3KCYA

Factor inhibiting hif-1 alpha in complex with 8-hydroxyquinoline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human FIH-1 in complex with quinol family inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 98
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3kcyA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kcyA01
1YCIA 3D8CA 3OD4A 3P3PA 2WA4A 1H2KA 4B7KA 2CGOA 4QU2A 1H2MA 2YC0A 4JAAA 2Y0IA 1IZ3A 2XUMA 4BIOA 2WA3A 1MZFA 3KCXA 3P3NA 4NR1A 4Z2WA 4AI8A 2W0XA 4B7EA 2YDEA 4Z1VA 1H2NA 1MZEA 1H2LA 2CGNA 3KCYA 5JWPA 2ILMA
chains in the Genus database with same CATH superfamily
4Y1XA 1JUIA 4O4HA 2DQ3A 4O4LA 2JENA 1W8NA 2LFRA 4RHV1 3VKLA 2A9HA 2EAKA 1I9RA 4TLGA 4X64B 2DTWA 4CDXB 2DFCA 3K59A 1D7PM 2DWDC 1I5PA 5FOJB 5KHHA 3TEWA 1G8MA 3M7MX 5DZEA 4Y24A 5LA6A 4FOVA 5CFCB 3A0RA 2ZMNA 1GNHA 3H1WA 1NH2D 5A7WA 2DWRA 1KFUL 2GNBA 4LH6A 4LJHA 4FPPA 3ASOB 4AYUA 2GUZB 2OUHA 1SQQH 1YYNA 1IKPA 2DUQA 2KXLA 3CX5F 1AR81 4LWSA 3GM8A 2B9ZA 2QCSB 5LMUO 1K9MW 1JCHA 1EP0A 3R0RA 4PDWB 3BABA 3OEHG 4MVQA 3HKEB 3K75B 3SEEA 2WNEA 1OFNA 2CTPA 4XCAA 4LLOA 1AYN1 5LA1A 1F5FA 3W58A 4J1XA 2CWSA 2BTQA 3OD4A 4TLFA 1W2TA 4LBQD 3KV5A 1ZL8A 1GM9A 1UY1A 3BIWE 3K4AA 4FLUA 4GH4A 2JKBA 3A8TA 2XOKG 4I09A 5GZFA 1WPXA 2D5FA 4GX5A 2VUDA 4QT6A 2YU2A 1G9CA 2WO2A 4MGQA 1NCQA 2YIBA 3B00A 2PQQA 4GULA 4KUMA 4LF5O 1HQLA 1VP6A 4I9WA 1FOD1 5F37A 1FS0G 3CC4V 1JHNA 5F3IA 5EYPB 5FLJA 1TUEB 1CGPA 4X1KA 5EV7A 2ZGQA 4BQ3A 5FPLA 4B3SB 4RYDA 4CUGA 3AYDA 3CMGA 1ODNA 4JC1A 5K9YA 4LBNA 5CYYA 4FJCC 5FZMA 3WF0A 4EWDA 5FWJA 1MOFA 4TXWA 4JI3B 3X2QB 1NE6A 5BMVB 3HPLC 5JLVA 4DUYO 3LDBA 5JCOC 3IDCB 4J7ZA 1JOJA 1DU3D 4FIPC 3K3OA 3RZMA 1US6A 2LFSA 2YEVB 5FWEA 1FPN2 2OXBA 3NV1A 1WP8A 4Q1RA 2JB4A 4DXRA 4R8CA 1UFIA 4Q1PA 3T0AA 2R9IA 4DUWA 2YHJA 3K79A 3H42B 3ZHUA 1B35A 1UXXX 3T1LA 2Q4SA 5KA6A 4YY3B 4JYAB 2ENRA 3ATGA 4QM9A 1GUIA 4H13B 4X8PA 4RR3A 3LSUA 3BHPA 4PJ0Z 2QQVA 4CUBA 4K21A 4UW6A 2WN2A 3SNMA 1Q86W 4LIUA 3VBSA 1QKQA 2VBPA 2W95A 5B1AB 3BTAA 3IMMA 1PK6A 1CP9A 3MIEA 1PMJX 2PZSA 4BIOA 1JFFA 3BIEA 3ZYPA 3M3OA 2W0FC 4LULA 1DGRA 2NPIA 3ZDSA 4XF3A 3DV8A 1ALYA 3KD4A 1BLZA 1F23A 4AXOA 2B4KA 4CDXA 3VL9A 1OLRA 2ATKC 3ZYRA 2BBAA 3W5MA 4W6WA 3KHCA 4E4DX 4J42A 4JPRA 2WJSA 3OGVA 1UXZA 5LA9A 5BV6A 1FV3A 4XW3A 2E33A 5I93A 4J7JA 1QXPA 2PN5A 1AXYA 3CXCU 3T09A 3CJXA 1Q3EA 4CVUA 3VDBA 5IFPA 3VN4A 4RHV2 5C3OA 1BMFG 2BU9A 1X82A 2YXYA 4W4KA 4DR3O 1ZBA1 2OIEA 3H1IH 3ZDVA 3I7DA 3RYRA 1RC6A 4GX0A 1NZIA 5GZEA 4CP9A 3NKTA 3IC7A 3ZFGC 1DBNA 5I8TA 2GDFA 2EJRA 2P3JA 5FP7A 4JTNA 2Q8CA 4DXSA 2RDNA 3JSLA 1B35B 5IK7A 4WM7A 5F2VO 4RS5B 2JJ2G 4YW4A 4AEDB 2A75A 4QM8A 2RS52 1I6XA 2XJRA 1RJ7A 1TMF2 3AG2B 2JDPA 5KX5A 4HETA 4LPLA 4EN7B 3ZIXA 4W50A 1COWG 4JGZC 2GHYA 3QNEA 5FYYA 3LIGA 2ODMA 2AZ0A 5JSRA 5DUWA 3MIHA 3EJKA 3THOA 1BZKA 2ES3A 3W21A 3NAPC 3SPIA 3J7NA 2Y48A 1X36A 4C7UA 5GONB 4IERA 1QMJA 1SDDB 1YDXA 1QF3A 3PUSA 1WW7A 5FDBA 3S57A 1RITA 3JB4C 1RUC1 4H14A 4QPYA 4UUJC 1X4TA 3PUIA 1VRH3 2WFF1 4I4TB 1E5HA 4RQEA 3DXRB 3AVSA 2ZX2A 4QKFA 4DR6O 1GM7A 4KWJA 1QLNA 4KMQA 4OUSA 4ZHQA 1AZDA 4GWNA 4AE2A 4XYXA 3KV9A 1N1YA 1OA4A 3M3EA 1XB9A 2WABA 3G6EV 3POIA 5ANQA 5C9AC 3A23A 1H9WA 5ISLA 4GIQA 1VRH2 3QG5A 3R4SA 2RV9A 5BZBA 5JAXA 2ITCC 3UL2A 5FZDA 1SLCA 3VQVA 3MYXA 4X89A 2YIAA 1Q6IA 1W2BU 1UIKA 5IJ9B 3LDEA 2A7AA 4EB6A 4QD2A 3HAGA 4RR3B 3ZXKA 4HT1T 1XNAA 2QUOA 5IW0A 1I94O 1AX1A 3OY8A 4AR2A 2YPJA 5JOWA 5J96B 4Q5OA 4QQ2A 1KKCA 4HVQA 2XHKA 4Z82A 2JDMA 1TVGA 2VNRA 1CPMA 4Y3OA 5LGTA 4BPZA 1LOBA 2WQ4A 4OQ9A 2XLFA 1SERA 2VZQA 4JTAB 4TSFG 4JCKA 4AFCA 4L87A 3VV1A 1SQBH 5HCHA 5GZDA 4PIYA 1HDJA 4NE9A 4YW2A 4DNYA 1I1EA 1G86A 1QQCA 3WSOA 1XEQA 1Q8SA 3O0XA 4P9OA 2B46X 1H2SB 4CCOA 4L92A 1B06A 5JZGC 1OC1A 2D40A 2HJIA 3Q9OA 4RAIA 4CCDA 5CA1A 1WLEA 1NQDA 1J5EB 4XDJA 2DCYA 4DV7O 1F35A 1MZ6A 4TYSA 2V09A 4JKKA 4LFAO 3ACIA 4QQOA 4BU2A 1Y43B 4ZPIA 3JAWA 3T2TA 1ND3A 3ZXGA 1UCXA 1XL6A 3R4UA 4LF4O 1AI6A 3BA8A 1SG3A 1VQ7V 4DUZO 4Y20A 3RMYA 5JH7A 2Z69A 4UB6Z 4LBMA 1KMIZ 4HZFA 4IEQA 3ZMNA 2EINB 4NKGB 3NNFA 3OTOO 1W2UA 2E7QA 3E5QA 4AQSA 3AZWA 3UYJA 2RS32 2QQOA 3K3WA 4RQFA 1SHWB 5GJ6A 4DV6O 4X65B 4D7YA 5IVCA 3O1SA 3GZTB 4FQZA 1BBT1 4XZPA 5A7OA 3WX5A 2JDZA 4LBLA 4I0XA 1Y74B 1E1RG 4UBGA 4HPKA 1EN4A 1GZTA 2DVGA 3ACLA 4MGTA 1PIV2 5CFDC 4QMAA 4QX0A 1Y9MA 3FB8C 5LY2A 2XOMA 4AVAA 3MDSA 4YFWA 1GMGA 4WM8A 3DYOA 1RUF3 1N47A 2XMLA 2CTVA 5C3RA 4EN9B 4QQHA 4CS4A 3J8F2 3B40A 1FMD2 3WLUA 1NCQC 4KFMA 2GTSA 2YXLA 1S0CA 3SXWA 2P67A 3OFNG 2YBSA 2QKCA 2P1BA 3H7YA 5DAXA 2ZGRA 3H01A 3ZHQA 2PYLA 2YG0A 4O4JB 1MS3A 2FCUA 2GP5A 4CP9B 4LHNA 3FJSA 2Y6KA 3M8LA 3INAA 1DQ0A 3OM3B 1RFYA 1V0AA 1W9TA 1F4NA 1VRH1 5AC91 5LP6B 1ZBE2 4CCJA 1U12A 4HVOA 5F3EA 2XVKA 4HZ3A 3ASIA 2X5IC 2Q8DA 4WM7B 1XJAA 1E57A 1W2OA 3HQRA 5B3SC 1WLCA 1IX9A 2HVJC 3E5UA 3K5LA 1KS5A 2UY8A 2HR3A 1IVSA 3ZS8C 4AGRA 1HQNA 3GBGA 1H8VA 2YFUA 5IT9N 3S0MA 1Y67A 1JOYA 2YC2A 3K48A 4JI7B 4MG2A 4R7CA 2XXZA 4B1MA 3RG0A 4BW5A 1NYWA 2CGNA 3H8XA 1UJWB 5JOXA 5FYMA 4IEYA 1NKGA 1EV13 3PU8A 5A6YA 3NRUA 3VHPA 2ZD9A 3IIIA 5LWBA 4N9HA 3F5WC 3JU9A 1ENVA 3JARB 2ZM6B 1SF9A 1PL0A 2WWWA 4XOGA 4JRLA 5FYSA 3VBOB 4HONA 3K06A 1EV12 5FZBA 5LK5A 2D6PA 5J36A 1X8EA 2YROA 3ZXAC 1BSMA 1URXA 2AREA 3KGLA 1TME3 5DECA 1W6OA 5K0UC 4CZSA 1JJ2U 2VH9A 4PQQA 2GV9A 1DCSA 1A6CA 2HHHB 1DK1A 3VD5A 5CA6A 4LBEC 1XUQA 4YSFA 1UZWA 3B09A 4Y33A 1JOBA 2IFWA 4TSVA 4J10A 5KLVH 3I59A 3RQ0A 1P4RA 1UO9A 1EYBA 1JZ3A 1E1QG 2F4LA 2RMU1 3CJIB 3SEPA 3WP6A 5D8AB 1BEV3 4PDWA 1TNFA 2BGCA 4AOCA 3HWJA 1XL4A 1J58A 3EO6A 3E8GA 4CCKA 4PA6A 4KHPB 2A1XA 3VBFA 3VHOA 1K5MC 5LMUB 3JALA 1VBE1 3ZFFC 5DAWA 4WVMA 3BN6A 1RUD1 1R6NA 1FPN1 3GXUA 1CQ9A 2IFRA 4Y20B 4E4HA 4AI8A 1XNTA 2ZMLA 3WHTA 5JIAA 3HKBA 1S0VA 1K4CC 3OBAA 2FDFA 1OPMA 4JDNA 1ASJ1 3W59A 1UL9A 1NCQB 4BAYA 4L8JA 4D6SA 3VBSB 2JWPA 1UMZA 2Y38A 4ZOLB 3S7IA 3MF9A 1JR9A 3ICXA 4E2SA 3UNPA 3WF2A 5EZYA 4OI2A 2A0LA 1DF5A 3WU2Z 1QR9A 2PAMA 1IBLO 5FZFA 2UU9B 4Q0PA 4Q4Y3 5A3TA 4GMP1 4G3YC 1DYOA 2VULA 4WBNB 1W8TA 4XUNA 4N7IA 2JJ1G 4X1YB 4DRRA 3JATB 4JTCB 2W52A 3SYCA 4CE8A 4LUKA 3ZXLA 4KU8A 1VMJA 1O4YA 1QHTA 4YVWC 2B5HA 2WFPA 3KVAA 4LF8O 1WA4A 4OZOA 1DGSA 1N1SA 4HNAB 5CA0B 3WW4A 3AXEA 4ORFA 2VCBA 1AR72 1OQ1A 1OT5A 2IJJA 4MHRA 1KGYA 1KXGA 4CEYA 4DR3B 4GZ9A 2R72A 5T5LA 1X59A 3QTCA 3DSQA 3NL1A 5FO7B 5DUVA 2RR11 4A6SA 5LEJA 4JI8O 2RJZA 2W46A 4Q8LA 5LMNO 1SBFA 4BR6A 2A6ZA 3THPA 4JI6O 1M4UA 3KT4A 2FMLA 1EM1A 3E6DA 5IK5A 4DB5A 3MIDA 4JI1O 4N43B 2OIIA 4FM0A 3WD5A 3QH7A 2G38A 2ZOEB 4CP0A 4H55A 4BE3A 2LP7A 3MHSC 3LGRA 3HKCA 1WCSA 2H0BA 5FL7G 3H3LA 5A6XA 4UWDA 3LOBA 3BKZA 4AGGA 4IEOA 1O4ZA 3WW3A 4E9KA 2EJ7A 4IE4A 4G27B 5FUNA 5A3OA 4MV2A 4IV3A 1R6KA 1COV2 4XDLA 1GR3A 5FYHA 1JZ2A 4GUNA 3GHMA 2EILC 1LOFC 5CB4B 2PI5A 4NRQA 2RDCA 1Y9QA 1NY71 4YJ3A 1DF0A 1XPWA 4HSLA 1QGLA 2G4IA 1X33A 1FXHA 1WW4A 1POV1 4QGNA 1Y9GA 4LBJA 2CAZC 3I8TA 2E5LB 3MEPA 1VBA3 3HBZA 1SQ4A 5L73A 4TV9A 3ZN1A 1DGWX 4L0PA 4ZHNA 1GBGA 4I0AA 3A0HZ 3FE5A 4FFKA 5CG9A 2EXIA 1WCDJ 1Z7S2 2J1EA 4YVSA 3BVCA 4RGGA 4OI0A 2Y6HA 4ISRA 3HNBM 4P9LA 2QQLA 1AX0A 2XVLA 2K46A 4EYUA 4FQ4A 3POSA 4GYCB 1NTKH 4GB32 2ZINA 4ASMB 4QPIB 2K1EA 2HEYF 3B9IA 3PVNA 3K9SA 1S0FA 2ZHKA 1K3EA 2ZR3A 4LP8A 4BW9A 1Q8VA 5C9AB 2XAHA 1BJQA 2WLHA 2W6JG 3KV4A 2QDRA 4QJFB 4CDQB 2AZ2A 3T2PA 1O4TA 3JCIA 4MHUA 4CDWB 1XHZA 5I8SA 4SLIA 5IJRA 2VNOA 1XNQB 4LK7A 3HD8B 4QU1A 3NAPB 2D3PA 3QOPA 2DYSC 1HN1A 4CEWC 4JGYA 4NHXA 3UT5B 2W1SA 2UUAO 5EFUA 2ZR2A 4XZUG 4NAMA 2RMKB 1PV0A 1AR73 4FOQA 4J80A 1V6MA 1PO23 4EWEA 2CDOA 1HV0A 5C7GA 1JYTA 5EZYB 4B3TB 4XJUA 1Z2GA 1ULPA 2YBPA 1YI7A 3QBQA 4Q0SA 3VDCA 3GWOA 2BQPA 1GO3F 2VC9A 1YI2V 1LHUA 4AVCA 1G8WA 4Q29A 2BE3A 5H9QA 1R64A 3ASNC 3MLLA 1KS4A 3LFIA 1O5UA 4EZHA 5ACA3 2XAGA 4QPIC 3WP5A 4I55B 1I08A 2BFUS 4AQ6A 3B3QE 2JDIG 2HWC2 2VBBA 5B66Z 3B93A 5EC1C 1SCRA 1YRZA 2ZE8A 2E76B 1CONA 4UCRA 1MMMA 1GQGA 1Q82W 5CBGA 1PO12 3WDVA 5BY1A 2JB8A 4GAZA 4CYDA 5ACA2 4CDXC 1KP3A 2JIZG 2G9FA 1TAEA 3RYCA 3S5QA 1W8OA 1UX7A 2RR13 4LITA 3GALA 1YITV 4HKWA 5FV3A 4A3ZA 3KZIZ 2ZX0A 3JD3A 1RSOA 1R092 3W5NA 3ILRA 1T6BX 3ZMUA 4K3UA 1SLIA 4OHXA 1N32O 1ZBE1 3L75H 3ZO0B 5H9CA 3N9LA 3RZJA 4ARXA 2GMPA 3K5NA 3KM5A 4NRPA 4DXWA 3WG7C 5FFOC 4BLIA 4YJ2B 1HB3A 5LASA 4YLZA 1W59A 1EV11 4O4LB 1S2KA 4FPKA 2YC4A 3QH6A 5C8CA 5HCBA 4UFKA 2GNMA 2P3KA 3VHNA 1DLBA 1G9DA 4MTGA 4RUFA 2F17A 3VD4A 2ZTNA 4NR1A 2Q8OA 5LGNA 5TSWA 1Z0HA 2ZE6A 2R042 4R4XA 2D44A 1JH5A 4AFAA 2Z5UA 3I55V 3M2MA 4OMDA 2QM8A 4JI2O 4FAGA 5E1AC 3AP9A 3FX7A 1SEFA 5L3CA 3NO8A 3I56V 2VTXA 3OGSA 5IVYA 3WUDA 3NJVA 3JYCA 2KQXA 1HNZO 1X9PA 5KR7A 3JQWA 4M3CA 4Y1UA 1SLLA 4G9SB 1W0JG 4JDMA 3K5MA 4CBCA 5FBZA 4UW4A 4AVTA 2J1TA 2BOCC 1YNAA 3KV6A 4DR2B 1ZSPA 5T5JA 1BBT3 2D2CB 3AMPA 3MPPG 1XHXA 4YG0A 5D5PA 3FYEB 4FBFA 1KQRA 2HP8A 2W1QA 5F6LB 2B7YA 2ZIOA 3IPVB 2W5FA 2AH2A 4IT5A 5H9PA 4QKBA 4FPOB 2VMHA 2EZOA 3GJBA 3U11A 4A7KA 1GOGA 4DY5A 5A1LA 1K92A 1F9KA 1YFWA 3ZVXA 2QJ1A 4UT5A 5AVAA 1R1A2 4DV4B 1F4HA 1VQ5V 4OLLA 1RUH2 4ZXEA 4DXTA 5JWPA 1GLHA 2JD9A 4CDQA 5F3GA 1UZ0A 4XDKA 1BZWA 1R3IC 1AL0G 1D4VB 2WNVC 4BXSV 1Q8IA 5BY5A 3TNQA 1LHNA 3SPGA 4YWAA 4LHSA 3SPJA 3CKHA 3J8F3 3X2QC 1NS1A 4DV6B 3VUOA 1QH6A 1OH3A 2Y69B 4B3SO 2CH7A 1OQEA 5DDJ1 4B4RA 4XJ8A 4X8NA 1KDKA 4N53A 1WAZA 2VZRA 5FPBA 5BNPA 3LDCA 1FXZA 1C1LA 2A7WA 1YCIA 4Q2FA 4BIZA 1JODA 3RZGA 4WFEA 4PA9A 3X29B 4WFHA 1BVP1 2Q30A 2VWKA 2J1VA 5IFTA 5ACA1 1VBA2 2JDKA 3H9VA 4UW3A 1POQA 4UCSA 1W6OB 3HJRA 2B42B 5FMDA 4X1IB 2VTXJ 4BWOA 4I55A 1RB8G 4DK0A 3OMAB 2K2SA 1WA8B 2JS3A 3TOJA 4AHCA 1H8EG 1MQTB 2I2SA 4M3CB 5EC2C 5L7OA 4Q4W3 4OYUA 3UKNA 2XTAA 2VMEA 2YFZA 2IXLA 2XVGA 4COVA 2QWNB 4XQ4A 2D3RA 4QU2A 3AK2A 2DURA 2CU5A 4ES8A 3L74H 4YNIA 5JSOA 2WNUC 4LA3A 1CIWA 4XUPA 1ACCA 5GZCA 2TNFA 5KC5A 2E5LO 1NA1A 2QTWB 4K6BA 4FVMA 4XFAA 4YIPA 1HR0B 5A7PA 4JI7O 5ABJB 5AVPA 1RXGA 2SLIA 2WS91 3ORJA 1OA3A 4QHZA 2Z4FA 2P90A 2HG5C 3BGAA 1O9HA 5F5IA 4MTOA 4SBVA 3FUOA 3IN9A 4AI0A 1Y76A 4DZGA 4FLVA 5L9BA 2XJVA 1VF6A 4Y5TA 3VZLA 3VBRA 1V9PA 5FZOB 5HXMA 1QR8A 4RQPC 2VG9A 3O0VA 2JEUA 1GSLA 4XDOA 1LEMA 1THZA 1CZSA 1VBB2 1K97A 5AC92 3KZ4C 1YLLA 2ZACA 1MSDA 1POV3 1SCSA 5EP9A 2XWBB 4FFBA 4UFIA 4IEPA 4LBQA 4MGSA 2PLV3 3PTRB 2ET1A 2ZHLA 4M4RA 4OI4A 5JZGA 2VQFB 3WNMA 2WLNA 3KCYA 5FNVB 1QNWA 4QX7A 4O4IB 3E83A 1V55B 2JGUA 3LZZA 1IZ3A 5GW7A 1QOOA 1V70A 4CCEA 4HNAA 5CA0A 4XE9A 3BVOA 5GKAC 2WT1A 3GVMA 1GK9A 3TNPB 5D8AA 1W6MB 1HNZB 1LULA 1AR1B 1RMU1 1E79G 4LA2A 5LB6A 1H1IA 4KHPO 3E8BA 2WAOA 4UBHA 2DOSA 3ZFFB 3J7MA 2JDYA 4RS5A 1M5IA 4S2FA 3ZSKA 1W8ZA 2BGPA 4B4PA 4QPKA 2KSDA 4URAA 1QJY2 3M70A 4P9WA 4IIJA 2M6YA 1H30A 1VIWB 5GLWA 2VMDA 1H6XA 1XOYA 2PHDA 2RHPA 2OW4A 1H2KA 3CCVV 4DR7B 2ZGMA 5FYCA 4UAPA 3P30A 2ZGSA 1Z78A 3VB9A 2CHHA 1U5XA 3OYWB 3ZEDA 4OPAA 2ZGLA 1OFSA 3HQUA 4W4LA 4XFCA 1FXKB 4LUMA 2HWE2 5A33B 3K51A 4MTFA 1MEC2 4A5UB 3FMGA 3AB0A 1WLTA 3NKGA 1YUDA 3R05A 4Q0UA 2CUGA 1Q8QA 2W3JA 4I01A 5FPUA 1OHFA 4PLOA 3CYOA 2ZX4A 2WNUB 3ZBHA 1N3PA 5JVDA 2D6MA 3Q8FA 3ASNB 3DXRA 3Q4HA 1PIV1 2R7EB 2MW2B 1QJZA 5JR7B 1RUI2 4R6ZA 3ABMB 2XAJA 1YIFA 5DZFA 2RM23 4GJZA 3POJA 3C7GA 5I91A 3AJZA 1XSRA 3WP4A 3C7OA 2BTQB 2XT9A 3N7LA 1BCCH 3VZMA 2OCHA 4Y4YA 3F5TA 5CADA 3ZRWB 1RXFA 5CKQA 2FDGA 1D4M2 2Q6AA 2XHBA 2ZT9B 2VQTA 2GU9A 1HRV1 5FZ8A 1ZBA3 5EQUA 1L8DA 4R9DA 5FZGA 3U75A 5CNAA 3RNSA 1XNQO 2Y69C 2Q7GA 4GH4C 1OURA 2E7AA 5C5TA 2B5UA 1G4YB 3RYIB 1N36O 1SQFA 4JGYB 3K4ZA 1Z5VA 2JS5A 3O7OA 3NWKA 1W05A 4MUVA 1UU6A 4UVBA 1CX1A 2ZDIC 2QQJA 2DVBA 3O65A 4QIWF 1NVPB 3SDLA 1SLAA 4GX1A 4I9QA 4AZZA 4JV4A 3WOGA 5D2AA 3VGIA 3QO5A 4WVZA 5FYTA 4A42A 3GHNA 1Q8OA 3C2UA 3SQOA 3MIBA 4KGGA 5L9VA 2ZX1A 1RUNA 4EZ4A 3ZYIB 2J7MA 3RI9A 2F95B 1GWMA 1YJKA 2ORZA 4K7JA 5FYUA 4O7XA 4CCMA 3M3CA 5T55A 3B9CA 2Y34A 4NIAA 2WNVA 3M7AA 2WLLB 3ST7A 4FPEA 2OVUA 5FNVA 3CCSV 4MO3M 3IDEA 2XBO3 2EILB 3WG4A 1PD3A 3WZ1A 5K1PA 4IE7A 1LNSA 4QXHA 2B1IA 5ABJA 3AP6A 4XIOA 2ZNIA 3H3ZA 1NR7A 1W0OA 4DUZB 4GALA 3POYA 1R1A1 1PNKA 5GLTA 1JOPA 1ND2C 3H8OA 3C3TA 1D2QA 2BJSA 4J11A 2JXAA 2OX0A 2AC1A 2XAFA 1OVPA 4MVZA 4XHXA 1AI7A 1AR63 1XNDA 4TOIA 3FYIB 3H1HH 3BOPA 2Y6LA 5KHIA 3HPNA 4HPKB 4S2DA 1OCCC 1WD3A 1XDCA 4GMP3 1UF2C 3T1HB 1UYXA 2CAUA 2HWE3 4Y1VA 2VQEO 2GAUA 4V2WA 2VZUA 4BDVB 5A1FA 3SPCA 1LECA 2GH2A 3U4SA 5LRRA 1UNBA 3HNYM 4HN1A 2DN9A 1N1TA 1KQSU 1AJQA 2IJIA 3T2QA 3IJ4A 1W28A 1O3TA 5IVVA 3GCWA 1RUJ2 1A8MA 2QDOA 3OPTA 4TQDA 5DG2A 1OKQA 4FLYA 2D6OX 2JG9A 3J4UH 5HPOA 2G19A 4JZRA 1LGCA 3RYIA 3NJYA 2PYJA 3MLJA 3SYQA 4CZZA 4MW8A 4CU6A 4M3CF 3MBWA 4MYEA 1CAUA 2IUWA 2RS53 4HKLA 2ZEYA 4YVWB 1V00A 2UY9A 1E5RA 5J9PC 2DUPA 4DINB 3PJYA 4DOUA 2CTWA 4JI0O 4F3JA 4J25A 2R32A 4A44A 1E5SA 5FO9B 1FT9A 1QVFU 4HMZA 3RPQA 1UU4A 5SV5A 4CCCA 2A5ZA 4D6RA 3DGEA 3ZR5A 1DYKA 4HVRA 2Y4UA 2RQ6A 1D2SA 1R3LC 4BHPA 5KXEA 4IEXA 4AVVA 1F8VA 3WB1A 3V65A 1BXHA 5IUQA 4X64O 4ZKIA 2KD7A 2YICA 3E97A 1T2XA 4YG3A 5IE9A 3ITQA 4UI9L 2ID4A 4UW5A 2ZPXA 3ES4A 1GKBA 2HYKA 2VZSA 1Y3TA 1IQDC 1KJRA 1KD7A 3KWVA 3ZX7A 3F95A 2YUAA 1DTOA 1MG1A 5IDJA 4DV1B 2FMDA 5A6QA 2RS31 1QIQA 3WB2A 4I2OA 1K5SA 1NKDA 1MZEA 2R6QA 4NRMA 5F39A 4M00A 3HKDB 4ZI7A 4HBNA 5FQ0B 3E6BA 3LEGA 1W03A 1AUYA 5IYDO 3CJIC 4IV1A 2IZWA 2DYSB 2IXIA 2QQWA 5EYXA 2QTOA 2HBTA 1U97A 4UFLA 2WKKA 1S72V 3PMSA 1XMOO 1XREA 4NIIA 3DN7A 3I4IA 1CAWA 2VD7A 4XAAA 2HHHO 1UKGA 4K8ZA 1OHHG 1IXBA 5K7PA 2OT7A 1FKAO 3JAKB 3RDIA 1AVBA 5FY1A 3BTYA 2QKAA 5A7WB 3LSDA 4HG6B 4AF9A 4BQXA 3ZXDA 1QBZA 5DG1A 5ABJC 5DPNA 2V72A 4EROA 5KMGA 1AVMA 4QB1A 1QWRA 1RMU3 4CTEA 4P2ZA 3VKOA 1XYNA 2XLAA 3JZVA 1S76D 5AG2A 1SFNA 4IEUA 2XJUA 5ITZB 4ITCA 3GNEA 3W7TA 2OYQA 4ASKA 4CDUC 4YPJA 4DIQA 5A80A 4J9ZB 3DKWA 3I3MA 2V73A 2LGQA 1W8WA 1ULCA 2ETNA 3RW0A 5G04L 2ZX3A 1NR1A 4N43A 3N2GB 5IAXA 1POV0 5FXVA 1O5LA 3N7JA 1KFXL 3PNAA 5BUVA 4RWUA 2VNVA 4AHXA 2P37A 1Q43A 4R8HA 2J1AA 2WT0A 1W99A 1PGL1 1AXKA 1VBE2 2JDAA 2UXXA 4NJ4A 3BU0A 4KNCA 1IBLB 2UU9O 3GZUC 4YFZA 3H0OA 3HMYA 3CF6E 5JXJA 1V6OA 1CZTA 3WXPA 1LU1A 2VJXA 3USUB 4XHBA 4Y5Z0 1L7QA 1I5YA 2CAVA 2YDEA 1OLQA 2R16A 1URFA 3I49A 3SYPA 1DZTA 5LYJA 2DVFA 1OKOA 5DAQA 1V6JA 3DTUB 2QQUA 2HWB2 4LWSB 2VZPA 5FP3A 3ALQA 1IHMA 3T2OA 4TV8A 2EULA 2VQFO 5FMBA 4CXXA 1C8NA 2AYHA 4M3CE 2WLMA 3EQEA 4PDWC 3TEXA 3I2JA 1EFRG 2W1UA 4KWLA 1RUJ1 4X88A 2BTVC 1BVVA 2PHFA 1XE7A 4I3PA 1NXD1 4FLZA 2HBUA 2V4VA 4LHLA 3ME2A 2Q1FA 2Y6FA 4QX1A 2X0LA 4R9BA 2KG7B 4I02A 3OMIB 4MX3A 2PUSA 5CFDB 4V1PA 4GB33 4QDQA 1GH6A 3NV2A 3O1UA 5FY5A 2OTJV 2BYVE 2FD8A 1ND3C 1T5EA 3ES1A 3UJQA 3UKVA 1NQJA 5IYZB 1H4HA 2BNNA 2JG9C 3DPRA 3PUQA 4IV3C 4CH6A 5T3NA 4JGSA 4CDWA 4Z1VA 1QY4A 4XFIA 1RUG3 3W7UA 1WZXA 3FZ3A 4LO6B 1LHOA 3ZN5A 1R081 2DQ0A 1AR82 4PDRA 1H8TA 2UXBO 5IVJA 5E88A 1UQXA 5GLZA 5LATA 2Y8KA 4GXLA 4Z2WA 2F4PA 1QJX3 3WT3A 5CMUA 4QX3A 1XXNA 4CCNA 4BWAA 2EIMC 4QPGB 5BMVA 1VF5B 4XJ9A 3ZXJA 1RVF3 1OMIA 3HEIA 3AYEA 1YQ5A 1L1FA 2BEOA 2JE7A 1ODMA 3CBNA 2L35A 5IY5C 1QDCA 3RI8A 4ARYA 3O1VA 3BA9A 2MPFA 5JZGB 5FR3A 1GP6A 2QQNA 3O12A 4K9SA 4WVWA 4JX0A 1U5YA 3U10A 3P6BA 2HWD1 1YWKA 3N35A 5CG8A 1RVF2 2QR4A 2ZGTA 4QB2A 3D36A 3ZPOA 4LBKA 3EMRA 1W8HA 5LBEA 1IBMB 5C3PA 1KDMA 4QX2A 4UFJA 2O0OA 4IE5A 3GBWA 5L9RA 2IW5A 3IB3A 1TEIA 5JSPA 4Y26A 2EVXA 4Y5SA 2BOIA 5EHDA 1W39A 3AXDA 2XASA 2QVSB 2AZ5A 2WN3A 4JQTA 3M4FA 4IDZA 1RSOB 5EPAA 3QO7A 4DRVA 4YM3A 4MW3A 1J95A 2RR12 1NTMH 4IETA 1W90A 4X6RB 4AQ2A 5EYPA 5E79Z 3ZHSA 1F31A 5FPZA 1NXMA 5TISZ 5A2QN 3UT0A 3OGCC 3RJ2X 2UUAB 1VBB1 2OZJA 3ZYHA 1IPKA 2OPKA 1U5IA 2VOTA 1VQKV 5CKMA 4WFFA 3H1LH 4GKKO 5FJHA 1K45A 2WLKA 1KP2A 3PN1A 2QWRB 5LGUA 3O1OA 4EV0A 5L36A 3ZIAG 4O4JA 3WVJA 4XXPA 1S5HC 3CRAA 1VB2A 3K57A 1BT8A 1M90W 3JUUA 5J2TA 4DR5B 2QE7G 4F83A 4NOTA 1D0GA 1A8DA 3VBFC 2V4AA 1LOGA 2GC0A 2Y6JA 5IHRA 2WUHA 5ERLA 2Z3YA 3KCXA 1VAVA 1JYXA 1DGLA 5ITZA 3UM7A 4FK5C 5CAZA 1LOCA 2PLV1 5C4WC 2UUCB 1HIXA 4OHVA 4N9IA 3LAGA 1SMVA 4A7ZA 1W8UA 3AMHA 3RYCB 5BPXA 4Q4Y2 2R071 4E8CA 3T4HB 4GJYA 1O3RA 3RS6A 5L7OC 5K0UA 2WAMA 3WV6A 5F7UA 2D5HA 5M0TA 3HOBA 1RTVA 3CNAA 3N7KA 2CL2A 2OPWA 1PNGA 2XH6A 1RUD2 3WY6A 2QJVA 3I3DA 2A6VA 2UUBO 2NNUA 1HX6A 1BQPA 5CIRA 1DLCA 1VBA1 2ZBJA 2W92A 1QVGU 2WYSA 3HKBB 4P00B 2D98A 4YZ3A 4EN6B 2QBXA 1RUD3 5FYZA 3WDXA 1YVWA 2E3CA 1UOFA 1NCRB 4P9IA 1RYYA 1HNWB 1YFUA 2HWB1 5FUIA 2JG8B 1S1AA 5J37A 1BS3A 4FPJA 4NWWA 3MHZA 1WJZA 2VQEB 2R70A 2VZ1A 3MV01 1P7BA 1JI6A 3CEWA 4H44B 4RGKA 1MS4A 3B7MA 1XU2A 3HBKA 1US2A 2AGAA 1COV3 2VZOA 4EJRA 1ENSA 1AYN2 4MSVA 3PJSK 2QA4V 2R0FA 1O59A 1CESA 4XF1A 3A22A 4AHZA 3AVRA 3AL6A 1FFXA 2K9PA 3CJIA 4IV1C 4PIXA 4BA6A 3T4DA 4PBOA 3CRCA 1UMHA 1AR71 4QHOA 2FKXA 5I0UA 1LHWA 3AP7A 5A6ZA 1UYYA 4FOYA 4CP2A 2Q67A 3D0JA 4X65O 4ZONA 1VBC3 4XJAA 4AQYO 1OOPC 1GQPA 2PA7A 4FXKB 3H1YA 3RGBA 2OYZA 3UETA 3WDWA 4IGOA 4FTEA 2VR4A 1ULDA 2GNTA 1CVNA 3NNGA 4P9PA 4KU7A 2AEZA 1H8TB 4PELA 1VQ9V 3TEZA 3OJBA 3R66A 3T0BA 3POBA 2FDIA 5EJ1B 4P9GA 2C9AA 5KUKA 3QLQA 3PL0A 1N1VA 2E6VA 4QGLA 4RQPA 2RE9A 4B29A 1W6QA 4LFCB 4YM2A 4W8JA 4K0KB 3ML0A 3AG3C 5C6CA 1AR83 3NVCA 4AGVA 4NTYA 4IV3B 3BTZA 2F1MA 3ABMC 1JZ4A 2UXCB 1MZFA 1HRV2 3A0NA 3A21A 4K3AA 3VQXA 2HEPA 3AZYA 5FZCA 3T1HO 2ADEA 3JXSA 4K8XA 1BMV2 5IWAB 4MVOA 2F93B 3ZSEA 2EA7A 5FYVA 4XJZA 2PTMA 5LA0A 1NZCA 3J80N 3FHQA 2W9XA 3IT8A 3CCEV 4GKKB 3HT1A 3MI8A 1RPRA 4DFSA 4EKWA 5F8PA 1XBFA 3CL1A 2VMGA 1H1MA 3H50A 4YVSB 2OQ7A 2ARCA 3U4XA 2DBNA 2VMIA 3AYCA 5DEDA 2ZXQA 4NYKA 4C0HA 3VDAA 1B3QA 1ZNPA 4DUVA 5I0RA 4XEZA 4UCTA 3VZNA 2GDSA 5JR2A 1OF4A 2AHZA 3APQA 5BR8O 4B7KA 2VMCA 1IDSA 4HK9A 4WBBA 4GB31 1WBLA 3BYWA 1FJGB 2NQYA 5JJJB 4B4QA 1DYPA 4S2HA 3JAMN 5LHGA 3CCLV 2A3QA 5FRAA 3JSNA 2BVVA 1HR0O 2RN9A 2JVDA 2HEVF 1OOPB 2C6SA 3ZJZA 5LCWL 5FMOS 4CPBD 4XFFA 2UWBA 1K8AW 1UOGA 2PELA 1WB7A 5J2TB 1YTFD 5IY5B 2VECA 4NHMA 4PA3A 2Q4PA 2W68A 1KU9A 1XNKA 2LRPA 2X5IA 2HKXA 5FZOA 5L3GA 4FM1A 2OA2A 5D8AC 3SH3A 5IYCO 4XDPA 5BNOB 4CEWB 1QNYA 2BTOA 1PGW1 5CA3A 3OGGA 2ZAHA 1JQ0A 1COV1 4GWIA 3V0AA 2FCVA 4CA9A 1N34B 4CDUB 3F7YC 4CU9A 1ULOA 4OHWA 4M0NA 1FXKA 2BPA2 3NQHA 2HWD2 2ZMKA 5HCAA 4B3MB 1GANA 4FPFA 3C8XA 4NHKA 1JBCA 3UGGA 1RUC3 2Q1MA 1CAWB 4A6OA 3ASOC 1H6YA 3V0BB 2GMMA 1FFXB 2OUJA 3STZC 5LBBA 3EFFK 4Q6GA 4DO2A 4DW0A 5F2SA 1KC8W 1N3QA 5CFCC 2QGNA 1J59A 3BPZA 5I0TA 2MEV1 1BQZA 3SKJE 5IAVA 1ZA7A 3M1HA 2W1WA 4AHWA 4IUGA 1JZ8A 1H4GA 1MPXA 5EIYB 5I0SA 4RFT0 4YW3A 4KP4A 4LMFA 1NLRA 1JYNA 3VOUA 1FAYA 3FAVB 3H1KH 1ZZCA 3QF7A 3ZMZA 4JASA 4FXGB 4UXAA 2WWUA 3AG3B 3AG1B 3BB6A 1MZ5A 4JGZA 1PPJH 4LFAB 5JIUA 4DV0O 4P9YA 2WINB 1GTOA 2XG3A 2W0XA 1VMHA 5B4NA 3AMMA 2BUKA 4P5HA 5A3LA 2LW7A 2I74A 3BCCH 2IVIB 4QAWA 3MLKA 1W6QB 3AFKA 2LQTA 3JASB 3IMNA 4WM7C 2ERFA 3VBHC 1LR1A 1D4M3 3Q8CA 4XIKA 4C0BA 2BW8A 3EYPA 2QE3A 3TB0A 2UUBB 1AL22 5DQ0A 4Q4V3 2NMOA 3PTYA 4DXZA 1ONAA 4F6RB 3SJBC 5F32A 3E8HA 3AG1C 4AFMA 2OKXA 1GKFA 1K34A 5KUMA 2WA3A 2E63A 5FZ9A 4NAOA 2IH3C 1GWKA 1VQPV 4DRXB 1AXZA 3OUJA 1TME1 5B1BC 3KQ4B 2X53S 4PQ9A 2RG4A 1T6GC 4NIDA 3HN1A 4RSUA 3WEZA 1AYM2 1Y66A 4JI6B 5KA5A 3J9SA 3UESA 4Y22A 1HV1A 3ZN0A 2XQRA 1QXJA 1LB2A 1PMHX 2QNKA 1XMOB 3TEYA 3CE2A 4QXKA 1VQ4V 4XETA 3B5LB 2AR6A 1BEV1 4GKXA 3N9PA 3EB7A 5AFEA 4LE4A 2LM3A 3OEBA 4I50B 3H8UA 1DQ6A 2IH1C 1NT0A 1RVF1 2YV8A 1R091 1REFA 1V6IA 2ADQB 3W20A 4J7KA 1HW7A 2VO5A 2YU1A 3D6EA 3N36A 3M99B 2ZGUA 3ZKYA 2QM7A 1F4MA 5BNOC 2Q0AA 1OOPA 5FXXA 4ZZ8A 4R50A 1EN6A 3LOIA 3FKSG 1RUI3 5L3EA 4LNVA 3O1MA 3BY6A 2YGMA 1BK1A 1OV9A 2VY0A 4GKJB 2EIKB 2UXBB 2AENA 1R1BA 3USSA 4HSJA 2B45X 3FHAA 4HYOA 4MVRA 4J6GA 1AYM1 3LNMB 1K12A 2VVEA 1LTEA 2IC1A 4ZXKA 1TVKA 4COYA 4WBNA 1UPSA 4A2UA 3DYPA 2P2KA 1PM4A 3JATA 5F9TA 1HJGA 4UV8A 4LF7O 4O65A 2JGDA 5LOVA 4F6RA 4E4ZA 3FUQA 1FNZA 5BNNC 3CSXA 1VBD3 2WZR3 4YG6A 4D7TA 2L9LA 2V4DA 4DR4O 1QJEA 3GB7C 4RA0A 1WD4A 1X8MA 1N0NA 3POGA 1IBMO 3AZZA 2BNOA 1UY2A 2ZM6O 2G9GA 3C3VA 1IKQA 2WZR2 2SBAA 3T2MA 3E89A 2ETEA 3CS5A 3A0KA 3RT3C 2G9ZA 1WPBA 1VJ2A 3BEHA 1S0BA 2MHFA 1AILA 4ATFA 4WM8C 2EX3A 5CISA 2Q9LA 5DUUA 2GMEA 4B3TO 4KG8A 1UZVA 4YW6A 3E35A 4UCOA 4W4ZA 1OQDA 3MHHC 4FP2A 2A6XA 1GQHA 2RNBA 4D3WA 3JCUZ 3OBTA 4O61A 4S2GA 4L11A 2W94A 2I07B 2QDNA 2C1FA 2ET7A 1BK0A 4U7OA 2Y26A 3AK0A 5C33A 1MEC1 3KF3A 4QDRA 5CB4A 2PAEA 2EIEA 2X6AA 2ZGPA 4MADA 2PHTA 3BODA 3V0BA 4LF9B 1BHBA 4U36A 4CPBA 2YZ4A 2OCCC 4MLOA 5FZ6A 3C90A 4YRDA 1UPGA 5A1AA 3OPWA 1J1LA 1GZWB 3UJOA 2VM9A 4HFSA 2LW8A 3P32A 4ASUG 3RYHA 1HNXO 4A3XA 1IURA 2LGWA 1AR62 2DVAA 3PVBB 4QKNA 3H8RA 4OMCA 1HJFA 5HCFA 4C1XA 1S2BA 2Q0OC 1TVKB 1ZZ9A 1JZ7A 2XJSA 1N32B 2XGXA 4NXMO 2XDVA 3HIFA 5H9SA 3EXAA 1B04A 3V56A 1W9WA 4OHYA 4JGZB 2WBKA 1XOUA 1N33B 4NWVA 5K0UB 1M56C 1GM8A 5CB7A 3A2FA 1V54C 4OULA 3JBG1 1RPOA 1RMU2 4B3MO 2P22C 1RHI2 5D21A 4AI2A 4MGKE 3AG7A 3LA3A 2CTRA 1GZCA 4TWTA 3NAPA 2YMZA 3K58A 1O91A 1IPJA 3RZHA 1ASJ3 5EJZB 5F5QA 2ZCWA 3WQ0A 1QNMA 1LESA 4P14A 3WCRA 3ZPYA 4PA4A 1XMQO 5FY0A 1EN5A 4EN0A 1GNZA 2PHXA 2ILMA 4RQPB 1M9NA 2WWSA 4BK5A 2PXJA 2UWCA 4X1KB 4UCVA 1R1A3 3P3NA 3LFMA 3FLTA 4BMEA 1YQ8A 2WLPA 1MVEA 1ENQA 3N3HA 2ARAA 1G7YA 3DXTA 3I3BA 3OD0A 4CU8A 4LLFA 1NLQA 4WCEV 4CS2A 2Y64A 3O1RA 4DV0B 4DEQA 5IYYA 1G6UA 2OTLV 2GSMB 1K5MA 5JVDB 2WYFA 1CJPA 4KGQA 2BV4A 3VZJA 4WZCA 3EVKA 1HW5A 2WZR1 4ZU7A 4JRAA 3RYFB 1WMFA 1V55C 5LP6C 2WSVA 2IVJA 4AQTA 3S3WA 1EUUA 5BNNB 3VDDB 1BQ0A 3LQCA 1OSGA 1BMV1 2C9KA 3KG2A 2WRAA 2YS8A 3D3IA 4XTPA 1P7GA 1NH2B 4OQ8A 3TBDA 1LRHA 5F2WA 4R9CA 5IWFA 3FFZA 5BR8B 1D4M1 4C91A 1ZRDA 1PVXA 1EZJA 4JYBA 1K3IA 4NXNO 4HANA 2ZDIA 4NHLA 1WW5A 1QJY1 2CV6A 4IYHA 2V5YA 3JD72 4XVHA 3PHMA 3OYWA 1R1ZA 2Q8EA 4K0KO 1RUE3 2VZ3A 5APAA 3K04A 2YGLA 4OPHA 3I54A 2OS2A 1FXKC 3QACA 1MEC3 2JGDB 2JIGA 4MOAA 3GCXA 5KBFA 2QWPB 4LKSA 1YTFB 3PJQA 1CJDA 3JARA 5BNOA 1F51A 3TN93 4RR3C 1JN2P 1QJU2 3I3EA 1RUE2 1V6KA 3MFAA 4QPJA 2A73B 2BCCH 5FAXA 1BCXA 1KJLA 4CH3A 2MNGA 2O8QA 4OX9B 5JMOA 4O2AA 1MS1A 5FZ3A 4BJ0A 2NN4A 1G9BA 3BCWA 4BQWA 1O9GA 3BU7A 4IE6A 3J7HA 5J1XA 1W8FA 1NT2B 3RYPA 1S3JA 2EIKC 2P5BA 3CEIA 4JV5O 2OWOA 2IXCA 5DDJ2 4ZHQB 3RYFA 3ZRWA 4RFRB 4IGGA 3LPFA 4AEMA 4XACA 1MSWD 3VKMA 5FP9A 1FJGO 2WZPP 5L7OB 5CZKA 2CDYA 2IU3A 1DQ4A 2IU0A 3THCA 4K40A 4QHBA 1SC5B 4DMIA 5DDJ3 5JUVA 1FOD2 3KF5A 4OVEA 4ZU5A 4LBOA 1ZWIC 3AG4B 4BYYA 2H6CA 2XWJB 1I5XA 2Q68A 5FZ0A 1DGRN 1TUBB 5H6RA 4ES9A 2D6KA 1J1TA 2WPDG 4DV2B 2EIBA 3R6SA 2RCVA 2XB6C 4XURA 5BNPB 5H9RA 3N7MA 4I30A 1Q6UA 1HB1A 2JG9B 4XDQA 4DR1B 2DE0X 2LALA 2WIIB 1ENRA 2NR5A 4TUYB 2JJ6A 4X1YA 5CFCA 3NMBA 1LUVA 2VMFA 2UXCO 1SZBA 4U3FH 4JTOA 1KKDA 5FY7A 5JOYA 2RDQA 2CK3G 1CAXB 1PGL2 1A32A 3ZYJB 2VRZA 4K1YA 1KECA 3J8F1 1Q8PA 3OF1A 1VP7A 1XRUA 5LBCA 1FYJA 1C8M1 3AJYA 2JECA 5IK8A 2W08A 3K9AA 4Q26A 3E2EA 3VDDA 1M57B 4P5YA 1Q7YW 2LTNA 3QVNA 1RUG2 2Y33A 3K03A 4BIUA 3BOWA 3TRSB 4Q4V1 1WMXA 2JRIA 3F2ZA 2ZKLA 4E4SA 1PGSA 3ETPA 1JS9A 3KHBA 4CS3A 3WB0A 1Q81W 1NQTA 5HV4A 5T54A 4IEVA 4ASLA 1NJIW 1Z7S1 3E8FA 1QJU3 1R3JC 4FPLA 1UMIA 4Q4W1 2LUWA 2QSAA 2DU0A 3L2YA 2J22A 2LS6A 5I8YA 5E8AA 1YJLA 2JG8A 2B8MA 2F66C 1F15A 4AEDC 2CYFA 1TME2 3IIAA 3WNOA 5CVRA 1K7DA 1RUE1 3L72H 3JASA 1OCZC 2R9AA 3QD6A 1ND2B 2PGGA 2JEMA 2EIMB 1W0KG 2ZKNA 4YGDA 5B1OA 1FATA 4Y1ZA 3P5BA 4QDSA 3RYKA 2FDKA 2EXJA 4X1IA 4WFAV 4XFGA 4NPLA 2XLGA 4I5SA 2VOVA 3IAPA 1ZBA2 3FB5C 4DUYB 3CWBH 5E1RA 2XJPA 1KBHA 2HLDG 5ANNA 1XNRB 1RUG1 1PGW2 4TUYA 4B1LA 2WLIA 1N34O 3TCUA 1D5AA 2HEWF 3OE7G 2P4KA 3POEA 2F43G 4JHTA 4O9GA 4Y22B 4X62B 1CPNA 3N4MA 4DR4B 3RWRD 2UXDB 2DMXA 3O1PA 4FLXA 5LK7B 4NO4A 1AR5A 2WWJA 3EHBB 1ND3B 1CWPA 4YIOA 2R041 2HH9A 3D3AA 3VL8A 1ULFA 5DXDA 3D36C 2P3YA 4OUEA 5FYIA 3TAYA 1OCZB 3JCZA 1I3HA 4QPIA 1ZX5A 5K1XA 3AMQA 3ZXEA 1ORQC 5FY9A 3LWCA 4OI1A 4U7NA 3VBRB 1LU2A 1AR93 2DYRC 3ZRSA 1S0JA 4OZXA 1H2MA 2K0GA 4DR2O 3TK1A 5J3UA 2PI4A 3ZYFA 4TZDA 2DTYA 2Z79A 3MW3A 1QOSA 5FPOA 5EK0A 1QJFA 3NV4A 2HFEC 3CDZB 3GJAA 3OUSA 4LO8A 3CXHF 2Z42A 4HL0A 1AR92 3RJRA 1PX3A 5JI9A 5A3PA 3TXQA 2E7TA 4GKJO 2C4XA 1RHI3 4JHZA 1KB9F 1ZZ7A 3WNPA 3ZN6B 4NROA 5BXXA 1RUC2 4PLMA 2DCTA 4KBBA 1C5HA 4QNHB 2ITDC 2PF4E 1SQXH 4H3WA 4XF9A 3WP3A 3MIFA 4NN0A 1IG0A 4XBNA 1O8SA 1D2DA 5JJNB 4GT1A 1H2LA 3O0WA 2VXJA 3FB7C 4XQDA 4AHYA 2ZHNA 2G1MA 3WNLA 2DU1A 3SGIA 5FYBA 3GYDA 2W39A 2YBKA 1N8RW 3ABLC 1ZZ8A 2RM21 3G4SV 1Q5OA 2PHRA 2X6BA 1R73A 3B8MA 1DIWA 1VAMA 5A3MA 5E89A 2VXRA 1BHAA 3G80A 5H5NA 1K42A 5IJ0B 1N0JA 1DHKB 4YHHB 4QE9A 3DYMA 2PAKA 2WL1A 5HI0A 2WLJA 2JG8C 5JQGA 3IZOA 1JUHA 5FK7A 2DFBA 5KX5B 5IT6A 5FLXN 2X10A 1A34A 2WSUA 3BRCA 2FBEA 3OGJA 1ZRIA 2VZVA 2EZPA 2DCZA 3OCPA 1NZ6A 5IWAO 4PF5A 3CCUV 3WQ7A 1ZAUA 3TN91 1VIBA 4PV1B 2CNAA 2WO1A 5IVBA 5JPNB 5FREA 4KWKA 3VBSC 3HB3B 3WCSA 1R093 4AVBA 5H2FZ 1IGOA 4XFBA 1GICA 4N53B 4LR4A 4QPGC 3RWKX 3OGIB 4LF9O 4BQ4A 3AL5A 1IBKO 4WV8A 5F6KA 4CCLA 4XMAA 2YY1A 4JQRA 1B09A 1HWYA 2O1QA 1F2NA 1SA0B 4D7SA 3S6PA 1K5MB 1RP3B 4PI2A 2DBIA 2N7GA 3N27A 4C90A 5LW9A 3D0SA 4QXCA 2ZCEA 4G2KA 4BISA 4FZ1A 5FXWA 4Q4W2 2QQMA 1AL21 4CEYC 3VQWA 3WQBA 4F6EA 2P17A 3WINE 4G28B 4GCZA 1SPPB 3CZJA 2ARXA 5E16A 5DAPA 4YZ5A 4M0HA 1N33O 3ROUA 4L99A 1VQOV 2ZZJA 4K20A 1C4RA 2OT5A 1HXS2 4O2BB 4NXMB 3SJCC 3EXUA 4MT8A 4ZS2A 3VZOA 3OR7C 4XTMA 2QQIA 4AFDA 2JICA 1JYWA 3WDYA 5FCCA 1B35C 1ZUQA 1JMKC 1OPOA 1LODA 1AR91 1W6NA 2YB7A 3ELNA 4B08A 1AR61 2V5DA 2WR9A 3FHIB 4Z92B 5J2UB 1LGNA 1SFYA 2YIDA 5LHHA 4KXRA 4I0BA 2WA4A 4JI3O 3K4DA 4D6QA 1ZRCA 1IS3A 4LKEA 4FOWA 1JU3A 5KHJA 3H3UA 5HXVA 1GNYA 3DF0A 3TJTA 3VBUC 2JD4A 5JVVA 3ZYGA 3J81N 5CEHA 5KHGA 3W7WA 3VDDC 2WLLA 3NW4A 1QXRA 2JKXA 1FI2A 3JD1A 3K5OA 3HKDA 4ZI7B 3D4KA 5FQ0A 4DRXA 4HN0A 1DZRA 3L71H 3POFA 1DLLA 3SJQC 1YHQV 3PDQA 2NZ9A 4YZ2A 1EAH1 4E2GA 2DV9A 1OCCB 3ABUA 1MABG 4N43C 1OH4A 4KL1A 3K46A 5B5EZ 4N21A 1OD3A 2OQ6A 4FFHA 3W9AA 5H6QA 3MV11 2AUYA 2R061 2ZS6B 1M57C 3GZAA 1S0EA 2A71A 4JKLA 1UW8A 2FZ2A 3GDBA 3NXSA 4TWKA 1AYN3 4NIGA 1AJNA 4FZ0A 1W6MA 3L9DA 3AKTA 5GLVA 1YZBA 3VBUB 4YGBA 4O4HB 1QU7A 4LCUC 2XNDG 3DPRC 1OCOB 4XUQA 4PBPA 5IJ0A 3AP5A 4BQYA 3AKRA 1PZ8A 3ZN6A 2LW1A 1WGPA 2Q8VA 5JOZA 1M4WA 4IIJB 1W3XA 2J42A 1HRI3 2E74B 5FZKA 1RIRA 1S0DA 4UB8Z 3I2IA 5A9GA 4CRQA 1YHFA 4OGQB 2ZXWB 4YARA 1M93A 2PY5A 1H38A 5FY4A 5KAFZ 4FAHA 1FPOA 2VTFA 1QHDA 3JQXA 2D93A 1GP5A 2D3SA 3MO4A 1VB4A 1U0AA 4ZY9A 2P34A 5G05L 3SHRA 4JTDB 5CA1B 3T1YO 2YEVA 3I2KA 2VUAA 1P49A 3USUA 4MSWC 1DQ5A 4V2VA 1BBT2 3AZXA 4Q0QA 1YJWV 4N90A 2VU9A 3LEIA 1NA1C 3T1CA 4KWUA 1HB2A 2GZWA 4QX5A 3JD0A 5B4XA 3AKPA 3Q4HB 1QQP1 2XPJA 3M3IA 3HNMA 1BHGA 1KD1W 3OSDA 3LB9A 4TV8B 5AC93 3S3XA 2RDSA 3CMAV 4DY3A 3VD9A 2VAUA 3CC7V 5IK4A 5CBHA 2P06A 1W9YA 1XYOA 1VQ8V 2ZGKA 3RWNA 2EXHA 1ASJ2 2YI9A 4HKOA 5LRSA 5D1IA 2WFF2 2FHRA 2J1SA 1WKYA 3FC0A 3ZMVA 3JD4A 1CXZB 2H6BA 1FD9A 1W0PA 1XYPA 3G7DA 4EE2A 1L0NH 4Z2AA 3DKQA 3LUTB 3WW2A 3M3QA 2H94A 2XUMA 4PJYA 4YW1A 1PMIA 5BYNA 4YJ2A 2GALA 4RGAA 2WO3A 5EBLC 1AJKA 1BKZA 2Y6GA 1O7FA 2WSSG 3P3PA 3U78A 4R4ZA 2ZJCA 1G1XB 1NX9A 4DR7O 4XF0A 4MGZE 1Q90D 2HJDA 4TT3G 1U96A 2TEPA 1S0IA 2R072 1ZLZA 5A33A 1E5IA 1GU3A 2QZ3A 2A3YA 1SQVH 3MD0A 4N8MA 1P8JA 3D82A 1K5QA 1EAH2 2VGDA 2RS51 1I7FA 2KA3A 1SPPA 4Q4X1 3DGTA 2RS13 4W65A 1QJY3 3IDAA 4LXLA 2TBVA 1S5LZ 3UGFA 2WNUA 1UY4A 3OTOB 5FKCA 4H7MA 1TMF1 4IL7A 2IBZH 4MVSA 4UF0A 3MZHA 4DS0A 5DN6G 4LOSA 1M1KW 4CP1A 5IYBO 1XSQA 4QGPA 3LKJA 4JI4O 2ZQMA 3OUIA 5C3SA 3L73H 2EXKA 1UAIA 3CCQV 3ABKC 4E27A 3HT2A 1C5IA 3ACHA 5C70A 4BH9A 1NI8A 3ACFA 2CTQA 3IPVA 1DZQA 3D5OA 3ZHTA 2JDUA 2O14A 3MIGA 2E53A 3SCGA 3JB8A 3EHKA 4IW3A 4H0LB 4FPGA 4AEDA 2CY6A 5GLUA 2XONA 2WLQA 1XMQB 2IWGB 4NMIA 1ZX3A 1LOEA 1JU4A 5B1NA 4MXWA 5JDBA 5KWRA 2PHUA 3RRDA 4CUCA 4IGPA 4LC1A 5C93A 1OUXA 1OBNA 3LA2A 2FTKA 3H1JH 2B9VA 1YSCA 3E6CC 1NBMG 2BOBC 1AX2A 4YY3O 1S55A 3NNLA 3LDDA 1EPZA 4UFMA 3ACGA 1HP8A 4GZRB 3ETGA 2A6YA 1MS8A 3N9NA 2GC2A 3G71V 3E1F1 3IKWA 4LE3A 2FDJA 4BLJA 1SETA 4LF6O 2XKPA 1FPN3 2PLV2 2VL4A 4PDLA 2IXJA 1K5JA 1UY3A 4ZZ5A 2NMNA 3DEMA 5HFMA 2BFUL 3N9QA 3SR2C 3N9OA 1F5JA 4DR1O 5K4LA 1VQMV 1PO22 5A7QA 5EWSA 2UYBA 2ZXWC 4IQPA 3LIHA 2WFF3 4URTA 3LNNA 1LOFA 2C26A 4YZ1A 2Y60A 4BZ4A 4LFCO 4CEYB 4PF1A 3WG1A 3MUZ1 2ARHA 1PVC1 1OA2A 4JAUA 4NTXA 2NYYA 4I4TA 3T1YB 1SBDA 5FUPA 2RJKA 1MS5A 5LMNB 1LEDA 4A7YA 1PO13 4LEJA 4GKYA 1WCKA 4EWAA 1VQLV 3PUHA 1V54B 3VZKA 1IPSA 1WCQA 4LKDA 1TZOA 5A7SA 3B8NA 5C8CC 2O8OA 4XBLA 3MF6A 4P9XA 4X9QA 3TXSA 2JDNA 5E6HA 3WF1A 2VUCA 4YHHO 4XFHA 3OBRA 1UZZA 5IJ9A 3LCPA 4CSWA 2CE4A 4XBFA 4H2AA 1HQWA 2IJHA 3OAAG 2VWJA 4JI5B 1REDA 1OF3A 4H7LA 4XJWA 4MS2A 1Z7S3 1VF6C 2J1RA 3JD73 3BPSA 3ZIWA 3ZFGA 1ZYBA 4X6QB 3ON7A 3OGRA 2VCAA 5T50A 1NCRA 4BCUA 2D97A 1DQ1A 1NE4A 5CU1A 3FWEA 4W6XA 1X9TA 2BP6A 2YPDA 4CXYA 4ATEA 5EIBD 4NVPA 4M01A 3B4SA 4IE0A 3K0DA 1FFTB 2V7QG 2DDUA 1ZBE3 3AX4A 4WM8B 1C8M3 4NUBA 4OHZA 1LOAA 2PFWA 2BWCA 1WLWA 2R1BA 1RUJ3 3H1MA 2P3IA 5IATA 5AFBA 2GTAA 3WF3A 3U07A 4XMIA 4UF0B 1CIYA 3HQXA 3I2GA 4COUA 2RDRA 2EBOA 3OEAA 3N2KA 2UXNA 1RM1C 5EBWC 1H1AA 3ZMTA 2VW1A 3OPZA 4J41A 1H2GA 1PX4A 3O14A 4XC9A 3N9MA 1JJOA 1HRI1 5FZIA 3HKEA 4AWDA 4BK4A 2KR2A 3K77A 5C3QA 4ISQA 1TQ5A 3THDA 3KSCA 4JGYC 4Z8BA 3SYAA 4NXNB 1RL3A 2EAAA 2EINC 2C2AA 2F6BA 4GH4B 4CUAA 5B3SB 1SZTA 3WQ1A 1LR5A 3VKFC 1X7NA 3P1IA 4YXWG 1VAKA 4B3RO 1YXWA 2FMYA 3PMEA 5LBFA 1AR4A 1MA1A 2QWQB 1FXVA 3VQYA 1IXMA 3NNMA 2V1DA 5A32B 2FZ1A 5I0DA 2E31A 3ILNA 1VPHA 4RD7A 4QGMA 4FPHA 3GZEA 5FMCA 3AZVA 4CH4A 2HWF1 4BIFA 1AP5A 2ARBA 3NJZA 4AK3A 5KC6A 1RINA 2AXTZ 1PP9H 2ZE5A 4YVSC 1DF4A 4NPRA 3POWA 1K4DC 2HWB3 4PD4F 1QU0A 1AYM3 4HXCA 1CAVB 4O2AB 2Q1ZB 5LP6A 1ZTEA 2FQPA 4BB3A 1FX5A 4EEQA 2X7RB 1PNFA 4KH9A 1GN4A 4J9YB 3JAKA 1PZ9A 1QQP3 5IVEA 5FBJA 1JZ6A 4FCAA 1JTZX 2NLRA 4I50A 3ZKUA 2C24A 5A70A 1LJ7A 2PMWB 1BGYH 4MXWB 1KYOF 1OD5A 3T30A 1UIJA 2YSUB 4GA9A 3CCMV 2DJVA 2HVKC 3GGLA 3U37A 4L9BA 3U1XA 4NPMA 1OXCA 3T4VA 4YM0A 3KB5A 1GN3A 2D43A 4I0XB 4RO2A 5A3WA 2UUCO 4DO0A 3NR7A 5JCTA 1OUSA 2GH8A 5DABA 3ZOIA 3CD6V 4FLWA 4M4PA 3RZLA 5FZEA 3STLC 4ET7A 1L3JA 2ADPA 4AL9A 3CU7A 1YC61 3L2HA 3IC9A 2R9RB 1QOTA 3UKTA 1MQTC 2RS11 3KMHA 5C5UA 3H7JA 5EIBC 3I2DA 1HXS3 2DW4A 2BERA 3CRMA 4HAMA 2PYTA 2AACA 1R6TA 1TMF3 3KT7A 3OR6C 5FZ7A 3B2EE 4W6YA 5LA2A 3VD3A 3AKSA 3AM2A 1XNRO 4GD4A 3CHXA 4DV3O 4UFZA 4ZOLA 4Z1MG 3U14A 2X5IB 4JI8B 3IFXA 3SH5A 2R0HA 3UV9A 3LEKA 1B6QA 3ZSMA 2XR4A 3WUCA 2EIJC 4RN5A 3PVEA 3S7EA 1GN2A 3VBHB 5FK8A 2BSKB 1GRJA 1VR3A 1VBE3 3LDKA 3K2OA 2WS93 5GONA 4CDUA 1CPYA 2XJTA 4GMP0 1WW6A 4XABA 1RUH3 2CGOA 2VE1A 1QLEB 3C7FA 1XC6A 1ZREA 2WNVB 1IS4A 3PVOA 5FXZA 4KQ7A 1NY72 3U0ZA 3ZFEA 3JALB 3CJHB 3Q8BA 1UKRA 1LGBA 1H8HG 4Q0VA 3FD9A 3SC7X 1O8PA 2JEXA 1REEA 5FPVA 4LHKA 3AK3A 1IS5A 3KLSA 1XNBA 4LQRA 3SJAC 2A6WA 3JBG3 5LXTB 4DV4O 5FLIA 3VBUA 1NCRC 1SQPH 4AI3A 3KS7A 3T1MA 2WQZC 3ZXFA 2A3WA 4CH5A 4L2NA 1Y4WA 3AFGA 2Q7EA 5IYZA 4B8EA 1FAFA 3IBMA 1R083 2RS12 3DPRB 1GZ9A 3BFRA 1ZZ6A 1GYKA 4MZUA 2ATFA 1XI1A 1S2EA 1W2AX 2QTSA 1WB8A 3URFA 1HDKA 3MW2A 4LF8B 2P6CA 4Q4Y1 5A32A 3OY8B 4XUOA 4AQYB 4FO9A 3E22A 1GOFA 4DPNA 1D0HA 3DCQA 5J7MA 4XAEA 3QCWA 4X20A 1H0BA 3MICA 1PO21 4EFBA 1W9SA 2DVDA 5T5OA 4I0WB 1KRIA 5C4WB 2Q5ZA 3V0AB 3CCRV 2ZGNA 1MS0A 1SDWA 4TTGA 2ZEWA 4BXFA 2EIGA 4KI5M 4AW7A 4WF9V 1U5ZA 2GN3A 4QX8A 1UYZA 2GUZA 5BNNA 1SZXA 3DC6A 1LAJA 1MACA 2UYAA 2VVFA 4XF4A 1XQNA 4RUEA 2P4VA 1W6PB 5T5PA 4F4LA 2WNOA 5JXIA 3W7SA 1LENA 4ZIBA 2CGPA 1JYVA 2P6HA 1S0GA 2N05A 4D8MA 3UGHA 3OT7A 3WG3A 3A0BZ 1P84F 3O9OA 3WR0A 4ZBMA 3CJHA 2RJLA 4D6TH 1YF2A 3GF6A 4LH7A 3J26N 3HKCB 1VBB3 4COWA 1LUWA 3ZN4A 2IJKA 3WFVA 1JHJA 1ZA4A 3K3NA 2YYOA 1VARA 1GMMA 5F1RA 3I97A 3K0GA 2IM9A 4DV5B 2N74A 2VCMA 4QB6A 3MFCA 2HYXA 2M7WA 2P4EA 2R073 4B7EA 4YJ3B 3S5AA 1VF7A 1WMEA 3I2FA 3TWIA 1EAH3 4IEWA 5DN2A 2YI8A 5FOBB 4A41A 1VMFA 2J1UA 1H9PA 3H9AA 2VQ0A 5KAIZ 4KG0A 3ILFA 4B3RB 2EIDA 4J1WA 3IAQA 4COZA 4YGCA 3VLBB 2R063 1BL8A 3UO2A 1TGOA 4BOWA 3MUY1 2BSKA 5DUXA 1CD3G 2YUEA 4NHYA 2DYRB 1SA0A 1F7YA 3FX3A 2IXKA 3UCSC 1O3SA 2EICA 2GBOA 2D3OW 4QXBA 2JE8A 4U3JB 5F3CA 3IGAC 4TV9B 2WT2A 1ULEA 1W9FA 3EBRA 1V9U3 3A7QA 1H8TC 4OXSA 2VW2A 3SCFA 4F8AA 1UWWA 4FPYA 1NA1B 3O5SA 3DL3A 4O2BA 1H2NA 4JI2B 3WNKA 1VQ6V 2TUNA 2A79B 3VBRC 2GC3A 2D6LX 1AB3A 4K35A 1BE3H 3VHRA 4JVAA 3OB8A 1W6NB 3UT5A 5C9AA 4UVAA 2F4VO 2X09A 2FCTA 5GALA 1XILA 5J2UA 5L19A 2WAAA 4FTSA 3F7VC 1ZRRA 2E26A 1OCOC 1PK6B 1MVQA 1TG7A 4U2AA 4BQ2A 1J3RA 1DG6A 1RM1B 5SV8A 1JFFB 1Q56A 3TN92 1J3QA 2ZGOA 2R49A 1DDLA 4WZFA 1YIJV 3ZFGB 3L9JT 3T08A 2B39A 5FPAA 3UO3A 3ZYBA 4LF6B 2XL9A 3C3SA 4UV9A 1AF9A 4ZS3A 1NU1H 2DCKA 2QEXV 1X50A 3SPHA 5HBAA 3C7HA 5C4WA 1RUI1 5L3BA 4IHJA 1ENXA 1IBKB 4O4IA 2JE9A 4FFIA 1AI4A 1ST8A 5IVFA 2Y0PA 1UZYA 2CSGA 1GZWA 1NLSA 2ZIMA 5LHIA 4YW7A 1VBD1 4XUTA 1VBC1 5L3DA 5JMCA 1FYUA 3KVBA 4EQVA 2FB5A 2NP0A 2GSYA 4FPCA 4R52A 3RBZA 2N04A 1VQNV 3LA7A 4PDVA 5LXTA 2YXHA 4D0QA 1PIV3 5FO8B 2XJQA 4LNUB 3HVDA 4MVMA 2E9QA 3CPWU 3CRRA 5JXHA 3FLPA 4MGYE 1UPIA 4YM1A 3AMNA 3ZSLA 1S5JA 1JVMA 2JX9A 1JZ5A 3D3QA 1LHVA 4Z07A 4Q4V2 1WWYA 2VOXA 4FFGA 3WG7B 2MEV2 3VD7A 1OZ0A 3WDTA 4HLTA 3I2OA 4Q4X3 3OTFA 3VBFB 4ZU4A 2AGSA 2QKSA 3BI3A 4AAXA 1S77D 1QQP2 3B02A 4X8AA 2OCCB 1WP7A 2WDBA 4FLTA 5FZLA 4MXVA 3B94A 4IEZA 5CBLA 4CDWC 2AW9A 2R062 3ABZA 5DMYA 1N3OA 1Y7BA 1ND2A 4NB5A 3ECQA 4E8DA 2A3XA 1ULGA 1K33A 1OCRB 1GAXA 2X29A 4LFBO 4JAAA 2VOWA 1OI6A 5A3UA 2A70A 3W7XA 1N4CA 1W2NA 1YJNV 2QQPA 3LEMA 1CEZA 2W6IG 2Z5WA 1CZVA 4K8RB 1W6PA 4DV5O 3NV3A 2MK3A 2H0VA 3WF4A 3KCCA 1ZRFA 1WCUA 2UU8A 4CU7A 1J3PA 4EFEA 3CIHA 3RZZA 5FZAA 3CO2A 1GFF2 2YIBD 2VNGA 1I0HA 3I3QA 1IS6A 2ADDA 5DZGA 2UURA 1APNA 3LDRA 2HLEA 2LO1A 3MPBA 3ZMSA 3ETEA 3M8AA 4OCTA 2NM1A 2Y0OA 3R65A 2RM22 3I59B 1VBD2 3WNNA 4A45A 3E86A 1M56B 3T3YA 3AC0A 1QCEA 1V9U1 4LF7B 3NNJA 1AP6A 2XUEA 1OVSA 1XE0A 2X6CA 4MTXA 3J7AU 2E32A 2C5DA 2XBO1 2VBDA 1VRBA 1NAEA 2ZEZA 1IQAA 5FZ4A 2BRTA 5FY8A 3GWKC 1PHMA 2CDPA 4LR3A 3AP4A 4N7UA 3ABKB 1J83A 5LBQA 1UU5A 1GN6A 4CDQC 2ZNJA 5LEKA 1JW6A 1PO11 3RFRA 2ZABA 3LF7A 4LO7A 5JXGA 1DGWA 3IDBB 1S4CA 3KKYA 2WC2A 4P02B 2R30A 3AG2C 3RSJA 4H33A 2P5OA 5FKBA 2VZTA 4AEJA 2JK5C 2CWMA 4BM8A 3HR0A 2PHWA 5C8YB 1JYCA 5JPMB 2GC1A 2HJFC 3ZCCA 4QPGA 1WLDA 3JBG2 3IAYA 3RVYA 1GV9A 2FYUH 1F4AA 3PLQA 4QQLA 5JJEB 3A4UA 4AVSA 1EZVH 4LO5B 1RHI1 5FP8A 3T4ZA 4H37A 1EPWA 4U3JA 4LOTA 1CAUB 1C1FA 1CAVA 3LSSA 3O1TA 3LSEA 1UOBA 2MEV3 3SLIA 3APBA 2VOKA 3CQOA 2BZDA 1Y4MA 4QKDA 4EN8B 3ZFEC 1OLMA 2DYCA 2BWAA 2RJ2A 3KGZA 4IGQA 3JD71 3CRQA 5KXBA 1PL4A 3TYJA 2ZE7A 3UKMA 4P9JA 5JI7A 4INDA 3BTXA 1L7RA 1CN1A 1C3HA 2XBO2 1WA6X 1HNXB 3ZHVA 1VLNA 1O6UA 1HLCA 2AEYA 3Q8AA 1XE8A 4YZ4A 1UYPA 4PI0A 4FMTA 4LNUA 1NTZH 3ZFEB 1DP0A 4DR6B 1SACA 2VUJA 4ZKTB 1V9U2 4P08A 2QM4A 4LF5B 1FV2A 3AYAA 3OUHA 5HV0A 5JH7B 4JZ2A 1KITA 5A3NA 1AJPA 2BNMA 1C28A 5T52A 5GTHZ 2VVDA 3ETQA 4LIVA 4LT5A 3ZFFA 4DK1A 2XKOA 3D8CA 2RVAA 4X62O 2Y4TA 3SKVA 5C8WA 5A7NA 2ZHMA 2KB1A 1SS3A 3IM0A 4AAPA 4NIHA 1AI5A 5B1AC 1TUBA 5EBMC 1Y76B 4C1WA 2GP3A 4FVVA 4AI1A 3CCJV 4B3NA 1MNGA 3RN4A 1YFXA 2NN8A 1C8M2 3WG2A 4X66O 4JF3A 2HWF3 4YYOA 1US3A 1AHSA 4JKMA 1J84A 2WS92 2X8KA 1YQCA 3VBHA 5FPRA 2YXSA 5EZWA 4FSJA 1NOVA 4FM2A 3APOA 1EUTA 1YI9A 1L0LH 3G67A 4PLNA 2HWC1 2QZ2A 5EJ3A 2H3OA 1FOD3 1PNLA 1PNMA 2Z0AA 4RS5C 5LOVB 4L97A 2W2IA 4UOJA 4JI4B 1SFPA 3ZRXA 5FMOL 4D69A 1GP4A 2IXHA 3WW1A 4D94A 4QQPA 1AL23 1VE0A 2EALA 4GX2A 4JYAO 5F5AA 1NG0A 2KM2A 2VPVA 4OX9O 4QE7A 2Q69A 2QQKA 2QKDA 5JCOA 5JQGB 2PHLA 1JPXA 4JAVA 3ZR6A 1R082 3OBZA 4JI5O 4YW5A 5KHKA 3FFQA 2BOJA 2UWAA 3B01A 3ZRVA 3RVHA 1YFYA 3Q8EA 1Y74A 2X05A 2XL7A 1TE1B 2XHNA 4WVVA 1EBOA 4WFBV 5D5QA 2Q5TA 5CN0A 1Y6XA 1HRI2 2VW0A 1K73W 1SESA 1FMD3 3FBYA 3E22B 4RHV3 5C8CB 4X20B 1PKXA 4AILC 5J09A 1HXS1 1R3KC 1RGSA 4MVTA 4LORA 3SH4A 2OZ6A 1UY0A 4PA7A 1YO8A 3J7LA 4WFGA 1V6LA 4UXNA 1PM9A 4UFHA 1WNSA 1ZM1A 4DV3B 2XQXA 1IOAA 3I5DA 3CLPA 3MGUA 4HOOA 4Q27A 2VQAA 4I7ZB 1G9AA 2DCJA 1GOHA 4DUXA 3FLRA 4IYIA 4Y1YA 2I45A 2Q7HA 5EYYA 3SYOA 4MVUA 1W06A 3N2KB 3FN9A 2BBVA 4PT6A 4XCBA 2H8PC 1SLTA 3PURA 4L8QA 1RUOA 2HKOA 2AHYA 4PDMA 1LNQA 3B69A 1I94B 3RMXA 3QO8A 4GLXA 2QWOB 2VCCA 2VS0A 1OCRC 5C8YA 1YXBA 4BQ1A 1HRV3 5BXZA 4FI9A 4Q20A 2GNDA 4JV5B 1QJU1 4JYYA 4ABMA 3UQ8A 4JZGA 1UN1A 2W91A 3MW4A 1GWLA 3AG4C 1HB4A 2HWF2 3PIGA 1AJOA 1HKDA 3ZMOA 4JI0B 3T0DA 5BNPC 5LY1A 1WMDA 4FTBA 4XBQA 3SMHA 4N53C 4E2QA 4QWNA 5L3FA 2E51A 1C57A 4Q8KA 5GM0A 2K9ZA 3NSTA 3E5XA 4CEWA 3VBOA 4YGEA 3VBBA 5FTTC 3MDPA 3FL7A 2ORXA 2A06H 2GN7A 1NUKA 2D7FA 2OIGA 4A4AA 1Z5WA 4DV2O 1RUF1 1HN0A 1QJX1 4META 2CH7B 1QEXA 3K08A 3KQRA 5GZGA 3RYHB 2BGOA 5B2GB 1VALA 4Q4X2 2KKWA 1RUH1 1G9FA 4AG4A 2BDRA 4CXWA 4IHJB 3TETA 4XILA 2WQ8A 3B77A 2HWC3 2F23A 2EF6A 4MGIE 3THTA 1JYIA 4C8DA 3PUAA 1A78A 2KG7A 1ZVFA 4X66B 2HWD3 4FT8A 3R4DB 5CFDA 2LROA 3ZM8A 2PQSA 1O3QA 2R043 1WN7A 1UD1A 3UK9A 1YJ9V 4WVMB 4DEVA 4HK8A 1XBLA 3RVZA 2L6LA 3AK1A 3OEEG 4TQFA 1KEXA 5K8SA 3ETDA 2Y0IA 2B9UA 2P6JA 3WNXA 4DYLA 1W3VA 1MS9A 3ZX6A 3NJXA 3OMNB 2ZEXA 3PU3A 1PVC2 1EY2A 3CP1A 4UCUA 4BMBA 3RZKA 1XNCA 1QJX2 3DECA 1FNYA 1V6NA 4LTAA 3GBFA 1UX6A 5FZHA 3ZLIA 4O9EA 4I3GA 1YQ2A 3ZSJA 1SRYA 1WBFA 4MH0E 1SBEA 2F4VB 3ABLB 4E4EA 1AROP 2WLIB 2B1GA 1SKVA 5LA6B 4DR5O 1LKNA 3L70H 4XXAA 5KXCA 3WHUA 1OJHA 3DC5A 5B1BB 3FB6C 5C71A 4IXLA 2O57A 1W0NA 4LKFA 2QFEA 2R1DA 5FLHA 3C7EA 3SITA 2HWE1 4YVWA 4F7ZA 5DAVA 3I2HA 4JYCA 1I5ZA 4Y4RA 4PIZA 1W04A 4ICGA 4FFBB 4N23A 1BYHA 1OLME 1UOJA 2BVBA 5BNQA 3OG2A 4DV7B 2JDHA 4IL6Z 3CZUA 5F5CA 2DUOA 4GQ7A 4NTWA 1WA8A 3JAWB 4P30A 3PIJA 1MQTA 3S30A 4GWJA 2VQUA 3FAVA 4JDOA 4LF4B 4CC6A 2LJ2A 4DW1A 1VEWA 3OUFA 3BAAA 4DV1O 4K1ZA 4AEKA 4KBZA 3VKNA 1ZL8B 1BEV2 4EB6B 1PZ7A 4LK6A 4CC5A 5J48A 1VMGA 5KMGB 1DQ2A 4AFBA 1ROPA 1YEWA 5GTIZ 4UYBA 5DM6V 5FJKA 3LE0A 3LSQA 3FBMA 1HNWO 3OOXA 3IWZA 2E75B 3MAQA 1TNRA 1ZZBA 2WZ8A 3CMEV 1Q6HA 2RS33 5CBFA 4XPVA 2UXDO 2WO7A 1M06G 1RJ8A 4PCRA 2JIJA 4JI1B 3OW2U 3HR9A 2ZA9A 5FIXA 3TGUH 4IV1B 1LCLA 2DWEC 3JD2A 2RMU3 1L7LA 4DQAA 2ZZQA 3N2GA 4OFGA 5J98B 1JA8A 3SCHA 3G6BA 4QPWA 3HN3A 3BUCA 4R9AA 4LO4B 1A3KA 4E2LA 1TA8A 1JMUB 4LFBB 1QH7A 5FPXA 1JXNA 1RUF2 2P7TC 1VBC2 4FP3A 3ZHRA 4AI9A 1DFQA 1IG3A 1D5NA 1YIPA 1PK6C 2W47A 2XAQA 1MR5A 1WUVA 2RMU2 3AEIA 3LD8A 1SLBA 5EXOA 4PHZA 4LBQB 3AKQA 5LL6Y 1JX9A 1J5EO 2C0ZA 4UVCA 1PM7A 5LZ6A 5LYJB 4IESA 3CC2V 4G4FA 1CAXA 2FL4A 4ONUA 1N36B 3G6JB 2ZKOA 4K8FA 2W87A 4XQWA 1XQ8A 1CR7A 3DUIA 3CB2A 2Z2SB 5KXDA 5FZ1A 3WDUA 1KUQA 3ENRA 1YQ6A 3BALA 1QLEC 3KT1A 2D6NA 2YC0A 1G6NA 1PVC3 3V64A 1STMA 1XU1A 1FMD1 2WZEA 1SQGA 1NVPD 3LPGA 4GWMA 4RL7A 1QDOA 2FDHA 5HFLA 3SISA 2DF7A 4FFFA 2EIJB 4BQ5A 2NLJC 5CKNA 3ABTA 2ZAAA 5FP4A 1CX4A 4TN7A 3DXUA 4OUMA 2Q73A 3VBOC
chains in the Genus database with same CATH topology
4RA0A 4ISQA 4Y1XA 1OIJB 1SCSA 1WD4A 1JUIA 1TQ5A 2XWBB 1X8MA 2JENA 3KSCA 4JGYC 4RHV1 4IEPA 3VKLA 4LBQA 2PLV3 4Z8BA 2EAKA 1I9RA 2ET1A 3AZZA 2BNOA 2EAAA 1RL3A 2ZHLA 4OI4A 2DTWA 2F6BA 5JZGA 2G9GA 4GH4B 3C3VA 4CDXB 1IKQA 2DFCA 2WZR2 3WQ1A 1LR5A 2SBAA 3VKFC 1X7NA 1VAKA 3KCYA 5FOJB 5KHHA 2ETEA 1YXWA 2FMYA 3PMEA 1QNWA 3A0KA 5DZEA 5A32B 3LZZA 4Y24A 2FZ1A 1IZ3A 4FOVA 5CFCB 2ZMNA 1QOOA 1VJ2A 1V70A 1GNHA 3H1WA 3ILNA 1S0BA 2MHFA 4XE9A 4RD7A 2DWRA 5GKAC 1KFUL 2GNBA 2WT1A 4ATFA 4WM8C 4QGMA 4FPHA 3TNPB 5D8AA 5DUUA 2GMEA 1W6MB 3AZVA 2HWF1 4KG8A 4AYUA 4BIFA 2OUHA 1LULA 2ARBA 1RMU1 3NJZA 1YYNA 1IKPA 4AK3A 5KC6A 2DUQA 1OQDA 1RINA 4FP2A 2A6XA 1GQHA 2KXLA 4LA2A 1H1IA 4D3WA 1AR81 3OBTA 2QCSB 4UBHA 4M23A 4YVSC 4S2GA 4NPRA 4L11A 2I07B 3POWA 3ZFFB 1EP0A 2QDNA 4RS5A 2C1FA 2HWB3 3R0RA 2ET7A 1QU0A 1AYM3 4S2FA 3ZSKA 2Y26A 3AK0A 1CAVB 5C33A 1MEC1 4PDWB 4B4PA 2PAEA 2Q1ZB 2ZGPA 1QJY2 3M70A 2FQPA 2PHTA 4P9WA 3BODA 3V0BA 4U36A 2WNEA 1H30A 1VIWB 1OFNA 2YZ4A 1FX5A 5GLWA 4MLOA 1PNFA 4YRDA 4KH9A 4LLOA 1AYN1 1J1LA 1F5FA 1GZWB 3UJOA 1PZ9A 4HFSA 1QQP3 3W58A 4J1XA 2PHDA 2CWSA 2OW4A 3OD4A 2RHPA 4Y0EA 4BHIA 4TLFA 4LBQD 4FCAA 1JTZX 1H2KA 2NLRA 3BIWE 4A3XA 2ZGMA 4GH4A 1LJ7A 2JKBA 4I09A 1AR62 2DVAA 2ZGSA 1Z78A 3PVBB 5GZFA 1VZ5A 4MXWB 1OD5A 2D5FA 1U5XA 3OYWB 5HCFA 3O2GA 4QT6A 4C1XA 1G9CA 2ZGLA 1S2BA 1UIJA 1OFSA 4GA9A 1ZZ9A 1NCQA 3B00A 4XFCA 4L9BA 2PQQA 4LUMA 2HWE2 4GULA 5A33B 2XJSA 3K51A 4YM0A 3KB5A 1HQLA 1MEC2 1VP6A 2XGXA 3HIFA 2D43A 3FMGA 1FOD1 3AB0A 5H9SA 1WLTA 3V56A 3NKGA 1JHNA 1YUDA 5JCTA 4OHYA 3R05A 4Q0UA 2GH8A 4JGZB 1Q8QA 5FLJA 4NWVA 4I01A 5K0UB 1OHFA 4PLOA 1CGPA 2ZX4A 2WNUB 5CB7A 5EV7A 2ZGQA 1N3PA 4OULA 2D6MA 3JBG1 1L3JA 1RMU2 1PIV1 3CU7A 1QJZA 3AYDA 5JR7B 3L2HA 4JC1A 1QOTA 1RUI2 5K9YA 4OJ8A 4LBNA 1RHI2 3UKTA 1MQTC 4AI2A 2RS11 3KMHA 4MGKE 3H7JA 4EWDA 3LA3A 3I2DA 1YIFA 1HXS3 5DZFA 2RM23 1GZCA 4TWTA 2PYTA 3NAPA 1NE6A 2YMZA 1TMF3 1O91A 5I91A 1IPJA 3AJZA 3KT7A 1OIKA 5JLVA 1ASJ3 3IDCB 4W6YA 5F5QA 1OIJC 1JOJA 1DU3D 2ZCWA 3AKSA 3WQ0A 3AM2A 3WP4A 1FPN2 1LESA 4P14A 2X5IB 3WCRA 3ZPYA 3N7LA 4EN0A 3VZMA 3SH5A 3NV1A 1GNZA 2R0HA 3UV9A 2PHXA 2ILMA 4Y4YA 4RQPB 5CADA 4Q1RA 2WWSA 5J92A 3ZSMA 2UWCA 3WUCA 3PVEA 1D4M2 1R1A3 3S7EA 3VBHB 4Q1PA 3P3NA 2YHJA 1VR3A 2GU9A 1B35A 1HRV1 1VBE3 3FLTA 4BMEA 2WS93 2WLPA 1OIHA 1ZBA3 4CDUA 3T1LA 2Q4SA 1MVEA 1ENQA 2XJTA 3N3HA 4GMP0 4R9DA <