3KCYA

Factor inhibiting hif-1 alpha in complex with 8-hydroxyquinoline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
335
structure length
332
Chain Sequence
b'EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Crystal structures of human FIH-1 in complex with quinol family inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 98
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3kcyA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kcyA01
2ILMA 2YDEA 1H2LA 3KCYA 5JWPA 3OD4A 4QU2A 4BIOA 1H2MA 2WA3A 4Z2WA 1H2NA 3P3NA 4AI8A 2W0XA 4NR1A 4B7KA 3P3PA 1IZ3A 2CGOA 4B7EA 1MZFA 2XUMA 3D8CA 2Y0IA 2WA4A 1YCIA 2CGNA 3KCXA 2YC0A 4JAAA 4Z1VA 1H2KA 1MZEA
chains in the Genus database with same CATH superfamily
1RYYA 4BQ2A 4HG6B 4X1YA 2QKCA 4D69A 2W0XA 1FFTB 3ML0A 4NJ4A 3E8GA 1OSGA 5GZCA 4FOWA 3FFZA 1GANA 1SQQH 5FZ1A 4JI5O 2BTOA 3N2KA 4XDOA 3SCHA 3AZXA 3SPCA 3CCQV 3LSDA 4Y5Z0 4XJWA 3AVSA 4CP2A 1RJ8A 3ZM8A 1ACCA 1SLCA 2WNUA 1WLDA 2YI9A 1HRI2 2JEXA 2C2AA 5LP6B 3CYOA 2D5FA 2ORXA 5K1XA 3PIGA 3IB3A 2VBDA 4X65B 3OTOB 1OPMA 5A6XA 4Q4W1 1SBDA 5FPUA 1UO9A 5F2VO 2VZPA 2LW1A 3Q8BA 3AJYA 2O1QA 4EWDA 4Q4V1 4IEXA 5IVBA 3ZYIB 4KWJA 2DVDA 1NVPB 2YBPA 3LSQA 2B42B 3RBZA 1LHUA 4WVVA 3UM7A 2PI4A 4AEDB 3AP7A 5B1NA 3RYPA 1W2OA 3BIEA 5C8CC 2Q7HA 2ZXQA 4JHZA 2PLV1 2YS8A 4LF4O 4JI7O 5CBGA 4DR6O 4I4TA 1BBT3 4QKFA 4NAMA 5JJEB 3WNPA 5JZGA 3CSXA 3L75H 4LNUA 3CC4V 2ZX2A 5EPAA 2YEVA 2DQ3A 4JI2B 3TNQA 3TYJA 5LA6B 4CH3A 5FOJB 5E89A 2WABA 3ASOC 3ZCCA 1YZBA 4R9BA 4LKDA 3SYCA 1F4AA 3RZMA 2M6YA 3O7OA 2WWWA 4OUSA 2F43G 4QX2A 1VAKA 1HB1A 5FZAA 3SC7X 2JGUA 3CRCA 1RMU1 2Y0IA 1OOPA 4DXTA 4IDZA 4HBNA 4LBNA 4ZHNA 5E6HA 3L2HA 4LF9B 2QUOA 4B3TB 1CZTA 4I0WB 1RUC3 1NCQA 2V09A 4NIHA 3UO2A 2BE3A 4DS0A 4FPJA 1SRYA 1SS3A 3OD0A 3E6DA 4AXOA 3UK9A 2RM23 4FAGA 4IGQA 4MYEA 3WNKA 5FZ4A 3ZJZA 3N2KB 3ZYFA 4AE2A 4RO2A 2A3YA 2PLV2 4LF6O 1W6OA 1WPXA 4FT8A 5DUWA 1ZREA 4P9WA 3AMPA 1MA1A 2MHFA 1NTMH 3HT2A 1XL6A 2KB1A 3H1JH 2IW5A 5CFCA 1LECA 1VBE1 4J42A 2IXJA 4X1IA 2P4VA 1VMJA 4NPRA 1QXPA 4HAMA 2UUBB 3CMAV 4JTOA 2W95A 1UF2C 4CEWA 3ZRWA 3LNNA 1W6QB 5A7OA 1N1TA 3UJOA 2P2KA 4OI2A 1NQDA 4YYOA 5FYSA 4ZZ5A 4DO0A 1LULA 2X5IA 3FAVB 1QU0A 3S6PA 2EXIA 3POYA 3BN6A 2UY8A 1S55A 3THTA 3W7UA 1MVQA 4AGVA 2LFSA 5FO7B 3BVOA 5LOVA 4QPGB 4MX3A 2XDVA 1S0FA 5JDBA 1C1LA 2XL9A 5JZGB 1R1ZA 1W6PA 4JI3B 3MI8A 4XBLA 5K1PA 5H9SA 1PP9H 4XW3A 5LY1A 2VW0A 2EIMB 1BE3H 4I55A 1OH4A 2QM7A 5A3PA 1ULOA 4GQ7A 3OFNG 4OHWA 2BBVA 3B5LB 4LPLA 1K34A 4CPBD 3GZTB 5FZGA 3TXQA 1X59A 2J1TA 3I2GA 5C3PA 2GNMA 3HKCB 2BPA2 3KT7A 3KG2A 5BZBA 5CBHA 2OYZA 2RR13 1ZLZA 1OOPB 4AYUA 1S5HC 5BR8B 3QBQA 2CTWA 4IV3C 4AI3A 2C24A 1WLCA 1WA4A 1XNDA 5KUKA 4K8ZA 4DXRA 4R8HA 2GH2A 2A6ZA 4EZ4A 2VG9A 4Y5SA 4P9YA 3WB0A 1JS9A 5DEDA 2WO7A 1ZX3A 2ZGTA 3L72H 2G9FA 1R3IC 3EYPA 4MVTA 4UV9A 2D3SA 4I0AA 3RJ2X 4UXNA 2YXLA 3MLKA 3P3PA 5L3CA 3IIIA 1GZTA 4BLJA 2QZ2A 3VBRB 3L9DA 4DINB 5HV4A 4A6OA 1IS3A 1HIXA 1UMZA 1AR91 4HMZA 3VZOA 1Z5WA 2DVGA 3IDAA 2EA7A 2ZKLA 3CJXA 4M01A 5DAXA 5F6LB 1ZTEA 3ZOIA 1Q6UA 3G6EV 3QCWA 2CV6A 2JGDA 3UT5B 3ZRWB 4EN0A 4JQRA 3JD73 3MIHA 1ENXA 4JV5B 1QJX1 3ILRA 1CESA 4ZS3A 4CPBA 2FZ1A 3ABMC 4JI6O 4XF4A 1A8DA 3DGEA 1NKDA 2PQQA 1IS6A 3OUJA 2G1MA 4JYAB 3KF3A 3IDEA 2JG8A 3ZFFB 1LGNA 2XXZA 1GQPA 3OYWA 4FPOB 2IU0A 4IE4A 5LOVB 3MHZA 2FHRA 1US3A 2P6JA 3CP1A 5CFDB 5CIRA 1NE6A 4U3FH 1UKGA 2EXKA 2WSUA 4LWSB 3SJBC 2YC0A 1GV9A 1QNMA 2JIZG 4IV1C 4D7SA 1A3KA 4UCTA 4OUMA 1AR92 4H37A 5C9AA 1AP5A 4W50A 5A70A 2CGNA 5LMNB 4YVSC 1NCRC 4UI9L 5FKCA 3FB6C 1US6A 1VRH2 4HNAB 2X10A 1OCRC 2QKDA 3QG5A 5GZDA 3SYQA 2VQEO 1W2NA 3U07A 1BT8A 3KV4A 1EAH2 3TEXA 1W3XA 4TZDA 2QBXA 2IC1A 3DC5A 1JZ6A 4QHOA 2Y0PA 5FFOC 4JI0O 4GWMA 2QKSA 4JZ2A 2ZCWA 4W4LA 1FPOA 5LGTA 1OUSA 4I01A 5FLHA 3U37A 4JTDB 3M99B 1KJRA 2Y69B 4NIAA 3S5AA 5BXZA 4FK5C 3MUY1 4ATFA 3THPA 1VF6A 3E8FA 5LGNA 1ORQC 4JI8O 1AXKA 2OS2A 1HP8A 1RM1C 2XAFA 5KWRA 4LTAA 3R4UA 4TQDA 1HW5A 3GNEA 5A3NA 2ARHA 2DYCA 2CDPA 3IIAA 3T4ZA 5AC92 4ZHQB 1OCZC 4COVA 1XHXA 1SFYA 5IYZB 2Y4TA 1VLNA 3HQXA 4Y20B 5FP9A 1N8RW 2QQUA 3O1OA 3C7FA 3DYPA 4HPKB 2Z79A 1PIV3 1HXS2 3N2GB 4WM8C 1T6GC 2FMLA 4YARA 1UXZA 2QA4V 1N1YA 4DUYB 1UL9A 3JAKB 2J1RA 4BA6A 2YICA 3KWVA 3KZ4C 2UXBB 2EZOA 2BGPA 4Q5OA 1ZZ9A 3B01A 4W6XA 2QM4A 1FJGB 4A44A 4P9GA 1JUIA 1Y4MA 2GMMA 4WVMB 1VF7A 4XTMA 2A6XA 4AILC 2YFZA 4YZ5A 4MLOA 2QDNA 3JD0A 1SLTA 2WSVA 5LHIA 4LO4B 3CXCU 1UW8A 3AP4A 5FP8A 5T3NA 3U0ZA 1CAXB 3BA9A 1T5EA 4XJAA 2HYXA 4MTXA 1X50A 3GM8A 4Q26A 2WLIA 1UY1A 1GOGA 4CDWA 4PELA 1V6NA 5C3SA 2YC2A 4FXKB 4PI0A 2K0GA 2DN9A 1DCSA 1XU2A 3VN4A 4GLXA 3VB9A 4AR2A 3LA2A 3H3ZA 3VDDA 1W8UA 2BTQB 2PHLA 1Q3EA 4OHXA 3B9CA 3B94A 1UMIA 1ND3A 4ZU5A 2XMLA 1D5AA 4PDVA 1B04A 2VRZA 5B66Z 1DHKB 5DZGA 4AEKA 4QGPA 3ZYPA 3OEBA 2OX0A 3ZMSA 3AZWA 3OPWA 1D2QA 5LATA 4XUNA 3PN1A 4CDQA 4DUZB 3AG7A 5TISZ 3V0AB 3A4UA 1E1QG 1FATA 2WQ4A 3EHKA 1RUE1 4LBKA 3HAGA 5FPLA 4CCNA 2AACA 2BFUL 1ZRRA 1Y6XA 2Y6JA 3OUIA 2ZT9B 5JUVA 4QX7A 3C7OA 3ON7A 4TLGA 1X36A 1HLCA 1TA8A 4UFZA 3FE5A 4JF3A 2FMDA 1QJZA 4JRLA 2VMEA 1H8EG 1C3HA 4PDWC 3HR0A 3EQEA 1OVSA 3IDBB 4WFGA 5AFEA 4CZZA 4OMDA 5L73A 1VBA3 4ASKA 5FMCA 1M4UA 3WW4A 3WG3A 5LWBA 4PJYA 4DR3B 2EILB 4AFMA 3I55V 4GWNA 3G6JB 5HCAA 4KGQA 3LEKA 2GC3A 3OBTA 3I49A 4RS5B 3LNMB 3OOXA 3PMEA 2FL4A 4QPIA 5B1AC 4CCEA 3FKSG 5FMDA 4NN0A 1VMGA 1K42A 3CU7A 2A7AA 5IAXA 1FXKB 2DVAA 4CDWB 1Y3TA 4Y22A 3AYDA 4OMCA 1RUE2 2GUZB 1SQBH 1BCCH 4YIOA 4JZGA 3HBZA 2WAOA 1UZWA 4LMFA 2FB5A 3CO2A 3RWKX 1SEFA 4GKYA 3JAWA 1U5IA 5HFMA 5I0SA 3JBG3 5DM6V 4MGZE 5BPXA 2D6LX 5GLZA 5LW9A 3N36A 4HL0A 4BIZA 5CA0B 3ETQA 1MZEA 3AFKA 3N9OA 3ENRA 3TCUA 1NLQA 4MZUA 4QAWA 4UV8A 4AVBA 3UKTA 1RUF2 3LWCA 5FLXN 3HB3B 4LFAB 2P3IA 1UOGA 2VTFA 2CUGA 5A3UA 2LM3A 5FL7G 1CD3G 2IBZH 3OBZA 1D2DA 4LK6A 2Y48A 2EIJB 1GH6A 1HNWB 4NRQA 3R4DB 2A75A 3OGCC 2V4DA 4XCAA 3WF2A 1DFQA 1ZX5A 2JD4A 2R32A 3Q8CA 1XILA 5LBBA 1LJ7A 1MS0A 5L7OA 4R9CA 3ZN0A 1QJU2 4DV4B 3HOBA 2XJPA 2RR11 1AR72 4LEJA 5J98B 1F31A 4MXWA 1Y76A 4AHCA 1UKRA 2P5BA 3NNJA 4BM8A 4K40A 4YZ3A 5DDJ1 1NA1A 4AQ2A 5FZOB 1V9U3 2RG4A 2WPDG 3RI9A 2KD7A 4CEYA 2JDPA 3CCSV 2JENA 4EV0A 3SR2C 4MVUA 3H1YA 3WCRA 4Q0UA 1IKQA 3UKMA 4NUBA 3RS6A 4A6SA 4QQOA 1H1AA 2P3KA 4QPYA 3OUHA 4NKGB 1X9PA 5EIBD 1RUI2 5CB4B 5E88A 5HI0A 1GLHA 1ZYBA 2OQ6A 5AC93 3CE2A 4IEPA 4E2SA 4LA2A 5FP3A 1PO21 2VU9A 1ZM1A 2R072 1F9KA 2DTWA 2YFUA 1W0JG 1O8SA 3DEMA 3M8LA 3LGRA 2ZNJA 3LQCA 2ZA9A 2GH8A 2QTOA 3K59A 4K8RB 4I3PA 3JB8A 4BZ4A 5KXBA 3FN9A 5BNPC 1K97A 3FB8C 3RJRA 5BNOA 4YXWG 4Q4X1 1YQ2A 1KEXA 3HN3A 3Q8AA 3ZXEA 5DDJ2 1J84A 1QWRA 4LIUA 4OX9O 2BOBC 5DG2A 3IZOA 4QQHA 1WN7A 2ETEA 3H42B 2BEOA 3KV5A 4XJ8A 1JJOA 3VZJA 5FY9A 2B7YA 2B5HA 2W6IG 1IBLO 2R041 4WVWA 1PHMA 4NYKA 2FBEA 2XVGA 1G7YA 3UT0A 4FM2A 3T2OA 3F7YC 5GKAC 1KQSU 1NYWA 3P3NA 1R73A 1AVBA 5L7OB 4JTAB 1XE7A 5FYVA 2GTSA 3QD6A 4RN5A 1F5JA 2ZR2A 4ZXKA 4NWVA 1SA0B 2OIGA 3S7EA 4AFDA 3AKRA 1YLLA 3TOJA 4N53A 4BMEA 3K57A 2XJQA 2ZD9A 2BCCH 1R091 4Q4X2 1NR1A 4ASMB 5FPZA 4XF3A 5FIXA 3ZS8C 2P34A 1ZRFA 1H8TA 3FLPA 1TUEB 2E33A 1K4DC 4YNIA 1Q8PA 4DW0A 4IE7A 2DFCA 5IWFA 4RA0A 3HMYA 4LHSA 3IPVB 1CZSA 5J9PC 2FCTA 1RINA 3VZNA 4PHZA 4OPHA 2WT1A 1D4M3 5T5JA 2R042 1VQKV 2A6VA 2YUAA 3ZXJA 3K46A 1MNGA 3K3NA 1W2UA 1QY4A 4OHZA 3D8CA 5FPAA 4FTSA 4BCUA 2YBSA 1IQAA 4IV3B 4JGZB 4YSFA 1GN6A 4K0KO 1GOFA 2B8MA 4JGSA 4R52A 1VBB2 4XE9A 4H3WA 3OD4A 5FY4A 1W0OA 3WSOA 1PZ9A 1TME1 1W8TA 5J3UA 1ZAUA 2LJ2A 5FMOS 4N8MA 3VL8A 2WJSA 4QX3A 3ABKB 1TGOA 3WG7C 4CP9A 1JYNA 4FIPC 3S30A 1PIV1 1UOJA 2Z0AA 1PK6C 1MEC2 2CH7B 5F3CA 3WR0A 1OBNA 1W0PA 4EROA 1K5MC 4BHPA 1AJQA 4X6QB 2Y0OA 4XQ4A 4MGTA 4LOTA 5LRSA 4AQYB 5DECA 1QR8A 2VQAA 4FXGB 2Q8EA 1S0CA 4G27B 3OUFA 1QXRA 1NX9A 3NJXA 1JCHA 3OTFA 4GX5A 1POV1 1KD7A 3PVNA 3ZMOA 1I9RA 5H9RA 1W9YA 3PL0A 2ORZA 2WA4A 3AVRA 4AVSA 4XJ9A 2RS53 3Q8FA 4EB6B 4G28B 5IFTA 4CH6A 1FNYA 5DUXA 2BYVE 1AYN3 4MHUA 3K79A 2ADQB 1UIJA 2A0LA 1FFXA 2XAJA 1LHNA 4DV0O 5BYNA 4LUKA 4N53B 4FZ1A 1TME2 3K51A 4U36A 3K0DA 1J1LA 1MS5A 3TB0A 1H8TB 1BS3A 1ODNA 3RVYA 1RUF3 2R9AA 3NAPC 2C26A 3ABLC 2H0VA 2JDMA 4PIXA 4M3CB 4AAXA 1MZFA 1JOBA 4MGYE 5EQUA 1OF4A 1W0NA 2NP0A 1Q8SA 5JQGA 2PN5A 4O4IB 5F2SA 2JXAA 1ZWIC 4Y1XA 3K58A 2Y6FA 4UW3A 2MPFA 4XACA 3OMAB 4N23A 5D8AA 2WLHA 5JXGA 5T52A 4YVSB 3BRCA 4B3SB 3LPFA 1W6MA 4GKJB 4BQWA 5D2AA 4MVZA 2LQTA 1M5IA 4RSUA 3OSDA 2VBBA 1AXYA 2EJRA 1H38A 3FB7C 1HV0A 4JTNA 3CKHA 1NH2D 4KHPO 1O5UA 3VDCA 1AR73 3O1VA 5A2QN 3W20A 1GR3A 1POQA 2BOJA 3EXAA 3CXHF 1MOFA 3INAA 4ABMA 3NWKA 1KD1W 4JI1B 1WZXA 3E8BA 4YLZA 4CZSA 2ZXWC 1ZZ8A 2X09A 1Z7S3 4P9LA 4XDPA 3ETDA 3O0VA 4ORFA 1RM1B 4ZBMA 5LBEA 4UAPA 5J1XA 5ACA2 1RUI3 4TXWA 5FKBA 3J81N 4R8CA 1IBMO 2E6VA 4DNYA 4W6WA 4YWAA 2R30A 4IHJA 1G9FA 3MW2A 2AHZA 3AZYA 2CU5A 1OD3A 2R073 4OHVA 4MW3A 4EN7B 4FM1A 4X20A 2B45X 1A32A 3LSSA 2V7QG 4WM8B 1HNXO 4CUGA 3H1MA 4ATEA 1JZ2A 3CC7V 3RT3C 3N7MA 4X9QA 3STLC 1AR81 4K35A 3D0JA 3LIHA 2Q0OC 1KGYA 4NXMO 4B7EA 3ZKUA 5F3GA 1QJY3 3SEEA 1DF0A 2PAEA 3AZZA 4FFHA 5JQGB 3APOA 4YFZA 3K3WA 2F6BA 2HWE1 2F1MA 4F6EA 1VB4A 1NY71 1VBC2 3CZJA 1DZTA 4KBBA 4Z07A 4IETA 1G1XB 3B8MA 2IXCA 2YUEA 2EBOA 1OFSA 4FOVA 1RSOB 3NNGA 5I91A 3CCLV 2XR4A 2QQPA 4IEWA 3OCPA 3ACLA 4JTCB 2HKXA 1P49A 3CPWU 3USUB 4QM9A 2UXDB 3BVCA 4Q8LA 3KV9A 2R72A 3HKEB 4CUAA 2UYBA 4JAAA 1P7BA 4LHKA 1WNSA 4DK1A 1K45A 3HKBA 2RDNA 3R4SA 1ZBA3 1DDLA 3RMYA 1AR82 4PLNA 4J80A 2WZR3 1K4CC 2CHHA 4WZCA 2MEV2 1PMHX 1POV0 2IZWA 2NYYA 1S2EA 1NT0A 1IBKO 1OCOC 3JD1A 4LQRA 1VPHA 1AL21 3J7AU 3USSA 2YPJA 4CCDA 4UCVA 5IHRA 1NBMG 3MPPG 3IBMA 2K2SA 1Y9QA 4O4LB 5ISLA 2F4LA 4DRVA 1AILA 2XL7A 4XURA 2OTLV 4B4QA 1SCRA 1M9NA 4OUEA 3SPHA 4IHJB 1PM9A 4PLOA 1R083 4NMIA 1SLAA 1OLQA 1R1A2 3Q9OA 4R9AA 5I0UA 3O12A 3J7HA 4PF1A 1W6NA 1SZTA 4Q4Y1 4TV9A 4L2NA 3TRSB 5JCOA 1CR7A 1FV2A 4S2DA 4J9YB 2HLDG 3S0MA 1CAVA 2W46A 1VBB3 4P9XA 2VQFO 4FPKA 1WBFA 2GSMB 4HKOA 1N0NA 4PDWB 3H1WA 3I2KA 1R6NA 2JS5A 1LUVA 2Q4PA 1NH2B 3GF6A 1P7GA 2AC1A 3U14A 1MEC3 5F6KA 4DV5O 5IY5B 1UZYA 1LEMA 3GCXA 2XLFA 4ZONA 1BVVA 3WDUA 1FPN3 1G9DA 1O9HA 4CDXC 2JDNA 2D44A 3ZHQA 2HEWF 1AL22 1LOEA 1DGRA 3T08A 4BQ1A 4YRDA 1YNAA 2XHKA 1G6UA 1N0JA 1WLTA 1RUNA 1JTZX 3PNAA 2XJSA 3LSUA 1W8WA 5LCWL 3SPGA 2F93B 3D6EA 3CDZB 2VQ0A 1IQDC 1XRUA 2UYAA 2YSUB 5H6RA 5EC2C 1KXGA 1DZRA 5C8YA 5IJRA 2HKOA 1DGWA 2R70A 4RR3C 3SH5A 2JRIA 2VE1A 4L0PA 1K3EA 1MABG 4INDA 1DZQA 4O4JA 3ABZA 2EICA 1LCLA 4TYSA 4NR1A 3ZX7A 2IFRA 4MHRA 2P17A 4X65O 3OTOO 1TE1B 3MFCA 3ELNA 4IIJA 4AGGA 4EN9B 1O5LA 2A1XA 2ZX0A 4L8JA 3O1MA 3I2IA 1C5HA 1I0HA 2WFPA 3JATA 3LZZA 1OA3A 1UN1A 4KWLA 4GX2A 3K2OA 4IT5A 2VTXA 5BMVA 3G7DA 4XIKA 4V1PA 3WY6A 1IGOA 4JPRA 2WLQA 4NPMA 4XF0A 2C9KA 3WDWA 3QF7A 5J96B 2HWC3 3WW1A 1CAVB 1JN2P 4QX1A 1HQNA 2XAHA 4JI2O 3D0SA 3VBUA 3LA7A 3A0BZ 3VBFB 2XLGA 4GCZA 1PGSA 3OAAG 5IVVA 2Y38A 5DABA 3M8AA 1DQ4A 5J2TB 4ONUA 5GALA 1YJ9V 2WN2A 1NXD1 1C28A 5F9TA 1G86A 1AR61 2C9AA 3K48A 4GAZA 3I3BA 4R4XA 4NHXA 2P3YA 4DIQA 1S76D 3ZPYA 2NR5A 2H6BA 1IHMA 2JDZA 5IT9N 2Z42A 3DYOA 5JMCA 1VQ4V 2I07B 1QBZA 1PZ8A 4LF9O 3ZIWA 1WMXA 4PDRA 4B3TO 1BL8A 1XSRA 3D4KA 3WG2A 1JZ5A 3ZO0B 5FUPA 4LIVA 4DR7B 1AR1B 3FHIB 3PVEA 1E5IA 4LE3A 3PHMA 4DEQA 2YG0A 2VY0A 1Q90D 4JCKA 4UOJA 5L36A 1UD1A 4JAVA 2QFEA 4LULA 2V4VA 1GWMA 1B35A 2RDSA 3OM3B 1VBD1 5KUMA 1QNWA 2DUPA 2ZM6B 1IPSA 3MPBA 4QPKA 2WL1A 3JD2A 5JXIA 1OQ1A 1KDMA 1CQ9A 4D6SA 3WNXA 3VUOA 3KQRA 5C4WA 1RB8G 4PIYA 5BNNB 4S2FA 2FTKA 4EWAA 3VKLA 1FXHA 1DLLA 5BNPB 3AP6A 3B93A 1O3RA 2DBNA 4RQEA 2UUBO 1IPJA 5FOBB 2ZMNA 3C7HA 5FZ7A 4CCKA 1HRV3 4DW1A 2VOVA 1VMFA 5EWSA 3RZGA 5F5AA 1S2BA 4YVWB 4X6RB 1UOFA 2E5LB 3KZIZ 5B3SC 2R0HA 4KL1A 1VBC3 3A2FA 2VMHA 3WG4A 3W5NA 5C8CA 3APBA 1CZVA 3VBSC 4TSVA 3POBA 2X05A 5FPXA 3BABA 4P5YA 4JI3O 2HHHB 4NHYA 3BTXA 3ZR6A 3PVBB 4N21A 2E53A 2VQTA 2JEUA 2B4KA 4XFHA 2QSAA 4XFCA 5CA3A 3ZMUA 4IQPA 5J09A 2R49A 4UFHA 5T50A 1IS4A 1A34A 4WFHA 4LBJA 4KXRA 4Q2FA 5F5IA 4WF9V 1KYOF 4WM7A 1UU4A 2RMU1 1MR5A 3NVCA 3RFRA 5BR8O 4K3AA 1VQMV 1GUIA 1O3SA 4NO4A 2ADEA 5J48A 4C7UA 4YM3A 4I5SA 1MACA 2IXKA 2O57A 4QGNA 1XOYA 2OKXA 3I59B 2YMZA 4EE2A 2JVDA 2VAUA 2VWJA 2YYOA 4N9IA 4Y4YA 4QXCA 2OXBA 3T2TA 1V55C 1SFNA 1YHQV 1OT5A 4MGIE 2XBO2 4CS4A 1EPWA 4COWA 1SDDB 4AOCA 1Z7S1 1B35B 5IJ9B 2XQRA 2DYSC 3V64A 1UFIA 1O4YA 5CKMA 2CE4A 3S3XA 4F6RA 1BEV1 5HXMA 5H9PA 4DK0A 2DU0A 3VKMA 2NM1A 1IS5A 4P2ZA 1I3HA 4BDVB 3SCFA 2PHUA 5LA2A 3HKDB 5L3DA 2VMCA 2RJKA 3WDYA 2B9UA 2RMU2 3N7KA 5JOWA 4JV5O 3OPTA 3OR6C 4RFT0 4IL7A 3JZVA 2JG9A 3O5SA 3OG2A 1AL0G 4N43B 5JH7A 3WHTA 1DYOA 4Q8KA 1K5MB 1GOHA 2AXTZ 4JYAO 3AP5A 3LEIA 4B3MB 2WIIB 1UX7A 3P5BA 3IAPA 1PNKA 1VALA 1QJY1 1JR9A 2GTAA 4IYHA 3ZVXA 3QH7A 5B2GB 4NROA 2WYSA 4W8JA 2X6BA 1WW4A 4KG8A 2PYTA 5JWPA 4XHBA 2DURA 2ZNIA 3HQRA 2W5FA 1Y9MA 5B5EZ 5GLUA 2PHDA 1IKPA 4O9GA 1F5FA 4E2GA 4XDJA 3AG2B 3C7GA 1IDSA 4I09A 3TEWA 3DCQA 2BP6A 5HFLA 4XDLA 2LGQA 4WM7B 5LMNO 2YC4A 3KD4A 2ZX1A 1TZOA 1F4MA 4RUFA 5EP9A 5ANQA 3LFMA 3MYXA 4A7KA 2XJUA 3K5LA 4LR4A 4O2AA 3N27A 3ZMVA 1WWYA 4QHZA 4UXAA 3NAPB 5JR2A 3OMNB 4Y1YA 2VD7A 1Y4WA 2D93A 4HZ3A 1ZBA1 2VMGA 1C1FA 1PO13 3OGRA 4TLFA 1C57A 3IJ4A 1TVKB 2WZR1 3JYCA 4MVSA 4KUMA 4X62B 5ABJB 4KQ7A 5IE9A 2WFF1 4UCUA 5APAA 1FOD2 3NO8A 1NZCA 1QDOA 5IVYA 2BNNA 1S4CA 4E27A 2QQLA 3PJSK 3RW0A 4G3YC 4QQLA 2YXSA 2ZACA 5A7WA 5D5QA 3A22A 3BTYA 1HN1A 1WW7A 1QQP1 4NOTA 3BU0A 5GM0A 2ET1A 4LR3A 5B1OA 4C90A 5JPNB 1LTEA 4YPJA 4DR5B 4MTFA 5AVAA 1OPOA 1PNMA 5JH7B 3UNPA 3KHBA 3DKWA 3RYRA 1I6XA 1KKDA 2QWNB 1W06A 1P8JA 1SZBA 2X29A 4IXLA 1YIJV 3FJSA 1JFFA 4DUYO 5FZHA 3CJHA 2HBUA 1HX6A 5K9YA 2UXBO 5FZ9A 1RUD3 3PTRB 1GNHA 2X0LA 4CCOA 2GP3A 4GKXA 1FJGO 1RUH1 2XG3A 4OI1A 5F32A 3RN4A 2QQOA 1VARA 2KQXA 1SPPB 3M3EA 1GN3A 4GZ9A 1H2GA 3O65A 4CP1A 1SG3A 2YXYA 5JMOA 4AZZA 3LDRA 4XZPA 1STMA 1UX6A 3M4FA 4G9SB 3GWOA 4QPGC 2Y6HA 2V72A 1OMIA 1QQP2 4ZOLA 4NB5A 1NCRA 5T55A 4OQ9A 5JZGC 4UVCA 1M93A 4X8NA 2VO5A 4O2AB 5IYBO 1KMIZ 4RHV1 2AEYA 4HK9A 4NE9A 2P4EA 2XQXA 2VQUA 3I54A 2XKOA 1DQ5A 4MT8A 1AXZA 4COYA 2NLJC 2FYUH 1XC6A 1GZ9A 2KKWA 4BE3A 1CAWA 2RDRA 1OOPC 5FDBA 4X64B 2QWPB 1UOBA 3I5DA 1YRZA 1ZA7A 5KHKA 5CMUA 4KNCA 4LO5B 3VLBB 3WCSA 3GZAA 1V6LA 1NCQC 4GMP3 2V5DA 4BB3A 3GB7C 5IVCA 3B9IA 4DV7B 4H13B 1Q5OA 1NQTA 3ZN1A 1AROP 1RHI1 4DUZO 2TBVA 1JYCA 2QTWB 3FBMA 1EV12 5EXOA 3T3YA 1WA8A 2VZRA 2ARXA 3J4UH 2QGNA 1TMF1 4LFCB 4HK8A 1M56B 4RYDA 3M1HA 2WS91 2X7RB 4A42A 2Y4UA 1K73W 4RHV2 1PVC1 2E76B 1YFUA 4FZ0A 5K0UA 3UL2A 1G8MA 1OCOB 4J1XA 3CCJV 1JFFB 1YXWA 3CJHB 3POEA 4Z1VA 1QU7A 4LE4A 3I56V 5GLVA 3MV01 4UW6A 4B3RB 1GZWA 1UCXA 5IK5A 1OFNA 3T0DA 4NIGA 3DPRA 2YROA 2X5IC 1F2NA 5DQ0A 3KGZA 5LA1A 1OH3A 3JUUA 4DR3O 3CRAA 3DF0A 1VRBA 4LUMA 3V56A 1SACA 4RGKA 2EAAA 3BB6A 4C1WA 4DRRA 1D4VB 3H3UA 4MO3M 4CH4A 1X9TA 2BZDA 2ODMA 4AEMA 3O1PA 5CFDC 4JZRA 1LGBA 4PT6A 3HNYM 1KU9A 5FYHA 5KXDA 1PKXA 1SQ4A 3QTCA 4PI2A 1Q8IA 4IE6A 5EYPA 2VW1A 2JE9A 3FFQA 2P6CA 2WS92 2Q0AA 2VZSA 5TSWA 1OF3A 2FMYA 1XNCA 2Z5WA 1CAWB 5D21A 4OZOA 1W0KG 1UY3A 4CDXB 4DV6B 4CU9A 3AG3B 4QE9A 1HRV1 5KHJA 5LA0A 4PV1B 1XB9A 1PPJH 2Q7EA 4HETA 2Q4SA 4MH0E 2ZE6A 4GKKB 3WP3A 4HVRA 1PNGA 1YQ5A 4GB31 4LFAO 4B3NA 1NJIW 4RR3B 2PELA 3WFVA 4ISQA 3ZRSA 5A7QA 1QOTA 1HNWO 3U11A 1SQGA 3VKFC 1UJWB 2NZ9A 1NXMA 3D3IA 3VBOB 4JC1A 4O2BB 1ZVFA 4PBPA 3TN91 4XZUG 4OI4A 3T1LA 4DV4O 5CU1A 2IXHA 3RYHA 4W4ZA 2W39A 4YW4A 2D3OW 5A80A 3VD3A 4UB8Z 4DR4B 1UPSA 5CG9A 3ZHUA 5LMUB 5I8SA 1W39A 3GVMA 3BHPA 1QJFA 3J8F3 5DAWA 4NIIA 1SCSA 2JG8C 4BYYA 2DDUA 1YJKA 1VQ5V 1HN0A 1CWPA 4OYUA 2GZWA 5CA1B 2XVLA 5JVDA 1VAVA 2LO1A 3CF6E 1SHWB 2DWEC 2WUHA 4X1KA 3QO5A 2XH6A 3WF3A 1KFUL 3B40A 4AGRA 2CDYA 3IAQA 2HYKA 1K7DA 3H01A 2VPVA 3H9VA 2VNVA 2EXHA 5EZYB 3TN92 4FFBB 3AKSA 3LEGA 3F7VC 5C9AC 5LYJA 2W6JG 3ZN6A 3K08A 1WCUA 2HWB3 2DYRC 3ASNC 1YC61 1N3OA 2ZDIC 5JVVA 3UO3A 1BHAA 1CVNA 5IVEA 1V54C 3PUHA 3GCWA 5JXHA 2V5YA 5BUVA 1KS5A 2YXHA 4FAHA 4ARYA 4KBZA 2UUCB 2OTJV 1Y74A 2LW7A 3WUCA 3W7XA 2Q73A 3E5QA 4YM0A 4LFBB 4UFIA 1ZBE3 5JXJA 1S0DA 3LSEA 3F2ZA 1AYM2 3I8TA 2R9IA 3TEYA 2N05A 4WVZA 1YO8A 2ZIMA 2YIDA 1N32B 4BIFA 2KR2A 1RVF1 4TUYA 5JLVA 3MZHA 4PDMA 3O1UA 4YHHB 1K92A 4BXFA 3JSNA 4CCJA 1VF6C 4J7KA 3M3CA 2YHJA 1KECA 2N7GA 1BYHA 5FYYA 1G9BA 3GWKC 1UMHA 2JE8A 5FNVA 2VGDA 3EVKA 3MAQA 3Q4HB 5DPNA 1N33B 5J36A 4Z1MG 4JDMA 1OA4A 2GP5A 3C8XA 4UW4A 2GU9A 2VNRA 2LTNA 4UCOA 1S0BA 1IVSA 1KITA 3ZIAG 1UPGA 2DW4A 4D6RA 1LAJA 1JBCA 3M7AA 2K9PA 2Z5UA 5ANNA 3FWEA 3UKVA 2WT2A 1ASJ1 4D94A 2ZQMA 4DV1B 1QOOA 4CP0A 3BKZA 3NMBA 1DBNA 4W6YA 2ATKC 2EIKB 3NNFA 3PDQA 4LH6A 4P9IA 1EV13 1XNRB 3RZZA 4BR6A 4LBQD 2R061 3CIHA 2EILC 1J5EB 5H6QA 3A7QA 2E63A 1VP7A 5A3OA 4MVRA 1QH7A 4ZIBA 3VDAA 5LBCA 4I9WA 2ZGNA 3W7WA 3ZDVA 3AKQA 2NQYA 4L9BA 4Q0PA 4DRXB 2DCYA 1FXKC 5J2UB 3CBNA 3UV9A 4RQPB 4CDWC 2GALA 3B77A 1OLME 4AVVA 4HT1T 5FPVA 3LOBA 4IUGA 4CH5A 1R1BA 2AZ2A 1CPMA 5A1LA 2ZX3A 2ENRA 3VDDC 2O0OA 3JALB 2XUMA 5FY7A 1N1VA 2OPKA 4MG2A 4B4RA 1ND3C 4XEZA 2WDBA 1I1EA 4Q20A 4AQYO 1XYNA 1Q56A 5B4XA 4XXAA 1VR3A 3ZFEB 3OR7C 2ZE5A 3VBHA 2HWD1 2QZ3A 3ZFGA 3D82A 2VXRA 5FWEA 3LIGA 1URXA 3V0BA 5GONB 2D3RA 2R062 2ZAAA 1FMD3 3T1HB 2TNFA 1AX1A 1L0NH 2Q1MA 4KH9A 4P9JA 4XXPA 2SLIA 2EIJC 2FQPA 3ACHA 3G80A 3CCVV 3THCA 5FYZA 2OT5A 2WLNA 2PMWB 4G4FA 3AKTA 2VZUA 4LBQA 1I5PA 1YVWA 3SHRA 3ZLIA 2JKXA 1H1MA 4U3JA 4LF7B 4Q1PA 1H2KA 1PZ7A 4YW7A 1WCDJ 4LCUC 1WP8A 5ITZA 5CG8A 3AJZA 4D6QA 2QE3A 4K8XA 2XPJA 1DTOA 2G9ZA 1BLZA 3GZEA 4JGYA 2Q1ZB 2B1IA 5EJ1B 2E75B 2FZ2A 2GC2A 3KS7A 3SLIA 1H2LA 2W94A 2RS12 5T5PA 1N4CA 2HWF1 2IU3A 1GFF2 4F3JA 1HQWA 2QJ1A 4RL7A 3OEAA 3NXSA 1UY0A 4UF0B 4B3SO 2BVVA 4EYUA 1JW6A 5C33A 4GZRB 2EULA 4GKJO 4PQQA 2RMKB 1ODMA 5A32B 3TGUH 3VHPA 5L19A 2DVBA 3AYEA 4EJRA 3JARB 1C4RA 4HKWA 1VP6A 2D3PA 3RYIA 2N74A 4QGMA 1GO3F 1WD3A 2Z4FA 3WQ0A 4QKDA 1SQVH 2VZVA 4Q4W2 3SCGA 1H9PA 4JI1O 1N1SA 4U7OA 3ABUA 1UYXA 1ULDA 1WBLA 4Q4V2 3RI8A 3RVZA 4QXHA 5DAVA 2DF7A 1AR5A 4X1YB 1H0BA 2DFBA 2ZE7A 1J58A 1F7YA 4J10A 4CS3A 2OQ7A 3H1HH 3DECA 3VBHB 1COV3 1FAYA 2WNVA 5A33A 2GC0A 5C8WA 1IOAA 3MUZ1 5IYCO 4BQ5A 4PD4F 3UYJA 2SBAA 1BZKA 3R66A 1C5IA 3BFRA 4P9PA 4FLTA 3BGAA 2WNUB 5F1RA 3K0GA 3TEZA 1QCEA 4A7YA 4XMAA 1OD5A 4O9EA 2IJHA 3HEIA 1XL4A 2WINB 3S3WA 1OHHG 5L7OC 2Q8DA 4TN7A 3LDEA 1E5RA 3ES1A 4ZPIA 1K9MW 4S2HA 5LHGA 1Y67A 4AQ6A 1C8M3 4PA3A 1RMU2 5JIAA 3E8HA 2BSKA 2YDEA 1AYM3 2UWAA 2W1UA 3KKYA 1N36B 4DXWA 1RUG1 1ALYA 3CCMV 2ES3A 5F5QA 1NA1C 3JQWA 3O1TA 1AHSA 5F3EA 3HQUA 2JDKA 2RN9A 1WMDA 3RGBA 4CEYC 5B4NA 4I4TB 4OHYA 3WNLA 1BMV1 3HT1A 1MMMA 4HVQA 2Q9LA 4J1WA 3C3TA 4Y26A 1M90W 1AZDA 2RS33 1PNFA 4XDKA 1VQLV 1PD3A 4LNUB 1RIRA 4ISRA 1IZ3A 2X53S 4WFEA 2YEVB 2VVDA 4HKLA 4B29A 5HV0A 3L73H 3CL1A 1NG0A 4B1LA 2UXDO 1NOVA 2JE7A 1VBE2 4HZFA 1N3QA 2VUJA 2WSSG 3MD0A 4QU1A 2P90A 4YIPA 3ILFA 2PHWA 1W2TA 2KA3A 3LDKA 4OULA 2DUOA 4A2UA 5FTTC 4UBHA 5H2FZ 4JGZC 2E9QA 5D1IA 1RUOA 2XGXA 3A0RA 1EP0A 1F8VA 4DR2B 2VH9A 1NCQB 5BNOC 3S57A 1ZL8A 1RUG2 5IYYA 2YPDA 2VZTA 2GMPA 2A6YA 4U2AA 2WNVB 5A33B 3ABKC 1VB2A 1K33A 3GBGA 3H7JA 1SLBA 1DU3D 1W6OB 3PLQA 1X33A 1MZ6A 1JZ4A 1SMVA 2ZJCA 1G9CA 3VKOA 5LZ6A 1W99A 1PVXA 5CFCB 4I2OA 1DGLA 5KBFA 4X1IB 2JS3A 1UAIA 4JDNA 2AUYA 5C3QA 2DCZA 3RYCA 4R6ZA 5BY5A 1FS0G 4OPAA 1OURA 4SLIA 4CEWB 1TUBA 3CJIA 4UCRA 2XJVA 2HWB1 4DY3A 2BSKB 1UPIA 5EIBC 4GMP0 1RPOA 2J42A 4L92A 2X5IB 3SISA 5L3FA 1VQ8V 1RXFA 4N53C 2ZGMA 1UZVA 2QQJA 3CNAA 1H4HA 5H9QA 2XAGA 4HN0A 3JQXA 4XFFA 1AJOA 4LF5B 2QWRB 4NVPA 1AF9A 4Z8BA 1H8TC 1TNRA 4YW3A 5LEKA 5LXTA 1AUYA 1W6PB 2ZGQA 1KRIA 4D3WA 4YGBA 2XNDG 1JQ0A 4I55B 3VD5A 3R6SA 3N7LA 1RGSA 1W03A 1CAUA 4E4EA 2IJJA 3CCUV 2HLEA 5IK8A 1V0AA 3RG0A 1I08A 1RUJ1 4UFJA 1HRI3 5FLJA 5FXXA 5E1AC 1GKFA 1V6IA 3VQYA 1YYNA 1X8MA 2C1FA 4FFGA 1YEWA 3WNNA 4AAPA 3I2JA 3E35A 5JSPA 1QJX2 4A4AA 1YQCA 2OW4A 4UUJC 3KCXA 5CB7A 1S5LZ 4XFIA 1LB2A 2RS13 2E7QA 3GZUC 4P08A 1OV9A 2X6CA 4R9DA 1R3JC 3ACIA 5EYYA 3MF6A 3NV2A 1LESA 4GH4A 2J1SA 3SPJA 4CC6A 3BYWA 4KI5M 4QDRA 1SF9A 4YJ2A 4JKMA 4Y24A 2HG5C 4FPEA 1JZ8A 4A7ZA 5K7PA 1NI8A 1KC8W 5FUNA 1U5ZA 1H9WA 2WQZC 3QOPA 3AXDA 4I0XA 3K4AA 1O59A 3BPZA 3EMRA 1R3KC 2JGDB 5KX5A 3H0OA 3C3SA 3CJIB 5KMGA 5IJ0A 1VE0A 1GSLA 1UNBA 3AG4B 2Q7GA 1QHDA 1WGPA 2AR6A 3CRQA 1OKQA 2EIEA 1AJNA 1PNLA 1UWWA 1X4TA 2CNAA 1QR9A 4Q4V3 2VCCA 1Q82W 3SGIA 3UESA 2XJRA 2JG8B 2VZQA 2YGLA 3KVAA 3ZDSA 2FD8A 3OYWB 1GNZA 2HEYF 3E22A 5FZ0A 4DR7O 1IXMA 4D0QA 1S0IA 5G04L 1ENSA 2VOXA 4CC5A 1OQEA 1ENQA 2PLV3 1HNZB 3CCEV 4D7TA 3TWIA 3WEZA 3ST7A 3NW4A 4XMIA 3E89A 3QLQA 2ZM6O 2BERA 4DXZA 2UY9A 4OGQB 2JX9A 4H55A 1QJEA 5C9AB 3AMHA 3DXRA 5D8AC 2F23A 2DYRB 3ASNB 4YJ3A 1BHGA 4N9HA 5FXVA 3JB4C 1V54B 1JXNA 1L7LA 3L71H 1Z2GA 1FXZA 3HIFA 3T2MA 2B46X 3WNOA 4AI2A 3TAYA 1JOJA 2VC9A 4J41A 5IT6A 1ULCA 2E5LO 2JEMA 1YSCA 2VUCA 4GH4B 5CBFA 4BH9A 4YJ2B 2P7TC 3POGA 4JV4A 4EEQA 1U0AA 3FX7A 2HHHO 2H0BA 1N47A 3LA3A 3RZLA 2W9XA 1PGL1 4BU2A 1YFWA 1E1RG 4FOQA 4O65A 1B06A 3HPLC 5LASA 3AYCA 3WLUA 3DXUA 2OZJA 1RITA 2CYFA 2QQWA 2KG7A 1BBT1 5GZEA 1VBE3 5IJ0B 4M0HA 3HPNA 2RV9A 1JI6A 1ZRIA 3SNMA 5F8PA 3AM2A 1LEDA 3F5TA 1WCQA 3AXEA 4BQ4A 4B08A 5DZEA 3RVHA 3LOIA 2Q30A 5JOXA 3BI3A 1U97A 1RTVA 2C0ZA 4XPVA 3RRDA 3KV6A 1WMEA 2P6HA 1Q8VA 1JYIA 1SETA 4A45A 3E6CC 4J11A 5I8YA 1I7FA 2HH9A 3FHAA 5C3RA 2YIAA 1UYPA 2QM8A 4CDUA 3ZSMA 1RUC1 5IY5C 4FPCA 1LUWA 1ZRCA 1H8VA 2CK3G 2RM21 3T0BA 2HP8A 1O9GA 1PGL2 4I3GA 1P84F 2B39A 4YZ2A 3HJRA 3AK2A 2IJIA 5IYDO 5CZKA 1F15A 3N9QA 2JDIG 1BBT2 4LXLA 2WLIB 1OLRA 1J3PA 3K5OA 2VZOA 1DGWX 1R3LC 1FT9A 1K5SA 4AVTA 2VECA 3W21A 5JJJB 3EHBB 3GALA 3VDDB 2XAQA 1PL0A 5IWAB 1QNYA 2QQNA 4MADA 2H3OA 4BQYA 4GWJA 4Q0VA 2VMIA 1D5NA 1S3JA 3JXSA 1ND3B 5KAIZ 3Q8EA 4B3MO 3CHXA 1YI9A 4XAEA 1H2SB 5JR7B 2JDHA 5C6CA 3GHMA 4KWUA 4SBVA 1JMUB 3NSTA 5FXZA 3VBSA 1MQTA 2R9RB 1DP0A 2WZ8A 4XFBA 4DB5A 3ZIXA 4CDQB 2JK5C 2RM22 4CUBA 3ZMZA 4AQTA 4IGPA 1AR93 2K1EA 1LOAA 1APNA 3NV3A 4AHWA 5LK5A 5FQ0A 2JB4A 3WF0A 2EZPA 1LHOA 1VRH3 3ZHTA 3BCCH 1X7NA 4PIZA 4ASLA 1S0VA 5IDJA 3IT8A 5FZLA 1QJX3 2QR4A 1EAH3 4RUEA 3JASA 4L11A 3WW2A 3THDA 3VBFC 2G19A 3WX5A 5A3WA 1GP6A 4L87A 4QB2A 2ZKOA 3H3LA 5C5TA 3ZXFA 4CDUB 4X62O 2HR3A 2PHFA 2BU9A 2F4VB 4I50A 4JYCA 2UUAB 2Q1FA 3KCCA 3QVNA 2BW8A 1V6KA 4QPIB 1B09A 3VGIA 5BXXA 2A5ZA 2JD9A 4Y22B 5FZDA 3FC0A 2GNTA 4K1YA 3LCPA 3N9MA 2ITCC 4LKEA 4DR5O 1YQ8A 1BMFG 3JAWB 3CLPA 4QMAA 5BNNC 3VQXA 1LR1A 1QXJA 1HXS3 1XOUA 2RR12 3JD71 5LP6A 3JD3A 1OCCC 3BUCA 3VKNA 3PIJA 1K8AW 1X82A 4YVWC 4FP3A 5B1BB 1PX4A 4E4SA 5FZ3A 4AEDA 1ND2A 1CPNA 3ABTA 1W05A 4I7ZB 2YIBD 1JZ3A 2JJ6A 1LGCA 4Q6GA 4QX0A 2D6PA 4YM1A 2ZGUA 4LLFA 3FUQA 1PO22 5KXEA 3U4SA 3VBUC 1W8OA 4MUVA 2QDOA 2ATFA 1R64A 5LA6A 3AX4A 4MXWB 4DV2B 2Y6GA 1B3QA 5LRRA 1Y76B 2Z69A 2GNBA 1PMJX 1NA1B 3UGGA 4QM8A 3N9NA 2EIBA 4DV3B 4KG0A 1UY2A 3CX5F 4X64O 4JYYA 3WQBA 1OLMA 4I50B 1VQOV 3LAGA 4LKSA 4CEYB 2EAKA 1Y7BA 3X2QB 4GD4A 3K9AA 3P30A 4M3CE 4XQDA 3PUIA 4K7JA 3M70A 2CWSA 3BODA 2N04A 3KCYA 3AMMA 5BNQA 2W47A 4Q27A 2P37A 2LROA 5KAFZ 1VJ2A 4DV7O 3I3MA 4YW1A 2ZINA 1GICA 1DG6A 1L3JA 4BK4A 3CB2A 1UYZA 2X8KA 1B35C 1F51A 4LFCO 1YHFA 3KVBA 4B7KA 4OQ8A 1JMKC 1YJWV 1WD4A 1FNZA 1E5HA 5C4WC 2YIBA 2H8PC 1YUDA 4FSJA 3O1RA 2ET7A 1F4NA 1JZ7A 1NQJA 2EIDA 5BNOB 4XC9A 2JECA 1SQPH 4IERA 4IW3A 1UZ0A 1AI6A 3WU2Z 3F95A 3MIDA 2HJIA 2XTAA 1YCIA 4B3RO 1SBEA 1KS4A 1N34B 5AVPA 1W6QA 1NT2B 1SESA 3X29B 1R092 5CA6A 2J22A 4N43C 3FYEB 2ZOEB 1ND2B 3FAVA 1K5JA 3N4MA 2F4PA 2D97A 5JPMB 2EF6A 1O4ZA 3N9PA 2BOIA 2Y6LA 2L6LA 4QPGA 3KHCA 3RSJA 1RL3A 1A78A 1RUE3 2WO3A 1OC1A 3SYPA 2D98A 1KBHA 4TQFA 4C1XA 4PQ9A 3AG2C 2ID4A 2BNOA 2NMNA 1IX9A 4JI4B 1BKZA 1CN1A 4WM7C 3HKCA 2QQVA 4DV6O 4NXNB 4OZXA 4QKNA 1GQGA 3K06A 3BIWE 1WMFA 3DV8A 4G2KA 4GKKO 1BHBA 2NLRA 4Q0SA 2ZEZA 3BAAA 1I5YA 3LE0A 1PIV2 2LGWA 3NRUA 4NAOA 3H9AA 4BJ0A 3WUDA 2MK3A 1XMOB 2ZIOA 3RWRD 4Y5TA 2M7WA 3PU8A 4M0NA 1EZJA 2CTPA 5DMYA 3HR9A 5CAZA 5E79Z 5ABJC 3POWA 2A70A 4L97A 2F95B 1J95A 1ZZ6A 5FZ8A 2PXJA 3VBRA 1E79G 1ZZ7A 2EINC 3H7YA 5CYYA 3D3QA 2WN3A 3SKVA 5FYUA 4FPFA 4NIDA 1QJU3 5AFBA 1YJLA 2CSGA 2RNBA 4XFGA 2BQPA 3HD8B 3VHOA 1CONA 3ZMTA 2WO2A 3IFXA 4XUOA 3A0KA 3UT5A 4CP9B 4DR4O 1WB8A 1Q43A 5LMUO 1I5XA 3POIA 4XBQA 2AREA 2JG9C 1RFYA 2WLJA 3JAMN 5DUVA 2W0FC 2E51A 3JCZA 5IAVA 4JDOA 5IFPA 4BW9A 3T1MA 3AFGA 3LPGA 2BFUS 3RZJA 3OGJA 1VBA1 3ZFFA 1LOFC 5FZBA 3ZYGA 5FYCA 4A3XA 4DO2A 1VQ9V 5IATA 1XYOA 4UT5A 5FY1A 3DUIA 5CFDA 2LS6A 3M7MX 2VUDA 4QNHB 5T5LA 4LWSA 5L3GA 1A6CA 2L9LA 3WQ1A 3OB8A 3AB0A 2KSDA 3GJAA 3VHRA 2PHRA 5JIUA 1FFXB 3B02A 3ZHRA 1CGPA 4QQPA 3N9LA 3D3AA 1KFXL 4HNAA 5L9VA 3J7LA 2CWMA 5DDJ3 2UUCO 1GMMA 1XMQB 3WG1A 4LFBO 3NKTA 3ZEDA 3JBG1 3TXSA 4YGDA 3PMSA 1HB4A 4Z2AA 2DU1A 1QGLA 2RJLA 4XOGA 4E4DX 1N32O 1VBA2 5FBJA 3ETGA 2ZHNA 3MW4A 3WF4A 1HWYA 1KUQA 5D8AB 3WT3A 1AR4A 1S0JA 1V9PA 1JX9A 4YHHO 1M1KW 1W6MB 1O4TA 5LEJA 1HR0B 5FREA 5I8TA 3W58A 4DPNA 3G71V 2OCCC 2R1BA 1PO23 3NJZA 3F5WC 4YW5A 5HPOA 4LF8B 4RGGA 1I94B 1N33O 2VMFA 3P6BA 2J1EA 1VRH1 1W8ZA 3QACA 1KP3A 5FUIA 1AX0A 3ES4A 3RNSA 3EJKA 2A71A 3V65A 4FM0A 4FQZA 5H9CA 4ZHQA 1M56C 4UFKA 1YXBA 1EAH1 3O14A 4Q4X3 2C6SA 2W68A 4FPGA 2BOCC 5IYZA 3AEIA 1AVMA 4Y20A 2UWBA 1CXZB 4GUNA 3T4HB 3CS5A 2HJDA 3AK3A 2EIGA 3JBG2 4HPKA 2YB7A 3N2GA 3POFA 2RHPA 4C8DA 5JAXA 2J1UA 4M3CF 4DV1O 2P3JA 3BY6A 1FAFA 2W92A 4AFCA 1WPBA 1V9U1 2HWE2 3JAKA 1LU1A 3D36C 5K8SA 4MOAA 2DV9A 4KGGA 1NY72 3LDCA 4IEZA 1XREA 1S77D 1XNRO 5I0RA 2R043 4ITCA 2Q8OA 4PBOA 2R6QA 2IJKA 2BNMA 1J5EO 4WVMA 3J80N 3IAYA 4E2LA 3WV6A 1MSDA 3H1KH 1XQNA 2DVFA 4GYCB 1CX1A 3WINE 2K9ZA 3TK1A 4X20B 1AP6A 2JJ2G 1BK1A 5A3LA 5AC91 2ZDIA 5EV7A 2IH1C 4DMIA 1V6OA 1CAXA 1EUTA 5FO9B 5JJNB 5EJZB 1FD9A 1WW6A 4S2GA 4AW7A 3KGLA 2P4KA 1FX5A 2FDKA 1R093 1SFPA 1HXS1 3UCSC 2BGOA 1AI7A 1XI1A 4B4PA 2UURA 2W91A 2BTQA 5GZFA 2BV4A 5A6YA 3AG3C 1Q8OA 4Q1RA 2PZSA 5F37A 1JU3A 3CRMA 3JD4A 1V9U2 4BPZA 4X8AA 5FXWA 5A9GA 3T4DA 1BCXA 4ES8A 1W9TA 4YG3A 4TOIA 1DLBA 3E5XA 3ZSJA 3T1HO 4K3UA 5FMOL 2WWSA 5FCCA 3AMNA 2R16A 4Q4Y2 3SDLA 3C7EA 1UXXX 2WKKA 1SERA 4IGGA 1V00A 2C4XA 3V0AA 4F7ZA 3BU7A 1L8DA 3HKBB 2XHBA 1Q6HA 3VBOC 2ZGSA 4LF7O 1TME3 1JHNA 4H2AA 4HXCA 4LO8A 4ZY9A 1VAMA 2DE0X 4QX5A 1NTZH 1SDWA 4I30A 5K0UC 1GAXA 5FJHA 1HQLA 1SKVA 4XABA 1Q7YW 4X8PA 5FZKA 3LD8A 3J26N 4OLLA 2W3JA 1HV1A 2BGCA 3E5UA 4CE8A 3DPRC 4QXKA 1PV0A 3MIFA 5SV5A 2MNGA 4M00A 1MZ5A 2G38A 4LA3A 4QXBA 1POV3 2WT0A 4RAIA 1W6NB 5A6ZA 3EXUA 4TV9B 1W59A 2RQ6A 1JPXA 3OE7G 1H8HG 4RS5A 4NTYA 3L70H 1D4M1 3ORJA 4OCTA 1JH5A 5GW7A 1AI4A 1NZIA 3J7MA 4YFWA 1FXKA 2TUNA 1V6JA 5G05L 2PYJA 4PA4A 2GUZA 3R05A 3PJYA 3NL1A 3NV1A 2JDAA 4NRPA 3CC2V 2ARCA 1UY4A 3T1YB 2QCSB 1JOPA 2NNUA 3K75B 3KT1A 1QF3A 3KB5A 2UU8A 2A73B 1Y9GA 1JOYA 5FK7A 5HXVA 1DGRN 5AG2A 5CA0A 4MVOA 3B8NA 4Y1UA 3CMGA 1Y66A 1PMIA 5ACA3 4QJFB 2RJZA 5C8YB 5EBLC 2VMDA 3WDTA 3B00A 4URTA 1IXBA 3RDIA 3WW3A 3IM0A 1SLLA 4XBFA 1FXVA 2LALA 4O4JB 3DXTA 5FZIA 3POJA 1H2NA 3MHSC 4LHNA 1D4M2 4K20A 3ZSKA 3PTYA 4Q29A 5A1AA 4W65A 3K04A 2RS51 5CEHA 1OCCB 4FPHA 4IIJB 4C0HA 1AYN1 2YGMA 1ZNPA 3L74H 1C8NA 3ZRVA 3OGGA 5CVRA 1AR62 2XOMA 5JCTA 4LBLA 1HJGA 3JATB 4EFEA 4CYDA 1KQRA 3IKWA 3BCWA 3OGVA 4P5HA 4TSFG 1N36O 4WBBA 1MS1A 2WNOA 1ST8A 3ZRXA 4ASUG 4BAYA 5BMVB 1J1TA 2CDOA 5FP7A 3PUAA 4DFSA 4CRQA 4GIQA 1YFYA 1RUF1 1ZZCA 3RZKA 3H50A 2YU1A 5FZOA 5IK7A 4YG0A 3G67A 3ITQA 4NHKA 2XWJB 3QNEA 4A41A 3CMEV 3LKJA 3DYMA 1YDXA 2DQ0A 4ZZ8A 2AZ5A 4X66B 3U1XA 1VBD2 3VBUB 2EIKC 5CN0A 2EXJA 3ROUA 1CP9A 3IDCB 4UW5A 5CB4A 2GDSA 1GWKA 2RS52 3ACGA 4YZ1A 5HBAA 1QJU1 2HFEC 1AYN2 2WA3A 4B8EA 1AR83 2AGSA 1AR71 5E8AA 1QVFU 2MEV3 1LRHA 3IC7A 3PVOA 5F2WA 5GTIZ 4DR2O 1LODA 5KHHA 4XETA 4JAUA 3T09A 4RQPC 4PA6A 4FI9A 1NUKA 2MW2B 2HWE3 1XBLA 1H4GA 3IMMA 3FLRA 1VMHA 5EJ3A 2J1VA 4IYIA 5C7GA 1R1A3 4AHZA 3WNMA 1EM1A 1D0GA 3DSQA 2LW8A 2W08A 1OZ0A 1RUI1 5C4WB 2XONA 3NJVA 3ZFEC 3BEHA 4J25A 3SJCC 2GHYA 1G9AA 2FCVA 1HW7A 3B09A 5L9BA 2R071 3EB7A 4YW2A 2UXCB 3BTAA 1O3TA 1S2KA 1GBGA 4EN8B 2A6WA 2BJSA 1M57C 3VZMA 1UU5A 1M06G 3LF7A 1SA0A 4CXYA 4FPPA 3VV1A 1U5YA 1AL23 2QWQB 2D6KA 4NTXA 2VZ1A 1DGSA 4PJ0Z 2J7MA 3SYOA 5C8CB 3MICA 4LF5O 4JRAA 4UYBA 3MIBA 3MHHC 1XYPA 3SJQC 4DR1B 1ULGA 1PM7A 2DCKA 4V2VA 4CU6A 2WC2A 3AG1C 3MFAA 4BXSV 5L3BA 1Z7S2 4FPYA 3B2EE 1WW5A 4H7MA 4LK7A 4MTOA 3E2EA 4Q4Y3 4UWDA 4ES9A 1O8PA 1QLNA 3IPVA 4OFGA 5GLWA 1QIQA 3ASOB 5KC5A 4O7XA 1BEV2 3B4SA 1REFA 5FRAA 1GYKA 1JUHA 4UFLA 2UU9B 3ZYHA 2DMXA 2PF4E 3A0HZ 3THOA 5FPOA 3OBAA 4QHBA 1WAZA 4JGZA 4IV3A 1XJAA 2ZHMA 4AG4A 1X8EA 2BWAA 5FK8A 2ZKNA 3MDPA 2HBTA 1XU1A 1YIPA 4XF1A 2VCAA 2ILMA 4NTWA 3A21A 3ZXGA 3BA8A 4DXSA 4XFAA 1LHWA 4MW8A 1OI6A 4FLYA 1CIWA 2RE9A 1R6TA 1J3QA 3VD9A 3C90A 3RYFA 4MGKE 2K46A 2W52A 3DGTA 1V70A 3K77A 2ZGLA 1PX3A 1QJY2 2CH7A 1T2XA 3NKGA 1RJ7A 3G6BA 2ZPXA 4KU7A 4XF9A 2EINB 1OQDA 1W8HA 4M4PA 2WWUA 4F6RB 3ZN5A 4AL9A 3CWBH 4YM2A 2VNOA 3ZN4A 3VBHC 5FBZA 3ZFGC 5L3EA 2PYLA 1R081 2KXLA 5DZFA 4DEVA 4L8QA 2CTQA 1EUUA 2P5OA 5BY1A 4YY3B 3VQVA 1THZA 2Z3YA 1KP2A 3HWJA 1VQPV 1VBB1 4EB6A 2QDRA 1NAEA 2WNUC 2JG9B 4QB6A 3FHQA 2EVXA 4K9SA 1XNQB 5FZMA 2ZGKA 4LKFA 3TETA 2HEPA 4AHXA 2XOKG 1XHZA 1ZBA2 1HB3A 1MEC1 5H5NA 1W90A 2WZR2 3NJYA 5CBLA 2IVIB 4JGYC 1TNFA 3VZLA 3BOWA 1FPN1 3S5QA 1HNZO 2WFF2 3MLJA 4AK3A 3T30A 2VUAA 4ZKTB 4M3CA 3POSA 3AKPA 4WFBV 1S0EA 3AMQA 4IV1A 5LBFA 1O3QA 4GJZA 2ZX4A 4O4IA 2XWBB 1YTFD 3IMNA 5GTHZ 3ZXLA 5KA6A 1R082 2VM9A 4YVSA 2CY6A 4EWEA 1EZVH 4ZKIA 1BGYH 1S5JA 1SQFA 4LOSA 1AR63 3FB5C 3T0AA 3U75A 1BZWA 3OBRA 2E32A 5HCHA 2GC1A 4AQSA 3HBKA 4HFSA 3AC0A 4GT1A 2Q8VA 5DG1A 2AH2A 3RYFB 4EKWA 3QH6A 5FWJA 1UYYA 5KHIA 2ZMLA 2ZS6B 3NQHA 3GJBA 4LORA 2O14A 1YF2A 3W7TA 3RYKA 4HN1A 1FPN2 3UKNA 5KC6A 1DQ2A 4AWDA 1RUH2 4AI0A 2DTYA 5I93A 1XE0A 5A7WB 2OCCB 1VBD3 3ZYJB 2WNVC 3WXPA 4BIOA 5LGUA 2QWOB 3I97A 4JI5B 1G8WA 1O91A 4LNVA 4OXSA 2HWC1 4IEYA 4MSVA 5GZGA 3OF1A 2VOKA 2PQSA 1YI7A 4YGEA 3FLTA 1QLEC 1K5QA 3FYIB 5CFCC 4UVBA 3ABMB 3AP9A 1XXNA 1JA8A 4QKBA 2OIIA 5GJ6A 4IEOA 3JCUZ 3RQ0A 4BK5A 2FKXA 3UGHA 1R6KA 4AVCA 4JYBA 4NHMA 4CVUA 3MIEA 4WM8A 2OVUA 4CEWC 1RPRA 3P32A 2ADPA 1JYTA 2JIGA 2HVJC 1Q6IA 2XBO3 4U7NA 1B6QA 4URAA 4JASA 5GLTA 2B9ZA 3FL7A 1IG3A 4XTPA 5EBWC 1DQ6A 4ICGA 4ZU4A 5DAQA 4IV1B 2IFWA 1NR7A 5ACA1 4K6BA 2DUQA 4FPLA 5FYIA 4LF4B 4JI7B 3I2FA 4DR6B 4ZOLB 1NCRB 1RHI2 2ZGRA 4FJCC 2FCUA 3CZUA 3CEIA 1OCRB 4O4HA 1RSOA 1VQNV 2HWC2 4P02B 3SKJE 2JJ1G 2OCHA 1TMF2 1FYUA 3FBYA 2RMU3 1A8MA 3N35A 4QWNA 2YZ4A 2XB6C 3USUA 2E7TA 5IWAO 2E7AA 5DXDA 1WKYA 3HKEA 1PVC2 2VNGA 4E8DA 2ZZJA 4IESA 3GHNA 2DWDC 2IVJA 2WLKA 3MF9A 4P9OA 2O8QA 4XVHA 3ZSLA 5JOZA 1EBOA 2BTVC 1JODA 1NLSA 2Q68A 4IL6Z 5C3OA 5D5PA 4A5UB 2Z2SB 5C71A 2HEVF 2Y34A 1CX4A 1VBC1 2AHYA 3ZXKA 2WLPA 4BOWA 4BQ3A 4O4LA 3IWZA 5FV3A 1BEV3 2HJFC 2DCJA 3I3QA 5FY5A 5A7NA 4LF6B 4H7LA 1WA8B 1JYVA 1MS3A 1NU1H 3R0RA 2JB8A 4YG6A 1OCZB 2BUKA 4K21A 1BVP1 1F35A 4KWKA 3AL5A 1YTFB 4XCBA 5K0UB 2IH3C 1ZSPA 4QT6A 4O61A 4LT5A 3OUSA 3UQ8A 1XNKA 1FKAO 2HVKC 1SZXA 4PDLA 1W04A 2ZCEA 3UGFA 3CJIC 5T5OA 1DQ1A 1GZWB 4PDWA 1GRJA 2GNDA 2MEV1 5C5UA 1HRV2 1NTKH 1IPKA 3W7SA 3AG4C 4XDQA 3DPRB 2CAVA 3MIGA 2AZ0A 1W2AX 5CKNA 3OEEG 2WYFA 1MSWD 3E86A 2F4VO 1EN5A 2F17A 4R50A 2A3XA 2UUAO 1FOD3 4GB32 3O0XA 3ZR5A 1G4YB 1Z5VA 1W9WA 5F39A 5IVFA 1SC5B 1H6XA 3LUTB 2QNKA 4LP8A 1RXGA 5A7SA 5CISA 3WOGA 1R1A1 2GAUA 4FFKA 1LNQA 4FFFA 4RWUA 4O4HB 3SH3A 4MSWC 3B7MA 2FDGA 1W9SA 3WD5A 2OA2A 4JQTA 1JHJA 5EYPB 4AI1A 3KLSA 2BRTA 2G4IA 2LP7A 5FR3A 4WFFA 3KT4A 1WLWA 4ZI7A 1WP7A 1HDJA 2VCMA 1OXCA 2PFWA 3CEWA 5C70A 1OHFA 3MO4A 1BSMA 3KMHA 1L0LH 5KR7A 4ZS2A 4BISA 4X89A 2EALA 2WFF3 3QO7A 1XDCA 1WCSA 2H6CA 3L9JT 3K5MA 5FY0A 4AEJA 1Q8QA 4WBNA 2WLMA 1I5ZA 4GH4C 4BQXA 3OMIB 4XHXA 4W4KA 2QE7G 4QX8A 3K9SA 2BWCA 3M2MA 1QDCA 1QQP3 5FYBA 2QQIA 5M0TA 2GDFA 2VW2A 2ZBJA 4NWWA 1URFA 4CTEA 1GP5A 4DYLA 2KM2A 2IM9A 4COUA 3RYHB 4FP2A 1BK0A 3ATGA 4NRMA 1XUQA 4LBMA 5A3MA 4J7JA 3GXUA 4DV2O 1UU6A 3AK0A 3VBFA 4TTGA 1LOGA 5J2TA 2Q8CA 2V4AA 1T6BX 4DV3O 4FLXA 5EZWA 5EFUA 4DQAA 2OPWA 3ME2A 5FZFA 4QE7A 1VIWB 4JI6B 1ULPA 4LBOA 4BMBA 2GV9A 1PO11 4FMTA 1RUH3 3I2HA 5FLIA 4FTEA 4GULA 3JSLA 5ERLA 5JVDB 5B1AB 3MW3A 1GTOA 5LA9A 4PA9A 4FBFA 4F4LA 4X1KB 4QDSA 2OWOA 5JI9A 3WQ7A 3D5OA 1RVF2 3FZ3A 3VZKA 2YY1A 3I4IA 2F66C 4H14A 2B5UA 1J83A 5FYTA 5LL6Y 4ZI7B 5LYJB 3ZN6B 4RHV3 1ZA4A 5F3IA 1TEIA 4Y1ZA 5BNNA 4MTGA 2QQMA 3LDDA 3HNMA 2CTVA 5BNPA 1XEQA 4UVAA 4ZU7A 1Y74B 2ZGOA 1RP3B 2VQEB 4QU2A 1N34O 4D6TH 1GZCA 1W9FA 4FLZA 2WZEA 4F8AA 1ONAA 4WBNB 3O0WA 4YVWA 1PO12 1ASJ2 2GBOA 4JI0B 4QIWF 1QEXA 2E26A 4TUYB 2D6NA 3AL6A 1RUD1 3OJBA 1H30A 3E97A 3LFIA 4FVMA 2CAZC 4Z2WA 1RHI3 4HLTA 1YJNV 5JOYA 4E4HA 1H1IA 4YW6A 1E5SA 2PGGA 3MDSA 4WZFA 1YFXA 3IC9A 5FNVB 3HNBM 1TMF3 2L35A 4JI8B 1LNSA 4D7YA 2LFRA 3ZBHA 1SBFA 2VXJA 3H8UA 4CDQC 4KFMA 2Q5TA 2WS93 4CUCA 2Y64A 4KMQA 1QOSA 4XAAA 1M57B 3SQOA 1GQHA 2XLAA 4CCLA 1PVC3 4JI4O 5A7PA 1BJQA 2CAUA 5FJKA 1L7RA 4QB1A 2X6AA 2W1SA 1WJZA 3P1IA 4NXNO 2VJXA 5EC1C 2DJVA 1U96A 4WV8A 3OGSA 1FYJA 1GMGA 3DL3A 1ULFA 2EX3A 5CADA 3FUOA 3SPIA 3AG1B 1XMOO 4DUVA 2JDYA 3ZX6A 3I59A 1ZRDA 2Q6AA 5A3TA 3MGUA 5LBQA 1RUD2 3ACFA 2JDUA 4CDUC 4GMP1 2HWD2 5I0DA 3SXWA 3H1LH 5IJ9A 5DUUA 4QPIC 2JKBA 4E8CA 3MBWA 3O1SA 1KDKA 4GX0A 2VL4A 3M3QA 1MS9A 4C0BA 4RD7A 2R1DA 5K4LA 4HONA 3HKDA 3WZ1A 5FO8B 3IGAC 2WZPP 5FPRA 1H6YA 4AI9A 5KHGA 1YITV 3ETEA 1PK6A 3WP4A 5IVJA 4N43A 4GB33 4AVAA 1K5MA 2VZ3A 2E74B 1O6UA 4NHLA 3PURA 4UCSA 2W87A 2JIJA 3T1CA 2XBO1 1VQ6V 2DBIA 2QJVA 2HWF2 3HN1A 5J37A 3ZFGB 4PCRA 1EYBA 2ZTNA 1MQTC 2B1GA 3V0BB 4XIOA 5I0TA 3WDXA 3KSCA 4IEUA 4Z82A 1NLRA 2Y33A 5B1BC 3NNLA 3ZMNA 3RMXA 3WP6A 3TN93 2OUHA 3PJQA 1JJ2U 1MG1A 2AYHA 2JWPA 4LBQB 3VHNA 3FX3A 2IXIA 2ZEXA 4U3JB 3EBRA 2VS0A 1GP4A 5FZCA 3OY8A 1BXHA 3M3OA 2O8OA 5ITZB 2PAMA 2D5HA 3W5MA 1QMJA 4DUXA 2P06A 4LO7A 4JGYB 3TNPB 1XMQO 3SMHA 4L99A 2W1WA 1XPWA 1Z78A 3NAPA 3BPSA 5KLVH 4E2QA 3N7JA 2ZABA 2ARBA 4FOYA 4B1MA 1QHTA 3AYAA 2OT7A 1UQXA 1TVKA 1J59A 3VOUA 2QKAA 4MVQA 2D2CB 4A3ZA 1NS1A 1XSQA 2XHNA 3I7DA 4IEVA 4YZ4A 3WF1A 3ZXAC 5ABJA 3X2QC 2ZGPA 2CGPA 4QPWA 3K03A 3N3HA 4BW5A 2BDRA 1F4HA 5FAXA 1TQ5A 1HR0O 4META 2WAAA 1MS8A 2VTXJ 3K4ZA 4EQVA 2P67A 1UZZA 2BBAA 4LF8O 1I94O 5FMBA 4AHYA 3I2OA 2IWGB 2ZR3A 3G4SV 4COZA 3RYIB 3K4DA 4QGLA 4IE5A 1CJPA 3WVJA 2GN7A 2WQ8A 3WG7B 1OA2A 1NKGA 2UWCA 1PK6B 1MVEA 1DF4A 1GK9A 1GN2A 2C5DA 4JKLA 5LP6C 4OVEA 3SYAA 4CS2A 4IE0A 4HSLA 3CCRV 3C3VA 1HKDA 4XQWA 2NN8A 1HJFA 2ARAA 2A3QA 3J7NA 3U10A 4JHTA 1LOFA 4CU7A 3ZYBA 3J8F1 3PU3A 1FOD1 1US2A 1RVF3 2Y6KA 2D43A 2FDJA 4AI8A 1BMV2 1IURA 4AEDC 1GWLA 1ND2C 2AEZA 1S72V 2YU2A 1SPPA 1OKOA 2CL2A 4JVAA 2PTMA 1QLEB 4I9QA 1S0GA 1ROPA 4RFRB 2ZHKA 2VOTA 4LBEC 1M4WA 3OY8B 5FY8A 1TAEA 1U12A 4GALA 4CXXA 4N7UA 4E9KA 5E1RA 4GX1A 2YBKA 3ZSEA 1GM7A 1ULEA 1XNTA 5SV8A 4P14A 3KQ4B 2PHXA 1GN4A 4FQ4A 4AFAA 3VD7A 4CA9A 2I74A 3ZXDA 2W1QA 3ABLB 1EN6A 3OEHG 4KU8A 3E83A 1AJKA 1NZ6A 1ASJ3 4H33A 3ILNA 1QQCA 3VDBA 1QVGU 1SQXH 2B9VA 4CU8A 1PGW1 4DZGA 1J3RA 1ZBE1 2DWRA 3I3EA 3K3OA 4FLUA 4DUWA 4EN6B 3VBBA 5EK0A 4PF5A 3ICXA 3WHUA 2QVSB 3J8F2 3IN9A 4Y1VA 3WDVA 4MV2A 4QQ2A 2A3WA 2Q5ZA 3A8TA 2R063 1QH6A 4FFIA 1PL4A 2JICA 4N7IA 2OUJA 2WO1A 1W8NA 2PA7A 2IXLA 1DQ0A 3GDBA 1W3VA 3S7IA 3B3QE 1MS4A 4BWOA 3ZHVA 1K12A 4ZXEA 3JCIA 1W2BU 4XUPA 2AENA 2RDQA 4MGSA 2R7EB 4I0BA 2CTRA 3WB1A 2DOSA 2HWB2 1KJLA 4AFBA 1DF5A 4UB6Z 2ZXWB 2J1AA 1VF5B 2WRAA 1ZL8B 2H94A 4J7ZA 4PLMA 3MLLA 4LHLA 3ZKYA 3CQOA 4GXLA 3KM5A 5FPBA 4Z92B 2Q67A 4GA9A 1WUVA 2OIEA 1COWG 4Q0QA 3ECQA 4FO9A 3DTUB 1H2MA 3D36A 5DN2A 2I2SA 4OX9B 1Z0HA 1PGW2 1ZBE2 4K1ZA 4H0LB 2CGOA 3BALA 2HWD3 3VL9A 3C2UA 3VD4A 1CIYA 1DIWA 5IUQA 3AZVA 1IBLB 1EV11 2DCTA 2Q69A 2RVAA 1PM4A 3I2DA 3APQA 3RYCB 4QDQA 4F83A 3CD6V 4P30A 1RUJ2 5LHHA 1TUBB 4EFBA 1REEA 2EIMC 2XJTA 1OUXA 2XUEA 4CCCA 2WLLA 4Q4W3 4OI0A 3T1YO 4HANA 4CXWA 4FTBA 1VQ7V 3H8XA 2YV8A 4QD2A 3VQWA 3GBFA 4R7CA 4Y4RA 4CDXA 2AGAA 1NE4A 2ZE8A 4WCEV 1JYXA 5LB6A 1EFRG 5FYMA 2HWF3 1YI2V 5LXTB 3H8OA 4IGOA 2RDCA 5DN6G 5FP4A 1LOBA 1CAUB 1WCKA 5JI7A 1YQ6A 4RR3A 5FZEA 4K8FA 5EYXA 1D7PM 1O7FA 2IUWA 3U4XA 2VVEA 3RPQA 1F23A 4RQFA 4M4RA 2VOWA 2VWKA 1D0HA 2G9GA 2XVKA 3SH4A 2E3CA 3OGIB 3VBRC 1FMD1 1KKCA 2V73A 2TEPA 3B69A 3VBOA 4D8MA 2GN3A 4HYOA 4O2BA 3RWNA 4K0KB 4TT3G 3PUSA 3URFA 3SEPA 5J7MA 1RMU3 4FCAA 3R65A 5IK4A 2AW9A 4FLWA 1BQ0A 1KB9F 1WB7A 2A79B 4BIUA 4X88A 3WP5A 4LH7A 1LR5A 2OZ6A 4LO6B 5CKQA 2I45A 3EO6A 2P1BA 4V2WA 3OW2U 2D6MA 2E31A 5JSOA 1Q86W 4EZHA 2ZEWA 3ZFFC 3JU9A 1RC6A 5CA1A 5HCFA 4X66O 1AB3A 4I0XB 2ZMKA 5KA5A 1XNAA 2PAKA 3LDBA 4HOOA 5KX5B 5KMGB 1OJHA 3W9AA 1FMD2 2WLLB 1FV3A 5LK7B 5EZYA 3ALQA 3LB9A 3EFFK 4FFBA 1YIFA 2ETNA 2NPIA 2A06H 2A7WA 5C93A 2VULA 3U78A 2QTSA 4DV0B 2D40A 3ZPOA 1TVGA 4GWIA 1VEWA 3LEMA 5EHDA 3E22B 1RUG3 1AI5A 2VCBA 1FI2A 4GJYA 1IG0A 4Y33A 4CCMA 3DKQA 3E6BA 4KP4A 1LU2A 4HSJA 1REDA 4RGAA 3K5NA 4MS2A 1HB2A 5L9RA 1EY2A 3ASIA 4DOUA 4BWAA 2GMEA 3H1IH 1JU4A 1COV1 3UETA 3DXRB 3GBWA 1JVMA 4UFMA 2D6OX 2Y26A 2VVFA 4YJ3B 4DY5A 1WLEA 3W59A 3M3IA 2Y69C 3STZC 4H44B 3ZYRA 1WA6X 1JYWA 2UXCO 2Y60A 2LRPA 2XT9A 1GM8A 1CJDA 4E4ZA 5KXCA 3Q4HA 4KHPB 2PHTA 2UXXA 3QO8A 3NNMA 2W2IA 5F5CA 4AF9A 1Y43B 1XNBA 1C8M1 1Q81W 4TWKA 3TJTA 4CSWA 1VIBA 3ETPA 1LENA 3SITA 3L2YA 1AYM1 2R0FA 2PI5A 2ZZQA 2QQKA 4DR1O 1QKQA 2ERFA 5DAPA 3FD9A 1W28A 2WBKA 5T54A 4LC1A 1RUC2 4IEQA 3FMGA 2P22C 3PUQA 2ADDA 3NV4A 2ZAHA 1COV2 2KG7B 3KF5A 3DC6A 3OPZA 1IBMB 1LOCA 2RS31 1MPXA 3UJQA 1SLIA 5IW0A 2YI8A 2UU9O 2WWJA 5A6QA 1V6MA 2RCVA 1ZZBA 5JCOC 1D2SA 4R4ZA 5FZ6A 3T2PA 4N90A 1HNXB 1BQZA 4DRXA 3E1F1 1NVPD 4HVOA 5J2UA 3TBDA 4RQPA 4J6GA 2Y8KA 1EPZA 1LHVA 3DN7A 4NXMB 1C8M2 1DK1A 4JKKA 3NR7A 1LKNA 3JALA 1GNYA 1HDKA 2PY5A 1EN4A 1W8FA 1GU3A 3OT7A 2ZHLA 3AK1A 4TV8A 1GKBA 3SJAC 4YGCA 5EIYB 2XASA 5CNAA 4XBNA 4BLIA 1DYPA 1TG7A 3ZFEA 3BTZA 2XKPA 1RUJ3 2FDHA 4TWTA 2PUSA 2RS32 4PA7A 1CEZA 2D7FA 3MV11 5GONA 1ENRA 3I3DA 4YY3O 2FDFA 1P4RA 2EJ7A 3A23A 1U5XA 2NN4A 2RJ2A 4LLOA 3GGLA 1AJPA 2QEXV 2WNEA 4Y3OA 4UBGA 4MXVA 1XNQO 2VBPA 4XJZA 4LJHA 2ZEYA 2V1DA 5B3SB 1AX2A 4ARXA 2OYQA 5A1FA 3VBSB 1OVPA 1MQTB 1UIKA 2ITDC 4FVVA 1IBKB 3J9SA 3HVDA 1DYKA 3CRRA 4XUTA 4ET7A 1G6NA 5EBMC 4LITA 1E57A 2FDIA 1XE8A 1ZUQA 4XILA 1YWKA 1L7QA 5BV6A 5FQ0B 2VR4A 1XBFA 1BQPA 1ENVA 2A9HA 4UF0A 2UXNA 3GYDA 4J9ZB 4C91A 4RS5C 5HCBA 1N3PA 2WAMA 1XQ8A 2NMOA 4CBCA 4JX0A 5A32A 3T2QA 3ZHSA 4P00B 3JASB 3O9OA 5E16A 1HRI1 2BVBA 4NPLA 3H8RA 4MGQA 1GM9A 2VQFB 3JARA 2LUWA 1K3IA 4WFAV 5JSRA 4XYXA 1S1AA 1DLCA 4FLVA 4QPJA 3JD72 3T4VA 1V55B 4DV5B 1L1FA 3MEPA 5F7UA 4XJUA 3A0NA 4I02A 5LY2A 2WR9A 1CPYA 3WB2A 2DYSB 4MVMA 4XUQA 2RS11 2GSYA 3RZHA 3BOPA 4TV8B
chains in the Genus database with same CATH topology
1C5HA 3IMNA 3ZXLA 4D69A 2WFPA 2W0XA 1R082 1GSLA 1QHDA 3LZZA 1WGPA 2AR6A 4YVSA 1OKQA 1OA3A 2CY6A 1OSGA 5GZCA 4FOWA 3FFZA 1UN1A 1GANA 4KWLA 4EWEA 2CNAA 4Q4V3 2XJRA 3G7DA 1AR63 2JG8B 2YGLA 3ZDSA 4XIKA 3OYWB 4V1PA 1BZWA 1GNZA 3OBRA 3SCHA 3WY6A 2HEYF 1IGOA 3AZXA 2WLQA 4XF0A 2GC1A 3LSDA 4Y5Z0 4XJWA 1S0IA 1NX4A 4AQSA 4HFSA 4CP2A 1RJ8A 1ENSA 1SLCA 3WDWA 2VOXA 2WNUA 5DG1A 2AH2A 5J96B 3QH6A 1WLDA 2HWC3 1HRI2 1OQEA 3WW1A 1ENQA 2PLV3 5KHIA 1CAVB 2ZMLA 1JN2P 2D5FA 1HQNA 4D7TA 3TWIA 3ST7A 2ZS6B 3NW4A 4XMIA 1OPMA 4Q4W1 1SBDA 3D0SA 3VBUA 3LA7A 3QLQA 3VBFB 2XLGA 1PGSA 2Y38A 4DXZA 2UY9A 1DQ4A 3RYKA 4HN1A 2JX9A 4H55A 1FPN2 4ONUA 3AJYA 2O1QA 1DQ2A 5GALA 3UKNA 4Q4V1 1NXD1 3AMHA 4IEXA 4AWDA 1C28A 5C9AB 1RUH2 3ZYIB 4AI0A 5D8AC 4KWJA 2DTYA 5I93A 1VZ5A 5F9TA 2DVDA 1G86A 1AR61 2C9AA 3K48A 4N9HA 4Y0EA 2B42B 4R4XA 1VBD3 3ZYJB 3ZPYA 1LHUA 4WVVA 2WNVC 3JB4C 2H6BA 1IHMA 3WXPA 4BIOA 4AEDB 2JDZA 2Z42A 5JMCA 1JXNA 2I07B 3AP7A 3RYPA 1PZ8A 3ZIWA 1G8WA 1FXZA 1O91A 3HIFA 4LNVA 5C8CC 3D4KA 3WG2A 2HWC1 3ZO0B 4IEYA 4MSVA 2B46X 5GZGA 3OF1A 2PLV1 2VOKA 1YI7A 4AI2A 4YGEA 3FLTA 3TAYA 1JOJA 4M2FA 3FHIB 3PVEA 1BBT3 5CFCC 4LE3A 3PHMA 3AP9A 2VY0A 4JCKA 5IT6A 5L36A 1XXNA 5JZGA 1ULCA 2OIIA 2JEMA 1UD1A 5GJ6A 4IEOA 3RQ0A 2QFEA 4GH4B 4LULA 2WBOA 2ZX2A 4AVCA 4NHMA 4BH9A 3MIEA 1B35A 3TNQA 3TYJA 4WM8A 5FOJB 5E89A 1VBD1 1QNWA 2DUPA 2OVUA 4JV4A 4R9BA 4CEWC 4BGMA 3MPBA 2WL1A 1OQ1A 3O7OA 1U0AA 1KDMA 4OUSA 1CQ9A 3WNXA 2XBO3 1VAKA 2H0BA 3VUOA 1N47A 3KQRA 3LA3A 5C4WA 4PIYA 1RB8G 5BNNB 4S2FA 1PGL1 1RMU1 2Y0IA 4EWAA 3VKLA 1YFWA 5GLTA 1OOPA 4FOQA 1DLLA 3AYCA 4XTPA 4HBNA 5BNPB 4LBNA 1DQ6A 3WLUA 3AP6A 3B93A 2OZJA 1O3RA 1RITA 2CYFA 4IV1B 4ZU4A 1IPJA 3L2HA 1BBT1 5GZEA 2QUOA 1VBE3 2IFWA 5FOBB 2ZMNA 1HRV3 4M0HA 5ACA1 4I0WB 1RUC3 4K6BA 2VOVA 1NCQA 2DUQA 2V09A 4FPLA 4DS0A 5EWSA 4FPJA 1NCRB 1RHI2 1S2BA 3OD0A 3AM2A 3SNMA 1LEDA 3E6DA 4AXOA 2ZGRA 4YVWB 3UK9A 2RM23 4X6RB 4FAGA 3AXEA 4MYEA 2HWC2 5DZEA 4AE2A 2A3YA 3LOIA 2PLV2 1W6OA 1TMF2 1FYUA 2R0HA 3FBYA 2RMU3 2Q30A 4FT8A 1A8MA 4KL1A 5DUWA 1VBC3 5JOXA 1ZREA 1RTVA 3N35A 2C0ZA 2VMHA 2YZ4A 3WG4A 4P9WA 4XPVA 3RRDA 5C8CA 3AMPA 2XB6C 3APBA 2MHFA 3VBSC 3USUA 3HT2A 2E7TA 4TSVA 2E7AA 5DXDA 5FPXA 1PVC2 2VNGA 4M2GA 1WMEA 1Q8VA 1JYIA 3E6CC 2ZZJA 5I8YA 5CFCA 4IESA 1LECA 1VBE1 2IXJA 3GHNA 4CDUA 3ZSMA 1RUC1 3PVBB 3MF9A 2O8QA 3ZSLA 2E53A 1JR7A 5JOZA 4FPCA