3KCYA

Factor inhibiting hif-1 alpha in complex with 8-hydroxyquinoline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Crystal structures of human FIH-1 in complex with quinol family inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 98
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3kcyA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kcyA01
4NR1A 4AI8A 4B7KA 4BIOA 4B7EA 4Z1VA 2YDEA 3D8CA 1MZEA 4QU2A 4JAAA 1IZ3A 3OD4A 4Z2WA 1YCIA 1MZFA 3P3NA 2W0XA 5JWPA 1H2NA 2CGOA 2WA4A 3KCYA 1H2MA 1H2KA 2YC0A 2Y0IA 2ILMA 3P3PA 3KCXA 1H2LA 2CGNA 2XUMA 2WA3A
chains in the Genus database with same CATH superfamily
1FKAO 1Q3EA 2CTWA 3CWBH 5IK4A 3ZSLA 4GWMA 5SV5A 4TUYB 3FYEB 2PQQA 1TVKB 1UPSA 2A73B 3H42B 1S0VA 1GK9A 1W2BU 1UMIA 3O14A 3DXUA 2YG0A 1R64A 1UU5A 1A3KA 4QJFB 3RGBA 4FP3A 5HCAA 4ZIBA 1F8VA 1YFUA 4C1XA 5EPAA 2AW9A 1X8EA 2EIMB 1OUSA 2Y4UA 3THCA 1AYM3 5I8SA 4XIOA 3WNMA 5A9GA 3L2YA 2C2AA 1QJX3 2LQTA 2ZDIC 1WB8A 1I0HA 2HWD1 3WQ1A 2EXKA 2Q1MA 4O65A 2YMZA 2P4EA 5FAXA 2GUZB 1L0NH 2J1SA 3URFA 4GCZA 1W6MA 1RHI2 1GOHA 3RS6A 5F5CA 1OPMA 2JE7A 2WNEA 5CVRA 1H8VA 3CS5A 4AHXA 2XXZA 5LRSA 3THDA 3GZTB 1FOD2 5K0UA 1J58A 3HKBB 3ZYBA 3MW2A 4GKJB 4JV5O 4HONA 5J3UA 2UXDB 2C24A 1CJDA 5J36A 1PK6B 4XILA 1VBA2 4CUBA 2W5FA 1WWYA 3RRDA 1EV11 4TV9B 4XW3A 3SYPA 4JTCB 4PA3A 2VZ3A 3FLPA 1PD3A 2UURA 1NA1C 3U4SA 5FV3A 2VUJA 5LGTA 4QXBA 4GYCB 1MABG 1UYPA 4ORFA 3ASOC 3POYA 2E51A 1F31A 5CG8A 3E8HA 2DQ3A 2ARAA 2BV4A 3OBTA 2R9AA 2P17A 3IDAA 4L99A 5FYIA 4AG4A 4GAZA 1W0NA 1N0NA 3R05A 5KXDA 5DABA 1DHKB 3ZN6A 2XNDG 4O2BA 4FLZA 4QXHA 5T54A 1W9SA 3MIFA 3DUIA 3OUIA 1PX3A 4YW5A 4LO6B 3JD72 4AZZA 4UCSA 2CDYA 4JCKA 3VBRC 2HHHO 4BHPA 2G4IA 3UV9A 1W05A 4DRXA 1IPJA 1PMIA 4RN5A 4KWKA 5BV6A 1LRHA 2OUHA 2OS2A 4I7ZB 1TNRA 2GC2A 1K4CC 4I9QA 1RUC3 5DM6V 3RI9A 2R9RB 2WDBA 3IM0A 4DOUA 4Y1VA 4UV9A 3PNAA 2XH6A 3RYHA 4E8CA 5T52A 3VBHA 1QJY2 1RVF1 4XJ8A 3SMHA 2NN4A 2YROA 3MLLA 1JVMA 1SEFA 1B35A 4Q0SA 1LENA 3E5QA 1RPRA 3CRQA 4V1PA 1YQ6A 3T1HO 2IXIA 1ZZ7A 1S0BA 2OIIA 4QPYA 3HKDA 4YSFA 5EJ1B 5LBEA 5B4NA 5J2TA 1SA0B 5GLUA 4H7LA 4MVSA 3U11A 4Q4Y1 4DO0A 1OOPB 2WNUC 3QACA 5FZDA 2QQUA 1AI4A 5LP6B 1V00A 3VBOC 4L97A 1PHMA 3FB5C 4G4FA 1BQ0A 2DVGA 2XAQA 3H1IH 1Y74B 3OMNB 4X88A 3BTAA 3W7SA 4LE3A 3K58A 5DPNA 3RYCA 4DUZB 3M4FA 1ENSA 1OA2A 2YPDA 5EIBD 1QJU3 2ZHMA 4ZONA 3X2QB 1IS4A 2F4PA 1SACA 5FMDA 4CDXC 2PXJA 2QWRB 2TBVA 2VE1A 1ZBE2 4RYDA 3RNSA 3QO5A 1SPPA 4GX1A 3SHRA 2I45A 4QE7A 1NBMG 5A7WA 1Y9GA 1YTFB 3JAWA 4AILC 2ZGLA 2W6IG 3FHAA 3D0SA 2DYRC 5A7QA 4ARYA 2ZKNA 2X6AA 5EQUA 4DR7O 4P02B 2E76B 2QBXA 4HFSA 2YI8A 3VDDC 4IEQA 2ZNIA 1WMDA 3MHZA 3DPRC 4FFGA 4PDWC 2NMNA 5LMNO 1ASJ3 3OEHG 1CX1A 1QH7A 1W2UA 4PI2A 4JGZC 1JA8A 4UFJA 1RPOA 1PVC1 1Q8QA 1J5EB 5FZBA 1CIYA 3KQ4B 2GN3A 3RZHA 3ZRWB 3PIGA 1E5SA 2YI9A 1H9WA 4O4JA 3JB8A 3CCSV 1US6A 4WM7B 3MIBA 4W8JA 2R49A 2QWNB 3USSA 1IXMA 3H1MA 3FB7C 3VD4A 1ROPA 5FYMA 4DXRA 5FYTA 2PHRA 1QU7A 2Q4SA 3R65A 4LA2A 2K1EA 5LATA 4LE4A 3O1PA 1DLBA 3S6PA 1AYM2 1UD1A 2ZGOA 2FL4A 3DKQA 2PHTA 2PELA 1DTOA 5I91A 5FY8A 1OUXA 1C28A 1QJX2 3LEGA 5BR8B 3GALA 1OCCC 5LA6A 1YNAA 2F4LA 3RYPA 1YYNA 2J42A 1FXKC 3I4IA 3ZVXA 1NE4A 3WX5A 2R0FA 3IAPA 2VUDA 1CVNA 2E5LO 4AHWA 4RR3B 4TWKA 3G67A 2C26A 1MPXA 5D8AC 3LZZA 3SR2C 3PN1A 3FMGA 2DF7A 3B8NA 3T4VA 2W52A 4CCOA 1QVGU 3ZXEA 1ZZ8A 4QB1A 4I01A 3OTFA 5CIRA 4JI4O 5IUQA 4Y20A 1A8MA 3JXSA 3WG2A 2R1BA 4LOTA 5LZ6A 2ZQMA 3W7UA 2VQFB 1FS0G 4KI5M 3W5NA 4CCJA 1G7YA 4QQHA 1AJQA 5A70A 2VZUA 4L0PA 3WT3A 1M5IA 2WBKA 1DYOA 1O91A 4NN0A 3ZFGC 3BOPA 1RUF3 1QH6A 1MG1A 4FI9A 5KBFA 4R9BA 2HEVF 3N7JA 1IBKB 1XB9A 4QXKA 1GH6A 4JGSA 3CXCU 5BNPA 4FPLA 2Q0AA 4N43B 5JSOA 3ZYRA 1LOAA 4MTOA 1W2OA 4X8AA 3QO7A 1ZSPA 1XMQO 3O0VA 4MVMA 4KL1A 2LS6A 4LBQA 3KCYA 4XFHA 1PGL2 4WVZA 4A2UA 1K34A 2IU3A 4LO7A 1W8FA 3ZXGA 3CJIC 1YI2V 3IZOA 1Q8SA 2GMEA 2NR5A 4QPGB 3N4MA 1RIRA 4QPIA 2D97A 2J1UA 3BEHA 4RQPB 1C5IA 3LD8A 3R66A 4G3YC 3QLQA 3E2EA 4N53C 4DR1B 4DINB 1GZWB 2VVFA 1S0FA 4JI8O 1H9PA 4QIWF 2HWB1 1VQMV 3BUCA 4GZRB 3PUHA 2X53S 1RUC2 1KYOF 2EIKC 4IE6A 5CBHA 4FT8A 3UKVA 1F4AA 1MEC3 2ZGPA 5JH7B 1LU1A 4B3MB 4Q4X1 1UMHA 3V0AA 2R072 4PF5A 1PO23 4DV4O 3K3WA 1GMMA 4GMP1 4Z8BA 2P67A 4PELA 4O4HA 3E6BA 1YIFA 3NJYA 2Y69B 4QX1A 4GH4A 1BEV3 1ZZCA 1LEMA 2BGPA 4JPRA 1CQ9A 2ZX1A 2DW4A 1ZZ6A 4S2FA 1RUH1 2XWBB 3UO3A 1US3A 1JPXA 1F5FA 4JI0O 4NIDA 1Z5WA 1IS5A 1S1AA 1RITA 3DYMA 2JICA 4U7NA 3GBGA 4P30A 3VKMA 4E27A 4CDQA 1ULDA 3FN9A 2VTXA 2BVVA 3ZXKA 4YJ3B 2VECA 1TME3 2KG7A 1JX9A 2P6CA 3E22A 1QJU2 3OUHA 2F43G 1Y43B 1ZL8B 4X6RB 1DFQA 2EVXA 5A1FA 1OCRB 1VQOV 5GALA 5EWSA 3FZ3A 2GHYA 2ZXWC 5L7OA 2UU9B 4UCOA 3ETEA 2X5IA 1O8SA 4KU7A 2WSVA 5A3PA 2DYCA 2K46A 4Y24A 1RUD3 3WNXA 5F3IA 1V55C 4QPWA 4JI2O 1D5NA 4U7OA 4LNUA 3FBYA 3VD3A 5C8CB 3ZKYA 3LPGA 4LOSA 4QKFA 4COZA 1CX4A 1YFYA 5FPLA 5IK5A 1QQCA 1LUVA 4IV1B 1S0CA 1AILA 2EIEA 5CA1A 4AVCA 1HQNA 1LULA 1SG3A 2D43A 4IV3C 5CG9A 2Y33A 3H01A 4I0XB 1VMHA 4XJWA 2CU5A 1FJGO 2RR13 5C5TA 2OUJA 3B09A 1QBZA 1HJFA 4UOJA 4P00B 2CH7A 3TCUA 2UWCA 3T1YB 3IKWA 4DPNA 1R3KC 2J1RA 4FPCA 5K1XA 4I5SA 4ZS2A 2WFPA 5DZFA 2EZPA 2Y38A 5LHIA 1UZZA 4CDWA 3AMPA 1OA3A 1VLNA 4LITA 3STZC 3P6BA 1LHUA 3VD5A 1AYN3 2ZX2A 5EBLC 1E1RG 3M3QA 4R50A 2ZOEB 1BZKA 1TMF1 4I55A 2BVBA 5FY1A 3BABA 1MZ6A 1DQ1A 1RC6A 1F4HA 1RUG1 2XHKA 4X65O 1AI5A 1R73A 2Q1FA 4Z07A 4U3JB 2CGNA 4P08A 4GALA 4DMIA 5FY4A 1LHWA 1SBEA 1WA6X 4JI7O 1IZ3A 1JYNA 2GBOA 4ZU7A 4KH9A 3WDVA 3T2MA 4OUMA 4BB3A 3B93A 3AM2A 4UI9L 5A2QN 4LH7A 3RWRD 3L74H 5A80A 2E26A 4OLLA 1NLSA 3EXAA 1M1KW 3SC7X 4MH0E 4WFGA 4P9JA 4K1ZA 2BSKB 2RS13 4FSJA 3SITA 4AOCA 1YXBA 1CAVB 1O3SA 4NPLA 2F17A 4XDKA 1K5JA 1H6XA 3BY6A 2VBDA 2VZTA 1WBFA 3UL2A 4CCEA 3JQXA 1R6NA 3T4HB 1FFTB 5FUNA 4TUYA 1M57C 4C0HA 4QX2A 5J7MA 5A3UA 1GNYA 1TVKA 4HANA 3AZVA 4XIKA 2WZPP 4RS5C 3VKNA 1X7NA 1WAZA 2Z0AA 2VY0A 4BIZA 4QWNA 3JCZA 3ICXA 4MUVA 4A7ZA 2EX3A 1RUF2 2ARHA 3S7EA 4X66B 3T2PA 5B1NA 5BNOA 1RM1B 1NG0A 1N1YA 3UESA 3OYWB 4WVWA 1DP0A 1JYTA 3ROUA 4YW3A 5JAXA 2XL9A 2OPWA 1J95A 4YW2A 4XHBA 4JTAB 3ZHVA 4GMP0 2JG8B 3GXUA 5AFEA 2GUZA 1WZXA 5C70A 3AYDA 3VBUB 4IE0A 1HB2A 1HW5A 2QQKA 4YGDA 2JXAA 4QKNA 1I5YA 1KJRA 1QXRA 2WO2A 4MLOA 4QB2A 1PNFA 3HAGA 1XNRO 3ETQA 4PLMA 5CZKA 1TEIA 4AEDB 2FYUH 1POV0 3HKBA 2WSUA 1NXD1 3TXQA 4OUSA 4AFDA 1TE1B 3OTOO 5GZCA 1PGW2 1R1ZA 2C6SA 1X33A 2BTVC 4H37A 4ZU5A 1PK6A 1Y4WA 5FXXA 1DLCA 2QTSA 3NV4A 1MEC2 4DIQA 3KF5A 2XDVA 4WVMB 1FNZA 1I1EA 2ZAAA 4OMCA 1PO22 4J7KA 1QHTA 1SCSA 2VVDA 4LT5A 3ZCCA 3ZHTA 2VZ1A 2VRZA 1B06A 2VQAA 4IEVA 3LPFA 5C4WC 5IY5B 3ETDA 3RT3C 1BEV2 4P9XA 5JCOC 3VHOA 5IJ9B 1FV3A 2HWE1 2X09A 1FPOA 2VMEA 2XVGA 4BPZA 3WNNA 3I56V 3CX5F 5C3PA 3VZLA 2WZR1 5LBFA 2AZ2A 2VOXA 1OCZB 3KVAA 4IHJB 5FZCA 4J42A 2BW8A 1W6OA 4B7EA 2ARXA 5I0UA 1TME2 1OI6A 4PIZA 2FCTA 2EIGA 2Y0OA 2GNTA 4UAPA 2XLFA 1X50A 1SZBA 4EWEA 1OCOC 1NI8A 4Q0QA 1HDJA 5C8YB 2HWD3 1VEWA 3BYWA 2IH3C 3MUZ1 4MS2A 4OQ9A 3OUJA 4HKLA 2LFSA 2V5DA 4I50B 2YBPA 2X10A 1VIBA 5AVAA 2BNNA 1OKQA 1RUD2 3POWA 4I30A 3VBHC 3JD2A 3I3QA 5BNQA 4UW5A 4U3FH 1RTVA 2WNVB 1PZ7A 4BE3A 1YEWA 4E2GA 4MGIE 2D93A 1P7GA 3PJSK 2IJIA 1CZSA 5FPOA 1S5LZ 2PI5A 2J7MA 4IGPA 4META 2MEV1 4P9YA 3E97A 3H7JA 5IVJA 1NH2D 1VMFA 3IAYA 2OQ7A 4PJYA 2D2CB 3PURA 4Q2FA 4O2AB 4A7KA 2Y60A 3NXSA 2RR12 3VKOA 1SA0A 2Q8CA 3OEBA 2XOMA 4NTYA 1OOPA 4DEQA 1EV13 5LP6A 5CKQA 2B9VA 1Y67A 3H9AA 4GB31 4J1WA 4I0AA 2OW4A 4YW6A 1Y74A 4YG6A 5DZGA 2X0LA 1SZXA 3M3OA 2D5HA 3TGUH 1AYN2 3J80N 5LRRA 1AL21 5A7NA 3ST7A 3ASOB 1AP5A 1S5JA 2QJ1A 3HBKA 5FYZA 3Q9OA 1S2BA 5EYPB 1PO11 1WPXA 4N9HA 2HWC1 2XJPA 2WLQA 3ELNA 4K8XA 1K73W 4Q20A 5JCTA 5A32B 2C1FA 4CEYC 1YQCA 4XFBA 4JQTA 5HXMA 2WNOA 3Q8EA 1C4RA 2ZE5A 4YG0A 3BVOA 1ZTEA 1NZ6A 3CZJA 3ZYHA 4MX3A 2RM23 1BZWA 3CO2A 4IUGA 1QQP1 3KHBA 5BNNC 2BBAA 2AENA 4IYIA 3NV1A 1X82A 3VBSC 3FE5A 2RS12 3DEMA 3H8UA 1Z7S1 2XL7A 4NHKA 2ARCA 2N05A 2UWBA 5JIUA 3G6JB 4MT8A 2A7AA 3M8LA 3ZRWA 1IVSA 3ZDVA 2DU1A 5A7OA 5FZFA 4WM7A 2EJ7A 4CCNA 4BR6A 2Q7EA 3WP6A 4DV2B 4K9SA 1I5PA 1LOFC 5B4XA 5EXOA 1HB4A 2MK3A 1QWRA 3MV11 3K04A 4MTFA 4DV7B 1NCRB 4LHLA 1OBNA 3BIEA 4BIOA 3VLBB 4NKGB 1H8TB 4OHXA 2HYKA 1URXA 4BQ3A 2BTQB 3VD9A 1POQA 4GKJO 4BK4A 5LBBA 3BRCA 3SEEA 2UXDO 3WW4A 3R6SA 1GKBA 1SESA 4FMTA 4JDMA 3T3YA 1UN1A 5ABJC 4S2DA 1W9FA 4EN9B 2VMIA 3I2JA 4CP1A 3M1HA 4M3CB 2OT5A 2BOCC 1C3HA 2P3YA 1W8TA 2AXTZ 1K45A 4XFAA 2YUEA 1M93A 4KP4A 3LEKA 2XJVA 1PIV3 2W1UA 2B7YA 1IX9A 3ZFFC 5L3FA 4DRRA 5FZKA 3AG4C 4XFIA 1TUBB 2XR4A 5IE9A 2UY8A 2KXLA 2JDAA 3IFXA 1F2NA 4F83A 1PNGA 4ZU4A 2RDQA 3VDDB 4H13B 3IJ4A 4LP8A 4OCTA 5FYSA 4A45A 4PDWB 4QDSA 4WV8A 5ERLA 4WM8C 3OPWA 4ICGA 2D3PA 2UU8A 3F5TA 1HNWB 4MV2A 1PVC3 4FFIA 2AYHA 2VCBA 2YPJA 1UNBA 4LF4B 2RN9A 4P2ZA 1OC1A 1XBFA 3W7TA 5EC2C 3AJZA 5H9PA 3KGZA 4JV4A 5DAQA 3VDBA 1EPWA 1AROP 3QBQA 1K7DA 2DWEC 3CCQV 4OVEA 4LFCB 5LGNA 2QKDA 5IVBA 4QPKA 4QPIC 1SFYA 2O8QA 2LTNA 1HV0A 5HV0A 4AVBA 2RS31 1S0DA 4QPGA 1GTOA 1VP6A 4YLZA 2V7QG 1L7LA 1FOD1 4N9IA 1UIJA 3T2QA 5A7SA 2QWOB 4RQPA 5LOVB 3NR7A 1HN0A 1GWLA 3T0AA 4A41A 5FQ0B 2W46A 3M3CA 3I49A 1E5IA 3TN91 3BI3A 2HWD2 3AC0A 5LK5A 2VZSA 2J22A 1VR3A 1OCCB 1VRBA 2FQPA 3B4SA 1V9U1 3KVBA 1EUUA 2ZGSA 2EILB 3QNEA 4AHYA 3JYCA 5JH7A 1W8ZA 1FNYA 5FZOB 3T08A 5IATA 4FM1A 3ABMB 5JZGB 3M7MX 4TLFA 1P4RA 4LF8B 2PA7A 4B3SB 4K8ZA 1JI6A 4ZI7B 1SRYA 5D8AB 4BOWA 5F2SA 1W9WA 1GWKA 3IDBB 1ULGA 1S4CA 2YGLA 1K92A 1JN2P 3LIHA 3MFCA 5D5PA 3ZX6A 2ZEYA 1EV12 4JZ2A 3TEXA 3I2HA 4CDQC 3H1JH 2HKXA 2Q6AA 5T5LA 1VMGA 3T1CA 3UNPA 3IDEA 3VUOA 3IMMA 3KB5A 1B09A 1O4ZA 2XJRA 4M3CE 2Y34A 4YJ3A 1SS3A 2FCUA 2H3OA 2P3IA 4MO3M 1I08A 4NHXA 1ZL8A 2R043 1YUDA 3AVRA 1MVQA 2FDKA 5LGUA 4OX9B 1YLLA 4N90A 4Y5SA 1US2A 1VRH3 5F5AA 5K9YA 4FTBA 2WLMA 3ZMTA 4GKKB 4OPAA 3RJRA 1S3JA 4OMDA 3EHKA 1G6NA 1H1AA 3A8TA 2B9ZA 2EIJC 1M9NA 2WQ4A 3CJIB 3K0DA 1IQDC 1EUTA 1AHSA 3W7WA 2PYTA 4XMIA 1UX7A 4FVMA 2RM22 2ZS6B 3AKTA 4NRQA 3UKNA 4EFBA 2HWB3 1DF0A 1IG3A 4DB5A 3C2UA 5FMBA 4I0XA 2H0VA 1HR0B 3O0XA 4PIXA 2QQPA 4QKDA 3LE0A 2VC9A 2FDIA 4Q4X3 1WW5A 2WAOA 3H3ZA 4QX0A 1YQ5A 5BR8O 3VZNA 5C8WA 3POFA 4GMP3 3NNGA 2NZ9A 2P37A 5IT6A 2YC4A 1ND2C 2O1QA 3H1LH 4LR3A 4K21A 4E2SA 1UAIA 4YZ1A 1NH2B 5D21A 4BZ4A 1OQDA 4C8DA 4J11A 4CH5A 3FB6C 1E1QG 4A7YA 1BHGA 2D3RA 4U3JA 2QQNA 1W6NB 3KLSA 2WIIB 2VQEO 3BIWE 1CAUB 5JXIA 4DEVA 5LW9A 1W9YA 3ASNB 2FDFA 3OD4A 1AXKA 2GN7A 1VQ5V 5A3MA 2Y26A 5A3LA 1P84F 2VQFO 4QM8A 2E7TA 2DYSC 1PIV2 3DTUB 3WV6A 3R4DB 5FYHA 5I0DA 4M3CF 4DR6B 5A1AA 5FZ1A 2BSKA 3PUSA 1FT9A 1LOCA 1CAVA 4WFAV 3D3IA 1WCSA 2X8KA 1IBKO 2V5YA 2WLKA 2HHHB 3C7EA 1FX5A 3WCSA 3SQOA 1XE7A 1CGPA 3P30A 2PUSA 2W95A 2HJFC 1H2NA 3NV2A 4COUA 2EIMC 1DGWA 4MVUA 4BDVB 4FPPA 3BB6A 3HOBA 3H9VA 2ZD9A 3CCUV 1EAH1 2YGMA 5EK0A 5FYVA 1N8RW 2Z79A 2CV6A 4BXFA 2WABA 1PVC2 3DECA 3R0RA 5K1PA 3CC2V 4XF3A 1QJX1 3N36A 3W21A 3OYWA 1LHNA 3MUY1 4DR1O 4PLOA 3KV9A 3J9SA 3RN4A 2JG8A 5I93A 4YY3B 1ZLZA 3VBUA 4YIOA 2GU9A 4GT1A 2Q73A 4Y4RA 1TMF3 2YC0A 2WLIA 2PAEA 5LY2A 1D2QA 1ZWIC 4UFLA 1N0JA 2FKXA 4XE9A 4AEDA 4DO2A 2C4XA 4Q5OA 1M06G 4D7SA 3C3VA 3HPNA 3OPZA 3STLC 5LWBA 2WWJA 3FFQA 1KD7A 1UY1A 3CEWA 4JC1A 3E86A 3W9AA 2LO1A 3VQWA 4NB5A 1ZA7A 5CB7A 2ATFA 5GTIZ 3ATGA 2VAUA 4WVMA 3IIIA 5JUVA 1ST8A 5C3SA 1H1MA 3N27A 4CH4A 4ZXKA 4LBMA 1KECA 4UBGA 4XUOA 5T5JA 4OZOA 1WA8B 4CU7A 2BTOA 4FTSA 2DTWA 2TEPA 1SDDB 3H1YA 5IJ9A 2ZX4A 2Z5UA 1W2TA 4QX8A 4KGQA 4DR3O 5LMNB 2DOSA 1BJQA 3MW4A 4UBHA 4CCLA 3SNMA 3OMIB 3KWVA 1IURA 1NLRA 4BQ4A 2UYBA 2EJRA 3CMGA 4YXWG 4YWAA 5GM0A 4RS5B 1O5LA 1EY2A 2UUCB 3LA7A 5HCBA 4JTDB 1QOTA 2D44A 4IE5A 5FLHA 2A75A 3ZN5A 2LP7A 4EKWA 2FBEA 2R042 5FZLA 5FWJA 3BTYA 5C8YA 1DQ4A 3AP5A 3T30A 4XDLA 4I50A 2Y0PA 5IK7A 2WLNA 4BM8A 1ENRA 2PZSA 1A8DA 1VRH2 4FBFA 3TJTA 3NNFA 2NM1A 5FPRA 1ZUQA 4LPLA 4OGQB 1Q86W 1VAKA 4RO2A 3MZHA 1GP5A 2QM8A 1ENXA 5T3NA 3ILFA 3RZGA 2WNVA 3PU3A 5J96B 2XJTA 1WGPA 2R071 1UO9A 1C1FA 1W9TA 2V4VA 1ORQC 3IAQA 2N04A 2DUPA 5B3SC 5L3CA 2VBPA 2UYAA 5DN6G 5EP9A 4JAAA 2AGSA 2RVAA 2HWB2 4KQ7A 4W4LA 1OOPC 2VXJA 4MGTA 2P06A 3WQ7A 1WP7A 2E63A 4O2AA 1RJ8A 2IH1C 1DQ5A 2CTPA 2D6LX 3ZXJA 3HEIA 4N7UA 2WLLA 3WG7C 4DV0B 1XDCA 3BCWA 2IWGB 3UT5B 3FX3A 1D2DA 2OCCB 3OD0A 1U96A 2J1VA 2Y48A 2VZQA 3F95A 2R7EB 3RZJA 4LK7A 2OA2A 2P34A 4JDOA 1WW7A 3RYFA 5LA1A 3QTCA 5FYYA 1TQ5A 1D0GA 1UCXA 3TAYA 3E83A 3U10A 1K33A 3I59B 5C4WB 2HWE3 4L87A 4XJ9A 5EYPA 3NKGA 2QJVA 2HYXA 2ZHNA 4LKFA 1NZCA 4LLFA 1P49A 2L9LA 3ACLA 3JCIA 4AR2A 2PHXA 4YZ2A 3S57A 1JZ4A 3AKSA 4H14A 2WA3A 4MXVA 5T5PA 3SH4A 2YYOA 2UXBB 2D6OX 3N35A 5IYYA 3SPJA 3ACGA 3VBRA 3BA8A 5FMOL 5KA6A 2B5UA 3LDKA 1NLQA 4QB6A 4FM0A 3AL6A 4KHPO 5C71A 1NQDA 4KWJA 5B1BC 1XNCA 4RSUA 4CSWA 5LHGA 2B39A 3KKYA 1XNDA 2CL2A 4X66O 4WM7C 2R30A 4I9WA 5L3GA 3SH5A 1AVBA 2EF6A 5LB6A 2WLHA 2WINB 2GDSA 1COV1 4SLIA 2K0GA 3DYOA 2QKCA 2Q8OA 3JAMN 3CC7V 5LA9A 3ZYJB 3TEWA 1BKZA 3JB4C 4DQAA 4URTA 4OI0A 2ZHLA 3IT8A 4ES9A 1NCRA 1LR5A 3ABUA 1X9TA 2DMXA 4AFCA 5JXHA 3S3WA 4NR1A 1OSGA 1W6QB 5HV4A 4LHKA 4GB33 3ZXFA 1XREA 1LOBA 4J6GA 1GRJA 2YFUA 3L9DA 2AR6A 3HN3A 2QZ3A 2PHWA 4LORA 2HBUA 1JMKC 2ES3A 3CD6V 4AK3A 1AL23 1Q82W 1JTZX 2YXLA 4RR3C 1PNMA 3GM8A 4EN0A 5FTTC 1PO13 1R1A1 1RUE1 1TMF2 5FZIA 3JAKB 2Q68A 4M3CA 3I3BA 2E7QA 3ZRSA 3KQRA 2VBBA 4LF5B 4Q0VA 3L9JT 4RQFA 2XQRA 4IIJB 1IBMB 1J3QA 2Y6JA 3GWKC 2YB7A 3DF0A 4Z2WA 1AX2A 1TUBA 3K9SA 1OA4A 2XUEA 1TUEB 3EMRA 1YQ2A 2WYSA 4IE4A 4CEYB 5FR3A 1VF7A 4DYLA 1S0IA 2A0LA 1REDA 1WCDJ 3VDDA 3CJHA 3UGFA 1QQP3 4BLJA 4PDWA 1RSOA 2GZWA 3JZVA 4FK5C 5CISA 4KFMA 5J9PC 4JKKA 1SLIA 1Z7S3 2HKOA 2ZZJA 5BNNB 2P7TC 4N43C 3LDBA 3AKRA 1S55A 4JGZA 2PYJA 5EJZB 5FZ9A 4EFEA 4E4SA 3WF1A 4MTXA 3OOXA 3B77A 2KQXA 4LKDA 1NYWA 3KV5A 4WZFA 1G4YB 3K03A 2ADQB 2HFEC 5IVFA 5IDJA 1M56B 3MGUA 3P1IA 1N47A 3EBRA 4BJ0A 5L9VA 2ERFA 4QPGC 1WLDA 1N3QA 2IFRA 3C3SA 1AR91 2WAMA 2Q4PA 3N9QA 5CNAA 1YF2A 2F4VB 3AG7A 4IEWA 2P4KA 4RQPC 3LIGA 2JX9A 4CPBD 1JW6A 1HP8A 2JE8A 4FPEA 4WZCA 2G9GA 4XF4A 5LOVA 3D6EA 4DUYB 1LR1A 1ULFA 5FPAA 1A34A 5EIYB 3VD7A 5I8YA 2CWMA 2VUAA 1XC6A 1BK0A 3HMYA 1KKCA 3NJZA 5K4LA 2ZE8A 1YI9A 5J48A 4ONUA 1FXKA 4EE2A 4HZFA 2XVLA 5DG1A 5ABJB 1HKDA 2C9KA 4ZKIA 4XZUG 2EALA 1AX1A 4UW3A 1BE3H 3E89A 3PMEA 4AVVA 5HCFA 5JZGA 4KG8A 1U5XA 3C8XA 4OXSA 4XYXA 3BAAA 2WRAA 1I7FA 4HETA 4ZI7A 5D8AA 5DMYA 5C7GA 3AG4B 1WLCA 4L92A 2ZNJA 4JI3B 2XMLA 3WP3A 4AYUA 2JDUA 2PYLA 3FKSG 4BISA 3PLQA 5A6XA 5B1OA 5JVDB 1HW7A 2AACA 3WINE 2W6JG 1OT5A 2JD4A 4RFRB 1UF2C 4LHSA 5KMGB 2VQTA 1REFA 5CAZA 1Q56A 2B1GA 1F4MA 2ATKC 3E6DA 1Y66A 3F5WC 2HWE2 2QM4A 2UUBO 2A7WA 5F3EA 4TXWA 5C9AB 1Y6XA 4LK6A 2JJ6A 3Q8CA 3SGIA 4FTEA 1RUD1 3RMYA 1SHWB 4EN8B 3PTYA 5C8CC 2RS33 3NQHA 4AQTA 5IYBO 1BHBA 1KDKA 4A42A 1OHHG 1LHVA 3CJIA 2HLEA 3ILRA 1DU3D 4IV1C 1R3IC 4P9OA 3TN93 3CMEV 1XE8A 3WDUA 4DV2O 1MZFA 5F37A 1GNHA 3M70A 3ZM8A 4DV7O 1DGWX 1V9U3 5CFCC 3LSUA 2DFCA 3E8GA 1NY71 4LR4A 1G8MA 4GD4A 2WZEA 4BQXA 3UKMA 3WHUA 3C3TA 2JG9C 2XJQA 2RDNA 3VOUA 3LSEA 4XDOA 1UY2A 3HR9A 3MD0A 4FJCC 1O3QA 1DYPA 1V6MA 2VM9A 3UK9A 3O0WA 1OH3A 2YSUB 1DLLA 3NW4A 4FFFA 1GANA 2WL1A 1GUIA 1UPGA 1LGCA 1KEXA 2P2KA 1QR8A 2VO5A 3VV1A 3BPSA 4AFBA 1AR1B 3POGA 2W9XA 1T6BX 4LC1A 3ZLIA 4B3NA 4LIUA 4AAPA 2IXJA 1BMFG 1DQ2A 1M4UA 2QA4V 1W6NA 2JE9A 1QCEA 1YDXA 2KB1A 2XQXA 1E5RA 1CAUA 2VVEA 2A71A 4YM3A 3ZKUA 2W87A 4NOTA 5FOBB 2WSSG 4GKXA 1W6PB 3POIA 4K7JA 3JALB 5C3QA 2VOWA 2VZPA 4KMQA 1NQTA 2ADDA 4IE7A 4CH3A 2Q8VA 5DAXA 1ACCA 3NKTA 4LBOA 4TLGA 3LB9A 4JQRA 3I55V 3USUB 3TB0A 2Z3YA 4LF4O 3DN7A 5FY5A 3H1KH 4CXWA 2Z2SB 4J1XA 1BGYH 3UM7A 4YARA 2GH8A 4ATFA 4CCMA 1DK1A 1URFA 1PKXA 3B3QE 4QD2A 1RL3A 2VZOA 4LFCO 1QQP2 4NUBA 1RFYA 3QD6A 3MFAA 2OYZA 2A1XA 3JARB 1YRZA 4YVWC 4NRMA 2E32A 1XNBA 1S2EA 5A6QA 4GQ7A 4JTNA 5DAPA 1U5YA 1Z7S2 5CBLA 1Q8VA 1WA4A 2BCCH 5DAWA 3S30A 2RMKB 1ZRIA 2QVSB 4ZZ8A 4BAYA 4XC9A 3JD0A 3WNOA 3FAVB 1NS1A 3LKJA 2WLJA 4ARXA 2WFF1 3VBUC 2YBKA 4QU1A 2QDOA 3LA2A 3OG2A 1W8OA 5FY7A 3ZHSA 3VDAA 4MSWC 5EBMC 4DV3B 1JJ2U 4TSVA 4CP9A 3OGRA 3WNLA 3NNLA 1CXZB 1NX9A 2CAUA 1SFPA 2DCJA 2A6XA 1H2GA 4B1LA 1ND2B 5AFBA 3EQEA 3PUQA 2UUAO 1WKYA 2ID4A 1GOFA 1BL8A 5LBCA 5BUVA 4MOAA 1UKRA 4HMZA 3RBZA 1NTKH 3TYJA 5CN0A 4NWVA 4LF8O 3J7NA 4B3SO 3ZPYA 1CONA 2JIJA 4LULA 3GF6A 2DCKA 1WMEA 2F23A 2A70A 4XQ4A 5M0TA 3MLKA 4E9KA 1AJPA 2X7RB 1HXS1 3N7MA 3APBA 3LEMA 3WG4A 5FOJB 4XTPA 4ASMB 2QDRA 1JZ7A 3GZEA 1CWPA 5IY5C 1ENVA 2DYSB 3AG1B 3RZKA 1NOVA 1QHDA 3GDBA 1QKQA 3QG5A 4XDQA 1NTMH 1KP2A 4FLTA 2VMCA 1VQ4V 5FZ4A 3N9OA 2YY1A 4MVTA 1OCZC 4OX9O 3SH3A 2ITDC 2CDPA 2ZGRA 3GBFA 1KB9F 4IGGA 1X59A 1FAYA 4IEOA 2CY6A 1EAH3 2DCTA 2JDZA 3AP6A 3DGEA 4GKKO 5DAVA 1ZM1A 4RS5A 2W0XA 1ALYA 2CHHA 4XDJA 1QGLA 2DWRA 2ZACA 5JDBA 2UXCO 4TWTA 1MQTB 4RGGA 2DU0A 3CZUA 2DBIA 1GN2A 4J9ZB 2WC2A 5LASA 3WEZA 3FUOA 1RMU1 3FHQA 2QQIA 3AK3A 4QQLA 3AP4A 2WNVC 4XJAA 1PL0A 4I4TB 2ET1A 1HR0O 4B3TB 2RS32 1J84A 4YM0A 3LDDA 5B5EZ 3HNBM 4R4ZA 1KJLA 4XACA 4DK1A 2DTYA 1JYXA 2CTRA 3FYIB 1W90A 3SDLA 2E53A 2E33A 4MADA 3KT1A 1YWKA 4I0BA 3TN92 1SZTA 5FZAA 4JI5O 4A3ZA 4ZS3A 3HR0A 4U36A 2RS51 5IAXA 3MHHC 4JF3A 3ABLB 4QGPA 2BZDA 5IWFA 4QAWA 5L3EA 2WZ8A 1V9U2 3WSOA 5BY5A 2GALA 4FP2A 1CESA 3CB2A 2YFZA 2YU2A 1ZZ9A 4OZXA 1CPYA 3C90A 4G28B 2GNMA 3F7YC 4LFBO 4JVAA 3FUQA 3UT5A 1MSDA 4OI2A 3J26N 1NCQB 1LECA 1BXHA 5IFPA 1DF5A 2P6HA 1N32B 2O8OA 3DXRB 4I0WB 1O8PA 1WNSA 1QDCA 3IPVB 3I59A 4JI6O 1FYUA 5C4WA 2GTAA 2WO3A 3FBMA 4K8FA 2DJVA 3QF7A 1XSQA 1BQZA 1SLAA 5JCOA 5F2WA 1R3JC 3I2FA 3IBMA 4DXSA 1XL4A 4DR6O 2Z4FA 3T2OA 1W0PA 1XEQA 3IC7A 3OPTA 5B2GB 3ZHRA 3A0RA 4ZZ5A 1H2MA 1C1LA 3T2TA 3O1OA 4YZ5A 2OZ6A 2AREA 4LO8A 4CCCA 4CUGA 2RM21 1AXZA 4O61A 2D3OW 1TVGA 3Q8BA 5AG2A 1UYZA 4RUEA 4BU2A 3LSSA 5CEHA 5A3NA 3RMXA 2YU1A 4C0BA 1JU3A 5FKBA 1UOBA 2BU9A 3K3OA 2PHUA 2JEMA 4XBNA 2IC1A 2QQMA 3E6CC 1DF4A 3BODA 2HG5C 4DUWA 3H1WA 3WF2A 2R073 1M4WA 4LTAA 1JYIA 3G71V 2A3XA 4P5YA 3D0JA 4NRPA 4L8JA 1RB8G 4NWWA 3LFMA 1NCRC 5LXTA 1KDMA 1Q6HA 4LEJA 1WW6A 1QY4A 5F32A 5B3SB 4A5UB 4YY3O 1H8TC 5L3DA 3U75A 4Y1YA 5GONB 4YJ2B 4GIQA 1AR71 1ZREA 4ATEA 5KHKA 4XBFA 1FFXB 4KBZA 5FZ6A 1W6QA 5A33B 1J59A 3ABTA 4FVVA 4CUAA 3WG7B 3S3XA 1UXZA 2KR2A 2ZEXA 4MXWB 2KSDA 1V6IA 5FZ7A 1VBE1 5CYYA 5JPMB 4AL9A 3LNMB 4AHZA 2C9AA 3NMBA 1GSLA 3O1SA 1NU1H 1GV9A 2PAMA 1TZOA 2Y6LA 1K5MB 4EV0A 3MDSA 1UW8A 1K5SA 4XFCA 3D4KA 5CA6A 3JAKA 1XE0A 5ITZA 2P3KA 3NSTA 1HV1A 2BUKA 1PIV1 2YICA 1UXXX 2R061 4IIJA 1HX6A 3T0DA 2X29A 4LFAB 1OVSA 5JOYA 2C5DA 3PHMA 1VBB2 1YCIA 2PMWB 4CEYA 2ZIMA 1NJIW 1BK1A 1N3PA 3ZHUA 3EB7A 4YIPA 2QSAA 1NKGA 2G38A 1V70A 1UYXA 3MEPA 2KD7A 2XLAA 2ZE6A 4PF1A 2UUCO 3WQ0A 1UPIA 5BNNA 5B1BB 3ABZA 3VBSA 4H0LB 4LO5B 1XSRA 1AJKA 3WQBA 4YG3A 5I0TA 3C7FA 4YGEA 1COV3 2BNOA 2DE0X 3IB3A 3UJQA 5FKCA 1OH4A 4ZHNA 3HQXA 1ZBA1 1Q8IA 2JEXA 4GWIA 2B46X 3N7LA 3W59A 4LNVA 1I3HA 1KQSU 3HBZA 1EAH2 4DRXB 3ZSJA 1AI6A 1ZRDA 3JATB 1LOFA 4Q26A 2XT9A 4TSFG 1CZTA 3B2EE 3NV3A 3TETA 3CQOA 4PIYA 2HEWF 5KXBA 3SJBC 2PY5A 3K9AA 2EILC 4J25A 4CUCA 4AEJA 2BNMA 2IM9A 4JHTA 1JH5A 1LCLA 4M0NA 3A22A 5JPNB 4YGCA 4GX2A 1R081 1RUE3 1R1A3 4O9EA 2JK5C 3ABMC 1B35B 5ABJA 2EAAA 5JZGC 4DV0O 4DNYA 1IKQA 1XNQO 4H44B 1JQ0A 1G1XB 3SCHA 2VQEB 4I2OA 2FDHA 4IERA 3ZFFA 1XYNA 3IC9A 3H8RA 1UL9A 1JR9A 2Y6KA 2EINB 2OIGA 5FZGA 2R0HA 2NLRA 2RJZA 2GH2A 4UYBA 4A3XA 3ZXDA 3RZMA 4CZSA 4FAHA 2DVDA 3G4SV 5E88A 3HD8B 3JASB 4ISRA 1XNTA 3L73H 2QQLA 1MA1A 3WW3A 5G05L 4WM8A 3L70H 4BYYA 2ZMKA 3VDCA 5GKAC 1OD5A 2PFWA 1QLNA 3I54A 1SPPB 3V56A 5JJNB 4BA6A 3CIHA 2R041 5A7WB 1XU1A 2UXBO 3JAWB 4DR5B 1QJZA 5FZMA 1D2SA 1H4GA 3C7GA 3MHSC 4H55A 3D3QA 2O0OA 2OXBA 1YXWA 1VRH1 1AR93 4DXTA 3VZMA 1BHAA 2ETEA 1FXVA 1T6GC 2IXLA 2EULA 3B9CA 3VZJA 4QXCA 4UB6Z 2Q8EA 3U4XA 5KHIA 4OYUA 3OSDA 5JMCA 5LEKA 3KF3A 2QQOA 1G9FA 1UZVA 4LBNA 3MYXA 2IXCA 3SEPA 4MG2A 1S0GA 5E8AA 3TWIA 1W3VA 4WCEV 1ZYBA 2F6BA 4M4RA 3AK2A 1F9KA 4Z1VA 4QX7A 1GMGA 2OIEA 1G8WA 4LXLA 4CDUB 1CPMA 4UF0B 3K08A 1PMHX 3E35A 3K57A 4A6SA 4G27B 4LWSA 3NWKA 1M90W 1YQ8A 3B01A 4GXLA 1W0KG 1RJ7A 1CIWA 2D7FA 5JOZA 1POV1 4B29A 5F1RA 4JKLA 2E3CA 4LF5O 2A5ZA 3U14A 5HCHA 1IBMO 2XAGA 1MS0A 4AI0A 1UZ0A 2WUHA 3ASNC 2JB8A 1MZ5A 4JYCA 2WO7A 1QLEB 1KU9A 2Q9LA 3ZXLA 3K79A 3H8OA 5EZYB 4D6QA 4DR3B 2D5FA 2ZJCA 1IGOA 4LF7B 2VNRA 3BU0A 4NIIA 3JALA 2OTJV 1H1IA 4NTWA 3O5SA 1KUQA 3EYPA 3POEA 4PJ0Z 2IZWA 4UUJC 2IJJA 4LF6O 1EN6A 2IFWA 5DUUA 1VMJA 2H8PC 2FMDA 2WT2A 5F6LB 3AFGA 2QE3A 4AHCA 3JD4A 5TISZ 1HDKA 1LOGA 4HLTA 3L75H 4CXXA 3OGSA 5H2FZ 1VQNV 4X62O 4I02A 1NQJA 3NL1A 1G9AA 5HPOA 5FNVA 4D6RA 3JARA 3VL9A 4N23A 4BQ1A 3B02A 3UGHA 4EWDA 4LHNA 2F4VO 3JU9A 2EIDA 4JTOA 2A79B 4LBQB 4DUVA 4CRQA 5CFCB 3QVNA 1ULEA 4DUYO 1COV2 1DGRN 3FAVA 4HL0A 4UFZA 1G9DA 2TNFA 3ZIWA 2JG9B 2A3WA 2DDUA 4B4PA 3ES1A 1LOEA 2GSMB 4FZ0A 2D6KA 1Q8PA 2YHJA 4JZRA 4BW9A 3B00A 1GM8A 1ND2A 5C6CA 3LAGA 2PI4A 4W65A 5JR7B 4XTMA 5F6KA 4OHZA 1O6UA 3NAPB 3N2GB 1WUVA 5IYZB 4P9LA 3OUSA 3MIGA 1FMD1 1GU3A 2ZAHA 1Q6IA 2GC3A 4BWOA 3HKCB 4TQDA 4QHBA 5IW0A 1SQ4A 4QNHB 5ISLA 5FBZA 3QOPA 1Y3TA 3VKFC 2XLGA 3NNJA 4JI3O 3DC5A 1UKGA 3ZOIA 5KAFZ 1I5XA 1F7YA 1DGLA 1RUE2 4O4HB 1R1A2 1W06A 1RUI1 3AG2C 1XU2A 1SMVA 2WN3A 2R6QA 1XXNA 2XBO1 2Q0OC 1DZTA 2DUOA 3WW1A 4F6EA 1OZ0A 4HAMA 1JXNA 3AP9A 1Z78A 4HG6B 4Q0PA 5TSWA 4R9CA 3BU7A 1OLRA 4R8CA 1N34B 4XUQA 4X1KB 1SKVA 5F5IA 1JOBA 3OUFA 1KFXL 1VBC1 1KFUL 1W0OA 3ENRA 2ZGNA 2G9FA 3WB0A 4Q4W3 4KHPB 3WG3A 4DR4B 4BW5A 3K5LA 2VL4A 1FAFA 3RJ2X 3F2ZA 4YVWB 4AGRA 4DZGA 3HNMA 3ILNA 2VCAA 3JQWA 5EV7A 5L7OB 3AG3B 1Y7BA 4YNIA 4CEWC 4N7IA 2OKXA 3O12A 1PGSA 3B8MA 5BMVB 1PM9A 1KQRA 1HNZO 4P9IA 3FHIB 2WFF3 1SLBA 5A7PA 4NXNB 3D8CA 4AF9A 1H8EG 1PM7A 4HPKB 1AR92 1L8DA 4I4TA 4BQ2A 4F3JA 1FPN1 1VQ9V 2EICA 5CKMA 4JZGA 3WU2Z 2JRIA 4YM1A 2RDCA 3RW0A 4PBOA 3KV6A 1MR5A 3G7DA 5DUVA 4Q8KA 3TEZA 5GLZA 2RJKA 1JFFB 1Q81W 3CKHA 5FPUA 1KMIZ 4LKEA 1Z2GA 1HQLA 1C57A 4L11A 4HN0A 4CPBA 2F1MA 4NIHA 5FJKA 2YZ4A 3IN9A 2ZMLA 1RYYA 4XAEA 4Y5Z0 1K12A 4O4LB 1IOAA 4R4XA 3LOBA 2OCCC 4LBEC 1HXS3 4RHV3 2JJ1G 4TV9A 4CDWB 4Y22B 2ETNA 2HLDG 3D3AA 2B4KA 1LGBA 2GDFA 3BPZA 2GC0A 1NCQA 3Q4HB 3AMHA 1JZ6A 2DVAA 3AKQA 2YEVB 3DXRA 3KZ4C 4DK0A 5A1LA 3WZ1A 3V64A 4AEMA 5J98B 1SQQH 1D4M1 5HXVA 3U0ZA 3A2FA 3L72H 2VD7A 1GZCA 2ZR3A 1ND3C 3E5UA 2NMOA 4AI2A 2BOJA 2K9ZA 3MLJA 3ALQA 4AI9A 5E79Z 1AR4A 3IDCB 2WA4A 2WN2A 2WJSA 1NT0A 4DXWA 4ITCA 4GZ9A 1Q43A 4Z82A 5H6RA 1UWWA 5L73A 3SJCC 1LUWA 4AGGA 2MHFA 2WPDG 3W20A 4LCUC 1G9BA 1RMU3 2NP0A 5IAVA 2ZGQA 2XG3A 1R092 2QEXV 4NPMA 3ZFEB 2RV9A 4X6QB 3ZJZA 3AXDA 1AP6A 4HBNA 4DUXA 1Z5VA 3GCXA 2D6NA 1COWG 4Q4V1 3A21A 4IEUA 2W2IA 1W8UA 2ZMNA 4M4PA 1KGYA 3B40A 1SQPH 1NE6A 1QOSA 4OUEA 1IPKA 2GNDA 4X1YB 1GQHA 3HVDA 5BNOB 2RS53 1F4NA 3W58A 4HKOA 5DXDA 3H1HH 4Q1RA 4NHMA 3FLTA 4C91A 4DV3O 3PL0A 1UQXA 2W68A 4LUKA 5GONA 1JS9A 4YJ2A 3ABKB 1XMOB 4QGMA 1FFXA 4GX5A 5F2VO 1NY72 4OI4A 2ZX0A 2BDRA 4ZOLB 1MS8A 3I2IA 5A33A 3KCXA 2YXHA 2BWAA 2ZPXA 3ZYPA 2VXRA 5I0RA 3DSQA 1R6KA 4Y26A 4MXWA 3TNQA 4XXAA 4EB6B 5CFDB 4QX3A 5CU1A 1K5MA 3G6EV 1EZJA 5DDJ1 1S0JA 2N74A 2JGUA 4MZUA 1BBT1 4LMFA 4IYHA 4JX0A 2JKBA 3AL5A 4PD4F 2RMU2 1BMV2 4W50A 1D7PM 2B1IA 5FYUA 1KP3A 4ES8A 4A44A 3PMSA 4PA7A 2L35A 1LB2A 1NVPB 3BVCA 5SV8A 4TZDA 5GTHZ 3R4UA 3M99B 2UUBB 4D6TH 1AR81 4L9BA 3LEIA 4FQ4A 3WLUA 4DV1B 5IK8A 1AR61 3ML0A 3CCLV 4YW1A 1IQAA 4FFHA 2GC1A 3ZBHA 4XCAA 4X64B 2OZJA 2Q69A 3OR6C 2VTFA 4X89A 2V72A 3CNAA 3I3DA 4YPJA 3ACIA 5LK7B 1M56C 2WR9A 1JZ2A 1GN3A 4W6WA 1WCKA 1W6OB 2DBNA 1UJWB 1J3RA 2V1DA 2VTXJ 4YW7A 4PV1B 3OM3B 4Q4W2 3K51A 3N9NA 1C8NA 2ZCWA 1JOJA 2XGXA 3JATA 4B3TO 1AR73 4FLVA 2Q5ZA 3ZPOA 4BWAA 1XHXA 4B4RA 1F35A 5FP7A 2G9ZA 4UFIA 1IBLB 1PP9H 3N2KB 2WFF2 1STMA 4NAOA 1X36A 1VBE3 5I8TA 2YDEA 2XTAA 3RWKX 1MSWD 1IXBA 4FLWA 1SC5B 5FZEA 1QR9A 5FP3A 1V6JA 3CBNA 2G19A 2Y8KA 3EJKA 4UV8A 4AQYB 4RR3A 2D98A 4PHZA 1MS4A 1AVMA 4DV5O 4HVRA 2R063 1QDOA 3VQVA 5FK8A 1R6TA 1DZRA 3ES4A 3NRUA 1H30A 1N32O 4UT5A 2YBSA 3UJOA 5C3OA 2VNGA 3MF6A 4X8PA 3THTA 4EQVA 3AKPA 3JSLA 5HFMA 3A23A 2LW1A 4K35A 1YZBA 3G6BA 4NJ4A 1HXS2 1HWYA 4RHV2 1D5AA 2JDMA 1HRI1 3BHPA 3JASA 1RUNA 3OGIB 3S0MA 3K5MA 2GSYA 1RUOA 1D4VB 2FZ2A 1GFF2 5FY0A 5IWAB 5KUMA 2JJ2G 1IDSA 1KD1W 4RWUA 3HIFA 4N43A 1VQ6V 5C9AC 4DV6B 3SISA 1SBDA 2ZZQA 2WAAA 4Q0UA 3H3LA 3ZN0A 4DR2B 2E9QA 3JBG1 1ZBA3 2XASA 1ULPA 2DURA 3J7HA 3DV8A 2ZBJA 2F95B 1W2NA 1UOGA 2JENA 3SKJE 2M7WA 5K8SA 4O4IB 2HWF1 1LEDA 4XHXA 3CLPA 3AMNA 4DW1A 1YJWV 2ORXA 4AI3A 1C8M1 1JHJA 4C1WA 2CSGA 3GYDA 4JI1B 1YSCA 4MVZA 2DN9A 2J1EA 4CE8A 4LBKA 1VQ8V 1O9GA 1LNSA 1GZWA 1YITV 4QDRA 5GLVA 5JSRA 4D0QA 1RMU2 5FYCA 2BPA2 2E75B 4X1IB 1R083 1CAWB 2UUAB 3J8F1 5I0SA 4LF9O 4K3AA 3GJBA 2NYYA 1VBD3 1BYHA 3AX4A 1V54B 1WCUA 4CDUA 3AZZA 4UF0A 3MICA 5D1IA 3ZMUA 1GP6A 2XJSA 3RPQA 4DW0A 1IS6A 2RS52 1SETA 2RNBA 3ME2A 2N7GA 1SQXH 4QPJA 4YFZA 5FMCA 5H9RA 3WUDA 3OGCC 3SYQA 4UVAA 3S7IA 1PNKA 5J09A 1WW4A 2CNAA 3BN6A 3WXPA 3WFVA 1HN1A 4MGKE 4LFAO 4QGNA 4EEQA 1WLTA 3A4UA 1W3XA 3X29B 1LNQA 4CC5A 3U37A 1VF5B 3VBFB 1FD9A 4CH6A 3PTRB 1V6LA 5EZYA 4BH9A 2YS8A 2ZXQA 1BLZA 4BK5A 2FB5A 4F4LA 3H50A 4IXLA 3IMNA 2XHBA 4COYA 3DXTA 3LCPA 5FY9A 2VW2A 5IYCO 5K7PA 2BOBC 2G1MA 4IL7A 2A06H 5J37A 2UXCB 3WCRA 2W92A 4K1YA 3ECQA 4IDZA 5C8CA 4ZKTB 5FPBA 2YIBD 4IETA 3N9LA 3Q8FA 5CA0B 5IJ0B 5ACA3 4XXPA 4IV1A 4FQZA 5HBAA 1N33O 1YHFA 2XWJB 2A6ZA 3O1TA 5LMUB 3CRAA 4TQFA 3VZOA 2PQSA 4RGAA 1JMUB 4CS4A 1OFSA 3VQYA 1O5UA 1PVXA 4FFKA 1XQNA 3GB7C 5L3BA 3SYOA 1LKNA 3AMMA 5CFCA 4DXZA 5JMOA 4AXOA 4PQ9A 2X6BA 1H0BA 4WFBV 2BBVA 1AI7A 2BE3A 4JI5B 3AZYA 5AVPA 4NIGA 3Q8AA 3LQCA 4I3PA 3CEIA 2JG9A 3SPGA 5JI9A 1WPBA 3AEIA 3H7YA 2AGAA 4M0HA 4BQYA 2R16A 2IU0A 4PLNA 3N3HA 1AR72 1IHMA 5EFUA 3O9OA 2PHLA 5KC5A 5FP8A 2DQ0A 1POV3 4LFBB 2H0BA 4BMEA 3LFIA 2HJDA 3SJQC 1CR7A 3J7AU 1VB4A 3NAPA 3ON7A 3N2GA 1EPZA 5IYZA 2VMHA 1NR1A 1SQVH 3P3PA 4BLIA 2L6LA 4HNAB 1ODNA 3HKCA 1VBE2 1VBB1 1RXGA 2VMFA 2WT0A 2XKOA 1APNA 1K9MW 3MAQA 3OGJA 4JI6B 3A7QA 2R72A 5FRAA 1H4HA 3T0BA 1HRV1 3FWEA 3VGIA 3GJAA 3VZKA 3UYJA 4QQ2A 4NROA 5B1AB 4X20B 3HJRA 3AG1C 3ZYIB 2EXIA 4JGYC 2E31A 3B7MA 2BQPA 3QH7A 2R062 4R9AA 4IGQA 4MVQA 3RDIA 4OPHA 4NXMB 3AP7A 3PVOA 5KXCA 5A3TA 5FO8B 3WUCA 1KITA 5BZBA 3ORJA 1SF9A 4XURA 4X1KA 3ZS8C 5JI7A 5APAA 4FAGA 2HR3A 4DR5O 4MTGA 2VMGA 4LQRA 1YI7A 4B4QA 4YGBA 3P3NA 3S5QA 1VPHA 2JGDB 4LKSA 2KM2A 3GZUC 3GHNA 3ZXAC 1CJPA 4R52A 2MW2B 1MQTC 3H0OA 2YIDA 4YVWA 2BEOA 4JRLA 3LSQA 1XUQA 5FJHA 2BJSA 4Y1UA 1JOYA 2D40A 2KA3A 1OLQA 2EA7A 1SQFA 3CRRA 4V2WA 3CF6E 5BMVA 2ZABA 3ZMZA 1E5HA 3KSCA 3RZLA 3DYPA 3OT7A 3LSDA 2A9HA 1SDWA 2WS91 3MIEA 1ZBA2 2ORZA 2B5HA 4FPKA 2IW5A 4AAXA 1ODMA 3ETPA 1XOUA 2P6JA 4HPKA 4BXSV 4MVOA 1R3LC 3BALA 5FLXN 4B3RB 3K0GA 3OB8A 1SQBH 1ASJ2 2FCVA 1OF4A 4XOGA 3M3EA 4FOVA 1JFFA 1O7FA 4S2HA 5FK7A 1I5ZA 1EN4A 5CB4B 4ZBMA 1JZ3A 2CWSA 3ABLC 2HH9A 5HFLA 1FMD3 3ZRVA 1JZ5A 1G6UA 2YUAA 4FLXA 1OV9A 2XPJA 4O4LA 4J7JA 2AC1A 5IJRA 1XNAA 2Q67A 5BY1A 1R082 3U1XA 5F39A 4C7UA 1A32A 1NCQC 1RUI3 2AUYA 2LGWA 2RG4A 2ZHKA 1JYVA 1B04A 3EHBB 4Y22A 1BVVA 2JECA 1JUHA 4XUTA 4MVRA 2P1BA 4XEZA 2QWQB 2XBO3 1VBD2 1J1TA 3AG2B 3Q4HA 1NUKA 3NO8A 4NHYA 3CE2A 2FTKA 5KX5B 1J1LA 4RFT0 1QXJA 2ZINA 4Q29A 2DVFA 2YEVA 4SBVA 4I09A 3CCJV 4KWLA 2WWUA 4JHZA 2XAJA 4LF7O 1VBC3 4IT5A 4BMBA 4ZXEA 4QDQA 3AYCA 2BYVE 5JJEB 5AC93 3DKWA 5LYJB 3RWNA 4IHJA 4UWDA 3LGRA 1CD3G 2OQ6A 1PMJX 2QQWA 1I6XA 3OEEG 4YHHO 1ZA4A 4X8NA 3POBA 1YIPA 4LBLA 5EHDA 4LUMA 3RYRA 3NJXA 4AW7A 2PTMA 2HEPA 1MNGA 1U97A 3CYOA 2JB4A 4D3WA 5JVVA 5JLVA 3AK1A 4CEWB 2ZM6B 1LJ7A 5B66Z 4AFMA 2IXKA 4COVA 4MHRA 4OFGA 2OYQA 5IVCA 3QCWA 1B3QA 4D94A 2D6PA 4Q27A 1NKDA 3TOJA 2A3YA 2CK3G 3ZFEA 2V09A 5JQGB 1FPN3 2IJHA 2CDOA 2PAKA 1S76D 3CCVV 2QQJA 2JDIG 4MW8A 3FLRA 4Q8LA 1RP3B 2JIGA 3K06A 2ITCC 2W1QA 4V2VA 5ACA2 2JDYA 2QQVA 3UGGA 3OBRA 4X1YA 4PCRA 5IVEA 5L9BA 3HPLC 5L36A 1H38A 1MS3A 5FWEA 2V4DA 2OTLV 1X9PA 4W6YA 2ZGUA 4E4DX 3BKZA 1XNQB 1S77D 4JAVA 4M00A 4ZOLA 1Y76B 4QQOA 1ONAA 2F66C 5K0UC 1LTEA 5LY1A 4AQSA 2WLIB 2Y6HA 2ZKLA 3SPHA 1K5MC 2QKAA 4EROA 1GAXA 1RUJ1 3WW2A 1IKPA 1VAMA 3VQXA 4EB6A 3RSJA 1WB7A 5CFDA 3VBBA 2LJ2A 1LGNA 2EXJA 2CYFA 1R1BA 4GJYA 3W7XA 1LODA 3GBWA 3SPCA 2RJ2A 5FP9A 1D4M3 1YJNV 3MV01 3RYIB 3TK1A 2VG9A 3S5AA 3TEYA 3VKLA 5H5NA 3AJYA 1MMMA 4F8AA 3CU7A 5A32A 4YVSB 2VWJA 1ND3B 4CVUA 1OURA 4JRAA 5DUXA 2PHDA 1E57A 2SBAA 5FIXA 1AX0A 1N34O 2NPIA 4W4ZA 4OQ8A 1QOOA 2QUOA 2B42B 2CTQA 1HNXO 5FZ8A 2E74B 1Q8OA 1OHFA 3NJVA 4DR4O 3PJYA 4FPOB 3K4ZA 2VPVA 2HVKC 3T09A 4JYAB 3EO6A 4PT6A 5KLVH 1VAVA 2HJIA 4BQ5A 4Q4V3 4UFMA 1WJZA 1DBNA 3EVKA 3WDWA 4TN7A 3GVMA 4NXNO 4E2QA 4MGYE 3CPWU 1CEZA 3CJXA 2JD9A 3THPA 1ZVFA 1ZNPA 2HEYF 1MACA 4J9YB 3RZZA 4XF0A 2HBTA 3KV4A 4Y1ZA 2A6WA 2QWPB 4J41A 4AGVA 4NTXA 2GAUA 1H8TA 1XOYA 2CGPA 3BA9A 2BTQA 2P5OA 3E5XA 2Q7HA 3N9MA 3BOWA 4FPHA 3K4DA 4Y33A 3N2KA 1W8NA 1LHOA 2V4AA 1B35C 2PLV1 1VQLV 5ANQA 2AEZA 4IEXA 4XFGA 5F8PA 5DDJ3 3WF4A 3ZHQA 2BFUS 1BBT3 3APQA 3PU8A 2B9UA 4J7ZA 1JU4A 3WG1A 1YO8A 4WBNB 2DV9A 5FPXA 1GP4A 2BRTA 1UIKA 3SCGA 1FMD2 2EINC 3K75B 2WLLB 1JBCA 4FPYA 5FUIA 2LUWA 3ZR6A 4ZY9A 1N36O 1ZX3A 1I94B 1X4TA 1VARA 1OFNA 5KA5A 2VOTA 1AR83 3HKEB 2JIZG 1O4TA 1RUI2 3RYFB 1NA1B 5DN2A 1QNMA 3HQUA 3A0BZ 1AR63 1YFWA 2ZGMA 3QO8A 5DG2A 4WBBA 2XBO2 3ZSEA 4FFBB 1CP9A 4XVHA 4HXCA 4OHYA 4R7CA 4LF6B 3A0HZ 1DQ6A 4RUFA 2ZCEA 1JODA 3OR7C 4MGSA 2WLPA 3PIJA 2JS3A 3WY6A 5DZEA 4CS2A 1VBC2 4XBQA 4TV8B 4X62B 2VCMA 1GN4A 2BERA 4FZ1A 3ZN4A 5AC92 1MOFA 1IG0A 4UW6A 1FI2A 3JUUA 2J1TA 3VBRB 1GR3A 4MSVA 2JS5A 4O4IA 1QJEA 1H2SB 4CCDA 1XILA 2WQ8A 1OXCA 5T50A 5FQ0A 4PDRA 1K3IA 2H6BA 1VE0A 4TTGA 5JWPA 5EZWA 4NPRA 1PV0A 2AEYA 1N4CA 2D6MA 3OBZA 3HQRA 2F93B 3PVBB 4MHUA 1OMIA 1RVF3 5IFTA 3ETGA 4X1IA 2B45X 3LOIA 4MGQA 3GGLA 3BTZA 1XMOO 1CAWA 1FPN2 4YZ3A 1DIWA 1GQGA 3MF9A 4L8QA 4GKYA 4CDUC 3UO2A 5FZOA 1SFNA 3OBAA 2EIBA 3UETA 5CKNA 4F7ZA 4Q4Y3 2R1DA 5KWRA 3VB9A 2LRPA 4CZZA 1NT2B 1HB3A 2ARBA 4R8HA 2RDRA 3K2OA 4W6XA 4XDPA 1OLME 2WNUB 3CL1A 5H6QA 3VBOB 2YXYA 2D3SA 5FP4A 3AYAA 2XB6C 1K42A 3D36A 2BFUL 3CRCA 1WCQA 1HRI3 4CYDA 4GUNA 2K9PA 2ZEWA 1QLEC 1X8MA 3JD1A 5IYDO 5FXZA 5JXJA 3FJSA 5F9TA 3I8TA 5C33A 2FHRA 2RJLA 4PDVA 3VBFA 1H8HG 4CDXB 2QGNA 1OJHA 3C7OA 2LGQA 2VMDA 1XL6A 4Q1PA 1HIXA 4Y1XA 4H7MA 3FX7A 4IGOA 3JBG3 3LF7A 4JASA 1D4M2 1OVPA 4DV1O 1A78A 3FB8C 1UYYA 3PUIA 3THOA 1GZ9A 2DYRB 3M8AA 4XCBA 1JJOA 3FC0A 4K40A 1R091 3B69A 3B94A 4X64O 5JR2A 4EZ4A 1W2AX 2PHFA 2HWF3 3CJHB 4FPJA 2VNVA 1UU4A 3DPRB 1EBOA 1C8M3 4HZ3A 1RSOB 1AUYA 4HK8A 3M7AA 2WT1A 4LA3A 2JKXA 2SLIA 4ZPIA 1HNZB 5IVVA 5BNPC 5CA0A 1ZRRA 5IJ0A 5CBFA 4XUNA 2IVIB 3WNKA 4JGZB 2WO1A 1GO3F 2O57A 4NYKA 2OCHA 3POSA 3K48A 3UKTA 1UY0A 1WMXA 4FPGA 3BCCH 1JUIA 4YFWA 4CU8A 2W91A 1BCCH 1BQPA 4H2AA 3NNMA 3VN4A 4EYUA 2YIAA 3J8F3 5LA2A 1QMJA 4ZHQB 4Q4V2 1PNLA 1RHI1 1IBLO 2BP6A 2BWCA 3OY8B 1ZZBA 4R9DA 4UCUA 4K0KB 4IW3A 2FDJA 3MW3A 3I2OA 1U5ZA 1QIQA 4K20A 2E7AA 1SLTA 3AYEA 5J1XA 1NAEA 5JSPA 3NAPC 2PGGA 1JOPA 1S2KA 4AQYO 5C3RA 2ZA9A 4D7YA 5KHHA 2RMU1 1VBA1 3V0BB 5FL7G 2BGOA 1BMV1 4OULA 3WP4A 1KC8W 1FXKB 4XUPA 1VB2A 3GWOA 1VF6A 1D0HA 4LO4B 4HNAA 2XHNA 1SQGA 1S0EA 4HVQA 1EN5A 2GTSA 2R32A 1AZDA 2DFBA 4GH4C 3K5NA 3TBDA 5DDJ2 4MW3A 2DCYA 5ANNA 3P5BA 1BBT2 4YRDA 2NNUA 4E4HA 1EP0A 1XQ8A 4X20A 4DUZO 3WR0A 1V9PA 1XHZA 3V65A 4JYBA 4ASUG 4B7KA 3U78A 3E8BA 2H6CA 1HLCA 4E2LA 5IWAO 3WD5A 4XF1A 4R6ZA 3POJA 3KD4A 4HYOA 2JVDA 1T5EA 3ZRXA 1KS4A 4DV6O 4GJZA 1H2LA 1TGOA 2ZE7A 1HJGA 4IEYA 1AR82 2NQYA 4KNCA 4D69A 4DR2O 3I3MA 3CCEV 4OHVA 4Q4W1 3JD71 5KAIZ 1VJ2A 5EYXA 2C0ZA 1AR62 4E8DA 3H8XA 4MGZE 2JGDA 3ZFGB 1IPSA 2LW8A 1MS9A 3RG0A 5L7OC 3AG3C 4GWJA 2X5IC 3W5MA 3WF0A 1XPWA 3TRSB 2XAFA 4XABA 1J3PA 1BT8A 4WFHA 3ACFA 3AVSA 4JI1O 5FCCA 4Y5TA 5G04L 4AVTA 3PVEA 2GP5A 3RYKA 1QEXA 4P5HA 1J5EO 5D2AA 3J7MA 4CTEA 1K5QA 4XZPA 3SCFA 1NZIA 1QJY1 3CMAV 2P3JA 4DFSA 4BCUA 1AR5A 2PN5A 4XJUA 1H2KA 2FDGA 1NXMA 2QNKA 5IHRA 4XAAA 4N53B 2ZKOA 3KT4A 4X9QA 3T1MA 1KXGA 4LH6A 3SJAC 1UU6A 4CXYA 5CB4A 1CN1A 1F5JA 4C90A 2GV9A 2EIKB 2VUCA 3TNPB 1VBB3 4H3WA 3CSXA 1CZVA 2YC2A 1O9HA 3LWCA 3MIHA 1FXZA 4CDWC 2Q7GA 5F3CA 1RVF2 4WFFA 4JV5B 3CHXA 3UCSC 2W39A 3K77A 4QMAA 4QHOA 2ZEZA 1HRV3 4RHV1 3LUTB 5H9QA 1ENQA 3I2DA 1L3JA 1LU2A 2JWPA 4NAMA 2WWWA 1UY4A 4Q4Y2 3WHTA 4JGYB 5FLIA 4LLOA 5KX5A 1RUH3 1WA8A 1ZBE1 4CU9A 5J2UB 2XONA 2UY9A 2PF4E 3ITQA 4W4KA 1HB1A 3SYAA 4FOYA 2JEUA 2R70A 3WDXA 5JOWA 4QQPA 2QTOA 1HRI2 4XETA 3EXUA 3OW2U 1GM9A 3WOGA 5LYJA 1AXYA 1HQWA 4PQQA 1DZQA 2VU9A 4D8MA 2RDSA 3N9PA 2VW0A 4NMIA 1RINA 1UY3A 2Y64A 1K97A 3I3EA 2GMPA 2CUGA 5JOXA 4EZHA 5EJ3A 4AVAA 4XJZA 3ZO0B 4AQ6A 3T1LA 5F5QA 2ZXWB 2W3JA 5FPZA 1SERA 3ZSKA 4CEWA 5KUKA 1OD3A 2O14A 2WS93 1O3RA 4D7TA 3JBG2 4COWA 2GNBA 3WB1A 3ZFEC 5LMUO 3WF3A 1V55B 4CCKA 5A3WA 1F51A 4PA4A 4UXAA 4D6SA 1QJFA 4CS3A 1CPNA 5JQGA 2HWF2 4LBJA 2ZIOA 1LESA 5KXEA 3TXSA 1C8M2 2JDNA 3BGAA 5FFOC 1IS3A 2LALA 3ZN1A 2H94A 2WQZC 5BNOC 1DDLA 2FMLA 4IESA 3KZIZ 5IT9N 4P9PA 3JD3A 2KKWA 2K2SA 4IV3B 1AYM1 4KXRA 3CCMV 3AB0A 3ABKC 2YXSA 2Z5WA 1WMFA 3ASIA 2OWOA 3KG2A 1SBFA 4UXNA 3KMHA 1W39A 1GKFA 2VULA 3J8F2 3VHNA 3WB2A 3T1HB 1EM1A 1YC61 2QZ2A 2CAVA 2M6YA 4DV5B 1Y76A 1J83A 4ASLA 3JSNA 2TUNA 2W1WA 1K8AW 4CP9B 4F6RB 2X05A 5GW7A 4UFKA 4KU8A 1PZ9A 3SPIA 3ZYGA 4EN6B 5CFDC 1XRUA 1MS5A 1N1VA 2Y6FA 2UWAA 1U12A 4B3MO 5GLTA 4XPVA 2VOKA 1WN7A 3AK0A 1RUG3 3ZEDA 2NN8A 3RFRA 5A3OA 4KGGA 3MIDA 1FATA 1PK6C 4INDA 2RQ6A 1I9RA 4Y3OA 1QVFU 1P7BA 3RYIA 2RHPA 4UW4A 2AH2A 1L7QA 4NXMO 3AMQA 3J4UH 4YVSA 1MS1A 2YV8A 2CGOA 3I97A 1ND3A 2Z42A 1Q7YW 1CAXB 1BSMA 1TAEA 5D5QA 1YJKA 1VQKV 4PA6A 4N8MA 5DQ0A 2EXHA 4JAUA 4WFEA 3AFKA 2OX0A 5A6YA 3LDRA 4DR7B 4LBQD 1UMZA 3K4AA 3BTXA 2VJXA 4AE2A 5BXXA 2VZVA 2OT7A 1SLLA 5CADA 2JDPA 2LROA 2A6VA 3E8FA 2OPKA 1OF3A 4FPFA 3GHMA 5FMOS 5DECA 5CBGA 2OVUA 3IIAA 1PGL1 2AZ0A 2UU9O 4ASKA 1M57B 3SXWA 3G80A 3KCCA 3AZXA 1S5HC 3IWZA 5EBWC 4UVBA 2Y0IA 1DQ0A 3O1VA 5L9RA 4QHZA 4J80A 5EYYA 2GP3A 5C93A 1YFXA 3A0KA 2YIBA 4RQEA 1K3EA 2HVJC 3DL3A 4B3RO 2Q5TA 4TYSA 4LF9B 2ZDIA 1OLMA 1W6MB 1GN6A 1A6CA 1RUC1 3E1F1 3ACHA 4AEKA 4QT6A 3FFZA 1RXFA 3RVHA 5K0UB 2VW1A 1RUJ3 3KHCA 3OGGA 3T1YO 1OQEA 4XMAA 4G9SB 4FLUA 1GZTA 1W03A 2DVBA 4Z2AA 1VP7A 2Y6GA 2P4VA 1W99A 1AF9A 1PM4A 2V73A 5FREA 1SCRA 3PUAA 4WBNA 2IJKA 3ZR5A 5LP6C 2FZ1A 1OPOA 4FO9A 2E5LB 2RCVA 2W08A 1Q90D 1N1TA 4RGKA 4U2AA 4Q4X2 1F23A 1ULOA 3HT2A 5FZHA 1ZAUA 3ZMOA 3MPBA 1HRV2 2VQ0A 1QF3A 3X2QC 2VZRA 4P9WA 3OJBA 1GOGA 3HKEA 4CP2A 1LAJA 1L0LH 1NA1A 1QJU1 4UCVA 4JI4B 1WD4A 5FZ0A 4KWUA 1W8WA 4FFBA 3ZN6B 5FYBA 2ZGKA 2Q1ZB 3N7KA 3D82A 2BOIA 4O2BB 5LHHA 4RL7A 1RUH2 2VOVA 2WZR3 4A6OA 1XYOA 4HKWA 3HWJA 2VR4A 3WP5A 1N33B 2ZM6O 1T2XA 4TV8A 4PDLA 2CAZC 3O65A 1L1FA 2Q30A 5FO7B 1NTZH 4TT3G 3ZDSA 3EFFK 3QH6A 2VS0A 1UOJA 3OE7G 4FCAA 4AVSA 1KRIA 3MO4A 1XMQB 1EFRG 1THZA 1ASJ1 3KM5A 1XYPA 1GLHA 5E1RA 5T55A 1OCOB 1UX6A 1QNWA 2IUWA 3ZSMA 5CMUA 1W0JG 4XFFA 4UCRA 3J81N 4QGLA 3VHRA 3OEAA 4TOIA 2B8MA 5GZEA 1WBLA 5C5UA 3CCRV 3RYHB 2WS92 2IVJA 2GMMA 2P5BA 3VBHB 1ULCA 2PLV3 1QXPA 4H33A 4PI0A 4EJRA 1YIJV 4JI8B 2MNGA 5LXTB 2VWKA 3ZIAG 1V54C 1XI1A 1L7RA 3F7VC 2MEV3 5JXGA 3L2HA 4P14A 3HKDB 1VBD1 5H9SA 1Y9QA 3L71H 5J2TB 2ZX3A 4LJHA 1KBHA 3ZIXA 2QR4A 1F15A 1QNYA 3K59A 3T4ZA 1V6OA 5IVYA 4AI8A 2P90A 1PPJH 4IEZA 1VIWB 4EN7B 3D36C 4CC6A 2WNUA 4HT1T 4DV4B 3VBOA 2RE9A 4UCTA 4HK9A 3RYCB 2X6CA 4GLXA 3FL7A 4YW4A 3MPPG 5JVDA 2ADEA 3VBFC 4BQWA 1OKOA 4QX5A 5KMGA 1B6QA 5ITZB 1N1SA 4DRVA 4IQPA 4JI0B 2HWC3 1GWMA 4XBLA 2UXXA 1V6NA 4NO4A 1RUG2 1TA8A 4CDXA 4MYEA 2W0FC 1JHNA 2VCCA 2I2SA 1Q5OA 2HP8A 1FYJA 4QU2A 2IBZH 1TG7A 5C9AA 5LL6Y 3PDQA 1REEA 3K5OA 3LA3A 2XOKG 2DUQA 2FMYA 4DS0A 1PZ8A 4JYAO 3KGLA 3SKVA 4FM2A 1UFIA 3DPRA 4CU6A 3CRMA 1W59A 4M01A 3WNPA 2XJUA 4RAIA 2R9IA 2I74A 4JI2B 3P32A 1RGSA 1RUF1 5ACA1 3I5DA 4K6BA 4ISQA 5FXWA 3VBSB 3KS7A 1GNZA 4AFAA 3HB3B 4K3UA 4O4JB 2MPFA 3I7DA 4N21A 1KS5A 1MVEA 3O1UA 4Z92B 4URAA 5DUWA 2QKSA 5BXZA 4JDNA 4HSJA 5FZ3A 1ZRFA 4ZHQA 1FJGB 3LNNA 3OY8A 2Z69A 5FPVA 4E4EA 2QE7G 2XUMA 1VALA 1BVP1 2QDNA 1Y4MA 2QM7A 4QKBA 5LA6B 5T5OA 5EC1C 2JDKA 1VQPV 3RVYA 3RQ0A 4EWAA 5FLJA 5A6ZA 1VF6C 1GYKA 1PGW1 3M2MA 4WF9V 3OGVA 4UVCA 4LIVA 4I3GA 2JDHA 1NVPD 3V0BA 1MEC1 4PBPA 3PJQA 1YHQV 4UFHA 4FIPC 1WLWA 1RUJ2 4E4ZA 4FOQA 4X65B 3AZWA 1GBGA 1BCXA 4WVVA 1I94O 5KHJA 5B1AC 1AB3A 1PO21 2DWDC 2Y69C 3MDPA 3APOA 3VL8A 4Q6GA 2WWSA 3T4DA 2IXHA 3M3IA 1W6PA 2QFEA 4NE9A 3C7HA 3ZFFB 1XNKA 1Y9MA 4JI7B 4GX0A 3J7LA 4Y20B 3INAA 1BEV1 3HT1A 5KC6A 3RVZA 1R093 2VGDA 5GLWA 3JCUZ 1W04A 4GWNA 5DEDA 2E6VA 3VHPA 2A6YA 3USUA 3MI8A 1UZYA 4XQDA 1XBLA 4YHHB 2VNOA 2ET7A 3OMAB 5E16A 5BYNA 5E89A 1S72V 1PX4A 4OHWA 3B5LB 3UQ8A 3ZMSA 1DGSA 4WM8B 1OQ1A 3DC6A 1TME1 2ADPA 1YJLA 3KT7A 4HN1A 3HN1A 2W94A 1JCHA 1SLCA 5BNPB 1OCRC 5CA3A 3ZFGA 1W8HA 4A4AA 5FO9B 5LA0A 2ZGTA 3K46A 1KKDA 3D5OA 5LCWL 5FUPA 2WZR2 4ABMA 1G9CA 4O9GA 4IL6Z 4B1MA 5F3GA 1RHI3 4B8EA 4NHLA 5GJ6A 3H3UA 4QPIB 4B08A 1TNFA 1N3OA 5FDBA 1PL4A 4OI1A 1FOD3 2LW7A 3I2KA 1ZX5A 2W1SA 5LEJA 1BS3A 3SLIA 1JZ8A 2AHZA 2XVKA 1WLEA 1O3TA 4JKMA 1AJOA 3BFRA 4S2GA 4N53A 1JYWA 2RMU3 3GCWA 1DG6A 1VBA3 2ILMA 1U5IA 2RR11 5E1AC 2WYFA 1EZVH 3WVJA 2VH9A 4P9GA 3MBWA 2ENRA 5GZGA 4HOOA 1XNRB 3B9IA 3V0AB 2XKPA 4Y4YA 2PLV2 4Z1MG 4XF9A 3WDTA 1WP8A 1E79G 1WD3A 1AL0G 2AHYA 3OTOB 2EAKA 4GH4B 2MEV2 3A0NA 1AYN1 2ODMA 3I2GA 4HVOA 1NR7A 5FXVA 4FLYA 3R4SA 4LWSB 2J1AA 3ZMNA 4FXKB 4RD7A 1YTFD 3DGTA 4XQWA 1DYKA 4QM9A 4BIFA 4JGYA 3GZAA 1QU0A 1DCSA 4DY5A 4CP0A 5GZFA 5J2UA 3OCPA 3FD9A 2EZOA 4GB32 2XAHA 4CDQB 4DY3A 1HNXB 3SYCA 2KG7B 1U0AA 4PA9A 3JD73 3E22B 2W47A 2Y4TA 5AC91 2A3QA 4K8RB 3IGAC 1AL22 5F7UA 3K3NA 5EIBC 2ZR2A 3UT0A 2QTWB 1PO12 4NIAA 1P8JA 4GA9A 2DCZA 2HWC2 2X5IB 1MQTA 4IEPA 3DCQA 2LFRA 3U07A 1VQ7V 2BGCA 2ZTNA 2CE4A 2RS11 3LDEA 4G2KA 1HNWO 1GQPA 2QCSB 4RA0A 5KHGA 1H6YA 2VQUA 4LNUB 1FXHA 1QJY3 1DGRA 1JYCA 5H9CA 2EIJB 3ZX7A 3NVCA 5CA1B 4QE9A 5FNVB 4L2NA 4JYYA 5KR7A 2I07B 1FV2A 3LDCA 4YZ4A 5JIAA 3RI8A 1V6KA 1RM1C 3ZMVA 3GNEA 4FXGB 4K0KO 4AI1A 4CBCA 4IV3A 4J10A 2EBOA 1G86A 1UZWA 2CH7B 3OFNG 3O7OA 4UB8Z 1O59A 2JG8C 1UOFA 1GM7A 3ZYFA 1Q6UA 4O7XA 2NLJC 3CP1A 3HNYM 3OF1A 4BIUA 2P22C 4FOWA 1XJAA 3PVNA 1MZEA 3AXEA 3OAAG 2ZT9B 4YM2A 4F6RA 4I55B 4AEDC 1YVWA 3O1MA 1ZBE3 3CDZB 5JJJB 1N36B 2LM3A 4KBBA 1W28A 3IPVA 3CC4V 1GICA 3CXHF 4AQ2A 4HSLA 2WKKA 4YYOA 3WDYA 5L19A 5FBJA 4AWDA 1K4DC 4YVSC 5E6HA 1ZRCA 4GULA 4NVPA 4CA9A 2FD8A 1O4YA 2UXNA 2AZ5A 4KG0A 4PDMA 1YJ9V 1V0AA 4ET7A 2Q8DA 3O1RA 1Z0HA 1C5HA 4KUMA 1CAXA 5HI0A 1EYBA 5LBQA 2CTVA 5GZDA 5BPXA 1AJNA
chains in the Genus database with same CATH topology
1Q3EA 5C8WA 2R041 4GMP3 1LHOA 1XU1A 1B35C 1QJZA 2PLV1 1D2SA 5IK4A 2NZ9A 1H4GA 4IEXA 4XFGA 2P37A 5DDJ3 4GWMA 4H55A 5SV5A 3ZSLA 5IT6A 1OTJA 2O0OA 1ND2C 2BFUS 2O1QA 1BBT3 1YXWA 1VRH1 2PQQA 2B9UA 1UPSA 2A73B 1AR93 3WG1A 4K21A 3VZMA 1YO8A 2DV9A 3O14A 5FPXA 2ETEA 4E2SA 1UAIA 4YZ1A 1UU5A 1A3KA 1T6GC 2IXLA 1UIKA 3SCGA 3B9CA 4BZ4A 1FMD2 1OQDA 4FP3A 3VZJA 5HCAA 1F8VA 1YFUA 4C1XA 3U4XA 4M2FA 1X8EA 4A7YA 1JBCA 4FPYA 2D3RA 2LUWA 1AYM3 5KHIA 1W6NB 3KLSA 5I8SA 2WIIB 4XIOA 3BIWE 3L2YA 5JMCA 1CAUB 5LEKA 1QJX3 1OFNA 1AR83 1G9FA 4LBNA 3MYXA 3MS5A 2IXCA 1O4TA 1RUI2 2HWD1 1NA1B 3OD4A 3WQ1A 1S0GA 1AXKA 2EXKA 1AR63 2Q1MA 1YFWA 2GN7A 2YMZA 5E8AA 2ZGMA 1DS0A 5A3MA 5FAXA 2Y26A 3TWIA 5A3LA 5DG2A 4WBBA 2XBO2 3URFA 4QM8A 3ZSEA 2E7TA 1W6MA 1ZYBA 2F6BA 1RHI2 1PIV2 3RS6A 3WV6A 3R4DB 4OHYA 1OPMA 4M3CF 1F9KA 2JE7A 2WNEA 5CVRA 1H8VA 1OIJB 4Z1VA 1DQ6A 4AHXA 1FT9A 1LOCA 5LRSA 1G8WA 1CAVA 3GZTB 1FOD2 4CDUB 5K0UA 1CPMA 1WCSA 2X8KA 1J58A 2V5YA 2WLPA 3WY6A 5DZEA 3MW2A 1FX5A 3WCSA 1VBC2 4XBQA 5J3UA 1XE7A 1CGPA 3ZN4A 3NWKA 5AC92 1CJDA 3B01A 4UW6A 4GXLA 5J36A 1PK6B 1FI2A 1RJ7A 1H2NA 3JUUA 3NV2A 4COUA 4XILA 1VBA2 1CIWA 1DGWA 2D7FA 3VBRB 5JOZA 3BB6A 1POV1 1GR3A 4MSVA 4B29A 1EAH1 2YGMA 5F1RA 2Z79A 4BHGA 2A5ZA 2CV6A 3RRDA 1EV11 4XW3A 1PVC2 1MS0A 3R0RA 4AI0A 5T50A 5FQ0A 3FLPA 2UURA 1NA1C 2H6BA 4XF3A 1QJX1 2VUJA 3N36A 5JWPA 5EZWA 1MZ5A 4NPRA 3OYWA 1LHNA 2D6MA 4ORFA 3ZXLA 3POYA 2E51A 3PVBB 4PLOA 1OMIA 2D5FA 2ZJCA 1F31A 5CG8A 1IGOA 3J9SA 3OBTA 1RVF3 2JG8A 2P17A 2VNRA 4L99A 4AG4A 5I93A 3LOIA 2B45X 1FPN2 1CAWA 3R05A 4YZ3A 5KXDA 1DIWA 1GQGA 3VBUA 1DHKB 3ZN6A 3MF9A 2GU9A 1H1IA 4GKYA 4L8QA 4CDUC 3O5SA 1SFNA 1TMF3 2YC0A 2IZWA 2PAEA 2Q4AA 5T54A 3MIFA 1D2QA 4F7ZA 4Q4Y3 2R1DA 3DUIA 2IFWA 4XE9A 4AEDA 5DUUA 5KWRA 4YW5A 2FMDA 2WT2A 5F6LB 1M06G 2ARBA 4R8HA 4D7SA 4LO6B 3AFGA 3C3VA 4W6XA 3JD72 2QE3A 2WNUB 4JCKA 3OPZA 3VBRC 1HDKA 4BHPA 4BHFA 2G4IA 3UV9A 3CL1A 1LOGA 4HLTA 3VBOB 4BGMA 1IPJA 1PMIA 3FFQA 2D3SA 4I02A 1NQJA 4KWKA 3AYAA 3NL1A 1G9AA 5BV6A 1KD7A 1LRHA 2XB6C 2OUHA 2BFUL 3CEWA 3VL9A 4JC1A 4BQ1A 1HRI3 3B02A 3W9AA 4EWDA 4LHNA 5CB7A 2ATFA 4CYDA 1TNRA 2GC2A 3ATGA 4WVMA 3JU9A 1RUC3 4JTOA 3RI9A 4LBQB 4M23A 1X8MA 4CRQA 3IM0A 1H1MA 4DOUA 2OG6A 4Y1VA 4ZXKA 4LBMA 5CFCB 3PNAA 2XH6A 3FJSA 5F9TA 3I8TA 1ULEA 5C33A 4UBGA 2FHRA 2RJLA 3VBFA 5T52A 4CDXB 1COV2 5T5JA 1DGRN 4HL0A 3VBHA 1QJY2