3KCXA

Factor inhibiting hif-1 alpha in complex with clioquinol
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human FIH-1 in complex with quinol family inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 102
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3kcxA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kcxA01
3KCYA 2XUMA 1MZEA 4Z2WA 1IZ3A 1MZFA 2CGNA 4B7EA 1H2MA 3P3NA 3D8CA 4BIOA 1H2NA 4B7KA 5JWPA 2WA3A 4QU2A 4JAAA 3P3PA 2YC0A 2WA4A 4Z1VA 4NR1A 2ILMA 3OD4A 2YDEA 2Y0IA 1YCIA 3KCXA 1H2LA 2CGOA 4AI8A 2W0XA 1H2KA
chains in the Genus database with same CATH superfamily
1C57A 3KGZA 4V2WA 4J11A 1MZ5A 5JH7B 2P6JA 3ZFGC 1ZZBA 3CRQA 1GZ9A 1W06A 2FDGA 5IAXA 5JPMB 1ND3B 1SG3A 2PYTA 4PBPA 1WBLA 3URFA 5GALA 4DEQA 1EPWA 1VBA2 3MPPG 4AI3A 5HPOA 3K3OA 4HVOA 1GN4A 5KX5B 4R9BA 1YFYA 5CBLA 4IEPA 5F39A 3OGGA 4D3WA 5GLVA 3W7SA 4L0PA 2GNBA 3OOXA 4PF5A 1WMFA 3LB9A 1OCRC 5A33B 2DURA 3VBOC 2JEMA 1WP7A 1IXMA 3T0DA 2V4VA 3NJXA 2W2IA 3POYA 4FFFA 2CHHA 4D94A 2OT5A 1X4TA 1PD3A 1RUE2 2Y48A 1PMHX 2Y38A 4QPIA 3ETQA 2YU2A 3RSJA 4NIAA 4JI3B 2HWC3 3ZRVA 3M3IA 3GF6A 2IW5A 1OH4A 5K0UC 5K8SA 4JTAB 3CB2A 2RDNA 2Q5TA 4K7JA 3V64A 3NMBA 3CEWA 1H6XA 5F5QA 4S2HA 4CCOA 1YO8A 4MADA 1AJPA 1Q8PA 3O65A 3E5QA 4OUMA 4O61A 3POBA 1B35C 5BPXA 2WYFA 1O5LA 1UMHA 3WEZA 2OQ7A 5D1IA 3M70A 2BDRA 4AEDB 3K08A 2CDPA 4LF9B 4XURA 3FAVB 3B5LB 2OUJA 5IFTA 2RJZA 2PXJA 2ZINA 5T5JA 1NA1A 5EZWA 5IFPA 4N43B 4BYYA 1UOGA 4GIQA 2MW2B 3LEKA 4LQRA 5C8CC 4FLUA 2V4AA 3ZHQA 2YEVA 5F8PA 3H1JH 5FP8A 3ZS8C 3W5NA 3SC7X 2D5FA 4P9LA 5EYXA 2TBVA 3RG0A 1ENRA 2Q73A 1VMGA 4PI2A 3CEIA 2B1GA 4OXSA 1DTOA 4HSJA 3W20A 3O1SA 4AHZA 3GZEA 4CCLA 1RUI2 4RGAA 3O1TA 1YJ9V 4YHHB 1SRYA 5A7OA 1RGSA 4AVBA 4O4JB 4D0QA 3N7KA 4ICGA 1AR82 4B08A 5JCOA 4DRXB 4TTGA 1BQ0A 5BNPA 1NCRC 2KSDA 4O7XA 5KUKA 1RHI2 5LA1A 2PQQA 3CZUA 4IEZA 3ETDA 1GWLA 5JMCA 4JHZA 3WUCA 4MS2A 4DV3B 4IEVA 2WBKA 4X62B 4YW7A 1AJKA 3UT5A 3DYMA 5CN0A 2DOSA 5JVDB 3T2OA 4XF3A 1LOFC 3GCWA 1VQ9V 4QWNA 4BQWA 1F7YA 4LR4A 1FMD3 4F6RB 1K4CC 3I4IA 1RJ8A 3ILFA 1CEZA 4P08A 1GK9A 4YJ3A 1EZVH 5K0UA 3S5QA 5FY5A 4AF9A 2EALA 4BLJA 4JKKA 1BJQA 1QJY1 3TWIA 3UKNA 4QPGC 4CEWA 1SBDA 3B8NA 2WLIA 4YSFA 1HQLA 2JRIA 4COWA 4NIDA 1XYOA 4CDQB 1DDLA 1SZBA 2PQSA 5B3SB 1B3QA 4I3GA 2RR12 4CEWB 5CB7A 3UCSC 3ZKYA 4UFLA 2WLIB 4EWEA 1N33B 5L19A 2XJPA 1W6NB 3ILNA 3LA3A 2IXJA 3AG3C 4MYEA 2NMNA 2VY0A 1R093 5IYDO 1GNYA 3KCXA 5FYMA 5K9YA 1H9WA 4J7ZA 4O4HA 5J48A 3LDEA 2XHBA 3VUOA 3JUUA 2ZKOA 2P2KA 3RYPA 1S76D 2ZGNA 1QQP3 5L3CA 3HN3A 1U12A 3BAAA 4CH5A 2QQIA 4IGPA 3WG2A 3ZMVA 4CU6A 3RYHA 1RUF3 3K59A 4OHXA 3N9NA 5EZYB 5DAVA 4CEYA 2ATKC 4TWKA 3VOUA 1YFWA 4A7ZA 3K03A 1SPPA 4GCZA 4OQ9A 1KQSU 5FXVA 1H8TC 2JJ2G 1HP8A 1BS3A 3GXUA 2X7RB 2E53A 4CEYB 3BYWA 4LF4B 2XJRA 4LKSA 2WZPP 4B7EA 4CRQA 1ND2B 2NQYA 2JKBA 4XFCA 3PUSA 1D5NA 1GAXA 2JJ1G 4BK4A 3JD71 5K7PA 3WG1A 1ENVA 5ISLA 2JIJA 1O59A 4HSLA 5CBHA 1LHWA 2H8PC 1EY2A 2WFF1 3VD7A 1OQEA 4O4LA 5FYCA 4DR3O 3KS7A 4BDVB 3VBFB 4AEDC 1VF6C 1G6NA 3BB6A 2DWDC 3T2QA 4MVRA 4I09A 5GZDA 3KCCA 2WIIB 4XF4A 3UO3A 3L2HA 5J37A 3ZJZA 1XNQB 5F6LB 1CX1A 4YPJA 1QLNA 5FNVA 1XB9A 1IVSA 2RDRA 1ULFA 3E86A 3KSCA 5A6YA 4FLXA 2L9LA 2AR6A 5FNVB 3RW0A 3MFAA 1I6XA 3CMAV 1XHZA 2FDFA 2ZMNA 2A3WA 1O8PA 1Q3EA 4KFMA 2IJIA 3GYDA 1UD1A 2QJVA 5GJ6A 3QTCA 5E88A 3B69A 3VBOA 2QR4A 3LSEA 3AP7A 2IXKA 2FTKA 4CUBA 2VZ1A 3ZYJB 1REEA 5B4XA 2QM4A 1TQ5A 1VRBA 3LDRA 2NLJC 1OCCC 4CH6A 1UPIA 4EZ4A 3FLPA 1QNMA 1LGNA 5BUVA 2QQLA 3BTXA 2QSAA 4DR1B 3PVOA 5DZFA 4FIPC 4GULA 1J3RA 2CUGA 3UK9A 2A1XA 3OMAB 2WQ8A 3LSDA 4YZ5A 2Z3YA 1J5EB 4HANA 4UYBA 4X6RB 2PTMA 4LFBO 4ASUG 4CDUA 2P22C 2ET7A 3S7EA 2C1FA 1DF0A 1FOD3 1W6QA 4FPJA 5FOBB 5F37A 2ZACA 2D7FA 1HR0B 4JI6O 1R6TA 5FZ8A 4HVRA 2I74A 4N43C 4IV1A 3ZFEA 1QJU3 1WPBA 5G05L 4FPKA 5B1BB 5CVRA 2QTOA 4FSJA 1XEQA 1JOBA 4DR4B 3QO5A 3ZFEB 3MD0A 1QCEA 2O0OA 4E2LA 5KA6A 1TNFA 2VW1A 3PNAA 4PA9A 5CG8A 5FBZA 5IATA 4DO0A 2A79B 1WA4A 2RS33 3RWKX 3VQXA 1XNRB 1FD9A 2Q8OA 4J7JA 4IEXA 3JQWA 2BW8A 3ZMZA 4AW7A 1LECA 2CWSA 3GHNA 5I0TA 3LOIA 2WN2A 3JD2A 1K73W 3M8LA 2PHUA 2GP3A 3VZJA 4C7UA 3J8F2 3JB8A 3O1OA 1LULA 5L3BA 1KP2A 4MO3M 1FPN2 2PMWB 5EWSA 4B4RA 2B9UA 1UIKA 1C8NA 2VMCA 2CH7A 4LT5A 3AMHA 3ZPOA 3DTUB 4LKFA 3ZN6A 5FO8B 5FXXA 4NR1A 3LNMB 2WZEA 3FUQA 3NV4A 2DVBA 4N53A 1AUYA 1VBA1 3OY8A 2D5HA 4ZY9A 5J7MA 4K3AA 4DR6O 1YSCA 4MGZE 5JIUA 3IC7A 5D5QA 3ZN6B 2A70A 3K04A 1XHXA 2FZ2A 2P06A 5I93A 5IK8A 3WDXA 5FV3A 3MIBA 2WNEA 2D3OW 1XJAA 4PQ9A 1V6IA 4CEWC 5H5NA 2W1SA 4DFSA 3KQRA 2NLRA 1KD7A 4JZGA 2DVDA 2UU9B 5CEHA 1IQDC 4TXWA 4FQ4A 4HNAA 3S3WA 4LFCO 1A8DA 1NU1H 1RUI3 4JYBA 1PKXA 1G86A 2GC1A 4CBCA 5FYVA 1VMJA 1GO3F 5LMNB 2QWPB 3VGIA 3TJTA 3INAA 2RS31 4BQ2A 4FPHA 4Y1XA 4OX9O 3WFVA 2LGQA 2JVDA 1AYM3 1I9RA 4UB8Z 1SACA 2UWAA 2RJ2A 4MTGA 3FL7A 3JBG2 4NMIA 1X82A 1XU2A 4OHZA 4KBZA 3UQ8A 4MVZA 5BXXA 3HBKA 4URTA 4P00B 4WFGA 1GN6A 3ZYHA 1R3LC 4PIYA 5DECA 4BW5A 3H42B 2YU1A 4JYAB 3THCA 2A6VA 3IN9A 4A5UB 2EXKA 4RGGA 1AVMA 2JXAA 2Q5ZA 3K4AA 1SLCA 5CA6A 3KZIZ 2JICA 2LW8A 5G04L 2X5IA 5GLWA 4HPKA 1GZWB 4JI5B 1CESA 5HV4A 2WNUB 2CAUA 1QR8A 3KKYA 3K0GA 2EX3A 3MW4A 5J2TB 2XHNA 1H1AA 2DYRB 1OCCB 1QJFA 4D8MA 5BR8O 2BERA 5ABJB 2WNUA 3N35A 4YY3B 1XI1A 5LASA 1BVP1 2VNVA 2R071 1VBE3 1LGBA 4FAHA 2JX9A 1C1LA 3LAGA 3VKFC 4ZZ5A 1MR5A 5FZ4A 1AI7A 1ZZ7A 1O7FA 5FMOL 4BWOA 5A6ZA 1FI2A 2WC2A 4ZKIA 3JAWB 4LF8O 3ZFFB 1NCQB 3V0BA 2XAHA 4AXOA 1DQ6A 1CAUB 2XBO1 4WM8A 1VBE2 1I5YA 3NNLA 4ZONA 4IGQA 4Y22A 4X64O 1XE0A 4NXNB 1TME3 2WSSG 4CXWA 4NHYA 2YBPA 2DFCA 3NNJA 3ASNC 4Y22B 3UJQA 3G6JB 1LR1A 1SCSA 3AFKA 4E4DX 5EP9A 3J7HA 3RWRD 2Y0PA 1MA1A 2E32A 4ZPIA 4AE2A 2VVFA 2WFPA 5LP6A 5DAWA 3T4ZA 2J42A 2ZE6A 2AHYA 2DCKA 3SH3A 4UFZA 3B3QE 4PELA 4FLTA 3ZSMA 5ACA3 4D6TH 4JQRA 4RD7A 4BMEA 2D6LX 1ZX3A 5I8SA 2BBVA 3WF4A 4OVEA 4IEYA 2ZDIC 5JMOA 1VEWA 4K8ZA 1ZSPA 3JALA 1PZ9A 3BODA 1W0NA 2Q30A 1F5FA 3ZN5A 2H6BA 2YPJA 4OI2A 1SQVH 3P32A 5F5IA 5DABA 1H1MA 4HKOA 3JALB 3R66A 5F2SA 1AZDA 3IBMA 3VBRB 2K46A 5FK8A 4P9XA 1WMDA 1YZBA 1GFF2 1HX6A 1L7RA 4COYA 4CDUC 3GBFA 2CY6A 3R4UA 2BQPA 1AB3A 4FFBB 1GUIA 4QKDA 3CCUV 2W08A 2D44A 3LQCA 4JYYA 2UUBB 1OA2A 2HVKC 2B5UA 1W99A 3ICXA 3RYIB 1AR73 4H33A 1ODMA 2WLHA 4NOTA 5GZCA 5KLVH 1UX7A 3A21A 1GYKA 2Q69A 2JIZG 4UBHA 1BBT3 2P37A 2VD7A 2WNVB 3ZR5A 3WSOA 5BZBA 4LHLA 1FYUA 2HYXA 1WMEA 4TUYA 5LOVA 3WNPA 1HN0A 1EAH2 4JTDB 4LF7O 4K35A 1MZ6A 4LBNA 2ITCC 4DXTA 3FX3A 4M0HA 4BLIA 3ZXJA 4R9DA 5CZKA 3KM5A 2XT9A 4LF6O 3K3WA 4WVZA 2EJRA 1DK1A 1JX9A 1LR5A 4FPOB 1JOPA 1U5XA 1UQXA 3ZXEA 1ENXA 4KG8A 5C3RA 1W8WA 4XF1A 1Q8IA 2WPDG 1ROPA 4UVBA 2Y6KA 4J1XA 2KB1A 1F31A 1RHI1 5FZFA 4N9IA 4SLIA 1B6QA 4DR7O 4NN0A 2WNOA 1U0AA 1XNQO 3VDBA 3ZYFA 4ZXKA 4ES9A 2H94A 4CH3A 1OOPA 1AYN2 1TMF1 3T4DA 1RUE3 2K2SA 1YQ8A 3AG1B 4INDA 3G80A 3T2PA 1X50A 1R1A1 4NJ4A 3WUDA 5FDBA 1F23A 3J8F1 4EQVA 5DXDA 1YQ5A 4LBEC 1VQMV 3U10A 5C9AA 4DR1O 2CU5A 4NUBA 1N36O 1POV0 3VHPA 3L9JT 2OPKA 1Y76B 2NR5A 2JE7A 2YBKA 3WB1A 4NRQA 3E22B 4RAIA 5DUUA 3QBQA 1YNAA 4CCMA 2OVUA 1Y76A 2VULA 2B42B 2WSVA 3S7IA 4ABMA 2E5LB 2X05A 4WF9V 4Q8KA 3HBZA 1SLTA 4K40A 1W6PA 4QXCA 3WNMA 2V72A 5ANNA 3IIAA 4FOWA 5FZDA 1UYPA 1VBD3 4DV5O 4Q4W3 4GH4C 3T4HB 1FS0G 3EB7A 4NXMB 3QG5A 1XMQO 2RMU3 3BFRA 5IJRA 4QPIC 1AI5A 1W04A 3AJYA 1SQBH 3CS5A 5KXDA 1FOD1 3BOWA 2FB5A 2F17A 1R1A2 3VZLA 3FB8C 2YXHA 1TZOA 3IJ4A 1SFNA 4X89A 1RMU1 4IUGA 3UV9A 1UPGA 5DN6G 2Q4SA 2Q67A 5FZOB 3POWA 1M57B 4QE9A 2A3XA 4DR2B 2XWBB 1V6LA 1H9PA 4OI1A 4RR3C 1KECA 3NL1A 5A7SA 4QGMA 1OD5A 5KAIZ 4FM0A 3AMMA 1HRV3 1LEDA 3OGVA 2JDYA 1MACA 1W2UA 1NY72 2HLDG 3NRUA 1FYJA 1XBFA 3GBWA 4NIGA 2D43A 1MOFA 2QZ3A 1ULCA 2ZX2A 1SKVA 4WBBA 4WZFA 5J1XA 1NLRA 2R16A 3PURA 4AVSA 5C93A 3USSA 4UCUA 4I50A 4P9YA 5H9QA 4M3CB 3WHTA 2BTQB 1LENA 4TT3G 4UCRA 2KXLA 4Z1MG 2C6SA 4LO6B 5GONB 4NROA 4DUYO 1W0OA 1BMV1 1NE6A 1UKRA 3I2DA 4RL7A 2UURA 4QIWF 5JH7A 4ZBMA 4I0XA 2R30A 1RHI3 1OA3A 2FL4A 4D7YA 3TXSA 1DGWA 3CJHB 3I2JA 3V0AA 1QDCA 5L36A 1NLSA 1U5YA 4XIKA 3PJSK 2MHFA 1QHTA 5LP6C 2WZR2 4GMP3 4XAEA 4UUJC 2ITDC 4EEQA 4LXLA 3BI3A 5DUVA 4UBGA 2H3OA 3WHUA 3JAKA 2OZ6A 1ZREA 5IHRA 1FKAO 5AFEA 3ALQA 3JD73 3R65A 2CL2A 3IM0A 1JXNA 1DQ1A 3DYOA 1NTKH 1EV13 3EO6A 4EN6B 4YW1A 5DEDA 4GKJO 4NAOA 2ORXA 1Y9QA 4QPIB 2WZR3 1TGOA 1COV1 5CFDB 4C0BA 5IK7A 1C28A 2SBAA 2P3KA 2V09A 3CCVV 1OHFA 2R49A 3E35A 1WWYA 5LW9A 4YM0A 4QDRA 4DR3B 1QGLA 2YYOA 1OSGA 4IERA 1XBLA 3CCQV 3JD4A 1XNBA 1I7FA 4B3TO 4YJ2A 3DYPA 4MTXA 5HCBA 1UYXA 5C8CB 5IVYA 4ZXEA 4GD4A 4LUKA 4COUA 1CJDA 4EN9B 3QO8A 4MGQA 1HRI3 3GZUC 5GZFA 3WR0A 4KG0A 3W7WA 3PUQA 2F4LA 3HN1A 4FTBA 1HWYA 2FMYA 4QU1A 1RSOB 5JXHA 4QQHA 5DDJ1 2P3JA 3OR6C 1OLRA 1Q8QA 4WBNA 3T1LA 4L97A 5LCWL 4LF5O 2X10A 3CLPA 2EAKA 4XTMA 1DLLA 2YEVB 2XPJA 5IYBO 2ARHA 1M1KW 2WAMA 4OUSA 2OUHA 1JUHA 2R32A 1FNZA 1RSOA 3A7QA 4PDWA 2ADPA 1D4M1 5IW0A 3WD5A 1W3XA 2E26A 1TUBB 3SMHA 1FOD2 4B4PA 2WLMA 4MGYE 4LBOA 2W46A 4LNUB 5FZ3A 3GHMA 3O1MA 4AHXA 4F83A 4TQDA 1O3TA 5FL7G 4LEJA 2ZGLA 1S0IA 4HL0A 4XPVA 4A45A 2YIAA 4FAGA 4RQEA 3TB0A 4PJYA 1OKOA 2KA3A 1P7GA 4UFKA 4QJFB 2VOTA 4MVOA 5H9CA 2PYLA 3ZYGA 3AYEA 5BMVB 4X1IB 1BKZA 2D3SA 4OMCA 3L74H 5E1RA 4HONA 3OAAG 4XHXA 3AMNA 1VF6A 3WT3A 3ZXDA 4Y1UA 2PHDA 5JOYA 2OCCC 2VOWA 4LBJA 4CDQC 3AZYA 4LPLA 2VMGA 3HOBA 2Y6HA 4UW4A 5DAXA 1BVVA 1ZZ9A 2IJHA 4IETA 4Z1VA 4UXAA 5JOWA 3RYFB 4K20A 1DF5A 5FZLA 4BW9A 3VD4A 1QWRA 1SQ4A 1P8JA 1HNZO 3AZWA 4FI9A 1S5LZ 5A7QA 4DV0O 4MVSA 3RYFA 3KG2A 2WSUA 2RS32 4O65A 1UY1A 2WRAA 2ZR2A 4QPJA 1CONA 1IPKA 3F95A 2YGMA 4BU2A 4YARA 3OBRA 1PL0A 1N0NA 1SLIA 3K77A 2RMU1 1F9KA 2QDRA 5FXZA 3CCLV 4QPWA 3H3ZA 4WV8A 3EFFK 3B93A 3RJ2X 2UU9O 2HWC2 3K5LA 3ZYIB 3ZIWA 4G2KA 1MSWD 3AX4A 3UKVA 2PHWA 1HNWB 4R8CA 4DV0B 5DAQA 1PGSA 3W7TA 1Q43A 5H6RA 2Y0OA 3E97A 1NUKA 2SLIA 1D0GA 1UOBA 3R6SA 4RO2A 2ZX3A 5B1AB 3SLIA 1IOAA 1JHJA 4X1KB 1LHOA 5FR3A 3VLBB 1Y67A 4NKGB 2XL7A 3CKHA 3OJBA 1YF2A 2MEV3 4BE3A 5DQ0A 4K9SA 1W3VA 4ZOLB 1SETA 4IT5A 4Y26A 4W4LA 4MHUA 2CGOA 2KD7A 2UUCB 2O8OA 3NO8A 1UWWA 5B1BC 2OTLV 3A0BZ 1FT9A 4GZRB 4CYDA 4MUVA 2GH2A 4I55A 1RUH2 4ZZ8A 4YVWC 2ODMA 3AKRA 1I94O 5FXWA 4TV9A 1MS3A 4DV6B 3VBSC 4RGKA 4A3XA 2HH9A 2HWB3 1VLNA 1NG0A 1WW5A 4QHOA 3EXAA 1L1FA 3CXCU 5DG1A 3T1YO 4CZSA 2OKXA 3JBG3 5BNOC 1PM7A 3JD3A 1VB4A 1MZFA 1LOEA 2RHPA 5CBGA 5C8YB 4LO8A 4AVAA 3D5OA 2ZD9A 5B5EZ 2R0FA 2XAQA 1PIV3 1XE8A 1AX2A 2DTYA 3VZMA 4DPNA 3ZIXA 1Q56A 4N53C 1HKDA 4Q4Y1 2RM22 2EINC 2GDSA 4AR2A 2LUWA 3VBOB 5LA6A 2P6HA 1Z5WA 3FKSG 4AQYO 3VBUC 1XNAA 3SPJA 4S2GA 1A32A 1VF5B 1N1SA 4HK9A 2A6WA 3UKTA 3JXSA 4GALA 1FFTB 4DQAA 4CPBA 2ZQMA 3IMNA 4Y5SA 2R9IA 1LKNA 2BOIA 3OFNG 1D4M3 2DYRC 2QQVA 1H6YA 1YQ6A 2FD8A 5CB4B 3E1F1 3S57A 2EIKC 1URXA 1YUDA 1J1TA 4LITA 4YFWA 2FZ1A 1W6QB 3DXTA 4OYUA 5D8AA 3GVMA 2UU8A 1O6UA 3CCSV 3MZHA 3IMMA 3L2YA 3EHBB 4XF9A 3O1UA 5GZGA 4ZHNA 2CAZC 2VUCA 2JDKA 2A7WA 5FYSA 2BUKA 3I97A 4Z2WA 4XUOA 5FREA 1OV9A 5D8AB 4Y20A 5FP7A 2A73B 3HPLC 5JI9A 1D4M2 2ZHKA 1GQGA 1VQNV 2NYYA 5EQUA 4TWTA 2BWAA 3K4DA 2IU0A 3J7AU 2OA2A 3LEIA 4NTWA 3O12A 2FCTA 1UW8A 2Y6FA 3ATGA 2FKXA 3CHXA 3MPBA 5H6QA 2LALA 3LSUA 5JCOC 2W39A 3JCZA 5JJNB 4AGGA 2GNDA 3HB3B 4I4TA 1ASJ1 4U2AA 2PY5A 5C3QA 1HJGA 3VDDC 2EIMC 4V1PA 3AL6A 1BHBA 1OA4A 4CA9A 1C4RA 2UXCO 3ZXLA 3TOJA 3N7MA 2YUEA 3HIFA 3SYCA 5FJHA 3LD8A 1VQ4V 1M90W 4UXNA 1QU7A 4N53B 3OY8B 4GT1A 4I3PA 2QDNA 3IFXA 4GJZA 3VV1A 2GMEA 1QNYA 5KHKA 4OHWA 1WN7A 3TK1A 1XU1A 3ZIAG 4LHNA 5HCAA 5J98B 2EIJB 2QQJA 3C7EA 3SYAA 4YM2A 1XOUA 2HWF3 5BNNC 2XDVA 1NTMH 3OR7C 5H2FZ 2QKDA 2YFUA 3TYJA 3RVYA 1ASJ3 1T6GC 1AJOA 1JFFA 5B1NA 2YROA 1XYNA 3GB7C 1X36A 3K4ZA 1HB3A 3AKPA 1VJ2A 1C8M2 5EC2C 3BTAA 3NKTA 1DQ4A 4BXFA 4A4AA 2Q7EA 4RSUA 2QQUA 3MF9A 2ZGSA 1CAVB 2K9ZA 4FCAA 2HVJC 1AROP 4D7SA 4NRPA 1BCCH 2HHHB 4XDOA 3BPSA 4BIFA 1QOOA 1Q8SA 2ZX1A 5HXVA 4YVSB 2VTXA 3H1HH 3AMPA 4PF1A 2B39A 3Q8EA 3RI9A 4JI2B 3Q9OA 1IURA 3CP1A 3HPNA 4RFRB 5JPNB 4B29A 2BRTA 2GP5A 2R062 4UV8A 5KHGA 4MSVA 1H38A 4C91A 5KBFA 1N4CA 1GN2A 3OUJA 3NNGA 2ZXWB 1D2QA 2X5IB 4QX0A 1V9U1 4BM8A 1OLMA 3ZXFA 4RR3A 1PO23 2XXZA 3H01A 3AZXA 1HQNA 2GDFA 2W9XA 1MVEA 1WW4A 1R083 3ML0A 1QLEC 5DUXA 4HN1A 1Q82W 2UXBO 3HKDB 5FY7A 4HETA 3AVRA 3AK3A 4KWLA 1X9PA 1J83A 5KMGA 4QXKA 2DBIA 1NY71 5FY8A 3ZSKA 2IC1A 1P49A 3GDBA 2EIKB 3EVKA 2WWWA 3KZ4C 5A1LA 2GC2A 3JD0A 3H8OA 5L3FA 4CS4A 1K92A 2P17A 2YY1A 1MS8A 2AEYA 3U14A 1RMU2 2C9AA 2E74B 4HOOA 3D36C 2XLGA 1GM8A 2JDHA 1WB8A 4FZ1A 2JJ6A 5GTHZ 1JOJA 3VB9A 3B7MA 2FMLA 5CMUA 2HWD2 4P30A 4IE6A 4J9ZB 3PIJA 1O9GA 4LCUC 3LA2A 3TEZA 5D5PA 2IU3A 3B9IA 5CFCA 5LGNA 1GTOA 2P90A 5LRRA 3K51A 3QOPA 4IE4A 5F9TA 1WB7A 3NNMA 1SZXA 1UZZA 4FVVA 1VQ6V 4A7YA 4O9EA 2BE3A 1VBB1 4XTPA 2VCAA 3KCYA 2XKOA 2VWJA 3PJQA 4GKXA 4XUQA 3BTZA 1YIPA 3T1HB 2BCCH 1OF3A 2RDSA 4QM9A 1V9U2 1U5IA 3AK0A 4EROA 4JI0O 5JI7A 3VBUB 5SV8A 1Z2GA 2GSYA 4GQ7A 1DYPA 5FZ9A 1QOTA 4NWWA 1OUXA 5T50A 5FLHA 4IXLA 4GH4B 1LNSA 4CDWB 1AR81 3VBUA 3I55V 3ZKUA 1HW7A 4TZDA 1FFXB 4BHPA 1THZA 3AG1C 1PNGA 3HJRA 4XMIA 2IUWA 3N36A 5AC93 3PVBB 5FY4A 5A6QA 2Y4UA 4ZIBA 3DV8A 4KP4A 4EV0A 1YHFA 3LCPA 3TGUH 1EBOA 1MEC2 2ZA9A 4R6ZA 1Q86W 3U11A 1IDSA 5FWEA 2DU1A 1AYM2 3X2QB 3S5AA 4UF0A 4Y3OA 1N34O 4M01A 4OUEA 2RQ6A 5DZGA 4YY3O 1UYYA 3FB6C 2O8QA 3HR0A 4TQFA 4UWDA 4UOJA 3IB3A 3JD72 3JSNA 1NT2B 3C7GA 5EBMC 2QZ2A 3WB2A 2KG7A 4OZXA 2GTAA 3E6CC 3BUCA 3VZKA 5F3EA 1NAEA 4FM2A 1A3KA 3RJRA 4DRXA 3WY6A 1B04A 1CZTA 5LMUB 1UIJA 2W68A 2F4VO 4XYXA 1YRZA 4MZUA 1ZRFA 2IXLA 2EIEA 5C70A 4FPEA 4QB6A 3UT5B 1J1LA 4FPGA 5F3CA 2VBDA 4IL7A 4KH9A 3E6DA 1OCOC 1AR92 3PVNA 3WXPA 2D98A 4LLOA 1F4HA 1DGSA 4XMAA 2WLNA 2RS52 4YG3A 1AYN1 1TMF2 3SJBC 2F93B 4DXRA 1XDCA 4YJ3B 1WLTA 3VD3A 2VMDA 1GBGA 4GWMA 5BYNA 3DKQA 1J59A 3NKGA 5LA9A 3DGEA 3MIGA 4B4QA 4FBFA 1N32B 1OCZC 1VARA 4FFKA 1VALA 3AG7A 4XE9A 1OOPB 1SC5B 2I45A 4ZI7B 2EILC 4QHBA 3EJKA 4EE2A 2WLJA 5FPUA 3RZJA 1WW7A 4LIVA 1HW5A 3WVJA 1YHQV 4O4IB 3AFGA 4RN5A 1S0FA 3P30A 4DK0A 1ULEA 3B09A 4FO9A 4CVUA 2DV9A 4L9BA 4TV8A 1EAH1 4Y4YA 5FMCA 5A1AA 2ZE5A 2ZHMA 2GBOA 4N7IA 2O57A 4MGSA 3ASOC 3W59A 5SV5A 3MLJA 3QH7A 4AFCA 1ULDA 4JDMA 3OYWA 2ZHNA 2GH8A 1HXS3 3T0BA 4RHV2 1IG0A 1KD1W 1JTZX 2QA4V 1GZCA 3WF3A 3OCPA 1V6JA 4A2UA 3OBTA 4XUTA 4B3RO 5BV6A 2VMEA 5EV7A 4L2NA 3HVDA 3T4VA 3J80N 2FHRA 2Y34A 1K3EA 4RQPB 2ARCA 2BP6A 3GALA 1VIWB 3RYHB 1VRH3 4KWUA 5HI0A 5EZYA 1ZL8B 4RQFA 1CPMA 3E8GA 2UXCB 4M0NA 1WAZA 3H7YA 2YIDA 1C8M1 2VQFB 4JGYC 4RQPA 1P7BA 1AJQA 4JYCA 4LH7A 4PA6A 3H1YA 3D6EA 2ORZA 4CU9A 1PO21 1PGL1 4J80A 2C0ZA 2RM21 2X6BA 3ZSEA 2Q9LA 2EZPA 3LDBA 3OGRA 4AFBA 4L87A 2VM9A 1RUC1 1BBT1 4BQ4A 3MUZ1 1BEV1 3ZR6A 2P3IA 3Q8AA 1CZVA 4FJCC 3WQ0A 3NJYA 4W6WA 2RS51 3PTYA 2VW0A 2QTWB 2V73A 5FZ0A 5CFDC 4J25A 2GMMA 3ZFFC 1AILA 2DW4A 3ZX6A 2JIGA 3WZ1A 2WAAA 2WQ4A 5TSWA 3EQEA 4FLVA 2Y6GA 2ZEXA 2Z42A 1LU2A 5C71A 1BZWA 1XMOB 2DQ3A 2D6PA 1BGYH 4FOYA 3K5OA 3DGTA 3G67A 1MG1A 1RM1C 3ACIA 1Y9MA 2PLV1 1W39A 5CNAA 1RIRA 2WLPA 1DQ2A 4OZOA 2P4KA 2HWF1 1KRIA 2AGAA 2DE0X 2LW1A 4WM7B 3LFIA 1OJHA 3JQXA 3T1CA 3D8CA 3ZLIA 1RUJ3 3S30A 3BCWA 5CU1A 2V4DA 3VKOA 1ORQC 3C3VA 2DDUA 5FJKA 1BBT2 2Z79A 3ZHSA 1DU3D 5A32B 4XABA 2BTVC 4BQ5A 1JN2P 4FPPA 4Q1RA 1KGYA 2XOMA 1NI8A 3GZAA 1JQ0A 1UOFA 4CC6A 3CD6V 2R041 5A32A 1AR5A 1LOFA 3TEXA 3MW3A 3KD4A 2W6JG 1G8WA 4RQPC 4C8DA 5FKCA 1CPYA 2XBO2 3OPZA 3THTA 3APQA 4DR4O 3USUA 2JWPA 4LR3A 3KWVA 3QD6A 2C2AA 3AEIA 5FYHA 1NXMA 4Z8BA 2GHYA 3O1RA 5FPXA 4FFIA 4WFHA 2XJSA 1BK0A 4I30A 4QMAA 5ITZA 1KKDA 2A7AA 2E76B 4CDXC 4LC1A 5I0SA 4JI6B 1HR0O 2F4PA 2IXIA 4KI5M 5KHJA 3HD8B 4CSWA 3PUIA 3JASB 1UU4A 1VAVA 5FUPA 2OCCB 5CFDA 4AEMA 2IXCA 2QWRB 3UKMA 5ITZB 3DEMA 4X65B 4CU8A 1MNGA 4CS3A 4AQTA 4EFEA 1W2NA 4RUEA 3JASA 3PIGA 1V6NA 1W6MA 1O4YA 1XPWA 3ZBHA 2X6CA 3ZXKA 4OHVA 2BBAA 3F7VC 4QX2A 4META 2A0LA 2YZ4A 4DXZA 2H0VA 1YIJV 1IS3A 2CK3G 3RFRA 2Y33A 4WVMA 2J1AA 2BZDA 1XC6A 1CAXA 5JCTA 2H0BA 1EN6A 4TSFG 4GB33 5EFUA 3NV1A 2LP7A 3AP9A 1G8MA 1DGRA 4KUMA 1N36B 1FX5A 1DG6A 3CMGA 1BZKA 4WBNB 2A3YA 1OHHG 1H4HA 3T0AA 2Y60A 4QXBA 1KITA 2EJ7A 2YHJA 4TYSA 1KFUL 4Q0UA 3EHKA 2A9HA 1TA8A 2YS8A 2P34A 2VQEB 4IE7A 2DTWA 2EVXA 2XL9A 3SH4A 3EMRA 2HEVF 4K0KB 3WQ1A 5BNOB 3H7JA 3STZC 2UWBA 4Z82A 3SH5A 1NJIW 4G9SB 3IAYA 1OOPC 4K3UA 2LGWA 4LBQB 2A71A 3PL0A 1NKDA 3A23A 1LODA 1S5HC 5JQGA 4TLGA 1XNCA 1R1BA 4UFJA 4A3ZA 1JYTA 2YXYA 1IQAA 4LBQA 2XKPA 1W2AX 1JVMA 4QD2A 3LPGA 4ZS3A 3DPRC 2N7GA 3RQ0A 4BIZA 2ADQB 2R9RB 2J1RA 2DYSB 1W8OA 5I0UA 2HEWF 4FP2A 1CPNA 2VBBA 5JJJB 5E1AC 1VP7A 3THPA 5LK7B 2Q8CA 2WUHA 4JI0B 1NKGA 1POV3 2DUQA 3FB7C 2WT2A 3MDPA 2CDYA 4X66B 3QH6A 4FTEA 2FDHA 1JS9A 4AI1A 3CDZB 1IBMO 4DUYB 1QMJA 4JQTA 1J84A 1BQPA 4MH0E 3BEHA 4MTFA 4XQWA 2OXBA 3WU2Z 5AG2A 1LHVA 5IJ0B 3UYJA 2RR13 1YJNV 3BCCH 4LK6A 2JG9C 3GGLA 3ZDSA 2WFF3 5A3NA 1ENQA 3APBA 3ENRA 1UJWB 5E6HA 4QKBA 4WVWA 3E6BA 3MIDA 3MV11 2ZGTA 5J2UA 4J1WA 3RZGA 1E1RG 1RC6A 1NXD1 1S5JA 4RS5B 2TEPA 1AXKA 1S0CA 2E63A 1JZ4A 4K1YA 2G19A 3IDCB 1GN3A 1WLDA 4BJ0A 4FT8A 4IHJA 4NPRA 3VD9A 2MK3A 2FCVA 3QVNA 3ZVXA 4BA6A 2Q4PA 1YWKA 3OEBA 1N33O 4IQPA 5FMDA 4HN0A 1CVNA 2XB6C 3GM8A 4ZU4A 4X8NA 3A2FA 1WCKA 1IS6A 1UO9A 1DFQA 1VBC3 5HFLA 2B7YA 3OTOO 2MPFA 3ES1A 1ZUQA 5JLVA 3ZFFA 1GH6A 2HJIA 1RPRA 3CBNA 3IDAA 1QQP1 2ZPXA 2QM8A 5FZBA 4BB3A 3WNOA 3ZRXA 4HG6B 2VZSA 2E33A 3O0VA 4PQQA 3V65A 2PI5A 4X1KA 1UFIA 3ZN4A 4OQ8A 4FOQA 2D6NA 1IGOA 1W2OA 2QBXA 1HJFA 3WF0A 1HRI1 4AI2A 3N2GB 1NS1A 1UU6A 3O1PA 3GWKC 2EXJA 2WT1A 3BABA 4EJRA 3DC6A 1JPXA 1K5MC 2BYVE 3LZZA 1QXRA 2ZMKA 2IZWA 2UUAB 4CC5A 3APOA 4N23A 4J9YB 2DYSC 1W6OB 4I55B 2YIBA 4QX1A 1VIBA 2D93A 5B4NA 1QQP2 1Y3TA 3OPTA 4LF8B 2Y0IA 2KM2A 1VPHA 2IM9A 1QY4A 2G9FA 3KMHA 4NHLA 1W6OA 4RHV3 3TCUA 4IYHA 3P6BA 1LOAA 3MLKA 4Y1YA 1CWPA 1EV11 1K5JA 1S0GA 3OTOB 1XQ8A 1ULOA 1NZIA 4OI0A 4AHCA 4I01A 4BOWA 4DO2A 3GBGA 4AVVA 2A6XA 2J22A 5LATA 1X33A 4XDJA 4LIUA 4XBQA 4DR7B 4H13B 3THDA 1SEFA 4DV2O 4EN0A 4FFBA 3JATB 4S2FA 4EFBA 3D4KA 5CKNA 3BGAA 3BVOA 1DZTA 3B4SA 4I2OA 1UZ0A 2GSMB 3VHOA 2XVKA 2EICA 3FHIB 4MVMA 1HN1A 2Q7HA 4LBMA 2QVSB 1HRV1 1PO13 5BNNA 5A3UA 2VCBA 4HFSA 2BEOA 1VB2A 4LKEA 3VQVA 3VDAA 3J7LA 3GNEA 2JE8A 5LRSA 1UZWA 3FE5A 3LKJA 1S72V 4NHKA 2YG0A 2Z4FA 5LOVB 4I7ZB 4PI0A 3Q4HA 1WLWA 2IVIB 5LBQA 4ARXA 2WLLA 5IVEA 4FVMA 1YJLA 4Z92B 2QQNA 5JZGB 2CWMA 5CA0B 3ZFGA 5EBLC 2NM1A 5IAVA 1K5QA 4A42A 1AL0G 1R3JC 3OMNB 3Q4HB 5J09A 3B02A 2VZ3A 2QUOA 1OFSA 1F4AA 3ZRWA 1IG3A 1HRI2 4K0KO 2UUBO 5CA0A 1AL21 4X9QA 2UXDO 2W47A 4YGCA 3MFCA 1CGPA 3T1YB 2D6OX 3Q8CA 3D82A 4CE8A 5T52A 2EIMB 4XFHA 2JECA 3KV5A 3AG2B 4LK7A 3NW4A 4IGOA 3SEEA 4B3NA 4LO4B 2UXDB 4ET7A 4G4FA 3B40A 3CCRV 1BYHA 3OEAA 3KGLA 4JRAA 1NQJA 1US3A 1RUG2 2UXBB 4FMTA 3ACHA 4PCRA 1VF7A 1QLEB 4Q4V1 3D3QA 4L8JA 2X53S 1E5IA 4JKLA 4WM8C 2BSKB 5L7OA 2HBTA 4E8DA 3BALA 4E8CA 3MEPA 5CBFA 3AP6A 4Q4X3 4DEVA 1PZ8A 5C3SA 3ZMOA 1DZRA 3KT4A 5T55A 2R6QA 3I2FA 4H37A 5JR2A 2ZX4A 4AHWA 4N8MA 1QR9A 4JI1B 3SQOA 4WCEV 3WV6A 5KHHA 3AG4C 4GKKB 5A1FA 2O14A 2HR3A 4LA2A 1K5MB 3LDKA 3K57A 1KS5A 2ZEYA 3TN92 4JHTA 3ABKB 4XBFA 1N3PA 1IS5A 1YC61 5C8WA 1YI9A 1JFFB 4DUZB 3QF7A 4FLZA 3ZOIA 1UCXA 1M9NA 1QJX1 2QWOB 3WW4A 2X29A 3Q8BA 5FWJA 1FXKA 2ZDIA 3W5MA 1BMV2 1COWG 3M3EA 2VZTA 5FYTA 3TN93 4E4ZA 4LFCB 2DF7A 1RUG3 4WFEA 4LFBB 5EJ3A 2OQ6A 1OXCA 3UJOA 1NX9A 2IXHA 3IZOA 5FZOA 1UL9A 2RG4A 2YMZA 2H6CA 4UT5A 2EAAA 4CPBD 4KGGA 5LBEA 4QKNA 4JCKA 3CJIA 2TNFA 3RVZA 1BMFG 1US6A 5FZEA 2FDJA 1ZRIA 1YQ2A 1I0HA 2ZM6B 1GU3A 3A0NA 2HKXA 4C90A 3DL3A 4NAMA 2LTNA 1PMJX 4XDKA 3MICA 5EC1C 4PT6A 3FD9A 1V6MA 1I3HA 3JCUZ 1SF9A 1JJOA 3KLSA 4YIOA 3ZXGA 1AXZA 1CR7A 1H30A 4DV3O 1R081 4MVUA 1RUC3 4DK1A 2EBOA 3MYXA 1LOGA 4KWJA 4FLWA 3HKDA 1SFPA 1JZ7A 3RMYA 2VNGA 3MF6A 4JGZB 1COV2 1ND3A 1IXBA 1FNYA 1PM9A 2QEXV 3JD1A 5CYYA 5LMUO 1ZVFA 2DJVA 4AQYB 3N7LA 4YVWA 1AL23 3AC0A 1D4VB 2PLV2 4EWAA 2VUDA 5F3IA 4MXVA 4LE3A 3DF0A 1KDKA 1VBC1 2ZKLA 2GMPA 5F5CA 4F8AA 2XAGA 1JI6A 5AFBA 3MLLA 4XZPA 4YVWB 2VQTA 2WDBA 5CFCB 3N9PA 4BQ3A 4IEWA 3O14A 4BR6A 3HNBM 2QWQB 2E6VA 2GC3A 2W5FA 3NVCA 4ISRA 5EIYB 3AP4A 3M2MA 3K58A 2CNAA 3OEHG 5GTIZ 5C33A 1EAH3 4GX0A 4IL6Z 2LROA 1QXJA 1BLZA 3AZVA 3CCEV 2E7AA 3RI8A 1UZVA 3L71H 1G1XB 4D7TA 1AR62 4ATEA 4CEYC 5HCFA 2ZCWA 1RUC2 1SFYA 3G4SV 2GAUA 1W9YA 4P02B 3BKZA 5KHIA 4AI0A 2PHTA 1H8TA 4AGRA 1OBNA 1Q90D 1R73A 4CDXA 3UO2A 1DIWA 2RMKB 2UY8A 4HKLA 4XJZA 1FFXA 3ZHTA 2A6YA 3WOGA 4XJWA 3VBRC 3BTYA 2VZOA 2RS11 4CP2A 1UNBA 2LJ2A 1JU4A 2VXJA 1AR63 3HQRA 4XEZA 3O0XA 4C0HA 4E2QA 3WQBA 3B9CA 3I59B 4JI4B 4DY3A 4JAVA 1S1AA 2EXHA 5IJ9A 1MS1A 3JARA 1DGWX 5JSPA 4K6BA 4AEDA 1O3RA 4L92A 2JE9A 4MXWA 2NPIA 3MO4A 4NHXA 2XBO3 4LO5B 4Y5TA 1H8HG 2VG9A 1VAKA 4JKMA 3M7AA 4PDWB 5K4LA 4YRDA 4O4JA 4QQPA 2WL1A 3AZZA 4MXWB 4FPLA 2XWJB 2VE1A 3PN1A 4LNUA 2QKAA 1MSDA 5IWAO 5L9VA 3RRDA 3H8UA 1EPZA 2HG5C 3QO7A 1SQQH 4WM7C 1EUTA 5FP3A 4QGNA 1GANA 5F3GA 2D6KA 2P4VA 1PVXA 4XDLA 3LWCA 4E27A 2FBEA 3ZMUA 2Q1ZB 3OG2A 3AVSA 5BMVA 3FMGA 1IBLB 3A0RA 3I8TA 1REDA 3RYCA 4PDRA 4X6QB 2ZOEB 4NIHA 4BXSV 3JCIA 3I2IA 2ZMLA 3BY6A 1N47A 1ZA7A 3FBYA 2NP0A 4XETA 2VBPA 3WNXA 5JVDA 3AYCA 5JR7B 4AEJA 3RYCB 2GUZB 1W05A 3FBMA 2Y69C 3BVCA 4PHZA 4PDLA 4BH9A 3OM3B 4JI7O 4CDQA 1PP9H 1AXYA 3ASOB 2GC0A 2GNTA 3FWEA 1YEWA 5JIAA 5K0UB 1W6NA 3KHBA 1RUH1 4CCNA 1AR91 5LA2A 1EFRG 5EBWC 3OBAA 2PGGA 4Q4Y3 3T1MA 4H3WA 3KHCA 4QB1A 1ZYBA 5LBBA 2HWE2 2VUJA 1I5XA 1OPMA 4O4HB 2CYFA 1UOJA 1QJX2 3SKVA 1W0JG 2PAMA 3D0JA 1EYBA 1B35B 4GMP1 2AZ2A 4DRVA 4LF9O 4CS2A 1JYWA 5AC91 4ATFA 4IEQA 1MVQA 2RN9A 3E5UA 4CUGA 2UUCO 5FPBA 1LOCA 5KXEA 3HEIA 4A6OA 2JG9A 2VOXA 4MOAA 3UETA 2F43G 1Y6XA 1Z0HA 4JV4A 1TE1B 1LCLA 3PU8A 2X6AA 2HBUA 4HYOA 1LU1A 1RUH3 1K8AW 1HLCA 1E1QG 1KJRA 1SPPB 2Z5UA 2LFSA 1POV1 4XAAA 3DSQA 4W8JA 1E79G 3WDYA 1HNXO 1H8EG 2PYJA 1YLLA 3LSQA 4XJ9A 1XQNA 3OEEG 1JMUB 4K21A 2P3YA 5L9RA 4Q4W2 1QQCA 1FATA 3FUOA 3VDCA 2WR9A 4JI3O 1IX9A 1QJU1 2VNRA 3ASIA 4BK5A 1OQ1A 1W8TA 4F6EA 3FC0A 1KMIZ 5JXJA 1DYOA 3BHPA 1G4YB 1VBD1 4ZOLA 2AGSA 2OCHA 1PNLA 1RVF3 4FFHA 3I2KA 3G6BA 4X65O 4U3JA 2P5OA 4OLLA 5A3WA 2G9GA 5EJ1B 2BNNA 4QX5A 1NA1C 4RWUA 3RNSA 3UESA 3NXSA 3HWJA 4U3JB 4I5SA 1QH7A 5M0TA 1ND3C 2PA7A 2J1VA 1NCQC 3MIFA 5FK7A 4JTCB 4O4LB 3UNPA 1B06A 2ZS6B 1QBZA 3PUAA 3SCHA 1RVF1 5IVBA 2CTVA 4IESA 3VBFA 5JOZA 1KEXA 2VMIA 1GWKA 4CCCA 3K9AA 1H2LA 3M8AA 4QKFA 3DPRB 5FPLA 1ALYA 4CH4A 1WD3A 1GRJA 3HQXA 2DUPA 1H8VA 3ZHRA 4PLMA 1BSMA 1YXBA 5EPAA 4IIJA 5CADA 1VP6A 2VMHA 5F32A 4Q0QA 5EJZB 1IBMB 1F4NA 2R042 1LHNA 2DMXA 1AR61 2VO5A 2Q7GA 3MDSA 2XJQA 4F3JA 1GQPA 1K7DA 4P9OA 1JYCA 1YVWA 5GM0A 1SZTA 1N3OA 2QE3A 1SQXH 2ZR3A 4WFFA 1CQ9A 3KF3A 2HJFC 1RB8G 3J4UH 2W94A 3PU3A 5FO7B 1HDKA 2YV8A 2VTXJ 3I3EA 3LSSA 4G3YC 3VKLA 1GOGA 4PBOA 3DKWA 5KXBA 4YGBA 5DPNA 2PHRA 3FJSA 4DY5A 4EN8B 4GKJB 1TME2 5T5OA 2CGPA 4M4RA 4IV1B 3RN4A 1LUWA 1LTEA 1YFUA 3EYPA 3OSDA 3KV9A 2EA7A 4YWAA 2DVGA 1ZA4A 4Q1PA 3ACFA 1DLBA 1QXPA 3HKCA 5FTTC 2ZGOA 1ND2C 3ABLC 4Q29A 5J3UA 5C4WB 1X7NA 4QGLA 4DUVA 2JEXA 3SPHA 1W8NA 4Y20B 1PK6A 4EKWA 1AI6A 4Q0VA 2R0HA 5A3PA 1MEC3 5C4WA 4MX3A 4X1YA 1QU0A 4X20B 4AILC 1PMIA 1LEMA 4Q26A 1N32O 2QNKA 2WO2A 4FPCA 4YZ4A 2XJUA 1O3QA 1HDJA 4LF7B 2WNVC 4X1YB 5J96B 5FUIA 4WVMB 1UF2C 1KJLA 1IBLO 3RDIA 2XJTA 5DDJ3 3IT8A 1CAXB 3U75A 3ETPA 1O3SA 1W2BU 4MT8A 1F8VA 3M4FA 4E2GA 4RS5C 3POGA 4IV3B 1Y74A 5LB6A 3J26N 1E57A 2JD4A 3LGRA 3I2GA 1A8MA 2ETNA 1BL8A 3HAGA 4OPAA 3F7YC 3ZSLA 2EINB 4QX8A 4IV3A 1QVGU 2A6ZA 1R3IC 1LAJA 2CH7B 2YI9A 1AR72 3OGSA 4IGGA 4CCEA 2BJSA 1QIQA 4B1MA 3OGJA 3K75B 5FAXA 5FCCA 3CYOA 4I0AA 3AXDA 2XMLA 4CP9B 2Z0AA 3MHHC 4DV2B 5B2GB 1G9BA 1WW6A 3I7DA 4B3MO 1UN1A 3VKNA 4UB6Z 1Q6IA 1JH5A 1FXZA 4GWJA 1NT0A 1OCZB 3IPVA 2ZTNA 4QXHA 4UFMA 2V1DA 1REFA 4DOUA 3AG4B 4Q20A 3EBRA 1ZBE3 1RYYA 2YFZA 1PO12 4LOTA 1W9WA 2WO3A 5FZIA 2UUAO 3NV3A 3AYAA 5FY1A 3T3YA 4E2SA 2VAUA 4W4ZA 4GZ9A 4YNIA 1SESA 4HNAB 2VU9A 5FLXN 1VQKV 2VH9A 1C5IA 2XNDG 3C8XA 3LEMA 3NSTA 4IEOA 4JTOA 5L3GA 5IT9N 4P14A 4HPKB 2VVDA 1ST8A 3F5WC 2R7EB 1IS4A 4NHMA 3I54A 2WKKA 4GX2A 2MNGA 4XF0A 4XCBA 1I08A 1HQWA 2HKOA 4UFHA 1Q5OA 5C7GA 1L8DA 4Y1ZA 3K2OA 4UVCA 2XLAA 3VQWA 3CJIC 4QM8A 4RS5A 1W8UA 1JCHA 2RDCA 2F23A 2MEV2 1APNA 2P67A 5IYZB 1OT5A 2BOBC 2ARAA 3N9LA 4IV3C 2JGDB 2K0GA 4WFAV 4DNYA 1WCSA 2CTQA 1RXFA 4IV1C 1CXZB 1WKYA 2D2CB 2CGNA 5IYZA 2WS93 3H1LH 1BK1A 2R073 4DZGA 4CP1A 2WLQA 5FPOA 1XL6A 2PAEA 1OPOA 4Q4X1 2ZCEA 3RPQA 3F5TA 3D36A 1QJZA 2WO1A 4U36A 4DV6O 1WA8A 3OGIB 2BU9A 1VQPV 4MGTA 4PLOA 3QCWA 1RL3A 1W28A 4WM8B 4DS0A 2VC9A 1GLHA 1FV3A 3ZN1A 3NJZA 2VWKA 4GB31 1DBNA 3HKEA 3WG4A 5JAXA 3VHNA 2Z2SB 1KS4A 3FLRA 2Q0OC 4JC1A 4KBBA 3NAPA 1K4DC 1S3JA 1H2SB 1QJY2 3N27A 1PGW1 4LBQD 4TOIA 4R8HA 4LWSA 2UYAA 2OT7A 4G28B 2PZSA 3HMYA 2HP8A 1JZ6A 1SLLA 1Z7S1 3B00A 3C7OA 3NAPB 3VDDA 1J58A 3U4XA 5A3TA 1LRHA 2ZEZA 3ZX7A 3G7DA 4LWSB 2HWC1 1DGLA 2R1BA 3E83A 1ZBA1 4FOVA 5LY2A 4JGSA 2HWE1 4EYUA 4AL9A 3I5DA 1RUI1 2PF4E 1GOHA 1PVC2 3ZM8A 3CRMA 1VQ7V 3ZDVA 2OYQA 2B46X 1JMKC 3KT1A 5L7OC 2ZNJA 2VUAA 3ETGA 2VQ0A 3CCMV 2B4KA 2AUYA 3POJA 5I0RA 3M3OA 4GKKO 2ZABA 4KWKA 5B1OA 1RJ7A 4DR6B 1TMF3 3VBRA 4YLZA 4ARYA 4UF0B 1IBKB 1JYXA 1M4WA 5LEJA 4DUZO 2CAVA 4LE4A 1IPSA 4HXCA 1NZCA 2Y64A 3WP5A 3CC7V 1SDWA 4AQSA 1AVBA 3J9SA 4TN7A 2J1SA 3H0OA 2XTAA 2Y26A 2KG7B 4NE9A 5FZCA 3RYIA 5I0DA 3I3BA 2BTOA 3SGIA 3CO2A 3CPWU 1SHWB 2YICA 1JODA 3ORJA 1G6UA 1V55C 4JI5O 4JDNA 1S55A 2WNVA 1UYZA 3OUFA 2NMOA 2VGDA 2FDKA 3ZFGB 3THOA 5LWBA 1PL4A 3VL9A 5IK5A 5J9PC 3LFMA 5IYCO 1ONAA 1R092 4XVHA 1HIXA 2J1EA 4GB32 1ULPA 3RGBA 5AC92 2R061 3OUHA 3ZMNA 2JDMA 1N0JA 4AQ6A 4CUCA 3ABMC 2G4IA 2WNUC 2LM3A 1AR71 1Q81W 4IW3A 1VBC2 1BQZA 5DZEA 3TEYA 1CIWA 3GJBA 2XAFA 5DM6V 4OHYA 3ELNA 4DV7O 3NWKA 1IBKO 4EZHA 2JGUA 4QE7A 3ZPYA 4ZI7A 2VZPA 3CSXA 4BQXA 1W8FA 2R063 4OFGA 3P3PA 1CP9A 2VTFA 2YC0A 1F2NA 1LJ7A 4LBLA 1XSQA 4ASKA 4O4IA 3A22A 5F2WA 2W1QA 5KWRA 4Z07A 1S2EA 1EUUA 5B66Z 3G71V 3ILRA 1E5HA 1SQPH 4B3MB 1Y43B 3OYWB 5JJEB 5H9PA 3U4SA 2ZGQA 5C9AB 3VBBA 1O4TA 1AHSA 5JSOA 4F7ZA 2ADDA 1W9SA 3MIEA 1YJKA 5F5AA 4LORA 2ZE8A 4M3CF 1ZL8A 4NYKA 1WGPA 2PFWA 1MEC1 2XJVA 2WZR1 4ORFA 3JU9A 1DQ5A 1QNWA 3Q8FA 4BZ4A 4AFMA 5JSRA 2ATFA 3UM7A 2HWD3 2ZGKA 3KV4A 2VMFA 4O2BB 4CP0A 1IPJA 2VZRA 4GUNA 5IVCA 5CG9A 1STMA 3C7FA 1MZEA 3OE7G 5F1RA 4K1ZA 4YFZA 4O2BA 1BHGA 4P5YA 1NYWA 4B3RB 5FYUA 3VL8A 4XBLA 5APAA 1C1FA 3FN9A 1SQGA 5EYPA 1XMOO 3U78A 2XHKA 3SCFA 4UCVA 1RUF1 1KXGA 1L0NH 5EYYA 4E4EA 1NTZH 3POFA 4UW3A 4ZU7A 4CCKA 3WLUA 5A80A 5IVJA 3K5MA 2HWE3 5CA3A 5I8YA 4MVTA 4AFAA 1CJPA 3ON7A 5I91A 3RYKA 4Q4V2 4YZ1A 1VQLV 1S0VA 5GKAC 5IYYA 1YDXA 1EZJA 1W2TA 1V6KA 5FYZA 2VQFO 2EIDA 4JGZC 4LA3A 4QU2A 3ES4A 2UXNA 5FZAA 4X88A 1W0PA 3L70H 4PV1B 1IHMA 4J10A 2QQKA 5FZKA 5HFMA 1PNMA 4MW8A 4XW3A 1QJU2 4AWDA 4CXYA 1LESA 4RA0A 3OW2U 4DW0A 3AB0A 4OCTA 1LOBA 3CRRA 3FB5C 5FPZA 3I2HA 1YCIA 4M3CA 1RVF2 2IFWA 2PELA 4Q4Y2 5IVVA 4XHBA 3WDWA 1AI4A 1UMZA 3SEPA 2VZQA 5ERLA 4RUFA 2PN5A 3MUY1 2AYHA 3NAPC 3GZTB 1CAWA 4FPYA 1XSRA 2LW7A 1LUVA 4I0XB 2IJJA 3M99B 5IWAB 1PNKA 2WS91 1W59A 5LK5A 1S77D 1RINA 3CJHA 2E7QA 5FZHA 4AVTA 3V0AB 4Q6GA 4JV5O 5LMNO 4PA7A 1CAWB 1B09A 3TN91 1ZWIC 1A6CA 2RV9A 4KGQA 4XFIA 4R4XA 4AZZA 5L3EA 4AK3A 1D5AA 2GV9A 2QWNB 2QQMA 4AQ2A 2XAJA 2B9ZA 4UCTA 4LULA 4QX7A 1FPN3 2W3JA 3CWBH 2FYUH 5LGTA 3OPWA 3PLQA 1WCQA 3J7NA 5JXGA 1F51A 1URFA 4O2AA 3H1MA 4PIZA 5CIRA 1IKQA 1H8TB 1W6MB 1GKFA 4I0WB 1ZBA2 4XBNA 2DYCA 1DF4A 4CDXB 2ZE7A 2XG3A 4XUPA 3B01A 3ZN0A 2R70A 1H2MA 2DBNA 3T1HO 1L3JA 4O2AB 3SHRA 2ZZJA 3ETEA 3MHZA 3ZYPA 4Q27A 1UY3A 4URAA 3ROUA 1LGCA 5T3NA 4YJ2B 2HEYF 1RUJ1 1V55B 2BV4A 5C8CA 2Q0AA 3IGAC 3OF1A 4JVAA 3WINE 1NH2D 4U7OA 4JGYB 1AP5A 3I59A 2IVJA 4I0BA 4C1XA 1NA1B 2F95B 1KC8W 1V54C 3VBSB 1BCXA 1DP0A 4P9PA 1XUQA 4YZ2A 2PHFA 4JGYA 4GA9A 4KU7A 3T2MA 1F5JA 2ZJCA 3NV2A 3POEA 1V9PA 3ZHVA 4JRLA 4B1LA 3FYIB 1MPXA 2Y6LA 2ZGRA 3UGFA 1GP5A 5FZ7A 3KQ4B 1W03A 3AL5A 5LYJB 2JEUA 5BNOA 1BT8A 5F2VO 1KFXL 1JR9A 1SLAA 3ZO0B 4K8RB 3IKWA 3LIGA 4DV7B 5JQGB 5BNPB 3WB0A 2MEV1 1M57C 1O8SA 4NXMO 1QOSA 4FM1A 2WN3A 2CSGA 1ZZCA 2Y69B 1Y9GA 3N9OA 3ZYRA 3K0DA 3ZMTA 5A2QN 4LKDA 5HBAA 1V0AA 3SJAC 4QPGB 3ZXAC 4LF4O 2AEZA 2C26A 3HR9A 5BR8B 4DUXA 5LXTB 2YBSA 4U3FH 2AXTZ 2DUOA 4X1IA 1AX0A 1SLBA 1RUD1 4Y4RA 3PVEA 3WW2A 4QB2A 3RS6A 2GUZA 1ZRRA 2OWOA 4GWNA 4NVPA 1NR7A 4ASLA 3LA7A 3CRCA 4TSVA 1Y7BA 1WBFA 4H7MA 5FY0A 2QFEA 3VZNA 3BPZA 5IJ0A 2FDIA 3WCSA 2AC1A 1QHDA 5LZ6A 5FRAA 2WABA 1OD3A 4C1WA 1TNRA 1QJEA 2YSUB 2HLEA 2ZHLA 2RS12 3WP4A 3CXHF 3J8F3 1COV3 1POQA 3LNNA 1FJGO 2CTPA 3VHRA 1UAIA 3LEGA 2VRZA 1SERA 1YXWA 3N4MA 1DGRN 3RZZA 1WD4A 4A41A 2W1WA 2RDQA 1FXKC 3ABKC 2R72A 4DV4O 1F15A 2JG9B 2WINB 4Y1VA 1VMFA 4QQLA 2W52A 2JS5A 5DG2A 4LTAA 4JF3A 1VQ8V 3WDTA 2EIBA 2W92A 1JZ8A 5FMBA 3MI8A 1AF9A 5DN2A 3L73H 3GCXA 3RT3C 2OYZA 1S0JA 5JWPA 2F66C 3KB5A 2GALA 2Q6AA 5FYBA 1NR1A 5D2AA 3NQHA 2XONA 4EN7B 3JSLA 1ND2A 2RE9A 2PLV3 2P6CA 2XASA 3BU7A 2DCYA 3MW2A 2PAKA 2A5ZA 2Y8KA 2OIIA 1S4CA 1BHAA 2E31A 5BY5A 1TME1 2EIJC 5C4WC 3RYRA 1XNKA 1RUD2 2IBZH 3GJAA 3H50A 4HKWA 4PA3A 1YFXA 3A8TA 4Z2AA 2IH3C 1R6NA 2IFRA 4KHPB 1OKQA 1DCSA 1R1ZA 2QKCA 1X9TA 2WA4A 1OVSA 1L0LH 3A4UA 2UXXA 2AZ0A 1WMXA 4BIUA 4JAUA 4TV9B 1KYOF 1AYM1 3D0SA 1H2KA 4XZUG 5BNQA 1R091 4YM1A 4H7LA 4IIJB 2E9QA 3E2EA 4LF5B 5LA6B 1C8M3 1YI7A 2AH2A 1GWMA 1PM4A 2C24A 4BWAA 4NO4A 5EIBC 4CCJA 4JV5B 4Q4W1 4XDPA 3TNQA 2RR11 3DCQA 4QPYA 5KAFZ 1KBHA 5ACA2 3CC2V 1O91A 1J5EO 3P1IA 5FP4A 2K9PA 4XJAA 1NQTA 3LF7A 3UT0A 1H2GA 4JI2O 3U37A 2C4XA 4D6SA 3SDLA 4LUMA 2TUNA 3VQYA 3R05A 1VBA3 3T09A 3WQ7A 3UGHA 3RMXA 3B2EE 1R3KC 5EHDA 1RUG1 2M6YA 2BPA2 1YJWV 4CU7A 2VCCA 4HZFA 2QKSA 1HB2A 2AW9A 2A3QA 3H3UA 5L73A 1XNRO 3N2KB 2VJXA 4W65A 1JUIA 5CB4A 5JZGA 4MHRA 4LFAB 4DR5O 2UYBA 1Y4MA 3HKCB 5IWFA 3S0MA 1I5ZA 2YDEA 5EXOA 1JZ5A 1V54B 4DYLA 3K06A 1XNDA 2VW2A 1NLQA 3O1VA 3ZRWB 2RJLA 1PK6B 1PVC3 4XFAA 2E3CA 3A0HZ 4O9GA 3IDEA 1JYVA 2QGNA 1SA0B 1R64A 2P4EA 1FXVA 2J1UA 4AAPA 1WP8A 4W6XA 1VQOV 1AYN3 4YIPA 1XMQB 1RUNA 2RCVA 5IVFA 4H0LB 1G9CA 2W95A 4K8FA 4N21A 3SJCC 4QT6A 3BN6A 1RP3B 5GZEA 4LMFA 4ZU5A 5A3OA 2DWRA 4B3SB 4EWDA 2DFBA 2ARBA 4LF6B 1PIV2 4XJUA 3HKBB 4Q4V3 3ST7A 5JDBA 4NB5A 2YXLA 4W6YA 5ABJC 4X66O 4JI1O 1AP6A 4ONUA 4K8XA 5GLUA 1D7PM 1M4UA 1O9HA 3O9OA 4B3SO 4KXRA 3MGUA 1SMVA 3HKBA 1D2SA 3R4SA 2OS2A 3D3AA 2ZBJA 1JZ2A 3SPIA 3M1HA 2QDOA 3POIA 1OF4A 1RXGA 2A75A 5A7WA 5B3SC 1M56B 4MVQA 4UW5A 2VQUA 4MSWC 4CP9A 3H8RA 2ZIMA 5A7WB 5FBJA 5FO9B 3CC4V 1RPOA 2YPDA 3AM2A 4Q2FA 3NJVA 3IPVB 1Z7S2 1OQDA 1VBD2 1S2KA 2CTWA 1SBFA 3DC5A 3ABTA 3T08A 3H9VA 4UCSA 1BEV3 2VZVA 2PHLA 3OTFA 3ZRSA 3H8XA 3DECA 4I9WA 1RUF2 1H1IA 5LBFA 5FYYA 2ZX0A 3SYQA 4YXWG 2I07B 4MV2A 1YIFA 3CF6E 2ETEA 3VZOA 2OIGA 2PI4A 4GAZA 1I1EA 1M06G 5L9BA 1OLME 1WLCA 1V00A 4WVVA 1FJGB 3A0KA 3KV6A 2VECA 2Q68A 3HT2A 4QQ2A 1E5SA 4YVSA 4R50A 4GMP0 2W6IG 5JOXA 1OURA 1UY2A 1GZWA 3QLQA 1HNWO 3OUIA 3IDBB 2ENRA 2WFF2 3RWNA 1R1A3 2JG8B 2UWCA 5KC6A 2VNOA 1FAYA 1NOVA 3H1WA 4YG6A 1N1YA 5ABJA 1K5SA 2W0XA 2BFUS 4AFDA 1Z7S3 2YGLA 4BQYA 3H1IH 4SBVA 4DR2O 4NIIA 1FAFA 1JW6A 2FCUA 5JVVA 5EK0A 2DVFA 2HWF2 3CCJV 1GQHA 5C3OA 1X8MA 3ASNB 1JOYA 3JAWA 3STLC 1NCQA 3IAQA 2OW4A 3SR2C 1J95A 3K48A 2Q8DA 1QEXA 3K3NA 1RFYA 2DCJA 4B8EA 5KX5A 3V56A 1WA8B 3RZMA 1WA6X 4AGVA 1F4MA 1RM1B 4M4PA 2BVVA 2HJDA 5ANQA 2OZJA 1BXHA 4XQDA 3K46A 5A33A 5I8TA 2PHXA 3HKEB 1YTFB 1JJ2U 4LNVA 3FYEB 4R7CA 3ABUA 1OFNA 2FQPA 5CA1A 3I3QA 2OIEA 4RYDA 5DDJ2 2ZGPA 2IH1C 4DV1O 1GKBA 1UKGA 3PTRB 4JTNA 4JASA 4GH4A 5CA1B 2ZM6O 3E8HA 3M7MX 1NVPD 3L75H 3VDDB 2YB7A 4J7KA 5LA0A 4BMBA 4KQ7A 2YUAA 3H9AA 4JZ2A 4AOCA 3HQUA 4ITCA 5H9SA 4A7KA 2W91A 1WLEA 4Y5Z0 2RS53 2ZGMA 2DU0A 4DUWA 3WDVA 4R4ZA 2ARXA 1NBMG 4CUAA 2G9ZA 3AKSA 2ID4A 4FQZA 2BNOA 3UGGA 1FMD1 5A7NA 5E16A 4CDWA 3ABLB 2ZGUA 4FP3A 5FPAA 3ACGA 2QTSA 5FLIA 1EV12 2BOCC 1M56C 1GMMA 3FAVA 2E7TA 4XXPA 4UI9L 3I2OA 4N43A 5IJ9B 3JARB 4J42A 2WQZC 4QDQA 3W7UA 1UZYA 5FQ0B 4HT1T 1SBEA 1ULGA 1PK6C 1Q7YW 2XVGA 3NR7A 1TVKA 2XR4A 5D21A 2QQWA 4AVCA 4DB5A 1VBB2 5FQ0A 2QQOA 1LB2A 1ZLZA 2RNBA 5CKQA 2B45X 3AKQA 4DR5B 4XIOA 5IUQA 1TVKB 3WG7B 1S0EA 4MW3A 5A3LA 2AENA 3CRAA 3DXUA 3DN7A 1G9DA 1QKQA 3FFQA 2M7WA 3FFZA 5C5UA 4LO7A 3K9SA 4B7KA 1PO22 1YI2V 2X0LA 1GR3A 3BA8A 3POSA 4JZRA 5C5TA 3LE0A 3M3QA 1OCRB 2LFRA 3HNMA 3TBDA 2BNMA 4DW1A 2Q8VA 1E5RA 2WLKA 1HXS2 4Q0SA 1DYKA 2BGPA 3JBG1 3OUSA 4GLXA 1TAEA 1RUJ2 1KQRA 3LDCA 3ZCCA 3ZMSA 1ZNPA 3SNMA 1PX3A 4F6RA 1UMIA 4PA4A 2ZIOA 4P9GA 4XFFA 1G9AA 2HHHO 4HMZA 1V70A 1U96A 3JYCA 2X09A 2NN4A 3B94A 2WS92 1Q8OA 4HLTA 1UU5A 3U0ZA 5JXIA 4J6GA 3SYPA 5GLZA 4P5HA 3N9QA 2YXSA 3W58A 1KB9F 3ECQA 3S3XA 3JB4C 2WYSA 1UY4A 3ITQA 4FLYA 1YQCA 4YHHO 5FIXA 3JAMN 2XLFA 1GP6A 4GKYA 4NRMA 2ADEA 1W0KG 2JKXA 2QQPA 1OI6A 3IWZA 3CQOA 5CFCC 3TEWA 3OGCC 4W50A 3ZSJA 1B35A 4DRRA 4N9HA 2F6BA 4QQOA 1ENSA 5KUMA 1SCRA 2VPVA 3CNAA 1G7YA 1K97A 4NTXA 2NNUA 2LS6A 4TV8B 4G27B 4P9WA 1QJY3 1FPOA 3X29B 1V9U3 4JI4O 4TLFA 3FHQA 3WNLA 5FZ1A 2YI8A 4I9QA 2XQRA 4KNCA 2ZNIA 4A44A 1P84F 3NNFA 4H44B 3MBWA 1MQTA 2OPWA 3BRCA 1VMHA 3J7MA 4HBNA 3PMSA 4QDSA 1AL22 5FY9A 1NQDA 4RFT0 1VQ5V 2VQAA 1LHUA 1Q8VA 2V5YA 1W6PB 2J1TA 3KVAA 2KR2A 4R52A 5T5PA 1Y66A 4BISA 4OPHA 4OGQB 1A78A 1MQTB 1UPSA 3W7XA 1NE4A 2DVAA 4HZ3A 1T2XA 2JDZA 4WFBV 3SCGA 1QF3A 1GNZA 2VXRA 3K5NA 4OULA 2P7TC 1A34A 2W87A 4BPZA 3I3DA 4D6RA 4YW2A 4XOGA 2G1MA 2LRPA 2A06H 2HWB1 1OMIA 4P2ZA 1AR83 3MV01 4YM3A 4PD4F 3H3LA 3CU7A 2RS13 5IDJA 5F7UA 5F6KA 4QX3A 1L7LA 4GWIA 4YW5A 4PDVA 2B9VA 2VQEO 5K1PA 5CAZA 4GX1A 1WUVA 4MG2A 1PVC1 2L35A 1Z78A 3R0RA 4Q5OA 3C3SA 4LOSA 5DAPA 1T6BX 2L6LA 4EB6B 1N1VA 4LFAO 2G38A 1S2BA 3DPRA 3LOBA 3DUIA 2Z69A 1AX1A 2ZEWA 3VBFC 5FPVA 5KR7A 4CZZA 1GOFA 2NN8A 4I50B 4EB6A 4COVA 3BOPA 2JDUA 2E51A 3HNYM 1W8ZA 2BOJA 4JYAO 1XOYA 3O0WA 3AG3B 4DV5B 3N9MA 3CIHA 2LO1A 1ZBE1 2VVEA 5AVAA 1KKCA 1AR93 2JDPA 3O5SA 4PLNA 3OBZA 4JAAA 1XILA 2WWSA 2JB8A 5EIBD 3AMQA 2VS0A 1AJNA 2ILMA 4N7UA 2EZOA 3FLTA 3FZ3A 4WM7A 1M5IA 3CMEV 1NH2B 2CDOA 3MHSC 3DXRA 1FXHA 4NPMA 2LQTA 4LHKA 1P4RA 4FXKB 2BFUL 2JB4A 1BEV2 4XILA 3USUB 2D97A 4AEKA 4B3TB 3DXRB 4PDMA 4KMQA 2ES3A 1GP4A 5LHHA 5LGUA 1XL4A 1OVPA 4YW3A 1GMGA 1K3IA 4XUNA 2IJKA 1MS5A 2JDAA 4P9IA 2W0FC 3JAKB 4PJ0Z 2GTSA 4CDUB 2ZAHA 3LUTB 5CKMA 1ZBE2 2I2SA 2VR4A 4XFGA 2ET1A 4YZ3A 2VOVA 1EN4A 1SDDB 1DZQA 2RM23 3P3NA 4J41A 3AYDA 3WF1A 3E8BA 5BY1A 2EILB 4DV4B 1X8EA 4CTEA 1PNFA 2BGCA 5E79Z 1J3QA 3VBHC 4N90A 1TEIA 4IEUA 4X8PA 2B8MA 1LNQA 1YYNA 3SPGA 4FPFA 5IE9A 1H2NA 4I02A 1V6OA 4YYOA 4X20A 1HRV2 5B1AC 3SKJE 3K79A 3B77A 3AP5A 3JZVA 2OTJV 3R4DB 5HV0A 1ZZ8A 1GZTA 1HB4A 2OX0A 5C3PA 1FMD2 3AJZA 1SS3A 3RZLA 2N04A 2JK5C 2ZXQA 5FKBA 2CV6A 3SPCA 2GU9A 3UL2A 1ODNA 3TAYA 3AXEA 3ZEDA 2Z5WA 5LL6Y 5FLJA 3T2TA 1RTVA 4HVQA 1T5EA 1OZ0A 2O1QA 1OH3A 3PMEA 1Y74B 3VBSA 3ABMB 1W9TA 3ME2A 4PDWC 4IYIA 1KUQA 4IE0A 3SXWA 4X64B 1MMMA 2ZT9B 5A7PA 1VAMA 2VCMA 4Q0PA 4R9AA 2QCSB 3RZHA 4BAYA 5A70A 1D2DA 2RJKA 2C9KA 5IY5B 2DN9A 4M00A 1TUBA 4W4KA 2D3RA 4YG0A 4XQ4A 2DWEC 4X8AA 2R072 3RBZA 5LYJA 1JZ3A 2P1BA 1GV9A 1WPXA 3I49A 3SJQC 1UX6A 1ZTEA 2BWCA 1VBE1 4NXNO 2ZZQA 5IT6A 1U5ZA 4UW6A 1RUD3 4L11A 5FZGA 4OMDA 5FMOS 1G9FA 3WX5A 2WWUA 4FTSA 2XVLA 5FZMA 5BXZA 4OI4A 4DXSA 1K9MW 1CN1A 4KL1A 3WW3A 5C9AC 3I56V 1X59A 1JYNA 4UV9A 3E89A 2CE4A 4Q8LA 4QPGA 3QACA 5LXTA 1XREA 1HNZB 1VE0A 4FXGB 3KVBA 4NWVA 5DMYA 1K12A 3VBHA 2K1EA 1FV2A 4MLOA 1C5HA 4WZCA 1K45A 4AHYA 5FP9A 3SITA 1DQ0A 3ZFEC 5FOJB 4H55A 1ZZ6A 1Y4WA 3SYOA 3L9DA 3ACLA 3VBHB 2V5DA 4M3CE 3PDQA 3FHAA 2WZ8A 3PJYA 2AREA 1MABG 3U1XA 3F2ZA 1ZAUA 2AZ5A 1K34A 3LPFA 1PHMA 1NZ6A 3AK2A 1NVPB 5KC5A 1H4GA 1MQTC 2VZUA 3WW1A 3IC9A 1ZRCA 4BQ1A 5J2TA 4XJ8A 3RVHA 4QGPA 3C2UA 1MS9A 1J3PA 1R082 2HWB2 4XCAA 1N1TA 2VL4A 2XQXA 4LBKA 5J2UB 1TVGA 3W9AA 5DUWA 2P5BA 2GN7A 4XFBA 4AG4A 2JGDA 3N3HA 2ZAAA 2WWJA 4IHJB 2Q1MA 1W90A 1N34B 4LP8A 3CE2A 4YGEA 3V0BB 5GW7A 2RMU2 4MTOA 1CAUA 1XXNA 5T54A 2JDIG 1PGW2 2ERFA 2BVBA 1JHNA 5JZGC 1ASJ2 2B1IA 1JU3A 2E75B 3VN4A 3WG3A 3D3IA 3L72H 3WF2A 3PUHA 1VR3A 1VBB3 2GNMA 3MIHA 5T5LA 1M93A 1N8RW 1KDMA 2Y4TA 3U07A 1W9FA 5J36A 4XACA 4QPKA 1HV0A 1EP0A 1XRUA 1XE7A 2XGXA 2F1MA 1IKPA 1ZBA3 4XC9A 1CD3G 1QVFU 5LBCA 2KQXA 4S2DA 3N2GA 1RUE1 2EIGA 2ZKNA 1GM9A 4ZS2A 5LP6B 1YITV 4XXAA 5HCHA 2PUSA 3M3CA 4JX0A 3PHMA 4V2VA 4DINB 1UXXX 2QM7A 4ZHQA 5TISZ 1Z5VA 2IWGB 2CTRA 4COZA 1QH6A 1WJZA 2W1UA 3AKTA 2F4VB 2YC2A 3N7JA 4L99A 5JUVA 1ACCA 5LEKA 4ZHQB 4OX9B 1GICA 1FPN1 1I5PA 2WA3A 4D6QA 5FPRA 4UCOA 4ISQA 1HB1A 3WDUA 4FZ0A 1PPJH 4NTYA 3VD5A 4HAMA 1WCDJ 2YC4A 5AVPA 4DXWA 5C8YA 2XH6A 1EN5A 4R9CA 2XUEA 2D3PA 1JBCA 2WJSA 3AK1A 3ZHUA 1I94B 1EM1A 3C3TA 4MGKE 3LDDA 4E4HA 5GLTA 1CX4A 1AR4A 3W21A 3B8MA 1PZ7A 1F35A 2E5LO 4H14A 1BE3H 2WAOA 1TUEB 2GZWA 4ZKTB 3JATA 1O5UA 2ZXWC 2AACA 4YW6A 5A9GA 1W8HA 1PGL2 2C5DA 4UVAA 1OC1A 4X62O 2KKWA 3TRSB 3LIHA 2WLLB 5K1XA 4UAPA 3T30A 4KU8A 4HK8A 5BNNB 1L7QA 5D8AC 3BIEA 4ASMB 1KP3A 4U7NA 4TUYB 2FMDA 1DHKB 3N2KA 1K33A 1HXS1 5FUNA 1CIYA 2R1DA 4L8QA 2Q8EA 3H1KH 2DQ0A 5C6CA 5FYIA 4GJYA 3I3MA 2N74A 4QNHB 4P9JA 3OD4A 5FZ6A 3OD0A 2QE7G 1GM7A 2VOKA 4Q4X2 2R043 1JA8A 4CCDA 5A6XA 3BA9A 4RHV1 2D40A 1SA0A 2NZ9A 5FFOC 2AHZA 1OCOB 3P5BA 1AR1B 1O4ZA 3WNNA 4E9KA 1HV1A 3KF5A 5IY5C 5ACA1 4YVSC 3TETA 1QDOA 5BNPC 1NCRA 2JDNA 1ZRDA 4JI8O 2EXIA 2WT0A 4ES8A 3HT1A 4MGIE 3CL1A 4QAWA 1U97A 2X8KA 3RZKA 2V7QG 2YIBD 2JENA 1NCRB 1US2A 5LHIA 3E8FA 1ZM1A 2JS3A 1GSLA 3G6EV 1OUSA 4I4TB 5L7OB 3ZYBA 3CJXA 5IK4A 1KU9A 2N05A 2JG8C 4GX5A 1SQFA 2WO7A 2HWD1 5HXMA 1DLCA 4FK5C 1D0HA 1WCUA 1WZXA 4BIOA 2HYKA 3E22A 1GNHA 1PV0A 1CZSA 2BSKA 4FFGA 4PIXA 1VRH2 2EULA 3OMIB 2JD9A 1C3HA 4IDZA 4DIQA 4QHZA 3FX7A 1K5MA 3OB8A 5CISA 1JYIA 4LLFA 3GWOA 4JDOA 4DV1B 2XUMA 2HFEC 1UY0A 4XDQA 4GXLA 2Q1FA 5L3DA 2GN3A 3IAPA 2RVAA 1WNSA 1Q6UA 5LHGA 4H2AA 1FXKB 1RITA 4BCUA 4AI8A 1Q6HA 1PX4A 3C7HA 3VKMA 4DMIA 1RUOA 3O7OA 1S0DA 1IZ3A 1RMU3 4JI8B 3BIWE 3X2QC 5LY1A 4Y33A 1TG7A 4D69A 1S0BA 4AAXA 3WNKA 2D6MA 5E8AA 4KHPO 4IE5A 2XOKG 4AYUA 1PO11 4A6SA 4GYCB 5EYPB 1VRH1 5E89A 1ZX5A 2DCZA 2UY9A 1CAVA 3WCRA 3ABZA 4CXXA 4LJHA 2X5IC 1XNTA 3SISA 2Y6JA 3WG7C 2B5HA 1YTFD 4YGDA 1K42A 3MAQA 3WP3A 2EF6A 2BGOA 5KXCA 3OT7A 3TXQA 4CDWC 3WP6A 1H0BA 2DCTA 5KA5A 4E4SA 3CX5F 3J81N 1N3QA 4UFIA 1UXZA 1R6KA 3CJIB 4JPRA 3E5XA 5A3MA 3C90A 1OLQA 1XYPA 1HNXB 4RR3B 4LHSA 4YW4A 3S6PA 3CZJA 3AG2C 4JGZA 4JI7B 2JG8A 2BTQA 3TNPB 3QNEA 1QJX3 1PIV1 3KT7A 4AI9A 1MS4A 2J7MA 3EXUA 3IIIA 1MS0A 4LH6A 4F4LA 3BU0A 2R9AA 4Y24A 5GONA 5H9RA 2HEPA 2QJ1A 4NPLA 5KMGB
chains in the Genus database with same CATH topology
1ND3A 1XNKA 3NO8A 1C57A 3KGZA 1FNYA 1RUD2 1MZ5A 3ZFGC 1FT9A 3H50A 4HKWA 4CYDA 4MUVA 1ZZBA 1YFXA 1ZVFA 2GH2A 1RUH2 4YVWC 1GZ9A 3AKRA 5JPMB 1ND3B 3N7LA 4YVWA 2PYTA 1AL23 4PBPA 1WBLA 1D4VB 2IFRA 2PLV2 4EWAA 3URFA 1OKQA 5GALA 1MS3A 4MXVA 4LE3A 3VBSC 4A3XA 3DF0A 1EPWA 1R1ZA 2HWB3 1KDKA 1VBC1 1VLNA 1VBA2 1NG0A 2ZKLA 2GMPA 3MPPG 4AI3A 1WW5A 4F8AA 5AFBA 3MLLA 4XZPA 4YVWB 4HVOA 2WA4A 4R9BA 1YFYA 5DG1A 3A4UA 5CFCB 5CBLA 4IEWA 4CZSA 3JBG3 4IEPA 3O14A 1AYM1 3D0SA 5BNOC 3OGGA 4D3WA 1H2KA 1PM7A 5GLVA 5BNQA 1R091 1VB4A 1MZFA 1LOEA 2E6VA 2RHPA 4LO8A 2GNBA 4AVAA 2GC3A 4PF5A 3D5OA 4YM1A 1WMFA 3LB9A 3NVCA 2R0FA 4ISRA 5A33B 1PIV3 1XE8A 4H7LA 1VZ5A 3AP4A 1AX2A 2DURA 2E9QA 2JEMA 3M2MA 3VBOC 2DTYA 3VZMA 2CNAA 4DPNA 5C33A 1EAH3 1C8M3 3ZIXA 1QXJA 3POYA 1Q56A 4N53C 1YI7A 2AH2A 4D94A 1RUE2 3AZVA 1HKDA 2E7AA 4Q4Y1 3RI8A 4NO4A 2RM22 2Y38A 4QPIA 3ETQA 4D7TA 1AR62 3RSJA 4Q4W1 3SWTA 2LUWA 2RR11 2HWC3 3TNQA 3VBOB 4ATEA 4QPYA 3M3IA 4CEYC 5HCFA 2ZCWA 3GF6A 3VBUC 1RUC2 5ACA2 5K0UC 5K8SA 1O91A 1SFYA 2GAUA 2Q5TA 4XJAA 4K7JA 3V64A 4S2GA 5KHIA 5J92A 3CEWA 4AI0A 1N1SA 2PHTA 4HK9A 2A6WA 1H8TA 3UKTA 4AGRA 4GALA 5F5QA 4S2HA 4DQAA 1YO8A 3IMNA 4CDXA 4LUMA 2TUNA 1LKNA 3R05A 1DIWA 1Q8PA 2UY8A 1VBA3 3WQ7A 4HKLA 1D4M3 4XJZA 2A6YA 3WOGA 3E5QA 3RMXA 4OUMA 4XJWA 3VBRC 1RUG1 2RS11 4CP2A 1B35C 2BPA2 1URXA 1YUDA 1J1TA 5BPXA 1AR63 4HZFA 1O5LA 4YFWA 5D1IA 3M70A 4XEZA 3O0XA 4C0HA 4AEDB 3H3UA 5L73A 2FZ1A 4E2QA 1W6QB 3B9CA 4W65A 1JUIA 3I59B 5D8AA 4DY3A 3B5LB 2OUJA 5JZGA 1S1AA 5T5JA 2R6SA 1NA1A 2UU8A 2EXHA 2UYBA 5EZWA 4N43B 3MZHA 3S0MA 1I5ZA 2YDEA 1OIJA 1MS1A 3L2YA 4XF9A 5EXOA 4BYYA 4GIQA 5GZGA 1DGWX 5JSPA 5C8CC 1XNDA 4K6BA 4AEDA 2VW2A 1O3RA 2BUKA 4L92A 4Z2WA 2JE9A 4MXWA 5FREA 5D8AB 4Y20A 2NPIA 2A73B 2RJLA 1PK6B 1PVC3 2XBO3 4LO5B 5JI9A 2VG9A 1VAKA 1D4M2 2D5FA 4XFAA 2ZHKA 1GQGA 4O9GA 3IDEA 3M7AA 4P9LA 4PDWB 5EYXA 2TBVA 2NYYA 3RG0A 1ENRA 4TWTA 4YRDA 2BWAA 4QQPA 2OA2A 2WL1A 4W6XA 4HSJA 3AZZA 4MXWB 4FPLA 2XWJB 4AHZA 1AYN3 3O12A 1RUI2 4RGAA 3O2GA 1RUNA 1NX8A 1UW8A 1RGSA 3RRDA 4AVBA 1G9CA 3ATGA 3H8UA 1EPZA 3N7KA 4K8FA 1AR82 3MPBA 4QT6A 2LALA 1NCRC 5GZEA 4WM7C 5BNPA 2W39A 4ZU5A 2DWRA 4AGGA 4QGNA 1RHI2 1GANA 2PQQA 4EWDA 2GNDA 2D6KA 4IEZA 1PVXA 1ASJ1 3LWCA 4U2AA 5JMCA 4E27A 4M26A 2FBEA 2Q1ZB 2DFBA 2ARBA 3VDDC 3WUCA 4V1PA 4IEVA 1PIV2 4XJUA 4Q4V3 3FMGA 3ST7A 5JDBA 1AJKA 4W6YA 1OA4A