3H9VA 4CDXC 1NKGA 5FL7G 1W6OB 5JMCA 1FV2A 4A6OA 2DMXA 1KDKA 4Q29A 3LEGA 1REFA 1H6YA 3MW2A 5B1BC 1C3HA 3X2QC 2P37A 3CCLV 4BIOA 2ZHKA 1ZRIA 1NQDA 1UYZA 4H2AA 1BGYH 4I50B 1HX6A 4HZ3A 4D6TH 4ZPIA 4J7JA 1I3HA 3R4SA 1JTZX 4QM8A 2RS53 4Z8BA 5EXOA 1E5RA 1LHNA 2YIDA 1OCRB 3E83A 5A1LA 2HWE3 1PX3A 3NKTA 3K9SA 2A3QA 2P7TC 2VNOA 3PIGA 3CCMV 5BMVB 4FQ4A 2BUKA 1OA3A 5FZBA 2JEMA 1HB2A 1XQ8A 5L9RA 2PHDA 2DQ3A 1U5YA 1Q81W 2TEPA 1EV11 1T6BX 2VAUA 3UYJA 5FYIA 5JSOA 3DXRB 2YG0A 5JDBA 2CWSA 2Y6KA 2ZZJA 1J5EB 1HNWO 1LR1A 3OM3B 3AJZA 1R1BA 1MEC3 5L3FA 4WFEA 1JVMA 1M56B 3B93A 4GX0A 3CDZB 3UT5A 4OUMA 4QPKA 1FS0G 2ID4A 1FJGO 2D3OW 2ZACA 4DV0B 2DYRC 1V6JA 1N0NA 4MHUA 5C5TA 3RZMA 4Z2WA 4QGMA 3FUQA 3VBRB 3KV4A 3CO2A 3APOA 3ZMSA 3VBHC 5EK0A 3B9IA 5FJHA 4DFSA 1VMGA 4PLMA 1P49A 5HCBA 2KSDA 2W87A 3NNMA 3AMQA 3AFKA 3MD0A 3VQXA 3GDBA 1QLEB 4IL7A 2HWD3 1SFYA 3NL1A 1TMF2 1F9KA 1PO11 5CFDA 2D97A 1BMV2 4Q0UA 1V9U1 3AP9A 1ASJ1 1HXS1 3I2GA 2VBPA 2HEPA 4COYA 3HEIA 1HQNA 3C8XA 5F2VO 2CNAA 4HN0A 2MK3A 2Q1FA 1S5JA 3O1TA 3DL3A 5F6KA 2VS0A 3N4MA 3OPWA 4X62O 4KHPB 4UBHA 4HZFA 4X1IA 1OF3A 2CUGA 2IW5A 4OLLA 3HT2A 1N33B 5EBMC 1TNFA 2EA7A 2LP7A 5C71A 3FHQA 4QX1A 2WWSA 1XL6A 2ZGOA 1AXKA 4PA9A 3F7YC 1RUD2 3VDCA 2PGGA 2R30A 4YGBA 3QH7A 4DV4O 2WBKA 1K9MW 5C9AB 2UXCO 1H2MA 4KGQA 5CB4A 1H1AA 4MGSA 3IZOA 5AFBA 2Z42A 5IVFA 3BFRA 4IE4A 1QWRA 4JYAO 2GNDA 4RS5C 3H8UA 2Y60A 1RUJ1 4MX3A 1VAMA 2VQFO 1TA8A 1VBB2 4BIUA 2IJIA 4XIOA 3WY6A 1HKDA 2XASA 1RJ8A 3ZFGC 2E51A 2NLRA 2W9XA 4WVMB 4XURA 2J1AA 2J22A 3VBOA 1DQ1A 1XU2A 3DC6A 1MVEA 2ZKOA 1NJIW 4FLVA 1GNYA 1VBC3 4C0HA 1BZWA 2WLQA 2OXBA 4NMIA 1RUF3 4B29A 4MTGA 4JI3O 5A6YA 1JH5A 1YXWA 1N1TA 1NZIA 4YVSB 2D6KA 4JTNA 2I2SA 1BSMA 2JS5A 2D6LX 4XZUG 3DXUA 3OD0A 3K3NA 1OCOC 2HWF1 3K4AA 1ND3A 5DM6V 4HSJA 5IVBA 3BA8A 1FOD2 4KQ7A 4U36A 3WQ0A 1LOBA 3K4ZA 1I5ZA 3E35A 2WA4A 4NIAA 4PIXA 2RDRA 4JKKA 4AQ6A 4AVSA 5KMGA 5BNOA 5LMNB 3C3SA 1SA0B 3HAGA 2YXSA 4IQPA 4BYYA 3GWOA 2JEUA 1AL21 2QA4V 5LP6C 2YROA 2JEXA 3OG2A 3E5XA 4MH0E 4NXNO 3WF1A 4DUYB 3QBQA 1S0EA 4RQPA 5IVEA 2IH1C 2RS32 3T0DA 1OLMA 2VXRA 2HWC3 2RMU1 3KCYA 2VCBA 4LF4O 3K5MA 3HNYM 4DR3O 2OCCC 5FMBA 1JZ3A 1EV13 4HL0A 3FMGA 4MVZA 1NU1H 4X20A 1JR9A 3A2FA 4O4HA 2FD8A 2KQXA 2NP0A 4JGYB 1ND2C 3N2KA 3I8TA 5FY4A 4NO4A 1AR4A 1N32O 2W91A 1R73A 4RWUA 5EYPB 3IDBB 4WFBV 4QPJA 2Z4FA 1YRZA 5BNPC 2ZMKA 4HLTA 1Z0HA 4LFCB 3RYCA 2VTXA 2FKXA 4XILA 1Z7S1 5BZBA 4P9YA 3CC4V 2YU2A 1JW6A 4CDWA 4DR6O 2E63A 3BHPA 4XMIA 1NX9A 3HKDA 3WNNA 4JRLA 3VN4A 1NA1C 4YPJA 3UGFA 2ZA9A 3SHRA 4YIPA 4DV6O 2WNOA 3E2EA 5LY2A 3PUSA 3CCEV 2GN7A 5A2QN 3ZCCA 2IM9A 4B7KA 2IXHA 1RUG1 5I8TA 3GJAA 3IJ4A 1V9U3 4COVA 1ASJ3 2Y26A 1HXS3 1FXHA 2VQAA 4YM0A 4F8AA 1BK0A 3ACLA 5ITZA 3NAPC 4AQ2A 4DUZO 1EAH2 2W94A 2IWGB 3N27A 4ZI7A 4XBQA 1DZQA 3RPQA 1KB9F 5A7SA 5FZGA 2DCKA 4LE4A 1JHNA 4AEMA 3ZFEB 1WLEA 1D7PM 3JCUZ 1RHI1 3WNOA 2J1EA 3D4KA 1YIJV 1GN4A 2C9KA 2KD7A 2Z0AA 3LFIA 3S0MA 2RM21 3NXSA 4LORA 4OHWA 4QPIC 3VBFA 4IE6A 5LOVA 2JIJA 3M3OA 3WW3A 1W9YA 4DZGA 2JENA 5J9PC 1MQTC 2W5FA 5T5OA 4COWA 1RYYA 5C70A 2RJZA 3WG7B 1LHWA 3WHUA 3WX5A 4GALA 2JG9A 1CGPA 1RUJ3 5JR2A 2W2IA 3OBTA 2VBDA 5CVRA 3QLQA 4A42A 1AXYA 5DECA 1LENA 4C91A 4GH4A 4QX8A 4Z82A 3WCSA 3H1HH 2G38A 3CCRV 4PJ0Z 4CE8A 4GLXA 1N3OA 1UIJA 4J7ZA 4QGNA 4B3TO 2QWPB 3HQUA 5LWBA 4BDVB 2E53A 2B9VA 4FPYA 1UQXA 5ACA2 3MHSC 2BU9A 1HB1A 1APNA 2VY0A 4ASLA 2NPIA 4BLJA 4YXWG 2WLKA 2JG8B 2HKOA 3V65A 2MPFA 3A22A 5F5IA 5IWFA 2Q73A 5LK5A 1PNMA 2Q0AA 3CZJA 3T2PA 4QHZA 5IYCO 4MADA 2ZGSA 3EMRA 1QEXA 1Y9MA 4YW1A 3OMAB 2YS8A 2G1MA 4YY3O 1QNMA 4MZUA 5FY9A 1UKGA 3N9OA 3KV5A 2EIMB 1RXGA 1DYKA 1YYNA 3FBYA 4QGLA 1HR0O 4YSFA 1FYJA 3ZM8A 2JDMA 2WNUB 4YNIA 4AI0A 4LA3A 1AL23 5T52A 5I93A 2X0LA 4PIZA 4LBQA 5J2TB 1UY4A 3IDAA 1FMD2 2RJLA 5CA6A 3JD4A 3NNLA 4P5YA 4CP1A 3TJTA 2YXLA 1BYHA 1UN1A 4XEZA 2RMU3 1XHXA 1SQPH 3T4HB 2WO7A 2BCCH 3JBG1 4QXBA 4BOWA 4AVAA 1FPOA 2JICA 3KZ4C 4OQ8A 1HJGA 1HQWA 5JWPA 1G7YA 4UCUA 3JAKA 4OULA 3O0WA 1NQTA 4UV9A 3KWVA 3DGEA 1BK1A 4FZ1A 1AILA 4ZZ5A 2XAFA 4NHXA 3LA3A 2HYXA 2O8OA 1OLME 1YQ2A 4Q1PA 2VZUA 3E86A 2Q8EA 3MV01 4ZY9A 3PU3A 1Z7S3 2VUDA 4ET7A 3P6BA 5AC91 5FV3A 2ES3A 2ZINA 4CZSA 2ZE5A 5IDJA 5FMDA 1JYWA 3KF5A 1OI6A 2QZ3A 5GW7A 3S30A 4IW3A 1NCRC 3ZIXA 2BPA2 5JJEB 3TCUA 4XTMA 1W2TA 4KMQA 4QX0A 5DN6G 1ENXA 3AP7A 2GC2A 1GZWA 3W21A 4AILC 3ZDVA 4XDOA 4IV3C 1UY1A 2Q9LA 1YHFA 5FO8B 5GJ6A 1JFFB 1BBT3 4CH6A 3LIHA 3ASOB 2BOIA 1K5JA 1COV1 3LEMA 2Q8OA 1GK9A 3GM8A 1QCEA 1N3PA 4AHZA 4ATFA 4AR2A 4X62B 1C1LA 5BNNC 3Q4HB 4LNUB 2XAGA 2LFSA 2ZHMA 1HNZO 2IVIB 1S5LZ 1XNDA 3RZLA 4K40A 3O0VA 4ZU4A 1FFXB 4Y5Z0 4O4LA 3I3MA 2X29A 4LTAA 5LK7B 3Q8EA 3ZSEA 2MNGA 4P00B 1X36A 5T55A 2WZR2 5FZDA 2RM23 2Y6HA 3PU8A 3ZMNA 1H2KA 2UXCB 2NQYA 4UB6Z 2WO1A 1WLWA 1AVBA 1GZCA 4CCEA 2NR5A 5A6QA 1TAEA 1Y76B 2VQFB 3LFMA 1JQ0A 5IUQA 2XR4A 2CH7A 3WG3A 1NLSA 1K42A 2PY5A 1IPKA 1UNBA 1KITA 2UU9B 1UOBA 2EALA 2IFWA 3SXWA 2XLAA 3BOWA 1L7LA 1VBE2 4KBZA 4M4RA 1CAWA 4JI7B 1GQGA 2ZE7A 1QHTA 1SPPB 4Q4V2 1KKCA 4JTAB 3CXHF 4BQXA 4DRXB 3ILNA 3WEZA 5A3PA 2JWPA 4JI4O 3ZX6A 1HV1A 2ZKLA 2CU5A 4XUPA 4PI0A 1BZKA 3MUZ1 2VBBA 2EZOA 1BMFG 1RL3A 4HN1A 1AR81 3FKSG 4Y33A 5LYJB 3A0RA 2XH6A 1IGOA 1CQ9A 1NTMH 5IK4A 1YI7A 3TEWA 2X09A 4UF0B 3TXSA 1RSOB 1I5XA 3KVAA 1U96A 2P3YA 3ON7A 3CU7A 2QQJA 2JK5C 3G4SV 3RWRD 4FFBB 1GO3F 1PD3A 1Q6IA 3NV1A 1V55B 4EN8B 5KC6A 2WNVB 3KQRA 4RR3A 1J84A 2YPDA 3W9AA 4FPJA 3C7EA 2Q5TA 4CDQA 1D2SA 4QJFB 4LWSA 1DHKB 4C1XA 3K59A 1W2UA 3AK0A 3ZOIA 2WSVA 3AKTA 5HV4A 3B01A 3H8RA 2ARXA 1CP9A 2VCCA 4O4JA 5C8WA 4J9YB 4N43A 3SQOA 3BTYA 4DR3B 4YVWC 4L11A 2BDRA 5J48A 4MUVA 4WZCA 3RVYA 4HPKA 1P7BA 4Q4X1 1HRI2 1U5ZA 4CEYC 3JBG3 5FK8A 3OGCC 4OPAA 5EJZB 1WCDJ 2B45X 3N7JA 3ZMVA 4BXSV 4MG2A 1F15A 3C7OA 2IJHA 5CIRA 5A9GA 4QNHB 4NYKA 2AREA 1QJX3 1MPXA 3AEIA 4A5UB 5A7OA 1Q3EA 4DR6B 2VZ1A 1TUEB 3JQXA 1GICA 4EWAA 3M8LA 1AYN2 4MVQA 5ABJC 3ZN1A 3B8MA 1F4NA 1T6GC 2ZEZA 4FM2A 3MV11 4DV6B 4QHOA 1PNKA 2QWOB 1IS4A 1I7FA 2BERA 3M2MA 1DQ6A 4MVUA 2XHKA 4ZBMA 3NW4A 1F23A 5LMUB 3K3WA 1W2OA 3AYEA 3JD1A 5D2AA 2OX0A 5EHDA 3AZZA 2VUCA 5EYXA 4X64O 2XVLA 1WLTA 2E74B 1RVF1 2NYYA 1OQEA 2B42B 2VOWA 1F31A 1COV3 5FZHA 4TWTA 4KWKA 4IEZA 2YFZA 1H9WA 2EXIA 4CDUA 3O9OA 1MNGA 2AUYA 3ABMC 5KAFZ 5DMYA 1K5MC 1DDLA 2LALA 5CFDB 5IAVA 3VHRA 4IEUA 2A5ZA 3ASNB 4JZ2A 4BQ1A 3ZRWA 5H2FZ 4BIZA 3HKCA 3WHTA 4HKWA 3OMIB 3H9AA 5J1XA 2QKAA 3NV3A 2YDEA 3E6DA 1CESA 2VQ0A 2UWBA 4X1IB 1QJFA 4TSVA 1I0HA 5I0DA 1XNBA 3GCXA 2WUHA 4I4TB 5FZCA 1TVKB 2P22C 5FPZA 4LBLA 1NCQB 4LF6O 3R66A 3POEA 2JJ2G 1IBKO 1CX4A 2R063 3HPNA 4NOTA 3W7XA 3QCWA 4CXYA 1H38A 1OD3A 2BZDA 3P30A 3AKQA 2PLV3 1ODNA 2JVDA 3CRQA 2D6OX 4Q0QA 1VAVA 1XDCA 4B3TB 2EIKC 5BPXA 1GLHA 2F6BA 2G9ZA 4K1YA 5GLTA 3F2ZA 1OKQA 5CG9A 4E9KA 1H9PA 4AFBA 3B77A 3CQOA 3N7MA 2JDNA 1AR72 2ZX0A 5LGTA 2EILC 1HJFA 1AR83 3APQA 1YTFB 1UZ0A 4A3ZA 5E79Z 3VBOB 3NNJA 3BKZA 4AGRA 3ETDA 1W0KG 4KL1A 1YFUA 3HBZA 4AEJA 4ZONA 3D36C 1I5PA 1FATA 4RO2A 3JCZA 2BSKB 4DV5B 1QH6A 4Y3OA 5EZYA 1HR0B 1K5QA 2R9RB 3PVOA 5CA3A 2UYBA 1YSCA 5FPBA 4JI6B 3WG1A 3ZRVA 3FB6C 1QOOA 4LCUC 4Q6GA 3I97A 1J3PA 4N9HA 3UNPA 1ND3B 1GRJA 2FZ1A 1PMJX 3SH3A 5KBFA 2CAUA 1UD1A 1F7YA 2XWBB 4A3XA 5BNOB 5CNAA 1J3RA 5CFCA 3B8NA 4MGZE 4GQ7A 3RFRA 1TUBA 1A6CA 4LHNA 4GULA 1H2SB 3TB0A 4CRQA 1UW8A 1DFQA 2H3OA 5C8YA 1SACA 3VLBB 3RJRA 1A78A 2BWCA 4OMCA 4LO6B 4HNAB 1QF3A 4QB2A 4GXLA 1TMF1 1SBFA 3CD6V 1BMV1 2W47A 3WZ1A 1N8RW 2NMNA 4JQTA 2HWE2 3O7OA 2UXBB 1FI2A 3X29B 1S0CA 3N2KB 2VQEO 2SBAA 5F1RA 2BP6A 2AXTZ 1JX9A 2WZPP 2Q4PA 1CAUA 3KHCA 4AGGA 1PV0A 2A06H 3KB5A 5JAXA 1PVC2 5FO9B 1VQ8V 3RYCB 2XKOA 1BEV2 3J81N 1HRV2 5LL6Y 3DXTA 2DWDC 3TBDA 5FY7A 1LOAA 3QO7A 4QX5A 1IS3A 4CDWB 1MZ6A 1RUD1 4M0NA 1BQ0A 2WR9A 2W1QA 2ETNA 1RVF3 2CAVA 4N53A 2VMHA 4PDWC 4JF3A 3PLQA 5FYVA 5IYZA 4Z2AA 1NVPD 4ZKTB 3SPJA 1RPOA 3ZXKA 4IUGA 4P9GA 1O4TA 1AUYA 2IZWA 4MO3M 5F6LB 1HNZB 1GZTA 5JMOA 1H8TC 1PK6C 4YM1A 4LKEA 4NRPA 4DXZA 3IKWA 1VBB1 5IK7A 1M93A 3VBSC 3JZVA 4X6QB 1H2NA 3KG2A 2WAAA 2XAJA 5ITZB 2Y69B 1LGCA 1UY3A 4AEDC 3H0OA 5J96B 1Y9QA 4QQHA 2CAZC 1URFA 4AL9A 2WT2A 1W6PA 2ZKNA 1KKDA 4AI8A 1EFRG 4JAVA 4BM8A 5B1NA 1Y66A 2VZVA 1S4CA 3MFAA 3B2EE 2XJSA 4ZZ8A 2AC1A 4Y5TA 4WZFA 3HR9A 3VKFC 4ONUA 2LROA 5FXWA 2VD7A 3TK1A 1S77D 4AAXA 5DPNA 1D4M1 2KKWA 2AGSA 4RQFA 3VBFB 2W6JG 4LHSA 5DUUA 1WN7A 1FOD1 1O3TA 2ZNIA 2EXJA 4IXLA 1VE0A 1D0HA 3WF0A 3AYDA 1DGRA 3LPFA 5H9RA 4XQWA 3FLRA 4UXNA 3VZJA 1PMIA 2X05A 1S72V 4E2QA 2JG9B 1AROP 2OZJA 5F3GA 4Y5SA 3AMNA 4LF7O 4LA2A 4LF8B 2RS31 5LA2A 4YGDA 2IXJA 3UK9A 5FLXN 5EIYB 3M99B 2Y0OA 2DUOA 5GONA 3MYXA 1AJOA 4COZA 2F93B 2QVSB 4K8RB 2YI9A 1ULOA 4D7TA 4BK5A 4P02B 5KHJA 1WW5A 1PZ7A 2WO3A 1KQSU 2PMWB 1R1ZA 3ZYFA 5C3PA 5LBEA 3OUHA 2KR2A 1KXGA 1WB7A 4GX2A 2A6VA 2XTAA 2PN5A 1RUF2 1G9AA 5DUVA 1PO22 2WLIA 1XSQA 2OUJA 5IY5B 1KS5A 4LITA 5KX5A 5IYDO 1ALYA 4BW5A 2E26A 2B1GA 4Q20A 4JX0A 3OGGA 1VP6A 4IEXA 4YW5A 3PJSK 3LOBA 3VZMA 5A33A 3I2HA 3LDCA 3SYQA 4CS2A 3CCUV 3CRRA 3ABTA 3KGLA 1L0NH 3VD9A 3G6BA 1RMU3 1EPZA 2ARHA 1TMF3 2B9UA 1QJEA 2VTXJ 4TLGA 5GZGA 4NXMO 5CMUA 5SV5A 1K12A 4JZGA 1MA1A 2ORXA 3JAKB 5H6RA 1EAH1 3AP4A 1J3QA 3WF2A 1NR7A 1GNHA 3T2MA 2QZ2A 1XQNA 2UXXA 3OR7C 1SLCA 3RRDA 3CCJV 3ENRA 5CB7A 1IG3A 3JQWA 2DWEC 3WF3A 3RYHB 3ME2A 5L3GA 3PVBB 1N3QA 1P84F 3LB9A 2HVJC 3I5DA 4CC5A 4BPZA 4KU8A 4CCLA 5LB6A 3S7IA 1RUD3 2VXJA 2I74A 3WP5A 4N9IA 1UXZA 3IIAA 3QO8A 3VBHA 5LA9A 5F5AA 2VULA 2CDPA 3MIBA 1AI6A 3CHXA 4IL6Z 2C1FA 2CSGA 2PQSA 1FXKA 3G80A 2R32A 1A8DA 4F4LA 3I3BA 2UYAA 2XWJB 5IAXA 3FN9A 4WM8A 1AR1B 4AQYO 5FTTC 1VBB3 4XUNA 2JDZA 5J98B 4SLIA 4LPLA 4XAAA 2WAMA 5FZFA 1QVFU 4GWJA 2WPDG 3UKTA 4PLNA 3OMNB 4FAHA 4W8JA 2K0GA 2D6NA 5ACA1 2O0OA 5GM0A 1R3KC 4QM9A 2G19A 3H1WA 4K3UA 2JS3A 4O4LB 1G6UA 4LF6B 4F3JA 1W28A 2R043 1RM1C 1PNGA 3RBZA 4MS2A 4GKYA 4EE2A 4FPHA 3ZXGA 1VQLV 3AL5A 4NHKA 4TYSA 4AGVA 4ZXEA 5FUPA 3BTAA 3LPGA 2ZHLA 3AG2C 1FOD3 5L9VA 4QU2A 4XIKA 5HPOA 3SYAA 2YGLA 4XDQA 1QH7A 1RUE3 1ZYBA 4GUNA 1LODA 5FZKA 2CH7B 1UJWB 3Q8AA 1W6OA 5F2SA 4FLWA 1UZVA 1Z2GA 3E22A 4H44B 2RE9A 1AJNA 4JRAA 1FMD1 3LQCA 4R9CA 1CAWB 3ALQA 5DN2A 1MABG 4HG6B 4FOQA 4HYOA 3POYA 1Q8QA 2RS33 1L0LH 1U97A 1V54B 5FQ0A 2JKXA 1LU1A 3P3PA 5G04L 5CKQA 1RJ7A 3VZKA 5CBLA 4QPWA 4UFIA 3ZFGA 1RUNA 1VQ7V 4H13B 2RV9A 4GZRB 5KHIA 4O4IA 4IIJB 3V0BA 5DZFA 2TUNA 4XUOA 1OA4A 4JGZC 2EZPA 2DTWA 5EP9A 5FLHA 1S1AA 4DW0A 5FXXA 3AG1C 5BY1A 3VV1A 1HB4A 5I0UA 5CBFA 1ULPA 2Y38A 1Q7YW 1XNRB 4OVEA 2JIZG 4EZHA 1QDOA 4NVPA 2PYTA 1OFNA 2P90A 4OX9O 4CBCA 4RR3B 1VARA 4CEWC 4CDQB 2IJKA 1LUVA 2YGMA 1WD4A 1SHWB 4LWSB 3NV4A 3M7MX 2EINC 3CS5A 5B66Z 3EBRA 2OCHA 2XHNA 5FZ9A 3VBRA 4O4JB 4N43B 3I7DA 4UVCA 4BAYA 5LP6A 2F4VB 3VQWA 4HPKB 2VU9A 1X59A 2CTQA 3L72H 1NAEA 2VO5A 2DQ0A 3LDEA 4XFGA 4FMTA 3F95A 2BV4A 2QQLA 4YJ2A 5ISLA 5D8AC 1OPMA 2OKXA 1MZFA 1VMFA 4QGPA 3ZO0B 4O61A 2VQEB 3W20A 4XBNA 5BNQA 1EAH3 3A8TA 5D1IA 4R50A 2IBZH 3SYPA 2VQTA 5F8PA 4JDNA 1F4MA 5L3CA 1LHVA 2D40A 4QKDA 2PELA 3O0XA 1B35C 5LEKA 3UJQA 2C24A 2WZR1 4BMEA 3SPCA 4LBOA 2DDUA 1TQ5A 5DQ0A 1UXXX 2X5IB 3MEPA 3VZNA 5JUVA 3RVZA 5BNPA 1A8MA 5LBCA 4FFFA 1HW5A 2BEOA 5A7WA 5FCCA 1YQ8A 4U3JA 2C9AA 1L7RA 2ZNJA 4EROA 1W03A 3PUIA 1NA1A 2ZHNA 5CA0A 1BHGA 1J1TA 4I5SA 4FJCC 2RJKA 1T2XA 2OA2A 4XVHA 4DUXA 1MZEA 4R4XA 4E8DA 4O7XA 1VBE1 1REDA 4ZXKA 5C9AA 4PLOA 4LIVA 3SMHA 2YC0A 3I2DA 4Q4V1 4FIPC 5FWJA 1OOPC 3WP3A 3F5TA 4XFFA 4CDUB 3DF0A 2RS11 3MGUA 4D8MA 5ACA3 2XBO3 3NAPA 1BBT2 5KC5A 1LOFA 4L87A 3BVCA 3HKCB 5FYYA 1CONA 3GZTB 4GWMA 4ZU5A 4XHXA 1XMOO 4FP3A 4UVBA 2F23A 5K0UC 1EY2A 1WPBA 1BQZA 4B3MO 1ZZ8A 4EN9B 2A79B 3FAVA 4DR4O 4CU6A 1OBNA 1B6QA 2PXJA 2QKSA 4BH9A 4Z92B 2DBNA 3IAQA 3MIEA 2HLEA 5EV7A 3IPVB 2ZCWA 3BVOA 4NN0A 1VLNA 3UO2A 1H1IA 1M4WA 1Y9GA 1GOGA 1MS9A 3ROUA 4COUA 1V6IA 1OUXA 1RPRA 4UV8A 3AG4C 1ZA7A 1FMD3 5F7UA 3OE7G 2GTSA 2ITDC 2FHRA 2RJ2A 2ZX4A 1YJNV 1UAIA 2AENA 3QOPA 2CYFA 4TV9A 2BOCC 3LA2A 1HRI1 4FVMA 3N2GA 2UUBB 4TOIA 5T5JA 4PF1A 2PI5A 1DZRA 3HB3B 4RAIA 1O9HA 5FUNA 1CWPA 2EF6A 5LA1A 2A1XA 2G9GA 1NBMG 1J83A 3B9CA 3R65A 3CMEV 5FP8A 4ASMB 4GKJO 1OURA 3WDWA 5B3SB 2GC1A 5K8SA 4I9WA 1WPXA 1E5IA 2CTWA 4RD7A 4WM7A 2GP5A 4AVTA 3GB7C 3N7KA 2ZT9B 3ZHVA 1ZAUA 5EZYB 4JGYA 1WP8A 1AYN1 3A0KA 4DYLA 3D6EA 5BY5A 4UWDA 1DGLA 4E4ZA 4LP8A 4RA0A 4QQOA 4FLTA 2YV8A 4E2GA 5LXTB 4LBKA 2UUAO 3ABKC 4YZ3A 1RITA 4PELA 2PA7A 1KYOF 4B8EA 3TGUH 3AG7A 3MIHA 4D6RA 2B5UA 3K75B 3AK1A 2LGWA 5GLVA 3SEEA 3CRAA 3N3HA 1G9BA 2WLPA 5A3NA 1JODA 2ZIOA 2BVVA 2LFRA 1BJQA 3ES1A 1W9TA 1YNAA 3I59A 5H9QA 4M3CE 5CFCB 4DV3B 4QX3A 2K9ZA 1TUBB 1UL9A 4U7OA 5KA6A 4ATEA 1Q86W 2YBSA 3WDYA 2JB4A 4LO5B 3U07A 5FWEA 4MVRA 1K73W 1AVMA 5C8YB 1W8NA 2BVBA 3B02A 4L97A 5DZEA 5FZ8A 4MGTA 2ZDIC 1D2QA 4MGQA 2O57A 3CLPA 4AVBA 4LH7A 3ZKYA 3K0DA 4O9EA 4MTFA 4YARA 3PHMA 3ETPA 5LA6B 1PGL1 4XFBA 1MOFA 3LUTB 4WVZA 5JCTA 4AK3A 3ZSMA 2WZR3 1HP8A 5HFMA 5L7OC 3E8BA 4JI1O 2N05A 1CAUB 1QJX2 2AEZA 1ZRDA 1PM9A 2ZX3A 4KBBA 3ZFEA 4LBQD 4Z07A 1NS1A 3JU9A 4X66O 4DR1B 3OW2U 5FP9A 1D0GA 4RGKA 4A2UA 1YC61 1NY72 5GZCA 4R6ZA 3G6JB 1QDCA 2E31A 4S2HA 4PHZA 2DVBA 2GNTA 1NCRA 3T3YA 2OPKA 4YLZA 4I3PA 1XUQA 4N53B 1W59A 4IV1C 5IYZB 2QQVA 3SJBC 4YYOA 4Q4V3 4MVOA 1KD7A 3CMGA 3BTXA 2OQ6A 1H2GA 5EZWA 2BOBC 3VQVA 4JKMA 4AI2A 3MI8A 1AR71 1JJ2U 4IGPA 4V2VA 1W8OA 1TE1B 3M3EA 1IURA 3WLUA 2JJ1G 5BNNA 2XJUA 1T5EA 5BXZA 1U5XA 3E97A 4A6SA 4EV0A 3U75A 3LSDA 4PT6A 2RN9A 1UZWA 3BI3A 1D2DA 4FFGA 5FFOC 2RHPA 3WUCA 5C93A 3R0RA 3WINE 1GR3A 4QXHA 1QKQA 2WC2A 2QQIA 3JXSA 1CPNA 4QB6A 5L9BA 2JG8A 2BWAA 4CP2A 2VL4A 2VC9A 3JCIA 2ZCEA 3O14A 5FY1A 5L3DA 4FM0A 4BR6A 1VQPV 3THOA 1S0JA 2QE3A 5GLZA 1ZWIC 5K4LA 1JI6A 4ZHNA 4C0BA 4D69A 2XJRA 1HDJA 4QX7A 2WFF3 1OT5A 2AW9A 2DUQA 1JYNA 1WP7A 1ZVFA 5GZEA 5KXEA 4UCRA 2BTQB 3VZOA 1SZXA 2QTWB 4ITCA 5FAXA 2WLNA 3WQBA 2WNUA 2EIJC 2R062 5FZ6A 2GUZB 1C8M2 3T1YO 2R9AA 4UOJA 5CZKA 1HRI3 3ZXLA 3EFFK 5J2TA 5IWAB 2L9LA 2PLV2 5EQUA 2Z5WA 3CMAV 2E3CA 1EM1A 4X1YB 4DNYA 5LHIA 4FPPA 3ZPOA 2ZMNA 4NRMA 4OCTA 1WB8A 1CJDA 4DXRA 4AI3A 1G86A 5GONB 2P3KA 2E5LB 4IERA 4YM3A 2HWE1 1CZVA 3KVBA 4E2SA 4FT8A 5F32A 1V00A 1AYN3 1QU7A 1U12A 1CEZA 2Q7HA 2QKDA 1XNTA 3C2UA 1O8PA 3I2KA 1IPJA 1BKZA 4KWLA 2P67A 1IBLO 4OGQB 1PVC1 3GNEA 2OIGA 2WLIB 2GAUA 2A7AA 2BQPA 2VVDA 1BEV1 3GF6A 4CDXB 2DYSC 5KX5B 4GKKB 1HRV1 4YW7A 2FCUA 4KH9A 3VBOC 1W3VA 3HT1A 1J95A 4LF9B 2R49A 1QQP2 3H1LH 4NHLA 3K77A 2GV9A 3CPWU 4QXKA 3JAMN 1AP6A 4UFKA 4BA6A 5B1AC 5A33B 4KFMA 4YVWA 4H55A 2IU3A 5FYZA 3X2QB 3AZVA 2XL7A 2VOTA 3T08A 3UQ8A 3KKYA 2JECA 3RMYA 4CEYA 2Q5ZA 3T4VA 1E1QG 4FI9A 4LXLA 4Q4Y2 1R3IC 1P7GA 1EUUA 1JFFA 1SQFA 5JR7B 4PBPA 3RZZA 2DF7A 1KFUL 1C8NA 1LECA 5FZ4A 3J8F2 2Q8DA 3THCA 5BNOC 4LUMA 4AQSA 4D94A 5J09A 3N7LA 1W6NB 1TME2 2Q69A 3JD0A 3ZFFC 4DUWA 1GANA 3MW3A 1JMUB 3LSUA 3RZGA 4QPGC 2WQ8A 4RQPC 4PBOA 1K92A 5C3SA 1OUSA 4OHYA 4UFZA 4LR4A 2VZQA 4J80A 2DYRB 2RNBA 1GQPA 3J7NA 2BGCA 2ZX1A 3B94A 5LW9A 4W4LA 1GMMA 1CN1A 5J37A 3PVEA 2WQ4A 3VBHB 4DY5A 4E4DX 3WG4A 4Q0VA 3ABUA 4GB32 1RIRA 2W39A 1VQ6V 1J59A 1TNRA 5FNVB 3B7MA 1V6LA 1JBCA 1F51A 2WS92 3RGBA 1LGNA 2OW4A 1S0DA 1Q90D 2ZGKA 2ET1A 1AR73 5CEHA 2JE9A 3FWEA 5JCOA 4FOVA 3NNGA 4AVVA 3SISA 1XMOB 1K5MA 5FZIA 3MICA 1UX7A 5GZDA 3JYCA 2PHRA 4META 5FP4A 4DR4B 3UO3A 3M70A 4IYIA 1H8EG 1W8UA 4YHHO 2A6WA 5A7PA 1KFXL 2H6BA 4AOCA 2J1TA 4JV5B 3FLTA 4M01A 2IXIA 1KJRA 4B4RA 5BV6A 2OYQA 1VBC1 5FZMA 1RUF1 3L73H 1PO21 2AZ2A 2DTYA 3WB0A 3CF6E 5FKCA 2WNVA 3Q8FA 2OTLV 3TOJA 2R0HA 4JAUA 1IOAA 3O1VA 3ZRSA 1JMKC 3A4UA 3THPA 4JYYA 4RYDA 2C5DA 2QSAA 1RGSA 1E1RG 5FKBA 5JXJA 3E22B 3RG0A 4J41A 3WV6A 4RS5B 1F5JA 2HHHO 1PIV2 2EJ7A 4FCAA 1U0AA 2GMEA 4K21A 2D43A 1LESA 2FBEA 5FQ0B 2ZQMA 2YBKA 1ZBA3 4FAGA 1SS3A 2VRZA 4GMP1 3N9QA 3ZFGB 3SDLA 2RDCA 1OCCC 1GP4A 4O4IB 3V0BB 3H7JA 4XF9A 2VNGA 4N7UA 2FMYA 5L36A 2BGPA 2RDQA 1JYVA 2HWC1 3UM7A 3EQEA 5JZGC 1EZVH 1IXBA 3POFA 4K0KO 3OYWA 2HWB2 4DR5B 2C2AA 2Y0PA 2A6ZA 2PHUA 3S3XA 4GH4C 2EJRA 1PVC3 2HVKC 4B3RO 1KP3A 4M3CB 2FDHA 4I30A 1ZRCA 1BEV3 1HRV3 2QM8A 1X4TA 3FJSA 1OCOB 2D5FA 1NH2D 2ZMLA 1XMQO 4LFBO 3MHHC 1LHUA 3ZKUA 1FXVA 1DK1A 3U10A 3UESA 2VMEA 2DU0A 3RYFB 2QM7A 4RUFA 3C7FA 1UPSA 2OIEA 3Q9OA 3USSA 1BCXA 4UBGA 5DABA 4BIFA 3VGIA 2ITCC 1QGLA 2ZXQA 5LP6B 2YXYA 4DR2O 3FX7A 1CD3G 4FOWA 3S6PA 5F3CA 1YO8A 3U1XA 3VQYA 2X6CA 1CZSA 2YZ4A 3CRCA 3T1CA 4ICGA 4J10A 1SQVH 3JSNA 4YJ2B 1JZ5A 1LUWA 2J42A 4GX1A 5CKMA 3OGRA 2OCCB 1RMU2 1W0NA 1S76D 4YJ3A 4DMIA 2VOKA 3FB5C 2DFCA 5KHKA 4H37A 1XNQO 3I55V 4PF5A 3EHKA 1M4UA 3OBZA 1NYWA 1X8MA 2UWAA 1IXMA 1IDSA 4IEOA 5C4WC 1DIWA 3CCSV 1YCIA 2YIBA 3GXUA 5FPLA 1CPMA 3BUCA 3O12A 1GN2A 1SQQH 1ENQA 2LTNA 2C6SA 5BNPB 5JIUA 4R8HA 1JCHA 1EN6A 1P8JA 1YQ6A 3J80N 5A7WB 1WW4A 4EQVA 4DIQA 1DG6A 4U3JB 4I4TA 1TVKA 3BY6A 4BW9A 3RZJA 1NQJA 2D93A 4RFRB 1NCQA 2OT7A 4ASKA 3HBKA 2XJPA 1NA1B 1SZBA 5CA0B 3H1MA 5GALA 4PDWA 4NHMA 3NMBA 1YJLA 4YW6A 4BWAA 5GTHZ 5J7MA 3HNBM 3NNFA 4XJ8A 4N21A 1LOGA 3K51A 2Q7EA 1SQGA 4G28B 3ABLC 5E1RA 1H8TA 1PK6A 1QBZA 1VB2A 4AFAA 3SITA 1PX4A 2Z5UA 4YFWA 2UWCA 1ZX3A 2YYOA 2IU0A 4XCAA 1XNKA 5J2UA 1PPJH 2LUWA 1QXPA 2Q30A 2KXLA 2GH2A 4LUKA 1OFSA 3NAPB 3ZSLA 2I07B 1Y43B 2D6MA 3WNMA 4JI8O 3NV2A 3VB9A 4Y26A 3WDTA 1PHMA 1QY4A 3H01A 3NO8A 3D8CA 1OQDA 1J58A 5HCFA 2QTOA 4NWVA 4B1MA 3ZS8C 3TN93 3RDIA 1PO23 2BSKA 2VNRA 1V9PA 3FAVB 1WLDA 3K5OA 3LNMB 2VMGA 1UIKA 3WU2Z 3AZYA 2R042 4QPIB 3ZXJA 4UW6A 1UCXA 2QTSA 3J9SA 3LCPA 3MPBA 4JI2O 2R72A 5FPAA 2QEXV 2DVAA 3KF3A 1MQTB 5BXXA 4FTEA 2V5DA 3A0HZ 3IBMA 2IXCA 2QQOA 3MAQA 1VBD3 1RUE2 2JGDB 2X8KA 4TV9B 3T0BA 5FPRA 4H0LB 1NZCA 2P6JA 5E8AA 3N2GB 1Q82W 3LEIA 1OHHG 3RJ2X 4GMP3 2BNOA 1W6MA 2A0LA 2P6HA 3FHIB 2WT1A 3FLPA 4AF9A 3QF7A 2AH2A 4AHWA 4HNAA 1GKBA 3T30A 5CISA 5IVCA 4O2BA 1QJY3 2AHZA 2QQPA 3VD5A 1POQA 3B69A 4LBEC 4LOSA 4MXWA 1W99A 5T3NA 4WM7B 2MW2B 1W6QA 1VB4A 1ROPA 4XF0A 1MS3A 4MW8A 1V54C 3CEIA 1RUG2 2PHLA 1FAYA 5FLJA 1DGWX 3POSA 1D5NA 2UUCO 2CDYA 4XZPA 2W46A 3SNMA 2O14A 3ZXEA 1GWKA 4YG3A 1K3EA 2L35A 5A3WA 2W52A 4TQFA 3T1LA 3WP6A 3ZHSA 1N34O 2GZWA 1SLBA 3POGA 1QLNA 5AVPA 3AG3B 1W2BU 4OUEA 3OEBA 4BJ0A 3I59B 1XBLA 5CKNA 4CZZA 1VMHA 3K79A 3O1MA 2YXHA 3VKNA 5IJRA 2Q8CA 4B7EA 1FT9A 1OCZC 3D3QA 4CDQC 2ZGNA 3CSXA 3OTOB 1XOYA 2EIGA 1TEIA 4J6GA 1ZA4A 1UX6A 4P2ZA 1PKXA 4NRQA 4P9IA 5FZ0A 3S3WA 4QQLA 4AEKA 2ZGPA 1XC6A 4LFAB 2VGDA 4TV8B 1BBT1 2VW2A 4AFMA 3LKJA 4UFMA 3NVCA 2WABA 4PDRA 1TVGA 4LT5A 4CCMA 4DQAA 1M57C 2JE8A 4OUSA 3NJVA 4TSFG 3MIFA 3R05A 3AZWA 4AAPA 3E89A 3B40A 1YWKA 5IVJA 5HCAA 2JD4A 1YHQV 2UURA 1SLAA 3ICXA 2GU9A 3TEYA 3P1IA 3M3IA 1PVXA 3SJQC 1X8EA 2OPWA 3HOBA 5J36A 4ZHQA 1WA6X 2P3JA 2HBTA 3L9DA 3CB2A 1ZREA 4INDA 3LZZA 5K9YA 3AKRA 1NCRB 4TZDA 5K1XA 4CCCA 4QKNA 3UETA 4BQWA 2GC3A 1JOYA 5FPOA 5JH7B 4IV3B 4UCSA 1LEMA 1Y74A 2ZZQA 4LR3A 2XNDG 3O1UA 2HYKA 4ORFA 1EPWA 5FK7A 1W9WA 1J5EO 5FPXA 5BNNB 4P9WA 2YU1A 3EYPA 1VF7A 5EC2C 1ZX5A 1KMIZ 2WA3A 4OQ9A 2Q1ZB 2EX3A 2DW4A 2RR13 1S0VA 4DV0O 4XUQA 2C0ZA 4ISQA 1Y4MA 3JUUA 1XNCA 3ZPYA 2XBO2 5E89A 2WNEA 2A3XA 2XHBA 3V0AA 1RUI2 4LBJA 2EVXA 4WV8A 1WGPA 3I54A 3ASIA 5I8YA 2J7MA 4CH3A 1G9CA 4JKLA 4TUYA 1S2EA 2DE0X 1XYNA 3JD72 1Y6XA 3LDRA 1UU6A 5FO7B 1W9FA 2K9PA 3G71V 1W2NA 3NJXA 2FMDA 1YXBA 4D7SA 3OEEG 4YRDA 4WCEV 2TBVA 3ZYRA 3VOUA 3M3QA 5A80A 4PJYA 2WIIB 3CBNA 2BFUS 5A3TA 2AACA 3FZ3A 5F3EA 2W08A 1OF4A 2RMKB 1Q6UA 2ZEYA 3SLIA 3CE2A 5L73A 4JPRA 3O1PA 2DCJA 5FYBA 3K57A 1LNQA 1WAZA 5LASA 1NR1A 2ZGUA 2ZE6A 3W59A 1Y67A 2A6YA 4WBNA 4KHPO 1YJ9V 3AMHA 2YC4A 5IE9A 3WR0A 1GM9A 5JQGA 1WCSA 1ZZCA 1N33O 2DCYA 4LQRA 1HNWB 5H9PA 1BHBA 5CAZA 1GBGA 2HJFC 2VVEA 1XMQB 4LFBB 2Z79A 1WZXA 3ZN5A 1OH4A 3UKMA 1C57A 1E5SA 1MG1A 5EBWC 1FJGB 2W68A 4I0WB 1QJX1 4CEWA 4XW3A 2GH8A 5F9TA 2NN8A 3NJYA 4KWUA 2OYZA 3ZSKA 3RYHA 4J7KA 1NLQA 3D5OA 4BISA 2LW7A 1NY71 4XE9A 4UW5A 3PTYA 5FZAA 3MLKA 3RNSA 2ZBJA 4F83A 2IXKA 4XQ4A 3RSJA 5C8CC 4X88A 4EWDA 5A3OA 2JDAA 4YVWB 4I55B 4K8FA 1DZTA 3I3DA 1S3JA 1AXZA 3KCCA 3U4XA 3L71H 3T1HO 1VALA 3MBWA 1ONAA 3ZHUA 3B3QE 1XNQB 2Q4SA 4CEYB 3K2OA 4PCRA 2SLIA 2QNKA 1C28A 5HXMA 3W7TA 1ODMA 4JYBA 2F17A 4UW4A 1GU3A 1R64A 5BYNA 3S7EA 4MGKE 3AX4A 4ZS2A 1O5LA 4B4QA 4FOYA 4R9AA 4CU8A 1VQMV 3RS6A 4R4ZA 4N7IA 1A3KA 3POJA 4CPBD 3SGIA 4YZ5A 3JAWA 3ZVXA 1F5FA 5JOYA 1EZJA 2AHYA 5ABJB 4NAMA 1VF6C 4I02A 3DKQA 1N1VA 5FOBB 2H8PC 3KM5A 1RUH2 4U7NA 4WF9V 3VDAA 1YI2V 4DV4B 1R083 2FMLA 3BA9A 2VWJA 2J1UA 3MPPG 3EB7A 4JYAB 1SLIA 4P14A 2GDFA 5I8SA 2R061 1C8M1 1XNAA 1Q6HA 3K4DA 3D0JA 3OPTA 3ZJZA 2PLV1 2ZEWA 1S55A 3VHNA 3SPHA 2IUWA 3ABMB 1KQRA 5LATA 4LK7A 1K5MB 4LE3A 4Y24A 1UZYA 3DUIA 3LEKA 4IEWA 3KT1A 3ZXDA 2JDHA 3UT0A 1OLRA 4JI3B 3OFNG 2ZD9A 3NRUA 1AR92 4GMP0 4HVRA 4AG4A 3EVKA 1GFF2 5JSPA 2VE1A 4K1ZA 3POWA 2K2SA 3DN7A 3VZLA 2NZ9A 3ZX7A 4IIJA 4L8QA 3EJKA 3SPGA 3PUAA 3MIGA 3EXUA 4NPLA 4JI2B 1H2LA 2B1IA 4R8CA 3DYMA 2A71A 1N47A 4KG8A 1ZTEA 3FUOA 2XJQA 4FTSA 1XYOA 3JB8A 4W65A 3IIIA 1WW7A 3HQXA 2QR4A 2WZEA 1NXMA 4QWNA 4YWAA 3GZAA 2D98A 5K1PA 1QQP1 2FL4A 2Y33A 1YEWA 5FYSA 4RFT0 3A21A 4NXNB 1W2AX 1UO9A 2BBAA 2ZPXA 4RL7A 2Q6AA 2WFF2 4D6QA 4F6RA 1VAKA 3SH5A 1NTKH 4LF4B 2JX9A 1UYYA 1FX5A 2YEVB 4Q4Y1 2R1DA 1V6OA 4X8NA 1GMGA 1CJPA 3WNLA 2VOXA 3OY8A 1XILA 1DQ4A 1LU2A 3WDVA 1VIBA 3UGGA 4IGQA 1AI7A 1G9DA 1PZ8A 1MS1A 1N32B 1HNXO 3U14A 5B4XA 4G3YC 2V72A 3CXCU 1TME1 2VECA 3AC0A 2CE4A 3QH6A 5FZOA 5LA0A 3KZIZ 1SETA 3JATA 2QDRA 3OYWB 3LSEA 5FP3A 4B1LA 1WA4A 3ST7A 1N34B 1VRH2 2X7RB 1RINA 2AZ5A 2MEV2 3DPRA 1QMJA 2QWRB 1IKPA 4UT5A 1K7DA 1SESA 1QOTA 3VBUC 2X5IA 5DAPA 3H50A 1A34A 1SC5B 1G8WA 4PI2A 2ZGLA 2MHFA 4Q4W2 1RXFA 3ETQA 4XDJA 4GB31 2PAMA 5FOJB 2CTPA 4N90A 1XB9A 1IX9A 2WS91 3WOGA 2ZEXA 4IDZA 2QDOA 2VZOA 1RC6A 3CJIC 3THTA 4Q0SA 4YGCA 2BBVA 5IK8A 2TNFA 2XQRA 5DG2A 2DWRA 3SEPA 4DUZB 2JDUA 2ZDIA 1ENRA 1JUIA 1ZNPA 1DTOA 2M6YA 4HMZA 4UVAA 3AJYA 1VF5B 4FXGB
chains in the Genus database with same CATH topology
4LBKA 3JB4C 4YZ3A 3OBTA 4QQPA 5JOXA 1RITA 2PA7A 5CVRA 1SCSA 3QLQA 3HN1A 4B8EA 1AXYA 3MIHA 1LENA 4L2NA 4C91A 4GH4A 5EWSA 2BYVE 5GLVA 4Z82A 3O5SA 3WCSA 3SCGA 4XJAA 3N3HA 1G9BA 2DURA 2WLPA 2XJTA 1N3OA 2HEVF 4RHV3 1UIJA 2Q1MA 2BVVA 5L7OA 2HEWF 4QGNA 5F5QA 1BJQA 1NE6A 4A7YA 3ES1A 1DS1A 1VBD1 1YNAA 2E53A 1H30A 3I59A 1LTEA 1Q8PA 4FPYA 4M3CE 5H9QA 5ACA2 5CFCB 3PMEA 4AFCA 1APNA 3VBFC 2VY0A 2K9ZA 4ASLA 1UL9A 2NPIA 4ATEA 3VKOA 4M27A 4OHZA 3WDYA 2GMMA 3U07A 4LO5B 2JG8B 4BLJA 3V65A 2MPFA 3DKWA 3VL8A 2WQZC 4AHXA 5A32A 1OIKA 2BVBA 3B02A 4L97A 5DZEA 5LK5A 1GZWB 2Q0AA 4LO8A 1D2QA 3WNXA 3IPVA 1KRIA 3CLPA 4AVBA 2ZGSA 4BHPA 4O9EA 2WBQA 2JG9C 1QJY1 4FFAA 4YARA 1C8M3 4D3WA 4PDWB 3PHMA 4QD2A 1UPIA 4XMAA 4IV1A 4YW1A 1PGL1 5HXVA 4XFBA 1ENSA 1CAVA 4WVZA 4MZUA 1UKGA 1C1FA 1ZM1A 5JCTA 3BODA 1S0IA 1BQPA 1DYKA 1YYNA 3FBYA 4QGLA 4AK3A 1PIV1 4YSFA 3ZSMA 1PO12 1H8TB 1PK6B 1FPN3 1AL0G 2WZR3 2WNUB 4NE0A 4YNIA 4AI0A 1KDMA 3WQ1A 1V9U2 5L7OC 3KGZA 4LA3A 1ASJ2 1AL23 1HXS2 4RGGA 3VBSB 5T52A 4DS0A 1CAUB 1QJX2 5I93A 4DB5A 4PIZA 4LBQA 1ZRDA 5FLIA 2ZX3A 4KBBA 3ZFEA 4LBQD 4Z07A 1KJLA 1FMD2 3JU9A 2RJLA 5CA6A 5C6CA 3H3UA 5JI7A 4AEDB 3HMYA 1O91A 4CP1A 1D0GA 5EJ3A 1D4M3 1M06G 1BYHA 1UN1A 4XEZA 2RMU3 4A2UA 1HDKA 2DU1A 5GZCA 1NY72 3ELNA 5DUXA 3G6JB 1QDCA 4S2HA 4WM8C 2R6QA 3JBG1 3H3ZA 1Q56A 2DVBA 1S0GA 4BOWA 2GNTA 1NCRA 4AVAA 3PJYA 4GA9A 2ZJCA 5BUVA 3T1MA 2OPKA 2HWB1 2JICA 4CWDA 3KZ4C 4YLZA 4I3PA 3VHPA 1HQWA 5JWPA 4M00A 4N53B 1G7YA 4JDOA 4OULA 3O0WA 4IV1C 3FFZA 4LHLA 4YYOA 1UU4A 1FNZA 1BK1A 3G7DA 3I4IA 3LWCA 4OZXA 3H7YA 4Q4V3 2VVFA 1KD7A 3KT4A 3HD8B 3E5UA 4FPEA 1B09A 3BU7A 3IMNA 3TNPB 3DGTA 5EZWA 4MGYE 1PNFA 1QQP3 3LA3A 4Y1VA 3ZN6B 4AI2A 2O8OA 1AYM3 4KU7A 3MI8A 1AR71 1POV0 2R071 4Q1PA 1TE1B 3WCRA 2ZGMA 4DOUA 3M3EA 3WLUA 3QD6A 2P2KA 4NR1A 5BNNA 2XJVA 2XJUA 1Z7S3 2OG6A 4DRRA 1U5XA 3E97A 2Y0IA 4J5IA 1CAXA 1ND2B 3MLLA 4EV0A 1R1A3 5DDJ3 5AC91 1RUJ2 1GZ9A 2ES3A 3ILFA 3LSDA 1NX8A 3DV8A 4CZSA 2JKBA 1GY9A 4MYEA 4K6BA 5FFOC 2RHPA 3WUCA 2AR6A 4I01A 3R0RA 1W0PA 1OI6A 4Q4Y3 3WINE 3J26N 1F2NA 1DYPA 1GR3A 4AI1A 2QZ3A 4CP0A 5JLVA 1QKQA 4M3CF 2WC2A 1NCRC 1Q8VA 1CPNA 4P9XA 5GLUA 3S30A 3VL9A 4I0BA 3ZIXA 2XUMA 1S2BA 2BPA2 2V5YA 1GVGA 2JG8A 1W6MB 2BWAA 1N1SA 5I0TA 4XTMA 4CP2A 1H4GA 3JCIA 3J8F3 3O14A 1ENXA 3AP7A 1RMU1 2GC2A 1H1MA 1GZWA 1MZ5A 4IV3C 1S0JA 1YHFA 5FO8B 1LEDA 2QE3A 5IT6A