3KDAA

Crystal structure of the cftr inhibitory factor cif with the h269a mutation
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
298
structure length
298
Chain Sequence
b'AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMEAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGAGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSRGRHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CFTR inhibitory factor (Cif)
molecule tags Hydrolase
source organism Pseudomonas aeruginosa ucbpp-pa14
publication title Crystal structure of the cystic fibrosis transmembrane conductance regulator inhibitory factor Cif reveals novel active-site features of an epoxide hydrolase virulence factor.
pubmed doi rcsb
total genus 112
structure length 298
sequence length 298
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kdaA01
5CMLA 5K3FB 3QPCA 4G4IA 2WQZA 4YASA 4PNZA 1LPSA 4QA9A 1CFJA 3AUKA 1Y7IA 1ZD5A 3Q0TA 4FWBA 3WKCA 3C70A 2V97A 2WHPB 5JZSA 2PUJA 3HZOA 1ZGBA 1UK9A 5FLKA 5CURA 1R88A 2ZYRA 4FLEA 4X97A 4E15A 3WKBA 4B80A 5ESRA 4EZIA 1IUNA 5DYTA 1E8NA 3I2JA 4X6XA 1SCKA 3BIWA 2JGLA 4GI1A 5BWCA 3W9BA 1CUXA 1TK3A 5CBKA 1MJ5A 4WDQA 5ALHA 5K5EA 4FNMA 1XKLA 4IHAA 5JAHA 1CRLA 4CIAA 1J06A 4FMPA 4BYMA 1LPPA 3E4DA 5H3HA 1Y37A 4UHFA 1JI3A 1K5PA 2OCLA 4BAZA 5T4HA 2HHAA 4BVKA 3D0KA 1QJ4A 2XUPA 3QYJA 1L7QA 4B85A 1QIFA 4BC0A 1JU4A 1LGYA 1QIMA 1YS2X 3D2BA 2WUFA 4Q1VA 4BTLA 1H2XA 4ARAA 1S8OA 1BU8A 2X5XA 3WZLA 2AJCA 2QXUA 2WILA 3IBTA 5C81A 1WB5A 3C87A 2R8BA 2H7YA 4WFIA 3AZOA 1WHSA 5CXXA 4Y2SA 4EB0A 3ICVA 1FFCA 5HCUA 4U2EA 1VKHA 4KR0A 5I7UA 3CN9A 3STXA 3HYSA 4FTWA 2YH2A 4ITVA 3W9UA 3I2IA 3WYNA 2B9VA 2OPHA 4TVKA 5SYMA 1F6WA 2PU7A 2JGIA 1CUSA 3OPMA 5DLPA 1GGVA 5A2GA 2VAVA 3QPDA 2ZJFA 2ZYSA 3D2CA 1XRRA 3WLAA 2H9YA 3FYTA 5KREA 4W1RA 5DJ5A 4P93A 1UKBA 1DX6A 3H2GA 2HADA 2PPLA 2PU5A 2GBFA 4GWLA 3DS8A 2HU8A 2RGUA 4M0MA 4B81A 1YA8A 2WFLA 3IIIA 5CT5A 1YASA 1RP1A 3DCNA 5C8XA 3DJYA 4Y2QA 3W05A 1QO7A 2ACEA 3H2HA 4L9AA 1CUCA 1XZIA 1XZMA 4BATA 4J7AA 1ZD3A 1A8SA 2BGNA 1H2ZA 5D3ZA 4K6GA 5ALRA 1QONA 5C8ZA 4BP9A 3DYVA 4KE8A 3QH4A 4GXNA 4KEAA 4Q34A 3WKAA 3D7RA 4UFNA 2BUBA 1CPYA 3Q8WA 2VEOA 3EQ9A 5CT9A 5E4YA 5AO9A 5LZ2A 2AJDA 3L1HA 2I3DA 1P0IA 4KAFA 3U1TA 4Y7DA 4WY5A 2YASA 3WMRA 1VLQA 2VT6A 5IVDA 3O4GA 5HQ3A 1XZEA 3G0DA 1ZI9A 5AKZA 2D0DA 1TIBA 2Z8ZA 2GBCA 1BRTA 3TGLA 4PSUA 4AQDA 1UOQA 5LIPA 1R50A 4UFOA 3WYDA 3C5WP 1N1MA 5AKKA 1MNQA 5EHQA 1Q0RA 1MAHA 1Q83A 2B61A 2J4FA 5EHNA 2RAUA 3GA7A 4G5XA 1DT3A 4Q3OA 5EI5A 5D6OA 3NOXA 1Z68A 4G9EA 4LHEA 3I2FA 5HF6A 5K3CA 1CLEA 1XZDA 4Y2RA 3H04A 4RE6A 3V1MA 1IUPA 3FYUA 3PUHA 2PX6A 4Q3LA 2BCEA 1XROA 1XRPA 4DLNA 3AILA 3RARA 3IA2A 3DKKA 1GKKA 5FPQA 5AM1A 3MVEA 5ALPA 4QEKA 5JD4A 1HPLA 2WLSA 2DHEA 2XLCA 5HF9A 4X93A 4XX1A 4ARBA 3FBWA 5E2IA 5AKIA 5ALUA 5HZGA 5EGNA 3O95A 4ZV7A 4QE3A 5AOBA 3QZUA 5ALJA 4EY4A 2AXEA 5CH3A 4B9EA 4BCBA 1IZ7A 4A16A 3G0CA 3WA6A 4B7ZA 4DSAA 1U4NA 1EINA 2VT7A 3C5VA 4FBLA 1UKAA 1ODSA 3H18A 4B6GA 3N0TA 5ALNA 4DIUA 3UUFA 4A23A 1RYYA 4WFJA 4RPCA 1CUFA 4JUIA 4V2IA 2OGSA 4J0JA 3F97A 3LP5A 3O9VA 1UK7A 3KSRA 4M0EA 5FKJA 1R3DA 4U2GA 4UBJA 5AM4A 1LPOA 1BCSA 5DNVA 5AM0A 2CKMA 4J0CA 2JEZA 3H1AA 4Y9SA 2WHRA 4GDMA 4KE7A 4GHWA 5BWBA 5AI5A 4EBBA 3AIKA 2DHDA 4H7IA 2XMRA 1YS1X 1D07A 2XUIA 2O7RA 3RM3A 4NS4A 4F0JA 2HA4A 2I03A 7YASA 5BV7A 3FOBA 3WL8A 5KBYA 1GXSA 4BDTA 4K2AA 5AI4A 3VDXA 1AMNA 4OB7A 3VKFA 4W9RA 1U8EA 3IVMA 4P9NA 3BDVA 4M0FA 3A2NA 1QE3A 4LXGA 5I8PA 2VSQA 3AZQA 5AKGA 2O2GA 4KE9A 3V1KA 2WKWA 4HAIA 3ZPXA 2EDAA 2OQVA 2HRQA 3PICA 1NU8A 1ZI8A 5AKHA 2X76A 4EA6A 1EVEA 1ISPA 5ALKA 1ETHA 4MQLA 5T4EA 3EQ7A 1OXMA 5K3FA 3DDUA 4OB6A 4UHDA 1QIGA 3VJLA 1ACLA 3KOOA 2PBLA 4Y2UA 4MYDA 4X6YA 1UT6A 5LZ9A 3I2HA 3F8SA 5FXMA 2XI4A 2WUGA 4QWMA 3U0VA 5AM2A 3BIXA 2WHQA 2V96A 1CUHA 1SC9A 3TEJA 4RE5A 1WB4A 3NUZA 2HU7A 5ALWA 2Z3ZA 5HF8A 4C87A 4WY8A 4H7DA 4KRXA 5AIAA 1LPBB 5K3EA 3D4LA 2O2HA 3MUNA 4PQEA 2G63A 3DEAA 3DNMA 5ALOA 5JAPA 4FKBA 1XLVA 1CUGA 3GFFA 4AN0A 1WHTA 3O0DA 4CCYA 4Q05A 4DNOA 3O4HA 5JAUA 1LPAB 4WDRA 1ODTC 3WQHA 1CV2A 3QMMA 2IITA 2CMFA 1W52X 2WIKA 1K8QA 5A62A 4I3FA 2E3JA 1FFBA 1QTIA 4YX9A 1E8DA 2YYSA 4F21A 5AM5A 3LCRA 5D3KA 4MQMA 1MNAA 1YR2A 3QITA 3WL6A 4EY7A 4ZRDA 1XRLA 2ACKA 2ZYIA 3PE6A 4YPVA 2ZJ7A 3WKEA 5C7YA 3TJMA 2DHCA 1BE0A 3RKSA 3AZPA 4DNQA 4PF1A 5AOCA 1HQDA 1CUZA 4X85A 2RHTA 5ALSA 3SC2A 3QBJA 4BCDA 2WIGA 4G8BA 4LYEA 4B82A 5A7FA 1MN6A 3W04A 4U2BA 1CUJA 4B0OA 1JKMA 1YAHA 5LKAA 4PSCA 2PM8A 4BZWA 1B41A 3F67A 1DQYA 4KJXA 2PSFA 1YSCA 3OOSA 3DYIA 4H7KA 4BRSA 5A7HA 4ZI5A 4L0CA 4BE9A 4H77A 1QFSA 5JALA 1QIJA 4FLMA 2C5FA 3T4UA 4BVLA 2CB9A 4B0PA 1SFRA 3G0BA 5DYWA 4J0IA 4EHBA 1HLGA 4EY8A 4HZGA 5JADA 5DWDA 1CQZA 4AZ0A 4CG1A 2ZSIA 3H1BA 2FUKA 1CIJA 1AX9A 1AQLA 2WTMA 2RONA 4RNCA 5T4FA 3IUJA 2QJWA 1L7RA 1UWCA 2W22A 3O4IA 2WG0A 2OG1A 5ALVA 2HIHA 4BDSA 3HC7A 3VISA 5DNUA 3M83A 3AIMA 4S0XA 4IH4A 4N8DA 2B4KA 4K6KA 4UBMA 2DSNA 4OCZA 3C6XA 1FFAA 1AZWA 3BF8A 2PSEA 3ILSA 1IMJA 1O6FA 4X92A 1B6GA 3FSGA 1HBJA 2XUFA 4X00A 4AMYA 3IUQA 4FBMA 4ZXFA 1UKCA 2C58A 2HA6A 3SWWA 2J3QA 1EHYA 4DM7A 5ALZA 4W63A 4DNFA 3DL7A 1ZD4A 4ZGBA 1EVQA 4Y2PA 1I6WA 2XMQA 4J3JA 5ALGA 3M3DA 1XZJA 5HKBA 1DWPA 4AX4A 1LBTA 3R3WA 4BP8A 5IKXA 4H18A 2H7XA 5JATA 5AKEA 1VE7A 4FFWA 2OCIA 2XQJA 3HXKA 3V1LA 2XT0A 3K2IA 4KAJA 3R0VA 2ES4A 2C7BA 1KU0A 2VJDA 1UFOA 5EIHA 2AJLI 3ZLUA 1TCAA 4AO7A 5ISMA 3C6ZA 1NX9A 3RLIA 3ZWQA 5I9IA 3PF8A 5ALLA 3T52A 3ANTA 2WUDA 5AHXA 1Q84A 1G4HA 4X90A 5AKJA 1CUDA 5HK9A 4C4YA 2Z5GA 4Z49A 1A88A 1JJBA 4IH1A 5LZ4A 4DNPA 2J3DA 4TPKA 1W75A 3ANSA 1TQHA 3I1IA 1H22A 1A7UA 2OCGA 1XZAA 2VQ6A 4JYPA 3QMVA 2AJ8A 1R1DA 2HL6A 4UHHA 4UHBA 1R9MA 5CT8A 3PDCA 1ZIXA 1X2BA 4OU5A 5CH5A 5A6VA 5SYNA 3FLEA 2QVBA 1WB6A 3BJRA 3CXUA 1XLUA 5JD6A 1BS9A 1THGA 4UHCA 4G4JA 1H23A 3KWJA 5KWIA 4KYVA 1A8UA 2XMGA 1WM1A 4IH9A 2GYUA 4GECA 5AJHA 4C01A 5AK4A 1XZCA 3JYHA 1AKNA 4JNCA 1NU6A 2HU5A 2JEYA 5HKAA 1QIHA 3TRDA 4LIPD 4C89A 2WJ4A 3PF9A 1F0PA 3PFCA 4QZVA 2WIFA 4ZWNA 1ZICA 1XLWA 1T4MA 3DKRA 5IVKA 5AKYA 2NW6A 3R40A 1GPKA 1QZ3A 3A2LA 1UOPA 3PUIA 2OXEA 2XUJA 4KACA 3E0XA 5IH7A 2WHPA 3FAKA 4HXEB 2JIDA 4PO3X 1BN7A 5LYYA 3CCCA 4BBZA 4I19A 1CR6A 3O4JA 1AGYA 1QLWA 1CUWA 4CG3A 1XKTA 2OCKA 1MT3A 1TCCA 2DR0A 3G9XA 4LYDA 2WIDA 3H19A 1EXWA 3BXPA 2XUHA 2RIPA 2C0QA 3S8YA 3WK6A 3A6ZA 1CUEA 2QXTA 2Z3WA 4J0GA 5JAOA 4ZV9A 5DTJA 4QDTA 2XUQA 4DMFA 4QDZA 2XUGA 3BDIA 3WJ1A 4OPMA 2YXPX 4F5ZA 3BF7A 1U65A 3SX4A 1QIEA 1F8UA 3BJMA 1XRNA 4HRXA 1YCDA 1DT5A 1EX9A 1XZFA 5ALIA 1XQXA 2XE4A 2VAXA 1JMYA 1W4LA 4G8CA 2ECFA 1N8SA 1ORVA 4UBIA 3H0CA 4NZZA 3N2ZB 3PFBA 5FDFA 1CQWA 3WL5A 4B9AA 4OB8A 5C8VA 3V1NA 1QO9A 1UXOA 4J0KA 4N8SA 2DQYA 3FVTA 2DCMA 5ALEA 5CRIA 2Q0XA 4AMZA 2RHWA 1K63A 2XUAA 4C4XA 5AICA 3FLBA 2C5GA 4PW0A 1LPNA 1QIDA 1UK6A 4L3WA 2QM0A 5T4BA 3G9ZA 2RI6A 4GW3A 5JARA 5ALQA 1N5RA 5K3BA 5FOQA 4AO8A 2JGJA 1XRMA 2Z8XA 2UZ0A 1XQYA 4Y2XA 2FX5A 1XZKA 1JT2A 3ZLTA 4EY5A 2K2QB 3D5EA 1VZ3A 2GYVA 3KD2A 1YB6A 3M82A 4UHEA 1UOOA 1LZLA 3F9CA 4DSZA 4XVCA 4BVJA 4F60A 3OC0A 3MGAA 3EBLA 2IIVA 3LIIA 2XMZA 4BC1A 2EEPA 3ZI7A 5HQ3B 4LXIA 3FVRA 3W06A 1E3QA 5FPPA 4NVRA 5AKLA 4OUKX 1XFDA 1XQWA 3I2GA 5DYYA 2PL5A 1H2WA 3BL8A 3PI6A 4CG2A 2CJPA 4G1FA 1WOMA 4QNNA 1U2EA 4K5QA 1MO2A 2XQKA 1YA4A 5CT6A 3D2AA 3C8DA 5FV4A 1M33A 1EK1A 2OAEA 2QT9A 3O9MA 2ZYHA 4GLBA 1G5FA 1C7IA 1JJIA 3V9AA 3GBSA 3WIBA 3G7NA 1EB8A 2WM2A 1BROA 3DOHA 2CZQA 3H2IA 5HFNA 4IO0A 1BN6A 3R3ZA 3WK9A 1K4YA 2GYWA 1CEXA 2CEKA 1SCQA 2XUOA 3L1JA 3STVA 4TGLA 2JGKA 1P0PA 2EDCA 2HA5A 4X6UA 5JIBA 1FJ2A 5LP1A 3STUA 4HXFB 1ZD2P 3L1IA 4BZZA 3CN7A 2OGTA 4QDUA 1FSSA 1MX1A 4MYSA 3E3AA 3FYUC 4YK7A 4CCWA 4G9GA 2QKYA 2HM7A 3YASA 4DMKA 4GBGA 3FNBA 4J0DA 4UBLA 1LNSA 3ZV7A 5HK8A 1Q0ZA 1XZBA 5BOVA 4UBKA 4DMHA 4OSEA 1HL7A 4CIBA 5AM3A 4WFKA 2H1IA 4G8DA 2B20A 4CCYB 3H17A 4MXDA 3R3UA 3SK0A 1EK2A 2WFZA 2VA9A 2H7CA 2LIPA 1QGED 4A5SA 4FHZA 3WWDA 2PKYX 2XMDA 3GZJA 2HA7A 1YB7A 1TKRA 5AK5A 3B12A 4CFSA 1QFMA 3WK8A 4Q82A 3I28A 2W6CX 4OD0A 1J07A 4G4GA 4FFVA 5LLSA 1O6GA 1OILA 4P08A 3EIOA 2ZVDA 3VJMA 2VJAA 3ICWA 1JU3A 4MEBA 4X91A 1C4XA 2D5LA 4DYHA 2XMCA 5JZBA 3FYUB 2VJCA 3S2ZA 4MWTA 3HACA 3WA7A 4J0HA 3JWEA 1XQVA 3G8YA 3I6MA 3CCBA 3C8HA 2WUEA 1OCEA 3LLCA 5K3AA 1E5TA 3STTA 3WWPA 1TRHA 3UMJA 4AXBA 2FJPA 1ZOIA 3E1GA 3LIPA 1ZJ4A 1Y7HA 1HDEA 1CUBA 4HVTA 2HDWA 3DL4A 1DTEA 1G42A 4PSDA 2BGRA 1DINA 3NGMA 4UUQA 4BAUA 1P0QA 3KWFA 4AB1A 5AI6A 4XWGA 3DOIA 1GQSA 2XUKA 2BUAA 5HF5A 4MEAA 2C4HA 2WU4A 4QLAA 3RK4A 1W76A 5LZ5A 4BE4A 3HI4A 5IVIA 2ROQA 4JEIA 3OM8A 2HRRA 4DGQA 5JANA 2JF0A 4K6HA 3I6ZA 3OG9A 1MTZA 4Q3KA 2GZRA 5F4ZA 4BB0A 4H7EA 1HKHA 4HS9A 5ALYA 2G5PA 3IB3A 2O7VA 2G4LA 4FOLA 2XB6A 3K9BA 3ESAA 1GZ7A 3FSGD 2WIJA 2Y6UA 4DTCA 2XQGA 3W2TA 3G0GA 4Y2JA 1J1IA 3GELA 4EUSA 5LZ8A 5ALDA 4H35A 1CUUA 5LKRA 1H2YA 5E4JA 4UFPA 2OGZA 1VJ5A 3ESCA 2DFPA 4H7FA 6YASA 3BWXA 2XMSA 4AZ3A 1DQZA 1MX9A 1IUOA 4UPDA 2WSLA 4ZREA 5K3DA 2Y2UA 3QM1A 3WJ2A 2VTVA 5A7GA 3VJKA 4H0CA 1VZ2A 3IUMA 5KWJA 5AK3A 5AKXA 4N5IX 2O2IA 4GEGA 3AJAA 1EDEA 2QZPA 1XRQA 3A70A 4U2FA 5CXUA 3G0IA 1CUIA 2PSJA 4E11A 1KU6A 1P0MA 3M81A 4XJVA 3BE8A 1RWQA 2PUHA 2WG1A 3WZMA 5E4TA 5AH0A 2XQFA 1JFRA 4J03A 3H2KA 3C45A 3X3HA 1BCRA 1VOTA 3STYA 1GKLA 1XZHA 3STWA 3DLTA 3R3XA 3V48A 3VXKA 3OTQA 3MUOA 5J3JA 3IDAA 1QTRA 3UUEA 4P92A 2QS9A 5D7BA 2GBGA 1E89A 2VATA 1VA5A 1VXRA 1ZI6A 3C6YA 1VE6A 1W6RA 2PSDA 3EQ8A 2HA2A 3HJUA 3KXPA 5JYCA 1DWOA 1ZJ5A 4IQ4A 3KDAA 2I3ZA 1ODCA 4FLFA 4MWSA 1IZ8A 2OLEA 2XMBA 1JMKC 2V98A 4BRZA 2ORYA 1IVYA 1L7AA 4LXHA 3FCYA 2BKLA 1DWQA 3WWEA 2QUAA 4BCCA 2BUCA 1K6EA 3D59A 4QDOA 1EA5A 3WI7A 1PV1A 4RGYA 1E8MA 2QUBA 1A8QA 5ALXA 2QR5A 1R9NA 2WJ3A 4C88A 3WIOA 1BEZA 2HFKA 1W1IA 2C0PA 1UZAA 5FP0A 1CUYA 5AOAA 1EB9A 5JZ9A 5AK6A 2GBIA 2CBGA 4X7BA 1EDBA 2PSHA 2WJ6A 3K6KA 1DU4A 3HLKA 5CW2A 3G9TA 2PVSA 1E66A 5AI0A 1ZGCA 2G5TA 2ZJ6A 4QLOA 3QMWA 2WFMA 1WCYA 3HRHA 3NWOA 2J4CA 2DQZA 2R11A 4W1QA 1GPLA 5JASA 1MAAA 2XUDA 3GUUA 2JGMA 2V9ZA 2WFLB 2XLBA 1FFDA 3P2MA 2WTNA 4L72A 2XQIA 3G02A 2OAGA 2ZSHA 2HFJA 3OURA 4Y2YA 1N5MA 1G66A 1XZGA 5ALFA 1EI9A 2WG2A 1KEZA 2JGFA 1LPMA 3VVLA 4C6HA 1AUOA 4O08A 2BFNA 3QPAA 4EY6A 1AURA 5DTIA 5EIEA 5AI9A 1GQRA 2Y6VA 1EH5A 4H7JA 4W1SA 4OU4A 1PJAA 3AIOA 1MU0A 4X94A 4E46A 3I1YA 5FRDA 5FUMA 1X70A 4UBOA 4CI9A 4C4ZA 3F98A 3R3YA 5EHZA 1LLFA 3IUNA 5AIBA 3WKDA 1X2EA 2JGEA 4X71A 1VXOA 4D9JA 4OYLA 2GZSA 5YASA 1BEEA 4INZA 2I78A 4W1PA 1YAJA 5CTAA 2FJ0A 3IURA 3I2KA 3B3QA 2BAGA 4B84A 4WJLA 1LZKA 2P8SA 4MJ3A 2OQIA 1AC5A 3WWOA 3H2JA 1JJFA 2QRUA 1PFQA 2QOEA 3WL7A 2AJBA 1VA4A 3FCXA 1ORWA 3QVMA 3D3NA 4B83A 3DD5A 1MX5A 3EF3A 1LBSA 2VF2A 4UBNA 4E14A 1QIIA 4QWWA 4ETWA 1UK8A 1DX4A 3VVMA 1QIKA 2X8BA 3ESBA 1THTA 1F0NA 3R41A 1ZIYA 4NMWA 1TCBA 1QOZA 1SOMA 3AINA 3HEAA 3F96A 5IVHA 2CUTA 1CUVA 5EIAA 2Y1KA 4X3CA 2VJBA 3ED1A 4AN1A 2ONCA 2IX9A 3C43A 1ACJA 2HA0A 2JBWA 3I6YA 4N8EA 4BAGA 4QDXA 3FLAA 5CH8A 4XIIA 3G9UA 2Y2VA 1FFEA 2QMQA 1WPRA 3HABA 4HRYA 1TAHA 5A71A 3ZLVA 4H7HA 3WK4A 3AFIA 3WK5A 5DNWA 4OYYA 1EDDA 4AO6A 1GT6A 3HSSA 3A2MA 3ESDA 4JH0A 4KRYA 4ROTA 1J2EA 4X95A 3DQZA 1SCIA 4PV7A 4WCVA 5HFAA 1CUAA 1R4ZA 3FWHA 5AI8A 5CT4A 2QTBA 1C7JA 4FNGA 4KAAA 4N5HX 5AP9A 2XDWA 4DMCA 4KE6A 5EFZA 4Y2VA 4BTVA 4Y2TA 5ALMA 3JW8A 1GPNA 4HXGA 2HA3A 3B5EA 3IULA 4LKOA 1WPXA 3GROA 4U2DA 4U2CA 2QJRA 4HTAA 5EHXA 3WK7A 1MPXA 3C6BA 1CVLA 3WWCA 2BJHA 1T2NA 2WU3A 1USWA 4I4CA 3LS2A 3R3VA 4JYMA 1XZLA 5LZ7A 5ALTA 4FDMA 5JD5A
chains in the Genus database with same CATH superfamily
2JRLA 1PZHA 1PNOA 2DJ5A 3I42A 2IHBA 1TYDE 5B57C 1YDWA 2H4XA 4LY3A 5K3FB 4RENA 5AYVA 1X39A 2A35A 5DHTA 1DP4A 4N5DA 1U2ZA 1LPSA 4CM9A 1KAEA 2EJCA 3GV0A 2VUUA 1CFJA 1D1TA 3TUIC 3BCRA 1QVWA 1ZSVA 5LXTF 5K9ZA 3MGGA 4OYHA 1THMA 1X1TA 2ESRA 2V5UA 4QOHA 3AUTA 4XDGA 3TVYA 3HDVA 2C07A 4DC1A 3LUJA 3JASA 3HZOA 3S55A 5L3SB 1DQSA 1VJ1A 2QM8A 4LBYA 1N2CA 2E1RA 2RFLA 3WLJA 1OVGA 5GGYA 3U40A 5KYKA 1KETA 3VR4H 3MYYA 2XGJA 2IC5A 3FNIA 1DC8A 3EY4A 2AE1A 2FRDA 4D6YA 1FW8A 2ZPUA 5F12A 4YRCA 5CVVA 5H82A 1XMPA 1Y80A 4I4TA 5ERXA 1NF8A 4ZGGA 5B3KA 5LPNA 2B8TA 2BFWA 3A14A 4KLCA 1NM5C 4L0QA 2GCOB 5DYTA 4G0QA 3TDNA 2WJVA 1P1BA 3JAMA 3G2HA 3A37A 4S0ZA 3LTNC 1Q1GA 4CQMD 3BIWA 4RLHA 1Y8AA 2A1UB 1PJ4A 3IOMA 4O4IA 5LOVA 1JHMA 1L9KA 2Z9CA 3IESA 1SCBA 1WO8A 1TAQA 2QV7A 5CBKA 2YZMA 2PQMA 2JCXA 4D3DA 4FNMA 4F72A 4Q01A 4YAFA 1XKLA 3D3QA 5G3ZA 1O6CA 3BJEA 1J70A 5BT8A 3A6HA 3ZX5A 2G8NA 1CRLA 3FYDA 3HWRA 3L6RA 3PT9A 3EWIA 2NUTB 2H4JA 1SU8A 4BYMA 4POOA 2R8YA 3WYCA 5A5FA 4CQLA 1C1XB 1ECGA 4FHFA 3FIUA 1Q14A 4Z9XA 2HNKA 4A6EA 4B2IA 3AERA 4BO4A 3A3OA 4P4SB 2CLMB 4BFYA 3DMTC 1JI3A 2YJ4A 3NOOA 2OCLA 1EVKA 1A7JA 1D0SA 4PC7A 5HGJA 5T4HA 1PZGA 1RWMA 1WXQA 4ZO7A 4ZTUB 1FFWA 4W5OA 2HWWA 5U4QA 2J1LA 3D0KA 1MHPA 2N75A 3LRTA 4ALIA 1L5VA 2EEZA 2XUPA 3D6MA 4M7WA 4OQEA 1KF0A 3S4YA 2GHQA 5TEVA 1IMOA 2VR1A 3PGXA 4PG4A 1YRYE 3X2SA 4B4VA 2Z6UA 4DEYA 1T34A 1JU4A 2VJMA 2IPOA 3RTCA 4U7GA 1UFQA 3KJEA 2P8JA 2J6CA 2VHYA 3HRIA 1YBHA 3P9XA 2X42A 5IM5A 3EXIA 3EXHB 4MMYB 4IFTA 4YJHA 1ZN9A 5REQA 4BLOA 1V9LA 1WG8A 5G02A 2FMIA 5BR1A 3M6LA 3BB1A 2AJCA 4LOAA 1RM3A 5EWMB 3T7CA 2WILA 2O0JA 4JS0A 1EBUA 1RYBA 4DLXA 1R6BX 2D0OB 1KRHA 2QNBA 4LZWA 2FCRA 3DBRB 2IZ6A 3OKFA 3C87A 4XVHA 1VBFA 2W6JA 5DHSA 4GMKA 4JP3A 5AOVA 1PG0A 3O91A 3CZPA 1E2QA 1VKZA 4OMDA 4B3FX 2HPAA 4O8CA 2YHAA 4Q5IA 1FLVA 2LXNA 1H2EA 4YBZA 4QNRA 5HZMA 1T13A 2ZI4A 3C3AA 4RMJA 2IXBA 4DR4B 1AXEA 4GP6A 3C3KA 2O57A 2O7NA 1FFCA 2EHDA 2DBYA 2ONYA 3AL2A 1UAAA 1KFEB 1REQB 1K27A 1PGQA 4EVRA 5C37A 4AF8A 4IDHA 3GOHA 3RIGA 5JPDA 2ID4A 2TMYA 1G291 3CN9A 5CX1A 1DV1A 1EUCA 2OK7A 1PW7A 4WADA 3STXA 2P1ZA 1AN9A 1HDYA 1WV0A 2QROA 2WMYA 2ZDQA 3EXHC 1XEXA 4ZO9A 4I8IA 5GZ6A 3SFZA 2FKNA 4NDAA 4NEHB 1K9VF 4P33A 5DK6A 1LQ2A 4ADSG 4NY1A 5DV9A 4UD2A 2F55A 3AI1A 2I91A 3WYNA 3IP6A 4QPJC 1RLOA 4XWAA 3UK0A 1G17A 2OPHA 3VKVA 5AVVA 1B6RA 2QL9A 2ZRNA 1KAOA 3E82A 2V8BA 4TVKA 5B1HA 1SHUX 3DOOA 4B2YA 2YKGA 2PU7A 3PEYA 4IGKA 3NIFB 2EJWA 5FL7A 3IT1A 1D2EA 2PAFA 3ZE2B 1HDZA 2PH1A 5DLPA 1GGVA 2Z2ZA 2DERA 1D0IA 3LBNA 1NE7A 2FKAA 4B8ZA 3D2CA 3ANXA 1BZYA 1PTKA 3QVXA 2MHCA 4H59A 1YK0A 2FLKA 4HAYA 3JQ8A 4IX1A 4Y6RA 1PN3A 1JECA 4BLRA 4F6LA 4DR2B 5LYJF 4HL6A 2CE7A 3LY5A 3NPMA 3UF0A 4HAVA 3I9LA 2F4VB 3R7DA 1T6NA 3LP8A 3AP3A 3SJBA 3SSAA 3NUQA 1DX6A 3H2GA 3T5GA 2HADA 2ZATA 3AHJA 4RTOA 2J5RA 5IXSA 2A9JA 3WL3A 4TQAA 1C7QA 1KJ9A 1ZOSA 2JPDA 4CKCB 2IY7A 3E3LA 2WIAA 2F9MA 5ITWA 4MV0A 4NFHA 2J87A 3PFFA 3SIPA 2HU8A 3MQ4A 5IT5A 4ZCMA 1OLUA 1IXZA 1YI1A 3BFJA 3OJOA 2VKTA 5C3MA 4LCJA 5CT5A 1RP1A 2R7KA 4JUAA 4DQVA 2ZQYA 1LA2A 3DJYA 3MTIA 2H5IA 5JSUA 1H5UA 2HBZA 2J46A 1U2TA 4HBZA 3DE7X 4RJ2A 1QO7A 3ZV4A 3TZLA 4ZMSA 2C7OA 3ITEA 4AZ3B 4BLPA 2GM3A 2ZSBA 3CSUA 3MEQA 2JFUA 3FOZA 1SB9A 4BU0A 1ZVQA 4MV5A 4UM9B 1Z15A 1G8JA 5AVSA 3SHWA 6AT1A 1RXCA 3QBEA 2IBMA 1RJEA 1U8ZA 5LXTA 1S2MA 1ZD3A 3GUYA 4R2XA 2BGNA 3JZFA 3P97A 3AOEA 1CQJB 4Y30A 2QI9C 1RWKA 1MOZA 1PTJC 3R5HA 3PFNA 1NKTA 3N2GA 4CM3A 2AFRA 2X9NA 1DARA 4EAAA 1ENOA 3JU3A 2WFAA 3K73O 4QQRA 4TSFD 4YECA 5EY5B 3ZYZA 4LF5B 1EWRA 4V3BA 1YDEA 1KWKA 3T5DA 4BMPB 3DUFB 1FP1D 2ZRCA 1R0CA 2F90A 4MDHA 4C6TB 1IFXA 1OZGA 2R97A 3VU9B 1SEVA 2H2AA 4QFMA 4B87A 4FX5A 1RXUA 4FZ5A 3GLFA 3DOJA 4O0LA 4CU5A 4BP9A 5KVQA 4MHTA 4HGZA 2VDOB 1U0BB 2C7RA 1ZOOA 3KZCA 3QYFA 5F35A 2WZBA 4QTUB 4LAFA 5EE3A 2E5WA 2ZB3A 3TIVA 4EJMA 4PG7A 1C5KA 4G26A 1CRWG 5DXJA 3CZAA 2XHEA 2ZS7A 3PIRA 3VNAA 1NBOA 3BSFA 1CPYA 1R0KA 2ZI5A 3OEHA 3Q8WA 5MDHA 3EQ9A 1EFAA 4YCMA 3IRVA 4CMIA 3AC0A 3MSCA 1HT0A 2AJDA 4JODA 5DT9A 3U3XA 4ZT2A 2PRZA 4CL0A 5BOSB 2ECPA 2O54A 4A6PA 1O6BA 2PL1A 2HHJA 3JATA 3SXUB 1J8DA 2I9KA 3E1SA 1DAGA 2IPNA 1SBCA 1XPOA 3H5VA 1P75A 3BC1A 3EIWA 3TRJA 4D81A 1TAUA 5IVDA 1JZSA 3A6GA 3ORSA 4UZSA 5TIIA 5E8RA 1DEAA 1UODA 5HQ3A 2FJUA 1DIBA 2DKFA 3M3HA 3WBKA 2ZK7A 1FNBA 3FHCB 4HZUB 4W82A 2AMJA 4DBLE 3P2IA 1PP4A 2OBNA 4JP1A 3TGLA 1E2BA 3RS8A 4PSUA 3I39X 1U0SY 3CKMA 4JLNA 4RD3A 4IVPA 1E20A 3TUZC 5DN6A 2HMYB 3DXXA 4M8KA 4ARZB 4DYVA 5JDIA 3TEFA 3K35A 1FTSA 1R50A 4UFOA 1UJ4A 2AUMA 2X6TA 4IJWA 5DT2A 3ESQA 3UVEA 4E1VA 4LF9B 2POCA 5BRJA 1MNQA 2CYCA 3MAJA 4H7PA 1WW2A 2AQKA 1LKZA 2HWYA 3QXHA 1Q0RA 1UP4A 3I6BA 2B61A 2I76A 1YR7A 4GLLA 4H16A 1U8UA 4LUCA 4XPIB 4L07A 1YVDA 4KH0A 4URFA 1KYWA 3AUAA 1QRSA 5DO9A 5KTMA 2C94A 5F3DA 2IU0A 2X7HA 2V6IA 3RSFA 4PQYA 3WAJA 1ECLA 1Z68A 2QGNA 2GD1O 3NGXA 4OM7A 2W11A 3BSWA 5JCPA 1MQAA 4ZQIA 1L1FA 2J9ZB 1FFXA 2B36A 3RUHA 3AI7A 4JEHA 3OFND 1CCWA 5K3CA 5GOZA 5J4YA 2JFFA 1MRSA 2OTCA 4GVLA 2B4RO 4P3OA 1H94A 1K8RA 3G68A 3HK2A 4G1CA 4PPNA 3H04A 3KQVA 2ZVQX 1QU3A 5KYGA 1PV4A 3MNFA 4BKRA 4ITRC 3WVNA 4MWEA 5EZYA 1MXFA 2GLUA 2RAPA 4E5NA 1PQWA 2W6PA 3BWBA 4US1R 1XRPA 4DLNA 2OHIA 2ZUSA 3BGIA 3QJGA 2LD4A 1FDIA 3BXFA 3HA2A 4TT3D 3V7FA 4BNVA 4AS1A 5AJWA 4C7OA 3IA2A 4WBSA 3IP1A 1ZHFA 3R4VA 5FPQA 1OSNA 4E7OA 4JXJA 4W9NC 3SM3A 4F38A 3WJAA 4RJKA 1Z47A 2WLSA 4TKUA 1YB1A 2YWRA 1XR3A 4M87A 4CT0A 2WMOB 4X93A 4XX1A 3THWA 3IDOA 4MTLA 1NVVR 1L5YA 5T57A 5DBEX 3DM5A 1C0LA 4BGUA 1Y1QA 2PD3A 3NEJA 1EQ2A 2EERA 3TQCA 4QAJA 3WGYA 1DXOA 5JJLA 3AQ4A 1XTSA 2I1QA 3FSEA 1ITZA 4CKXA 5HX7A 1AVTA 5BN3A 3E1KA 1VYUA 2IF2A 3M1LA 2PL9A 3VNBA 1W34A 4QE3A 4KPUB 3D6UA 1DAOA 4IX9A 4R3WA 5ALJA 3D64A 4ZGWA 1L4MA 4MS3A 2Y0BA 3GLHA 1DL5A 2AOUA 1XMVA 1PJSA 4NWIA 4OGLA 3Q8MA 1I7DA 3LCJA 2XTMA 3U7QA 1P72A 4DIDA 1JLRA 2J9YB 1IZ7A 4DY4A 1OYOA 3OEED 3L49A 3G0CA 4B7ZA 5BWMA 5JJBA 1EBBA 4O4IB 4DSAA 1TT5A 1QOPB 3KAKA 4GYYA 4TQUS 4N41A 2YVUA 3C4VA 1QHHA 3R77A 3U3OA 2R60A 3C5VA 3CNNA 4YUZA 1VBKA 4N18A 1WEKA 1YQDA 2GS9A 2JFBA 2BFAA 3HV2A 4JOSA 3AF5A 4M3NA 1KPGA 1DO0A 1NYTA 4PAWA 5KDLA 1C3XA 4NZMA 1M7BA 2C04A 5LUBA 3VA7A 3DC7A 1PD0A 3BM5A 3Q41A 4QRDA 3GUHA 4RH1A 4A23A 1RYYA 2W6OA 4BX3A 4U7JA 4B2PA 3MTBA 1QRDA 1U0EA 2E6KA 3OJCA 4G4SO 4Q9NA 5EIXA 1U7DA 3IUYA 1Y81A 3HJBA 1NXPA 3KOUA 2XCSB 1ZR2A 5FWXB 4QTTB 2V55B 1JQJC 4PEVA 2B0JA 4TTAA 3W8DA 1M6EX 4RY8A 4ENPA 5KPDA 5ADWA 1FVHA 3FGOA 1NVWQ 1QKIA 2P6NA 4NNOA 3B20A 1YQQA 3EVFA 2DUMA 1W46A 1VLZA 2D8MA 2FMFA 5E1OA 4K6OA 3GLIA 1GCAA 5BV0A 5EMHA 1R3DA 3KLPX 4D96A 3IKMB 4BX8A 1ISJA 1CJUC 3BA1A 2PS1A 1E2IA 3G2LA 1QV6A 1HWYA 3PPWA 1ZBQA 4R1OA 2GJSA 3VO9A 4J0CA 2GN2A 1QB8A 3H1AA 4KV7A 4Y9SA 3QA9A 4NCBA 1KEUA 4YCBA 1AHPA 3THXA 3DGFC 4DSTA 5JTUA 4GDMA 4CWAA 3O2SB 4KE7A 3DWGA 4LJYA 4ZMRA 1GCGA 4LRUA 4MVJE 1NM5A 3M70A 3UMYA 5CYFA 4J76A 1MH1A 4GZ3A 5IJWA 1C14A 4R1NA 3S99A 4GD3Q 3LGSA 3TK1A 3QPBA 3DJFA 5LM3A 1CZLA 3UGKA 4MVWA 2ZRFA 2IT1A 3AP1A 3NM5A 3MFYA 3MBOA 1ZZGA 1Q2UA 5C1DA 5ICMA 2WT4A 3H11B 1JAHA 1E62A 4H7IA 3CLTD 3LPDA 1D07A 5J4LA 3QF4B 4IGFA 2X14A 4XXHA 4JDPA 1EKXA 4QXAA 2XNJA 2O7RA 1XWWA 1Q95A 1TO2E 2P69A 3CRVA 3LCMA 3LVRE 4KXXA 3WGJA 1ZLXA 4DSUA 3K31A 3ZCQA 4NS4A 4TYYA 2FMHA 1Z33A 4NOJA 2HA4A 2OCBA 3WB9A 3FOBA 3WL8A 3QX8A 4DJFC 3IELA 4KLRA 3B1ZA 2ZAYA 3X2EA 4JBLA 2WT9A 4K2AA 5HILA 4DHEA 4F2DA 4UDNA 2VXBA 1R6AA 3SC3A 3VKFA 2NACA 4M9QA 1U8EA 3JQ9A 2ZJ2A 3GARA 1PD1A 1I10A 1K86A 2YYYA 4I5GA 4KXQA 4RA6B 4X1OA 4QG7A 3RRZA 1U80A 1ZU5A 4M0FA 2DLNA 2Y99A 1H4QA 3F6SA 3PE4A 1Y8QB 1WMBA 1UBRS 2L18A 5I8PA 3DT8A 4M1QA 5J4HA 2D2VA 3EXHA 4KBYA 2A30A 3AR7A 3AZQA 5D7NA 5AKGA 5KAPA 4PN7A 5ECDA 3C8ZA 1PYDA 4NV0A 1M10A 3RVDA 4HMPA 2NYUA 1JHDA 2ZWAA 4LQ4A 3DMYA 3UAGA 4JK3A 3EW9A 5DLQC 2FEPA 3T9CA 3W1WA 5IP5A 4CF7A 3HJHA 3T7EA 4HNUA 1MJNA 1TL7C 4IOMA 3UAOA 3UB2A 2YINC 3FJOA 2DR2A 4AJLA 2XCLA 3LZCA 4NARA 2YW2A 5G1OA 2OKCA 5EKSA 2DBZA 3U9LA 1R0XA 2CNKA 1NU8A 1GG8A 3G5AA 3JRNA 3N07A 2DT5A 2H1SA 4IIGA 3GMTA 5AW2A 4DCSA 2GEUA 3R0XA 2W4MA 4CG0A 3I8XA 4TT3A 3UB3A 4ABYA 1EVEA 1NJGA 2GN4A 5LP6C 1NPYA 4U7WA 9MHTA 1G8SA 4ES6A 1ISPA 1D2MA 1ETHA 1Z7EA 4JU9A 4K9KA 3QPWA 4RHTA 5T4EA 4KDFA 4U8HA 3OPYB 4DCTA 1NUTA 4J0EA 1M8KA 5GAJA 2PEZA 3AKEA 2IV3A 2HB6A 3PNKA 1E2GA 1S2GA 1XD9A 2XD4A 1KQFA 5DWVA 2RSLA 1VE5A 2BH9A 1VRVA 2I4RA 3AKCA 3H1EA 5FXMA 5JXJA 4MS4A 3A4IA 5GQSA 1BE8A 3WIDA 1X9GA 5CM8B 1IDN1 4Y9DA 1DJNA 2JLWA 4MPRA 2R1ZA 4KMOA 1CUHA 2J5QA 1RAFA 2NU6B 3QEJA 1F20A 4HPXB 2DR3A 2R65A 1SC9A 4GZLA 3LC2O 2FGKA 3D7MA 3G17A 3QX7A 2VXCA 2QX9A 3QVKA 1UMDA 4AXXA 2LKCA 1UBSB 1H8HD 5ALWA 2KHZA 1QUEA 5THKA 4BKMA 3CO5A 4MKRA 3BL5A 2DLDA 4KRXA 3CZ9A 4ZYZA 1LPBB 2IEYA 4M4SA 3D4LA 3PJFA 2ECQA 2BP7B 3E9EA 3CGGA 3Q3JB 4JEUA 3PHIA 4MRVA 4PQEA 4WXEA 5A1TA 4C7OB 2J9FA 1WR8A 3UPDA 3ZXSA 1JH9A 2AF4C 4QYIA 2MYTA 2AT1A 2XEXA 2X3UA 1V39A 1Y6JA 5CU7A 4BNZA 1SBYA 4FKBA 3GAZA 4TLAA 1AZLA 2LWIA 3CVVA 1G64A 4E3WA 2LVBA 3KL4A 1CUGA 3P7MA 2ZR8A 2XE7A 4AN0A 4C2AA 5KSZA 3TLGA 3O0DA 3A04A 4JITA 3O4HA 1W85A 3RT7A 2GWRA 2X2FA 1GG5A 2GPNA 3H1GA 1J5EB 1XVVA 4Z9FA 4RD0A 4CMIB 1YDGA 1YOVA 3M0EA 4HWOA 1OFIA 4A3SA 2CDBA 3WQHA 4URXR 2RHJA 3U4QB 1J8YF 4YRDA 1CV2A 1P7ZA 2IITA 4L4UA 1TPZA 1W52X 2RG1A 2ZRAA 3RS9A 3ZHQA 1Y4AE 3A28A 4DIBA 4P8RA 5C1BA 5K8CA 1Z0IA 3SHTA 5THQA 4JBGA 2FRVA 1O0SA 3BFPA 2AZXA 4LBVA 3CVUA 3EPHA 4L73A 2X15A 4RD4A 1JLKA 4UMFA 5LBIA 1E8DA 2HEGA 3A4MA 3U7QB 3RYCA 2WLTA 4S2UA 4LMAA 4OOEA 4DHWA 1N77A 3PGJA 1K7SN 4MW1A 4OP3A 4IIXA 3N3BC 2IVFA 3L0CA 2D2XA 3CQ9A 3VHQA 2AUNA 1MNAA 3E05A 4MAMA 3ROKA 1NHWA 3N2GB 1IN6A 2FN9A 2QZJA 4G0ZA 4DLKA 4QU5A 2NLOA 1I36A 4C2TA 4Q93A 4U7HA 1FU8A 3BB3A 5ELLA 1CRZA 1O96A 3O8RA 1HDGO 4MDEA 5G4LA 3RVSA 4I46A 2PANA 2RGDA 3RKSA 4DNQA 1JT9A 2QORA 1R74A 3AHHA 3OEHD 2CT8A 2NQTA 2GO7A 3HB5X 3HQ4O 3JAWB 3N1UA 4XM2A 5CM9C 4NDNE 3H4IA 5DI3A 2RHTA 3UJHA 4D0LB 2DQ4A 1OI3A 3EGIA 4UOEA 3IT2A 2JJ1A 1I4TD 2JA2A 4JC0A 5EESA 5EQDA 1ZCJA 4TL8A 4S1WA 4LYEA 4BCDA 3CZQA 4M6WB 2EBUA 2Q3DA 3TS1A 4OQQA 4B0OA 1FFXB 5KU1A 2Q3BA 4ALKA 1M1YE 5BOSA 1LS1A 2ZIVB 4Y1FA 1GL9B 2ZAGA 2PM8A 2XYRA 3ZQ6A 1OI7A 4M8LA 3MIIA 4JXXA 4ZZ1A 1DAFA 5KOJB 2I29A 3X1ZA 3ZWYA 1ZOPA 3EGCA 5I6DA 1PI3A 3F67A 1DQYA 4IXMA 4L4XA 1T8PA 3CWQA 2JI7A 1P2VA 3OOSA 5GV7A 2I6UA 3AHGA 4C14A 1WUJS 1H0RA 2VDPB 4HSGA 4BRSA 1AB5A 5A7HA 2G9ZA 1EWVA 4L0CA 4ZO4A 4BE9A 4F3TA 2ZJYA 4DIFA 3BMCA 1G8GA 3VZCA 3L01A 3TTVA 5DTEA 3IXMA 3K0AB 1IOWA 4JLBA 1ZXLA 5EUBA 5JALA 4EHJA 1RHKA 1QIJA 3LPMA 4XLTA 3VSBA 2O8EA 1VYTA 1LJ8A 4LFCB 1J8MF 1Y9DA 3A4LA 3S7ZA 5I4IA 1Z4LA 1G1MA 2PT7A 5CFOA 4DNXA 4UREA 5DYWA 2Y9MB 3DCIA 1Q0PA 4OBXA 4Q37A 4J0IA 2Q3EA 1YI0A 2CVZA 2V6GA 3GQBB 5DE3A 4ZYLA 5KSYA 5IF3A 3DSRA 2WWWA 5ETJA 4YQYA 1U1GA 1RJWA 4QECA 4EHBA 3DHWC 1FX1A 4HZGA 1M0EA 5K99A 1TCVA 5KYNA 1CQZA 1QGZA 2RGWA 4CG1A 1BMQA 4JJIA 1FCJA 3NVKI 1M66A 1MRZA 3KIPA 4WUVA 2AF3C 5FTKA 1Z6PA 3VMFA 2NO5A 2FUKA 1CIJA 5K3SA 3JD2A 3Q6IA 3TNLA 1MRNA 2WTMA 4R9VA 1VB3A 4BN4A 3VKHA 5T4FA 4WOJA 1JE0A 3TDKA 2A33A 4MW0A 4UAGA 3DR5A 3O21A 3UAZA 4ZCIA 1CYEA 4X7RA 3GGJA 4OBBA 3QKTA 1A95A 5HQJA 1JWLA 1TA9A 3G88A 1FDOA 4GMGA 2GUWA 4EFNA 2P7IA 1XPJA 3LT5A 4NFSA 1COZA 5IRCD 4M1SA 1UWCA 5IJ9A 2SNIE 1P31A 1EFHA 2OG1A 3D81A 5ALVA 1J22A 1LC3A 4BDSA 1KK0A 1C8VB 4CBVA 5LLTA 1VI6A 3VISA 2FZGA 4HKTA 3BBPA 2WPDD 1LSJA 3VGJA 2J41A 4AMVA 4E22A 2FSUA 3AIMA 3EMDA 4TRJA 2FFJA 4ENSA 2G1PA 1NDUA 3NNDA 2B4KA 4K6KA 3KZMA 1E3WA 2YHBA 2IW1A 3T06B 1Z16A 4RMNA 1KYXA 2DSNA 5U4XA 3RS5A 5JWOA 5DBIA 3Q72A 1X8LA 5J63A 2CXRA 1YZHA 3GIDA 1ANKA 1U0LA 1WXDA 3H4VA 3VPFA 3WSWA 4L5CA 1WKCA 4ZO8A 3WP0A 1AZWA 4D5GA 4EG8A 3BF8A 3KT8A 4W99A 3HCNA 2BV3A 3ROXA 2Q49A 2QD1A 4ENVA 1YBFA 3QVLA 4ZC1A 5IBQA 2IP2A 4GPTA 3GVIA 3U44A 3K4QA 3CR8A 4HLUA 3B82A 5TJHA 2W98A 2F8SA 5IASA 2PUEA 1B4DA 9ATCA 1O6ZA 4X92A 3FSGA 1BVHA 3DVRX 3M6VA 4KN5A 5EUCA 4J3NA 3PZRA 3TLCA 3IUQA 3ZWDA 4C0LA 1W4RA 2NZXA 3COSA 5IPFA 4GL2A 3ZU5A 1FBNA 1NOJA 1Y98A 1VL6A 1VIAA 3F5MA 4F46A 3RHFA 1X1SA 3QU2A 4XA8A 3Q5GA 2MSDB 4D0GA 1LI5A 5KNDH 2CDAA 3DL0A 2XYPA 5A3RA 5BN4A 1UPBA 1Z4PX 1ZMXA 2J3QA 3PGKA 4LYHA 4WBNB 2AFHA 2XOKA 3AYXB 1EHYA 4JFRA 4W63A 3QVSA 2QP3A 3HDGA 3E84A 3QBVA 3PXXA 4I9GA 4OREX 3DL7A 3PPVA 2QVZX 1WSDA 3V4ZA 4WZZA 2WB2A 3WV5A 4I1OA 3GPIA 3IAFA 3L4BC 4Q0MA 1BQEA 5JAIA 3ELDA 5M7EA 3L4SO 2EAUA 2FFAA 1TM4E 2JJ2A 3FTNA 4HPWA 4KRGA 4L2IB 1WZUA 3KUDA 3M3DA 2B82A 5HKBA 2FTKE 1F5SA 4POAA 4DBZA 4DV4B 3L7IA 3WYFA 2B1JA 1BO6A 4AUMA 4IEFB 5IXJA 3QKRB 5IKXA 3COJA 1PJTA 4OBWA 4TUYA 4LV5B 1OB5A 1SZPA 1I2AA 3F4KA 1GV1A 1YS7A 2CGEA 3MRXA 4NYJR 5JATA 2GLTA 2CHVA 2NVUA 1IE3A 1FX0B 1J2UA 2GILA 2NO6A 2WYVA 5BUSA 3NBFA 4YGYA 1PGPA 2X5NA 3G0HA 3QJ5A 5LNK6 3V1LA 3HN6A 3NBQA 3H83A 4G07A 2XT0A 4KAJA 1JNYA 1GAWA 4I55B 4E09A 3R9KA 3UWPA 5KWEA 4XASA 4Y8VA 2C7GA 3I9KA 2VJDA 3GRAA 4EJSC 2NNWB 1DRJA 1E1YA 1UFOA 1L4EA 1XWIA 2EQAA 2W2QA 2XAAA 3EMVA 1REQA 5EIHA 3T3EA 3ZLUA 3ZZMA 3IUPA 2P27A 3C6ZA 4WI1A 3UMRA 3ZWQA 3OOYA 4P36A 1QB7A 4CTKA 3QEMA 1EQUA 3PF8A 4CNBA 4ASUD 2CZCA 3M4XA 2VP9A 4MVJF 3ANTA 4KQJA 5SZJA 2E82A 3GU3A 3Q11A 4OP1A 3TG8A 1ZO8A 2XR1A 5AHXA 1SUBA 4FFOA 1Q16A 1JGTA 5EXPA 1M2EA 5AHKA 1P2UA 3TCXB 2QHXA 1N2OA 1YD7A 2JCSA 2NNLD 3BJZA 1F8GA 1C0PA 2XADA 3EC7A 4QFDA 3VHRA 3IMGA 3QHPA 2VL7A 2IS1A 1FJGB 1XYYA 1GTG1 4TWIA 1VPTA 2OORC 3NYQA 4A73A 3PJEA 5CB0A 4YWHA 5UKDA 1WZEA 3ADPA 3PVSA 4Q3NA 4QUAA 5AESA 2O2EA 4RZ2A 1W75A 3AUXA 2EZUA 4BTEA 3IA7A 2JJQA 2HZ7A 621PA 4YMSA 3HS3A 4UU0A 3BK1A 3DDNA 2AK3A 2GK4A 3PQ5A 2FEXA 4I81A 1U9CA 2R8EA 4RA6A 4YJGB 1M67A 1XZAA 1ZMTA 2A9FA 2Q99A 2X41A 4JYPA 4PRLA 1DLJA 3VNSA 1I6KA 3F5FA 2WA2A 2G07A 3EOAI 2AEFA 1LEHA 4R4JA 1SKBA 3WDSA 3QTBA 3QUCA 2XCTB 2VQSA 1CY1A 3HBNA 1P77A 1ZIXA 3NIWA 4IIJB 1X2BA 3DE4X 4OU5A 3CZ4A 1TYAE 4PR3A 5LQDA 4B3GA 2X5KO 2QVBA 1WB6A 2A88A 1EA7A 4RXUA 1SM4A 1GTMA 1SG6A 2FHSA 3H6HA 3HZZA 5CVEA 4MP8A 5JD6A 4Z53A 1C9JA 1M0SA 1QYRA 1R6XA 1YC2A 1WQ3A 3K0KA 3PC7A 1THGA 7REQB 1X7XB 2RGNA 5DM4A 3A3YA 1GSOA 4FX2A 1GSAA 2XDQA 2YHIB 4CDRA 4D82A 2AI3A 4RA9A 4DR3B 3KDSE 3D8HA 5DHPA 3WGGA 3HL4A 1W36C 2Q3FA 3VYSB 3NHUA 5KSWB 2JI4A 1CR0A 2DM6A 4OFWA 1VPVA 2CEAA 5B1DA 1ZC3A 3HZHA 5C1IA 4C7KA 2FPWA 4YLYA 4D1YA 2EOAA 1A8UA 3HB4X 1VE1A 4FONA 2OFXA 1CF9A 4M37A 2EC5A 4REQB 5KZMB 3CWCA 2CMDA 1V5GA 4J2TA 4IH9A 5FI1B 2WWTA 4Z2YA 2IHVA 3TNJA 1L7PA 1LNZA 3OMLA 1FTYA 1K6MA 5CIYA 3N0XA 5FQOA 5AJHA 4RPHA 3URKA 3VR6A 1BE1A 1XZCA 4FS8A 1H8ED 4FYVA 4DQXA 3BEOA 3MS4A 3AEQA 4JNCA 1U4OA 4DARA 1NU6A 2DYKA 2H1WA 5DX8A 3ZX4A 5BYJA 1NOIA 1X1DA 2FPKA 2IF0A 2HNAA 1SIWA 2O1SA 2XMPA 1T5OA 1V2HE 1FDRA 2DX7A 4L1KA 3TSAA 4MR8A 3GY0A 2IYNA 4H6VA 4JLDA 4N03A 1PJBA 4BJ6A 3WYAA 1OH5A 1UT8A 3NONA 4UTOA 3TTUA 4RPLA 1Q7GA 2K2WA 3C5HA 2P2ZA 5C7LO 3L5OA 4JJ4A 2R96A 4JJ8A 3TAXA 5EHGA 2C54A 1PUXA 1WKBA 2OQRA 4MR7A 4AQYB 1K89A 4BNYA 1GPKA 1TUGA 2ECKA 2JAQA 1C9EA 2YFKA 5CX4A 2ODNA 1J0AA 3KJNA 1DIGA 1HI9A 2X5JO 1F2UA 2X6QA 1USKA 4KNWA 1XTBA 1RTKA 3NAQA 1P62B 4AQ7A 3RFXA 4EWLA 1QFYA 5DTMA 3RIMA 2QL5A 1FP4B 1QVVA 3ASZA 4FBGA 4QUHA 1BN7A 4INPA 4ND2A 1RKBA 5I4BA 5LYYA 3CCCA 1YRQA 3IIMA 1TFUA 2HMAA 1CR6A 3INNA 4NJMB 1GU1A 1E0AA 1QLWA 3U44B 4YP1A 1J21A 1YOVB 1T5DX 4HK4A 4B6QA 5MN4A 1X1AA 3H4MA 4JT9A 1XKTA 1FUYB 2XNDA 3NHBA 1JQAA 4ML3A 1JDVA 1MT3A 2XSZD 3OETA 1NW4A 3BHIA 1NJ1A 4Y2HA 3UAWA 2BR3A 4AKIA 4LYDA 1TW3A 1W4AA 3H19A 5KAMA 2PZJA 1NP3A 1Z74A 4FN5A 1LDYA 3R7LA 5A1JA 1O8CA 5C80A 1O57A 2XUHA 3QUQA 1FRZA 1W4BA 2GCOA 2AKAB 2OV4A 3LUAA 1ZGHA 4BWFB 5DVZA 1KDVA 4CLRA 3I9OA 1XTVA 3UCFA 3QXJA 4B4DA 1X74A 2FWNA 4B3XA 1S1MA 3B5JA 4RFVA 4TTVA 1CUEA 4ZJZA 2A9PA 1R4MB 4BGDA 1PZNA 3A3KA 1GEGA 1H2RS 1SUIA 4ZYUA 1E3DA 1IULA 1WXEA 3EBPA 2I71A 3U4HA 2PWYA 3VR5A 1S8AA 2A67A 1A7KA 2CFSA 2VNAA 4P58A 4QDZA 4RKYA 3L06A 1ZK0A 4DLYA 4NBSA 3KTFA 1MABA 5AVUA 4MUGA 4UDXX 2WVAA 1PWEA 3V33A 4F5ZA 4REOA 3MCZA 3I5MA 4BMZA 2ASEA 1U65A 1L4NA 3GHHA 4HFNA 4YJ3B 3SX4A 1LF0A 3AEYA 1N2HA 4FDUA 4OQNA 2I80A 1GCUA 1GLNA 2FW1A 2C8LA 1NPTO 3J81A 1G0OA 3QENA 1VKOA 2L17A 2PUTA 1ISRA 4EF6A 2NSYA 3DF7A 3MRVA 3DVSX 1XZFA 3FPBA 2ZYTX 4LXYA 2O20A 4I55A 4L4YA 4ATNA 3O5AA 3ZOKA 3U6BA 2XE4A 2DFNA 3MCWA 3S2IA 1RHQA 3AYZB 4CPDA 1KZGB 3BD7A 3IO3A 1JR2A 4G8CA 4AYWA 1BH6A 4EMUA 4P0PB 1T4GA 4B6OA 3AHEA 2LKDA 1G2PA 1T1EA 2XQVA 3OZWA 3FI9A 1LVUA 3QWAA 4NZZA 4S12A 3N2ZB 3O3MB 4WKCA 4Q03A 4ZCQA 3AF4A 3SYNA 5AD1A 2I4LA 1U3TA 2JFYA 1UAGA 5FDFA 1CQWA 2VUHB 1Y8RA 4BGVA 4UEJA 4EABA 3W8EA 1G6HA 1P81A 4O33A 5DK4A 3QI7A 5IDWA 1OE0A 3UJAA 1PVOA 1P4HA 2HK7A 4QYIB 1OJLA 1V48A 3V1NA 4A0SA 4ECEA 3PRHA 1UXOA 3NRCA 4J0KA 3ZNNA 4CGZA 4NCNA 2W5UA 4U02A 4RGBA 1K6IA 1RWWA 3E7DA 5I51A 1JHAA 2XECA 1U11A 4YAUA 5JSFA 2DCMA 2PLRA 2J45A 2R6FA 8LDHA 5ALEA 5EPEA 1M1XB 5LMZA 4G2TA 1GZVA 1YU6A 1QYCA 2VBGA 1WP9A 3IEKA 1BU5A 2B1GA 4ER5A 2D13A 1HE5A 1N2IA 1Y7LA 4F1KA 5L3SA 3GJZA 1D7AA 1M2OA 5DLEA 2I2BA 2M6RA 4EPYA 2QG9A 3FCAA 2HDHA 1F6DA 1K63A 2QD5A 1YDHA 4CLHA 4YV7A 4NULA 4OQDA 4Y6GB 1ZN8A 3TMYA 5JQGF 3O83A 4LYJA 4C4XA 2JHAA 5BT9A 1G7SA 5LSAA 3N2IA 2R44A 3FLBA 2YIVX 3ZZ0A 5J23A 1M2NA 1X7ZA 5BSVA 4PW0A 5FEMA 3WGKA 1AQUA 1UK6A 3OTWA 2I2WA 3MWJA 4JZYA 5TX7A 1NJ5A 4BP3A 1UBLS 1F48A 3U7RA 3V4OA 5AUNB 2FK8A 5DNYB 1ZJYA 4PYNA 3CX6A 4XRRA 5KQGA 1VE9A 5JARA 2QMEA 1N2ZA 3T3PB 3D3EA 4N39A 2VXOA 5C9ZA 1N5RA 3JQ8B 3CF0A 1ODKA 3UYKA 4AO8A 1WCWA 4B7XA 2Z8XA 1F6BA 1RC1A 5HKKA 1V5FA 2UZ0A 4B5KA 1T1GA 2FX5A 5LYJA 3P27A 5E9QA 5EKTA 4Z7JA 1JEAA 2IP1A 4UULA 2NUTA 2IU6A 1JT2A 2QX6A 4ZANA 2HRBA 5ITSA 4U5QA 2GYVA 2X9VA 4HX2A 5K6AA 4MGYR 1NVDA 1S9DA 1KP2A 3KD2A 3M82A 2WZQA 4NZYA 1UOOA 2QLLA 2CXHA 3EE6A 4EHDA 4UTPA 4I5EA 1LZLA 3F9CA 2CDRA 4DSZA 5C2JB 1Q19A 3OJXA 2VRCA 2P6RA 2BLLA 1PL8A 2ZXFA 5BW4A 5JHGB 3H2SA 2WZDA 3CPJB 3GCDA 3NHLA 1GKYA 2H18A 3PD1A 3N8GA 1ND6A 2GEVA 4XD7D 3I04A 1RAGA 3NORA 3ZI7A 1IDOA 721PA 4S05A 3OZBA 3RHTA 1IPHA 2ZLBA 1HETA 3AW8A 3ECCA 3K0BA 3W06A 4DMMA 3SYLA 1OX4A 2DECA 1E3QA 1PR4A 2OV6A 3AEQB 3N28A 4L0DA 4NVRA 1L8OA 4X8OA 1T0UA 1XFDA 1M1NA 2IDKA 4EY3A 5CCEA 3MJDA 1XQWA 3I2GA 1CHDA 3PNYA 1A98A 4KIWA 5DYYA 1CHNA 3SIRA 3TBHA 2PL5A 1ZIDA 1H2WA 1UFKA 2YXBA 2VK8A 2Y1OA 4O2LA 4Q39A 4CG2A 5DTRA 4NG5A 2GHIA 2PX0A 1VCOA 4DA9A 4NTZA 4G1FA 4QNNA 2E7ZA 4MUYA 4TLEA 3RC7A 3KELA 1W8IA 2OCPA 5HM6A 1Z0KA 1TYZA 2ZBEA 1XXHE 4M60A 2WJZB 4QGHA 2O8DB 1MTOA 5HEKA 1I01A 2HSDA 3T5PA 3CSDA 1JIVA 3R0JA 5A04A 1N2CE 4XB1A 1M33A 4O4JA 3Q1KA 3OIYA 1DEOA 2NTEA 5CK5A 3O1HB 1C7IA 3QIAA 1VCMA 4IJ5A 4OAOA 4TN1A 4D0NA 2AVNA 4ROSA 1XD8A 3WIBA 2VFAA 3PEUA 3Q85A 3AG5A 2WM2A 1JHUA 1EK0A 3MRTA 2VYCA 5K45A 3IXQA 1WPGA 4PBRA 4ND1A 3TVDA 4KQGA 2QNIA 3VSDA 4B6SA 4QT4A 2XKJE 1BN6A 2MSKA 2W2XA 3LFUA 4LX8A 4O2AB 2RJOA 3HJFA 4MWOA 1D3AA 1DDOA 4B4OA 1K4YA 1P0FA 1YT5A 2FVYA 4WOBA 2G8LA 4MROA 2OBMA 4PWZA 2GYWA 4R7TA 5DN6D 1AQYA 3OLYA 5KTTA 4O2BF 1OHHD 4HCJA 1SCQA 1LLDA 2C83A 2JIRA 1G5QA 1OY1A 2V54A 2X77A 1K0UA 4TSRA 1RYDA 5FA6A 2EDCA 3S2GA 3SHOA 1Z5UA 4UM9D 3A36A 3DAPA 1A9XB 3A4VA 3TIFA 1PFKA 3DVAA 3IC5A 3NHRA 4LRQA 3VTKA 4CFYA 3PR2B 1KVSA 2R86A 2P75A 5LP1A 4RD2A 1CY4A 1AKMA 1NONA 4I1VA 1YE5A 4DOMA 1ULAA 4MVXA 2ETVA 1MB0A 4BZZA 3B6MA 4KJZA 4EYEA 4XIYA 3I09A 1XKXA 1PR3A 3TM5A 1PO7A 1UJMA 4QDUA 2CVHA 4YT4A 5FUXA 4MYSA 3E3AA 3BTVA 3CEHA 3V2GA 4CCWA 1XIVA 3MIZA 4M9SA 4KYTA 1F1BA 2HM7A 2QL7A 3G6WA 3OKPA 2WSMA 3EA4A 4LJLA 3TLBA 3YASA 3HLTA 4LYFA 2HQ1A 3DUWA 5TARA 3NHJA 2BMVA 4PSKA 1FVXA 3F1KA 4J0DA 4RVUA 2CL7X 2QX4A 2RI0A 4EPXA 1RBZA 3LK7A 1ZWLA 2ZIXB 3S28A 1FIUA 4JAVC 4G5GA 3DBHA 2CNLA 5JXGA 2MU1A 1L3IA 1M2WA 3EVCA 3SQMA 5BOVA 3L7DA 4UBKA 3UGTA 4DMHA 2EIXA 4ZN6A 4OSEA 4RHYA 2Z2KA 3QOWA 3U56A 2E9SA 2ZRDA 5IS2A 1NQAO 4GG1A 1N6RA 1M74A 1ISSA 3H6KA 4BO1A 3GVCA 4CW7A 2GM9A 4FUTA 4M0KA 4IOJA 3LV8A 3DAHA 4FGLA 2FZ5A 3BAZA 1T8RA 4DMRA 2A9VA 1OH7A 1Q1AA 3MYRA 3PB3A 5U1PA 4LXXA 1J23A 3R3UA 3SK0A 4BWYA 1EK2A 1O95A 2Q46A 3A10A 2FCAA 2QX7A 3LRXA 3M5WA 3TLZA 3TZEA 1TUEA 4MR7B 1GQYA 1Q3KA 3C7CB 3DHEA 4M0DA 4QXQA 2JJMA 5EZSA 2PYZA 2QN1A 4RKEA 4A5SA 3JY6A 2PFSA 2CJYA 3K2BA 1LLUA 5EP2A 1N6HA 1F8FA 4ACBA 1ISIA 1CY8A 3WWDA 1RE0A 4HEA6 4TWBA 1HNWB 4HYQA 3RAPR 2PUDA 4QU9A 3WLTA 5AK5A 1LK5A 1TKRA 5FHQA 3UTCA 4RF2A 4N9QA 5IHPA 1DBVO 1JHPA 4RDCA 5FOSA 3KD3A 1PGNA 3C85A 1ESMA 1M8PA 4WZBE 3BXZA 3KU1A 3O2NA 4ZKDA 4YY3B 5JWHA 4R0NA 4MW6A 5EJ9A 3WK8A 3AO0B 3T15A 3I01M 1HZZA 4TMVA 1A7AA 4G89A 3NVDA 3R5KA 4JA0A 1TMKA 1OILA 2JS7A 5BQ3A 2YWCA 5GP1A 2WT8A 2ZVDA 3FDZB 2W4QA 1Q11A 1X7HA 3OO0A 4Y1GA 3BH7A 4FMCB 3FCOA 1XZPA 3SC2B 1JU3A 4K6MA 4MEBA 3U17A 1NMSA 2NT4A 3L6DA 4TQGA 1J2TA 6Q21A 5CDSA 1P7CA 1RPAA 4TN5A 2NAFA 2Q2NA 3OUUA 4J49A 5C4MA 5HTOA 1US8A 5GJCA 3PLRA 2O2YA 3CJTA 4XTRA 4RDHA 4HFMA 3UH1A 4EUHA 1QHIA 4KXVA 2CFCA 1DKLA 3IQFA 3RE1A 1UBEA 3CCBA 3L7YA 3C8HA 2JD0A 1SIOA 2WUEA 4I9HA 4OLJA 1C3OA 1SKAA 4V3CA 4Z5XA 1JEOA 1YRAA 1QHHB 1XUOA 2CFOA 2ZKLA 4MYRA 3S44A 2PJUA 4EIWA 5C8YF 5LMNB 2E85A 2P7HA 1MX3A 1JPVA 1NI3A 4K9PA 4MYCA 1ZQ9A 2D1SA 4D8XA 3PNBA 3H3JA 3N2NA 4H1VA 2J3IA 3T1TA 1Q7RA 2N0SA 1NVXQ 2IUYA 3DUFA 3DKPA 3UMJA 4J43A 1F2UB 3OLCX 1BE6A 1M9NA 4FR0A 3EB9A 4KXWA 2PX2A 3L43A 4NI5A 1GRNA 1PS0A 3UHJA 3GBPA 4C3OB 4ZDJA 2IH4A 4MZXA 5AVXA 4HVTA 3NETA 1M2GA 2OXCA 4YJ3A 3DZCA 3DL4A 4PCUA 3F1LA 3M9WA 4BL5A 4DL9A 1G42A 4PSDA 13PKA 4LV8B 2NZVG 5EC8A 4PIVA 3N58A 3NGMA 5EERA 4CCSA 4LJ7A 3NW9A 3KQHA 3MTDA 3KSDO 1S8NA 4BAUA 1P0QA 3QKWA 1MEOA 5D1HA 1I3NA 1XL1A 4HQNA 2GM5A 3BTSA 2JAUA 5EWJA 1WCIB 5KOYA 1LV7A 3WNVA 4O0MA 1CDZA 1P1JA 2E4AA 1PEAA 2V7WA 1JEEA 1NSFA 3OZ7A 1OX4B 1CLUA 3RYFB 2C8JA 4MEAA 1ARZA 3V4RA 5G1NA 4R01A 4DB4A 1HG1A 5ANRB 2VUIB 3RK4A 1S89A 2IODA 1JAXA 1T9HA 3HYTA 1G5TA 2XHZA 2GCIA 3P32A 1GPBA 3KYDA 3AJ8A 1B3BA 3A4NA 4K6HA 4KPYA 2IIQA 3F0TA 3A32A 3AF0A 3A11A 3I2YX 5FLEX 3T7KA 1MTZA 3PL1A 2P1DA 2WWYA 5F4ZA 2PXCA 4O59O 1AA6A 1FF9A 4L5BA 5KNBH 4RNDB 1T4CB 2RDMA 3UHFA 1HKHA 4KQ6A 1WXWA 2TSYB 1H3FA 3RYFA 3RADC 1Q1NA 4R68A 4UZFA 1CVIA 2G77B 4IRUB 3T35A 3QF4A 1N5LA 4REQA 4KUGA 3DZDA 1DAIA 1I80A 4XYGA 4CKWA 3ESAA 3TKYA 2ZROA 3UM9A 1L8AA 3JZDA 5IKOA 3EIXA 4RTSA 1ZEJA 5AJVB 2QB5A 4AMGA 3V9PA 1UXHA 5JH7F 4Q66C 2XQGA 2FRDC 1E4VA 2AOWA 3LW8A 5F2OA 3ZVRA 1L5OA 4LWOA 1N0HA 4DA0A 4PC3A 2PS9A 4N0DA 3RUFA 1FS4A 2ATIA 2GZHA 1Z6AA 4OYRA 1MH9A 1IATA 2I8AA 1ZISA 5H16A 3VPBA 2DOKA 3HBFA 3B13B 3AVPA 5LZ8A 2EYUA 3IMFA 4XOUA 3UATA 4G5FA 4U6NA 1CUUA 2ZT6A 1UEIA 3OF3A 4WKNA 5DW3A 5LKRA 5LD2B 4N4AA 4EI8A 1NQ5A 2QSUA 1N5DA 4P86A 1L7VC 5E4JA 3PWKA 4UFPA 2EBHX 4OFZA 2YJTD 1W0JD 5L7YA 4C08A 3JQFA 2WD7A 3CW9A 4DDUA 4BZXA 4BUJA 3L04A 3ESCA 2DFPA 1ORHA 2XT6A 1WXHA 2TECE 2VNKA 2IZ7A 3BWXA 2GEKA 2XMSA 1CDOA 2JJ2D 4HDKA 4B46A 5BNWA 1G38A 3DBIA 5DKFA 4ARIA 4AZ3A 3E5HA 1N5KA 3HU1A 1DBQA 4QGFA 3HGQA 4HO1X 2QZZA 2IP4A 4U5XA 4DIKA 4JU8A 4J0QA 4UPDA 3G1TA 1OT5A 1Q20A 3ICQB 4L57A 1YL5A 2CZGA 5B64A 3EEOA 5ECWA 3FOCA 3GX1A 4YQFA 4GMHA 4IDCA 3UAYA 3HSKA 3W90A 3N2YA 4ZREA 2UZ3A 5K3DA 4NMMA 1WB9A 3AHCA 4F71A 5JC1A 4MRSA 5FBVB 2UYOA 3WJ2A 2H2HA 4NJEA 2VTVA 5A7GA 1G5RA 2O3RA 5J9FA 2PXAA 5C8YA 1Z2PX 3HN7A 3OU6A 4N3BA 5J43A 3RUAA 2C7QA 3T5BA 1BHO1 4YREA 1H3NA 1VM6A 3FVQA 2O2IA 2RK4A 4GEGA 1SBIA 4KPEC 1EDEA 2ZCVA 3QTTA 1NXWA 2A2ZA 3L46A 1XRQA 3UW1A 4CMAA 4Q4HA 1NULA 5JEEA 3R9WA 1RXSA 1W25A 2QN9A 3AERB 3F71A 3LJKA 3PC4A 1AB6A 4P4SA 1X7DA 5FAKA 1FMTA 3QKRA 1G6OA 1SD5A 4U2FA 5CXUA 1Y1SA 1GPH1 1P4JA 3G0IA 3EGEA 4E11A 4RMIA 7MDHA 4ISCA 2Y05A 5LFAA 3IEUA 4L9SA 1IM2A 2YV4A 1ZNXA 3QWFA 4M1EA 3RO7A 3SJ7A 3AOGA 4BFUA 3M81A 1M7HA 4IQ0A 4PLPA 1OLXA 1DO2A 1ZC4A 3DFFA 3L7MA 4CMEA 2NG1A 4DLBA 5LBTA 4XVRA 4A2PA 4JI7B 4WLOA 3DHNA 4TTRA 3E27A 1ONSA 3DAYA 1AKYA 1ZDMA 2H1VA 1Z0ZA 4YAJA 5E4TA 3SMQA 1KEKA 3K8QA 5ENDA 2OAQ1 1H1TA 3GJTA 3QE0A 4G1VA 4GMDA 3TPCA 4BEJA 1BVYF 3DAFA 3UK2A 1UANA 4GXTA 4HDMB 3VR3D 4PNHA 3SZLA 2MR5A 3CB2A 2DJIA 2QJOA 4PZYA 2ENUA 2LTAA 4I5FA 1OFUA 3X3HA 3ZOZA 1M6NA 5ENZA 1PJRA 4HQOA 4AP6A 1KY2A 5LD2C 1FU7A 3GZNB 4FHEA 5DSZA 1W49A 2L82A 5EN4A 2O5EA 1C1YA 1L7BA 3FPAA 1JFFB 3BTUA 1X92A 1E9SA 2WWRA 3AF1A 3QUTA 4TXMA 2ZITA 2RD2A 1GN9A 2X19A 4O6VA 1R0SA 1RHRA 3IS3A 1SCDA 1TZJA 4QXPA 3DG9A 1JV2B 4RHEA 4TV8A 4ZVOA 1A2QA 4FT4A 4C1NA 4DRXB 5J3JA 4YA6A 2DWOA 1ODFA 2ZYAA 2WVJA 3K94A 1H6AA 1T4BA 1AO3A 2FEOA 5IBPA 1VG8A 3GMIA 1I9GA 4E5PA 1E7RA 2IYOA 3RYCB 4CEHA 4UM5A 4JJZA 3T6KA 1HDRA 1Y6ZA 2W7TA 5M2QA 2VATA 3ORFA 1VA5A 1PDWA 1VXRA 1Y8RB 4NYMQ 1T9AA 3G6KA 4UNSA 5A4IS 2W0SA 3C6YA 1PT7A 1RFGE 1W6RA 3CF2A 3FX2A 3LNTA 5FI5A 1Y8ZA 2ODAA 1ZINA 4E5VA 3IP3A 3ZY4A 3FR8A 2VZ0A 2OFOA 1XE3A 4KN8A 4QEZA 3S5UA 1ZJ5A 3F7OA 3ZKAA 1PK8A 1J9GA 1NRJB 3ZWAA 4EH1A 1DKQA 1GUZA 3DMRA 5HUQA 1ODCA 3HJCA 3ME5A 5LOVF 1YIOA 3KNZA 2FSIA 1N2GA 5I7AA 4AP5A 4B35A 3OUTA 3CINA 4O4HA 1QYDA 3R75A 4K46A 2V98A 4BRZA 3HBAA 2VDJA 3FCEA 2XB9A 2ORYA 4GYKA 2QRVA 3T3NA 4KB5A 3KOWA 1IVYA 5DP1A 1XTUA 3RS4A 1P5HA 1Y5LA 1E9BA 2GHTA 4BUZA 3FYCA 5JAQA 4LXHA 1QG2A 2ZJ1A 4AUKA 4OHMA 1NUHA 4CYMA 1N1DA 1NBEA 1WCIA 4G0WA 1SBQA 1DWQA 2JD1A 4Y6OA 1Y1TA 2L42A 1IN4A 3K0CA 1XMXA 5I9TA 4BCCA 1NJFA 1Y63A 3DE0X 3CRNA 2DG2A 1MB3A 1U8FO 4C04A 3JQFC 4ERNA 4D02A 1OAKA 2AUTA 3DW1X 3P0FA 4KYIB 1HR0B 3D59A 2A0UA 3AHFA 2Q6LA 1EHIA 5IT9A 1BYUA 5KNBD 5KS2A 4XWWA 1G6KA 4DUZB 3EPLA 4CLDA 4KKVA 3O2QB 2CHUA 1PRYA 3C7AA 1EHCA 4KGXA 5TXGA 4QYXA 4TOIA 3IE0A 4CDGA 3QFFA 4WN9B 3CR7A 4ZVVA 2BKAA 3DULA 4HDCA 1I1HA 3WOVA 2A1TR 4G1UC 3SGLA 1SOAA 5HW0A 5HHTA 2P3QA 2O2CA 1NA5A 2QR5A 2WBLC 5EYPA 1OQAA 4B83A 2BJVA 3WIOA 2QLNA 4UM8B 2H1FA 1VFNA 1WP4A 2FHPA 4HGRA 3BE6A 1GXSB 1RCTE 3F6YA 4EP1A 1UC9A 5NULA 5AW0A 1FNNA 2O8BB 5JSHA 2VQ3A 1VKJA 5AOAA 4D9EA 1EB9A 3BE5A 3WQBA 3C8MA 3DEZA 3DFZA 2GBIA 3W7BA 3MOSA 3JV7A 1X38A 4GPD1 1YTLA 4X7BA 2M6KA 1CG6A 2Y1FA 1XMSA 3BGVA 4OGKA 2YBEA 2QN3A 1LSUA 5EA2A 5BYAA 4BPRA 5KYTA 1Z34A 3UOGA 2Q6OA 1T4DA 2RG7A 2AG5A 4NMHA 4O3FA 4Q9DA 3IVRA 3LLUA 4LZLA 4RZHA 4URWR 3EY9A 3G9TA 3ZHTA 1FP4A 5AI0A 1R0BA 3ZDEA 1PBTA 2JIMA 3KLOA 4HLUC 3VTFA 2G5TA 3PUJA 1KZHA 2ZJ6A 1Y5MA 3EJWA 1BVUA 4TS4A 1RHMA 4W6QA 3RRMA 4G1MB 1Z8DA 1L3CA 2W2VA 4HAOA 4AJ1A 3ICEA 4V39A 4BNMA 3B3AA 3NGLA 4IMPA 1YZKA 1NTRA 2SICE 4ODIA 3OC6A 1BKDR 4L72A 4NE7A 5F73A 3K72B 3LUCA 1IHPA 5TPZA 5JMWA 5TF0A 2FPGA 5T3YA 3B70A 3MBIA 3DZBA 2WEKA 1IPFA 3JATB 3SXUA 1YKSA 4G0NA 2WFLB 2XLBA 3GFSA 5B12A 2OCYC 1G18A 2IZ5A 3ET4A 2H4FA 2A1IA 3HKCB 1TMGE 1LQTA 3IILA 1JBQA 1KQ3A 4MCJA 5JVDF 4DQ0A 4MDFA 1YE3A 1QCZA 2DWCA 1Q3TA 4RKRA 4TL9A 4Y2YA 3MC1A 4LZAA 4G0UA 2QLJA 3FKQA 4XAQA 2R8PA 3LDAA 1U2GC 2OZLB 1FYDA 1AIPA 2ANCA 1IRIA 1QH8A 4GI7A 4L8WB 1NBME 2QMHA 4D9CA 2YHSA 4TM8A 3I9JA 4MS1A 1ZH8A 4C6HA 3ISVA 2CNOA 2HN9A 1V45E 4LDPA 4FWTA 1MC8A 3SICE 4L76A 1W7AA 1CNMA 1H8EA 3TSWA 3UMBA 4YUYA 1YL6A 1AOXA 2MWMA 3FJYA 4F5EA 5LVAA 2OORA 3DOFA 3OF5A 4R7GA 1FS5A 2WD8A 1AURA 4QOFA 1FNSA 2AQHA 2VJNA 4MA4A 1HNNA 4YJ3F 4F86A 2I67A 2FEWB 3CF6R 5J47A 4ZQCB 4HVAA 4EPWA 1L4UA 3A31A 5EIEA 4HS4A 1JPUA 1GQRA 4UXJA 1SWWA 1C3OB 3KZ1E 3GPCA 4JVOA 5DX1A 1NVGA 4IGAA 4PHTA 4ZEMA 4Z4FA 1FNCA 2BZ1A 1PSDA 3PFHA 2VSOA 1ZA1A 4MHSA 5FBQB 1AO0A 3FWYA 3MCTA 2LIVA 3OOHA 3RBVA 3MCVA 3JQBA 4LCEA 1TA0A 4JOBA 2ODWA 1HSOA 1Z6QA 2LDBA 4KNYA 3GFBA 2P11A 4DSNA 4TS1A 3GFQA 4UBOA 4FR5A 4YRPA 1WABA 4P38A 1C4OA 4YROA 5FI0B 1JILA 1HURA 3HCFA 5EZYB 5EHZA 2PCLA 2VP4A 3HRKA 3BKXA 4RACA 5CYOA 5HIIA 2X9GA 3M2TA 2PV7A 3L77A 1M34E 3EG9B 5CG2A 4KI0A 1W35A 5KI6A 4X20A 2IZOA 5K6RA 4D4KA 1TE2A 3GRFA 4URZR 3SE0A 4TV9B 1AM4D 1QP4A 1RTTA 4TKMA 3CNQS 1NHGA 2QLMA 2D7DA 1BDIA 2EKBA 1JSRA 4F8EA 3VR4D 1P7VA 4HB0A 2GZSA 4R83A 4Y9TA 2QRHA 2XSZA 1T2FA 4W1PA 1FQKA 5E2BA 4U9HS 2WJPA 5FO1A 4KFCA 1DAKA 2GN6A 2ZOSA 4YXFA 5CTAA 4TSFA 2QTAA 4UCWA 5FPKA 4JT2A 2R2GA 1KMHA 1JG2A 3TW6A 4EVQA 2RB4A 1APBA 2X2EA 3AB8A 2BBTA 1DVRA 2HC9A 5CAEA 5CLLA 4BLTA 3BD6A 4JR0A 3WNQA 4DEVA 2BAGA 3K0AA 4RBNA 4ND3A 4WJLA 1GNTA 2P8SA 4AJHA 3WL4A 4N49A 4EX6A 2OQIA 3HUUA 2Y76A 1A9QA 2A5GA 3H2JA 3PNMA 5EE1A 5GY7A 1D2CA 3SEAA 3OU2A 3T5CA 1V7ZA 1X7ZB 4B8WA 1BMFA 3O47A 4WXHA 5JS8A 4HUJA 1P7WA 5E4FA 2J0VA 3MJSA 9LDTA 1U31A 2WE7A 2R6ZA 3DMPA 5I7EA 1CE8A 3FCXA 3HB1A 5KYYA 4AJKA 3QVMA 3SFVA 1SGWA 3B3FA 5C8YB 1CX9B 3WNCA 1ZRMA 5AJUA 4DADA 2ATEA 1K4MA 1R0LA 3QFRA 1GRVA 4QWWA 2KBEA 4ETWA 5LU8A 4YCAA 4IZIA 1ZZEA 2BFMA 2GJ8A 3R20A 4QOSA 3I52A 4YRFA 1M6HA 1Z62A 1Y6RA 1DDIA 3ML1A 4YCNA 3UPUA 4GOXA 2J9FB 1DEHA 1UJNA 3ESBA 3P2KA 4U7PB 4UQPA 3QYPA 1Z0SA 2D6FA 3GA0A 2EGHA 4NOKA 2C4MA 2O0HA 3TOXA 1GRQA 2VLIA 3W2EA 5FFFA 1ZIYA 3P0RA 5PNTA 5KO2A 1TCBA 5BN4B 3FNHA 4BLVA 3MELA 3HEAA 1SOWA 3DR3A 4XX0B 5IVHA 4KN6A 2CUTA 1CUVA 4P2BA 1CEYA 1M8GA 5EPUA 5HRUA 1MIHA 4ZVSA 3WDLA 3WGNA 2C4KA 2NADA 4R5MA 3CX8A 1SHJA 2IX9A 3C14C 4Z0NA 3D4OA 2KBFA 2Q5HA 4N8EA 3EEIA 1X7XA 2I66A 3FLAA 2DE0X 3OJEA 5BSWA 1PX0A 2NZ8A 2CF5A 2MSCB 2XDQB 2YHIA 3SOPA 3ZLBA 2JB9A 5LUAA 1P2SA 3CVYA 2F3TA 4XIIA 2PX8A 3OPNA 5IZ4A 1E18A 2ZGVA 3G9UA 2Y2VA 3K09A 2QMQA 3U4IA 3RU3A 2CLSA 4V1CI 4IF4A 1CB0A 3KPJA 1GD1O 3I9V6 4G5YA 4WTOA 3VZRA 4CF4A 5KU7A 4N9WA 1TAHA 5A71A 3ZLVA 1A50B 3DCYA 4WY2A 1FX0A 1JHXA 2VO1A 1XYVA 3DXFA 4D57A 3L82B 3L7AA 4KL8S 1KBOA 3I5XA 1Z37A 4GBED 2P90A 4EEKA 1DX9A 4IMRA 3UAXA 1VIVA 3HO8A 3DLCA 3RBXA 3ZDZB 2PFGA 2CD7A 2JLXA 3HSSA 5IDXA 3WMGA 2AC2A 2P3SA 3DPSA 1PZMA 2ZZKA 4JHXA 1YHNA 4EQZA 2D1QA 3DQZA 3UN1A 3V3TA 4Z4CA 1JB1A 1Z4KA 4PV7A 5CUQA 5SZKB 3WO1A 3ER8A 1SMKA 3Q2OA 1EGQA 3A9RA 5AI8A 5CT4A 2JKYA 3BK2A 1KSFX 1PQ4A 3B2EA 3INYA 1C7JA 3MTJA 3N53A 4B3RB 3ZWCA 5CPFA 1JZQA 2DU8A 2YFYA 2AFHB 4RZQA 5IN5A 5B37A 4RCZA 3JQ7B 2WSSD 1SZCA 3I8OA 5AP9A 1LTHR 1KP3A 2FMXA 4FMBB 1E69A 4YUAA 4O63O 4GLOA 4Z8YA 1KR5A 2Z56A 2CLIB 3QXSA 4HF7A 4Y2VA 1G3QA 5CHEA 2QQEA 2PUFA 3CUWA 3PS9A 4BTVA 1JKJA 3INGA 5ALMA 2QM3A 3QXXA 2BELA 4IZOA 3B5EA 4OFBA 3EASA 1ZGAA 1AKQA 1MJGM 1KNQA 5LMUB 4TZ6A 4G1BA 4WASA 1N3BA 3GROA 4E6PA 2IGTA 3AEUA 2CDNA 1V43A 2EKLA <