3KDPB

Crystal structure of the sodium-potassium pump
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
286
structure length
286
Chain Sequence
NSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRSRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Crystal structure of the sodium-potassium pump.
pubmed doi rcsb
molecule tags Hydrolase
total genus 33
structure length 286
sequence length 286
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3kdpB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 3kdpB02
3M91A 1GK4A 2YO2A 1CI6B 2C9NY 1OWAA 4RETB 3M06A 3TNUB 3HTKA 1IO4A 1S9KD 4C7NB 2WPSA 5AW2B 4AUWA 1DH3A 5AVVB 5AW7B 5AVTB 3HE4B 3LIDA 3MD0A 2WTYA 3A5TA 4JYBA 4XE5B 4GKGA 2WT7B 2QM7A 3NTNA 4DZOA 2WPQA 5AW6B 3NXSA 2WPRA 3V4WA 4GT1A 5AW5B 1FOSF 1HWTC 1A02F 3B8EB 1KQLA 3A3YB 2WWWA 3O8ZA 3TYYA 2QM8A 2W27A 5AW1B 2XU6A 3OAKA 5AW0B 3TK1A 2P67A 1A02J 5AVQB 2R5DA 5AVRB 3NFQA 1JUNA 2XZRA 3M0AA 4M3LA 3UIAA 5AW3B 3HE5A 3P7KA 4JYCA 2R32A 2VRSA 3M9BA 3VN0A 5CMZA 3KDPB 2Q5UA 5AW8B 2XV5A 2YO3A 2Z5IA 4KHXA 1GTWA 5AVZB 1SLQA 5AVSB 3WGVB 2Z5HA 1GZLA 3L35A 5AVYB 1HUCA 1JNMA 2R5BA 5AW4B 2W6AA 2P7JA 3L37A 3MGNA 3V5BA 2H7HA 4I2LC 1GU5A 5APQA 2N9BA 1HBWA 3VMYA 1J2JB 4B86A 1X8YA 4HYTB 1H8AA 3P32A 1MV8A 3A7OA 1MFZA 1GU4A 5APTA 2ZFCA 3NMDA 3VMZA 2Q7CA 5APSA 1S9KE 1T2KD 3T97A 3TNUA 2JJLA 4C7NA 1SP4A 5AW9B 3VYIA 3M9HA 3L36A 1NWQA 4EOTA 3HE5B 1GK6A 3LIEA 5APXA 2R3CA 3SWFA 1GD2E 3HE4A 5APWA 3A2AA 2Q3IA 5AVXB 1FAVA 1FOSE 1OXZA 2ZXEB 3M0DA 1CZQA 4RESB 2WT7A 2E42A 3VMXA 3WGUB 1T2KC 1HJBA 2P2UA 4AYCA 2C9LY 5AVWB 2BASA 3P8MC 1H89A 3VTPC 4LC1A 1CI6A 1G2CB 2YNYA 4AQRD 5APUA 1YYCA 2IPPA 3IR9A 3V4QA 3KQGA 1H88A 5APYA 2KP8A 4I6MC 1CSBA 4C46A 1NAFA 3I5CA 2E43A 1MUUA 5AVUB 5APVA
chains in the Genus database with same CATH superfamily
3RL0C 3V2PA 3GBMH 2XPYA 1SMAA 4PWJA 1A6WH 4FRWA 4P9ML 3EO0A 4KVCL 1K9MQ 5JIIA 3EJYC 5I1GH 1H6UA 1HNGA 3EOBB 5E8EA 5B1BB 5BV7C 1F6FB 1GGIL 2RCSL 4I3GA 3JWNE 5DRNA 3ZRSA 5G55A 2E74B 3MJ9A 2OTJP 1H3XA 2ATAA 2BNUB 4XN2A 4PJFF 2AK4D 1JV5B 3ZE1E 3ZTDC 2DQEH 2XG5B 5TJHA 1LTJA 1ZMEC 1BE3D 1WH0A 5C8JB 2WPQA 3MVSA 1TYRA 2CCLA 4K23H 1QPKA 4OCYH 2VZOA 3HJEA 4WCYH 2E75D 2DJMA 3GHBL 4DP1X 1IB5A 1OVRA 3GMNB 3T65B 1BEYH 5EZLA 3DOHA 1EHKB 5IK3B 1BD2E 3UPRB 1J86A 2Y7OA 1FO0B 1MIML 2Z7WA 3ARFC 3C8HA 4NJAH 25C8L 2QJKB 1D5RA 3IVKB 4G43A 2E4TA 2HG5B 3GZKA 4G8IA 2ICES 4KHXA 2ESVB 1A7OL 1NCTA 1TPXB 1N6VA 2CKBB 2EZ0C 2ZX8A 5EU3A 2WSEJ 1A6TB 1O9WA 4UB0L 3AS1A 2ICWA 2FUTA 4WGKA 5AZEH 5JXEC 2R69A 4H13D 2CBMA 3MCKB 4DOHE 1A3LH 4N2LA 4MAUL 3OAYK 1NZRA 4PM1A 4MMZC 3OGCB 3QR0A 4CPGA 4W9ZA 3VD4A 4YMPA 3AG2B 5JYLA 1DBAH 2V17L 1J0JA 5KVGE 2DLFH 2MCPH 4PUBL 3X3FL 2OFQA 3IN6A 2B1AL 5DS2A 3ZR6A 4HCRL 1B0GB 2I5YH 2CKNA 4UMGA 5D1XA 1YMMB 4ODBD 5ISZD 2W8ZA 3G04B 4NKIH 1KOAA 4P2OD 3FTUA 2ZKWA 4LVNC 1E40A 5B3NA 5APWA 2EVHA 4FERA 3BWZA 2P5EE 2IVFC 2GI0A 1FCCA 3MGOA 4GFXA 2KLRA 1XGRA 3LSOA 4BWNA 4PJCE 4UTBH 5DJDB 1P5UC 1L0LG 4XMPL 1H6EA 3ZHLA 4HG4J 3R2PA 1HHKB 3DTXB 1HILB 4MQXD 4DJMA 2NNRA 3OKEB 1CYGA 3KWWB 4X4ZA 3KYQA 1MJ8H 2OMXA 5KVFE 3TPKA 2VQ1B 1DQLL 3U9UB 2VTFA 4FQPA 1RF1C 1TQUA 1H5BC 4M3HA 1K8IB 3SPGA 1Q0XL 1GOFA 3WN6A 5I76A 1I8IA 3ULUF 4UINL 5C0IB 1YMHB 3CMOL 2O1JA 2G4GA 4DKFL 4JZJA 3RA7L 2XBDA 3V10A 1A7RH 4KMTH 1HINL 3JUYA 5ALBH 2I9LA 2DN7A 3JZ7A 4KO7A 1U6AL 4JY5H 3PE9A 3VUAA 3DV6A 1A14L 3JWDC 3NAAH 4QYOA 3B3BA 1BVLA 1HHIA 2DQFA 1M6UA 1ZGLA 1RPKA 3OR6A 3QNYB 4XC3L 1AZNA 2DBLL 4JR9H 1OCWH 3F7PC 2XQBH 2JI2A 5IUSA 3AB0C 4OU3A 3QRLA 1RCYA 4I0PD 3SYPA 4NQSB 5HJ3A 2KLUA 5DSCA 3ESUF 5GRVK 4WEEA 3B2DC 1DDHA 2BCKA 1OCCB 4G82A 2EVJA 3ULVC 3UAAA 4MX7A 3SBQA 1T5XB 1VCAA 2LHAA 4L8DB 5K33A 4NN5B 4OF8A 4A6YA 1F02I 2DW5A 4W9EC 3S37L 2O01N 5EA0H 1IEAA 3WXWL 4ALAL 4YXWH 1QMUA 5ICYB 1S78D 3M9BA 3SYQA 2CH8A 4DN3H 1OTTD 3MUJA 3OAYH 5GJSL 1NMBH 4ZNEE 4XOEA 5I17B 4MJHA 4W9KC 3L3JB 2Z5IA 5GRZA 3D4GA 3B3IA 3WNOA 4YHLL 2L7UA 4YGAB 4TKWA 3U25A 1AGCB 1QAWA 5IHUL 2OYOA 3HNVH 2CRMA 2E7HA 2FIKA 1H0DB 2OL3L 4WKZB 5FYKD 4MNQD 3P4NB 1NCCH 2D9CA 4PLNC 3KPPA 3ZVVA 4IOSD 1E6OL 4O2CB 4ETYA 3MBEC 3T04D 1YN6B 5CD5D 1HBWA 3HBPA 2D3VA 2YXWA 2B5IC 4PBWD 5ESAA 3ARPA 1BM3H 3IU4H 1J05B 5IEHA 4R0LC 3GYRA 1XD1A 1F1DA 3M88A 4TL4A 1QVOB 3RGBA 4L9LA 2V5MA 4HWBH 3VRLE 3IS1X 1L6PA 1IQWH 1IRAY 5INCA 3S5LB 3VA6A 3STBA 1IKFH 4IGBB 3VYOA 2MQGA 2VZ1A 3U0PB 1NANH 5I0XA 3IF1B 5HP5A 2CD0A 1AYOA 1Y6KR 2YWZA 1LWHA 1NAKH 4NPYA 2NQDA 4N78D 4DT0A 3MNWB 3FT1A 3MROB 3T6WA 5J12B 4L1LA 4YHPB 2Z7YA 43C9B 5DLML 2JXMA 3FX0A 4N85A 1J1EC 5D1QD 4OZIE 1YZZA 4JPIB 2WXRA 2F54B 4GBXC 4XXDB 2BOCB 4KFZC 5L2JB 5I1LB 2YQBA 4FXKB 1ZK9A 5F71A 5J0BA 2XKNA 3IMUA 4NP4L 4TLFA 3LOWA 2Y36L 2DIJA 1CD0A 3RX8A 3DXAE 1AXTH 1SDAB 1SYVB 1FZGA 1XL6A 1UD2A 5CD3B 3LKNA 5D7JD 4BWWA 4MHHG 3QZWG 3KBPA 4HETA 1MLBB 5DJUB 4QPEA 3H9ZA 2H2SC 4FTVB 1JY2N 3KXDA 1WFOA 4LHJB 4PY7A 4XVJL 4FNPA 4ONFL 2BK8A 3H3PL 4NZTH 4PREA 4POYA 5F7DA 5CEYA 4GRLB 2IH1A 3B4NA 2YEZA 1PKQE 2EKSA 1JDCA 4LSVL 3KPNA 1MUJB 1NMCC 5B1KA 3DWTA 2QGEA 5IP4A 2YPVL 4TL5A 3DX9A 3DA0A 3VDAA 1C5CL 4GT1A 1UH2A 4ODHH 1XQ4A 4J28A 1IGJA 3O6ML 1MVUB 4W6XB 1AZRA 4N2HA 3AY4A 3BKYL 4KRMB 3MLZL 5GRYA 2FYUD 4WTWA 2X4NB 3SPJA 4B27A 2FSEB 1ZE3H 2XRAL 3ARSA 4PWGA 1Y18A 5C6PB 1G1OA 2VLMD 2KBGA 2MFNA 4EMZA 4UB6E 2ZOLA 4HIIB 1IKNA 1TITA 5I8KH 5DJZB 1DVFD 4PJAA 2HH0H 1LK3H 3Q3DA 4KUCD 4IRZA 1NLBH 4E5XB 3KBFA 4UILL 1SLWA 4QRBA 4FJ6A 2NXYD 3GSXB 3L70J 4PRHD 5FXCH 4PD4D 2DH3A 5LBSA 4YBQD 1EHXA 1PL5A 4ZAKD 3SFEC 3NCWA 2AK4E 4HZLA 5IMOA 1P1ZB 4JQIA 1CXFA 1CFNA 3CFCH 1WEJL 3G5XB 3IXAA 4GSUA 5GGRY 1XR8A 3VFSB 4ZFOL 1PZ5B 2E5EA 3HUSA 4RNRB 1EGJL 4ADIA 5KJ7D 1BZEA 5K39A 2JMRA 3MLVH 4X7TB 1UGNA 5T5FA 4OJFH 3ZT6A 2NPSB 4J3OG 3APCA 2CM6A 2EIJB 3G5VB 3NEXA 5G5DB 5C2BL 3QB7C 2XNXA 1YC7A 3QJFA 3QUZC 1J1XL 4PJDE 4YDKH 1FBIH 3PHAA 4LLYB 1JCVA 3N41B 4JL2A 2WC7A 3DROA 5K1NA 3FTXA 4YDNA 5FYLD 4XC1H 5CAYB 2PR9A 4X6DE 5FPIA 1X9QA 1ORQA 4XVUD 1F8TH 1KV3A 5EC1B 2C1OB 3CH1A 1KN7A 4U1MA 1L0NE 3MREB 4UTAH 3DSFL 4FFZA 1CPUA 4TQ8A 1TOXA 2EIEA 1D7BA 2V5TA 4JDEA 5DMGC 3GPSA 3C5ZA 3WIHL 2O5XH 5E2TL 2H26A 5IBLC 2P8PB 4HEPG 3C60A 5AAWC 3GG2A 4DZBB 3SKJH 1U91A 2W91A 3MOQA 4AQRD 3HN3A 5DJ2B 4XPHL 1XFPA 1HXYB 3ABLB 4H8WL 5L8LB 2PFXA 3E80A 4R3SB 5AWNL 4YSQA 2WOBA 4G7YH 1J18A 5CJ5A 1GK4A 2BZCA 3RDJA 1TO4A 1VQ4P 5E79E 2WOYA 3WD5H 3LN5A 4AUUA 5MENA 3T1FB 4GOSA 3CFBB 1DL7L 1OSPH 1RUMH 1NGYB 1ND0B 2MCMA 4JCWA 3SWYA 2QADC 2CK0L 4J3OC 5KLVE 4DGIH 4XP6H 3L2MA 1RZ8A 1D7DA 3D9AL 2IDSA 2BS71 5D5MA 4APQB 2FJSA 4HEME 3CHPA 1QHPA 4XCNB 2JJSC 3MFFA 1CE6B 3UAJC 4JZOB 1RKRA 1HL9A 2OXHA 5J1AB 5IT2L 3DYPA 4MHHI 2YMKA 1G6RB 2H0PA 3MV8B 3S48A 4AT6A 3FFDA 4U31A 4YR6A 1NBZB 4G5ZL 2X9XA 1NKOA 2IZ1A 4WUUD 4DAGL 1RU9H 3HC2A 3MLXL 4LSSL 4JAMB 1BJ8A 1ACXA 4M7ZB 1ZGLP 2J20A 5D7EA 5DFAA 2LU3A 3LKQA 4H88H 5FDWB 2VRSA 4Y19B 5DUMH 4YXHH 4WI0B 2R39A 2ZXQA 2HSIA 2D7TH 3KLAB 5CJ4A 4JY4A 3QI9C 5IQ9B 4Z3FA 3SGJA 4BELD 1X5FA 3HC0A 2WCGA 2QVTA 3EYUL 1SOXA 3E2HC 5GTIH 4NPJA 4QCIA 4XPBH 5HDBE 4OBSA 3BZ4A 5F3BB 5B4MC 1S5LH 4BSVA 2KZ1B 4O02L 1F90L 2F1AA 3IGAB 1G0YR 1JF1A 4U1JB 2YMYA 5CHNA 3FMGL 2ICEB 1HHGA 4MJID 4P48A 4OLUH 4X0KA 5IQOA 2YPLD 1AQMA 3QP3A 2R1WB 2P5WD 2VLKA 3WMPA 4LDEB 4OD2A 4JG0L 3QEUA 1XGQB 4O51B 1RK0A 3AREA 3QXUA 4KVNL 2MWCA 5JR1H 3GSWB 1E5BA 4U6HA 1P4UA 3F7LA 5LCVA 2A6KB 3CFTA 1ETZA 1T2QH 3TNNB 1QHOA 5J6GB 4JLRA 4P2YA 2WLNA 1SJHB 1C16A 3MMEB 2DI9A 4LXFA 4OGAC 3QC5X 1BWMA 3QFDB 2XBZA 1LWUA 5JTWA 4GT0A 2OYIA 2IFNA 4K9EC 5I26A 3N06B 3MN8A 4UT9H 5HHOD 4LKCB 3AEEC 3QHTC 2KS1B 3UTSE 3NRQA 4O5LL 5D2NA 3LEYH 5EH1A 4OZHE 3SE9H 3TYGH 2ZUWA 2K9FB 1KBGH 5B66H 3VWJC 4EIGB 1E4HA 1AGBB 2J8HA 4PJXB 1TEFA 2AXHA 3NRPA 4GXUN 1SLUA 4PRBB 3GWJA 1A7PH 3TTYA 3SYAA 1VL2A 4R8WH 1PU0A 2WWMD 3CCSP 1ZHKB 1NIAA 3BLBA 1LXMA 3HPLA 4JO1L 3WHXA 4AYFB 2QQKH 5T1JA 1D9KA 1IC0A 3EJTA 4WWKB 3U9WA 2Y6SD 2X4UA 4X6CE 1FFOA 2A45H 1S5HB 5IR1A 3N2JA 3EUUA 1P7KA 1IBHA 4UIMB 2BVUA 5F3HB 1R3LB 2AABL 1UWFA 2BNRA 2B4CL 2BIHA 3B1TA 5GGVL 4N9OB 3D0AA 1MFTA 4EI6A 1IO4C 2VC2H 4Z7AA 4N78E 3OMZA 5TK2A 1MJ7H 1A1OA 3OC5A 4NO0B 4KJWD 4R96B 5HVGB 3D39B 4BK5A 2PLTA 4KITB 3ZIYA 2GJ6A 1IGIL 4JYBA 3IETB 5D1QE 1HIML 1WA1X 3PWLB 4N8CL 1ZHBB 1L9QA 1U7MA 3HOGA 1NU1K 2QG4A 4R4NC 4TYUA 2HTKD 5FYJD 5I74C 4RFNB 4JFUA 4KRPC 3TIEA 3OZ9L 5BU8B 1W72B 1WWWX 3B2XA 4W9IC 5ABAA 3I75A 2KIKA 1VGEH 4Y4HB 4ZOCA 3NRFA 4GT7A 3KS0J 2PP9A 4ZO7A 3VXRA 3QRGL 4L4VA 4QXVA 4YBLB 5L7XL 3WI9A 2N3JA 5DD0L 3L72J 1MW3A 1MSPA 3CSTA 5IF0A 4PJIE 2J8OA 1YDPB 3RK2B 4P5TB 5KSAD 4PGEB 4DCQB 2XWZA 5KANG 4U6VL 2AEIT 4XPFL 1XVSA 4OQ1A 5E6IA 4G6KL 3KAAA 1WAAA 1EFXB 3TZVB 1OGAE 4GRWB 1KEGL 1AZZC 1T22B 2J4WL 2XYCA 3BQUD 2V2WA 4G6ML 4KKBC 2YD6A 4QRFA 4NWTL 4DW2H 4FG6D 1FVDA 3WKNA 5GGSY 3L3DB 3V4PA 4NDMB 1NGMB 4J3TA 3CLEH 4D6TJ 3DECA 1JPEA 2WN3A 4B9FA 1QYGH 3RVTD 2WZPD 1MH5A 1MFNA 2FYUE 2MEJB 3WIAA 2CG9X 3Q5PA 2GUOB 3ZE1F 1R33A 4HKZB 4MJJA 5J6HA 4FADA 4CDHA 4RAHA 1KV7A 3QZOA 1ZLSL 3WUWG 6TAAA 3FNKA 5KG9A 1ZANH 4DGVH 1XD0A 3V0AC 1TETH 2FH8A 3NGBB 3LIZA 1ONQB 2CBOA 4DPAX 4HJIA 2K7PA 3KJ6L 3QDJD 3M0DA 4FG4A 3SPHA 2CO1A 5D6DA 2O3JA 1JI2A 5ENWB 3QIBB 2ADGA 1T21A 4KK6D 2LU7A 4PJ5D 4HUVB 5DHYB 2XN9B 2ZOKA 4JQVC 2EUVA 4IKJA 1CFQA 5KJ7E 3U4KA 1DIPA 4PJFB 2AXWA 4HGWB 1QVGO 4AENA 3FRPG 3IKKA 3QG7H 5HHNA 4ADJA 2R4RL 3WE6B 3MCLL 4N22A 4QAWA 3UYPB 1FAIL 1KXVC 2H8PB 4JHAH 4KWUA 4IBVA 4A63A 5FYJU 1KTDB 3WG7B 2WV3A 3WN5B 2HKHH 4BFKA 2RFXA 5JIDA 2A99A 3O4OB 1RJLB 3MDJA 7FABH 4R4LA 1FC2C 1S9KD 2WB7A 1BYNA 3EFOA 5ISZA 3QQ4A 5F7WC 1R5WB 3DIFA 3Q5YA 3VFOA 3W9DB 5HI3D 4PGJA 2OARA 2X70A 3VG0L 2HCZX 3ULUL 4EI5C 4P5KA 3HD7A 5FO8B 4M7JL 3QUGA 3L74J 1AHWC 3AXIA 5H37H 3SDDB 5DRWA 3TGXA 3EYSH 1ASQA 4ZI8A 1FIGL 3CFMA 5IJKC 2WTOA 1E5AA 2OP4H 5CFAA 3O3AA 1AO7E 1JGIA 3PWJA 1VPOL 1JGEB 4F93B 1W8NA 1RIVH 4B0MM 3WKYA 3V6OC 3FUFA 4PJCF 1HXMB 5SX5K 1P84I 3N43B 5I30L 2YPKA 4FEIA 1DEBA 4Y2OA 1CC3A 1WA2X 4J8RA 5IFJA 3Q01A 4LCUB 4OCRL 1DUZA 4L3EB 5ESAB 3ZTNH 3FUJA 1VQKP 3CZNA 5CMZA 3FH8A 5F96L 4U1KB 2EIBA 2ROYA 1EHNA 4FE9A 3FK3A 3S96B 1HYSD 5GSRA 4GG6B 2J5LC 2HVKA 4G8GD 3CC7P 4L9DA 1HSBA 2Y0DA 1MWAA 3BW9B 3GO1H 1JZJA 5FLUA 2EDLA 3RVWD 3TEYA 1RUQL 4EN2A 2PABA 3L16A 1GYVA 5BQ7A 4I4WA 2EH7H 4I0PA 1HDMA 4WUUE 4G9FA 1CW5A 4OCWL 4OLXH 3RZCC 1VADB 5KANI 1ILSA 1SQVE 1K73Q 3FSAA 5F9JB 3MRFB 1ED3B 4CMHC 1BQRA 1I1FA 1YUKB 2I26N 5GXBB 3RWCB 2QSCH 5AW9B 3TA3C 2DQTH 4Z0BL 5F9OL 2WJ5A 5CBAB 3BP6B 4PRPE 2Z35A 2CJSA 5E95B 2D2CC 1TCRA 4GO6B 1T89C 2FO8A 3AEDC 4LEEA 2HLFD 3L2NA 4ZODA 1JUFA 2EYTB 1IE4A 1JNLH 3BKJH 3D33A 1HZHH 5DK3A 3TS8A 3QRBA 5H2BA 1Z5HA 2WLLA 5IHWA 5D4IA 2AEPH 4PGZA 3CDCA 1LQSR 1P4BH 4F7PA 3RG1C 1R34A 2P5WE 2XVBA 5ESQA 5DZ9A 2HRHA 4TNWF 5FA4A 2E9BA 5DMIH 4AXWB 4QMEA 4HPOH 1CXIA 2WLJA 4DT2A 1HK6A 3BT2H 4TUJA 4EIZC 4RDQG 4IOSA 4AQAB 1HCFX 2R29H 4KX9A 3A67H 5GZND 5LAPA 3LB6D 2JJVA 5KKZB 5E2UL 1RIHH 4IRSB 1AANA 2UY6B 2WXKA 5KSUB 1HI6A 4NN6B 5ITBH 3ALPA 1N19A 1UWEL 2L4OA 4JQ0D 1U95B 4HF5L 5AW2B 5HHOE 4UM8A 5D7LA 2BVQA 3FN9A 3BSZL 3SE4A 2O5YH 2DRUA 1G87A 3VRLF 3ZYJA 1WFJA 4QJ4B 5KN5A 3V7AG 3FZUC 4GSDH 1HCZA 4S1RH 2BIPA 1UURA 4U1LA 3FBKA 2MOVA 3PNWA 1ORSA 1DLHA 4FL4C 2IFFL 4O2FA 4LESA 4X80H 2FHBA 4PJ8B 2XETA 3TYYA 1MI5E 3A6CL 3OAKA 4J6RL 4JDVB 3WAJA 3B5NC 4P57A 1RHHA 1FIEA 4ISVB 4XPTH 2KOGA 3L70G 1PP9D 3D85B 2K3TA 4LAJH 4OZIF 3C09B 5D2LE 1D5MB 4NC1E 2ZKHH 5IB1B 3ARGB 3FF7A 5CJOL 3B6SB 5L2KA 1SXSA 3L3KA 2ZONA 4U1HB 1E42A 4OF7A 4OD3L 5D7JA 3POCA 5T5NF 2NR6A 1YJDH 4G1MB 1O6SA 2I85A 3TEXA 2VXQA 1EJ6A 1UZGA 3NJIA 3WENA 1HC1A 4HZAA 1L7TH 2CQVA 4KZDH 1LT9B 4KUZH 2P28B 1AQDB 2B08A 3EFDL 3CFIC 5IROC 4KROC 2V7HA 2DYPD 2YQGA 4PJ9B 4CMMB 1N4XH 5I6OA 1T7YA 2F7OA 2NY2C 4QGTA 1FG2B 3NMDA 2WBXA 3X13A 4L4JA 2BS8A 2OS7A 4PV1C 3B56A 4OZFH 4ZMVA 3QUXA 1ZV5A 2X1QA 1V55B 3CXHE 3IF4A 1K72A 2HJLB 3MRHA 4P9HH 1KYOD 3QDGA 3T0EE 2FR4A 1YNTB 4QRAA 4AQEA 4N24A 4MAYC 5GQBA 5E9DD 5F89A 3GKWH 4Q6IA 3BUBA 4XN7A 1MCPH 3HZKB 3I9AA 1YYLL 5F44A 5L6YH 1FAVA 4U7JA 4L29A 5DD1H 1EIBA 1ZA6B 3AEFC 1U8OA 3FSOA 1DVFA 3WE1A 2EXYC 4LCWD 1WTGT 2Y9RT 4RRPG 4HS3B 2PP7A 5AYTA 1IK7A 3EDDA 2ZT9C 4PRHA 2J6EA 2HFGH 1HSAA 4ZAKA 2KSJA 4JG1H 4E9QA 4QIRA 1TEGA 4NUPA 1RY7B 3Q6FA 1AJ7H 4L2LA 3CSYB 5E8OA 2NSXA 4HJTA 1DHKA 2Q6WB 1V7ML 2IBZE 1R3KB 4CKVX 5DRXA 5GS0D 4IK6A 1KTLB 2HRPH 3ZDYB 3OKNB 4ANKA 4P4KC 5JPNA 1VQMP 2NY6B 3LRSB 2OR9H 2MTAA 4ZYKA 5I8OL 2ARJA 4XCEA 3K4AA 3M06A 1BV8A 3X2QB 3TVMD 3KDMB 4HIQA 3VXPB 1HKLL 4G1EB 4M7KH 2PO6D 4IKIA 3QDJE 4MB1A 4NUJA 2GHWB 3KLHC 4QXUL 5FGRA 4PJDF 4PJGA 5SWSB 4QRUA 1KILB 3LKPB 4Y2DB 1W15A 2X6UA 1A7BA 3CVIH 2A06D 3W39B 4TULL 4N8UA 4X6DF 4HJGA 2Y1AA 3HVDA 4PTTA 1K04A 3QQDB 1NTDA 4ZXBC 1TVBB 5DRNB 3SO5A 2ZG2A 3KPEA 3PP5A 1E2VA 3CDGA 3TBCA 5H35A 3AEAC 4A2MA 2XU6A 3MCYA 12E8H 3IKCA 1NO4A 4ALAC 3SE3A 3AECC 4Q6KA 1NBYA 2GA1A 1ZVSA 2QZ5A 3AGVA 2OX5A 2WZ5A 3L71E 4IJTA 4J3WA 4WJ5A 4PP1D 1S7TB 1MCHA 4HMCA 4QXTB 4RMWA 3OAWA 1YEFL 3U0WL 1QSEB 4FQIL 2F7PA 3H1KG 3BVXA 5E6UB 2E56A 3P2DA 5TPWL 2V6HA 5EOQH 4LL9A 3SBWC 1SS1A 5CILL 3HG3A 4WTQA 2CDEA 3UGXA 3V0HA 3L37A 4C59B 2LABA 1T1ZA 3F7RA 3PPSA 4OQTL 1WD8A 3KBHE 1NIFA 1NTZJ 4APXA 2Q3EA 5E1GA 2DQDH 4I1RA 2J21A 4EYYQ 3ZJAA 4DO4A 5DK2B 5HGGS 1IM9B 2WQYC 4H5SB 2Y7LA 5K5YA 3V2NA 1PZQA 1IJDB 3KXFA 4BWUA 2XZCH 2X40A 3WV0A 1TZGH 4PRIE 4Y16C 1LTXA 4YL4A 2W65A 2K9JB 2WUCH 4N5EC 1ERNA 5C0GB 5E6ZA 1KMGA 1E5CA 1JHLH 4W80A 4D0BA 1JN6A 5I19L 3DETD 3NBNA 2XZAH 5BOZG 1PMYA 3EADA 5D1ZB 2LQRA 3JC22 2HJFB 1SN5A 3QWRD 4G8GE 5ILTH 3Q6GL 3FB8A 4JBZA 2MTPA 2E7DA 2EUZA 2XQYK 5LG1A 3CU7A 4DP5X 2M2DA 2RB8A 4I48A 2M5AA 1X9RA 2XXGA 3MGOB 2F58L 1F4XH 4MJIA 5HDBF 3AE9C 1XGRB 2YPLA 3K8LA 1WA0X 3F7VA 3RX5A 3RK3E 2VMFA 2VR8A 4RWYL 7CGTA 1GCFA 5HGHA 1I9RL 1OANA 3CC4P 5FUCC 3DDGA 1UYWH 2OW7A 2XQ0A 5I6KA 4AIZB 1DBBL 2OMXB 4X4YA 3DKHA 4PGDA 3ZY7A 3BH9A 4GAGH 4KXDA 4QOKB 1CQYA 5J3HD 4RWHA 2OMUA 4TVSa 4A68A 2ZKYA 1I8IB 2QVIA 3QAZC 3F62A 2GIMA 3MRJA 2F53D 1Z0NA 2VN5A 4JZJB 1QQDB 3UDWA 3F6JA 4DFHA 3BAKA 5HHME 1XMEB 5LHDA 1UJTA 1W6LA 2VNCA 1X79B 3L72G 5BS0B 2G5UA 4P23C 4QYOB 1I8MA 5D96C 1TNMA 3CMEP 1ZGLB 2E6QA 1E3ZA 3OR6B 1VQ5P 1G9HA 3I02A 3NIFB 4OZHF 1T03H 1H15B 2ZYRA 1KB5H 4PCYA 4LP5A 3QFJB 4Z3HA 1G9NL 3AADB 3MNZB 4GRMA 1SEQL 3MV7B 4DVBA 5KAQF 1IC2A 3DC0A 3NFSL 1PG7H 2FKWB 2C3WA 2ZP8A 4NZRL 1K2DB 3US0A 3GSRB 2A6JB 3G08A 1MFEL 4YSOA 1KLFA 2VJ8A 3RWDA 1QX8A 4D6TG 1TZAA 4X9BA 4YJZL 1CO1A 1LEKA 4WI5A 4YPJA 1SN0A 1OP4A 3FSZA 3IDYC 4WVRA 4X6CF 1A47A 1R5VB 2EXSA 1ID5I 1IFRA 2BP8B 3EH5B 5T1LA 1L5GA 1X9LA 3CSPA 4L23A 4YSSA 1FYTD 3NJMA 5D7SH 5GGVY 3S4SG 3V55A 5K9JH 4PGBB 4AZUA 2YIUB 4P2RD 4FQXA 2I07B 2X4SB 2Z91A 5AQ0A 5GGTH 3C6LA 4CAGA 3FU0A 3WTSA 3OB8A 5EEZA 1ZSDB 1I1AD 2CGRL 3WKMH 1ZT7B 5A16B 4U7KA 3KEDA 2FIKB 5BVPH 2XPGB 3IDUA 1EQ7A 3EAKA 1B3IA 3KPPB 3QORA 1LTBC 1NEZB 4UOW1 1DE4B 1E67A 1SJEB 4BSWA 1RUKH 1BOGB 2XN1A 1FF5A 4WU5A 4DZ8A 4JREC 3GLAA 4MZ2A 3ZKMD 1E8YA 3IJ7A 1N73A 3V9EA 3II6A 5APXA 1UACL 1UJ3B 3BT0A 5E56A 2O1AA 4L9LB 2R56H 2VLRB 2Y0EA 4KTEL 3GIZH 5INCB 3VMXA 3GMMA 1NCNA 1GTNA 3FS9A 4GY4A 1BLIA 5J5EA 2ODHA 2XC8A 1IGML 1ZCRA 3D69B 4JJ5B 4PJIF 2IANB 2WIMA 5GRXG 1O7DC 1OWWA 4MCMA 4X8CA 1OX3A 3NK3A 1NC4D 3SGEH 2H6UA 2DQUH 3ARBA 4NPYB 2ADJB 5HVWA 2JTYA 1UIXA 2YNYA 2C4FU 3BQUA 3O9WC 2FX7H 4NQQA 4H8WC 4KQ4L 4OH2A 4ZFZB 3TDKA 1M2VA 3VRJA 4NC0B 5GIRB 1KPRA 3D51A 5DVNA 2ZXXA 2JXMB 1O7SA 4MB3A 2YAFA 4F37F 2WBJC 5IUCA 1QNZH 1FJ1B 3GI9L 3L74G 3W5MA 2CM5A 2IPKB 3KL3A 1KYOE 4QKTA 3WY1A 4Y1AA 5DT1H 4WZ9A 3KVPA 2XKNB 2EDJA 5DWUL 3RWIA 2E76C 4P3CL 2MHAB 5IHZA 1SM3L 4U2ZA 3GHEH 2Z64C 3H4FA 4G7VH 4MS8D 4TXVB 1E4XH 3UP1A 1E2ZA 2AQTA 4ZFFA 3BZFA 1QR1A 3FU3A 4JMXA 4LLVB 2DKSA 5MERA 2MMXA 2NNCA 4L3CA 1T20A 4IOFC 4M02A 2FEEI 2WTYA 3VE0A 1IAIH 5KVMC 2ZX7A 4DWHA 3VM5A 1R0AL 3P11L 4KUCF 1L4AD 3EH3B 1UH4A 3PGCA 5KVGL 3ZRFC 3MOAH 3B8EB 1DVQA 3FXDA 4WHDA 5E5UB 5BZWB 5CEYB 4KXCA 1U8CB 2EKSB 5I9QC 1A02J 3HI6H 4LCCB 2NDGA 4GXUM 4I9WD 1Q9WA 3SODB 5HGBB 1F4WH 3QUYC 3QEHB 5A2CA 5KAIE 3DX8A 1FYHB 1IGJB 4LPUA 1LNUA 3ZE1B 4PJ7B 1IC7L 2NMSA 4M7LT 1D2OA 4UYPA 2F8VA 5TH2B 2ATPA 5BQDA 4NRXA 1KLGB 1A9VA 4WEBL 3GDBA 3WJMA 5KBPA 1T83C 1UB6A 2R5BA 5AW4B 2A06E 3IGUA 1TCMA 2HLEB 2HFFB 1A7NH 4PJAB 2WQAA 2Y24A 2GSIB 2A83A 1BD2B 5EBWA 4LASH 5FUZH 4HG4K 5DJXB 3QYMA 1J2JB 1WITA 4JN2B 2IBZX 3JV5A 3FFCE 2DQJH 3SQOH 5DJAA 3I6KA 1FZKA 4OF0A 3DIDA 3IXAB 1SQQJ 1XTMA 3H1JG 3T97A 1EO8L 1EMTH 1NU1D 3NA9H 4JJHA 2C9AA 4I1NB 3LPWA 4LKXB 3Q7JA 5T3ZE 5IM7A 1KGWA 3N50A 4ETQA 4YHNB 5I1JL 3BOVA 4YHMH 5SV4A 3CDFA 1NFDA 4DOHB 2ZXBA 3FCTA 1ZLLA 3R1GL 2MPVA 5F1OB 3BE1L 3FDWA 4P99A 4XHJC 3SCMD 3TJPA 5I8CA 2FB4H 1PNCA 2OA9A 4K71B 4J3SA 1MHEB 2HJKB 3QG6A 5KS9E 3H9HA 4R7LA 3RL0D 2PPCA 4UTBA 1ORQB 3Q8AA 3D4YA 4U1MB 4HHAA 1YCSA 4FEMA 3ZHNA 3VD5A 5T1MA 1BGYD 4JQXC 3C5SA 1S3RA 4EUPH 2V7QJ 1USEA 3BHBA 2C4FT 3WBDA 5BOJA 4WFED 5IKCB 3HZMB 2VDML 3TIDA 2P5EB 3RTQA 3NYKA 5H37G 5K9KA 3H9YA 3MKKA 3C2SA 2Q1KA 1J11A 5B1AB 2B4CC 4PJCB 4OKDA 3IMBA 5JMOC 1WT6A 2A45I 2YUVA 4POUB 4LU5H 1AY1L 1JPST 1XR9B 5DQDL 4PRNA 4YAQB 4KTGA 1CDJA 4YEFA 4D9LL 2NTSP 2UXGA 5MENB 3OJDA 3SEPA 1YSOA 3LN5B 4I7ZB 4S1SH 1W6WA 4IBLT 2YD1A 1SQPD 4OVNF 3KJ4B 1QWHA 1ZT4A 3ARFD 3WFDH 3NCYP 2AV1A 5IGXH 4WO0A 4Y9BA 3M9QA 4LEXL 5GRWA 1T7VA 1ZJBA 3SHSA 1JZFA 2ERJB 1WC7A 4HS8H 5T3XH 2EZ0D 2DQ6A 4YC2C 3MIWA 1CFTB 5AALA 5SX4I 2W07A 3MFFB 1NL0H 3ALWA 1MCOH 2YGQA 4L1DA 3GB7A 3L75J 4NXKA 1D5ZA 2O30A 2OMTA 2WXOA 1KPVA 2P49B 3KW8A 2X2IA 4M1DH 4R7XA 2R32A 3I6LD 4XBGA 4EZMA 4ABVA 4YR6B 5GZNA 1P5VA 3L45A 2NX5D 3QH3B 1L9TA 5JA8B 2X4TA 4OLWH 4RH4A 2OJ1A 4RZKA 1U8QA 2G3ZA 3AABA 2WANA 3PP4L 5F1NA 4C83A 1AS6A 1ZXGA 1KJ2L 5TF1H 4N25A 5E4EB 3KCPB 3ZMRA 2JQZA 4L05A 4PJEA 4ZTOH 5KVEH 1SPDA 4GKLA 1QSFD 4JY4B 5EU5B 2OYMA 2VDMB 3BZ4B 3AU1A 3HMWH 1SQBE 3DVFA 4LE8A 1MV8A 3IJHA 2IAMB 1Z9SB 5I71C 4F7EB 5CHNB 2GAZB 3ARVA 1HHGB 1MCDA 3K81A 3CC5A 4Y2LA 4HT1H 3VXME 2EE6A 1YJWP 3GXMA 3A21A 1LGVA 3ZE0B 3BVHA 3LXUX 2AC0A 5F9AC 5CM1A 1RK0B 1S46A 2Y0CA 5BCAA 3LN4B 3ML9A 4U6HB 1LDPH 1UTDA 1WWCA 2J2ZA 1BVNT 1M05A 2R4SH 4GAJL 3RILA 2BY0A 1KLUB 2WBKA 3N1MC 2A74B 5D2LF 1EEQA 5JHLH 3WEXB 3BWSA 1FYTE 2WVVB 5TGBB 2E3VA 3BGMA 2OYIB 1RZIA 3LDBC 4K0OA 1XCXA 2BEQD 2Y1VA 3ME0A 4PRDB 4DN4H 5AAMA 2ED6A 2Y5TA 1DQJA 1U8NB 1U8HA 2JH2A 3KPLB 3P2TA 4JRYD 1FO0H 3ZTCC 1NDGB 5I6LA 4PG2C 3X14B 1CSBA 3PLNA 1J9SA 3HC3H 3BVTA 4RGNE 2L8AA 3QNZB 5F93C 1WD9A 1N7SC 1WHOA 4G59C 1AMYA 3PWUB 2YO2A 2CKBH 4W9JC 5PCYA 5JZ7C 5I15H 3U2SB 3FUMA 3FQNA 2L3BA 4AH2A 1I7UB 3WHXB 3TN0B 3ULVD 3ULUC 2FO4B 4ZFQA 1TMCB 5FHAH 4J5VA 4N0RA 3QZPA 1P1VA 2X4UB 2G2RA 5E9DA 5BUGA 1ESOA 1KG0A 5IR1B 4YE4H 4BCXA 1P7KB 3IFPB 1G43A 4X2UA 2HTLC 1I7TB 1NSNH 5DTFA 1HWHB 2BNRB 3IMRA 1UFUA 1AKPA 3H2WA 4EI6B 4GIAA 3ILEA 4ZX6A 3OHMB 4LCWA 4QXGH 1JYVA 2E27L 1ZS2A 3M6DA 3ZUNC 1EZVE 3T08A 4DESA 4Y4KC 1MDTA 2HAZA 4TQEL 5FCUL 3TP4A 4D0CB 3WXVH 1E4WL 2E7BA 5E70A 4AEHL 3P77A 1PKQB 1TQWA 4B9GA 2A0LC 3MBED 3TIEB 1NTZG 1U58B 2NPLX 4Y4FD 1NIDA 1BPLB 3AM8C 4MSWB 4YPCA 2XTLA 4JVUA 3VXRB 2Y3NA 2XV2A 5FECA 4L4VB 1F4YH 2PYEE 3TEZA 2G5BA 1M53A 3TVMA 1PY0A 3GLMA 4PQXA 1ZLVH 1GGBL 4OZFG 1JOCA 1TQBC 1MIMH 4K8RH 5HYQB 5I1CH 5ICZB 1MAML 1IGYA 2K0RA 1URQC 1NC2B 3UO1L 1D6EA 5LJYH 5EUKA 3KYKL 4U49A 3QS2A 4ZUWA 2GQHA 3HE7C 4AGQA 1KJ3H 2FWSA 5AYQA 4YFEA 5E7BA 5FA3B 2QV4A 2ZAGA 5EFWB 4XMKH 1SQXE 5D55A 4OT1H 4XH2A 3V4VL 5F1KC 5DEJA 4TF4A 2AK4B 1JK8A 2BMKA 3HE5B 5I1AB 1GK6A 1MH5B 2ZOOA 1KCSL 2X4PB 2ZJSE 3NDYE 1FZBA 4M5TA 2N9YB 4PUBH 4E41D 5EZOH 4F58H 4B9JA 3MLUL 2JB5L 3BD5A 3O6KL 3QJQB 5E99H 3UX9B 1O9ZA 3D0VA 5J6HB 2E75B 2H1XA 3UG4A 5CJXC 2FJFB 4Z1PA 6FABL 4WGWB 1EZSA 3JWOH 4UTAA 1E27A 1HL5A 4IBQA 1TZ8A 2ITAA 2G75B 4N6JA 3WY4A 4PJDB 3T3ME 3CHRA 2H2SD 4D3CL 4X5PA 3GEWB 3H9SD 4BZ1L 4BKTC 4C54A 5T1DH 1C8PA 1T0OA 1SHWA 4ODTL 4X6DB 3GJFK 3SE8L 5IB2B 1PZUB 2JJWA 4F2MA 4I6MC 4ORGB 4HQQL 4X4MA 1FQ9C 1S3KL 2F5AH 2OI9C 2P48B 2PCFA 4H8HA 4LSDA 4UV4H 4XMPH 1NCWL 1DR9A 4Z3EA 4PBVC 3NCYS 3RGHA 1AXSA 4IU3A 1BFSA 3AG4B 3HE6A 4H13B 2OSXA 4OJEH 4HUWA 3TNUB 2YXMA 5HHNB 5IQMA 1YYMH 1DQLH 5D9SB 4MA7L 1M6OA 4HB1A 1FHNA 3CX5J 4WIQA 1LTAC 5C3IA 1JF6A 1V5JA 2C8NA 1QLED 3RA7H 4OTXH 3ZKNC 3CFQA 4NQCE 1B2YA 5C7ZA 5CEXB 3EFOB 4ZSOE 5ISZB 3DIFB 1R46A 4NQEA 1S9XB 4E9VA 1HFUA 3QXAB 4P2OB 5C1MB 1JMMA 1T5WB 4JRLA 3GMPA 3K0WA 1NTKK 3MV11 4JKPH 2FH6A 3BFOA 4NZUH 1HHHB 3SDAC 2AXTE 2DLEA 1WE5A 2X53A 5DD5H 4RMRA 5EBMA 4D7BA 3O6QB 1EXIA 2BHZA 3QBTB 3QR1A 4LSRH 3IAPA 4FG0A 1KUMA 1YHPA 4LCYA 2YLHA 1TLKA 5L4MA 5SWQB 2ZWKA 4M1CC 1OAZL 4X7FC 1EZLA 2AEQL 4Y2OB 2AJVH 1KENH 1KWKA 3G6DH 5IFJB 2WXGA 3AQZA 3NN8A 4TSCL 1MHPL 2IWGA 5HHXL 1DUZB 2YR3A 3WFBL 5C0JB 3WXWH 1SQPE 1G7PB 5TE4L 2I1KA 5DMKB 4U05A 5HDQL 5CP7A 1MZ9A 4QD2E 2DTML 4MMXB 2B2XL 3RWHB 1FJPA 3WJLA 1BLNA 1G7QB 3IMSA 4PH8A 5GSRB 1X22A 1CG9A 3VDBA 1BX2B 2GJ6E 4I87A 5FW6A 3ZBMA 4HUUB 1B4JL 4KU1A 5DZAA 3T2NL 4OJAA 1HSBB 1MWAB 4D7PA 1S7VA 4A7GA 4NSKB 1LP9A 2J55A 4DGYL 5DMGD 3RGVC 1WFMA 1IFHL 3UYOD 4PWKA 3KR3L 3UZVB 4YSUA 4S1QL 5HPMA 5IBLD 1ZW0A 2BSSA 4I4WB 3BCCG 1HDMB 2XWXA 3V8OA 5CINH 1PF3A 3L1GA 5MEQA 3AUWB 2QGCA 3T4AC 3LNHA 1CF8H 4OZ4B 4UT9A 5ICUA 2I8DA 1EHAA 1HOCA 3NG5A 2R1XB 2YUXA 3GM8A 1BVZA 4H26A 4BD4A 1O9VA 5D70L 2ZNWA 2A6IA 5IW6B 1FZCC 1JD9A 2I60H 3Q2VA 2QADD 1WAAE 2X7LB 4OLYH 4OSUH 4O58L 1JUFB 3ZKXB 4KZEL 1JY3P 4PS4L 2FEDD 3Q5RA 3HIZA 3IJEA 1FV1A 1JVOA 4JFFD 4LP8A 4P2RA 2E43A 5E9NA 2VW4A 4B7IA 3AW5A 2NUTA 1I3VA 5DYOA 5ADOH 4CN4A 4F7PB 3UAJD 2OK0L 5FA4B 4GDOA 2YD3A 5ESQB 1T1WA 4MNQB 4OZHB 5K9OB 4TUJB 3PWPA 1DQDH 3CXFA 1M7DB 3RVUC 4AKPA 2BCMA 1VJSA 4U33A 3C8KB 3MBWA 4AUWA 1YECH 5KBMA 1U0QA 2DMHA 4KMQA 5AKVA 5ABDE 4JFDE 4QYAA 2Q2LA 3ZQWA 4IEFA 2RIKA 1SBSH 2IAAC 2C3VB 4NLAA 3QQ3A 2MKWA 3QUMA 4X6CB 1Z66A 1XB8A 2ATKA 1S7XA 2BVQB 3TO4C 1NLDH 1G7MB 3CN3A 3QI9D 3WSQH 4JRYE 3FWNA 1IKOP 1N8ZA 2AZAA 5LGYA 3N44B 1L4IA 4DETA 3DURA 3E3QC 4ANXA 2WN2A 5IHBA 5B4MD 4XPAH 1UB5A 3MSPA 1RFDL 1JZ8A 1FFRA 2UWEE 2ADFH 1L3NA 2APFA 2WUBH 2Y72A 3IJSA 4IIQC 1DLHB 3ESPA 5EEXA 2YPVH 4HV8A 4O2FB 2F74A 2IGFL 4Y9FA 1WP6A 5HXMA 3GT6A 3H0TA 1BXXA 2VITB 1VQ8P 3GXIA 5D1QB 4WY7H 2X4QA 2JNZA 4NHUB 4ASWA 1R75A 2AANA 3L3OB 4P57B 2M1KA 4WK0B 1EERB 5CEZH 3TH4T 4X5WA 5CO1A 3W11C 3QXVA 4MYWB 4R4FH 5EN3A 4ZZKA 1OSEA 1L0LE 1T5KA 3X11B 1SQQG 1CR9L 3SY6A 3T4YA 4OGAD 3VSTA 1OY3B 5CLYA 5D7JB 2KNCB 4C56D 2EXTA 3DX1A 2UZXA 5GJTH 4WENB 4B86A 4PJIB 3BXNA 1O6SB 3CLFL 1OE3A 5FWRA 1NJ9B 1BGXL 3GMLA 4UB8E 1SOKA 5DQ9A 2IPUK 4F7MA 4M8VA 1PTZA 4OGYL 2V7HB 4PHZA 3UJTL 1VA9A 4LLDA 3D25A 2Q7YB 1B4RA 3ALXA 5I2IA 4XCCL 4HKJA 2FYNC 2OM5A 3BP4A 3MNVA 4MNHA 3RBGA 5C2BH 1T8ZA 2D7NA 1G6RH 4F7CA 1K3IA 2VR9A 2XXMB 4UDTB 3UXFA 4AYSA 3N1GC 1CFVH 5BRPA 1JGDB 5HVFB 5D8JL 2FR4B 4U3CA 4AQEB 4FN0A 2CHDA 4Q6IB 2VRKA 1UXLA 3GUTA 1I9IH 1FNHA 1UM6H 1SXNA 3OLGA 2HLAB 4OIFA 2BXZA 4M4RB 4TOYL 3VTPC 2VSMB 4L29B 2EH8H 4LC1A 1REIA 1EZVX 1JHKL 4KGLA 2HKFH 2LTQB 3DX4A 3V52H 3ARXA 5JHDA 1VQOP 1DVFB 4JPVL 1ZTXH 5C9KA 4KDTA 3DSFH 4U1GC 1OP3K 2KT6A 1NUDA 4ERSH 2NXYB 4IKNA 2PGDA 4EF3A 3SOBL 1JWMB 4ZAKB 4AEFA 5I75C 1DX7A 4G9FE 1ASOA 3Q6FB 4HK3J 4K3JL 3VFWB 4R4ND 5E8OB 5BO1L 3U9PL 4YSEA 1QEWA 3RB7A 3Q8BA 4JGJA 4IMKC 1AD9A 1I7ZA 4YSTA 2J8UE 4ZUTA 4GMTH 2IC2A 3SCMA 4MGXA 1CZ8L 5H37A 2MJZA 1MW2A 3NXSA 3BD4A 3IRZA 3N91A 3P0YH 5FHBH 1D5XA 1PLCA 3AQDA 3O8ZA 1R3JA 1UOWA 1B0WA 4QRUB 2CO3A 4DP7X 3O6FC 1G9NC 1MPAH 3L4WA 2LVCA 4TVPH 1BQLL 5E2VL 5KS9F 4LVHC 5ITFA 1NINA 1EO7A 4KKBD 4QRPE 3CDGB 1UA6L 3ASOB 4JE0A 1CN4A 1RXLA 3VMNA 1D6VL 5EU7C 3VGFA 1B3JA 4R2GC 1X3DA 3MA7A 1NBYB 3LZLA 4BKLB 3PY9A 1QZNA 5EMYA 2R2BA 4EOWH 3HAEG 2TSBA 4GOEA 1MCFA 4TUUA 2VAAB 3UTTD 1MXDA 3OGOE 4FA8A 2CA4A 3GSQA 5DEFA 4JHBA 5D7LE 5EO1B 3V0WH 1X5ZA 2FXOA 4J2QA 4Y89A 2BP0A 5C0EB 1E5WA 2QPUA 2BIQA 3MPCA 1N18A 3VXTB 1YY8B 2ZFCA 2XTSA 2JKJA 3LD8C 4HOWA 2BWIA 1QVFO 1KGCD 1T1ZB 3VD0A 4N3UA 1RZKL 4RBPH 4Z0XA 4APXB 3UBXG 5EIIG 1ID2A 3FT4B 1UOVA 5TDOB 3V5DB 2OQQA 3RL2B 4AIEA 1N5YH 5G4NA 4PGCA 3LH2L 1WQVT 1W2BO 1EHLH 1AVOA 1QA9A 3TASA 4PJBA 5BVJA 2Z0UA 3VXSD 4FI7A 4MMYA 3ZSTA 4WY4C 4XVSH 4N2NA 1OP3H 5A3IC 5I6XC 4MMZA 4WUUB 3KGSA 1MCEA 1MCQA 2V7NA 4R97C 2NX5A 4LVEA 3ZZSA 1W72H 5KSVB 5D93B 3MV9A 2YAMA 3SE6A 3KL0A 1EA9C 1VZIA 2HX9A 3VP9A 2J43A 2NY5H 5CLZA 1KF9B 2X4OA 4HWUA 1FC2D 4BXSV 1GYWA 3SGEI 2YA0A 4YSCA 4IKKA 1FJKA 1OVUA 2JWDA 4AE0A 1QSFA 5CUSL 3U59A 4EI5D 3FOMA 1DQML 1PJWA 2PWDA 3GTNA 2QFRA 2R29A 2XFXA 4HKXB 4FHBD 5GS1C 3IBOA 3UABA 4HK0B 3RY6C 1WYJA 2EDWA 2F6AA 1TXKA 4GRWH 3GF8A 4MJIB 1RZQA 5EV7A 3PAVA 3I3DA 4E42A 5DJYA 3OLEA 2P5WB 4HIHA 4JO1H 3A23A 5HHQB 4L1TA 4PLKC 3EXLA 3JVGC 1E4XI 4MZ3A 5EFIA 3WO3B 2FL5A 4X4YB 2HFEA 4F3FA 5TTRA 4DVRH 3IEAA 3BH9B 1RF1A 1UA3A 1H5BA 4AE1A 2XX1A 4YO0A 2OMUB 1IAII 3W38A 4HKZH 4IMLA 4I3RH 3VQMA 3ESMA 2V37A 3K1KC 3Q8CA 2QM8A 2ENQA 2VSCA 3GHGA 4JFFE 3U4EB 1WZMA 2JKRM 2CHWA 2QEJA 4LEOA 1FE6A 1A3RL 2CDFA 3D12B 5HHOB 1OOAA 4H0LC 2R5DA 1U92A 1YEGH 1MRDL 1PD1A 1U3HC 2E74D 3QO1A 1PLBA 3LEVL 1H6FA 4M8QA 3QVAA 4PIBA 2ZCHH 1GW3A 2Q6QA 4X50A 5BRQA 5JYMA 1WZ1L 2IPTL 4G8EA 1OM3L 3OZ9H 2AQ1A 3GKZA 1TQCC 8PAZA 1F41A 1NCDL 1E0OB 5LXVA 2Z31C 3RZCD 1SLQA 5MP6H 4YHOL 4BK4A 3PWVB 3U7WH 1V3LA 4GRMB 1MI5B 4OZGB 3NSYA 4M62H 1QSZA 1XF4B 4MDIA 3TA3D 1JPFA 2WSCH 3AE6C 3I2CH 2IMMA 5D2LB 5JDSA 2HYNA 1BVNP 2RR3A 4BZ2L 4BFFA 1MNUH 2D2CD 3BDBA 4ABQA 3ROOA 1EAQA 3PJSB 2D2OA 3H32A 3A7OA 4NWUL 1JFQH 1DBKH 2FD6L 1L5GB 4AUJA 2VM4A 1GA2A 1SUJA 1XAKA 3AMLA 2MKVA 3MBXH 4W9CC 3LH9A 3FC8A 1OIOA 4BH8B 3L7EA 3FOLA 3RNQA 3NFPB 1JEKA 2VUOA 4IBSA 1CBVH 4R4MA 4OZFA 1GW4A 1MFAL 2BOBA 3FCGA 1CGSL 1JDDA 4QHMB 5LWYH 4HLZH 2EO1A 3SWFA 2WIIA 5IJDC 3ABVC 5LGJA 2KKQA 4OB5H 3SYOA 2C9VA 3MBEA 1OW0C 3Q1SH 4GW4B 4ESKA 1VFUA 4Y4FA 3ASNB 2CAKA 5BRZA 1ES0A 3MUHL 3QWOC 1KB9H 2D9QB 1MF2L 1JXFA 5BPPA 4DEWA 4DUVA 1JG9A 1N73B 3UBXI 4W1TA 5L88L 2C9PA 2D73A 5DD6B 3GSUA 2HX8A 3A4AA 5IV2B 4KDVA 1OZHA 1U8IA 1KN2H 3R0NA 4LRIA 4ZMLA 2RH0A 5KSAB 3IR9A 4HS6B 1UXSA 4JO5A 3WEAA 2A77H 3C2AL 3VQ1C 4JCLA 3QO0B 1FDLL 1MCRA 2JKWA 4OUUA 5C0CA 4K5LA 1BMGA 3G4SP 4PB9L 3FZUD 3MRKA 3UJIL 4C47A 4OFPA 2BSRB 1COBA 2E0PA 3BQUB 4I0KA 2QA4P 3H1ID 4TMPA 4EEEA 3KXFE 1M2VB 2H88C 2VDPL 3MZWB 3DOSA 1EVUA 1T3FB 3TBTA 3EOTH 3B5ND 2CPSA 1DSWA 2X2JA 3L3GA 4HMDA 2HRGA 5ECJE 5JUEL 2ITCB 4FLQA 1NGPH 3AWGA 3PQYD 4E41A 2Z92B 2UWJE 5F7LB 3U79A 5IHZB 4BXVA 1HH9A 5I5IA 1HWTC 3FB7A 3E1ZA 3FTYA 2VSDA 3B5HA 3CK0H 1QR1B 1YNKL 4LSPL 3V4UL 4C4KO 1NM4A 3CZLA 3RFZB 2ZUTA 5A2IH 2IZ0A 3QDJB 2Z6FA 1OQXA 5L4JA 4N8PA 1VFBB 1U8LA 3T3MF 3IYLW 3ZDZB 1AP2A 1E43A 2AQPA 5JO5A 3KZIH 5DHEA 2FFDB 2NY3B 4KKRA 4PJ5B 3TESA 3WNJA 1GYCA 4KROD 5IROD 4AQ1A 2FQFA 1KGJA 2NY2D 4A2LA 5I1EL 3QQ9C 4XB8A 2VO8A 1JMBA 3CD4A 1I8LC 1EXUB 4PV1D 5M1BA 5EC2A 3DX8B 1U93B 3I50L 4I88A 4ZS7L 4R26H 2P7JA 5HGAA 5GZOC 2E7LC 2PW1B 2NRDA 1BQHG 4MAYD 3QHZL 5ABZA 4NRXB 4B9IA 4ZW5A 3GNML 3F05A 3S6CA 4X9IA 1CMOA 3WUUA 2ZWYA 2ZUSA 2HLOA 3RDTA 3L70D 1S5IH 2KZKA 2C7UA 2EXYD 2ZWSA 4XP1H 3FO9B 4LNRA 3BISA 2A83B 5BVZA 4Y99B 2WQVA 4CVXA 5KYWB 2VISB 2ZT9D 3CCHB 1FP5A 2HODB 3QJZA 2PTTA 5F0PB 3VI4A 2K4WA 4KK9C 5DJAB 32C2A 3CZJA 4F9PA 1IZNB 5AVXB 1P53A 4AMKH 1WWBX 4EQ3A 1BQSA 3FL7A 5D72H 4IM8A 5DS1A 1KB9J 1MCKA 4A39A 5EOCH 3UTTE 4ETQB 3V6IA 4P4KD 1J0YA 2BNQA 1NFDB 2PWEA 3GBNH 3KPSE 4RISL 3FCTB 3VFPA 3MYJA 4NUQA 1JZ5A 1IGFH 5KEZA 4JFEA 3TT1L 4WJKB 5I8CB 5L0QB 1DBJH 4EDWL 3VVVA 3CD6P 3CLQA 2N7AA 1FE8H 3KLHD 1GSMA 4KK5C 3LW5H 3H9HB 2WQXA 1FAKT 4OM1L 2QHRH 1AZVA 5EUOE 4KXZH 3CVCA 4JO3L 3OAUH 2K9YA 2FECI 4XNMA 4YGVB 3KMDA 1J5OH 3ARDC 2ZYHA 4G8GB 3SDCA 2V3FA 3QC6X 4HHAB 5IB3A 2Q87A 2FWLB 5T1MB 4JEGB 5CZKA 4TNVF 1MFCL 2EUXA 1RZJL 4UQ2B 5BW7A 1A8JH 4JFXA 3HZVA 1YI2P 3BDYL 3S5LG 1YTZI 1XEUA 1ZP0C 1LO0L 3ARTA 4G42B 5H4ZA 4HWEL 2VABA 4N2GA 1GXEA 1ZHLB 2OYHA 2JJTA 1I3RB 4OLVL 4LLMB 2WLIB 3D05A 5FDYA 4K55A 2F5BH 4LGDE 3F01A 3FQ4A 2AEOA 2VR3A 4E9SA 1Q82Q 1CD1B 1T0NA 3FQYA 2DIBA 4NKDA 4NZ8A 5CMAA 4PWEA 2CZNA 1NVOA 2DQGH 1K5NB 1AGFA 4IBTA 4V1DE 3VI3E 1IAKA 1N2RB 1NGZB 3TWCH 4XPGH 5EEWA 3MRLB 5TFSH 4CBZA 3MXVL 1DANT 4WEMB 5B1CA 4OVUA 1KB5A 5E8PA 2K70A 4N0CC 1RUAH 2XIIA 5GS3A 5HHMB 1C5BL 3L5WA 3MJ7A 2VDLL 3UAJA 2AJUH 2E5TA 2LW3A 2W07B 3A6CH 3V6OE 4XNBA 2BINA 1F6LL 1FFNA 2DIAA 5HVHC 3GB7B 3CWBJ 4PJHA 2OMTB 2WWKO 4URTB 1KPVB 4Y1AE 3MZGB 1FNGB 2Z4QA 4Y16D 5DHDA 5EORH 3VD1A 1M1JA 1P5VB 3WFHA 2G2PA 1N5AA 2IXQB 1TUPA 3WOVA 2R69L 2HP4A 4OWFA 4B41A 4FABL 1WHPA 1JY3O 4C83B 4WKXA 4MRCA 2YAHA 4GRLC 1TZOA 5HD8D 2XTJC 2DI8A 3CFEA 4IBWA 3H6PA 3QI9A 3CDYA 1PY9A 4QRRD 2PW2A 3AE8C 1H3VA 1YEHL 3P30H 1UM5H 3V0EA 3WAKA 5CBOA 4N2EA 4XNZC 4N0UE 2K78A 3WS6C 1JJUA 1OAXH 1PSKH 3C6SA 2XQYA 3ERXA 2HN7B 3LQAH 1FN4B 4YBHA 1ZKAA 3IJHB 1J0ZA 1NMAL 1NTKD 1AMXA 3NPZB 4OD1H 3ULSB 1NAMA 1IZJA 3QCTH 4NO3A 2UWEF 3IFNH 2CR3A 2IALA 3IBEA 4Z7UE 2VDOB 2OTUB 1TTGA 3UGEA 1NKZB 4AQOA 1T80A 5FO7B 3MJ9H 1W9XA 4E5XG 3G5ZA 1E8WA 4JFOA 4LHQB 2F1EA 2P45B 1I1YA 2ZX5A 4N68A 4ZPVA 4EKJA 3JYBA 1M05B 1T4WA 4PEEA 1VFAA 5E00A 1YYLH 1S7QB 2YD9A 3UTQA 1B2WL 3EBAA 1WV7T 2DJUA 3PYCA 1LP1A 4QAMB 4QHUB 5EF1A 4GKSA 2VERA 1MRCH 3FUIA 3KPTA 1YEIH 4Z7OE 4XNXH 4WFFE 2AEFA 2YUWA 1EJOL 3ESVF 1KC5H 3A47A 1PPJD 5JHAA 4NJ9L 4WW1A 2UX6A 5GRJH 5KVDE 2IF7A 1A3ZA 1EZUA 1F6AB 3MRDB 1X7QA 1ZOXA 4BRVA 1ROWA 3V7MA 4L8CA 1WTLA 1WISA 1A4JA 1CICA 1GZQB 2CJTA 4OAWA 3RWGA 4KHXH 2DYPB 2PYFA 5I1KL 3I3EA 3F65A 3APDA 5J56B 1PEWA 3PP3K 4HWZA 1DDTA 4GW5B 5HHVH 1XO8A 1N2DC 1FH2A 1L7IH 3PREA 5I8OH 1TJHL 3A22A 4JF7A 5GGUA 5JW5A 3BVNA 2R7EA 1G9MC 1F4HA 5E9DB 1KG0B 1WZKA 2W0PA 4PPTA 2M26A 4YK4B 1AD0A 2NY7H 1X5LA 4ZFGH 4KGJA 4H25A 5DTFB 2Q10A 1JPGA 4PVLA 4XO8A 2Z3FA 1U3NA 1HCYA 4H8UA 1P7BA 5T3ZL 3RJDA 4GOFA 1HWWA 1YJ9P 4YDIH 5FX3A 4APQD 2OSLB 3NZSA 4LCWB 4KMLB 4Q0XH 2D03L 2YK1L 1PZDA 5EEVA 3TJHC 1GIGH 1KELL 4KJQC 2YBRB 4GKZA 2DEXX 5EHFA 4ZD3L 1FDIA 2R0WH 4YXLL 2WLMA 3QZBA 4YSAA 1XHHA 3ISWA 1HZLA 3AITA 5A6MA 1QKZH 2W94A 2VR5A 5JQ6L 3PQYE 5F21B 4QTFA 1JGUH 1CXKA 4PAZA 4W4NA 3VH8B 4DGWC 2X38A 3A0HE 2B89A 43CAB 5IW3A 4LP4A 2Y07H 1BEXA 2C1PB 5FECB 1FG9C 2AVGA 1KEML 2W88A 4JRXD 4XN8A 3RPBA 5KSBA 1VQPP 3TVMB 1F00I 2MPAL 3U6RA 2ZPKH 2ZXAA 2J8UF 3VMZA 2PO6B 2VSKB 1URZA 1IGYB 3AROA 1D6EB 5HI5C 1WS7A 1KSRA 4HBCL 1SXAA 1CLOH 3IDMA 2V9QA 3O9WD 5C08A 3BLKA 1YN7B 4MDJB 1NUGA 1OSYA 4KQ3H 1AR1C 3WHE0 2HA1A 5LGHL 1PLGH 4MQ7B 2AXGA 3V7AE 2WT7A 4FXGB 2HUEA 2F18A 2WBJD 3FFCB 5I24A 3HTLX 2KMWA 1U3JA 1AHMA 2Y2TA 2NW3A 2BMKB 1IC5L 4WWOA 3CZFB 3O3EB 3UBXA 3UEQA 2E76D 4N0YH 5M95B 2AJYL 3C75A 3UL4A 1CE1H 3IDGB 2KSEA 2XUWA 4XE0A 3D0VB 5FIEA 1YEEH 5IIEB 4K73A 3L70E 2FO1A 3VXOA 4LCIL 4YHKL 1IILE 2L7QA 4UNVA 4IOFD 4EUPA 3TV3H 3IDNA 1YPZB 2EE3A 3K71A 3HFML 2KLTA 2C9NY 3AS3A 4N90D 5KS9B 4YLCA 1LMIA 1MW1A 3VMPA 4EDXB 4EKXA 4CC0A 2JK5A 5GS2D 1LEIB 4X7DC 1PLAA 4ZMTA 1Q9LA 1FNSH 2A9AA 2BIIA 2PCFB 2CR6A 2YMTA 5CZXC 5FGCE 1NTMJ 3TBYB 2HMIC 1ZV9A 1EBPA 2WAHA 1UKTA 2V8MA 1AXSB 1H9VA 2OJEA 3QUYD 4IU3B 3Q8FA 3VXSA 4MD5A 2ICWJ 3EJSA 3CMGA 4CC1A 1KBVA 2H4EA 3I3BA 2P80D 4HOZA 4I18C 3FUDA 3NCCB 1DCEA 4G80A 5DJCA 1JZIA 4QRTB 4X4XB 1A4BA 4UQIM 1RZFH 3BPLC 2PTUA 1BIIA 4QI3A 3PGDA 3D39D 3KNBB 4TSAL 4ICXA 4ELMA 1DVSA 2C9SA 2JB6B 3TBTB 1Z5LB 3QIWC 1NCBL 3K4DA 4MA8L 4UU9A 3OHXB 2UUDK 4G2AA 4PV9A 4JM2C 4YN3A 3M8OH 1TFHA 2BW4A 1FU1A 1Z9OA 3OXRB 1KQGB 4XMLH 1OL0A 3OR7B 3V0VA 4JPWH 1GZLA 4L75A 3L5IA 3AXLB 2GPZA 4XO3A 5EBMB 4DGUA 3HHMA 2H7WA 1SEQH 1T66C 4YX2L 4W4OA 1S7RA 3MHZA 1OGTA 4UNIA 5LBSL 3RPIA 5TJWK 3P0VH 1XMWA 4JQIL 4AIXA 1OAQH 4BFGA 2QR0A 1Q9OB 4HH9A 4FLHA 1MZYA 3O6LL 3QPXL 3ES6B 4L4TE 3JZYA 1B0IA 4Q56A 1QW9A 2Q7CA 4XOBA 3VXUD 1TO5A 2F53B 4LB8A 2C3GA 1YEJL 5CP7B 2B0SL 2IG2H 3UERA 5CCKL 3EOBA 1FLRL 3D2TA 2YZ1A 3VWKC 4J3OF 3V0DA 1QUPA 3RU8H 4CW1A 1S7VB 2DQCH 3HR6A 2BNUA 1V7NL 1XGZA 2ZAIA 1OEZW 3LQZB 5DCCA 2XG5A 1CT8B 4JKNA 1KNOB 2Z1PA 4YNYB 3WO4B 4G72B 5IFAH 4DQOH 4UM9B 1FL3A 1J9CT 2ZX6A 5JHLA 3JBG7 3RZCA 4FFZL 1SVCP 2C9LY 4OCSH 2YJLA 1E4JA 2BFVH 4BV1A 1F18A 3JWNH 3H56A 5CCHE 3L1FA 1G2CB 4JFZL 3GMNA 3VB8A 3OKOB 5IK3A 3UPRA 1HOCB 1FO0A 3OKYA 4U3FD 4QRRE 3MLSL 1Y6NR 2ZG3A 2QFPA 2KXPB 2V2XB 4L8BA 3QIBD 3IVKA 5HYSG 2HG5A 5DDHB 2IBZY 1FYTB 1KT2B 5CIPB 5CZRA 2VLJE 3W0WD 1INDL 1VHPA 3H1KE 2CKBA 2HUHA 2XN9D 3OD3A 5I1HL 1A6TA 1FV1B 4M6ML 3LV3A 1CU4L 3QDME 4P2RB 2XVLA 1UATA 4OFYD 4WHYG 1OLZA 2NUTB 5EDXA 1KYAA 3SDYL 1EC5A 5CR8A 1KCVL 1I1AB 3MCKA 2IYPA 5FUCE 1T1WB 3GI9H 3U1SH 3OGCA 1BJ1J 4NI6A 4RGNB 3V5KB 5C0DB 5IMMB 2HG0A 3GEFA 3W2DL 3HNTL 4ORZC 3BUPA 2O61B 4Z8FL 4MCZB 1H6TA 4KDWA 3QYNA 2UUDH 1P9MC 1RSFA 2DM3A 5DJ8B 1B0GA 3EKCA 4DK5A 2C7FA 1JB0J 3OBAA 4LPVA 4W6WB 5T5FH 1ICTA 1ACYL 2BVEA 1YMMA 2JCCF 3QJXA 2AXFB 4K94L 4LRNL 2RAMA 4NGHL 5F72S 4NRYB 3G04A 3KHUA 4J4PC 3QQ3B 3QUMB 3VOPA 2DQIL 3DMMC 3BMVA 2ATKB 2ZCLL 4KPHH 1S7XB 2OGUA 4KJMA 4TNWK 1AE6H 1U2YA 2ZJSL 1N8ZB 4L8SC 2GSGA 3D48R 1MRFH 2F9BT 2IQAA 1AFOA 3FXIC 3FTVA 1GY1A 3DJ9A 4D8PB 3IXTB 4X4ME 1NC4B 5DJDA 1N64H 3TF4A 3MR9A 3MRQB 1E4KC 1HHKA 1HILA 2C3XA 3RB5A 2H2PC 3L5JA 5FAAA 1BCCJ 2OW6A 3OKEA 4H8QA 2W6AA 3H0TB 1PFOA 5A2JH 3ROLA 3B5NA 2X4QB 3HG1D 4ZNCD 4WV1B 4N9GB 2CO6B 3KLKA 3QXWA 3LZFH 2OMBA 4L3ED 4X5WB 1K8IA 1A7QH 4HLZG 3U4BH 1YMHA 3BIBX 1Q94B 3OG4B 4TLKA 5CF3A 1RZKC 1F3DH 1GH7A 3MP7B 3ZO9A 3S9DB 4M29A 5ACZB 3O4LE 2QSTA 3IJ9A 4HUCA 1BFTA 1FNFA 2JJLA 1ZLEA 5KVFH 2DQHL 4ONGL 3TCTA 4YPGA 1NWQA 3BXNB 4AQ8A 3L9RA 3S34H 1DSFL 3DO3A 3QNYA 2ZXDA 3KM1A 1L4AB 3TGUJ 1K3ZA 2LAGB 3MO1A 3O8XC 5C07D 5TE6H 3CCRP 4NQSA 3VVWA 3OB0K 5IROA 3HI5H 1N7SD 3L72E 5C71A 4HCRA 1SQBJ 2ORBL 3ARWA 1E2WA 5JZ7D 3QEGH 4L8DA 1J9TA 3IFLH 4AMXA 3REVB 3MNVB 3WTTA 3VG9B 3ULUD 1W8OA 1NOAA 4JRXE 4HW6A 5GTIE 4XMUA 2Q7AA 1RZGA 2W0FB 4NC1C 1S5LE 4Q4EA 4MAYA 5JHBA 2PR4H 5ICYA 3KPRE 1HAUA 2P46B 2HTLD 1YEKL 1O7DE 1ZPUA 3DIVA 4WI4A 3L3JA 1I75A 1PY4A 3DLQR 3P9WB 5E4IA 2X0VA 4D6TE 4X9GA 3KYNB 3T3MB 4LHUD 1UA7A 1JZGA 1N70A 1H0DA 3L4UA 4WKZA 3AUVA 1YEWA 3M1CA 5A7EA 3GI8L 4Y4KD 5B21A 1G0XA 4MWFA 2VDMH 4O2CA 4WU7B 1YN6A 2CJUL 1I4FB 2APVA 4XHQA 4Z7QB 4XE5B 1Y8AA 2A0LD 2X28A 1QEWB 3O2WH 1QRNE 1J05A 2QKIC 3R4YA 1QVOA 3LCYA 1AD9B 3OC8A 2DB8A 2Q8BH 3T0EC 5J11B 2VXUH 3CWBG 2WZAA 2MH4A 2YGOA 1R3IL 5LCVH 3U0PA 5B66E 3TJEL 3VFVA 1QOKA 2HPCB 4MXQC 1GJUA 2E47A 5IVXA 4N90E 1NPNA 4HJ1A 4WFGD 1R3JB 3RL0B 3MROA 2J1YA 2N0MA 1M3JA 1N7MH 3HE7D 5TE7L 4ZSOB 1JNNL 43C9A 5ITFB 4LSTL 5EUOF 2XWTB 3A4DA 1GY2A 5E0QA 5BV7B 4KAQL 5IOKA 2VXTL 4LFHD 4XCFH 5LG6A 4JPIA 2F54A 2H1LM 4XXDA 2BOCA 2VM9A 5L2JA 1EBAA 3BFWA 2UY7B 4FXKA 3MHVA 4QTHB 1KYDA 2CGYA 3L95B 4BKSC 3U1AA 2YBGA 3B7YA 3MA7B 4WJG3 2QSQA 4XWOC 3GZPA 2FIRT 1SYVA 4WNQB 1ZXKA 3QHFH 4NQTA 3BVVA 5CD3A 3T8XB 3V4PL 5TISE 3NSFA 3L74E 2GM4A 2P8LB 3FQUA 3QCUH 4L5FH 5J57B 5LQBH 2DDQL 3OB0H 4HJJL 5DEFB 5AB9A 2OL3A 4UT7H 5CZVL 1XIWC 3NJVA 3TL5A 2IV9A 1QBLL 4XTRC 4TNGA 2VXVH 1L0NK 3ARFB 4CGTA 1MCWM 3BUQA 3VI3F 3P4MA 1SVFA 1CDHA 4D9RE 1MUJA 4X0NA 2A2QT 2AK1L 1MN4A 1Q72L 3GQFA 5D7HA 3UAFA 3LIZL 1BP3B 3FQ1A 4WLCA 3V5HA 3X3GL 3SJVD 2KC0A 2BJMH 1KB9I 3AVEA 1JE6A 4PJBB 4RFOH 1A6VL 2D7PA 2FYVA 2CHZA 2X4NA 4JPKH 1SXBA 3W3BA 4MMZB 4JFHD 2NX5B 3LS5L 2QZQA 1QPPA 5JA9A 1QG3A 4LQ1A 5EDSA 3V2QA 2D3LA 5DJZA 1H8NA 2YD0A 3JTTB 4PYGA 2N1TE 2AMGA 5KLVK 4XZUA 1OSZB 1IBGH 3GSXA 1QSFB 4RJTA 4N20A 3BP7B 4XMWA 3SKMA 2J59M 4PS3A 4LVNB 4UQBA 1BAWA 1RIUL 2E7MA 1P1ZA 3QSKB 3NESA 3KPQA 1H3TA 3G5XA 4D94A 3B9KC 1Q0YL 2R2HB 3TBWA 3VFSA 1Y6MR 2WGNB 2QVKA 5E7FA 4KVPA 3SDAD 4RNRA 4CL7A 3MD0A 4HULB 3BRGC 4X7TA 2X05A 1P5UB 2P24A 4E42B 1RE3A 1MQ8A 2NY6D 3G5VA 4FQHB 5G5DA 4UWQB 5TD4A 3CPLA 4AVIA 1MG2C 4A2FA 4LLHA 2EE2A 3J2PA 4E9RA 2FGWH 5EFIB 4Z7UF 4TTDC 4LLYA 5IREA 3MUDA 1BZDA 3A4FA 4MNGB 3IK2A 1RF1B 1H5BB 2AQSA 3EGDB 4JFDB 1PCXA 1KILD 2FLRT 3ZE2B 1E50A 1AACA 3W0WE 4KNTA 4UQCA 2EDTA 2YPVA 2HT2C 2DD8H 1Z3GH 3MREA 2FWUA 1UWGL 2EDNA 3PV6B 2CDFB 1NGQL 1JTHB 2NNAB 3MODL 1KZUB 2ENYA 1UD6A 4Z7OF 4JRYB 2EO9A 1NM9A 4FJZA 2P8PA 3IDJA 4M8QB 2BHYA 4W70A 5C3TA 3RGVD 4DZBA 4LGPB 1IX2A 2VYRE 1WFTA 2IGLA 2JVUA 3AB0B 3RK3C 3SZKC 2R8SH 1HQRB 1HXYA 2J88L 5C0AE 1A0QL 3MGAA 1IMHC 3BWUF 3HUJA 1QSED 4R3SA 5B8CC 3R8QA 1VSCA 3CFBA 2JI1A 1NGYA 1DJZA 1ND0A 2VMEA 5DHVB 5CSZB 5JDSB 4K7FA 4L48A 5KTEH 3L1OL 5I73C 3L6FB 2AI0H 1W0WB 4HIJA 2X09A 4ZFOA 4APQA 3A2AA 4DUWA 5HDWA 2VDQL 5EU6D 4XCNA 1CTMA 1MFDH 5E79H 1QABA 3L7EB 5J1AA 3U6XS 4DO6A 3EH4B 3S2AA 4UMSA 3HR5B 5JW4R 1G6RA 2W0KA 3MV8A 2P4AB 3HG1E 1NBZA 1IE5A 4IRJC 3RVUD 3GFUA 1OV8A 3DK2A 1J8HD 3MBEB 4GH7B 2Y7SA 3NIGB 3WKPA 4JAMA 3L9BA 2VDRB 3SKOB 2VDNB 2NQCA 3CCLP 1NTMG 3QT2A 5FDWA 2Q76A 4WI0A 4R0LB 4XP9L 5D1ZD 4DKEL 3H1HJ 2ZP9A 4LQFL 4Z3TA 5F1SA 1JZDC 1RZJC 2H1PL 3BGFC 4KXZI 5IQ9A 4AJ0A 5AUMA 4RDQF 3NFNB 5HHPB 1CLYL 5F3BA 3TO4D 2YJQA 3FF8A 5EU4A 3IGAA 3OJ2C 3AE5C 3GRBA 2ICEA 3K0YA 3TFKD 1K6QH 4PMEA 3ZHKA 2B9AA 1BQKA 4YQXH 4YUEH 2R1WA 4R84A 1NCWH 1XEDA 3UZEA 2FX9H 2BCCD 1TQVA 2KH2B 4WRLA 4O51A 3DOSB 1J1EB 2FK9A 3QW9A 5DEGA 5H2FH 1RJYA 2WBJA 3TBSB 3T2LA 1LTJC 4O9HH 2Q9OA 2A6KA 3F7YB 4GBXB 1IGCH 3NCEB 1CLZH 2RKLA 3TNNA 5J6GA 3RAJH 1LWJA 4MA7H 4FQJH 3LRLA 3MV9E 3MMEA 2P10A 1I8AA 4YDVA 4E41B 3UC0H 4GYBA 4WUKH 1HEHC 1MQKL 3QFDA 4KKNA 1HH9B 3LHPH 4OFKA 1TJMA 3D2UD 2YQ2A 3K6DA 2J8UB 2WCPA 4LKCA 4I77L 4S1DC 4ABWA 5CN2A 5DFVC 2I25N 4DF9A 3H9SB 1P2CB 2VL5B 3BI9X 1MREH 3L73G 4TT3H 4HU8A 4G5AA 1AGBA 1J48A 1AP2B 4PRBA 3P2BA 5KTBA 1KCUL 2NCMA 4Y5XC 1NMCB 4YE0A 3RL1B 2O93L 4AVKA 1XCQA 5FW7A 4AYFA 3VW3L 2C9XA 1KTJA 1S5LX 2FYUK 2Q7NA 1N3NA 3EF4A 4WWKA 4YHIB 5IQ7L 1X8YA 1OAZH 4RX4A 5FYKH 1WBZB 2P80A 4LIQE 4F7TB 4WW2F 3IRPX 4UIMA 4DP2X 2YGPA 1R3LA 5F3HA 2CXKA 5HDQH 2E6PA 4WFGE 1QLEB 3MKGA 5D1XC 1T83A 1YQ3C 1L0LJ 2B2XH 4L1HA 2COQA 2CGZA 4TV3A 3F6LA 3MNMA 1J12A 3D39A 5DMJB 1KFMA 2C7UB 4YXKL 4AGPA 1USZA 5E2WH 4LNRB 3T2NH 1UXWB 4P04A 3PWLA 1SQQD 4XWGL 1ZHBA 5LBVA 2IDCA 4JKWA 5JXAH 1SXZA 1IFHH 4KXBA 2F7IA 2ZX9A 1JWSB 2PTTB 3FUNA 3TLRA 3VI4B 2QSVA 5DA0B 1W72A 2F7QA 1TEYA 4KRNA 1J7VR 4N2MA 4Y4HA 2EDQA 3BCFA 4AKQA 1FVEB 3E7JA 4M48H 1HH0A 3LXCA 3QEQD 5IJVB 3LXAA 4XMZA 5AKRA 3S3JA 2LKMA 3MRNB 4FLOA 3CFKB 1NCHA 4I3SH 3HLAB 2VLRD 1YDPA 3MYJB 3MA9H 4P5TA 4DCQA 4PGEA 4NNPL 3QUZB 1NTZE 3CFDA 4FQLL 2OZ4H 1AYRA 5JIHA 1X44A 2DJSA 1NEZG 1JGVL 3A5VA 2JKSA 4EI0A 1EFXA 1DVYA 1PVHA 2P42B 2WPSA 3NSJA 4NX0A 2G60L 1T22A 5F0JB 3O6FD 3RVXC 1JGLL 1QRKA 4XNMB 2A9NH 4QTIL 3HE4B 1XGTB 4HH8A 1KIQA 1EAJA 2QTVA 3SJVE 4BUHA 1X5AA 3P40A 5INDA 2DLIA 4KV5E 3VFTB 4X5XA 2VXQH 3O11A 1MKFA 1SY6L 2ZSWA 3NTNA 4DZOA 4JFXB 1D5BB 4LZKA 3U2IA 5E08H 3JQOB 5IBTL 2GUOA 3ZL4H 4R2GD 5FOBB 2EC9U 1DBML 3OF6D 1N0XH 4YFLF 4HHWA 4C58B 4AIOA 3ZDMA 4UOQA 5EIQA 4EE2A 4M61B 3R4RA 1BCCG 5F7YC 3FU9A 1QD0A 4FQ2H 4NKDB 4CUCA 3APMA 5CMAB 1ONQA 4TUKL 3O2DH 2EYRB 1BVKB 1S9YA 1GGCL 1QLRB 1XGYH 3F58H 3G3ZA 3QIBA 5A6IA 3ZSSA 3K6NA 2QADB 5B1JA 5IW1B 1A22B 1DVXA 1EEZB 3GC3A 1HKFA 4CGUB 4HUVA 1KDJA 5DHYA 2XN9A 1XGPB 3LNDA 4JFFB 4E36A 3L75D 4KNUA 2F61A 3NTCL 4OFYA 4QY8A 1C8QA 1GKOA 3CZKA 4PJFA 1OXYA 4HGWA 2H7HA 1RF0A 3MJ7B 1KFAL 4JW3A 5APQA 1ZIBA 2N9BA 4AV4A 2DS4A 2NUPB 3C8VA 1MCWW 2WGXA 3FU8A 3WE6A 2M3EA 4ATTA 1XSIA 1SQVK 1I9JL 3UYPA 4PD4H 2H8PA 4PJHB 4XAKE 3TGUG 4WY4D 4I2XE 1UASA 2CLZB 5ANME 5A3ID 1KTDA 1C7TA 2Z4QB 5DF0A 4NI3A 1RUPH 4KFMA 5KYXB 5E4AA 1D3CA 4L3FA 3MLRH 1CK0L 1KYFA 2YRBA 1N5AB 2O6DA 3K6IA 3S35H 3ZR5A 1R5WA 4CVZB 3W9DA 3D30A 4FJYA 3GSOA 1DD4A 1LO5B 1PD6A 2EJ1A 3BH4A 1AJYA 1OAKL 3TONA 2CK3H 1RULH 5FO8A 2WKOF 4YZWA 3CFEB 1LO2L 3NZUA 4A1RA 3QI9B 1BF5A 4KTDH 2JJUA 1XBRA 3E2HB 5FYLH 4LVOC 2A7BA 5I1DB 1JGEA 5I6PA 2DWDA 1T6BX 2O5NA 3D09A 5EIVA 3RLSA 3FQRA 1FSKC 1NAMB 1R1CA 5HSFA 5EZIH 4NO3B 1HXMA 2IALB 3X17A 2Q2EB 3ARRA 4YHYC 3CVHB 3G6JE 4ZNCA 4HKBB 4LSUH 5DO2C 4PLKD 4LCUA 1WS8A 4UT6L 2ICCA 3G5ZB 1W8EA 2KUTA 3HI1B 3GLEA 4JFOB 4JB9H 4L3EA 2X12A 4AC4A 4F57L 4WSGA 4LPWA 3L5XL 4AGOA 4FFVC 1GDTA 4HZ1A 3B9AA 2JCCB 2P9RA 4JDTH 1BAFL 1IZKA 4GQQA 4LSQL 3S96A 1JF5A 2OQJB 4V2BA 3PHLA 4C56B 4GG6A 5EU6E 1KBPA 2WHVA 3BW9A 1B4TA 1OZTG 3GPEA 4Y5VC 3X1FA 1U3HD 1ETA1 3GSNL 3RJQB 3PJNA 2A9MH 1X7QB 1BXUA 1RQUA 4K7PH 3VWJB 1VADA 3NH7H 1EDLA 1J8HE 2YAPA 3D34A 1A4JB 1AS7A 3RWGB 3U9PH 2X3CA 1R4XA 3MRFA 3QXDA 4FULA 5GISL 1ED3A 2Z31D 1OARH 1ZR4A 4LAQL 3RWCA 4AVJA 2BNQE 4JFSA 3M86A 4ZUVB 5KOVC 3AY4C 3R19A 3I84A 4J3VA 3PJSK 2GHZA 4ZMOA 1JO5A 1SLVA 5GGUB 2BX5A 5CBAA 5JW5B 3BCCE 1VF5C 2XNDH 2WZ6A 5A2BA 4TPRH 2EYTA 1ECZA 1AD0B 3RHWF 4ES9A 3D3VE 2ITEA 1LTGC 5HYFA 5DUPL 5CCGA 1UT9A 3V2RA 2H43A 2HXAA 4AXWA 4RA0C 1BZ7A 1JY2O 4LPCA 5ERWA 3HRZC 4F9LA 4AQAA 4A7GF 3HUSC 4WI2A 3RUGE 4PD4J 1OAYH 1XH2A 3ARUA 5I74B 4LBAA 1YHQP 3GF3A 4KRPB 2FNBA 2ZWNA 4IRSA 3VFMA 4Y88A 5HYJD 3I6GA 3CXHK 2UY6A 3EJCA 5KSUA 4ZQKA 3R4DA 4EVNB 1Q1JH 3L4YA 4HIEA 2E86A 3ZT7A 2W59A 2WWNA 3S0PA 2FSDA 2VDKL 1V05A 3TBVB 1ZAGA 3RURA 3GSNB 2CO2A 1BZ9A 5EZJA 3U4AA 4YWGL 4XRCB 1M8OB 4U0RC 4JVPA 4FLRA 1OK8A 3UROR 5KZCD 4MXWH 3WGUB 2CRYA 4JDZB 3HE7A 1X9VA 1HEZA 4N87A 3L08A 3IDMB 2YOCA 1A66A 3C5ZC 3DRTB 4JDVA 2GBUA