3KCYA

Factor inhibiting hif-1 alpha in complex with 8-hydroxyquinoline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
335
structure length
332
Chain Sequence
b'EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Crystal structures of human FIH-1 in complex with quinol family inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 98
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3kcyA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kcyA01
1H2LA 4BIOA 3D8CA 2WA4A 2Y0IA 1MZEA 1IZ3A 2CGOA 4Z1VA 2CGNA 2XUMA 1H2NA 3KCXA 4B7EA 1H2KA 3P3NA 4QU2A 4B7KA 1YCIA 3KCYA 4JAAA 2YDEA 4AI8A 2YC0A 2WA3A 2W0XA 1MZFA 3OD4A 5JWPA 4Z2WA 1H2MA 4NR1A 2ILMA 3P3PA
chains in the Genus database with same CATH superfamily
3SYOA 4ZOLA 1E79G 1E5SA 4Q4X2 2ZKOA 4A7YA 4ZI7B 1U96A 1GTOA 2WS92 5EYPB 5IATA 1HNWO 4YZ4A 2UXBB 4FZ0A 2P67A 3DGTA 1UO9A 2ZGUA 5A3NA 1AR5A 5IY5C 4M01A 2RR13 4CP0A 1DZQA 4F6RA 2MHFA 3K46A 3LGRA 4BYYA 5FP4A 5E1RA 2XHBA 4P02B 4ZONA 4TV9B 5BYNA 1SLAA 3GZTB 3KT7A 5DABA 2BEOA 1NT2B 1FXHA 2ORZA 3LE0A 1Y66A 1WZXA 3R05A 4TUYA 4YY3B 4AFBA 3G4SV 4JYAB 1CP9A 3SJBC 2CTPA 4R50A 1V54C 4JI1O 2BVBA 1ENRA 3NSTA 1W0KG 4YJ3A 3JYCA 3NVCA 3RYIA 3PUQA 1FMD1 1HXS3 3W7SA 4HFSA 2FCVA 4O9EA 3H8UA 1HNXO 2EAKA 2R072 1SA0B 5DDJ1 4NTYA 2ZZQA 2ZE5A 5BNPA 2A3XA 4QPGB 3NV1A 2DUQA 1MPXA 1TNRA 2WYFA 2ZXQA 5DUVA 3WNLA 5FMBA 5HFLA 2YG0A 2ZHLA 1IBMO 1BQ0A 4N7IA 1J5EB 3ACIA 2WIIB 2B5UA 5D21A 2FYUH 2EXKA 1OA2A 2ZHMA 4AHWA 3LZZA 2X5IA 4QE9A 4JI6O 3L72H 2IXLA 4K1YA 1ND2A 4DXZA 2F4PA 2ZMNA 4MW8A 4JV5O 1RB8G 2IJKA 2K0GA 4UCUA 1ENVA 4X20B 1S1AA 1W2TA 3OMIB 3SPJA 2B1IA 3ZPOA 4PHZA 5LA9A 1B06A 3MDSA 4CDXC 1YLLA 3EO6A 3I2GA 4AFCA 2Y6JA 4NRMA 4CPBD 2E33A 4LNUA 3U11A 1NTKH 4QXCA 3AMMA 4BHPA 2DVGA 5FYYA 3B3QE 3K79A 1AVMA 4KU8A 5GTHZ 4YVSA 2YIBD 3K9SA 5F6LB 4ZY9A 4D94A 1AR63 3U07A 2QZ3A 2XG3A 3ZKYA 2ZHNA 4J9ZB 3ZR5A 4YZ2A 5FZAA 2Q8CA 3E6DA 5J09A 2B45X 1XXNA 3OUJA 4RD7A 4X8PA 4B3TB 4IYIA 3K08A 4X62O 3EJKA 1UYYA 3GVMA 4XAEA 1JFFA 2XKOA 3ZN6A 1CAWA 5EBLC 4BPZA 4ZOLB 2WN3A 5LBBA 4YLZA 1M93A 2Y34A 4UCSA 3RWRD 4JYBA 3SMHA 3JCZA 1Z7S3 5A3OA 3APOA 3CXHF 1GZTA 1XYPA 4JI8O 4OX9O 3AYEA 5I8TA 3CZUA 3ZLIA 4QE7A 3SXWA 2TNFA 4YW1A 3G6BA 2XJTA 1VF5B 3NR7A 1RP3B 1W8TA 4EYUA 3VKOA 3M7MX 2V5YA 1AL23 5LA2A 3LDDA 5DEDA 4XABA 2N74A 4LF4O 3J7LA 1GMMA 2HEVF 3JUUA 2ZDIA 2QM8A 1Q7YW 2XASA 3I59A 4ORFA 1ZA4A 4TQFA 2EXJA 3BPZA 2QQJA 2AH2A 1UXZA 2KA3A 4FLWA 3VOUA 4XHXA 4LH7A 4NIAA 4LT5A 3ASNB 4DR3O 1HR0O 3FD9A 2CGNA 1X36A 1SERA 2WWWA 5BPXA 2KSDA 4M4RA 2JDAA 3AC0A 1OKOA 3B8NA 4I0XA 4MS2A 1UZYA 5F7UA 4XFAA 3E5UA 2X6CA 5B1BC 2BZDA 3FX7A 1EAH1 1MS4A 3ZSJA 4R9DA 4OMCA 1ND3A 3I97A 2YYOA 2D6KA 2NLRA 1COV1 3NWKA 3H9VA 1EV12 4NHMA 2OYQA 5A2QN 3FMGA 5AVAA 1FPN2 4XTPA 1ZWIC 3RYIB 2UUBO 1FAFA 4DV0B 1AR72 5EYXA 1RUF1 1TAEA 3ELNA 4FPGA 1JZ6A 1YIPA 5GKAC 2QKDA 3AP4A 1MMMA 4I7ZB 1NA1C 4X65O 1MEC3 4FJCC 2P4EA 2BOJA 3GCXA 3RYCA 1UZWA 5C33A 1D0GA 1JYIA 1VB4A 4JHZA 2JEMA 1REFA 3WW3A 1V6IA 3HNBM 1B04A 3M3QA 5F37A 4DXTA 5DG2A 1NAEA 1D4M1 2F43G 5KHGA 5C93A 1HKDA 5B1AB 3IPVA 3AZWA 1JUIA 3IC7A 2XAHA 4LFCO 1GLHA 4QPIA 2Q0OC 1IPSA 1QKQA 3LIHA 2VNGA 1W8NA 4FOQA 3G6EV 5ACA2 2C9KA 4B29A 3WW4A 3ZFEC 3RZJA 2IXCA 1L0LH 5JSOA 1QNMA 2QQNA 2YV8A 1SQ4A 1H9PA 1SESA 1EN5A 1OZ0A 3A7QA 4XDJA 3H0OA 4QM9A 1YEWA 3BTAA 2AHYA 1LGBA 1HW5A 5J48A 1FXKA 2WDBA 5LEKA 3VD7A 1I5YA 2D40A 2VZOA 4Z1MG 4ASKA 4L2NA 3I5DA 3KHBA 1CONA 2Q8VA 4XW3A 1C8NA 4CZZA 3HIFA 2X09A 3AKSA 2G19A 4DYLA 1JFFB 1VLNA 3ZN6B 1EN4A 2XJRA 3KV4A 4J10A 4U3FH 4D7YA 4YG6A 1Q86W 2UU9O 1VBE1 1UNBA 1TQ5A 1DQ2A 1W6QA 5DAXA 4OMDA 2AZ5A 5IFTA 4S2HA 3K5NA 5JJJB 5JI7A 3WNNA 1O4YA 3PUAA 1JZ5A 1RUG2 2HWC3 2A3WA 3CXCU 3LWCA 1WLDA 2R16A 3VBFC 4BZ4A 2P6CA 4YW6A 4EEQA 1RUI1 4BCUA 5HV4A 2RS33 2XHKA 2E26A 3BA9A 2ZE8A 2P4VA 2XJVA 4B3RO 1QOOA 5J36A 3GHMA 1FOD3 3N7MA 5H2FZ 5CBFA 1KYOF 3CC7V 3AKQA 3RI9A 2QM7A 4FLTA 3N7LA 2IFRA 3I2OA 1OC1A 2WAOA 5B3SB 1C5HA 2LFSA 3CLPA 1YO8A 2NN4A 2ZHKA 4AEDB 4YVWC 3FB8C 4H44B 4QU2A 4HBNA 1C1LA 2NMNA 2QZ2A 5BNNA 1JMUB 1K42A 1JZ2A 4FPYA 4NHXA 1XSRA 1AJKA 4CDUC 4J7ZA 4DR2B 3WF0A 3QACA 1NZ6A 5LY2A 5FKCA 4Q8LA 3FJSA 1AXZA 2GBOA 3NV4A 3IN9A 1NE6A 4N9IA 2IUWA 1PM4A 2HWF2 4YZ5A 3ETEA 1VIWB 4PA7A 5H9PA 1UZVA 2CH7B 4YJ2B 1S0DA 1YIJV 4UXAA 4DV4O 4PDWA 1DTOA 3D36A 4DXWA 1ZRCA 4DV6B 1UY4A 3ZXDA 2RJLA 4PI2A 4E2QA 1FXVA 1GNYA 5LA0A 2RN9A 4DUYB 1DF4A 1LHVA 2C4XA 5FMOL 4H55A 4WM7B 3ZJZA 5AC93 1K34A 4QX0A 1XBFA 2ARBA 1RUD3 4IEUA 4LBOA 2A5ZA 2A73B 5FXVA 3WG4A 5HV0A 1PMIA 3LNMB 5FYVA 1W6OA 1WW7A 4W6WA 4JDNA 1WMEA 2YUEA 5AFEA 1UOBA 2Y6FA 3H8RA 4YWAA 1F4NA 5SV8A 2XAJA 5JWPA 3NL1A 4HVRA 4OI1A 2ID4A 1FV3A 1VR3A 1XNAA 2VCAA 4UW4A 4DV5O 1IXMA 4Q20A 3MI8A 2PYJA 4KGQA 1H38A 1LGCA 4LR4A 1FXKB 1NBMG 1NXD1 4QPKA 5BNOC 2VE1A 2QWRB 2Q67A 5KAIZ 4GKKB 4FPJA 1DP0A 2EINB 3TEWA 2C9AA 2ZEYA 1LR1A 1ZBA2 4WF9V 2E5LO 1TA8A 2WZR1 5T5JA 4ZHQA 1JOJA 3ILFA 4WVZA 2QEXV 1L7LA 1R083 1BHBA 1IPJA 1BT8A 2ZAAA 3H42B 1R3KC 1AXYA 1ZRFA 2G9GA 1QOTA 5JIAA 2AYHA 2XNDG 3POFA 1IXBA 4CP2A 4PQ9A 5K1PA 3NJVA 2ADEA 2XAQA 4XF0A 1S72V 4MVUA 1Q81W 1W6MB 4P30A 5EFUA 3EMRA 2JJ6A 1WCDJ 2SBAA 1PGW1 3VBHB 1QXRA 4BQYA 2ZGMA 5C9AC 1VBA2 4M3CF 2EVXA 1RJ8A 1NT0A 4JGZC 1CGPA 2QQLA 1E1QG 4AI0A 3HKCB 2H6BA 4DV3O 5GJ6A 2XKPA 5L19A 3GWOA 5CA1B 3GXUA 2VZTA 2VVFA 3M8AA 2OT5A 1CAVA 3MFCA 1YZBA 1GM8A 5C8CA 3VBSC 1MQTB 4P5YA 2JGDA 2IBZH 4X1IB 2VQEB 1BCXA 5BNNB 3QO8A 2H0VA 3POJA 4R4XA 3ZRSA 1PZ7A 4NIIA 3LOIA 2RJKA 4Q4W1 2F4VB 1YUDA 4UB8Z 2XWJB 3PVEA 3OBRA 1JTZX 2BERA 1QJX1 1S0BA 4AG4A 1WB7A 1UPIA 2C24A 1H8EG 2GZWA 2DTWA 2Q4PA 1C8M3 4L92A 1R093 2A7WA 1WPXA 1H4HA 5LMUB 4KBBA 3STLC 1YI2V 3SPCA 5F5QA 2DBIA 4FOWA 2R042 4DV1O 3MIBA 4GH4C 4Y4YA 4YM2A 4JI5B 4Q4Y1 4UFJA 1ULGA 5LP6A 2ZACA 2GHYA 4QXHA 5EBWC 2J1UA 4NXMO 1W9FA 1XU1A 1K5QA 4Y24A 2JKBA 3H7JA 4H37A 4O4JA 1J59A 4U3JA 4LBLA 2XUMA 4LWSA 2ARAA 2B8MA 2CWMA 4ICGA 3N2GA 1QY4A 3HVDA 4JHTA 1KD1W 1F5JA 1GZWA 2YS8A 2OUJA 1SG3A 5CIRA 4ZS3A 4TOIA 5BY5A 5J2TA 3TNPB 4GAZA 2BVVA 4J80A 4TWTA 4YGEA 1PNMA 4NROA 3MAQA 1HRI1 4IIJA 4Q1RA 4BLIA 3I7DA 3ETPA 2JE7A 2IVIB 3CZJA 5DUXA 1WLCA 3HAGA 3ZFFC 5FQ0A 1CESA 4QKNA 5E89A 4EZ4A 3O12A 3LQCA 3VZLA 4AVBA 1ROPA 4CXYA 4SLIA 1SBEA 3BIWE 5JXJA 2ZMKA 4L0PA 1VP6A 4JI4O 5FYHA 1K92A 2QKSA 3CCSV 1PGL1 4IT5A 1UJWB 2ES3A 3U78A 2PQQA 2R72A 3P1IA 3IWZA 3TN92 1CEZA 2KKWA 4MGSA 1B3QA 3HKBA 1F4MA 5EZYB 3ITQA 4B3SB 2VQFB 4ZKTB 1NU1H 2H94A 3M3CA 2FTKA 5H9QA 3JATA 2D7FA 3A2FA 1G7YA 3WCRA 4PIZA 1HXS2 4RGKA 3M70A 5T5OA 1OLMA 3ASOB 1Y43B 5F39A 3U37A 4LE4A 1K45A 1KB9F 2VOWA 1ZRDA 1VQNV 4CCMA 1SFYA 4TSFG 5LYJB 4YW4A 2ZA9A 2V4DA 4UW6A 2WO1A 5JH7B 3CC2V 4OULA 3WP3A 4J41A 2FBEA 2WZ8A 1N3PA 3LB9A 1KJLA 1EUUA 1FMD3 1RUJ3 1BBT1 1KFXL 1VAVA 3LKJA 2AGAA 1RUOA 1ZBE2 3VV1A 1Z5VA 3OMNB 5I8SA 3CO2A 3VBRB 1RUNA 3A21A 5LMNB 1H6XA 1V9U2 3MZHA 2VZSA 1YQCA 4D7SA 1HN1A 5L36A 4BQ3A 1DGRA 4W4ZA 3RI8A 1K8AW 5DN2A 4CUCA 3H3ZA 2C6SA 3J7NA 2W3JA 1FNYA 3W5MA 1Y3TA 1FV2A 3IKWA 3EYPA 1WBFA 3OEBA 3Q8EA 4O9GA 3VL8A 1RUE2 2FMYA 5K0UC 3LUTB 2EJ7A 3D8CA 2UUAO 3J8F3 3OGSA 5IVFA 3HB3B 2F6BA 4HN1A 3DC5A 2WWUA 4Q2FA 3QF7A 1GWLA 5A7PA 4JI3B 4OI4A 2DYSB 3VUOA 3CS5A 1D0HA 1UPGA 1UOGA 1UX6A 4LF7B 3X29B 1OUXA 5LHHA 1XMQB 2A71A 2AHZA 3OR6C 4LK7A 4WBBA 1UY1A 4LF6B 4XUNA 2WC2A 2LS6A 4Y3OA 3MIDA 3SLIA 1RMU2 4LBQD 4WFGA 1PK6C 5L3EA 3WEZA 4WM8B 4DUZB 3W9AA 4O65A 2BOBC 3ETQA 1PPJH 2RCVA 4U3JB 4QKFA 1OCZB 5C4WB 4OUEA 4FPPA 1QVFU 1OLQA 1WCKA 3N2GB 3VDDA 4XJZA 3FB5C 3ZRVA 1FYJA 4CVUA 3NJXA 3AG2B 5LHGA 3C7FA 4YZ1A 5LA1A 2W2IA 2VAUA 5L7OA 1GMGA 2ZXWB 2UY8A 3O1MA 5JOYA 5BY1A 5BR8O 5FTTC 2LP7A 2UXCB 3WXPA 2KQXA 1XNTA 2W52A 1LNQA 3PVNA 4EN9B 1UN1A 2BP6A 4CUAA 1OQ1A 4BIZA 5JZGC 2JJ2G 4KHPB 2BBAA 3C7EA 3RGBA 1LAJA 1T2XA 2VQ0A 2Q7GA 4NVPA 1OCOB 1BEV2 2HJIA 4GKXA 3BPSA 5FP3A 2QFEA 4A44A 3RZGA 4PA9A 1QU0A 2JG8A 2Z4FA 2I2SA 1FT9A 3FHAA 2Q4SA 1W3VA 5DZFA 3EHBB 1AR4A 1IVSA 2GSMB 5FYCA 1AR92 1DLLA 1U97A 2GNTA 1GP6A 2OQ7A 3ZO0B 3ZFGC 3SR2C 1W8OA 4KG0A 2E53A 1KJRA 5JOWA 4IV3C 1BMV2 1J1LA 3MHHC 1EAH3 1XSQA 4LO7A 1PKXA 5CEHA 2DCZA 4YNIA 3CDZB 4AGRA 3P30A 2VH9A 2PTMA 1Q8QA 3VQVA 1COV3 4HANA 2VL4A 1KUQA 1JH5A 5FZ8A 4XETA 1R1BA 5FNVA 5ABJA 1G9BA 1HNWB 5LCWL 1YFYA 3I54A 3OGVA 4AAXA 4BW9A 2J1EA 4DY5A 3ZFEB 3P3PA 3QH7A 1L1FA 1DU3D 1AI7A 2NNUA 3D4KA 2ZX3A 4XUTA 3ZYBA 1QU7A 3G67A 4W6YA 1PX3A 2K46A 4K40A 2PMWB 4KGGA 3RZZA 2P17A 5KXEA 4XF4A 4C8DA 3WHTA 3ZXFA 4CP1A 1SQPH 1VBC3 2WKKA 2WAMA 1PGSA 1LUVA 1LHUA 1QWRA 3KF5A 4CXWA 1T6BX 2XGXA 2DCYA 2CAUA 2DFBA 2RDRA 4NRQA 3FBMA 3ZYRA 2WZPP 4FLYA 4MSVA 3WDUA 4TV8A 1VQOV 3OUIA 4O4IA 2XAGA 2VOXA 5C70A 4IGPA 4JI1B 1PMHX 5A1LA 4UF0B 1SF9A 3ZXGA 3WU2Z 2FHRA 2OPWA 4IHJA 2WFF1 2CYFA 5J98B 1K4CC 3KVAA 1AYN1 4B7KA 5L9BA 4OZOA 1HNXB 2WFPA 3VDAA 4JDOA 2XBO1 2XVLA 1N36O 4FXKB 1NZIA 3S30A 4XFGA 3B40A 3IAPA 4LO5B 3HR9A 3ALQA 1W0OA 3TAYA 4DIQA 4L8JA 4KI5M 1TVGA 4LTAA 5LZ6A 3VDDB 1VF6A 1A34A 1UMZA 4NUBA 2QTOA 3SJQC 1VBD2 3JU9A 3ZS8C 5CB7A 4DMIA 4ASUG 1KC8W 1PO22 4RQPB 1YJ9V 4X6QB 3WDWA 4TYSA 5A7WA 4JI6B 3DXRB 3POEA 2RS11 4LP8A 1OT5A 1OHFA 4JV5B 2M6YA 1I1EA 1VBE3 2R32A 3ENRA 5KUKA 2P06A 4BAYA 2UURA 1O3SA 5HXMA 3HNYM 1VQPV 4LMFA 3VDBA 2QDRA 4BIUA 3RS6A 1DF0A 2JG8B 4Z2AA 3LEIA 1UU4A 3FLPA 1R6KA 3SEPA 2EX3A 1OCRC 4ATFA 2L35A 2Q68A 1PM7A 4ET7A 4XF3A 1K5MC 1H1IA 3J7HA 3TK1A 2IXJA 2Y0IA 5CFCA 3C3TA 1H6YA 3CRMA 1HJFA 4QD2A 1O59A 2R061 4X62B 4NMIA 2AXTZ 4BK4A 4ZU7A 1Q6HA 3O0VA 2XJQA 4G27B 5JQGA 1OFNA 1R64A 3AG4B 2R70A 5FP8A 1PNKA 4GUNA 4U7NA 4JI8B 4OX9B 3B02A 1B35B 3CCRV 3FE5A 2D5HA 3TEYA 1NG0A 4A6SA 5FZHA 3QH6A 4YW7A 5HBAA 2ILMA 1RUC3 4AVSA 5C71A 1JU4A 4LF4B 1PIV1 5F5CA 5CG9A 1AP6A 1BHGA 1Q3EA 3SYPA 3DYOA 3T1HO 2Z5UA 4HAMA 1RUD2 1SETA 4R8CA 2Q0AA 4NN0A 1IDSA 4COUA 1JR9A 4DXSA 1Q8VA 1HR0B 1LOCA 4MTGA 3CF6E 1DGWX 5EP9A 2Q8DA 3WG3A 4D6RA 4CEWC 2VMFA 5IJ9B 1VRH1 4X9QA 1EZVH 2QE7G 2O1QA 2JK5C 2EILC 5FY4A 4TV8B 1OA3A 4FPHA 2PHTA 3WDXA 4YW5A 4JGYC 3T2MA 4P9GA 3TEXA 4EZHA 5FZKA 2KXLA 1GU3A 3TRSB 2UUBB 1SPPB 3AXEA 1DIWA 5CFDB 1W3XA 1IG0A 2AR6A 4Y1YA 2Q9LA 1W39A 3CJIC 2QQOA 3X2QB 3ZDVA 5H6QA 4X65B 3Q4HA 2ZBJA 4JKLA 2GH2A 1JYCA 1MABG 3VL9A 5F1RA 1CN1A 1R082 2VVDA 2RJ2A 1ENQA 2RMU3 3E5XA 5CBGA 2R6QA 4FFIA 2VS0A 4QGNA 5EHDA 4JGZB 2Y6KA 4JI0O 5D8AC 3N9PA 3ILNA 5IT6A 2P5BA 5A32B 2KM2A 4FAHA 1RM1B 2WZR3 1DQ0A 1YTFD 5EIYB 4DEQA 3POYA 1O9GA 3HQRA 4ZU4A 5GLUA 4LFCB 1RUH1 4P08A 5A7WB 3AK0A 2JVDA 5C3SA 1PX4A 3V65A 2BWAA 4BH9A 1QBZA 4AI3A 2DYCA 4CEYA 4QMAA 2YU2A 4HT1T 4CCKA 2E9QA 1YSCA 4RA0A 4GYCB 4XBLA 2PLV1 3IBMA 3L9JT 3WW2A 4HNAB 1J1TA 4RHV2 5KAFZ 4LBQA 4N53B 5A6QA 1GN3A 4D8MA 4QIWF 3O1OA 3FHQA 1AXKA 2RR11 3PTRB 2RE9A 1EBOA 1HB3A 3UT5B 3SCGA 1Q8PA 4BQWA 1THZA 5IFPA 1OF4A 3IMNA 1BZWA 2DMXA 1ASJ2 4KH9A 1R1A1 4PDRA 1M56B 3NV2A 2EIKB 4FLUA 5FZDA 4FM0A 5DUWA 3AB0A 3B7MA 2AW9A 2DU0A 3GALA 1RSOB 1UOJA 4J11A 3WP5A 2XLAA 1HN0A 3WG7B 4NR1A 3BTYA 4P9PA 1ZZCA 1AUYA 4UFZA 4ZPIA 3CQOA 2UU9B 2FDJA 3WCSA 1AZDA 4QDQA 3WFVA 3R4SA 3WG2A 3O1UA 5EV7A 5IW0A 3KQRA 1JI6A 1GYKA 1ULFA 4JGSA 4Q4W3 3CHXA 1REEA 3CNAA 1WUVA 2LFRA 4A3XA 4COYA 2WLHA 2FDKA 1QJY1 2PF4E 1W6NA 5A7NA 4DNYA 3I49A 1QJX3 3MICA 3STZC 4JQTA 3TEZA 2Y6HA 3ZPYA 1UZ0A 4B3RB 4N9HA 1JZ3A 2DV9A 2Q73A 4Q4X1 3P5BA 1XHZA 4ZHNA 2WINB 1MZ6A 1SKVA 5E16A 3KT1A 2D3OW 2WS91 1H8HG 4UFIA 4GMP0 4XQDA 4CCDA 5IVJA 4I09A 4NIGA 3UO2A 4YGDA 3GBWA 4ZZ5A 1XOUA 2P3JA 4CDXA 1AR1B 4O2AB 2H6CA 3PHMA 5K1XA 4MVQA 2RDQA 4CS3A 4UVBA 4E4EA 2O8QA 5FZ0A 3GM8A 4HPKB 4F7ZA 3VZNA 3M3OA 2Y4TA 1S0FA 5J7MA 5I8YA 3MD0A 5IK4A 4HETA 4AK3A 2OZJA 1NLQA 5CAZA 4JRLA 4KUMA 5FBJA 3J80N 5JOZA 1Q6IA 3W58A 4DOUA 5BMVB 3OEEG 2VMIA 2N05A 4FFGA 5JMCA 3NAPB 4QPGC 2QUOA 1OF3A 2XOMA 2PHXA 4KU7A 2NP0A 2F66C 3BTXA 2PY5A 4EN0A 2EXIA 2W47A 4DV4B 3CJHA 5FREA 4NPLA 5E1AC 2ZX1A 2P6JA 2JE8A 5JVDA 2YMZA 1OH4A 2RM22 3D3AA 2KR2A 1KP2A 2DYRB 1EPZA 1P84F 1ODNA 4W6XA 3HEIA 4A2UA 3BU0A 2V7QG 2PYLA 3OGRA 1SBFA 3K51A 4JVAA 4KL1A 4HZ3A 4JI7O 3T0AA 2EIBA 5JI9A 3I4IA 1LKNA 2JE9A 5FY7A 1MR5A 4CEYB 1XPWA 4OLLA 4XDOA 2ZTNA 3H1IH 3T1CA 3USSA 4DR2O 4OQ9A 3B5LB 4B3MO 3KGLA 3VHPA 2CWSA 1AL21 1CAXA 2BYVE 1FMD2 2WAAA 4Y20A 2H3OA 5T5LA 4DV5B 1QLEC 2IH3C 3U1XA 4I50A 3DGEA 2ZIMA 3HN3A 5IYDO 2VZ1A 2A75A 2XTAA 1NKDA 3K2OA 5DDJ2 3OYWB 1V00A 4DRVA 5IAVA 3VZOA 5B1OA 3ZMNA 1GKBA 5CG8A 3NV3A 1F23A 3SCFA 5EJ3A 5JXIA 2QTWB 1DGSA 2E5LB 3H3LA 1BBT3 2XVGA 1XQNA 5CA3A 1EUTA 4CDWB 5EC1C 3HKEB 1WA6X 4RO2A 4TLFA 1S0VA 4NB5A 5LXTA 1CJPA 4OUSA 3FYEB 2YXHA 1VE0A 3W7UA 3ZCCA 3ABUA 1LCLA 5FZBA 4PBOA 3AJZA 4PA6A 2ZKLA 2PHLA 3ZHUA 5CA0A 3SISA 1YQ5A 2FDHA 5I0RA 2FCTA 1LGNA 2DJVA 2ET1A 5FPLA 1MEC1 5FCCA 1RPRA 1HJGA 4FFHA 3ETGA 5TISZ 2GNBA 1CPMA 5L3FA 3ASNC 5T54A 3POIA 3AXDA 3RN4A 1A32A 2VW1A 2ZINA 2WNVB 5FYMA 1K3EA 2PQSA 4LPLA 4DV3B 1VALA 5FBZA 1I5PA 4ITCA 3BN6A 4IEYA 2OYZA 1BVP1 4RFRB 2W5FA 4JZGA 4ATEA 3L71H 3A0KA 1OVPA 1F7YA 4XIOA 2H0BA 5F3GA 3W7WA 2YGMA 2XOKG 2BGPA 1YQ2A 4OVEA 1EYBA 1NXMA 4FP2A 3NNGA 2LJ2A 1G4YB 1YNAA 1JZ7A 4F3JA 3J81N 5FXXA 4FPKA 2W1UA 2DQ3A 3HBZA 4GT1A 2C26A 1CVNA 1KDKA 4ASLA 4TN7A 4QGMA 2P2KA 2Q69A 3VD3A 2RV9A 5CVRA 2F93B 3N4MA 2WLIA 5IWAO 2XVKA 2VECA 3ZXKA 4LIUA 5T55A 2EBOA 1XQ8A 4BR6A 5IK7A 1XMOO 3GZAA 4IUGA 5FFOC 1AYM1 3L9DA 1POV1 4JZ2A 4X1YB 2HKXA 4K0KO 5B1AC 4K3AA 1KMIZ 2DFCA 3AL6A 3MF9A 2IM9A 3G7DA 4DV1B 2LO1A 5FZFA 2EXHA 1H2NA 1WW5A 1ZZ7A 2HH9A 3CRRA 1OPOA 1F35A 5LA6A 3VBFA 4CC5A 4OHVA 4NXMB 2RMKB 1C57A 2E63A 1LOEA 5IVBA 1QQP2 5BUVA 3ZHVA 1V70A 5ITZA 4QX1A 1RJ7A 2WYSA 4CDQA 4GJYA 4LO8A 2HWC1 4DV2O 4EKWA 4ES8A 2F4VO 4Y20B 1GFF2 1JW6A 1DG6A 1RUF2 2XONA 4J7KA 5FPVA 2W6IG 2RS31 2YXYA 4EWAA 2XB6C 2OT7A 3AG3B 2XL7A 2VW0A 3WVJA 1C28A 3JARA 1SLBA 3ZYJB 4YVWA 4JASA 2A0LA 4W65A 1SHWB 2OIGA 1U5ZA 4I0BA 1D4M2 4YFZA 5I0TA 2QQMA 3N3HA 4RGAA 2P22C 1GZ9A 2ZR2A 4ZU5A 1XDCA 4PA4A 1SEFA 1DCSA 5A3LA 3KKYA 4Q4V3 3G71V 1UX7A 4S2GA 1R6TA 3M7AA 2VNVA 2Q8EA 2A7AA 3VBOA 3FAVB 3P3NA 5L9VA 3UQ8A 1I5XA 4DR6O 2B39A 1XNCA 4UCTA 2PHFA 3IDCB 2QCSB 5A33B 1Z78A 2J1VA 1QXJA 3LA7A 4DO0A 4GXLA 2CGPA 1WBLA 3TETA 1PVC3 4GWNA 4UOJA 1IGOA 3O0XA 5IVEA 4AEKA 1ZUQA 2A6VA 2GMEA 4DRXA 3IDBB 4YXWG 3QNEA 3O0WA 4F83A 4I0WB 1HP8A 1TMF3 1ZL8A 1KQSU 4A7ZA 3WX5A 1OLME 3JAMN 1W0PA 3PJYA 5B3SC 3N2KA 1AYN3 4AEDC 4URTA 1LTEA 2XBO3 3ZMTA 3O5SA 4PJ0Z 1UMHA 3LSSA 1RVF1 2FQPA 4PV1B 4U2AA 3MPPG 2ZABA 3NNFA 1QEXA 1O8SA 5LRSA 1JMKC 2R30A 2WZEA 2AENA 1AJOA 3WLUA 2QA4V 3MV01 2AZ2A 3A8TA 4QU1A 5BNOA 1JOYA 4ARYA 4YM0A 2R0FA 5E8AA 2OA2A 1RUI2 1HB2A 3FB7C 3LDBA 1ULOA 3K75B 2VOVA 4AI2A 2UUAB 1XUQA 1S0EA 3C7OA 1EZJA 4I0AA 2E76B 3Q9OA 2RS13 1G1XB 5LL6Y 3KZ4C 3BCWA 3OG2A 1IBLO 5FYZA 3WP6A 3OD4A 1LOAA 3H1YA 2MEV2 3ME2A 5LGTA 1VQ5V 1S76D 4AW7A 1QJZA 5KX5B 1PO13 1O3TA 4WM7C 5G05L 1HQWA 3WW1A 4R9CA 4AQYO 4QM8A 5LA6B 4K8FA 2BE3A 5JVVA 1GAXA 3AEIA 3M4FA 2HWF1 2XLFA 4L99A 1OD3A 4JYCA 2KB1A 2OPKA 3WP4A 2CU5A 3IAQA 2CDYA 1WMFA 4YARA 1OBNA 3AP7A 1S0JA 3N35A 4DR5O 3TYJA 1YJNV 1OKQA 2CTQA 5C9AA 4CDQB 3QOPA 4Q29A 3SYAA 1N4CA 1MVEA 4NHKA 2RNBA 4KXRA 3ES1A 5HPOA 3CB2A 1UIKA 1HB4A 3BI3A 2HJDA 4LIVA 3JALB 3A0NA 5BR8B 1RHI3 2ITCC 1XNKA 1KS4A 1S0IA 2WLLA 4EV0A 1VF7A 3QD6A 1FXKC 3LD8A 4U7OA 3FX3A 1YI7A 3EFFK 1Y9QA 3VBSA 5JCOC 5F3EA 5IJRA 3RYHA 3AVRA 2EIJB 4LF7O 3ZHQA 3R65A 3JAWB 1CWPA 2EINC 1H1MA 3ACLA 1Q56A 5FPBA 3RWKX 1KEXA 4QJFB 1FATA 4IERA 5BZBA 4DK1A 3MDPA 1KRIA 5GZGA 1FNZA 1PIV3 4OHWA 4LH6A 4C7UA 2WT1A 2ETEA 3ECQA 1NUKA 2ZE7A 3H9AA 2FZ2A 4BIOA 5J37A 2E7QA 4YZ3A 3UGGA 3Q8FA 5FZOA 3E6BA 3GZEA 4IL7A 4NJ4A 2E6VA 3WF3A 4O2BA 2EIGA 5FZ4A 5GTIZ 2QWPB 1KQRA 2JDUA 1QJFA 3E22B 4ISQA 4F4LA 3NMBA 3V0AA 4GH4A 2VZ3A 2VD7A 1SC5B 3IIAA 5LOVA 1VQ8V 2UXCO 1R091 5FYUA 4CTEA 3D82A 1UYPA 3O1TA 4KHPO 2NMOA 5AVPA 4K35A 4FFFA 1QH7A 4I55A 4BXSV 3BOPA 4AZZA 3WNOA 2RS53 1NOVA 2LROA 1UIJA 2WZR2 4L11A 3N2KB 3OAAG 2D6LX 3L2HA 4LE3A 3ROUA 4AGVA 3RSJA 3JASB 2EAAA 2MNGA 1MQTC 3HNMA 3OOXA 3D3QA 3LPFA 2ZCEA 4Q1PA 5BNNC 3K4AA 4JF3A 4OQ8A 2X10A 4QXBA 2JECA 3DV8A 1TME2 3RZKA 4A3ZA 5L9RA 4QHOA 3HOBA 3WINE 3OCPA 1N47A 3DL3A 3VQWA 3ZRXA 1NLRA 1LU1A 5FPOA 5DAQA 3ZFFA 5JJEB 4GCZA 4Z8BA 3TCUA 4DO2A 1GZCA 2YBPA 4HKOA 5JDBA 1RUH3 4GZRB 4RS5B 4CS2A 1S0GA 1PGW2 3LEKA 1Y76B 3KB5A 5JMOA 2JDZA 3RMYA 1MZ5A 3D36C 2Q1MA 5LK7B 1JPXA 3P32A 4OI0A 4CP9A 3T1MA 3AX4A 1WA8B 3POBA 3FL7A 3G6JB 1O8PA 3CL1A 2JG9A 5DUUA 4H0LB 2HVKC 1P4RA 1A78A 1E1RG 2PLV3 3AP5A 4TQDA 4FVVA 3UETA 2SLIA 4W8JA 1V6MA 3L2YA 2AZ0A 4Q0QA 2DTYA 4LA2A 3C8XA 1W04A 4OHZA 5FZEA 4AHXA 1N36B 4I3GA 3MIGA 4GB32 2ZT9B 2YEVA 1TGOA 3SPGA 1H2MA 2WT0A 2HWE1 3ATGA 2P6HA 3KV5A 1W9WA 2UXDO 1G6UA 3HPLC 4LITA 2Y60A 1DGRN 2ZNIA 1ENSA 2ZGOA 2UUCO 2LGWA 4E2GA 1CJDA 1LOBA 1R1A3 3J7AU 2QNKA 4UCOA 2ZGNA 3PURA 4WFHA 4IEXA 4OHXA 1XB9A 1QJX2 1WPBA 5F6KA 4XF9A 3U10A 4NPMA 1STMA 3N36A 1QCEA 2XMLA 3MW3A 2CTRA 5H9CA 1RPOA 4LFAB 5K4LA 4XIKA 3QG5A 3OBTA 4LOSA 1WN7A 1TUBA 1AR83 1RUJ1 4YGBA 3A22A 1KD7A 3JCUZ 4JZRA 4PDLA 1QJY3 4IEQA 4Q4Y2 3T2TA 1RIRA 3E5QA 3FZ3A 3N27A 4O61A 4QX8A 3DF0A 5K0UA 3OUHA 1J3PA 2DURA 4E27A 5DAPA 3UKNA 3N7KA 4Q4X3 3RQ0A 2EJRA 2NLJC 3I3DA 3JCIA 3IIIA 2WS93 1HIXA 1Q8IA 1W03A 2FB5A 3LCPA 4K9SA 2YIDA 1UW8A 3E83A 3MIFA 3IT8A 5H9SA 4QQOA 3T3YA 3ASOC 2YIAA 5LRRA 4G3YC 1SQXH 3J8F1 2X0LA 4XXPA 2JDHA 2WNUB 1PL0A 2UYAA 3E8GA 1OCCB 3RYKA 2A3YA 4Z1VA 2YUAA 3TN91 1HRI2 2RJZA 4K8RB 4FFBB 3NO8A 3ACHA 1US3A 2B5HA 2JEUA 3K48A 3ABMB 4C90A 3FFQA 2QTSA 1V0AA 5T50A 4D69A 4K1ZA 3ZMOA 4NKGB 3K58A 2CAVA 2CAZC 1BYHA 2XJPA 3VBRC 2Q1ZB 1QLEB 3CIHA 3HBKA 4IQPA 3T0BA 5C8CC 2BFUL 3T1HB 4XFCA 3CCVV 1OURA 1PGL2 1N32O 2BTOA 4MTFA 1IQDC 4S2DA 2WL1A 5FYTA 4Z92B 1JVMA 3ZSLA 5LBEA 2YY1A 4YG3A 5JIUA 4LBMA 3IB3A 3AMQA 2F23A 1N1YA 4WVMB 3ZXEA 3KM5A 2KG7A 4FOYA 1MZEA 1H8TA 4CA9A 1UKRA 1PVXA 1GOGA 4FZ1A 2K9ZA 1SQGA 4IYHA 2X29A 4H3WA 3MLJA 3VD5A 5IYZA 3KVBA 1ZBE1 1HDKA 3H1WA 4IXLA 1U12A 4XZUG 1CAUA 3LEGA 4IGQA 2A6YA 2DYSC 5B1NA 1NCRA 4XEZA 4BM8A 4LHSA 2LUWA 4CP9B 5DZEA 3H1JH 2D98A 2JG9B 2IZWA 1SCSA 2BFUS 5LWBA 3OT7A 4AQ6A 2DUOA 2ZNJA 1W2UA 1BBT2 2ZE6A 4QKBA 1YHQV 1MOFA 3ZFGA 4GX0A 2PAKA 1FJGO 4FO9A 1I6XA 5A7SA 5EXOA 1RUE1 2YEVB 4IV3A 4WM8C 3QBQA 4F6RB 1ZRIA 3ES4A 4JTDB 1OCZC 2ARXA 3L74H 5C4WC 1HQLA 5E79Z 4GALA 3KZIZ 1WCUA 4DS0A 2ADDA 4JI0B 2QGNA 3U4XA 2GUZA 2V72A 4RAIA 3B01A 4JAUA 1SQQH 3AG2C 2OVUA 2ZXWC 1ZM1A 4A6OA 2JICA 4AL9A 3J9SA 4TUYB 4XJWA 3ST7A 4K7JA 2EIDA 4IE4A 1RMU1 1WB8A 1ZTEA 1I94O 4IE6A 5KHIA 3Q8BA 2WO3A 2ZGQA 5ISLA 3SQOA 2IXHA 4YJ3B 4KWUA 2XJUA 1WWYA 1OCOC 5G04L 4XFFA 1AP5A 4CSWA 2GP3A 5KC5A 3JXSA 3GZUC 3H1HH 1NH2B 1O4ZA 4QQ2A 3S3XA 1VP7A 3ML0A 5J2UA 2RVAA 3BOWA 1W59A 5DXDA 1F2NA 5BNPB 4JTNA 3SPHA 3JSLA 2VG9A 4MXWA 1YFUA 3ZM8A 1UCXA 4MV2A 4N43A 5FO7B 4QX7A 3KCCA 3ZIAG 1RINA 5FPXA 1VBC1 4FPCA 4XJ9A 3HPNA 1XOYA 4HL0A 5GLWA 5T52A 5A3TA 4IGGA 1C3HA 3MYXA 1GOFA 2XDVA 2BBVA 2VU9A 3CSXA 3A4UA 4XVHA 3SGIA 4AHZA 4LC1A 3RYFA 2X5IB 2IW5A 1ND2B 2I45A 3TJTA 4FCAA 1VEWA 4IE5A 4DR4O 3RYPA 4FOVA 4AF9A 4LORA 4NAMA 5IDJA 5K9YA 4IEWA 1VQKV 1RFYA 4NRPA 1K5SA 4JV4A 2D6OX 1CX1A 1WP8A 1HDJA 3RZHA 3NXSA 2WPDG 4LNUB 4LULA 5DMYA 3CBNA 2Y69B 2OXBA 1UWWA 4E4DX 1K5JA 4J25A 2ZMLA 1XL6A 4X1KA 5LGNA 4E8CA 3F5WC 3GDBA 4Z82A 1HLCA 4YVSB 4MVRA 3AMPA 3I2HA 2X05A 3GNEA 1JX9A 1MSWD 2BTQA 1AYM3 1POV3 2IFWA 3TNQA 1EV13 4XFBA 4NIDA 3S6PA 1ZLZA 3TXSA 3HQXA 2YI8A 1EN6A 4JTAB 4BQ1A 4JPRA 1YITV 1N33O 4DZGA 2ADQB 1AR73 2P1BA 2HEWF 3NNLA 4PIYA 2X6AA 1CAWB 3F7YC 3CRQA 4E9KA 3AL5A 3BTZA 3OUSA 4Q6GA 3I2JA 3LDRA 2QQVA 2ZPXA 2HHHB 1NCRB 2EIMB 2PUSA 1H1AA 1IS3A 2R1BA 3NKGA 2LGQA 4GWMA 2CK3G 4Y33A 3KS7A 1MA1A 1K5MA 2VZRA 3M2MA 2HWD2 5JXHA 2VGDA 1TG7A 3O7OA 5IE9A 2PGGA 3EXUA 5F5IA 5A70A 2QWQB 3AZVA 3I59B 4N23A 2EZOA 2WWSA 1EY2A 3OTOO 2G1MA 1GQGA 4P9WA 1UD1A 2WA4A 4XPVA 1BLZA 1APNA 3VDDC 1L7RA 4KNCA 4OXSA 5ACA3 4I0XB 1XYOA 4WVVA 1U5YA 4XHBA 2RG4A 1UYXA 2QQIA 4RQPC 4X89A 1XE8A 5FZIA 1N3QA 3OGIB 3RRDA 1ND3B 3KWVA 3FLRA 2VCMA 4JI7B 2GC0A 1NH2D 2FDGA 1C4RA 1TEIA 1DQ6A 3D5OA 5CADA 1G9AA 4RR3A 4V2VA 5LGUA 1VAKA 5CKNA 3T0DA 1QR8A 1SZTA 4I2OA 1CIWA 4GKJO 4B3MB 5FY1A 2W1WA 1RUC1 1ST8A 3CMGA 4Y22A 2H8PC 4URAA 1A8MA 2WFF2 4LF5O 4LO4B 3E8FA 4CEWA 4YIPA 1VBD1 2JG8C 3B2EE 1OPMA 4A4AA 2BU9A 2JIGA 1JZ8A 3AYDA 1DZRA 2XBO2 1QR9A 1X82A 4EB6A 2GDFA 4EROA 5FOBB 3RYCB 3MBWA 4UWDA 3EBRA 1F5FA 4L9BA 4MXWB 1MS5A 2E74B 3SKVA 1D7PM 4NO4A 1H2KA 1HB1A 4FLZA 4NPRA 3ZOIA 4N43B 5GONA 2ARCA 1W8WA 4Y1UA 3IPVB 1WA4A 3MW4A 2E75B 4IEPA 1Z0HA 1RUG3 3UYJA 3ABKB 4HYOA 5LBQA 3BVCA 1DQ1A 3AG4C 3BU7A 4QPIB 1OV9A 4A5UB 1RVF3 1BZKA 3CJIA 2PN5A 1IHMA 4B4PA 2RS12 4BA6A 1N0JA 1B35C 5FZGA 1J3RA 4UV8A 2JEXA 3WOGA 2J1TA 3PMEA 2W68A 3KLSA 1GR3A 1K3IA 2CL2A 1OUSA 3WSOA 1J84A 3SKJE 3F95A 1GOHA 4LEJA 3JAKA 5D8AA 1HQNA 4PA3A 4COVA 4COZA 3OR7C 1UY3A 3F2ZA 3AMNA 3TB0A 4R6ZA 2RMU1 1Y7BA 1CIYA 2OQ6A 4MHUA 2BTQB 2FMLA 5HI0A 4RYDA 3BKZA 1YI9A 4H2AA 2ZCWA 4CZSA 1J58A 4I4TA 1YQ8A 4XACA 1GH6A 5L3GA 1AX2A 1RGSA 2W46A 3ETDA 3USUA 5DQ0A 2R062 3E8HA 2BV4A 1Y9MA 2HWF3 2HEPA 5IT9N 2WJSA 4QQLA 4O4HA 3FBYA 3WR0A 1VMGA 1JZ4A 3AG1B 3PIJA 5CA6A 1KGYA 1W6QB 4QHBA 1VAMA 1K33A 3ABLB 2Q6AA 3CJXA 3PUSA 1IBKO 2J22A 1GWKA 2R0HA 4C0BA 5CFDC 5GZEA 4CPBA 3FKSG 5HFMA 4J42A 1SRYA 2OIEA 1X59A 1AI4A 2WLKA 3RDIA 1FS0G 3X2QC 5IWAB 1I0HA 2JIZG 3LEMA 1JYTA 1ODMA 1SZXA 4P9OA 2YIBA 4CH6A 2D97A 2CV6A 4G9SB 1XMOB 3SC7X 1FFXA 2GTSA 3OBZA 3FWEA 2DE0X 1GM9A 4L8QA 2WSSG 1VF6C 4DINB 1A8DA 4K0KB 3AZXA 1W90A 3I2KA 5LASA 1YWKA 3BIEA 5GW7A 1RM1C 3EQEA 1H9WA 1VRH2 1Y4WA 3CCMV 1MACA 3D0SA 2G9ZA 4UVCA 1W2OA 3ZR6A 4J1WA 5KXBA 1VBB1 1S77D 4XDLA 3HMYA 4R4ZA 4M0NA 5JR2A 5A1FA 1ZZ6A 5H6RA 1LB2A 3QLQA 1NQJA 4RR3B 4FXGB 3JBG2 3ILRA 4RFT0 2K2SA 3RZMA 4DXRA 3O1PA 3NRUA 4DV2B 2JWPA 3NW4A 4MVTA 2OKXA 1US2A 2WWJA 4TV9A 4N53C 2Y0OA 2GC2A 1R73A 5KHHA 4OZXA 4EB6B 4IETA 4UV9A 3CCQV 3LDKA 4MGIE 4OGQB 2Z69A 4GJZA 4PDWB 3UM7A 4H14A 1Y6XA 5CFCC 4LF8O 3B93A 2VY0A 2A3QA 5IYYA 1WCQA 1QHDA 1M56C 4PT6A 2EIKC 4Y5TA 3ZYPA 3ZSEA 5FUNA 3UKTA 1XEQA 3D0JA 3KCYA 4IEZA 4RHV1 1DYKA 2ZOEB 4B8EA 3F7VC 3WG7C 3MHZA 1RUH2 3U0ZA 4FM2A 2JX9A 1SA0A 1W0NA 4PDMA 1VQ4V 1W6OB 3AVSA 3I2IA 2CE4A 1QQCA 4QPGA 3RBZA 2I74A 4GLXA 4DR6B 5FPZA 3IFXA 2B9VA 3CX5F 5ERLA 4FVMA 1O5UA 2GU9A 3ZX6A 4MYEA 2QQUA 1IS6A 4XFHA 1Q8OA 1KKDA 3ZVXA 1JXNA 5IWFA 1SDDB 3G80A 1UPSA 4DRRA 2QDOA 3RW0A 4AILC 4BK5A 1AJPA 3VKLA 4L87A 3PIGA 2V09A 2RR12 1YVWA 3VQXA 1JYVA 1O4TA 1M90W 1W99A 1SACA 4DUWA 2F4LA 4NIHA 4E4ZA 4M00A 1SDWA 3N7JA 4FFKA 4ZHQB 1R1A2 2C2AA 2X6BA 3ZYIB 4AE2A 3B8MA 1GM7A 4EQVA 2N7GA 4O4HB 3W59A 1GRJA 1JJOA 4PF1A 5FYIA 1JYNA 2HWE3 1S5JA 1VQMV 5FMCA 2XQRA 5EBMC 2PELA 1TUEB 1AJNA 5AG2A 1NY71 3AM2A 3OPTA 5FJHA 2ZX2A 4D6QA 1CQ9A 1POQA 4YG0A 1QJY2 2OCCB 5CNAA 3NAPC 4ES9A 4CXXA 2Q7HA 1FFXB 5EZWA 5BNQA 1G8MA 1SFPA 1IBLB 4H33A 4KWJA 1KU9A 4RSUA 2ZX4A 3BAAA 3GB7C 2YC2A 2DYRC 4AHCA 3GHNA 1I7FA 2C0ZA 3N9OA 4H7MA 3VBUA 5FP9A 3UT0A 1CAVB 3H8XA 3UJQA 4BIFA 3OB8A 2VZQA 4AQYB 1YIFA 1I08A 2ERFA 5C8CB 2GC3A 3WNMA 1W9SA 2JGDB 1PHMA 4DEVA 2YC0A 3CRAA 5CBLA 1S3JA 4CEYC 2O0OA 2DOSA 4DR5B 3CU7A 4Y5Z0 2NPIA 4ZBMA 3OPWA 2AREA 3PMSA 2F95B 5BV6A 3BALA 4JCKA 2R9AA 4WFFA 3MV11 4W4KA 4J9YB 2RM21 1Z5WA 4WZCA 1QIQA 4XE9A 3T2OA 2FZ1A 4HKWA 2JDIG 2NZ9A 3I2FA 1LULA 2NM1A 5IUQA 2WLJA 4E4HA 2FL4A 4YPJA 4COWA 3HKDA 1WJZA 3JQWA 1AR62 5C8WA 5F32A 3IMMA 1OQDA 3TN93 3S7EA 1M4UA 4NTWA 2ZEXA 5EIBD 3JD71 5IYBO 1K12A 1NTZH 4CDWC 1GSLA 5LP6B 2RQ6A 2X8KA 4AI1A 3JZVA 3O1SA 5JUVA 5D5QA 4D3WA 5L3BA 2VQUA 1GUIA 1LHNA 3CC4V 1Z7S2 4CUGA 4XJ8A 1H2GA 4O4JB 3C7HA 5FZ3A 4XILA 2EIEA 4LWSB 4NHLA 2W08A 1WD3A 3RNSA 3I3MA 4I3PA 2GP5A 1GZWB 3S5QA 1AL22 1BS3A 2JDKA 2D43A 4UB6Z 5J2TB 5CN0A 1ZBE3 3FC0A 4FLVA 1UY0A 5FZ6A 2QDNA 1V9U3 3AFGA 4GULA 5CU1A 4KWKA 2WN2A 4IIJB 5A6YA 1WW6A 2WNVC 3RVYA 1MS1A 1TE1B 1YJKA 5FQ0B 2A6WA 4GD4A 2VBBA 4UXNA 4I30A 4LBKA 4AEJA 1XNDA 3FB6C 3WHUA 1V6NA 2MPFA 1ULCA 4JYYA 1U0AA 1GWMA 1HWYA 1RUE3 1RYYA 5FLHA 3ZYFA 4YSFA 3GF6A 4PQQA 5KMGA 3VKMA 3Q8AA 5C3RA 5KR7A 4OPHA 4J7JA 4A42A 1UKGA 3HKBB 1IX9A 1CD3G 1TNFA 3WQ0A 3JATB 1SLCA 3Q8CA 5GLTA 4GIQA 1E5HA 5LBCA 1Q6UA 3T4ZA 4EWEA 4QNHB 1FX5A 1RXGA 4QXKA 4UVAA 3N9NA 4TT3G 3TOJA 5FZ9A 3KF3A 3K04A 3WF4A 1MEC2 1RMU3 4G2KA 2KD7A 1NQTA 1URXA 2PI4A 5JPMB 1WGPA 4LKDA 4MW3A 5GZDA 3WNKA 1JJ2U 3T09A 4LHNA 4GA9A 2DUPA 2Y64A 1BQPA 1BMFG 2VOKA 3VBUB 4GKYA 4Q4V1 3LIGA 4BMEA 2JB4A 3DPRA 5F5AA 4MLOA 2VZVA 2LW1A 1W28A 2AEZA 1CPYA 2VMGA 4AQSA 2UXDB 1YHFA 1I3HA 5FXZA 3R4DB 2ZGSA 4XTMA 3QTCA 2UUCB 1P7BA 2W95A 4YYOA 3I2DA 1BEV3 3K03A 5FJKA 3CMAV 1QOSA 4XCAA 2EA7A 3LNNA 1PVC1 3AG3C 2PAMA 1VARA 2VUDA 4UI9L 5D2AA 4MUVA 2JD4A 4AEDA 3IGAC 3BRCA 2VWKA 2WABA 3HKDB 3K59A 1ORQC 2WO2A 2Y8KA 1QQP1 1AYM2 4P00B 1AR93 3BABA 5DN6G 1TMF1 1LU2A 3WV6A 3DECA 2ADPA 2CTWA 2CGOA 3LSQA 5FPAA 1XILA 4LR3A 2XR4A 1FI2A 4RQFA 1AI6A 2DVDA 1OH3A 4YHHO 5IK5A 3V0BA 4FAGA 4HMZA 4A7KA 1QF3A 1H0BA 2K1EA 2CH7A 3MIEA 4YJ2A 5EJ1B 4GQ7A 2BTVC 5T5PA 3OEHG 5FRAA 4JDMA 2P5OA 3H8OA 3ZMUA 1US6A 3VGIA 5FZCA 4C1WA 2HWC2 5ANNA 1OOPA 3B09A 2R49A 5L7OB 3DCQA 5B2GB 4ZKIA 2VMCA 1M5IA 3E89A 4AFDA 1CZVA 2FKXA 2W91A 2RS32 1JQ0A 4UBHA 4WM7A 2TEPA 4IESA 5JOXA 2OWOA 1X50A 4WV8A 1FOD2 3R0RA 3VQYA 4M0HA 1QJEA 4GZ9A 4LFAO 3CEIA 2JDMA 3H1KH 3THOA 5EYYA 4RWUA 2P7TC 1O3QA 1W8HA 3KV9A 2P4KA 2N04A 3VKNA 4AI8A 1PO11 1IPKA 1NJIW 4P9XA 5I0SA 3KMHA 2WQ8A 4K6BA 3PU8A 4QX5A 2CDOA 2LW8A 4U36A 1OLRA 4LF9B 1CPNA 4AVTA 1N32B 5KMGB 1N3OA 3T2QA 4IE7A 2XPJA 1R3IC 2BSKA 4PLNA 3IZOA 4JTOA 5GALA 5JCOA 2HLEA 5F2WA 3C7GA 1V55B 1DHKB 1VQ6V 1WLEA 1SZBA 3S57A 3SYCA 1C5IA 3T1LA 1ULEA 3T4DA 1RHI1 3RWNA 2BWCA 4BWOA 4Z2WA 3NKTA 1VQ7V 5KA5A 3RG0A 1BXHA 2Q30A 5FNVB 5ABJB 3OM3B 4JKKA 4BE3A 1COWG 5A7OA 4HZFA 1BVVA 3OJBA 4ZXEA 1VMFA 3RMXA 1LJ7A 3POWA 2B4KA 4MXVA 1VBD3 1T5EA 1FPOA 4BDVB 1FJGB 5AC92 1W6MA 4EWDA 1NI8A 1K9MW 1LUWA 4AHYA 3NQHA 3APQA 3DPRB 2JRIA 4YGCA 1PO23 1LOFA 2B42B 4I9WA 1RVF2 1QHTA 3ABZA 4IV1A 3VBHA 3QVNA 4MO3M 1IS5A 1N1TA 5FMDA 4WFEA 1DBNA 4Q0VA 4E2LA 3C3VA 4OHYA 3A0RA 4CDQC 2GDSA 4H7LA 1QJU1 5IYCO 4MGQA 1NCQA 5F2VO 2D44A 4QPWA 1HNZB 2MEV1 4LHLA 1DYPA 3OTFA 2ZGLA 3HKCA 2D2CB 3DUIA 3VD9A 4Y4RA 1ALYA 1C1FA 5ANQA 4AQTA 2LALA 3CP1A 5KLVH 5CA1A 1PD3A 3H01A 3U4SA 4IDZA 4O4IB 2J1RA 3T2PA 4FPEA 1I94B 2OIIA 1MQTA 3AK1A 2UWCA 4B3NA 2EIJC 4X1IA 5B66Z 3PJQA 2BNNA 3CRCA 3BY6A 4V2WA 2RS51 4IHJB 4HVQA 1G9DA 4IGOA 5HCHA 3PN1A 4B7EA 1J95A 4QB2A 4RL7A 3V0BB 2FD8A 3VBOC 4ARXA 4AQ2A 4DUVA 3IDAA 2V4VA 5EJZB 2GMMA 5KHJA 2DCTA 2Q8OA 4CBCA 1SBDA 3ZHRA 3THDA 1FFTB 1ZAUA 1OOPB 4HG6B 2DBNA 2QJ1A 3AK3A 2ET7A 4BQ4A 1VMHA 5EC2C 1M57B 3J7MA 3ZX7A 3GBFA 2WQ4A 2UU8A 5GM0A 4J6GA 3OW2U 4FBFA 5GLZA 1HRV1 3VLBB 4DR4B 4FK5C 1IKQA 1XE0A 2O57A 2GN7A 3ZHSA 3INAA 2RDSA 1O91A 1HX6A 2CTVA 4WVWA 1X8EA 5KBFA 3LFMA 1DGWA 1LEDA 1OD5A 1RITA 2HBTA 5KWRA 4GX5A 4ASMB 4P5HA 3S0MA 4BB3A 2XL9A 3N9LA 2LM3A 4NWWA 4UCRA 2WSVA 5L3CA 4QX2A 2BSKB 4JC1A 4SBVA 2QM4A 4MX3A 4EN8B 5FMOS 5CFCB 1SQBH 2DVBA 1ZZBA 4ABMA 4ZZ8A 3AZYA 1N33B 4IL6Z 1GN6A 4A45A 2XQXA 4DB5A 3H7YA 4RS5C 5JQGB 4F8AA 1VBB3 3DKWA 5TSWA 1KDMA 3ZYHA 1C8M2 1R092 4BISA 2HWB1 2A6ZA 2GN3A 5DZGA 3DKQA 2YROA 3LAGA 4AFMA 2WO7A 4AOCA 3WZ1A 1TME1 1N34O 3DTUB 5F3IA 1AR81 3KD4A 5I91A 5EZYA 1IS4A 3AYAA 4X6RB 5FO9B 4W50A 3TGUH 3K4DA 4D0QA 4LNVA 2L9LA 1D2QA 4OCTA 5FPUA 2IJIA 4P9IA 2VC9A 3OTOB 4IV1B 2GALA 2V5DA 4XBNA 2P3YA 1XC6A 3SJCC 5DPNA 3LDEA 2BCCH 3AP6A 1JBCA 2ZIOA 1NCQB 5LYJA 3K3NA 3HQUA 5JH7A 2RDCA 1UMIA 4X64O 5LY1A 3ZXJA 3DXUA 1WW4A 3IC9A 5C8YA 4DR1B 4Y5SA 4KG8A 5JR7B 1JCHA 5LB6A 4XDKA 3ZMVA 4RHV3 4XJAA 1JODA 2JDNA 4XDPA 4GB31 3VBRA 3VZKA 4HLTA 2HHHO 3UV9A 1U5IA 4G28B 4XDQA 4XUPA 1YF2A 5LHIA 1Z2GA 2JXAA 2QWNB 5FK7A 4MVSA 4GKJB 4C1XA 3I55V 4IEVA 1VB2A 1BK1A 2ZR3A 1ASJ3 3MIHA 4LF5B 5JPNB 3Q4HB 1Y74A 1XNBA 4QGLA 1W2AX 3APBA 2ITDC 1I9RA 1JYWA 4PELA 1V9PA 4OI2A 2WLQA 2IH1C 1SFNA 2C5DA 5C5TA 1L0NH 2HWE2 2VTXJ 3MPBA 1LRHA 1SLTA 4CCJA 1CXZB 1UOFA 2VCBA 2OCHA 5C3QA 4B08A 4XOGA 2YHJA 2VO5A 5JXGA 3LSEA 4BQXA 2XT9A 3L70H 4CH5A 3IAYA 2YB7A 4DR7O 3UK9A 1ZVFA 2NQYA 3I3QA 2BRTA 2VCCA 4LBJA 2R071 2MW2B 3VHNA 2WNUC 4FIPC 2YBSA 3THPA 1OCCC 5IY5B 4WM8A 3ZXLA 1JUHA 3ABMC 1DFQA 1BCCH 5C4WA 4C91A 2P34A 1FYUA 1RUJ2 1ZRRA 2VWJA 4LBQB 1W8FA 1Q82W 2HFEC 2YFZA 1A6CA 3BODA 3VB9A 1PMJX 2CNAA 3KSCA 4NAOA 4D6SA 1S5LZ 4E8DA 3F5TA 4Q0UA 3KV6A 1NYWA 1QXPA 1UAIA 4LLOA 4FLXA 2R1DA 2EF6A 4KWLA 1EPWA 3R4UA 1V54B 1LOGA 4MZUA 5C5UA 1JOBA 3HT2A 4K3UA 2VVEA 1MS9A 1YQ6A 4FPOB 3H1LH 3I8TA 3K3WA 1CZSA 4XBQA 1MNGA 4GX1A 1W6PA 2G4IA 4IW3A 4JRAA 4MGYE 1KKCA 3J8F2 3K9AA 1LECA 1NA1A 4BJ0A 5CB4A 4XQWA 2PHRA 2JG9C 1ULDA 1L8DA 1NTMH 2WA3A 1IBKB 4DQAA 3N9MA 3FFZA 2YZ4A 1E5RA 3C90A 1D2DA 2ZKNA 1UXXX 2RM23 4FT8A 5CKQA 4WZFA 5FV3A 3KGZA 3WDYA 2V1DA 1W6NB 5CISA 4NE9A 3K4ZA 1S2EA 4P9JA 1UFIA 1XJAA 4QHZA 2NR5A 1AVBA 1Y9GA 1GQHA 1RL3A 5EWSA 3WT3A 1MSDA 1G9CA 4Q5OA 4DFSA 3JB8A 3I56V 2ATFA 1BGYH 3OGGA 5FZLA 2WT2A 4V1PA 3JD73 1KBHA 5C8YB 2GNDA 4UCVA 2LRPA 4BOWA 5IK8A 3RVHA 2XHNA 2HEYF 3UCSC 3ZFEA 1P49A 4CDXB 4JX0A 1DK1A 4GMP1 4PD4F 5IVCA 4Q0PA 1GN2A 3MW2A 2OUHA 5DDJ3 3RZLA 3S3WA 3UESA 5A6ZA 4R52A 1XNRO 4GWJA 4K8XA 4KBZA 1W8ZA 4FPFA 2HYKA 1GICA 2ZGKA 4LFBO 2ZM6B 2JDYA 5F2SA 2GMPA 3H1MA 4FQ4A 2K9PA 3ZBHA 4OFGA 1B09A 1Y74B 1D4VB 2DDUA 2W39A 3URFA 5BNPC 1R3JC 5IAXA 2WLMA 2PI5A 4XZPA 3CYOA 4PLMA 1GP5A 4YW2A 4MG2A 3CJHB 1NQDA 3K0GA 1EV11 3A23A 2DQ0A 3ZN0A 1LEMA 1FPN1 5JVDB 4LF8B 1MS3A 3FLTA 2PYTA 4UF0A 1MG1A 4BU2A 3W21A 2PHUA 1VPHA 1AR71 4UUJC 1REDA 3ZMZA 1FKAO 2ZGTA 4DV7O 2IU3A 1EAH2 2W9XA 2E3CA 2X5IC 1ND2C 2OZ6A 1AB3A 3FN9A 3GCWA 3LSUA 1COV2 4LA3A 4AXOA 4RGGA 1SS3A 1H30A 4M3CA 3SDLA 4MGKE 2FDIA 2DW4A 1ZZ9A 2X53S 3K5MA 5EQUA 1CAXB 2QBXA 5FO8B 2Q5TA 5SV5A 3FUOA 1M4WA 2D3SA 4META 2Y69C 2J7MA 3C3SA 2YICA 2VQTA 4I50B 2QSAA 1NVPB 1K97A 2D3PA 2W6JG 1O3RA 2QQPA 4PDVA 4YVSC 5B1BB 4DW1A 4XQ4A 5JSRA 4RQPA 2FCUA 2WQZC 5IVVA 4RN5A 3DXRA 1KITA 4CRQA 4FPLA 1VQLV 1PNFA 4X66O 1H8TC 4JI2O 3KG2A 4I9QA 5ACA1 5FZ1A 4WFAV 1VBC2 2OTJV 3UGHA 3O1VA 3HN1A 2JGUA 1CR7A 5JJNB 4UFHA 1M06G 4CDUA 1PNLA 1W2BU 1PM9A 4OYUA 2B46X 1F4AA 3OD0A 1W6PB 5LXTB 1Q8SA 4HKLA 4EJRA 1NA1B 5CB4B 1NCRC 1O6UA 2EIMC 2WSUA 5FY5A 5FR3A 4LCUC 3AZZA 1M9NA 4L97A 2A9HA 2XLGA 1VJ2A 2CSGA 1ZREA 3T1YO 2VTFA 2VULA 3DN7A 1XI1A 1YFXA 3A0HZ 5CA0B 3IJ4A 4I5SA 2NN8A 3I3EA 2BNOA 3I3BA 2ZDIC 1W0JG 4QB1A 3AKPA 3JD3A 2HLDG 2DWDC 3PJSK 2UWAA 5KXDA 2GNMA 1QQP3 3PVOA 2WLNA 4UFKA 3PLQA 5JLVA 2ZEZA 1B35A 2JS5A 3CCUV 4QX3A 1G6NA 4QQPA 1RUG1 3U75A 4QDSA 4XF1A 2HWD1 3JD0A 2GAUA 1RUF3 5FOJB 3AJYA 2PHWA 1ND3C 2Z79A 4RUFA 3J26N 1URFA 1L3JA 3V64A 1PNGA 2LTNA 5BXXA 4NXNO 4I02A 4NTXA 1ZA7A 2DWEC 3WB2A 1VBE2 2B7YA 1PP9H 5HXVA 1WLTA 2VXRA 5LW9A 1D4M3 1XNQO 3LFIA 2IWGB 2WLIB 1I5ZA 2QJVA 4JAAA 5IJ9A 1QNWA 2WUHA 1TZOA 2JDPA 5BXZA 4WBNA 2EICA 2BOIA 1HW7A 1GN4A 1QLNA 4RUEA 2JD9A 1LESA 2A6XA 2W1SA 2B9ZA 4N43C 2E7AA 2ZQMA 1J3QA 3M3IA 5F8PA 2AEYA 3SH5A 3IM0A 1YDXA 4OUMA 3ABKC 3LF7A 4P9YA 1SPPA 1K4DC 2UXBO 2YXSA 5CFDA 2P37A 3RVZA 3VBFB 2VW2A 4QPIC 1N1VA 1T6GC 4AVCA 2WRAA 4LXLA 5AFBA 3MHSC 3P6BA 2D6PA 1XRUA 1NVPD 5ITZB 4M3CB 4PJYA 4FM1A 1S4CA 2VNOA 2ZAHA 4F6EA 5EPAA 4JGZA 1WMXA 3AMHA 1RUC2 2ZZJA 1IBMB 2GC1A 1LHOA 5A32A 4DW0A 1GBGA 4Y1ZA 1W9YA 5FAXA 3AKRA 4Q8KA 3JARB 3H50A 4YVWB 1YYNA 1S55A 4ZIBA 4YY3O 3AG7A 3PL0A 2VNRA 2J1AA 4JYAO 2QKCA 1ZX5A 3VHRA 2WR9A 1BKZA 3OEAA 1QGLA 1SQVH 1YTFB 1IKPA 2YI9A 1W06A 2BJSA 4CDUB 3O65A 3T4HB 4HN0A 1RUI3 4HNAA 1PV0A 2DN9A 4N53A 2IJHA 2PFWA 1BL8A 1KECA 3UO3A 3AG1C 1IQAA 4KP4A 3VBOB 2BUKA 3MEPA 3KCXA 2Z42A 4ZXKA 3ABLC 4CCLA 3RJ2X 2VUCA 4TZDA 3UT5A 4M4PA 1QJU3 2CDPA 4LK6A 2MEV3 4UW3A 3W5NA 4AEMA 1ZBA1 1FAYA 1J5EO 5E6HA 3JQXA 3QO5A 3OBAA 3BUCA 3WY6A 3ZXAC 1W9TA 3KQ4B 4R9AA 4XBFA 4DRXB 4LUKA 2WLPA 1AF9A 1RSOA 1R1ZA 2RMU2 4UFLA 1JS9A 4LQRA 5DAVA 4TSVA 4WCEV 1V6OA 2UXXA 5FZMA 1ZL8B 2VMEA 2Y38A 5FK8A 1F31A 2VMHA 1QDOA 2P90A 4CC6A 2XJSA 4AWDA 1S2BA 2A79B 4XAAA 3ZN4A 1JU3A 5DAWA 2L6LA 4YM3A 2D5FA 3QO7A 4QPYA 4RR3C 3RFRA 1W2NA 1VBA1 3GYDA 5A1AA 1WKYA 2FDFA 1X9PA 3V56A 1XYNA 4DR3B 2YSUB 1ENXA 5BNOB 1WNSA 2CHHA 3GGLA 3OPZA 1JHJA 3JD4A 3MLKA 4K21A 4CCNA 1YRZA 3SH4A 4BQ5A 5D5PA 3CCEV 2Z3YA 1EFRG 4WBNB 4B3TO 3ZIWA 2QWOB 4PDWC 1HRV3 2BDRA 4O2AA 1XHXA 3OSDA 3BA8A 3BHPA 4PCRA 4TXWA 3JBG1 4FQZA 3GWKC 4LJHA 3SH3A 4HPKA 2YBKA 4CH4A 5I0DA 3PUHA 5A80A 3B77A 4IE0A 4MTXA 2BGCA 3UNPA 3TBDA 3VKFC 2W92A 5LATA 4CCOA 2BOCC 3QCWA 5I93A 2OTLV 3NJZA 4YHHB 2XWBB 1VBB2 5BMVA 3ACFA 2VOTA 5EIBC 4YFWA 3NAPA 4ONUA 1K73W 3WQ7A 1MS0A 2HP8A 1Q5OA 3A0BZ 3WQBA 5C9AB 2JB8A 1G8WA 2TBVA 1KP3A 3MUY1 4XUQA 3OFNG 4Q4W2 3THTA 5A3WA 2LQTA 2R041 1H4GA 2YXLA 1AX1A 1JA8A 4QT6A 3IDEA 1LENA 2O14A 4BMBA 2WLLB 3D6EA 4Y1XA 3OGJA 3LPGA 3EB7A 2HWB3 5DG1A 3K06A 1NLSA 3VBSB 1VIBA 1DQ4A 3RYHB 1U5XA 1E5IA 5IJ0A 2E7TA 5KHKA 5L3DA 1TME3 3ON7A 3FYIB 4HOOA 4DK0A 4MGTA 3BCCH 3C2UA 2IXIA 1WP7A 3B9IA 5FP7A 1S0CA 4DV0O 2QKAA 1NS1A 5CKMA 1BHAA 4TTGA 3RPQA 2AC1A 4LLFA 5FZOB 2PHDA 3ZSKA 1ZYBA 4KFMA 1OVSA 1RXFA 1UQXA 3RT3C 2F1MA 3OYWA 2UYBA 4O2BB 5GZFA 2RHPA 4NWVA 4MSWC 1DLCA 2BNMA 3WF2A 1YXBA 1GP4A 2HJFC 4MTOA 3V0AB 2OCCC 4GH4B 3OF1A 2D6MA 2EULA 2PAEA 4CDWA 5A3MA 4UFMA 5LOVB 3BYWA 2Q7EA 3HKEA 2G9FA 4GB33 2D6NA 4GX2A 3M8LA 1AHSA 1PK6A 3CEWA 4Q26A 5FLJA 2E51A 4I55B 1YJWV 3VD4A 4GWIA 3E86A 5JCTA 1NZCA 1V6KA 1OA4A 5FYSA 4HSLA 4N7UA 1BJQA 1ACCA 2W1QA 5FIXA 2M7WA 1PZ8A 1HXS1 2A1XA 1BSMA 4CH3A 1N8RW 3ZIXA 4EN7B 4KQ7A 4AR2A 2Y4UA 1O9HA 1SMVA 2BW8A 3GJBA 4LF9O 4QWNA 3JB4C 3LOBA 1LODA 4CUBA 1NR1A 3HJRA 5FWEA 2BPA2 1G9FA 1W05A 5LBFA 2JENA 3VBBA 3SEEA 1LHWA 5JZGA 2WNVA 1NY72 4IEOA 3ZFFB 4KMQA 5FZ7A 3KHCA 2E31A 5DM6V 3JD1A 1K7DA 5B4XA 4Q4Y3 2OX0A 1XBLA 2R073 1V9U1 2GTAA 4PBPA 1VRBA 4BWAA 4B1MA 1XREA 3K3OA 1XE7A 5J1XA 1FD9A 4FMTA 1HV1A 2UY9A 4B4RA 2BQPA 4QGPA 1TVKA 5LP6C 5FY9A 5FL7G 3WDVA 5CZKA 4NYKA 1YCIA 3DYPA 1HV0A 1POV0 1IG3A 3POSA 1IURA 1Q43A 1SLIA 3O9OA 1RTVA 3NJYA 2VM9A 1R6NA 5KXCA 3ICXA 3UKVA 2Y0PA 4HXCA 2Y48A 1AR61 1EM1A 3VZJA 2ETNA 5LEJA 3TXQA 1HRI3 2Z5WA 4X1YA 2YC4A 1HNZO 5M0TA 2HKOA 1LR5A 4FP3A 3EXAA 1AROP 3E35A 2QVSB 2DVAA 3PTYA 3CE2A 5F9TA 2QQWA 3ZHTA 2FMDA 3LSDA 1GKFA 2W0XA 2VTXA 3MUZ1 4XC9A 4QKDA 1DQ5A 1G86A 1Z7S1 4YIOA 3U14A 5IJ0B 5J9PC 3JD2A 3CMEV 2HR3A 4NHYA 3LA3A 1TUBB 1P8JA 4QB6A 5F3CA 1XU2A 1MS8A 4RQEA 2ODMA 2O8OA 5LK5A 3JD72 1EP0A 1AJQA 3W7XA 2OW4A 2XH6A 1ZX3A 2EALA 3ASIA 5C7GA 4CE8A 1F4HA 4MVMA 5FKBA 1WLWA 4A41A 5K0UB 1YC61 2D93A 3O14A 1GQPA 1DZTA 4LKEA 1GO3F 3LA2A 4MVOA 1R3LC 2R9IA 5T3NA 1CZTA 2DF7A 1SQFA 4DV6O 1AX0A 5K7PA 4H13B 1BEV1 3SHRA 4O4LA 1AL0G 4D6TH 1Y4MA 1D5NA 4DUYO 2WBKA 2I07B 4XJUA 4CS4A 3S5AA 2HYXA 4GMP3 4CU7A 2ORXA 2R7EB 3MGUA 5FYBA 4OPAA 1PK6B 2B1GA 1X9TA 1AR91 1DF5A 2DCJA 3WNXA 2ENRA 4C0HA 1N34B 3FAVA 1WAZA 1SCRA 2ZGRA 1BE3H 3VBUC 5FLIA 1RC6A 4AI9A 2VZPA 5A33A 1BMV1 3B9CA 3CCLV 2WNEA 4YW3A 3K77A 3L75H 2XUEA 4D7TA 4QQHA 2VBDA 5J3UA 1OSGA 5L73A 4UAPA 2KG7B 5HCBA 3MO4A 1OHHG 2B9UA 1FPN3 3EHKA 1F51A 1H8TB 5D1IA 4ZS2A 5H5NA 2AACA 5JZGB 4UYBA 4E2SA 4X64B 4GKKO 2BGOA 4R8HA 1X8MA 5IYZB 2Y6GA 5J96B 4BQ2A 3DXTA 4WFBV 1WMDA 5A9GA 1CAUB 2Z2SB 1UU5A 4INDA 3BFRA 3WB0A 4CYDA 2R9RB 4BW5A 4FTSA 3OE7G 1WD4A 1D5AA 1QNYA 2YDEA 4QPJA 3CPWU 2C1FA 2PA7A 3BB6A 3S7IA 1ZNPA 1JHNA 3EVKA 4MOAA 2W0FC 2YPDA 3TWIA 1TVKB 1GNZA 3ZFGB 3AYCA 3ZDSA 1PL4A 4Y26A 2YU1A 3ZRWA 3MFAA 4IV3B 4Q27A 4Q4V2 3SNMA 2XXZA 1GNHA 2VZUA 3ACGA 4MH0E 5EK0A 4NOTA 4QDRA 1F8VA 4I01A 3HT1A 4QAWA 3SJAC 1UF2C 1QVGU 2E32A 1L7QA 2EZPA 2YPJA 3CCJV 4ISRA 2GUZB 2VUJA 4BXFA 2YGLA 3J4UH 4YRDA 5APAA 2YFUA 4LKSA 2VR4A 2GV9A 5L7OC 2QR4A 4DR1O 1SLLA 3DC6A 1AI5A 1UZZA 3K0DA 4DR7B 4CU8A 1QH6A 5KX5A 1M1KW 2JS3A 1PVC2 4LO6B 1VQ9V 2VXJA 4DUXA 3JSNA 2JKXA 5A3UA 4PI0A 2MK3A 4CU9A 4P2ZA 2VQEO 1O5LA 1PZ9A 1TMF2 1AILA 3GBGA 3T08A 3THCA 3RJRA 2ARHA 5C6CA 3VHOA 4DPNA 2LW7A 2ZX0A 2NYYA 5J2UB 4CCEA 1V6JA 3KT4A 1AYN2 2Y6LA 1MZFA 4LHKA 2PZSA 1ONAA 2XAFA 1PO21 3JALA 4P9LA 4CU6A 5FUIA 2GSYA 4EFBA 4PIXA 5FPRA 1FOD1 5IHRA 1CX4A 4JGYA 5LMUO 3K5LA 4UT5A 1BK0A 1DGLA 4N90A 1V55C 3FHIB 4JQRA 3JAWA 3GJAA 1ZZ8A 4O4LB 2HWD3 4XYXA 4HVOA 4XMAA 3K57A 1X4TA 4JI5O 2ZJCA 3W7TA 3UKMA 2HBUA 3E2EA 5FY8A 3WQ1A 4MADA 5CMUA 3RYFB 1H2SB 1OMIA 2OS2A 3VDCA 5FY0A 4AYUA 2J1SA 4JI4B 4AFAA 1OJHA 2CUGA 5JSPA 2ZS6B 2AUYA 1JN2P 5ABJC 4O7XA 1UL9A 3M3EA 1XL4A 3ABTA 3OUFA 1PO12 2Z0AA 2JJ1G 2ZEWA 4EE2A 3CKHA 4DY3A 4X8AA 3E22A 3DPRC 4X1KB 4XCBA 4N21A 3WG1A 2F17A 4B1LA 2D3RA 4MT8A 1MVQA 4BLJA 3RYRA 1OI6A 3PU3A 2V4AA 3E6CC 2DWRA 2IJJA 5DECA 3WUDA 4LUMA 1OQEA 4JAVA 1DDLA 3DYMA 1FXZA 2ATKC 3OMAB 2WFF3 1YXWA 4LOTA 2DVFA 3L73H 1RHI2 5AC91 2AGSA 5HCFA 5K8SA 1ZSPA 5CYYA 2J42A 3JASA 1RUD1 5KA6A 5JAXA 4HONA 4N8MA 4MGZE 1XNRB 1A3KA 2IVJA 1OCRB 4R9BA 1F9KA 1DLBA 1P7GA 1K5MB 5A3PA 1Q90D 1J83A 4B3SO 2VQFO 4LFBB 5A7QA 1OXCA 4HK8A 2VPVA 1X7NA 1OFSA 2W87A 3B4SA 3K5OA 4XURA 4E4SA 4XFIA 1PIV2 3E1F1 4XMIA 3R66A 4UBGA 3ZRWB 3OY8A 2DU1A 1X33A 3NNJA 4J1XA 2CY6A 3DEMA 4LKFA 4RS5A 2PXJA 4B4QA 5E88A 2A06H 4HK9A 2G38A 1Y76A 4S2FA 3WDTA 3ZN1A 4ZI7A 4LBEC 3FUQA 3M99B 5EYPA 1QJU2 3ORJA 1OOPC 3SCHA 3AK2A 1WA8A 3PDQA 3B69A 1BQZA 2VQAA 1F15A 5HCAA 1W8UA 1M57C 1O7FA 3PNAA 3AKTA 4PF5A 4Z07A 4DV7B 1E57A 3HD8B 5GZCA 1WCSA 1NR7A 5LMNO 4G4FA 4Y1VA 4MHRA 4EN6B 1R081 4Q0SA 4X8NA 1KS5A 2QQKA 4XXAA 3MF6A 2VJXA 4HSJA 4YM1A 3N9QA 3HWJA 1UU6A 3BVOA 5FLXN 3LDCA 1NKGA 2ZD9A 1YJLA 5FDBA 3NNMA 1GANA 4AVVA 2ZM6O 4Y22B 4AVAA 2RS52 3DSQA 3SPIA 2VMDA 5B5EZ 4CEWB 1ZBA3 3VZMA 3BEHA 2VRZA 1ULPA 2IXKA 3PVBB 3POGA 2R063 1H2LA 4XUOA 3WD5A 2EILB 4M3CE 2P3KA 1GV9A 2A70A 2VUAA 4LBNA 3W20A 5KC6A 4TLGA 5GONB 3CD6V 3VN4A 3WF1A 4JGYB 4W4LA 4JI3O 4FSJA 3ZYGA 4X66B 4JI2B 1N1SA 1NX9A 5I0UA 2Y26A 4K20A 4P14A 1VMJA 2QE3A 1IZ3A 5FUPA 1JYXA 1XMQO 1DYOA 4LF6O 3OGCC 1YFWA 3AFKA 2HG5C 4FTEA 3ZN5A 4TWKA 2Y33A 2V73A 3SITA 3UGFA 3CJIB 4AAPA 3ZMSA 5H9RA 5GLVA 1GK9A 1HRV2 4JTCB 5KUMA 4FI9A 1JOPA 1B6QA 1UY2A 1VBA3 4DUZO 1QMJA 2IC1A 3WUCA 3T1YB 1S2KA 3SYQA 2ZGPA 3T30A 2GH8A 3BGAA 2Q1FA 2PLV2 2Q5ZA 3ZSMA 5B4NA 3JAKB 1ASJ1 5D8AB 2UXNA 4X88A 4R7CA 1VRH3 3D3IA 2UWBA 3ZKUA 1LOFC 2DCKA 4IV1C 3VBHC 5A6XA 4CCCA 5C3PA 3T4VA 4JKMA 1LNSA 1C8M1 3E97A 2P3IA 2HVJC 2WNUA 1NCQC 3JBG3 5FXWA 5CBHA 5IVYA 4UW5A 4I4TB 4PLOA 1S5HC 4X20A 4FFBA 1D2SA 3O1RA 4AGGA 4K8ZA 3USUB 1NE4A 3R6SA 4MVZA 3AP9A 1H8VA 3M1HA 4NXNB 1V6LA 2X7RB 2HWB2 3UJOA 3H3UA 3WB1A 1KFUL 2RDNA 3E8BA 5C3OA 1KXGA 2JIJA 3CWBH 2WNOA 1N0NA 1IOAA 1QDCA 3UL2A 4WVMA 1Y67A 1AR82 3ZEDA 2VBPA 1XNQB 2R043 3B00A 5FWJA 4EFEA 2IU0A 2TUNA 3OY8B 3HR0A 4FTBA 3B94A 3PUIA 1UYZA 2W94A 3WNPA 3MLLA
chains in the Genus database with same CATH topology
1Q8VA 3M2MA 1LOCA 4CDXB 2HWD2 4Q4X2 3CF6E 1DGWX 4GMP1 4A7YA 2VGDA 3WG3A 4Q0PA 3O7OA 3MW2A 2OUHA 3EXUA 4CEWC 2WS92 5DDJ3 1VRH1 3AZVA 3I59B 4R52A 2WWSA 1EY2A 2O1QA 1GQGA 4P9WA 4FPFA 1UD1A 4YZ4A 1OA3A 1VZ5A 4FPHA 2WA4A 2HYKA 1GICA 2PHTA 4XPVA 2ZGKA 3WDXA 1APNA 3VDDC 4YW5A 4JGYC 4KNCA 4P9GA 3DGTA 2GMPA 3H1MA 2ZGUA 4FQ4A 5ACA3 1XYOA 4WVVA 1U5YA 4OFGA 1B09A 1D4VB 4XHBA 3URFA 2W39A 5BNPC 2KXLA 4M01A 2RR13 4CP0A 3TRSB 1DZQA 4XZPA 2MHFA 3AXEA 4PLMA 1DIWA 4RQPC 4YW2A 5CFDB 1XE8A 1N3QA 3RRDA 1ND3B 3LGRA 1NQDA 4BYYA 1EV11 5E1RA 2WBQA 2AR6A 4Y1YA 1W39A 2OG5A 3FLRA 1LEMA 2GC0A 1FPN1 3CJIC 1C4RA 1TEIA 1DQ6A 3D5OA 5BYNA 5CADA 1MS3A 3FLTA 1G9AA 4RR3A 1SLAA 2ZBJA 3GZTB 2PYTA 2GH2A 1JYCA 1VAKA 3VL9A 5F1RA 2WBPA 1CN1A 3KT7A 2PHUA 1R082 2VVDA 1ENQA 2RMU3 1AR71 3E5XA 4NE0A 1REDA 2BEOA 2R6QA 2ZGTA 4I2OA 1CIWA 4QGNA 3R05A 1RUC1 1EAH2 4AFBA 4JGZB 4Y22A 2X5IC 1A8MA 2WFF2 1ND2C 4LO4B 5D8AC 4CEWA 2JG8C 1VBD1 1OPMA 3ILNA 5IT6A 2OZ6A 5A32B 2KM2A 3AYDA 4FAHA 1COV2 4LA3A 1DZRA 2XBO2 4AXOA 4RGGA 1X82A 2BVBA 1ENRA 2WZR3 3NSTA 2GDFA 1DQ0A 4EROA 5FOBB 1H30A 3POYA 3EBRA 1F5FA 4L9BA 4M3CA 4MGKE 4MXWB 3NVCA 1MS5A 1ZZ9A 4ZU4A 5GLUA 1FMD1 2X53S 1RUH1 4NO4A 1H2KA 4NPRA 1HXS3 4N43B 1CAXB 3AK0A 4HFSA 5FO8B 2Q5TA 4O9EA 5SV5A 3FUOA 3H8UA 1M4WA 2D3SA 4META 3V65A 2BWAA 4Y1UA 4BH9A 3IPVB 4AI3A 2EAKA 2R072 5DDJ1 2DYCA 1WA4A 2ZZQA 4CEYA 4QMAA 3MW4A 5BNPA 2D3PA 4IEPA 1O3RA 1Z0HA 2A3XA 4QPGB 1RUG3 2QQPA 3NV1A 2DUQA 4HT1T 2E9QA 1TNRA 4YVSC 4RA0A 4XQ4A 4XBLA 2PLV1 5JSRA 4RQPA 2WQZC 1DQ1A 5DUVA 3BU7A 4QPIB 2ZHLA 1KITA 1RVF3 3IBMA 3L9JT 3WW2A 1J1TA 4RHV2 4CRQA 4FPLA 3CJIA 4LBQA 4N53B 1PNFA 2PN5A 1H8TC 1IHMA 4B4PA 5ACA1 1VBC2 2RS12 4BA6A 4N7IA 1B35C 3HN1A 1J3RA 3WOGA 1AXKA 2RR11 2WIIB 3PMEA 2RE9A 1CR7A 2W68A 1M06G 3KLSA 4CDUA 1GR3A 2EXKA 2CL2A 1OA2A 3SCGA 1Q8PA 2ZHMA 4AHWA 4LEJA 2B46X 3LZZA 2X5IA 3OD0A 1W6PB 2IXLA 4K1YA 1ND2A 5D8AA 4DXZA 2F4PA 1HQNA 2ZMNA 1Q8SA 3IMNA 4HKLA 1NA1B 4EJRA 1RB8G 1BZWA 1NCRC 4COVA 4COZA 2K0GA 1ASJ2 2WSUA 4KH9A 1R1A1 3AZZA 3AMNA 3NV2A 1S1AA 4L97A 3TB0A 5DUWA 2XLGA 3AB0A 5HSXA 1VJ2A 3B7MA 2RMU1 1Y7BA 1ZREA 2VULA 3DN7A 2DU0A 3GALA 1YFXA 3WP5A 4CDXC 2XLAA 1YLLA 3EO6A 4AFCA 1JR7A 4NR1A 2NN8A 5HI0A 1ZZCA 3U11A 1AUYA 2BNOA 1YI9A 3AMMA 2ZCWA 4CZSA 1J58A 3WCSA 4BHPA 2DVGA 1AZDA 3B3QE 3R4SA 1AX2A 3WG2A 1RGSA 4M2IA 3AKPA 4KU8A 4YVSA 3USUA 5EV7A 5F6LB