3KDAA

Crystal structure of the cftr inhibitory factor cif with the h269a mutation
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
298
structure length
298
Chain Sequence
AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMEAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGAGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSRGRHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CFTR inhibitory factor (Cif)
publication title Crystal structure of the cystic fibrosis transmembrane conductance regulator inhibitory factor Cif reveals novel active-site features of an epoxide hydrolase virulence factor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa ucbpp-pa14
molecule tags Hydrolase
total genus 112
structure length 298
sequence length 298
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kdaA01
3K2IA 4O08A 4Y7DA 2Y1KA 3IDAA 3KOOA 2XMZA 4QWWA 2HU5A 2AJ8A 3LIIA 3N0TA 4Y2QA 1VJ5A 3V48A 4L3WA 3U1TA 4H0CA 5A2GA 4WY5A 4J03A 5EIEA 3WLAA 2XE4A 4A23A 4UHCA 1XFDA 2OPHA 5AKIA 4UBJA 1CUEA 1LNSA 1EB9A 3WJ1A 1JJFA 1NX9A 5CT5A 3DOHA 4CIBA 3HEAA 5EIAA 2Y2VA 3Q8WA 2WHRA 4Q05A 3G02A 5A71A 4QE3A 4IHAA 4KRXA 3ESDA 3OTQA 4WDRA 3FSGD 3JYHA 2VJDA 3E1GA 1WOMA 2PSDA 4AMYA 3STVA 1PV1A 1CUIA 3KSRA 4I3FA 1BN6A 1EVEA 5AHXA 1HQDA 1TK3A 2AJDA 2VAXA 1CUSA 1JMKC 4UBMA 2WFLB 5CH5A 5ALUA 3DKKA 2G4LA 1QOZA 4XIIA 5CT4A 3BDIA 3WK9A 2WIDA 2WIKA 3WL6A 4FLEA 3WA6A 1QFSA 3DYVA 2OAEA 5LZ9A 2FX5A 3FAKA 4GEGA 3W04A 1VA4A 4F60A 4G5XA 4Y2JA 3AIKA 1UK6A 1JJBA 1DWPA 1A8SA 3WI7A 1VE7A 4U2EA 2XUKA 3HABA 4G8BA 1MNQA 4EHBA 3IUQA 4XX1A 4X3CA 1ZI8A 1XLVA 3FLEA 4F5ZA 2CJPA 1JI3A 4U2CA 2CBGA 5CXXA 2ZSHA 4G9GA 3STWA 2V98A 5FLKA 4U2BA 1ORVA 3AIMA 4AN0A 3AZPA 1A8QA 2HL6A 4JUIA 1XRPA 3E3AA 3O4HA 3DYIA 5AO9A 3LIPA 4CG2A 5AKLA 1DINA 2GBIA 1H2ZA 5AH0A 4HXEB 5IKXA 2GBFA 3UMJA 3VJMA 5FOQA 2Z3WA 5HF8A 3O4JA 3ZWQA 5AM5A 3G0DA 5HF5A 4Q3LA 4DNOA 5C7YA 2J4FA 4B85A 5CMLA 5IH7A 1ODCA 2ZVDA 2QKYA 5CT9A 4EY7A 1LPNA 3LP5A 1LPOA 3IIIA 3FCYA 2W22A 4BTVA 1EI9A 3MGAA 4ETWA 2PSHA 3K6KA 2DHDA 5AOCA 2XMQA 5DYYA 3QMMA 1F8UA 3D0KA 2JGFA 4RGYA 2QUAA 3QVMA 1ZI6A 5AOBA 4AZ0A 3DEAA 3H2KA 3RARA 4UBOA 5ALYA 5K3EA 3M82A 4W1QA 3O9VA 4DMFA 4B6GA 2C0QA 2QUBA 5K3AA 1F0NA 4H7JA 3S8YA 1XRMA 1MJ5A 1DTEA 2ZYSA 5LZ8A 4EY5A 2XMCA 3U0VA 2WKWA 4BE9A 1FJ2A 1KU6A 1E89A 4IO0A 3BIXA 5JD6A 3IULA 2BJHA 2G5PA 3ESAA 2QXTA 2HA4A 3DKRA 3GROA 3D7RA 1UOPA 2O2GA 1K63A 2WJ6A 3DNMA 3W9UA 4E15A 2GZRA 5LIPA 1UK9A 1H2YA 4BRZA 2Z3ZA 3AZQA 5BV7A 1CUZA 4BAUA 1DQYA 1ETHA 3FBWA 5AM3A 3FYUB 1AUOA 1X70A 2HA2A 4BVLA 2Q0XA 2XLCA 4C88A 1MO2A 3C45A 5AJHA 4BVJA 3PFCA 2XLBA 3F98A 4C6HA 5CTAA 1J1IA 5JAUA 4X92A 4B81A 3UUEA 3KWJA 3WK4A 3IB3A 2JGKA 1MX5A 1R50A 2HU8A 1ZGCA 3STTA 4WFKA 2HHAA 3I1YA 4DM7A 4KAFA 5FUMA 5I9IA 3QYJA 5KWJA 2ZJ6A 1QFMA 4G4IA 4KJXA 4PQEA 3G9TA 1S8OA 2LIPA 4B82A 1C4XA 1A8UA 2Z8XA 2WHPB 4TGLA 5ALDA 2XMGA 3B3QA 2VF2A 2Z8ZA 1DX4A 2X76A 1JKMA 4Y2YA 4EA6A 1DU4A 1G42A 4KYVA 1UKAA 3DJYA 3PE6A 2DCMA 3H18A 3ESBA 1VOTA 4CCYA 5JAHA 5LP1A 3LCRA 3HLKA 2PSEA 4H7DA 1E3QA 4J0GA 1Q83A 3A6ZA 3HXKA 4GXNA 3M81A 5LZ2A 4C89A 1JJIA 1XQVA 5LZ5A 3SX4A 1I6WA 2OGTA 3G0GA 4AO6A 4DMCA 1BS9A 4OU4A 1XZLA 2XUJA 3WA7A 1UT6A 3WYNA 4CI9A 1RP1A 1E8DA 3RLIA 5ALNA 4K5QA 3GBSA 3FNBA 4Y2RA 2G5TA 4OD0A 1HKHA 7YASA 4FWBA 1LLFA 2VA9A 4K6HA 5ISMA 3QPDA 2VJAA 5HKBA 2ORYA 4WCVA 5HQ3A 1MAHA 1GKKA 5A7GA 1CUUA 1EXWA 4BP9A 3WL5A 1ZD2P 4X93A 1ODTC 3NOXA 3QBJA 1GZ7A 5AK3A 2RAUA 2CUTA 5A6VA 2WFZA 5FPPA 2R11A 1EINA 1X2EA 4MWSA 1MN6A 2OQVA 1YB6A 3EBLA 4HS9A 2OCKA 2DR0A 5ALSA 2B4KA 5J3JA 4GI1A 1CVLA 1YR2A 5FPQA 1FFDA 2OXEA 3VVMA 4K6GA 3W05A 1JFRA 5BOVA 5T4EA 4J0KA 4CG3A 4C87A 3JWEA 4FLMA 2OGZA 1Z68A 4MQMA 2WIJA 2J4CA 1MTZA 1AMNA 1CUJA 1XZHA 2GBGA 2C58A 1OCEA 1A88A 1N8SA 4YK7A 2VEOA 4UFNA 5JZ9A 1TCAA 1KU0A 3WKDA 3R0VA 4F0JA 5ALVA 4UFPA 4B0PA 4GDMA 1P0PA 5AI8A 1H2WA 3M83A 1UFOA 2WUEA 2VQ6A 5T4BA 4XWGA 3CXUA 4HXFB 4B80A 1SCKA 1CUBA 1X2BA 3EQ7A 4DIUA 3H19A 1L7AA 4UUQA 2I3ZA 1CQZA 3BL8A 2OCLA 3IURA 4OSEA 1AX9A 1R3DA 2VTVA 4HRYA 3TEJA 4QDZA 1HLGA 3C6BA 4E14A 5JANA 2WIGA 3BDVA 5EHQA 2JEYA 3W2TA 2BFNA 4EY8A 1WCYA 2WTNA 4B84A 3ANTA 1ZI9A 2JBWA 2HM7A 3OOSA 3FYUC 4X90A 3R3VA 1LGYA 3ZI7A 4AXBA 1RWQA 4M0EA 2C5FA 2XI4A 4J0HA 1LBTA 3DOIA 4N8EA 4N8SA 2QVBA 2HRQA 1XZGA 2JGIA 3FWHA 4QWMA 5JARA 2D5LA 5HK9A 3VVLA 2ZJFA 3FOBA 1JU4A 3B5EA 2WJ4A 3R3UA 2RONA 1YA8A 2OLEA 2XQFA 5K3FA 2HADA 3R3ZA 5BWBA 1E8NA 4PSUA 1W52X 4BDSA 3ED1A 2XMDA 2CEKA 4P92A 2RHTA 2XQIA 1N5RA 3WIBA 1QTIA 2BUCA 4I4CA 3R40A 3EQ9A 5AM2A 4QDOA 4IH1A 3PF9A 4LXHA 1VZ3A 5AM1A 3H1BA 5JAPA 1JU3A 3A2NA 4QNNA 1SFRA 1XKTA 3LLCA 4B0OA 1LPSA 2XB6A 1ZGBA 3STUA 4J0JA 3V1LA 4A5SA 1GPNA 4WFJA 4IQ4A 4KE7A 3QPCA 3O9MA 4B9AA 5AKJA 3WK6A 2HDWA 4MYDA 4X6YA 5FXMA 1TCCA 4AN1A 1ZD5A 4UBIA 4N5IX 1YS1X 2CKMA 5E4YA 1XZBA 4X7BA 4JH0A 1CQWA 4GWLA 1N1MA 1H23A 2BCEA 1P0IA 2XQKA 1R1DA 1EDBA 3B12A 1DT5A 1CPYA 3L1JA 4PNZA 1G66A 5AICA 1MU0A 1VE6A 4M0FA 4V2IA 4YX9A 5A62A 1QIMA 3G0BA 5DLPA 1GXSA 1MX9A 4N8DA 1XZKA 1ZIYA 4ITVA 2PU7A 3DL4A 4HTAA 1L7RA 4C01A 2YASA 3D2AA 3ZV7A 4EY4A 1XKLA 4CFSA 1AC5A 4AX4A 4U2GA 4MXDA 3WJ2A 1WM1A 1OILA 1GPKA 4MJ3A 4DYHA 3ILSA 4OYYA 1XLUA 2V97A 3KD2A 1TIBA 1PFQA 4CIAA 2K2QB 5E4JA 2EDAA 2WUDA 4DLNA 1YAJA 3R3YA 4XJVA 5ALKA 4BTLA 3WZMA 4WDQA 5HFAA 3C6ZA 3EIOA 2GZSA 2QM0A 3WKEA 1THGA 4JEIA 3STXA 3ZLTA 4BDTA 4BCCA 4CCWA 1B41A 1XQYA 5ALWA 2HRRA 1BCRA 3I2IA 1EH5A 5D3KA 4JNCA 2ZYHA 1XRNA 5FKJA 3EF3A 4UFOA 5AKEA 3PF8A 3DQZA 1ZJ4A 3QMWA 3HSSA 3V1MA 1EVQA 2QT9A 2HA7A 3ZPXA 1GQSA 2B9VA 1T2NA 1W76A 3S2ZA 2ACKA 4DSZA 2WU4A 4WFIA 3H2GA 1DX6A 4HAIA 3H2IA 2XDWA 5T4FA 1HPLA 3GZJA 4X97A 3ICWA 4P9NA 3OPMA 1J2EA 1O6GA 5AK4A 1SCQA 4BCDA 4ZREA 2DHEA 2XUDA 2YH2A 3BWXA 2VT7A 2AJCA 1QIFA 5LZ4A 3QM1A 3F67A 1YASA 4QLOA 1XQXA 5JD5A 3QH4A 4U2DA 4OUKX 4X00A 2JGJA 4Y9SA 4W1RA 1HDEA 1CIJA 2XMSA 2AXEA 2HA5A 1XQWA 3H1AA 2WHQA 5C8ZA 4ZV9A 4D9JA 5DNUA 3MUOA 1UKBA 5AIBA 2Z5GA 4EB0A 2XUOA 3SK0A 3HACA 2XT0A 1EK1A 1W1IA 3DL7A 5DWDA 3C8DA 4RE5A 4F21A 4J3JA 1FFBA 5A7HA 5IVDA 2ACEA 3TRDA 1YS2X 4BRSA 2JEZA 1IUOA 3C6YA 4EBBA 4GHWA 1WPXA 1BCSA 4GBGA 5JASA 1C7JA 2BGNA 1BE0A 1MT3A 3HI4A 5ALLA 1IMJA 3MVEA 4E46A 1JT2A 2HA3A 4Q82A 1TRHA 2WILA 1R4ZA 2O7VA 2I03A 4H7KA 1Y37A 4HXGA 4Y2XA 5LKAA 1QO7A 1CUYA 2XUAA 1LPAB 3PUHA 1XZDA 3R3XA 2QJRA 2AJLI 1W75A 3IVMA 2CMFA 4M0MA 1CUHA 4OB6A 2FJ0A 3WKAA 4Y2SA 5AIAA 3FVTA 2PSFA 4CG1A 1ZICA 4PSCA 5JYCA 4BC0A 5CRIA 4AQDA 5I7UA 2PUJA 3F8SA 1ACJA 3HJUA 5ALIA 5ALGA 1CUDA 2PL5A 5C8VA 3SWWA 1ZJ5A 4Y2UA 6YASA 2XUQA 3RKSA 1FFEA 5FRDA 4GECA 4KE8A 5EFZA 3WWCA 3DDUA 4FTWA 2FUKA 5ALEA 4OCZA 2H1IA 3BF8A 4QA9A 5AK5A 5K5EA 4OYLA 3FCXA 3I6ZA 4H35A 3ICVA 1XZAA 4I19A 4DMKA 1TQHA 3CN9A 1VLQA 3G8YA 3PFBA 4BZZA 2C0PA 3ESCA 5AI6A 2QZPA 5CT6A 1SC9A 2DHCA 4PW0A 1LZLA 1YAHA 5AI9A 3PICA 3WKBA 5LLSA 2QRUA 4DGQA 4ROTA 1QIHA 1XZEA 1XZFA 2IIVA 3E4DA 1EB8A 4UPDA 1WHSA 4Q3KA 5AKKA 4C4YA 5HFNA 1CUAA 3YASA 3C43A 1GT6A 3F97A 5AKYA 1MPXA 4X6XA 3DS8A 4PV7A 2PX6A 1K6EA 3I2JA 1YB7A 4CCYB 5ALZA 5AKHA 3STYA 1O6FA 3JW8A 3RK4A 1A7UA 5CH8A 2X5XA 1BEZA 1UOQA 5HK8A 1CUXA 4FDMA 5D3ZA 4AO7A 3IA2A 1N5MA 5CT8A 3IUMA 3WL8A 1CR6A 2J3DA 2B61A 4H7IA 4LYEA 3VKFA 1XROA 1U4NA 3IBTA 1QIDA 4MEAA 1BU8A 3FYTA 4UBKA 4BBZA 2X8BA 1LBSA 3OURA 2BKLA 2JGLA 1Y7IA 5CH3A 5F4ZA 1T4MA 3G0IA 4L0CA 1QE3A 4BE4A 4ARBA 5YASA 3A2LA 1R9NA 3IUJA 4UBLA 3C6XA 5EHZA 1QIJA 4PF1A 5HQ3B 3WMRA 3G0CA 2UZ0A 1ZD3A 1QIIA 5LZ7A 1UZAA 5AKZA 4L9AA 4YASA 1UK7A 4HRXA 5ALQA 4J0IA 3GELA 4H18A 4UHHA 3O4IA 3H17A 3CCBA 2I3DA 2QJWA 3I2KA 3QMVA 3FLAA 3MUNA 2WM2A 4NVRA 4UHDA 3FLBA 3PI6A 2WQZA 2HA0A 3BJRA 5C81A 3HC7A 3T4UA 4A16A 1XLWA 1EDDA 2XUIA 1CRLA 2GYUA 3O95A 5DTIA 2OAGA 4MEBA 2XUHA 1E8MA 4WJLA 3SC2A 2H7XA 2WFLA 3I2FA 1QIEA 4J7AA 5FDFA 2C4HA 1CFJA 5HZGA 3L1HA 4QDTA 3BE8A 1YSCA 2XQGA 1GPLA 2WSLA 1QZ3A 3Q0TA 2D0DA 3WKCA 4OB8A 2O2IA 3I6MA 4FHZA 4G1FA 2DQYA 2Y2UA 1IVYA 1ISPA 1CUVA 3DD5A 5I8PA 1LZKA 1CUWA 4BATA 3IUNA 1CUFA 3LS2A 4PSDA 3VJLA 5HF9A 3R3WA 2DSNA 3I28A 4NMWA 3BJMA 5CURA 1J06A 2OGSA 4X91A 2EEPA 4S0XA 4FBMA 1H22A 2NW6A 5ALXA 4RPCA 3V1KA 1CLEA 3K9BA 2YYSA 4OU5A 5ALMA 1MX1A 2VJCA 1QJ4A 4ZRDA 4AZ3A 4H7EA 3H04A 5E2IA 3WK5A 1L7QA 1XZJA 3C8HA 1WB4A 3H0CA 2HU7A 5ALJA 5JD4A 4G4GA 2GBCA 1AZWA 1DWQA 1TKRA 5SYMA 2PKYX 2PU5A 2QMQA 1E5TA 4YPVA 4Y2PA 3GUUA 3UUFA 2BAGA 2W6CX 5AM0A 4FFVA 2XMRA 1AURA 2ZSIA 4FLFA 4FOLA 1EX9A 5HCUA 2GYWA 3NGMA 4KAJA 4MYSA 4FFWA 3AILA 4QEKA 1BRTA 4C4ZA 1Q0ZA 4XVCA 1G4HA 2V96A 3W06A 2HIHA 2WIFA 2HA6A 5CBKA 4KE6A 5EI5A 2RI6A 2WUFA 4B7ZA 3AJAA 5K3FB 1AGYA 3C5WP 2QTBA 2VAVA 3G9XA 3ZLVA 1VZ2A 3ANSA 5A7FA 4LYDA 1J07A 2YXPX 3E0XA 4EY6A 5AK6A 3VXKA 2O7RA 3QPAA 2IITA 2C7BA 4K2AA 4QDXA 4DNFA 2XMBA 3D2BA 5AI4A 2H7CA 1WB6A 3WK7A 3WWEA 5DNWA 4QDUA 2PPLA 1R88A 1U8EA 5K3DA 5EHXA 2ES4A 2H9YA 5IVKA 4W63A 1K5PA 1PJAA 2ZJ7A 3AUKA 4LKOA 4LXGA 4W1SA 1YA4A 2Y6UA 1WB5A 3A2MA 4E11A 1LPMA 3L1IA 3G9ZA 1E66A 3AINA 1MAAA 2OCIA 3WZLA 1W6RA 3WWPA 1WPRA 3FYUA 1Y7HA 5JALA 4Q1VA 4W9RA 4QZVA 1C7IA 1BROA 4Y2VA 2V9ZA 5IVHA 3HRHA 1M33A 4RE6A 1QO9A 2ONCA 4K6KA 3C70A 2WJ3A 5LKRA 1FFCA 4C4XA 2BUAA 2G63A 1MNAA 3G7NA 3VDXA 3BXPA 3I2GA 2QOEA 4P08A 1QIKA 5JZBA 2XQJA 4G4JA 5LYYA 2HFKA 4QLAA 5E4TA 4TPKA 3VISA 2H7YA 2J3QA 5EGNA 1NU8A 1P0MA 3WYDA 2WHPA 2RHWA 2Y6VA 3GFFA 3C5VA 1USWA 3HYSA 4PO3X 4Y2TA 2B20A 3W9BA 5AI0A 2WU3A 1ACLA 1QLWA 5DYWA 4ZI5A 3OC0A 1FFAA 1XRRA 4X94A 1UXOA 4ARAA 4FMPA 1U65A 2QXUA 4BC1A 3TJMA 1U2EA 3O0DA 3EQ8A 2WLSA 2WUGA 1IZ7A 1HBJA 1EK2A 4DMHA 2PSJA 3D3NA 3WIOA 1AKNA 5IVIA 2I78A 4UHEA 2JF0A 3ZLUA 2ROQA 4DNQA 5DJ5A 1OXMA 2GYVA 4BP8A 4W1PA 4ZGBA 3WL7A 4KEAA 5KBYA 5AKGA 5EIHA 3CCCA 2VJBA 4BVKA 5JIBA 2CZQA 2P8SA 5D6OA 5ALTA 3NWOA 1DT3A 1GQRA 5K3BA 4KRYA 4JYMA 4H7HA 2JGMA 1KEZA 5HKAA 1XRLA 5DTJA 2ZYIA 2OQIA 1P0QA 3D5EA 1B6GA 4KAAA 1QONA 2BGRA 2WG2A 1XRQA 2ECFA 2JGEA 1XZIA 3AFIA 2C5GA 1ZIXA 1TCBA 4P93A 4EZIA 4L72A 4BYMA 4KE9A 1F0PA 4IH4A 5AI5A 4BCBA 2DFPA 1HL7A 3FSGA 4OB7A 1IZ8A 4H7FA 4Z49A 1VXOA 4BAZA 5T4HA 3NUZA 3RM3A 3KWFA 1G5FA 4J0DA 4HVTA 3D2CA 4B9EA 1XZCA 4AO8A 1ORWA 4LXIA 2RGUA 3A70A 2R8BA 3I6YA 5ALRA 5ALOA 5ALHA 2E3JA 2BUBA 4UBNA 3F9CA 5FV4A 5KREA 4MQLA 4AB1A 1SOMA 3G9UA 1SCIA 4FKBA 1ZOIA 3PDCA 4DSAA 1RYYA 4G9EA 4EUSA 3F96A 4Q34A 3WK8A 1K8QA 2FJPA 5AM4A 1EA5A 2O2HA 5SYNA 1QGED 1Q84A 2WG0A 5JATA 4X71A 2RIPA 2AJBA 4G8CA 3C87A 2HFJA 3M3DA 1EDEA 5BWCA 1LPPA 1UKCA 1VXRA 4UHBA 4ZV7A 4BZWA 1JMYA 4J0CA 3HZOA 1QIGA 4RNCA 1NU6A 4LHEA 1DWOA 2PM8A 1IUPA 3H2JA 4FNGA 5H3HA 3VJKA 5C8XA 5ESRA 3T52A 5CW2A 3QITA 1H2XA 2QS9A 3WWOA 2QR5A 5KWIA 2JIDA 1CV2A 4X6UA 2ZYRA 1DQZA 2WFMA 3P2MA 3OG9A 1VA5A 3D4LA 4DNPA 4KR0A 1THTA 1GKLA 2XUFA 5K3CA 1QTRA 1BEEA 2WTMA 4Q3OA 3OM8A 1Q0RA 1CUCA 2VSQA 1BN7A 1GGVA 4AMZA 5JAOA 1ZD4A 5JZSA 4KACA 1D07A 4N5HX 4OPMA 3DCNA 4FBLA 1LPBB 4WY8A 2DQZA 1F6WA 1EHYA 4UHFA 5JADA 3D59A 4GLBA 3BIWA 1UOOA 3V1NA 1VKHA 3QZUA 1AQLA 2PVSA 4X95A 3CN7A 4TVKA 1CEXA 3FVRA 1ODSA 2OG1A 2VT6A 5ALPA 3R41A 3WQHA 4MWTA 1TAHA 2IX9A 3H2HA 5D7BA 2PUHA 5AOAA 3V9AA 5AKXA 3TGLA 2WG1A 4INZA 3I2HA 4H77A 1W4LA 3BF7A 3O4GA 4X85A 1IUNA 4BAGA 2XUGA 4NS4A 3N2ZB 4NZZA 2VATA 3WWDA 1WHTA 1UWCA 2XUPA 4ZWNA 3I1IA 4B83A 4GW3A 1K4YA 3AZOA 5ALFA 4LIPD 5CXUA 5DYTA 3GA7A 5DNVA 5AP9A 5EHNA 4ZXFA 1XZMA 4U2FA 2EDCA 3KXPA 3KDAA 4G8DA 3DLTA 1YCDA 4FNMA 3PUIA 3X3HA 3AIOA 2PBLA 4JYPA 1FSSA 1R9MA 2CB9A 4BB0A 4HZGA 1UK8A 1CUGA 4IH9A 2OCGA 4DTCA 5HF6A 5FP0A
chains in the Genus database with same CATH superfamily
5ILGA 1TA9A 3L06A 5LYJA 3UWDA 1QHFA 5EINA 5CFPA 1NBHA 2GJ8A 2QBYA 3UMBA 3QENA 5IJZA 1Q7BA 1W4CA 4H17A 3NIGB 4QWWA 1HYGA 4M49A 2AJ8A 1VJDA 5CX4A 3QI7A 3UG6A 3H1EA 4MWDA 1S96A 4L3WA 4H0CA 5DULA 1XYGA 5DTMA 1V8FA 2XKAA 3RREA 4DLZA 4BXOB 4ZJPA 1VE3A 4NEHB 1ZJWA 3QFHA 1WBBA 1P9RA 1KAHA 2XE4A 1PUXA 3DGEC 3GGJA 2N1BA 4I55A 1XFDA 2YQ4A 2GPTA 4JKOA 1DRVA 1Y8CA 4LOAA 2OPHA 4UBJA 5FIUA 1FNCA 1HA3A 3AYZB 4PVDA 1CUEA 3FUXA 1R0YA 3DONA 1MRZA 1FSGA 1NX9A 1XHLA 5DWVA 3FNFA 3A1FA 3N8HA 3ZHSA 1US8A 2QPAA 3KE8A 3U44B 5CT5A 4D0LB 2ZZMA 3FM9A 3IAS1 4PHFA 4FFNA 1B2LA 1JAYA 3TRHA 3DFFA 3HEAA 1Z13A 3QLUA 4MV6A 4R0MA 3U09A 3TNYA 4OUDA 3RI3A 2PGIA 4D41A 2JLVA 3ELYA 4JUFA 2WZQA 3M6UA 2BR3A 1FVHA 4CMAA 4BX2A 2QNBA 2J0EA 3HDYA 4QBKA 3CVOA 3SJUA 4J7CA 4U39A 2P78A 4ZHQF 3EODA 4QE3A 4HPWA 3T1QA 3AFGA 3ZGLA 2OP1A 4A2CA 1G20B 2C2MA 4BX9A 2FI1A 3PITA 3GA0A 2WF5A 3RVKA 3OTQA 5MF6A 3FSGD 5T8KA 2AK3A 2VJDA 3JYHA 4BO3A 1WOMA 3DE2X 2P9EA 1XBTA 2V1XA 4H6WA 5DLQC 3STVA 3E22B 2P91A 5LCXA 3TGWA 2KI5A 4CM4A 4LE1A 1E94E 3SJCA 2HAEA 5TQ0A 4AMBA 1CUIA 2ATXA 1E2MA 1BN6A 4ZOEA 4UU7A 2EARA 3ENQA 1UBTS 4HQFA 3VR5D 5KMGB 1BVYF 4Q4HA 5BPHA 1BDHA 1YS4A 1E3JA 5CD9A 4RSRA 2VT2A 5JWHA 4CCAA 1FB5A 4UMVA 4MRVA 3IOYA 4WPGA 5JTUA 4GI3A 4DIEA 4RZIA 2J07A 2O14A 3G68A 3KSZO 4P3NA 2JLXA 3ZHCA 1K6JA 5KX5F 3KOXA 4CEIA 1WUTA 3GLHA 3EWNA 1T43A 3KKNA 1II8B 2B78A 2VAXA 2IU6A 1JDBC 2GO1A 2FVYA 2L19A 5JSHA 3T4EA 2HHCA 4B17A 3Q7EA 3K0CC 1T0JB 5DB4A 1QH1A 2HLDA 4M60A 5IM5A 2WFLB 4MKHA 1H94A 3AUTA 4GP7A 1XTPA 1UAYA 2FPKA 2JCYA 4GOXA 4DEYA 3T7IA 2G4LA 4AY2A 4RPGA 2QN7A 2Y77A 4R9NA 3G13A 2XADA 4XIIA 4CM9D 3FFAA 1YCFA 3A3YA 3WK9A 1ZIDA 2WIDA 4HTFB 3QLJA 4RBNA 2PMCA 3D6JA 4FLEA 1N0VC 4DC9A 1UDCA 1EK5A 1QFSA 1SB9A 2REOA 1RKBA 2V4ZA 1OTXA 2P2NA 3DYVA 4PNPA 4W99A 2Q49A 3FAKA 4RKRA 1E7YA 1DRKA 4O4HB 1G1AA 2ADMA 1ZRMA 2G0TA 3WYAA 1DXHA 1QDUA 1UPTA 1RI1A 1U80A 3F71A 4BASA 1KYWA 5IDXA 4OTZA 4Y2JA 1YGPA 5FOSA 4B7AA 1UK6A 2VAMA 5CDGA 4CEHA 4TMWA 1S5PA 2BEKA 3I9FA 4QG3A 1RAIA 2PLNA 4G84A 1J8FA 1SUFA 3WI7A 2C5SA 2FG7C 5B1HA 1RXWA 1VE7A 2WM8A 2XUKA 1GUYA 2Z9BA 2ODTX 4MEJA 5LBIA 4Z1OA 4Y1EA 2GEKA 4BTEA 2G09A 1NX6A 2EJVA 3H9EO 1QM5A 5L4SA 1GY8A 4OP1A 1O3YA 2DSTA 3U7GA 2QSJA 3BT7A 4MQUA 5H16A 2D2IA 5IBCA 5ENVA 1ONPA 2J3KA 4DR1B 1KVQA 3H6HA 3PKJA 2CBGA 4R2WA 4EBFA 4F06A 2Q6LA 2ZRDA 5B55A 1OT3A 1RLJA 2ZSHA 4V0QA 4YMWA 4BB6A 1PCXA 4HEHA 2H0AA 2V98A 3DV0A 5E9JA 2ZU6A 3TUZC 4B3TB 4DIMA 2FN8A 1CQXA 4MLZA 2PR2A 3E15A 4E2XA 1F2UA 4LMBA 1JR2A 4U2BA 1ORVA 3L0DA 4DXHA 1VDMA 2WYUA 4RS4A 3RV3A 3AZPA 3ZHUA 1PW7A 2E18A 1SN7A 3GNSA 1CR2A 3V34A 5C35A 4GOND 4FCVA 4OA5A 2JCXA 3WDLA 1X7DA 3B6JA 4BLQA 4DM4A 4DMMA 1LDEA 2OY0A 3K05A 3LIPA 5FL3A 1N2HA 2Z8YA 3R7DA 221PA 3L8FA 3OJXA 1Y6ZA 2LR0A 1U8XX 3VI3B 1DINA 4FCTA 2PQ6A 4BFVA 2GBIA 1WZIA 1RXEA 1ZCBA 2IUEA 3FHLA 1H2ZA 1P2SA 5I3CA 1Z4PX 2BM1A 3WL3A 4BU0A 4HEJA 1BRMA 4HXEB 3DOEA 4YYEA 1MB3A 2PV0A 2HMSA 2QTHA 5TPWA 1K7FB 3OA0A 1HUQA 1X86B 2ZLBA 2L69A 3PX7A 2QTMA 2ZITA 4Q1BA 3V8VA 9ABPA 2IS6A 2M32A 2GETA 5FOQA 2E55A 3O1LA 4K3VA 4G2NA 4EM6A 1PUIA 2VP9A 4GPEA 1YCGA 1CYEA 5HF5A 4DNOA 5DHTA 1CJSA 5BR1A 5EIBC 4AJ4A 3MG9A 4ER7A 3SLKA 3AWDA 1L7DA 1P1HA 4JLKA 4WZBA 4JLJA 3P9PA 3VR4A 2HIMA 2B83A 4FZJA 4OIMA 4O29A 1P62B 1Z0DA 2ZVDA 2QKYA 4AP5A 1IZYA 3EAGA 1CZKA 3GVHA 4F4UA 3A25A 3LWDA 4Q9AA 4AS2A 2R8XA 4C4OA 2ZS8A 1LPNA 1EVKA 1LPOA 4MKZA 5AT1A 5B3JA 3IIIA 3I09A 5HX7A 3GFTA 5JO9A 1V16A 4BTVA 5K2MA 5B7PA 3VH3A 1ECLA 4MW9A 5ED4A 2RHOA 2W0SA 1TGVA 2G0NA 3H6GA 3K6KA 4KW7A 3S2GA 3TQSA 2BGGA 3AF2A 4N4AA 3QMMA 4LXTA 3OX2A 3TTWA 3AI3A 2CNNA 4BX3A 1IWOA 2WD7B 3A05A 3ADOA 1W2HA 3E48A 3QVMA 1ZI6A 1E6LA 3PT5A 5JQGF 3T06B 1SXHA 2ZTLA 3OQIA 5CLGA 3ZV4A 3U7HB 3P45A 4EA8A 1U2GA 1KH2A 3QFSA 2C96A 1IN6A 4OI2A 2VBFA 1KAOA 4RAQA 5ECDA 2LVBA 3BG5A 4C43A 3O1HB 4A8HA 4DMFA 2O4CA 4CKBA 5EJFA 3SYLA 3B70A 4M8LA 3EIUA 1XTQA 5AVXA 3DH0A 4K6MA 1S9DA 1P8AA 2I9KA 2FFRA 3EXHA 1MJ5A 1PL8A 1DTEA 3TTVA 5ADHA 3SVLA 3ZQ4A 4PCLA 3KHSA 5IPFA 4EY5A 2V7VA 1SUBA 3UXMA 4BZPA 1Z7BA 3O1JC 3FPBA 2JBAA 4BN4A 1HOXA 1EEHA 3ZDAA 2JI4A 1QS0A 3FCSB 1JEYA 4IO0A 1PR0A 5CIWA 3SVZA 1Q91A 2DULA 3V7FA 2XPCA 3EBPA 4EA9A 2FPLA 4J49A 3T7AA 3PHCA 2TMDA 2WA1A 4C3ZA 2HA4A 2DMRA 2ZJ8A 1FFWA 1CNFA 3AI1A 5AVQA 4RCYA 2PGXA 1HEYA 3PXUA 3JQ7B 5FBQB 1J42A 1K63A 3N3BC 4HFRA 3AUSA 3B9RA 2WJ6A 4KODA 2I6SA 3DNMA 5DGDA 4DIBA 3WHKA 1X15A 1YU9A 4E15A 1TZ2A 5ITSA 3DMFA 5AJZA 1Z22A 4AUEA 1E0AA 4OQEA 2HBRA 4RYDA 3TXXA 4YJ3F 1GZSA 4LPSA 4BRZA 1BWQA 3AZQA 2WWHA 4CM7A 2OBNA 1RLOA 5ADWA 2O8BB 2YWRA 4WUTA 3A3KA 1ODFA 2G80A 4C7OB 3ASYA 4ZKEA 1OX6A 4OFWA 1W94A 2XDYA 3EN0A 4AL4A 1M0SA 1PG5A 3Q3EA 4AFNA 4DBVO 4OI4A 3O6VA 5AVJA 3VU1A 4QRIA 2QX4A 1UBMS 2DP4E 2X4IA 4FE4A 4B4WA 3KRTA 5AM3A 4W8HA 3DXFA 4Y2HA 3DVRX 3ICPA 4JP3A 1CY6A 4PPGA 5EJ8A 2Q0XA 2OQRA 2XLCA 4C88A 4NZ9A 3NBMA 2OBBA 4JBGA 4Z9XA 3SGLA 5BRNA 1G8HA 4TQGA 4JCOA 3REQA 1AVTA 2XB4A 3L2OB 2C3PA 5H5JA 2H3EA 1RHMA 4LYFA 3RASA 3KR9A 1NQUA 2V6MA 2FF5A 3A04A 5CTAA 2EC5A 5F7JA 3M6AA 3VR2A 1J1IA 2NVOA 1XTZA 2IEIA 3MJRA 1BX0A 2FUCA 5HE8A 4ZGWA 5JAUA 3FGPA 3WBJA 2O8DB 2JLBA 2GM5A 1PJ2A 2FXVA 3QF4A 2QRLA 2BFMA 4YWHA 2JGKA 2J9FB 2ZRJA 1RQXA 4EO7A 4CLRA 1L4FA 1Z5ZA 4QBGB 2I4TA 5FUWA 3K0CA 4TT8A 4OLJA 3TZHA 3T1VA 1R4MA 2QX6A 1I51A 3UHFA 4DM7A 4AP6A 2RK3A 3H8VA 4F3TA 5K99A 2OCDA 3ZQ6A 2NSJA 3TI9A 2R84A 1G6KA 3QYJA 4TT3D 4BKMA 2CD9A 2ID4A 1AXRA 1TLLA 2GXUA 3FUTA 4ZDJA 2P9HA 2WSIA 5GZ3A 5F2KA 3ELWA 3R0ZA 4XUGB 2ZKIA 4HT3B 1V9CA 1NVWQ 2V4MA 2VZ0A 2A0XA 4HDKA 4C78A 4K6OA 1PWHA 2WHEA 2IUTA 1WCIB 3AFMA 2LIPA 3AW8A 3PUZA 3FKJA 4NX2A 1A9TA 1THZA 3GRVA 4OQZA 1KDOA 3CWCA 4RD2A 4B82A 4DPKA 1U0LA 4HFNA 1CVIA 3DO6A 3DYBA 4TGLA 2QUZA 5ALDA 3CIOA 4UDXX 3WLRA 4FYWA 2Q6VA 5JDIA 4C21A 4BNNA 3SQOA 3SHFA 2ISCA 3UAWA 3P2YA 5ERGB 3DKIA 4KDRA 3P9SA 2JAHA 2NOAA 3HY3A 3PPXA 2Z4SA 3QU7A 2AXQA 4MIEA 4Y2YA 4EA6A 2PZ8A 5AXDA 3AEXA 1DU4A 1G42A 3A14A 4KYVA 4H2DA 1UKAA 3DJYA 3C3MA 3CFYA 3TLCA 1DC8A 4Q02A 2GAJA 2ZS9A 2O7NA 4TV9F 3O8DA 1PNTA 2XWJI 1SQ6A 4MJ7A 3RAPR 3RUIA 2IA5A 2PGDA 2W7TA 1QQBA 4F5DA 2X15A 1YZTA 3MCTA 5E3IA 5LP1A 1EGMB 1PRYA 5G41A 2PK3A 3AR5A 3HLKA 5JRZA 2HLHA 3V7WA 4F9TA 2Q3FA 4J0GA 4PG6A 4DQLA 2PXCA 5B58T 5HOEA 3EUWA 1KBZA 4RMNA 3B1KA 4BZQA 2LD4A 2AMLA 4TTQA 4JYAB 1X8JA 4GXNA 1SU6A 3NU1A 1OTYA 5LZ2A 2VDUE 4ZARA 5FT9A 3GLGB 1B15A 3V42A 2O2SA 2H1SA 4C89A 5MGBA 3A1VA 5DDIP 1XQVA 4XB1A 1TUIA 1I6WA 1R9GA 3G0GA 2AYXA 1R15A 2DWCA 4ER3A 4WXMA 4UNRA 4LNHA 1QH8A 1QJCA 4G36A 2E5LB 4LZOA 2WE8A 2XUJA 3ZS8A 3JQDA 4KO3S 1LI4A 3BEOA 4A36A 2D1RA 3GMDA 3BIFA 5IAOA 4J76A 2HX1A 3MMSA 4DXAA 3DMHA 1NC1A 4HC4A 3CLSD 1JQKA 2H2IA 4KWIA 3UV3A 1XD2B 4D0SA 2HYDA 1D0IA 3EH1A 2O7SA 1T15A 4JYCA 3RLIA 2ZJ4A 1M2OA 4MTLA 3QTTA 4YI5A 2EKQA 1EKXA 2XQVA 5E9QA 3L0SA 4JB2A 1J9EA 5ALNA 1NY6A 1TX4B 2ZYWX 1VG9B 3AHHA 1ZDMA 4K5QA 1ZKDA 2GK6A 1NXTA 1JZTA 4ZC1A 3THSA 1MD9A 4MGZR 1U04A 2QQ0A 4HN4B 2PFGA 1AS3A 4EW1A 5B30A 4HDRA 3KL4A 4R2IA 7YASA 2D4HA 3OICA 4C7XA 2NTVA 4O2LA 4D26A 1ENZA 3D9QX 4K6HA 4KIGA 4KIFA 3S2YA 1NFQA 4F97A 3W5CA 2H4JA 5ISMA 5FTNA 2NYRA 5JQWA 1IXKA 2GJAA 2ZJ3A 3LHSA 3ZCPA 3KQYA 4CL2A 1NKVA 5HKKD 4I7EA 5DN6A 3EGDA 2Q2NA 5IWCA 1U8TA 3ZE9A 2K4MA 2BTQA 3UBTA 1APBA 1WUIS 3W9YA 1E3MA 5C34B 4PEVA 2AI2A 3CG4A 1UKZA 2IOFA 2OGWA 1KVRA 2GZAA 3HBNA 3FUWA 1GSOA 1PNQA 4S35A 4RETA 2BISA 5EJAA 2VP3A 2NP7A 4TMZA 4DDMA 2AB0A 2AG0A 3ZCXA 2LDBA 1U0HC 2V0NA 2OSVA 1I2DA 1R4NB 4KLNA 2LDXA 1FBTA 1GSHA 4FZRA 4PRYA 2ECPA 1PYGA 2FSHA 1UBKS 1HR0B 4NBRA 1IYZA 2QX9A 3JRWA 1X1DA 4DC0A 3ZJVA 1DKUA 1W8IA 2NPIA 2GAAA 4RPJA 2CKDA 4EHNA 3L9XA 4L5BA 4D9MA 4OJMX 2G17A 1NAHA 2IPOA 2OC9A 3UN1A 4TOIA 2DAPA 2ZM5A 4WXYB 1U7DA 1CEEA 1QGOA 3PNOA 3U0BA 1V3QE 3BRQA 3EBLA 4HS9A 2OCKA 3JY6A 4JB0A 1R6UA 2Q6TA 3RQSA 2V55B 2ZB3A 3LYUA 4WLNA 2Z2IA 3DPSA 2Q1XA 2AOWA 1E6UA 1I1OA 4OHXA 5JLAA 3HA5A 4H1HA 5EE9A 3KZMA 3SIXA 4KN8A 3IAS6 5FPQA 2PZJA 4E5VA 5BVHB 2ZB4A 3A7EA 1RYDA 4MLPA 1DX9A 4RPKA 3N2EA 1FRFS 2VNJA 1FFDA 4M9XA 2YFHA 5HP4A 3MTEA 4BJ6A 3VNSA 3X1MA 1YF3A 3LPCA 1BO6A 1NTOA 3KT6A 1JQ3A 1BVHA 4IJWA 2E0IA 4K88A 1E6CA 2ORIA 4KG7A 4ZVRA 4ALMA 1V6SA 4UCFA 4YBZA 2AOXA 1IOLA 3R9IA 3FH0A 3JWEA 3ZIAD 4E07A 1EIWA 4L75A 3INTA 2YX1A 1WDTA 2H1VA 1KPHA 1I4OA 3HHEA 2OGZA 4JEUA 4WLUA 3LYLA 2Y71A 4MQMA 1DTSA 1RQ7A 1SBIA 4F4CA 2PVCA 1MTZA 1UWKA 1E99A 1LJLA 3AUXA 2Y1FA 3PXDA 1CUJA 3Q5EA 1Y89A 3QJ5A 2ZSUA 4PCVA 1C0KA 1DAPA 1FFHA 4R7TA 3RK0A 3NPAA 1ZM9A 1ARZA 4E5DA 5CBPB 1IE3A 2TSYB 4YK7A 4KQWA 4RY9A 4LUCA 1MH1A 1VHJA 4E32A 5JC8A 2ZGVA 1NN3A 4O4LB 1VTKA 2XX3A 1YVRA 3B1ZA 4FFBB 4HRVA 2NLOA 4OQLA 4KGXA 4I4LA 4Q9KA 5A0FA 3AHIA 3R0VA 3R7WA 4F0JA 1NMXA 2FEMA 3C85A 5ALVA 2BEUA 3KEFA 3PQDA 2WWTA 3MIZA 1H2WA 3HP7A 4LYYA 2V74B 4B2PA 3USZA 3E3MA 3HBAA 3M83A 2ZBGA 3RUHA 2D3WA 1ZLXA 2VH1A 2VQ6A 4FQ5A 5E6RB 4ZAWA 4I9HA 5T4BA 3RC8A 2QMUA 2H1WA 1SXPA 1IXRC 2KBFA 2RB4A 1MC8A 4C4PA 2KMLA 1TJPB 3MTGA 3CXUA 4OQDA 3C7DB 4R5MA 1CS0B 4W5WA 4B80A 3H05A 2GRJA 4IIJA 3ELUA 1T4CA 3GQBB 4K9KA 2WE7A 1C50A 2YJTD 4CM1A 4R05A 1CUBA 3EC1A 4A7PA 1RRPA 1CQJB 1I3MA 3ZTTA 2W00A 1H0HA 3CW9A 3WTCA 4KQ6A 4XWYA 4B32A 1L7AA 5IUJC 2JCBA 4TTIA 1GTG1 3BL8A 3RUCA 3WGKA 1JR3A 1CZOA 1CQIA 2FFQA 2VTVA 3I04M 4HN2A 1KI2A 3TEJA 4B3XA 4C7MA 2OOSA 2XCSB 5KNBH 3A9UA 4S2UA 3HJNA 3PFHA 4DCGA 1K7SN 4PBRA 3N7TA 3HUTA 3JAKA 3RVDA 2O5CA 1B7GO 3ETJA 1C9EA 3HTXA 1ZN8A 2F3RA 2GPSA 4GKKB 1NMZA 1YB5A 1Q3KA 2IZOA 3IE2A 4MV4A 4PQYA 3ZUGA 1ZXLA 3DOFA 1MH9A 3W2TA 4HLCA 4ZI3A 5JSZA 3TB6A 3ACDA 2BFNA 3TB4A 2ONZA 5DIFA 3TTXA 3KYBA 1J2TA 4DSTA 1KEEB 2JIOA 2NZ8A 5IJ0A 5KTPA 4H3SA 2ZAIA 4RA6B 4UU1A 1L4YA 2NTYC 2MMCA 2BN4A 1WD7A 2IPMA 3G3EA 5B12A 2V65A 3ANTA 4FDAA 2C7VA 3EZ7A 1QAMA 2HM7A 2BHSA 1YRBA 3ZNNA 3EPJA 1WSBA 3BCSA 4X90A 1NVVR 1EBUA 4Y6RA 3T3MB 4Z2AA 3E18A 5BNFA 1M6HA 4D9CA 4ZEXA 1NRIA 5JW6A 2E49A 2J0UB 4DT1B 1KO5A 4ZPXA 2P2ZA 2PMBA 5FD8A 5T64A 3TOZA 1XA0A 5GTDA 3DOIA 3RIMA 2ZUUA 4H0FA 3UHAA 4WCDA 4XLTA 3P0HA 1D2HA 3EMKA 3OC6A 4J4HA 4BNZA 4QKQA 3L49A 2JGIA 1G2QA 4X3OA 4EVQA 2D5LA 3FTQA 1OH6A 1AKMA 1ONOA 3OZSA 4UJ5A 3I5UA 5M7EA 4PU0A 3ILVA 3RAGA 1HC7A 3RC7A 1GSIA 4EG8A 3PTAA 1JU4A 1PQUA 5JLJA 1ZUNB 1M8GA 3AOEA 3N70A 3LT0A 4NOKA 4QGSA 3R3UA 2G70A 4WXHA 5JNLA 1B8PA 2C8VA 2XQFA 4RDCA 5K3FA 4V0SA 1WE2A 2Z4TA 4RUKA 1M3SA 2VLIA 2AZ4A 4FSDA 3HZZA 2FMHA 3C6QA 1QBKC 1PNVA 1SKBA 5K0GA 3B1VA 2XD4A 2XOXA 4N0QA 2H5IA 4TN1A 4TZ0A 3MELA 1GGMA 3AKYA 1U02A 5TF4A 3QQ5A 3ZBTA 1W52X 3ENVA 2CVZA 3N0VA 3CPHA 1P1IA 1C3JA 4B34A 3CVUA 2VQFB 2WWRA 4KSCA 2CEKA 2HMYB 4P92A 1ORTA 1IC6A 2BF7A 2RHTA 3FPHA 1E6EA 1RXCA 1KOLA 2WNSA 3WIBA 5EJEA 3F7MA 5CFZA 3UGJA 2QTAA 3NZEA 1ZC4A 1BW9B 2A5DA 1N92A 5B36A 1JHZA 1IY2A 3PNYA 2QTNA 5AM2A 1O8CA 1RABA 2D06A 2GD1O 4DCCA 4G5GA 3PF9A 1DBIA 5JUWA 1IJKA 1UAGA 2Y92A 3MTJA 4BQNA 1BU5A 3AHFA 1YB1A 2W2VA 3UBMA 2JANA 1NQ5A 2GKSA 1TJ4A 4DOMA 1E2PA 5E9AA 2AOUA 2M1XA 3F5DA 3U17A 2XZDA 1EXDA 4HUTA 4MVJI 1SFRA 1A9SA 1T9AA 3LLCA 1XVVA 1R74A 2WTEA 4TS3A 1PWZA 1YKSA 3LO8A 2OWDA 5TQ2A 4QUAA 4XM1A 2XB6A 1NNUA 3E1SA 4KXMA 1QB7A 3P2KA 4NC9A 4KI0A 1BMFA 4XQCA 4YCMA 3SQWA 3SBEA 5EA2A 4LSGA 4HNUA 4FYXA 1TYDE 3KPJA 2VF4X 4JP1A 2VDPB 2VHTA 4RXUA 1HYQA 4XAQA 3ZDQA 3QJGA 2NNWB 4Q7KA 1J56A 2CF5A 1WSDA 3QBVA 4IDDA 3WV5A 1COWA 1B8VA 2EGHA 3RE1A 3UH1A 1WRBA 3L0CA 1JGTA 2C3OA 1KDYA 3U3OA 3O9MA 4ODIA 2FPGA 1X92A 4BLVA 4OKSA 3X1YA 3WK6A 1D4ZA 3HFSA 1U0NA 2EYQA 4CQJA 4M2LA 3PNPA 3PU6A 3LUHA 5C1IA 2QTLA 5U1PA 1GKUB 1AUXA 2RHLA 4X20B 4PR0A 2OBMA 5A3SA 2JI6A 4CL0A 3CLVA 4KAFA 3C3JA 4Y1RA 3HY4A 1MF7A 2I7DA 1F4VA 3GAFA 1YS1X 4DLUA 5DBGA 3GFGA 4AJ9A 3NYIA 2R8OA 3P9IA 4JQOA 4X7BA 3V9PA 4BVBA 1MOZA 4HAYA 3U7QB 4J4BA 1KY5A 2PY6A 1N1MA 4A0SA 1R00A 2NN3C 2EHDA 1P44A 1H23A 4Q5IA 2BCEA 2J1LA 2XQKA 5LYJB 1IY0A 1R1DA 3UV7A 2QBYB 2AC7A 4D98A 2OFOA 4M7PA 2RHCA 2R6CA 3B12A 3IILA 1CPYA 3HUDA 4PNZA 1G66A 2AT1A 1P45A 3DOCA 3ZU5A 4YX9A 5CEFA 5A62A 2YQZA 2FW0A 5DLPA 1JWBB 2X3UA 4GDFA 3IQXA 4YMTA 2HHJA 4MW0A 3WIVA 1I2ZA 3EEIA 2FSFA 4N82A 4E88A 4R1UA 1GKIA 1Q1ZA 1KZGB 2XTAA 4ZCLA 1E9AA 1QRDA 2V5VA 4I55B 3E9CA 1D4AA 2ZAYA 1Z62A 3KM0A 1JVSA 1QP7A 4M8IA 1W5BA 4KDEA 3KAQA 1KYIA 4HTAA 1ZNXA 2JC3A 5COBA 1M2GA 3AG5A 5DGIA 1CCWA 2CJYA 4D8UA 1US8B 1C8KA 1GPYA 1B26A 3OO1A 3D2AA 2PX3A 4UDOA 3FGNA 1WMSA 2NZUG 1PN3A 4EY4A 5TF0A 4LC1A 4NNOA 3VSAA 4AF6A 5H70A 4CFSA 2QZSA 1Y7PA 4OUDB 4OX9Y 4AX4A 3PTLA 1AZLA 1OHHD 1V2HE 3PLNA 4HB2A 4B6OA 3UFBA 2QWXA 4MXDA 1KMQA 3D8TA 1Q0UA 2IVFA 4CT4B 1C1HA 2YBDA 3AEZA 4MJ3A 4AKEA 4YA6A 3T5GA 1FQOA 1PV2A 3CZ4A 3CRNA 2B2XA 4KIUA 4YUZA 1PFQA 1LRLA 1KY3A 1L7OA 5CGQB 3F3YA 4WD3A 4CIAA 5E4JA 1ZRNA 1GPAA 3R3YA 4XJVA 4AULA 4Q48A 3WX0A 1YULA 1WDWB 1MOQA 4CM4B 2RGBA 1JHRA 2VK4A 1R8SA 5TQ0B 3ZDFA 3C6ZA 4LRWA 1YUBA 2Q1YA 3EIOA 2C97A 5A5EA 2R47A 5CB8A 3WKEA 3HVIA 2PWBA 4BFWA 2HY7A 1PI3A 3ZLTA 4OSOA 2PS1A 1L1RA 4Q4HB 3GLIE 2DBZA 2ZIGA 2QM3A 3ISTA 3SQMA 4ZOQI 3WGIA 1R0LA 5CJJA 4NARA 1J0DA 2PVPA 2ZI9A 4BVGA 1PT6A 4IQ0A 3GEBA 4RF4A 3FTNA 4WOBA 1EH5A 2EXXA 1MEOA 3ORRA 1JR3E 1ZIOA 4MDYA 1QLJA 3GLHB 1BKSB 2W2LD 3KOWA 3WSTA 4YRGA 3NS7A 3LL4A 2PS0A 4PXYA 2Q9UA 3O3CA 1O95D 1SRQA 2ZYHA 4AUMA 5IM4F 1JG4A 1QH1B 3OLQA 4LZAA 2UYOA 2G6TA 4XR4A 1KS9A 3DW3X 4MVCA 1SBHA 2JHGA 2XCOA 1PR2A 4M8NE 1J09A 1QCDA 2APJA 3QMWA 1TL7C 1N2IA 3ZWAA 3QEAZ 4QRDA 4R0NA 4U4AA 1NW3A 1P5RA 3V1MA 1RKVA 3TIFA 5ADVA 1IY9A 3B78A 3RJTA 4B5KA 2D8MA 2HQOA 4DABA 2HA7A 4LQCA 4RENA 3GLQA 4EG6A 1UH5A 2QYTA 2HWXA 2VWGA 1AKYA 2YV4A 3TVTA 1G8JA 5CJ2A 1EWQA 3AR4A 1N9ZA 2B9VA 3H13A 4HWSA 3JSAA 3UYKA 2IP1A 3OM0A 4FGLA 4IILA 4RF3A 4CKZA 3M6IA 3F8TA 3S2ZA 2E5FA 1Z5PA 3LQFA 3H99A 2ZTMA 3L79A 2BM9A 1Y8QA 2WU4A 3TX6A 4HAIA 3R0XA 3K9HA 3KPVA 5T4FA 3PNKA 2PAFA 1E3TA 3MOSA 4P9NA 1MOSA 4CEHB 4YJGB 1E0SA 1J2EA 3CISA 1SCQA 4MWBA 4ZREA 2XITA 2RARA 5KS2A 3T15A 3PWTA 2EIXA 1Y4DE 4TM7A 4ZT2A 3S6JA 4Z7NB 3UAOA 4YMHA 3BWXA 3I76A 3MWLA 3SXUA 3AK4A 4R6XA 3BJEA 3K9GA 3I83A 3ASVA 1XQ9A 3LOUA 1X9HA 2LTAA 5JSYA 5LZ4A 1Q74A 4TRMA 3T7EA 1KFBB 2NO4A 4QLOA 2CHUA 3AKDA 4QOFA 3NIDB 2YBEA 1XEWX 4W7SA 3W3ZB 2CXTA 4HK4A 3J80A 4MVJA 4ALKA 4IPTA 4YQFA 2MSEB 3LW8A 4HLNA 3DDWA 2NZ2A 4A03A 3DV0B 1WKBA 4NE9A 4M0UA 3FIJA 2QPOA 3R0QA 5FA8A 1PJTA 1NXQA 5CDUA 4JX9A 2C61A 1F2UB 1CIJA 3QOXA 2F3TA 2IYXA 3U3RA 2GN6A 1XQWA 1RVV1 2EKPA 4FU0A 3W7VA 1JSCA 1W36C 2GFQA 3RVJA 3W5HA 1M8JA 3GFRA 1M72A 4BFYA 4FHGA 3W3AD 3VPCA 4M76B 4CTKA 2HT1A 4WKNA 5I7HA 4PYMA 2QYOA 1OLSA 2Z9DA 1D7OA 2TMGA 3QLEA 1U0OC 4DNXA 3HCAA 3N75A 4RH1A 4F2PA 2XT0A 1U7XA 2A67A 2ORED 2P35A 3ENKA 3KVRA 3PJDA 4U1RA 4B8ZA 2O8NA 3DL7A 2AC4A 3OJLA 5TPWB 1QOPB 4PLPA 1CZRA 1AT1A 2I4OA 2ZW9A 2E1PA 3OY2A 1S7CA 1T0PA 3PC3A 1UZUA 5FEMA 5FWDA 3RRNA 2D1FA 3C74A 4TXJA 4ES6A 1FVFA 5BV1A 2ACEA 3DZFA 2B8JA 3W7AA 3EW9A 3UC5A 4KRGA 3Q41A 4ND8A 1EEXB 5AVUA 4PQRA 1HEIA 1WAMA 4KWCA 4IDOA 3HU2A 5K8TA 4WZBB 1FLAA 4B3MB 2X0EA 1LU9A 4EBBA 4GHWA 3AF4A 4Q37A 1XQ6A 2MMGA 3DE5X 1OYWA 1DRWA 1BCSA 3LSTA 1HE5A 3WS7A 4NDNE 1H8HA 4EI7A 3QWAA 3A1EA 4I4TF 4ZOAA 5PNTA 4ZVQA 1C7JA 2QHXA 1WPQA 1QPZA 3TW6A 4CTOA 1D1SA 1VL8A 2WUVA 1E77A 4RW0A 4TTJA 4KYTA 2WMYA 4UQLA 1P7VA 1KHHA 3VPXA 4A0HA 4A0RA 1V16B 4Q82A 5DRTA 2P6NA 4JBNA 2IFTA 3DQQA 3FMIA 4L8FA 2WF7A 1G59A 3O90A 1SUAA 2WILA 3OZCA 1R4ZA 1RLUA 3NDBB 3SM3A 3AVUA 4CHGA 2ZPTX 1IPEA 3BULA 2BV3A 5CYOA 5BO5A 3R5JA 2G1UA 1UOEA 1I8TA 2PJUA 2ECQA 3TL3A 4I14A 1LPAB 4LN1A 1Z75A 3ORHA 3CB2A 4DMRA 5F1KA 4OXQA 3ZGXA 3SS7X 1TEHA 2BELA 3OQIB 3NDIA 3AY7A 5FAKA 5LP6F 4TM8A 2IE8A 5FO1A 4M4SA 3ZU6A 5FCDA 2CMFA 1UODA 1MHTA 4OB6A 3DE1X 2DGDA 4PZPA 4R5HA 3LT2A 2FJ0A 4IDCA 1T9HA 1LF5A 4P54A 4JSRA 4R81A 5DHFA 1UIMA 4Y2SA 3OEWA 4V0NA 3RS7A 3F3KA 4P1ZA 2AGVA 5HRUA 5EG5A 1CY4A 3FNQA 1UPBA 2E2WA 3UOWA 5BYJA 3EXHB 3QOYA 1C9JA 4PSCA 3SSNA 1KMIY 1ZM4A 2D74A 4EGJA 3TL2A 4NZYA 4EX6A 4AQDA 3TO5A 2DBQA 4A8PA 4P22A 1GG5A 1I9CA 2JBAB 2AR9A 1G9TA 3EEFA 3DWFA 3WMFA 2PUJA 1DIBA 1QS0B 4HS4A 2HV8A 4NABA 3W8DA 1JEYB 3SEQA 4KXWA 5IMBA 1Q7CA 2H4ZA 3I6BA 2NZXA 5JZOA 3HCFA 3HJUA 3FBTA 2EW2A 4X8OA 3K8QA 3NYWA 4GRDA 4FFPA 1BKYA 3H0KA 1TT5A 2OR3A 3K53A 2CNBA 2UXCB 2LRHA 4DA9A 3PRHA 1C14A 5C80A 3JV7A 2CWWA 3ZHOA 5KVSA 4P5DA 2PL5A 1M6VA 1RWVA 4AYTA 1T6YA 1H2BA 4X7MA 1Y8AA 3ZI4A 2C2HA 3K73O 4Y2UA 4BO9A 2ODBA 6YASA 3AETA 4W7IA 5IWAB 1PR5A 2FN7A 1MRNA 1NR5A 2I29A 2QVYX 3RFTA 1EUDA 2B1RA 2BTEA 2VNAA 4MUNA 1MZPA 5FRDA 2Q0QA 5BMVF 4U7PB 3VFDA 3N2IA 4GECA 1OV6A 3SQLA 4WOPA 3KXDA 1NN5A 1Q17A 3S68A 3VAZA 2G07A 3DDUA 4YV7A 1RWOA 3VKVA 4KFTA 2C83A 2B8WA 2OG2A 4MP6A 5ALEA 5HKLA 3LVRE 4RQAA 5BSVA 1IIRA 1F8YA 1RI4A 2H1IA 2I2CA 2YN0A 2J7KA 3FR7A 4QA9A 4IF6A 5K5EA 2GF0A 4C30A 4OYLA 3VOAA 4RIHA 2YIVX 4K87A 3REQB 2PRJA 5JD3A 3Q7QA 4A2PA 4O2BA 4R9VA 5H83A 4DWVA 1WY5A 2I2BA 1WPGA 5BSMA 3RVRA 2DPYA 4DMKA 1L4EA 3QGMA 4QULA 2IKQA 3MEQA 4B4VA 4OP3A 3O3NB 5ICGA 4PAOA 5ILQA 3A4MA 4QOHA 1UXGA 3T41A 2LZ0A 1VYHA 3LFUA 4AJHA 3QF4B 4EO9A 1SXJD 1XL1A 3KQPA 4I9GA 3AEQA 3LBYA 5IZCA 1JDBB 3FSRA 5EC8A 4CLRB 2BMWA 4UOQA 4GBED 3D7LA 4LC9A 3L6EA 2C0PA 1QNFA 2CZCA 2Y27A 1R4MB 3PKZA 1UPCA 3Q7IA 5FR1A 2ZRPA 5E2AA 4E08A 5EJ4A 4YMGA 2VNKA 3GARA 3MBOA 4IDHA 2H2WA 3HPRA 1MIHA 3NJ8A 4J7XA 1AQNA 4ZVMA 4PW0A 3UZUA 2VK1A 3IP5A 4ZTZB 4ER5A 1X1AA 3PEVA 4E70A 3PICA 4OBXA 5C1BA 1E6MA 3KB2A 3L93A 1AKWA 3FTCA 1FOEB 1G18A 1WVIA 1TU3A 3M1IA 3NBQA 4TTPA 4WLOA 3ZI0A 4L9WA 5FOXA 4DGQA 1QIHA 4HDKB 1N3IA 4KBFA 2IIVA 2VHCA 4LJKA 2G77B 3VDQA 3P4UA 2R4QA 3GLVA 4NFSA 2KBEA 2E4WA 4DZRA 2ZE7A 4Q3KA 3LTEA 1S3IA 1OA0A 2PD3A 4P53A 4UMDA 5AKKA 3JWPA 3BZWA 4IBOA 4C4YA 1E3IA 1Q3TA 1QVVA 1FFGA 4IJUA 4TROA 4XCVA 4YLYA 1RPNA 3HNPA 2V9PA 3YASA 4NQZA 3C43A 1XEXA 5E4FA 2LPMA 1GT6A 3DZIA 3MC1A 4HMQA 3TKAA 1XVUA 3F97A 4DMLA 1GUDA 5F21A 4FYIA 4XQGA 2CCJA 1ZUWA 4PG8A 4R1SA 2ZAMA 3WLJA 1QMPA 4HQKA 1ZR4A 3IHWA 2VRBA 4G07A 3SDZA 2JHCA 3WHLA 4QD3A 4ER0A 1HMPA 1EAMA 4ZMRA 1YB7A 4NS1A 1U28C 1U8CB 2C8JA 3QXXA 4DDUA 2HW8A 3FPKA 5ALZA 2OAP1 3STYA 3VUFA 3G2PA 1G8AA 1MBZA 2RK6A 3IQIX 3AFNA 3HN7A 1PFVA 3EA4A 3K09C 2BJVA 2X5XA 4O5AA 5FOUA 5K0NA 3UJ3X 4QUDA 2FVXA 2N42A 4O2AA 1QFXA 1FFYA 5D3ZA 1POXA 2W90A 3KXKA 5EXXA 3MGBA 1RM0A 2NSDA 2W43A 3OU2A 3SIRA 1N5MA 5IBQA 3VM6A 2RGYA 5BSHA 4XUCA 4NBUA 4MKRA 1YE3A 5DNAA 2B8EA 5DSTA 2EKBA 3AEYA 5KYGA 3FJ1A 2VSFA 2XSZD 1QH8B 2AFRA 3RYHA 4IM7A 1QP0A 1K6IA 3KJGA 4LZJA 4LYEA 2XAUA 1JQDA 3VKFA 4JNKA 2BFCA 3EBOA 1XROA 1U4NA 2B99A 1VHDA 2E6KA 2VXCA 4O6VA 2QZJA 4JJZA 3DB1A 4R68A 1TT7A 4M36A 5C5CA 4NZPA 2EW1A 1Y98A 2X9LA 2WZCA 1O5IA 1RJGA 3FYTA 2ZT8A 1BXKA 4JVLA 1HT3A 3IODA 4UBKA 3RUAA 4HNVA 3IO5A 1N1DA 3QEOA 4MS4A 4RPHA 3FAZA 4PZUA 1GO2A 4ZZ1A 4QG7A 4DLBA 3OLCX 2R6HA 5A1TA 5KYXA 4F5YA 4DM3A 1VMAA 1TUGA 1LV8A 4I1RA 4BE4A 1X1SA 4IGEA 2PGOA 1ZW1A 2FUEA 2VCYA 4HDRB 3VKHA 4NF2A 5DN9A 1OZ0A 1DL5A 1R9NA 2XNJA 2JASA 1KMMA 4UC0A 4FZ5A 5LDHA 4RXTA 1FDWA 4UBLA 1WLYA 3LD9A 3OCZA 2EFDB 2IDKA 3HDTA 1XJWA 4YAEA 3EGDB 1H6DA 1JFVA 1QIJA 4PPQA 2HCRA 3CYFA 5BQOA 4YRQA 1U6JA 2BTQB 4BFSA 4CLOA 2QY9A 3FBGA 3WGUA 6GPBA 2WQ6A 3LC0A 1JDSA 16PKA 1CEQA 1QIIA 1EGQA 3K5IA 5TS3A 2WK1A 4U63A 5IC6A 2VHQA 5AKZA 4BO8A 3DHWC 5IJ9B 5BN3A 1UK7A 4DY6A 2YRXA 1FNBA 1USUA 3AUJB 4DJTA 4J1TC 4ZT4A 4LJRA 4YRDA 3ACBA 3R0JA 4H18A 3CRQA 4NCNA 4UHHA 2WTBA 2HK7A 4MQ4A 4OBWA 3H17A 2BR5A 3PNQA 3G0HA 1DDGA 1V7ZA 3I2KA 2MU1A 3QMVA 3FLAA 3MUNA 1N6LA 4MWOA 1N5KA 2WM2A 5T3UA 2XKJE 4MI6A 2NQ2C 1HFJA 2Y1WA 2P6MA 4HB4A 4NVRA 3ZWXA 3FLBA 4CV1A 3QRWA 3BOSA 3GUCA 4XM2A 3S8MA 2ZUWA 5JXHA 5L53A 2I54A 3R74A 4EJ0A 5FBRB 2GN9A 1RRKA 4XX0A 4Q4AB 2QP9X 4WKBA 4A6PA 5C81A 1G5HA 2DBYA 4I99A 2GESA 4TV8F 4N3AA 1CK4A 4HKTA 1NMYA 1TK2A 1YZFA 4B7XA 1Z56C 3LWNA 1Z74A 3CWQA 4IX9A 3WLOA 3K4QA 1FRQA 1JU9A 5G0TA 1E1QD 1CRLA 2FLKA 4C76A 2V8OA 3NANA 4G1BA 4MPJA 4TVOA 4MEBA 2WDZA 3VQTA 2HK6A 2PH1A 3ORQA 2H7XA 2VTEA 4U7GA 1P1CA 4MGKR 1EVIA 5EZ5A 1QG4A 4QGAA 5JBIA 3ILHA 5JVDF 1E1CB 1WXQA 3QX8A 3DFIA 4J7AA 4U2KA 4ZO8A 2C4HA 2VSNA 3QVJA 4CMGA 2J3HA 3H1PA 4GVXA 3HO8A 5A9RA 4YT8A 3ND5A 4GMHA 3KNZA 4IKOA 4KQIA 5G4KA 4KAXA 5AW3A 5CA0F 1QE0A 2HQSA 2NVBA 2ZK7A 4KPGA 3WLEA 3BE8A 4JITA 3FHTA 3FJYA 1E2JA 5J2TA 2QT0A 1B3RA 1NL3A 1Q7EA 1Z82A 2NV2B 4LVNA 4QLBA 1DO8A 1FDSA 4ZCQA 3EZGA 2OFXA 1QZ3A 2AXNA 2QD5A 4XIGS 2CXRA 1RYEA 2F00A 3BCRA 3WKCA 1AKUA 3WRWA 4BFXA 4RESA 3R7WB 1NVVQ 4KK3A 3IVCA 2XRYA 3RFUA 1H3EA 1ECGA 1UBEA 4MPRA 2BEUB 3VSCA 2M98A 3B1JA 2PXHA 5EESA 2GF9A 4CMBA 1ISPA 3COZA 2PH5A 3GCZA 5JNTA 2CJWA 3OCVA 4R51A 2C9CA 3HO6A 1ULTA 3F7TA 1L1QA 3B3JA 2E4AA 3H9QA 4NOMA 5HVNA 1QP4A 1MO4A 3MBKA 3WYEA 3DPUA 1FMCA 3TM4A 3UGTA 4E03A 1RZ3A 2GHRA 2P77A 3B20A 3N58A 5EERA 1RBZA 3VJLA 3O0TA 3K2BA 4GIBA 5LB2A 3KQLA 5M34A 4U8HA 1C0EA 2D3TA 2YN4A 4IIJB 3UJDA 6PFKA 4NMWA 4TWZA 4YJ2F 1J6UA 1W0JA 4KX5A 5CEEA 4OQ4A 9ATCA 3IKMB 4QXOA 2NW6A 5IABA 4W7HA 2H5LA 3Q12A 5C4GB 1U7PA 1TPZA 3KJQA 1RWNA 1CQIB 2Z8YM 4OU5A 4E12A 3FPSA 1U63A 1VMKA 2XXBA 3WR5A 3A1SA 3GT3A 4S1NA 1J22A 4R71A 2ZQZA 3OZXA 4BFCA 2PKRA 2QG4A 1AU9A 3JAKB 3FI0A 1Y3HA 2IGTA 5TPZA 1B8OA 2C4VA 3H04A 4FINA 1QCYA 1WQ3A 4C3VA 1N36B 1L7QA 2J87A 1UL1X 3C8HA 1GRNA 4MINA 3C97A 3WNVA 5JSZB 5BR8B 1IN7A 1Y3CE 2DY0A 2NAFA 3S0JA 1KQOA 3KSUA 5IJ0B 3A1NA 4Y2GA 3V8PA 1JE0A 3WOHA 4G4GA 1R6XA 4OEHA 3HBJA 1VRWA 1QQ5A 1C8LA 3TJRA 4ALLA 4D46A 1DWQA 5EKDA 4BGDA 3G2HA 4WOJA 3LV8A 3SM9A 4GPTA 3VR6A 1BWSA 1XEFA 1SXGA 2PU5A 3HU3A 5AW8A 1HFWA 5CLHA 1GPDG 4TUYA 4Z86A 4LF5B 2BAGA 3AY6A 3DLAA 4XQ0A 1KO7A 4FFVA 2JFHA 4YALA 2XMRA 1M1ZA 4ZTBA 1ZCJA 1AURA 2ZSIA 1OKKA 3LY5A 4BVFA 2VJYA 2Q7DA 4D42A 1EX9A 3M34A 4UNIA 4XTCS 1M75A 2DUJA 4KAJA 4OYHA 5FA5A 5J4KA 4XIFA 1PR1A 5KJ6A 4AKTA 2P8JA 3KYIB 1C9YA 2O3QA 4OLBA 4FXOA 1D7AA 2YUIA 1YQQA 2X5KO 3KWLA 2M6KA 2HJSA 2WBLC 3FF1A 5THXA 1MFZA 2GUGA 2HQ1A 1G4HA 2Y9PB 5DE3A 3RD5A 3V80A 3U7RA 2V96A 2ZM6B 4D7AA 4YMVA 3H86A 3VR3D 2I2XB 3B2QA 4LDNA 2B8NA 2HA6A 1X1CA 2A92A 3DTVD 3O82A 1KGSA 3OE5A 4HPJB 2ZANA 3VDNB 4CF3A 2IOQA 2HRDA 3MLBA 4DQDA 5EI5A 4YRBA 2QW0X 3FOCA 1QGDA 4BNDA 4FI3C 1U28A 2YWHA 5JHHB 4FHCA 5K3FB 1W4RA 1MDBA 4YC7A 4CVNA 1XVLA 2QTBA 4JLSA 3V1TC 1EP1B 3AVPA 2YUTA 1KZ6A 3UK0A 3K09A 5FJJA 3TM5A 1MQ8B 4N7MA 3AHCA 3KKLA 4E33A 1G7CA 1Y1RA 4PGMA 3ANSA 5A7FA 4X65B 1F51E 1K7XB 3CUSA 3NO4A 4AW9A 5IDWA 2PZMA 3ZLJA 2I9PA 1E3SA 1MR3F 1D9ZA 5K01A 1J07A 2FV8A 2YXPX 1F8GA 3OOHA 2D2FA 5IBRA 3DZJA 5KOJB 3LUJA 2QL9A 3D3QA 3TSCA 4MCJA 3OUZA 5KWEA 3U3MA 4IZ6A 2BI4A 2GJ4A 4IY1A 4E1VA 4EB8A 2ECKA 3LBHA 3ON5A 1JIUA 2NQTA 3BTUA 1TM1E 1E69A 4U5XA 1TVEA 5GONF 1O87A 1WCXA 3ETGA 5K4GA 3I52A 4WT7A 3MHPA 2XGMA 3EVBA 2VT3A 2AOUB 3KOYA 4QXAA 3L4BC 4Y9RA 5ESDA 3DEFA 1KORA 3W7BA 4KDFA 2P9QA 1WB6A 1NKTA 1YHZA 2KM1A 2NSYA 2GDJA 3C4QA 3E61A 3GHYA 5TQ2B 5JPDA 2WC1A 2AZMA 2GAFA 4B40A 1Z39A 2ZIEA 3B85A 1XNHA 5DNWA 2I22A 1FQWA 4E1BA 1V41E 4WBNA 1AQJA 3O03A 5K3DA 4ID3A 4KO1S 3FZNA 4XD7D 2DT5A 5EHXA 4J0EA 2ZUVA 4CQNA 3TQTA 1IQUA 3DZKA 4NULA 2HNBA 1W49A 4OREX 4ER6A 4ITUA 3WHPA 5K3OA 2YXLA 2G1PA 4GUAA 2V6JA 1AD2A 3RSLA 4JLBA 1IHXA 5HZKA 2PCJA 1VIVA 3AUKA 2MSWA 4ZVSA 3RLFA 4DUZB 1JAHA 3QW2A 4IEEA 4W1SA 1E7MA 1GZVA 4GM1A 1PZEA 2IUUA 2IX3A 4X6LA 1V1RA 4L6CA 4RFLA 4ZIRA 1KZ9A 4LBYA 3NUGA 3WMWA 2FPGB 3E9MA 1AV7A 3MMZA 3EDRA 4QOGA 5HR5A 3OCYA 1YQWA 4IGAA 4M1YA 3PWKA 4QUBA 1U5AA 4AI6A 2AS0A 2SBTA 2B4TO 5DGCA 1SUEA 1YKFA 5IFKA 1U0SY 1MAAA 4ZALA 1T36A 1LNZA 4J9VA 4ERXA 4M7RA 3R9WA 1RVDA 2A94A 1VLHA 1SY7A 2UYQA 3GFBA 2R751 4IMPA 4Y1RB 5B53A 2H4FA 4F46A 4FOTA 2ZVJA 2F1RA 2H3HA 2D2EA 2GJKA 2VP6A 1G64A 2B1IA 3LLMA 1WG8A 5E6SA 4R4JA 3PLRA 1P4SA 3FYUA 1L4HA 4ZT3A 1RDFA 5G4LA 5EEHA 5AWFC 2BFAA 2G25A 2OHHA 1NFRA 1XOIA 2UYYA 2V9ZA 5D7NA 1YVPA 2YXEA 5CXSA 5IJAA 4TLEA 4K8RB 4R1QA 5AUQA 1PR4A 2F59A 4KK4A 3WWZA 4MH0R 4K6KA 1IOWA 3F6YA 3H5WA 5KAMA 1ZN2A 4QT0A 1OZFA 2IYNA 4D6YA 2R85A 4O4JF 4Z51A 1KXZA 2PIAA 1L3CA 3KP1A 2HKIA 5DBFA 1KA9H 1ZAYA 1OWNA 2G63A 2P1ZA 4G0XA 3VZCA 2CNWD 1I3CA 1WTCA 3CJTA 2ZSDA 3LP8A 3T54A 3BXPA 3PQ2A 1MQSA 3ROPA 3VDXA 3RYFA 1WW3A 3ZHRA 1UZLA 5A9TA 2Q1WA 1MENA 4YIKA 4JQYA 1QIKA 4AD8A 5FBLB 1Z8HA 4GYWA 4RO0A 1R2QA 3HFJA 4B44A 1BS1A 4UAUA 1YI8A 2JARA 2B0CA 3E5HA 5M04A 3NR2A 2RFLA 5E4TA 4IX1A 4LGYA 5IKOA 3CVWA 4W5NA 1KNXA 3BPSA 2XDAA 1BIFA 2UVQA 2XDQA 2AF4C 2J3QA 4IIXA 4WZAA 4DE5A 4B3RB 1R0ZA 5EMNA 2ZJZA 4BMSA 3WB2A 1IWBB 1GU1A 4M1QA 1FTWA 2Y6VA 1NJFA 5D6NA 1DOAA 2FTKE 3C5VA 3VYWA 1JN0A 2PZEA 3HYSA 1L5YA 3MUEA 3QY0A 5EKSA 1O95C 4Y2TA 4DJJA 1GTMA 3TSWA 1H2HA 1WMAA 4ZI7F 1PW5A 4N6OA 3UXYA 3I05A 1JIVA 1MB4A 2JZNA 2CXOA 4XB6B 4EX7A 5AI0A 3TQFA 3GFQA 5FPYA 3BRWA 1SQGA 2XH8A 5LQKA 4AP9A 3TSAA 4ABTA 4UMFA 5KZMB 3CA8A 3M0EA 3TOCA 1ACLA 1QLWA 3WP0A 5EE3A 3LXMA 4FXPA 4D0NA 2ZB8A 4ZI5A 1Q0HA 3HL4A 1FFAA 3JALA 2H07A 1OFUX 2YRWA 3BTSA 2FPUA 3LQ4A 5J2UF 5CM8B 2ZB2A 4FMPA 5KQPA 1YOBA 3PBKA 3PKIA 4C2TA 1F14A 1U65A 2QXUA 1Z0ZA 3NAZA 1KSFX 1FFSA 4MVJG 2WAYA 3QTLA 1U2EA 3LVFO 3KTOA 1WEKA 2PXAA 4GC5A 5F4BA 3EQ8A 3OZIA 2CLIB 2G1JA 1JXMA 2WJGA 4IR7A 3UKJA 2VDLB 5GINE 2XYPA 4BMZA 1BHJA 5L40A 2DM6A 5GM2A 4KQGA 4BO0A 5HQTA 4DMHA 2JVJA 1RHJA 1EWRA 4JEMA 4EUEA 1YT5A 2O6LA 1LI5A 3URMA 1PVVA 1BKDR 5KYWA 2PUVA 3ZGNA 2H7VA 5JNWA 3ST7A 5IT9A 2YVKA 1NBIA 1J8MF 4H59A 1QHGA 2XW6A 2OXTA 1OXMA 2V58A 2X77A 3BN3A 4PFQA 5C8YA 2GYVA 2Z04A 4EYEA 4Q12A 2HWKA 3AF3A 1UUFA 3MJVA 4QU5A 1LBIA 3W6NA 2WF6A 2X23A 5KYUA 3TD2A 3WL7A 3WJAA 1LXCA 5H80A 1Y8QB 4X45A 4KEAA 4FD3A 5AKGA 1JG6A 2VJBA 1MC4A 2CL5A 4FYMA 4TRJA 3BL6A 5JIBA 5H9WA 2FZVA 2YJZA 2H8GA 4V38A 5D6OA 4Z53A 2ADOA 5DCLA 5ALTA 2FHSA 2ATIA 3EDMA 4MSUA 5HA5A 1D2RA 1DT3A 1GQRA 2RAVA 1IEXA 4WXRA 3G2QA 2PT6A 4PBTA 3W2GA 1X8LA 2FJUA 3EA0A 3TECE 2JGMA 1KEZA 1EM6A 3SXUB 4C04A 5JXGA 1WXGA 1ZJ6A 5HKAA 2W93A 3ENWA 2OQIA 2F1OA 1GAJA 2H2HA 2QX8A 1B6GA 1XDWA 3D5EA 3FPEA 4H4DA 4KAAA 4G23A 4D4LA 3V4RA 1G5IA 1J1ZA 1SU4A 1FUUA 1QONA 1YZYA 2ERCA 2BGRA 2POCA 3EG5A 3ROKA 3AI2A 1SMKA 1XZIA 1Z7WA 2P9BA 4EL5A 3U6KA 1TCBA 2VFAA 3WGVA 4EZIA 2Q4RA 5IBPA 3PC8A 2VP2A 4GKVA 2AEEA 4NPHA 1XVTA 4I1IA 4BYMA 1F0PA 4ZHQA 2REXB 4OA8A 4XCQA 2VDOB 3SHQA 1I4DD 2XKKA 4EA7A 5HTOA 4IDNA 3CRVA 4DA7A 1EVYA 1TYBE 2G9ZA 3IVRA 4YB8A 1IU9A 2VL7A 3UANA 2I55A 4G0MA 3T3PB 2ESRA 3K94A 1EJ6A 1NE7A 1IM2A 2CLSA 2XZLA 3GLTA 1VXOA 3F5SA 4BAZA 4KV9A 5CB4F 4R2JA 1E58A 5AK0A 3QVLA 3H42B 1W8DA 1OLSB 2X2OA 3K5WA 1VBMA 2BHLA 5D00A 2M6RA 4QUIA 2IOYA 3LHFA 4KUGA 2ZATA 2QTGA 4HVTA 2Q3JA 3KQTA 5F64A 1DKQA 3HCBA 3SP1A 4B9EA 3QUQA 2CFSA 4AKSA 4K9QA 3EXEA 4RA9A 2PZAA 2QJOA 4ENPA 4B3JA 2O6HA 4EFLA 4A92A 3DUFA 1FZQA 3UQYS 1GA4A 2IXEA 2VQ3A 3O91A 1JQLB 5KX5A 5KNCH 4XQEA 3M2TA 3S1LA 4L8GA 1NNLA 4R1NA 5FV7A 3F2IA 3ZWWA 2A3NA 4YRMA 4LDJA 4FD2A 1VECA 5ALOA 2E3JA 5GQSA 3R24A 4ND8B 1JDJA 2BUBA 1ISJA 3EEQA 4JEHA 4LS3A 5TS2A 2Y4OA 2C7RA 4ZODA 5FNVF 5FV4A 1RI3A 5JSKA 4MQLA 3IPAA 4PO8A 1CR0A 3N0XA 3A3NA 4CF6A 1Y1QA 1Z83A 2GPWA 3G9UA 4FKBA 3FTFA 2WPDA 3NHJA 5HRAA 1BCSB 5F2EA 4DSAA 1VYUA 5EE5B 2HI0A 4ZO7A 4B4DA 2PPVA 3KE9A 3I9LA 5DM60 1C3EA 3SKVA 2OO5C 3DMRA 2IIPA 4ZJUA 4DEVA 3F96A 3PC2A 4WGFA 4TYWA 1CJCA 3D6FA 3E9QA 2C2OA 4Q6BA 4A6XA 4UTNA 2GVDC 1CJUC 1X9IA 2QV7A 4IQ8A 1IB0A 2ZDQA 4HGNA 4KOEC 3TAUA 1K2VN 2QM7A 4HPXB 3TQIA 1Z9BA 1QVAA 4C5BA 4JJ8A 2AWNA 5A4JA 3I58A 1TZCA 3NHKA 1V5EA 4ZCMA 4LJAA 4YXWD 3PT9A 3B9PA 2RJNA 4X71A 2R5NA 2OZVA 2W6IA 1KYVA 4XJSA 3OPYI 3HA2A 2PLFA 2C2ZA 1BTOA 4GE0A 4FILA 3L1KA 1HDXA 3SDBA 3GLFE 3SR4A 2PQ2A 5JI3E 3D0OA 3K96A 1LK5A 3F9RA 1ZOPA 3JQFC 4M1SA 4C0KA 1ITZA 2O7QA 2FG5A 1ZZGA 2YTZA 3LKZA 2KB0A 3NOVA 4KMOA 4N0MA 3D6NB 2DB3A 1VM6A 3EZ2A 4IOKA 3LECA 4BZWA 1JMYA 4JVNA 4PE5B 2HNKA 4JJ4A 2AF3C 3LGXA 1Z7GA 4G1MB 1Z88A 2P27A 2X0DA 4P0QB 1NU6A 3CZ9A 1ZGHA 3DT6A 3T6KA 2IEYA 2JAQA 3LUDA 3H2JA 3VJKA 3A1DA 1Q57A 3UYLA 5C8XA 1JYEA 5ESRA 3H9GA 3RNOA 1SKQA 1SVSA 4ROSA 4N12A 5EHGA 5CW2A 2VBGA 3O2JA 4YXFA 4GYJA 4N1AA 4KL8S 3QITA 5KNDA 2QS9A 1FJXA 3VYSB 2G06A 3BRCA 4GSLA 4YR7A 2JFZA 3UMRA 5EEGA 4KFCA 3LPLA 1GRRA 5DHUA 5LNK1 1C9KA 1CDOA 2WFMA 1YQEA 1G7TA 4K9OA 4GG1A 3D7MA 1OAKA 3OZRA 5IYZF 3QP9A 5LB4A 3FDZA 5B57C 2D5CA 1JT9A 1M6VB 3D4LA 1NXPA 3DOJA 3P2MA 3PXBA 4DNPA 1ADFA 1X0XA 5CVVA 2OD7A 1YMUA 1PFUA 3QBTA 1YH3A 3AETB 3L18A 3N2KA 3O8RA 1Z4LA 3G8CA 1ZCZA 4M55A 5CB6A 1EUDB 2XUFA 5FTWA 1Y8ZA 4MDHA 5F7ZA 3UM9A 4N0DA 1T0UA 2ZTHA 2F90A 3A6LA 1SXJC 3JRNA 3OM8A 3FA2A 3OJFA 1J20A 1CUCA 4M46A 3QEBZ 4JBLA 3TMYA 3QUSA 5C1PA 3FNRA 1NQTA 3K70C 1IAQA 3L46A 4KACA 5TY0A 4E51A 1N5DA 2G1AA 1HWYA 2R5WA 1N57A 2H85A 2JRCA 4B7UA 5CA1F 1QVWA 1QRSA 1OU0A 5AVSA 4L0QA 3IKVA 1F6WA 4FQ7A 1M2EA 3IP3A 4O2BB 2Y3IA 4RF2A 1FDTA 4KV7A 2B36A 4D3YA 3B6KA 4FJ2A 1AK1A 4CEJA 1CY0A 1YI0A 3OMLA 3V1NA 2Z95A 4N5LA 1QHHA 3CLHA 1VKHA 3KU1A 4RSHA 5DCWA 1AQLA 1PEKE 4AF7A 4N76A 3CN7A 4TS1A 2VTBA 2FUG1 4MWZA 1CEXA 1V6AA 4B33A 2GTIA 4D79A 2M2IA 1JTEA 3AEQB 3I4LA 3RUDA 2XVXA 2HSZA 1EU1A 2E4UA 3R41A 3LYHA 3WYGA 3PB3A 1TAHA 4LEIA 1EJBA 1I7SB 1GVHA 3TOXA 4W9MC 5M5BA 4K9DA 1GILA 3L0OA 5CLFA 4HLQB 5E38A 1UBOS 3QOFA 2WG1A 2R1TA 1O5OA 1R12A 3I2HA 2AOVA 2WJJA 1XYVA 2ZRCA 4KLRA 4PLZA 4QHSA 1M9NA 5JQGA 2YNMC 1W4LA 1THMA 2JLRA 2Q5CA 3O4GA 4G0QA 4GX1A 4XOIA 3WOVA 2J4DA 2DFTA 4PLGA 2WOOA 2VRCA 5J5VA 1JFSA 1E2NA 4AK9A 3N2ZB 1RMTA 2CDNA 1OXUA 2DFVA 2VATA 1YJAA 3R3HA 4PIPA 2D2XA 1XV5A 3C24A 2CJFA 4GNKA 3U7JA 4AJNA 4YDQA 1ESMA 2ZRGA 1UPXA 5AXBA 3CY6A 5GAJA 4UM9B 4NSNA 3HM9A 3HV2A 1QLHA 3TPZA 2AC2A 5E1OA 2PUGA 2W6OA 2FW9A 4RQTA 1NOKA 1E2HA 1VHWA 5KVQA 1XEXB 1UANA 2WVHA 3AH8A 3SPXA 2IHZA 3AUFA 3AY3A 5AP9A 3TZ6A 5JS7A 2AEFA 3U16A 3IUPA 3F6SA 1ESNA 3OD1A 2R6AA 1ZOOA 2XA2A 3CRRA 3VU0A 4F1KA 1VC2A 4E3ZA 1SHUX 3ZCRA 3F6EX 1N0IA 2CXHA 3TG8A 4A8TA 3IPRA 3MFQA 2XCIA 3ZK9A 3KDAA 3VTZA 1FF9A 5KQGA 2PRKA 4ZZ0A 2FDCA 1LV7A 3WLFA 1Z5GA 3UJ7A 2QXYA 1R6TA 1P5JA 2WF9A 4TLDA 3T1YB 4O2AB 2ET6A 1IK4A 1W5SA 4Z3KA 4W5QA 4TMKA 3F1LA 2V1UA 1VL6A 2A9OA 3D8UA 4G0ZA 2JI9A 4RL6A 4LECA 4YJ3A