3KDPB

Crystal structure of the sodium-potassium pump
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
286
structure length
286
Chain Sequence
NSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRSRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the sodium-potassium pump.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
total genus 33
structure length 286
sequence length 286
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3kdpB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 3kdpB02
1KQLA 1J2JB 4C7NA 4AUWA 5AW5B 1JUNA 3KQGA 2R32A 2W6AA 1MV8A 2JJLA 3VTPC 4RESB 1YYCA 3MGNA 2Q5UA 3P8MC 3B8EB 5AVQB 3VN0A 3A5TA 1GD2E 4HYTB 3L35A 3A3YB 5AVTB 3SWFA 4B86A 1FOSE 5APSA 4GKGA 3KDPB 5APTA 4EOTA 2BASA 4DZOA 5APWA 1T2KC 1FOSF 2WPRA 1SLQA 1JNMA 1NAFA 1GK4A 5AVYB 5AW2B 5AW9B 1SP4A 2R5BA 5AVUB 3M91A 3O8ZA 2KP8A 2H7HA 2IPPA 2Z5HA 3P32A 1A02F 3LIEA 5APYA 1MFZA 1CI6B 1CSBA 4I6MC 3T97A 2XZRA 1CI6A 5CMZA 1HBWA 2P7JA 3L36A 2P2UA 3VMYA 3TYYA 1DH3A 1GK6A 2R5DA 4GT1A 2P67A 3M06A 1H8AA 3V5BA 2WPQA 4I2LC 5AVSB 3TNUA 2Q3IA 3HE4A 3VYIA 2YO3A 4AQRD 2WWWA 4KHXA 1OWAA 1GU5A 4C7NB 3NTNA 2Z5IA 4LC1A 3HE5A 2E43A 2ZXEB 1IO4A 5AVWB 3M0DA 2VRSA 5AVRB 4AYCA 1OXZA 3IR9A 3HE5B 1H89A 3M9HA 3WGUB 5AVVB 3VMXA 1X8YA 3VMZA 5AW8B 1NWQA 1G2CB 2QM8A 5AW1B 2ZFCA 3P7KA 4RETB 5APVA 5APQA 3A2AA 3A7OA 3NXSA 3WGVB 5AW4B 4C46A 1GTWA 1GU4A 3I5CA 2YO2A 3UIAA 1GZLA 2E42A 1T2KD 1HWTC 2QM7A 3NMDA 3TK1A 3HTKA 4M3LA 2W27A 3NFQA 5AW3B 1S9KE 2C9NY 3V4QA 1CZQA 1FAVA 2WT7B 5APUA 3OAKA 3L37A 5APXA 5AW0B 2YNYA 5AVZB 2WPSA 2R3CA 4XE5B 2Q7CA 2C9LY 4JYCA 3LIDA 3MD0A 2WTYA 3TNUB 4JYBA 5AVXB 2WT7A 5AW7B 1H88A 1HJBA 1S9KD 3HE4B 3M9BA 5AW6B 2XV5A 3V4WA 2XU6A 1HUCA 3M0AA 2N9BA 1A02J 1MUUA
chains in the Genus database with same CATH superfamily
2WZAA 4FQCL 1BGXH 2CG9X 3GIZH 3ABLB 2QR0A 5K9QI 4AYGA 2BCCE 1UKSA 4MMZB 1KFGA 1NWOA 4G6KL 1BQHG 1SYSA 1GD2E 2Z0UA 3WS3A 1YEEL 1BXAA 3PG2A 2Y0SA 1KQFB 2RFXB 1PZCA 2B3IA 4YEEA 4M6AA 5HI3C 4BKLA 3HCVB 4HD5A 4PLNC 1KYFA 5AB9A 1KGJA 3IS1X 3FB5A 4AKQA 5JW4M 1IZJA 1SLQA 2QPDB 2PPFA 3CFEA 4FNSA 4HJ0D 1ZOXA 3QH3B 3O8ZA 5IT2H 2B1AH 3H1ID 2OR9H 3LKQB 1GGIL 5EU4A 3NZSA 4ZAKD 1X5HA 4FYTA 3RJQB 3CBRA 1NM4A 1CI6A 1PV3A 2ID5A 3AQXA 4LMQI 1EXUB 1WRGA 2AEFA 1JMMA 2EIZA 2GJ6B 2OXGA 2P8PB 2W0KA 1BZ9A 3PL6B 5G4OA 4DAGH 2G4GA 3Q9QA 3EJZD 2DPKA 2GSIA 5ITBL 1WCBA 1MFBH 1PCXA 1Q90A 4Y4HC 2GBVA 4LCYB 3QZWG 4PJCA 4PJ5D 3AEFC 2NLJB 4NP4L 5E56A 5SWZD 4FABL 1ACZA 4NENB 1IB5A 1AP2A 1JUFA 3QPQD 3REWA 2PCFA 3C60D 3VX1A 1MHPL 5KG9A 3P73A 4OCWL 1QLRA 4WAFA 5CD5D 3BRFA 1FORL 5KUMA 1ZXQA 5DWUL 2FLBT 3QZWA 2EYTB 4OBSA 5DHEA 3WU2E 3TO4D 3SPHA 4AYDC 2WN2A 2BRRH 3JV6B 3RPIB 1KY7A 3K72A 4N22A 2ICEB 4PV9A 4HJIA 1I8KB 3RWCB 2A77L 3O8XB 1ZGLB 2C1PA 3LN4B 1OAXH 3GG2A 4ETQA 1AYRA 1PLAA 2Z8SA 1KF9B 3EH4B 5DHYA 3VU2A 3W11C 2OARA 2I7SA 4WY4D 3RWHB 3W5NA 1YDPA 3GM0A 1AQTA 1A7PH 2PF6A 3MA7B 2V5YA 1I9IL 1PZDA 3PS6A 1IAOA 2ZJSE 1DUYB 3AT8A 2JCCA 4CKVX 1B6UA 4RA0C 1PSKH 2WBJA 3II3A 1D5IL 3HHSB 4FZ8L 4JO5A 2P48B 4JW3A 5AUMA 2XZZA 4B6ZA 3S5YA 4GKNB 4F91B 1YEIL 3B2MA 4O02H 1SOXA 4N5EC 1G4MA 4PG2A 4B7LA 5BQ7B 4PJEA 1WDAA 4R7DA 3SDAB 1XR9A 3SDDC 1TU2B 4QHUB 4L3AA 1BAFL 1CXFA 1NTKG 4UNIA 2APFA 2UZIH 3KHUA 2PCXA 1J1XL 2GTWB 3NIFE 4YHKL 3ML8A 1EEZB 5K5GB 1HNFA 1IC7H 3MNZA 2DIJA 4LSPL 1MFTA 1RIUL 1RAMA 1CICD 3BO8A 3GINA 2Q8AH 4XBPB 3AB0B 3S3PA 4XWGL 3F83A 3MRJA 1XGZA 4AYFA 1PL3A 1XEDA 2NY2B 5DJCA 3TGUG 3R1GH 5BU5A 1DVFB 3O6ML 2C9VA 2XJLA 4J6IA 4HIEB 4DOHE 2EDEA 3CDZA 4G8AC 4MVBC 4FQXA 4PJ8C 4K9EL 4YK4C 1Q38A 2D3JA 2EIMB 4MNQD 3N9GH 3N5AA 1OGSA 4S1RH 2JE8A 1LJMA 5FM5M 2G0KA 4GRLD 1OM9A 5DVPA 5F7AA 1PP9G 3SDXA 4PP1D 3P0YL 2PYEA 1WA1X 1QQDA 1E5BA 1SVBA 3IJEB 2GJ6E 1WUNT 2NXYB 2VZSA 3NP4A 4NKQB 4NP4H 4CVXA 1A2YA 2M1KA 2VM9A 4OZFH 4JZNB 3HPLA 5MERB 2FECI 4ODXB 2E7BA 2HKHL 1JZ8A 1G6RB 1NC4B 2X2HA 1DUZA 3VMAA 3VB9A 4CDHA 3L71E 2XPYA 2JMRA 1NGPL 1NOLA 3U4EB 2G3XA 4O2FB 1AI1L 1U8QB 3AT9A 4PGEA 2ZJSL 6CGTA 3PF2A 4Y5XC 1YN7B 3F5WA 4UU9A 2AVGA 1D6EB 3P3RA 4ZMTA 2F8IA 1DHKA 1GW6A 2F74B 1T8ZA 3OXRB 3H1LJ 5I76B 4LCWA 1QP1A 1JZFA 3BAWA 4NERA 1UXMA 3QJUB 4YSSA 5IB4A 1SLVA 3HPJA 4MMXB 4WZ9A 2B9BA 4QCIA 3FUKA 1EDIA 3C5SB 4LE8A 4Z7VE 5CCKL 3V5KA 1FUNA 4YNYB 1NCAH 5GTHE 3E6HA 3V6IA 1AQMA 4P59H 5BZDA 4WJ5A 3KJ4B 3NFPA 2R4RH 1CE1L 1KIUA 1OSZA 4L05A 4B9JA 2P24A 3NZHH 1HZHL 4ZFFA 4FULA 1H9DA 2HYNA 1UC6A 5DD1H 4BDVB 1A4JA 4HJ0C 3ZMRA 4UTAL 3T5WA 2AMGA 5DD5L 2QKSA 1YEGH 1LTBC 3MCLH 3L75D 1QSFA 4KVNH 1P7HL 3P4MA 3VGAB 1UEYA 3F6IA 4HUNB 4A55A 3T4YB 1FNFA 1P7KB 5AVXB 2BNRA 3BDYL 1BBDH 4L4JA 2P7TA 2YXQB 2E7LC 4P57A 2FJSA 5IEKA 5L2JB 3V0EA 1I3RA 3RVTC 4HHAA 2SEBA 4LGDE 2R1XB 4OQTH 1F3JA 4UT7H 3LYRA 4I5BB 2XN9A 2VDQL 4TLFA 1CYXA 1G5GA 4FFYA 3WKYA 1YI2P 2C4FU 3FUHA 2XU9A 1SJHA 3MV01 4AE0A 1BLIA 3TBTB 5GGQH 1KTJA 3FCGA 4AEEA 1G6VK 1P4BH 1E9QB 4WIQA 4DT2A 4LSUL 3ZN6A 3U0PA 1MG3C 1D3CA 1OE2A 1KDJA 4XXWC 2R5BA 1FZJA 2Y36L 3CFBB 1ULVA 2J5WA 1EANA 3MR9A 5BUAA 4HEME 3SJVA 2VABA 5BQDA 4WTWA 2BWIA 2YWYA 2V8MA 1NCWH 3Q5OA 2RJMA 5J6SA 3CC5A 3NH7H 2NY1D 3U9UA 3MRIB 1KZQA 3O0RL 1R24A 4U1NB 1CGTA 1N12A 2EDRA 1PYWB 4E2OA 1PPIA 2IBGA 3QIUC 2O3JA 3R18A 1IC5H 4JDZB 4Y1AE 2ZUTA 1LE9B 1JK8A 1HT6A 2E7DA 4Z3GA 1RZFL 1Q0YH 2B15A 4JM2A 2IDFA 1L7TL 2XUWA 3NPSB 1IGTB 1V27A 4YGAB 4U3XA 5G5DA 3TNNA 1P1ZB 1UM4H 1WHPA 1DVUA 4GRWE 2WINA 4TLTA 1D7BA 4N3YB 3JV0A 2F18A 3M7OA 4KHTL 1K2DA 2DDQH 1WC7A 3W3BA 2K9UA 3FU5A 3L3HB 2DQ6A 3H7BA 3OKYA 1L4AA 1M2VB 1NCJA 5BJTB 4IOIH 4H8HA 5JHDD 2K3RA 1WBYB 4XPFL 2WNXA 3FT1A 1NCBH 4A38A 1HTYA 1NTZE 1NKZB 2UZYA 3QUXB 5D7IE 4D9RE 1QATA 4PGDA 2I07A 4UYPA 2QM8A 1ES0B 1ET7A 1RPQA 2EDNA 3PPEA 5CAYB 1YAIA 4U33A 1AGDB 5AAWC 1FRGL 4JRXD 1CZ8L 3GSWA 4FXKC 4D0CB 4GG6B 1RHHB 5F44A 4RLDA 1GU4A 1GW4A 3VWJA 4CDGC 2FX9L 1PDKA 4HUUA 3W2DH 4M7JH 3WUUA 1YO4A 1CFVH 4JN1H 2Y36H 4QHNB 4Y5XB 2K88A 4HPOL 3V0GA 1AOHA 3G3LA 1I9JH 3GMOB 3SY6A 5GS1B 1MWAL 4WVRA 3F58L 3H1LG 1K72A 3MRPB 4DK6A 4KJQC 2EEBA 1E4HA 3UTQA 5J12C 3T0DA 1YJWP 2CBTA 4WFHD 2X4SA 2HTLC 3ULAB 1Q8MA 1MCOL 2H1LM 2HFEA 3TVMB 4ODUA 4N1HB 3P11H 4GQ9H 4V33A 3DJ9A 3RWDB 4GH7B 3ARRA 1CFSA 3TESA 2X1WL 5LLIC 2YR3A 3S8FB 4HCIA 3EHBD 3QSKB 3X3GH 4JZJC 3L71D 2B1HL 3DTXB 4L9LA 5IVXB 4LCIL 1R3IH 3X1FA 4Y4KB 2QVFB 4IGBC 5D7EA 3FBQA 3IXTB 3K2IA 2Y1AA 3FWLA 3DX7A 2FWLB 5MENB 1A7RL 1KELH 5ESQA 1KYOE 1NGYB 1I1AC 3JTSB 1O5DT 2GTZB 3DSFL 3RX9A 5HYSA 2RB8A 2HFFA 2AXTE 5EBWA 3HNVH 3HNTL 4UM9D 3AM8A 2GUOA 4GMSL 4W81A 5E6IA 3BGAA 4JFEA 5T1LD 2XKMA 3WDIA 3U83A 2P43B 2IC2A 1KBVA 1NTKJ 1QBML 4KTDH 3VH8B 5TDPA 3SDCB 4KOBA 4LRNL 5BCAA 4H5SA 3SWKA 3H42L 1ZPUA 3QUYB 5T3ZD 4BFOA 1FORH 4W7YA 5DO2D 1TENA 4M7KL 3WG7B 3CFNA 3ZKMC 4PD4E 2IBBA 3GI8H 4Z0BL 1E65A 1F6LL 3ULSB 3PLYA 3SPIA 4KXZH 4ZMOA 3GSVB 4G8GE 1DVTA 5JOPD 4AH2B 5JMRA 2HTKD 4CC4A 3ISWA 4M62H 4PJ7E 4HIQA 1EFXB 1LGVA 1PW3A 1IZKA 5KEZA 5DRWB 4XCNA 2MJWA 4NJ9L 5DJZB 4KQ4L 4ISVB 1EAPA 3FRUA 4JN2A 2B89A 1HINH 3W81A 3LHAA 1PGRB 3PU7A 4P3CH 5KVEH 5APQA 1DZ0A 3FZUC 3H9YA 4R97C 4DERA 3QORC 1PX8A 1PU0A 1ZEAL 4MX7B 4XT1C 5D5MB 2ESVE 3NABL 4CVUA 4WO4D 4N0FB 5KZCB 4G72B 4PRDA 4D6TG 1SDDA 2V2TA 3O8XD 4CAGA 5C0JA 4PTTA 1CDGA 5J6HB 1JYVA 3ZQWA 5E5MA 1RE4A 4W9IC 1YN6B 3M1OA 4YBQD 4OW6A 4WWIA 1QUNA 5LO7A 4R96B 3LH9A 1OZTG 1E40A 4G6FB 2FFDA 4GDOA 5KAIE 3HAEH 3MVSA 4GSQA 2A45H 2QJDA 5IWLA 1P84H 2ICCA 5HHXH 4UIMA 3C6LA 4OJCA 4Q4EA 4UT9L 3UEQA 5AOMA 3GBNH 5LUMA 2OSWA 5C2UB 1BX2B 3WFZA 1W8OA 2VCOA 2XU6A 1U58A 5D96C 3QWOA 5ANMB 1IM9B 4JDEA 3TL5A 2HLAA 1G94A 1RY7B 3UTSD 4OQ1A 3VTAA 3IT8D 3X13A 2ITCB 4ZMYA 5CR1A 3IDMB 1I3GH 3VFMB 4UB6E 2RACA 3QUKA 5DJYB 3A5TA 3UYPA 4PVMA 4P4RB 2PKDA 5G2NA 1GRWA 5C1MB 3OAZK 4RFOH 1CK0H 1DQDH 2YA1A 3F00A 3UJJL 2YFNA 5BRZB 3ZDZF 4WW2A 1J86A 1VA9A 2EVFA 2GEEA 5GGVY 3SKNA 4J6RH 2R2HB 4YC2B 3WS6A 3OAWA 4MKTA 4WTQA 3O8XA 1ZGLA 1RZIA 3L9RB 2JSFA 3IKCB 3MLYH 5D93B 1LLAA 1OQOA 1M9WA 5FW7A 3VRLF 3TBYA 1RF0C 1B88A 5C3IA 2ZSWA 1CLYH 4X6BA 3H42H 3PWPB 1RSYA 2I24N 4E9LA 4YBLB 2CKBL 3EGSB 4QY8A 3MCG1 1EHNA 1TZIB 4IRZA 3IAOA 2Z8VC 2CR0A 3CX5K 3GSRA 3QQ4A 1P9MA 4TSAH 3LY6A 4WWKC 5IQMA 3C1LA 3I9PA 3MDJA 2Q3IA 2CCLA 4AQRD 3RQ3A 3IJSB 2CPBA 5IJDC 2OMZB 4HZAA 4U49A 4PTUA 1O9WA 2VGLM 2IANE 5FYLD 3ZY7A 4N8VG 4D8PA 1JGUH 1ZV5A 1Q9WA 2VM3A 2AQPA 3HNTH 5E1IA 5TE6H 4NWTL 4WEMB 5SWZE 4PJBA 4LLWA 4NO3B 3T1FB 3QIBB 4PJBF 3HG1D 1A6AB 3BN9C 4L1TA 1K9MQ 2PETA 1FAIH 1JMZA 2LFEA 1KCSH 2OMWA 3BZDA 3K74B 1J9QA 4AL8H 4S0HA 2HXAA 5M95B 2Y07L 3BZ5A 1OT2A 3CSYB 1HHIA 4K5MA 1I7UB 1YJDC 3BPNC 3QNXB 4MJ5B 5K69A 3KL3A 2M3BA 2FO1A 5E24E 3AREB 4AMKL 1N68A 3H9SB 3L5JA 4GI9A 2ZP9A 4QRPA 2ERJB 4IBVA 1V10A 3RGHA 4FG6D 3LSOB 4MDRA 2NY3B 4CW1B 1YZZA 3SKMA 3ZTDC 2VDOB 4OH2A 1RZFH 2Y7QA 3PXHA 4KRPD 1NTZG 2Q9OA 3HZMA 2MNUA 1JPSH 2D4DA 2JKWA 3QFJB 3EH1A 4R7NB 4X9IA 5B7MA 5E8NB 1VQOP 1SQVE 1TSRA 2BCKB 5JQHC 5CILL 5JIHA 4POUB 3WN5B 4Z3TA 2YXVA 4P46D 4BQ6A 3TN0A 4XMLH 3GSOA 4I88A 4OU3A 2OMVB 1KCUL 4RMUA 1T03L 5GSRA 5B38B 4HISA 5E8OA 1F4HA 4Z7UF 2WVVA 4X6CA 2XTSA 1ZLUH 5DRNB 3RL0D 3BT2L 3V6OE 3RTQC 5BNXD 1CCZA 4PJ7A 3ZUNC 2AAVA 3GB7B 2CPUA 4DIXA 3CVIH 3P2TA 1SQXJ 1U41A 2ZQKA 5APSA 4XNMA 3BIAX 1A7NL 2MPAH 4JR9L 3K2UH 4DZOA 2QTEA 3FT4B 1X5MA 1M71B 2WPRA 1NKGA 5BXFB 2QBWA 4I2XA 4OQTL 4W9LC 2WWKO 1BWWA 4WGWB 5E9AA 4KXCA 3KWXA 1MG2C 4LEOB 4R90L 3SE6A 3SBPA 2Z31C 3BN3B 1CGXA 3V4LA 3L5XL 5F9JB 4WTZA 5I6NA 1CYWA 1YECL 2O6CA 5E9DA 1WHOA 5KSUB 3QCTH 1FZGA 3R7QA 1HBWA 4F37F 4Q6IB 3V0WL 2X4QB 5JDSB 1L7TH 3CU1A 4YX2H 4GKOA 3QIBC 4R8WL 1N3NA 5IHUL 2ZX9A 4GLRI 2GY7B 5CHNB 5IW1A 2IZ1A 5KSAD 3MC0A 1HIMH 4OZGF 4PGCA 3F01A 3HE4A 1UM6H 3US1A 4BK4A 4X5LA 1J8RA 2EEFA 3WSQH 4MA1B 3H4FA 3MLZL 1A8ZA 3CQPA 1OD7A 5TE7L 4XO9A 5E4OA 5BZWB 2BVPB 3SHSA 1Z32X 2B3RA 3MLZH 3TH4T 1GVIA 1OW7A 1AP2B 3IDYC 4GJTB 4AYEC 4HBQA 1BZOA 5LGJA 2J1ZA 3NYKA 1FE6A 3DETC 4YDKL 1BQ5A 4C4BA 3VQ2C 4G8GD 3VGDA 3VE0B 4QXGH 2G75A 1WBXA 4A6YA 3LHPL 1IGJA 2ADIA 3D34A 3F04A 3KPNA 2N59A 4YFLI 2EUXA 1FL6B 4GRLC 4NBYB 5DGRA 4FI6A 2FR4A 4G43B 3OKMA 1OAJA 2JXMB 4XXCA 3SDAC 4JVPA 3QJHA 1CD9B 3RKDD 3S48A 3JV6A 3BT0A 1ED3A 3RPIA 2YIUB 1RIHL 5HHMB 2DEWX 4D0DB 1D9KD 2VDQH 3RWCA 4U3FG 5FKAA 3RX8A 3QPXL 1FGVH 4XPBL 1IKNA 2X40A 1N0XH 3E3QE 3OR6A 4M6NL 4R2GB 4BFFA 1VZGA 1V7NH 1NCUA 1NQBA 5CCHA 3VMNA 4A1RA 2WBKA 4ZXBD 1JDCA 5K9QG 4TVPD 3EOAA 1PY0A 4BZYA 2V37A 4FLOA 4IU3B 3BASA 4RH4A 3WY2A 5I6LA 5GRXG 2BJMH 2XNAA 4Z3FA 5DRXA 3V10A 4UTAH 2IANA 4FLRA 4H13C 3UCQA 1HWHB 5TJHA 4ZMPA 1VEMA 3MNVB 4NNYA 1MCLA 1CI5A 2WBJD 3VCLB 3LKPA 2ODHA 4HSAC 4XNZB 2V9QA 5K9OA 3OJ2C 3ZE1F 2VN3A 2JB5H 2QQNH 2ZAGA 4HWNA 4DEWA 4K15A 1XF2A 1F11A 4ODSL 5AG9A 2UUDK 3BCCJ 2VXVL 2QQKL 2XZCL 3LRLA 3SDYL 5KYWA 3MGNA 4M56A 4KY2A 1SHXA 2CUHA 4HWEH 4LSTH 4M1DH 3L35A 2GBAA 3H1KG 3S7GA 1J1PL 3LIUA 4K07A 3VRJB 3F12A 2GSGB 2IFGA 2VN4A 4TNGA 4Y4FC 5D5ME 5D71H 4ZXBB 5E0QA 2B4CC 4XOCA 3I6SA 2WXOA 5SWSA 4QRPE 3BIKA 4FNPA 2COVD 1FYTD 1QTYT 2ADFL 3MYJB 3B5GA 3GEFA 2XXCB 1UWGH 3MXVH 2WTRA 4F9PA 2H8PB 3ZPDA 2UZXB 1HC1A 1Z2KA 2F7OA 4N6RA 5GGUB 5I5MA 4QHMA 1NGPH 4HGWA 3IJYA 4AMKH 2IZ0A 4GG6E 3RVXD 3SPCA 1J0KA 2XPGB 3BQUA 4MD4A 1PAMA 3CHQA 3C12A 3CSTA 1UVQB 5E00A 3VWKD 1WCBB 4YHLL 2P67A 3ZSSA 2ZWZA 3R06B 32C2A 1EHAA 3RNQA 3WEMA 3TZVB 4LO9A 5JXEA 2P8MA 3PL6D 1DQVA 1AGCB 1JUFB 4PJCE 3P73B 5I15L 2R29L 3LV3A 1A1NB 4FKEA 1XTLA 5GTHH 2ZWKA 1CGWA 1JN6A 4FFVD 4X80H 2PR4L 3L4ZA 2QLYA 3RA7H 4XC3H 4WCYH 2TAAA 3VFUA 3FQ4A 2LFGA 3CHPA 2OTLP 4X80L 1LTXA 1NLDH 5DMKB 3NK3A 3RGVA 3QPKA 3U7YH 4YSEA 3EYOB 4M6MH 1AY1H 3DI3B 1TVBA 5CHXA 5HDRA 1KACB 4QXTA 4NNPL 3I9AA 1T7YA 2QQLH 1I8KA 2V2XA 4X8XA 3LKOB 2BP0A 1GGCH 1CI3M 4S2SA 2WB7A 1AXTH 2H0PA 1YQVH 1N7LA 4NXKA 1WWCA 3C60A 3RWEA 3O6FC 4MAYD 4EI6B 1R3HA 2YZ8A 4Y1AD 3CX5D 2NY5L 1G1JA 5CJ0A 4OLYL 3RAJH 2WOBA 3H9HA 5EBLB 3QDGB 3EAKA 3LNEA 1WFTA 2NOYA 2WCPA 1GCYA 1NANI 2IPKA 2RBLA 2WQSA 4GFXA 1OALA 3FJTA 3TEWA 1I53A 5KYYB 3Q8FA 1ET8A 3HMXH 1VERA 2F5BH 2Y7NA 3K2KA 1IGIL 4PJEF 4NX0A 5K93A 3S9DB 1IGFH 2QELA 1MUUA 1EXGA 4ZX6A 3PRJA 1EAJA 3RIKA 1XTCC 1MHHA 2W9EL 2AJZA 3HI1B 3TBCA 2X6CA 4XCYA 5AOLA 3BKML 2A4ZA 4UQIM 3NJNA 1AKJB 3FQWA 3TA3A 4Z7QE 2DBLL 2R0WH 5C0BE 2XN9B 2WMMA 5IROA 2R1YB 3GXFA 3OA7A 5TPWH 4CL7A 1H3TA 4DWHA 2NPSA 3O2WL 4YBHA 5FYJH 2KLSA 3P4OB 3RA7L 1YEWA 4PM1A 4XPHH 1H8LA 3NEOA 5C70A 4EKJA 1S3JA 2DQCH 3QHFL 5CLWA 1B6DA 3I6GA 5GRJL 5DEFB 4DZBA 1FHNA 1OSPH 4DKFH 5I8CA 2BIIA 4G8EA 2OYHA 5MI0C 3ZRSA 3C8DA 4NBXB 1L5GA 3COOA 3DXAB 3RKDC 4ZS7L 5PAZA 2GFBB 1HINL 5T1DL 3WMSA 4ICWA 4IK7A 5MEOA 3DARA 2KSEA 4IW4C 1TVDA 1YEFH 3FT2B 2GC7C 4U1NA 4DVBA 2YBRB 1K4CA 1NC2D 3L17A 3QPXH 3ULUF 1BA9A 3SZKC 2O30A 4I48A 3FTWA 5TH2B 4WHTA 4GSRA 1U8LB 5DFAA 3VFRB 1JZ4A 4ATTA 4RBPK 1YYLH 1JK9A 2B7DT 2BNQE 3EO0A 2VR8A 1WE5A 2YPLD 4Z0BH 3GI8L 4UV7L 1T4KB 5EU6A 1AQDA 4N2IA 1I8UA 4P99A 1QACA 4NQDA 3QHTC 5ANMA 4AUUA 2Q8BL 3MOQA 4XVJL 1XGPA 1MJUL 3CPWO 2YK1H 5F89A 2D0GA 4AYCA 3PH0A 3L1EA 2F74A 3OXRA 5J6GA 4YO0A 4UNUA 3KPPA 4H44D 2X3BA 1J1PH 3HC4H 4P4RA 3RLSA 1BCCE 5SX4H 4L0ZA 4ZUVA 1PY4A 1QWUA 4UT9A 5CGYD 1S7SB 3VI4E 5KLIC 1ES0A 3G4SP 2H9GA 5LB1A 1VFAB 3EJYC 1RE3C 1YEKH 1E28A 5EH1A 3CX5H 4NHCH 4N0YH 5CUSL 4OF6A 1R33A 3HA0A 3NMDA 1G43A 3C8KB 1N8RQ 2X28A 2WVRA 4F33A 2VC2B 3NCEB 3HAEB 2G4EA 1G0XA 1A7RH 3EO1A 4M9OA 4M7LT 3F7LA 1SQ2N 1GKOA 2K78A 5C6PB 1KC8Q 3TBYB 1GY2A 2GCYB 1UWEH 3GBMH 3VXOB 1EFXD 1MUJB 2ZE0A 3RBSA 5ITFA 4XB7A 3WLWC 2R56H 4G6AC 2C7UA 2VN5A 1WO2A 3C6EA 5HYSG 4EUPG 1MSPA 3CFIC 5D70H 1M1SA 2NY4B 2UY6A 4F2MA 2MPVA 4NRZA 3PWLB 3B71A 4Z7VF 4KKZA 3NACL 1OPOA 4AWJC 2UVFA 3HR6A 4GQ9L 4XCEB 3IETA 1OTUC 5C7ZA 3EZ8A 5D9SB 2L0DA 4JRYD 4BZ1L 2RHEA 4PWKA 3LZPA 1EPFA 1NCIA 2XN9E 1KB9J 2ZT9B 1MCHA 1PZ2A 2W6JH 5SWZB 2VJ8A 5JXAL 5E51A 2NR6D 1CLCA 3Q8BA 4BSVA 4CGTA 1KD1Q 5EA0L 4AIZA 3PHLA 1QNIA 2VIRB 1KBBA 4MJ4A 5EZPA 3AE5C 2Z91B 4LGSB 4M7JL 1XL6A 5E4EC 1ZVHA 2CGYA 3S3CB 2AKRA 2QMKA 4KPHL 4M7ZC 2JELL 4XHJC 4TLUA 1MFZA 1NMBL 1A22B 1MVUA 1WTLA 3H4HA 5IEHB 1OTUD 4YE0A 3GSQB 5I8EA 1CFTA 2J1KA 3G08B 2N0KA 4HPYL 5EU7C 2FEJA 3QDGD 3BCCE 2KT6A 5JA9A 3FN0L 2F5AH 5I1HH 4DEPC 1LE9A 1NCBL 2H32A 2XRAH 2IBZY 5D5MF 1I1AA 4HKJA 3BIBX 3TNNB 4QGYA 1S7WA 5E2UL 3EJPA 1ECZA 1J1EB 1YEJL 3NCYP 2VH5L 3P1VA 3O45A 5F9AC 3SGJC 4NJAH 1TZHB 1SYSB 5AAMA 3T6ZA 1ZE3H 3GXIA 3BCFA 2OP4L 1XB8A 2D7PA 1ZXGA 2O01N 1E5CA 1WIOA 2NZ2A 1M7IB 1I7ZA 3HR5A 3SD2A 4X9YA 5I75C 1ZV8A 1BIIA 2OR7A 4KUCF 4TVPH 4EUPA 2YGOA 1FDMA 3HI5L 5EBMB 2BWDA 1W2KT 4KGJA 3QEQB 5EBGA 4ZNCA 4C46A 1SEQL 1HYRC 1QRNE 2WTPA 1CD8A 2BP5M 2QM7A 2H2SD 2AQNA 1XGYL 1TFPA 1N9PA 2ENJA 4MFHA 1E6JL 2R7EA 1OXYA 4PSRA 3VDAA 1PPJE 3KDMB 4EE2A 2DJUA 2CRIA 4KK5C 5FYKU 2APSA 3MRQA 1NLBH 4ZUSA 1G84A 1HHGA 2FHBA 4PJ9D 4P5TA 5FF6A 3PWJB 5CEXA 4N9GA 5FKPB 3IJ9A 1RY3A 5DJ6B 4YFDB 3BAEH 4JG1H 4PGEB 5CBEB 1TTBA 3DDGA 1SQQD 4JDVA 4DFIA 4WUKL 2N01B 4AEIL 1V3JA 1S7QB 3APFA 5J7CC 2DQUH 4JF7A 2G3AA 4QTHB 4B3EA 4BHUI 1IKFL 5DTFA 4WO4A 4RAUB 1KN4H 1FG2A 2YOAA 2FFDC 5IOKA 2XKNA 3IGLA 4PRPA 2G75B 2B39A 4L9DA 4JM4H 5IB3B 5AW9B 1RJLA 3D0VA 3KYQA 3AU1B 4ILDA 4WUUB 5DQ9A 3PGCB 5C0CD 1DBJH 3FO0H 1FZAA 3PWUB 4NHCL 4LOUD 3LVEA 5BZDB 1CE1H 2FEDC 2WXIA 1VGEL 2CMRH 2YAEA 2XV0A 2VQ1A 2K9JB 1K6QH 4JQVA 4OQTA 3GS0A 2O1KA 3RJOA 3KPOA 1QW8A 4YFEA 5CD3B 1QBLH 1NUNB 5HHOB 3W9DB 4G8FB 4X83A 3V9FA 4OLWH 5IR1B 3FCUB 2FY8A 2BVTA 1MW1A 1IU1A 3OJMB 5IMOB 3WD5H 2BNRE 3M8OL 1C5BH 3V9CA 2ITAA 3AE1C 1ZA6A 3L72D 4MQXD 4QHLB 1H8AA 3ITKA 1BF5A 4JNXA 1WFNA 3H25A 1Z3RA 4R7DB 2QMJA 3QO1B 3QC5X 3OZLA 4N26A 1Z9PA 5CCJA 4KITB 3V4PA 1JNNH 1XZ0A 3EDEA 4PJHF 2Y06H 4Z5RA 4NZRL 4WKXA 2R59A 3U0TA 3FOMA 1ZK5A 4KDTC 2GTWA 3Q8AA 4YIQB 5DXWA 4YFLF 5FO2A 2XICA 5F3BB 4L23A 2QEXP 1BVOA 4NS0A 1YPZB 1UOLA 2CO6B 2NDGA 5K9OB 3ZXAC 5CEZH 3ME0B 3IBOA 1Z9SA 5IFJA 1ZD6A 4TLSA 1JJUA 2WVSA 1IFNA 5F21B 1P6WA 5I74C 4WWKA 3HS0C 2Y6SC 2G5BB 4LGPB 1E67A 1NCDH 1S7UB 1CMOA 3CVDA 1VQ5P 1O6TA 1N7SA 2AJVL 3FO2A 3MJ9H 4XPAL 5EPMA 5GZND 3WIHA 1WS8A 2AS5M 2J72A 4MXQD 4UIKL 3RU8H 1I1YB 4TTDD 3EGDB 1BYNA 2ZUQC 1ZDSA 3C87A 5D7KD 3PFQA 5IBUG 3ARTA 1T22B 3THML 4CN6A 4WB4A 1IFRA 2OI9C 4PUBL 1SF5A 4X6FB 4Y1AB 4ZD3L 4A7GA 5LDSA 2HYMA 1KBGL 2Z35A 4M02A 3PY9A 5C09E 2X10A 4L8DA 5I19H 3UTZB 3VDCA 3U48A 4OAWB 1B9ZA 2JKVA 2X0UA 3ZKQD 3VVVA 1PP9J 3MNWA 2WXPA 4NAMA 3FZUD 4NN5B 1ECYA 3CSFA 2V5SA 1BMZA 2CRZA 3ILQC 1TTRA 4JFHD 3GQFA 4BM7A 2EH8H 1CICB 4J28A 4HW6A 1MF2L 4M61A 1LDPH 1JVLA 4PRBA 1MV8A 3H7BB 1T5XB 1PPJD 3LXAA 3QWNA 4OCXH 2BNUA 3BLPX 5F6HJ 3EOBA 3TLRA 4UQ2A 2WO2B 4JDTL 4QCIB 2UYLA 5D2LA 3PJLA 3S98A 2DTMH 1KB5L 4P2QB 3VFUB 4JQ0D 1ZHNA 4KK6D 4WI4A 4GUCA 1NPNA 2AF2A 5C0AA 4QXUL 4AKPA 3FT4A 1BZDA 1WITA 4D0CA 2XZQH 4S1SH 4U3SA 3OPZL 4Y0GA 4L29A 4RGND 1TJXA 5DRZA 4JFSA 3ZU8A 3ATBA 2FO8A 3VB8A 4KNQA 1J8KA 1YQ3C 1O5PA 2VDRB 1DQJB 3QUMA 4QR7A 3D85A 3GBLA 4X98B 3I9GL 4NFBA 2R69A 1JSYA 1EJOH 2LKMA 3OZ9L 2XC8A 2BHYA 1FPTH 4L1LA 2E9IA 1MWAA 2XQYG 4RWHA 2E8ZA 4FFWD 4TNEA 5DA0B 2D2CC 3PLNA 5L2JA 1QLRB 4N0RA 3EG9B 4WU7A 2A45G 3HFMH 2O5ZH 1CIUA 3HUJB 3HJEA 3QYCA 3RL0C 2YMXL 4XXWA 1ZRTE 2C5DC 2FATL 3N85L 5L8RJ 2DQJL 4Z7QF 2VLRE 5CINL 3ULVH 1M1JB 2D4FA 4PRHD 4X6EA 5KJ7E 2JWDA 3RPBA 5LGJB 3D6ZA 2ITDB 3VXUB 4E9TA 3GJFK 4Y4KA 1GC1L 3MJ6A 4H20L 4A2MA 1F42A 2VMDA 1WLHA 2FEEI 2MOQA 3O9WC 3RDJA 4ETQB 2Z92B 1LMIA 7TAAA 4MD0B 2YA0A 5IB2B 3K91A 5JW4Q 3ABZA 3HRZA 4NRXA 4GI6A 3QUHA 4JFEE 1UGNA 5FYKE 2YQBA 3BFWA 3ZRFC 3BVVA 3WFBH 5E1HB 4E9YA 3HOGA 1EO5A 5FKAB 2AEPH 3DURA 5I1KH 4IIQC 5HYJA 5D1XE 1CGUA 2PW1B 3KWTA 3LEXB 4ONHB 4ZUTA 2BCKA 1H88A 1J7VR 5HDOA 2X44D 1N2DC 1LK3L 4HKBA 4GRWF 2FVNA 5C0ND 2J6EA 5E8OB 3HI6L 5IJKC 1OTSD 2WVVB 1GYVA 3CX5J 4HS8L 5H35A 1L4AB 1M2VA 3BCCD 4FAAB 5F9WB 4XO8A 4YXDC 3KPMB 1S46A 2R2BA 5AVQB 4WK2B 1KIPA 2V9UA 4O51B 4PJ7F 5BZZA 4E5XG 5EULV 2BXYA 4GW1A 3NJIA 1G9HA 3QH3A 4PW4A 3HMWH 1EHLL 5DJZA 5F7BA 4WTZG 3LS5H 1ZIBA 4RGMB 3S37L 3JWNC 4XPFH 4ZTEA 4I2XB 3U9WA 4ZXBA 4PV8A 4GOFA 5EOQH 2LU5A 3CU7A 5INDB 1F8TL 4UM8B 1BCCD 4M5ZH 1UWXH 3SDXB 2LU7A 2KC0A 4KHTH 2RQEA 4JFUA 5FUOL 2WTRB 5LWYH 5ECGA 5ILTL 4LXFA 3D6YA 2MQ0A 3AE6C 1FLRH 1KXQE 3L1FA 5IIEA 4LCUA 4M48H 1LNQA 1K8DB 2FBOJ 4PI2A 5D4JA 4GKSA 2NMSA 1TZGL 2M83A 3ZDMA 5KJ7C 2JV6A 3K6NA 2XPGA 1N3NB 3MLVH 1TXKA 1NAMA 3I74A 4I2LC 3NZHL 4LIQH 1INQB 4O4YH 2GAZB 2B16A 4ES9A 4KK8C 3BRTB 1KGIA 2XA8L 3RVUC 5GJSL 3K71A 3IJHB 1DJSA 1U3HC 2PXYB 5TFSH 2VMJA 2Z8WC 4IDJH 1NCWL 1C5DB 1RCYA 2Q86A 4K3DH 4XP9H 1OZUA 3GZKA 1A5FH 2O26U 3HE5A 4LEBA 2F53B 1QLFB 1OP4A 1AXSB 1HIML 1UXSB 4PVBA 1KYOD 1U3YA 3NJJA 2BCCJ 4XCEA 4AG4H 2FT6A 3E9TA 3AM8C 3GIVB 4I1LA 4YX2L 1AH1A 2CKBB 1M90Q 2E5TA 1B3IA 3D87B 3H53A 4KI5E 3ARWA 5FC9A 3GUFA 5A6LA 1IFHH 1RZJC 3U7AA 2FR4B 2DQDH 2A6DA 3BWUF 2XN2A 1X7QB 1BAGA 4G1EB 3FB6B 4NKIL 2ZCHL 1RQUA 5HHQA 4KJPD 4QXTB 3AE9C 1ZR4A 4OV5A 2BS9A 2CSPA 2OR8A 2ZKMX 4OD3H 4XMTA 2J88L 1PZUB 4R4BB 2ATPB 3DKHA 4HFUH 1Q2NA 25C8L 5FYJU 8FABA 4DP0X 2D73A 2ZUXA 1ZLEA 4Z95H 1WSST 2DKUA 1LP9E 1NAMH 1Q86Q 3BPCA 3DPDA 5LAXA 3S0PA 3SSGA 4J2QA 1U8OB 1QASA 3E8VA 5CCHE 4ZSOE 1J0YA 3X1NA 4JZJB 1LT9B 3GKWH 1NINA 5DQDL 2VDKL 4TQ8A 3AE4C 2WLMA 1YY8A 3S36H 5IHZB 1DIPA 1OVVA 3PJSK 4KI1A 2IANB 3P4LA 5DJ2B 1NTME 4H0LB 3KEHA 2FEEL 1SQXD 3LS4L 5HGGS 1E43A 1SQPD 1RK1A 1Q9WB 3O6FA 5AW5B 1UURA 4AH2A 3WLBB 2W6AA 3B3IA 1OCOB 4LLWB 2Y5QA 2VDOL 3HRPA 2IYOA 5DK2B 3MQIA 4HX1A 1MCCA 1CXKA 1IJ9A 5CILH 1NCOA 1OTTD 3G5ZA 4ODVH 1H6UA 1HOEA 1MFDL 3QG7H 4HV8B 4Q7DA 2ZUQB 1OCZB 4ZZKA 2A9CA 4LKXB 3MBXH 4NBZB 1GIGH 1CXHA 4APXA 4UBDD 1KFAL 1DQMH 3CCEP 4Z7WA 4KY1H 4ELKA 2K6WA 2QVKA 5CXPA 2BS8A 3L3IA 1TTFA 5DZAA 4FTVD 5DT1L 1SDDB 5TISH 2OTWA 3IJEA 3KYMB 3KPSA 4PVNA 4AYSA 1HH9B 4ZFOB 3F84A 3WMQA 4R4MA 1O6SA 3QVAA 5GGVL 2IBZD 5I0XA 4K2UH 1FNGA 4W9ZA 5K1VA 2H0EA 1G6RA 1NC4A 1CGYA 1CBJA 1ZVSB 2W1NA 4AC4A 3WTWA 3K6IA 1HHKB 2DQGL 4MRBA 3LZQA 3NRPA 2OA9A 4PJDB 2IBZX 2DQJH 1LTAC 4NO0D 1Z9MA 1OW0C 2OJZH 1URIA 1Q7YQ 2WB1A 5F3HB 4F5CA 1JNHA 2YOCA 4X6CE 3KZIH 3G6AA 3P0YH 1IFJA 4NWTH 1K4DA 3G9RA 1HL5A 3RIFF 3T8XA 5DC9B 3TGUJ 4JFDB 2K4WA 5E9DD 4FQIH 3D4YA 4WW2C 5ID0B 3BLKA 4N9GB 5FKPA 3F7PC 3GHBL 4L5FH 1PG7X 4QAWA 4PFEA 3P9MA 4QRUB 3DUSB 5FFLA 2FUQA 1R5LA 2CA3A 3CZNA 5CBNA 1B0IA 1ZS2A 3EBGA 3FTSA 5E23A 5BU8B 5CLTA 2EIJB 5E2TL 4UT6L 4F1SA 1RF0A 4J3OC 5F1IB 3DHMA 3APNA 3FT9A 4KUZH 3CXDH 5CEYA 4PYGA 3SKNB 2CJ3A 4QRRE 1MJ8L 5DJ0B 1XR8B 2P8LA 3NSDA 1BF8A 4F8QA 1AACA 3OPZH 4Z18A 4LEOA 3AU1A 4OD2B 4Y5XA 2E42A 3C60B 5FA4B 2X4PB 3LKNB 3KJ6L 4QHNA 4JB9H 4GINA 2ZF9A 4P0DA 5AW3B 2O01H 4NPFX 4UB8H 4PIRF 2F8XC 4MJ6A 3ALWA 4AW4A 3MRPA 5GRYA 2HJLA 3BUQA 2PPEA 2VOTA 4R4FH 5AKSA 2Z31D 4XP5H 5GGSB 2J6EL 3VOPA 3J07A 5ACZA 5CIPA 2DI8A 2ITFA 1RU9H 2F0CA 4A04A 1I9IH 4TS6A 2J8UB 5E7BA 2PR9A 1NGMB 4Y2DA 5CJ5A 3N43F 1TTCA 4ATWA 4U6VL 4NO3A 4U1JA 4DUXA 1JF1B 5IOPA 2FH8A 5JR1H 1XZ0B 4Z5RB 4QNPE 3DTXA 5H37G 2WQRA 3VN0A 1MH5B 3BGFB 3QCUL 1HCYA 4GFTB 4KMTL 4YC2C 5FX3A 2UY7B 4NYLA 4U3FE 2A9AA 4UQ3B 3IGUA 1SQBK 1I1CA 4ELDA 1AJYA 1T2KC 4JHAL 4OZHA 1AC6A 1VQ4P 4N0CD 1RUQH 3S5LA 1W80A 4QDGA 3PABB 3ULVD 3DTDA 1YDPB 5L88H 1QR1B 3CSGA 4NFDA 5AYTA 12E8L 2VAJA 1VQKP 1FNAA 1ED3B 5HY9A 4BCZA 1XCTB 2GUOB 3WUTA 4Q9RL 2OXHB 1WZMA 1MFCL 4GUPB 4YAQB 3AEDC 3V6BR 1U8IB 1ZEAH 1U2CA 4K3JL 2X1OA 2DMGA 4ANXA 3TC9A 1SXCA 2F1AA 4IJ3C 1VQNP 2WWNA 1PCSA 1QLED 1T83C 4NEHB 2IAMC 4KKBD 4X7SH 4XX1G 1NTMK 2GFBA 4X99B 1OEZW 2PWHA 2ZYHA 5L8KB 2EYRA 3QI9C 4H8WH 1QHQA 4LPUA 2NNRA 3ZDYB 4GPVA 4M62L 2HG5D 1U93B 4DP9X 5C0EA 3EYUH 4H88L 3VYIA 5F7UA 3L3HA 5TF1H 1KILD 2J20A 3MJ8B 5JO5B 5IB5A 2Y9RT 4UB0L 3LZFH 3Q9PA 4TUOB 3LIZL 2F68X 2HVBA 4HU8A 3WY3A 4KZCA 4RX4A 3HUSC 1W15A 3U2SB 4KFMA 3D2UA 4DKEH 5KYWB 5TQ0H 4XFJA 2BSTB 3H2QA 5DRWA 4EDWH 1KLFA 3D69B 4LRNH 2OTUB 3STBA 1T6AA 4TLKA 3AABA 2JJSA 2X4RB 2X4OA 1KCKA 2XHNA 5AB1A 3VFTB 4ABUA 4ZG1A 3IPBA 5CGTA 1YNTA 1UG9A 4XO3A 1QO3B 4LPYA 3QRLA 4IS6B 4JGJA 3QJVB 4N0UA 4AOFA 4C4KO 5J8OA 3BAKA 2VLJB 1E5UI 5AENA 5MHSE 5F6IC 1CDUA 1PEZA 5KS9E 5E8PA 4M5YL 2PP6A 1F1DA 3RY6C 1KIRB 3TEZA 2D2CB 5GRUH 5MP6H 2FYUE 5T5NG 1DFBH 5DJAA 4OCSH 1EJ8A 5FAAA 2ZXCA 3V0DA 3TBWB 4ZMWA 1MAJA 2GIXA 5AAMC 4JM4L 3QG6B 1DANT 3I3BA 5F9WC 4H8PA 3B9KB 4JY6A 4W9CC 4I7ZC 3HNSL 5E95B 2VXQH 4KAQH 4RGNE 1JZ5A 1HGVA 1JGDB 3NGBC 3BE1H 3H85A 3EHBC 3NFSH 1J9TA 1NWPA 2W80C 4Y9FA 2GITA 4IBSA 4Y99C 1BX2A 3HFFA 3ESMA 3BRDA 3UZEA 3QZPA 2P5EA 3C6SA 4JBSA 2F53E 3NT0A 3PP3K 5IHWA 1YJDL 3U7WL 5EORH 2KI7B 3PWLA 1I7RB 4A37A 4RMTA 2V7NA 1PP9D 3HG3A 1QPPA 5GS0D 1NCNA 1PNDA 2MQ3A 3WIAA 4URTB 1JTPA 5FGCE 2ATKB 1DQQB 3HUJE 2F54E 1RMFH 3OKMB 4APQA 4O2CA 1IMHC 2FWUA 4HSCX 2YKLH 5CCHC 1I9JL 1XH3B 5GGRA 3D18A 1OMIA 3ESNA 2NSXA 3JSVC 2ITDA 2X89A 5CEZD 5I9QC 5AOKA 1DBBH 2WNGA 3HE7C 2R23B 4M3HA 2YZ1A 4DUWA 4UINH 2KI6A 4JPKL 3D25B 4YSRA 5B66H 2YAOA 2Z92A 3KPQB 4LEEA 3IB4A 2XQYA 2EP6A 2L7QA 1FZOA 4U1SA 3IFOB 1SHSA 5EO1B 3EOAB 5LBSA 5DUBA 4AEFA 3DXAE 3GMMB 3O2VH 1TEGA 1IT9L 3C5XA 3H1KJ 5CKAA 5EOCL 1ZLDA 3HC3L 4FNRA 4N68A 1QX1A 4WO4C 1QOKA 2GT9A 2AQQA 1FVEB 1C5CH 5IMKA 5IW6A 3W57A 2N9YB 2FGZA 1S9YA 2VERA 4C7NB 1QG3A 2LLNA 1BXVA 3OR7A 4JANB 5CNHA 3SPGA 4IRSC 3V4PB 1LWUB 2XG4A 3OB0H 3GJFB 3S97C 4GMTL 1UM4L 4NZ8A 4U1IA 3FRUB 1GS8A 1QABA 4FNQA 5EN3A 3UJIH 4X5RA 5EO0A 3CC4P 3W38A 2QPEB 1KWGA 3QIUD 3ZTJH 3HBQA 4DVRL 4F7EB 3NA4A 4LRIC 3VD9A 4A2LA 4AQAB 2OQQA 1A4BA 1C12A 1MJJB 1T1ZA 3UEZA 4IRJB 4EN3C 2Y23A 5FYLH 1Q81Q 4AYMC 3CHXA 2ZX8A 1IJNA 1ZLVK 4CMMA 4FD0A 1RZPA 4HH9A 1VGKB 5KVGE 3ATAA 3MREA 2FB4L 3I5CA 4WWKB 5GHWL 5DYOB 2HWZH 1KBWA 4ZPTB 1DLHB 1CFQB 4D9LL 1G7IB 1YRKA 4ZFOL 4A68A 2I69A 1ZTMA 1H8OA 5T3ZE 3FFOA 1FH5H 2O1JA 3FMGL 4GG8B 4FN0A 3EFOA 3ROLB 1Y1UA 2DWXA 3OM3B 3TN0B 4BFJA 2K7QA 3K1KC 3FPYA 4XAWH 1BVLB 4TYUA 4Q9QH 3OLDA 4L1BA 4E41A 5EEWA 3HS0A 1TJIL 3V95A 3C5ZD 3F7RA 1HJ0A 4H2AA 5DJTB 3G6EP 2H26A 5JOFA 4QIRA 4GXVL 1A1NA 4DO4A 3NACH 1ZCRA 4KKAC 3GLEA 5CEZE 1YMMD 4E42A 4E9RA 2XWEA 4FFYL 1RK7A 4MA3B 5FM5O 3RFZA 3O6QA 1TQCB 4ONOA 1SHMA 3D2TA 4PV1D 3E1IA 5DMKA 1E0OB 3GBML 4HKZB 4BE6A 5I5IA 1T5XA 1FNSL 1VKXB 1QLFA 2VNCA 1FOSF 3P3TA 4BZ2H 5D96B 5E8EB 5B5EE 1N4XH 1M53A 3LZNA 3LXUX 2H7HA 1MIML 3PGCA 2DW5A 4ODTL 1R3LA 3DMMC 3HC0B 4QJ4B 3OKDA 1V7ML 4ODHL 3LN9A 2XZRA 4IOSA 2H3KA 1NCAL 3EJSA 3FFCD 3P9LA 5KSUA 3UC2A 1EERB 3L4YA 1IAIH 5DC0A 2C26A 5C0CB 2J8UE 4NLAA 1SQXG 2HLOA 3OX8A 4QNPF 4BELD 3IJSA 4OZGE 4YHYC 4B9GA 2ATPA 1CQKA 1AAJA 1X9VA 2WSFJ 5FFOA 4BXVA 1QFUH 1JZ3A 3FH7A 2NW2B 1HX0A 1PTZA 3RL0g 4Z7AA 1MCSA 4JPWH 1O7VA 1MHHB 5L2KA 4MWFB 3RX7A 2Y2WA 5I8OH 4O2EA 4XCYB 4XZ4A 3UP1A 4GAGL 1O7DC 3WLWD 2EUZA 4P46C 4QD2E 5DO8A 3I75B 2KLVA 3X12A 5HDLA 4FQXC 4PJ8A 2E76C 5I0WA 5LKNA 1NOHA 4J3SA 4WV1C 2I9TB 2R83A 2DH3A 2WLNA 2XQ0A 2A83A 1T66D 2YPLA 1DDHA 3SJVD 3VMXA 3HBPA 1X8YA 2ESVD 3VMZA 2CRMA 3FQXB 2ZFCA 5I1JL 2NX5E 4R84A 5DEZA 4N24A 4UQBA 2ICES 1RULH 1LWRA 4OCRH 4XNUH 1KENH 2HH0H 1NTZK 3MLSH 4WKZA 2OL3A 2BY0A 2QG4A 3B1TA 1I82A 3RPKA 3ZZSA 4HB1A 1C8QA 2IPTL 3FDWA 3PJNA 4K9EH 3VXRE 3LX9A 3D48R 4GXUN 4Q74A 3QDGE 2J1WA 1XVSA 2BIQA 5FW6A 2IFFL 4L9LC 5FUCE 2NT1A 1CFTB 3DSNB 4HGMA 4HS3B 2IBZG 4BCXA 5I75B 5SX5H 5CJOH 1GL2D 2VSDA 1UZ6F 4QTFA 2ARJB 3OKKB 5CFHA 1ZK9A 4W1TA 1G1IA 3O9WB 4XWOC 4DOJA 2VC2H 3VXME 5J13C 4GSUA 4Y4KC 1VACA 1XF3A 2X4NA 4XN4A 2WT7A 4ODWB 1SLUA 4LASL 1D5ZB 3Q05A 1N86A 1J88A 2OS7A 4ZS6C 3QIWA 2D31A 2OZ4H 4FNLL 2P5ED 3GS4A 3VCLA 2OYKA 1I1AB 3BKCH 4D7BA 4DGYL 3O2VL 1W72A 1BQLH 3ULVE 4CNIA 1EFXA 3RB7A 3ZK0A 1N7ML 2QVTA 2YXWA 1IKOP 4OJYA 4OJDH 3G5YB 2MQGA 1Y1DA 2QFPA 5JW4N 5ETUB 1HH0A 1UB6B 2W6BA 4YLBA 2CGRH 1D5IH 2BNUB 1MCDA 1NIAA 2HSIA 3DK0A 3T9WA 1E9PA 3QUYC 2W0PA 4PB0H 4KO7A 1GL2B 2XVBA 1I7ZB 3F7VB 3MYJA 5B1CA 4NKDB 3RP1A 2Q6WB 2HRPH 1TQUA 1XWVA 2CQVA 3M91A 4KZEH 2B77A 3EYFA 2IH1B 5D2LE 1G7QB 1G6RH 1UCTA 4JRFA 1QLEH 4LB8A 4NZDA 1E28B 1YNTF 3B4SA 1NFDE 2WD0A 2H3NB 4QRAA 4LIQE 4LPXA 3SGDH 4I18B 2Q76A 2YLHA 3Q43A 4JQIA 4KVPA 3N4XA 2IAAC 2EH7H 1H3XA 1YEHL 2XIIA 3EO1B 3TWYA 1EO7A 4FHBD 4YHML 4NQED 3JV5A 3O11B 1A1MB 2GQHA 1G7PB 1WP6A 2XBTA 3KPRE 2ZKWA 1RZKC 1NCCL 2VQ4A 3L75J 3BEVB 3BP5A 2IDQA 3PGFH 4N2MA 4OLZH 3IS0X 2HPCA 5TDOB 1BVKA 3T3PE 1PZ3A 3IDJA 1SYVA 2PWGA 3D07A 3FYIB 5T5FH 3SBRA 1YTZI 4JQXA 2W9DL 2H89C 3NJGA 2PTTA 1NICA 3CLFL 5AYUL 4W6YB 2FYNC 6FABH 4NHUA 1KB9I 4OFKA 3RWGB 3G04B 5DJYA 1W6LA 3MLWH 1JWUA 3TP4A 3UYPB 2IO5A 2CD0A 1KGXA 5D9SA 1L0NE 3UROR 3CK0L 2WQ8A 5J5EA 3K71B 4YDNA 1AFOA 3DRTA 2BERA 4DGVH 1YPZE 5D6CA 3TT1L 3ULUD 1P2CA 3HE5B 3KGTA 3M1BB 2LLGA 1MLCA 2MTPA 3II1A 1MRFH 2IPUG 5KAQF 1J48A 3TSIA 3OMAB 4RA3A 2QGEA 5KJ7A 4UQ3A 2NDFA 2WAQA 5MEND 1KN2L 3TYGH 2DMCA 3MXWH 4NC1C 3OR6B 4X4MA 3V2RA 2R0ZL 5E2WH 2WKOF 3H9ZA 3TXAA 4D9RD 3ZDYF 3ZDZB 3PABA 2A4CA 3HRZB 3KLKA 3KMDA 1VESA 2CNZA 2VKWA 3FQYA 2C4XA 1AHMA 3NTCH 2BINA 1M6OA 3I2CL 3RL1A 3LZFL 4D9QE 4OWFA 5ABAA 4ALAL 4HXAL 3O3DA 2NY7H 3CX2A 3T4AC 3B43A 4WI0A 3GPSA 1W0VB 2BVYA 4Y89A 1ZDQA 1INEH 4RSYA 1TYEB 2E7CA 3LQZA 3D1MC 4G6KH 4P9HH 5ICXB 4IKLA 5D1XA 3UOAB 4DZ8A 4AGPA 2P5WD 2WVTA 3N42F 2JB5L 2QQNL 2WHVA 3NCFB 1BGXL 1TJMA 3I85A 2VE6A 1J2JB 3AXHA 3L72J 2NY1C 1P4LA 3CVCA 4FQJH 2X5PA 3VP8A 3S5LG 5F3BA 3BSZH 1AKJA 3FQWB 3L75E 2XVLA 5FOBA 4OGAC 4PYHA 3U1SL 4EI2A 3ATDA 5KLVG 2YPLE 5L7XH 5E79H 2YMKA 1OV8A 4EEEA 2R4SH 3VWJC 3KXFB 4CMHB 3BOVA 3QULB 4HP5A 4HCRA 1P9MC 1PIFA 1I9EA 4DW2H 3ZGHA 1WTGT 1RUQL 2Y5TA 1E9OA 3SODB 3AGVA 3AADB 4P5MB 5AKVA 4UB8E 3MGOA 2Y7QB 3J7HA 3EKCA 3HG0A 4Y99B 1SDAB 3KCPB 5EZLA 1T66C 2A6KB 3E7JA 3I02A 5A3IC 2AXHA 1K85A 5BVPL 1JHKH 1TQVA 5PCYA 2BSBA 4OBRA 2XKSA 4ABWA 1SMAA 1A6ZA 3DLQR 1VADA 3UTTE 2XWCA 1G7MA 4UTBA 4P5TC 2DYPD 2VN7A 4Q6YA 5ID1B 2K8QA 2PXYD 1UZ8B 2GABA 3USSA 1L0LE 1FNEB 2B0SH 1M56B 2W38A 3TBWA 3UBXG 3TCXA 3TF4A 1XGRB 1AMYA 1QMUA 1JOCA 2R15A 1RZJL 3MRHA 5D6DC 4CPGA 1NEUA 2CJUL 1L7IL 3V2AR 1PMYA 3S4SB 4H8UA 1JK9B 3IRCA 2WCGA 1FBIL 1G9NH 4Y7OC 3QS3A 4LVEA 1MFEH 2YARA 5B8CA 3G6AB 4XGZA 2NR6A 1D6VH 2FSDA 3CHRA 2O4EA 5KVFL 3F7KA 4M61B 1MY5A 1BBJA 2BC4B 1P69B 3FO9B 1KIQA 2NYKA 4JO4L 4KNUA 2EEXA 4NQVA 3LZOA 3DPBA 4JY4B 2XTJD 2J7LA 4P4KC 4WI5A 4WO4B 4OJFL 2YMTA 5ANHA 3LIZA 3HE6C 4GY4A 3FTGB 4I3RH 4TSCH 5D7IB 1N2RA 1G2CB 1B4JH 4YDIL 3FK3A 2ZOUA 1S78D 2YGNA 4K0OA 4S0TD 4ZUVB 4KK8D 4IRZL 3CMGA 2Q7NA 1AQ5A 1F4WL 3ARDC 4V11A 1MHCA 2OX5B 5ENWB 2BEQD 4ANVA 1X7QA 2HG5B 1OAQH 1X7SA 2DBJA 4IRSB 2VQ1B 5DEJA 3MODH 1GOFA 2H2SC 2AGJH 4AVKA 3CZGA 3V4VH 1UTDA 1VF5C 1XR8A 3HAEA 1JZGA 4G8FA 3DRQB 5EF0A 2C9NY 5CCGE 15C8L 3JWNE 4I87A 2PO6A 4NQUA 4EI5C 2HJFB 3M0DC 3WMM0 2EECA 4HHWA 5EFIB 4JHBA 2M2DA 1QVOB 1FL5A 3KL5A 1ZLSL 2EDDA 3T65B 1M8OB 2CUAA 3FUJA 3PCYA 4PJFE 5MEQA 2HN7A 4RKUJ 3QUML 3H7LA 4CADA 2O5XH 1JY2N 3DGCR 3CCQP 1FLTX 4KXZI 1GYAA 4QRQA 1HDMB 3T6WA 2JWAA 3MKKA 3IFLL 1NTKD 1O75A 35C8L 3BCDA 3O4LA 4NC0B 4P48A 1LQBC 1YPZA 3POCA 4P2RD 3RWFA 1F90H 4U4IA 1EO8L 5TDNA 5C7XL 1G7LB 4GRMB 5D7JA 3SKJL 3V6ZB 3FTZA 1EZVI 4RZCB 4EBQH 3LCYA 3PHQB 3SE8H 4WUUD 4AXWB 3ZHFA 1NMAH 4NPJA 4OCYH 5C0DA 4ZZFA 2PCPB 3B9KD 5E99L 1RE4C 1VQMP 2DW3A 3K81A 4M6OH 2VLRD 2WMPA 3VXRD 3B6SA 1JEKA 1DD3A 4L1DA 1TOXA 3UERA 5EPMB 2XQBL 4LSVH 4OZHB 1PGJA 3MLRH 4K7PX 2BCCG 4C7RA 1UD6A 3HG4A 4Y2DC 4NUJA 3AITA 4JFFA 2IQAA 1JGLH 2QGDA 2OTWB 4KQ3H 4UV4H 4LLQA 4NO0B 3UBHA 4F20A 4F57L 1F90L 5A16A 1AGBB 2ZWLT 5GSVB 2CAKA 5H37A 4I0CC 3TT3H 5KVEE 2YBRA 3MCYA 2JDIH 3FFDA 1DLHA 1BFVL 3MROA 3SOBH 2Y0DA 5IROC 4LCVA 3P54A 3U46B 5JZ7D 1PZAA 2DWDB 1TETH 1M4KA 3IU4L 2X4TA 1JDDA 5C6TH 4P4KB 5E6YA 4Y16C 4UNVA 5ICZA 3P77B 1A3ZA 4Z76B 3EH3B 1JGVL 5B1BB 1PFOA 3PWPD 4KZ0A 5J3HC 4H44C 4OLXH 1AZZC 4X5XA 5E2VL 3M86A 3MZWB 4YHPA 2E9JA 1PEWA 3WIHL 3FCSA 3H9SD 3DX6B 7PAZA 3PFUA 3QEHA 2O5YH 4I7ZB 1NUGA 4PJ5B 3SYCA 4JY5L 4IU2B 1NO4A 2MCPH 3WS6C 2FT8A 5D2LB 3CDFA 2E75C 1FO0A 2DH2A 2IAMA 2OSXA 2VR5A 5DD3H 5JZ7C 1BFTA 2OJEB 1SQVG 1FZKB 4NN6B 4NZTH 1GAFL 5A2JH 5HGHA 5EMYA 3HHRB 2ESVB 2J3SA 4L4TA 3LQAH 4FCAA 4DN4L 4FQPA 4UOZA 1HE8A 1DLFL 3FS9A 4P46B 3RWIB 3SKOA 3MLUH 4MNGB 2FK9A 1U8KA 4P5KB 3GRWL 4QRRA 1GW3A 1VL2A 1MCQA 5HGDA 2ZNXA 4GS7B 1DL7L 2BHFA 3CFJA 4KO6A 3K5BA 4GNKB 4YDMA 4KI5C 2ZP0T 4HQQL 1YYML 1UXWB 2AK4D 3CLEH 4YHOL 4NKMB 5ITFB 3STZB 2YQ3A 4TL4A 5K33A 4FHJA 2PWEA 1RJZA 3S3SA 2P8MB 2E47A 1S6NA 2N7AA 4JY6B 2VZOA 4DGIH 5CWSB 5CN2A 5CZVL 3VVWA 4RQQB 4KXDA 4MQTB 2XY1A 3QXDB 1PD1A 4PJIB 1E5ZA 3JTTA 2RQ8A 1FU1A 2N9BA 4C83A 2BWQA 3L74J 3DGGA 1FGNL 3JV4B 4W9KC 3FSAA 2IALB 4PRNB 3O41B 1T04A 3GBNL 4RESB 2MCG1 3ZE0B 43CAB 3F7YB 1AE6L 3QNFA 4XMXA 2F2HA 4LPVA 2AJSH 3CQQA 1JZHA 3L54A 2QJPC 1YMHB 3S96B 4XBEL 5BS0E 4Y4HA 2NY0C 5IESH 1BZ7B 3D85D 3WKML 2VO8A 4OVVA 5FCSH 3WUVA 1YHQP 1N0LB 3C09C 5DZPA 5B1AB 3RHWK 2CKBA 2NNCA 3ARBA 4HUCA 5BRZE 2WSEJ 1XXFC 1WAAE 1CFMA 5B21A 5CM1A 4XBMA 4L8CB 3SB3A 3UZEC 4APQB 2OLDA 2AEWA 1PGQA 1IARB 4MB3A 4C56A 4HF5L 5D1QE 1HK6A 1UM5L 1IC4L 2R23A 2IPKB 3PUUA 1TJHL 1L9MA 4QKTA 1MZZA 1VAHA 1ZS8A 2BZCA 2NXZC 2Y69B 3CBKB 4JPQA 2VSCA 1UWYA 4KQ4H 3QCVL 1JRHL 3VD7A 3HLAA 1ZSDA 5EO1A 4X99A 4YSUA 2WK2A 1FHGA 1ZLWH 4WDIA 3WXWL 5TD4A 5LNDA 3UG5A 2O1AA 4ZFQA 1P0SE 2QZ5A 4FQLH 1T2XA 1F2XK 2YS4A 4YSOA 1SFDA 3C60C 2XWXA 5H35B 5JW4R 4CVZA 3GXDA 3CJJA 1WFUA 3FTYA 5EN2A 3PYCA 1T89A 1EC5A 2FX7L 4LPWA 3U2SA 3ECUA 5F7DB 1QKZL 4OLUH 4I77L 4GKZB 3IR9A 5J1TC 1MZ9A 5DURB 1OF0A 4JUTA 4YHIA 2K0RA 1JERA 4U1LB 5DVOA 4WY4A 4PVLA 4OFYA 4PQXA 4I13B 3IU3B 4PG2C 5E4AA 1LK2B 4ZUUB 4ZKPA 3HCVA 1XD1A 4N87A 1SBBA 1N5AB 5KLVD 1ETJA 1SQQE 3RDTC 4NZUL 4YXKH 3BYYA 1DQTA 2O93L 1GGUA 1QFWH 3WUWG 2H8PD 3O2DL 3OJVC 5IFAL 3FNKA 3OPUA 2YMXH 3Q3GB 3SE3A 4LDLB 4AYBA 2JF1A 2XXFA 4RDBA 2W27A 1WH0A 2NQ3A 4X6DB 3FT2A 5DJAB 1PZ5B 1UACL 2RA1A 2R9HC 4MJHA 2ZX5A 2Z6FA 5JIIA 2WXJA 3PP5A 3HZYB 4LL1A 4LOUC 4IBQA 1L9RA 1YNKL 3HE7B 4OT1H 2R39A 5IBTH 3CFDA 1HCVA 1B3JA 1NTMJ 1M6UA 2EYSB 2A9ML 2ZCLL 3KPRB 1JVKA 4NQDB 1BVKB 1OZHA 1E8WA 3T09A 1KUMA 4B97A 1XGPB 3HG1E 1E79H 1GA2A 2N0MA 3GF7A 3BFQG 4N28A 2F53A 4NHUB 1N18A 3KPEA 4XN9A 2LW3A 4QUOA 5ID0A 1JWUB 3ZW3A 4ZFGH 1TTGA 4FP8H 3S37X 1L4IA 2IMNA 3P9MB 1LE5A 4EOTA 3DWTA 5EU5A 4JFYA 5K1JA 1QR4A 2V17H 3HZKA 3MBWB 4DFHA 4U4BA 3QCVH 2FYUD 1CD1B 1AZBA 2ZCLH 1JY2P 3B9EA 3D18B 3QAQA 1WV7T 5E94B 3CXHD 4BWWA 4X7CC 1KLUB 5HHOA 1PD6A 4PCKA 3IJ8A 4QMEA 5F7KC 1GJWA 4EVNA 5FCUL 3SWYA 4GOEA 3JWOC 2DJSA 3KPQA 1UYWH 3MOBH 3P30H 3GHGC 4MDJB 4ORGB 3SDCD 8FABB 3O4OC 4A7VA 1ZTXL 1UACH 2ED6A 4PP2A 5C86A 5B39B 4DKTA 2XWJB 3BUYA 2KZJA 3NEXA 4LZKA 3L72G 2CK0H 3MA7A 2XTLA 1KTMA 3ZE2F 3RVWD 2UY6B 4IBLT 1OK0A 5JIKA 5BMFH 3ZTCC 1AR1B 4XH2A 3FPXA 2L91A 1WZ1H 1I85C 2OYLA 2HFGL 5I1IL 2W07A 3OLEA 4ZX5A 4W4OC 5F6HI 1ZHKB 1GCFA 2A0LC 4NUGH 2C9XA 4JQVC 3ELQA 3T0WA 1FZMA 2ZKHL 3GW6A 5DK2A 4BH7A 4YXHL 4ACTA 4PJGB 1L4AD 3TCLA 3QFDA 5JNYA 2XI9A 4NPKA 4PCTA 5FUZL 5FYKL 4DN3L 4N2AA 4AENA 4KUCD 4NZJA 1JTOA 2G3NA 1JCKA 1FIGH 4KKLC 2WV3A 4HIHB 2KL6A 1MJJA 1T1ZB 4NI6A 4JO1L 3QB7C 4LVNB 5C0BB 3TO4A 1OANA 4PD4J 1U30A 3FQXA 3KCWA 4GQQA 1BE3G 1ADQH 3JWOL 5FV1L 5CFAA 3MAWA 1SQMA 2AZUA 1SQQG 4U0RC 4FQQB 4P5MA 2DI9A 2EVGA 2YBGA 1N8ZB 2AV7B 3CDZB 4L8BA 3HBZA 5LDUA 3O9WD 3KH4A 1FZCC 3BN9D 1ZVSA 1BF2A 2WYTA 3AECC 1A65A 1FAVA 4AVHA 1HJCA 5ES4B 1JCVA 1G7HB 2C9LY 3Q01A 5DQJA 4HKJB 1IV8A 1QI4A 2VDPB 3QC6X 4ZSOB 3ROLA 3BGMB 2ICWA 4BQ9A 2N1TB 3QRGH 2WY3B 1KPRA 2ZKXA 3RG1C 2A6IA 2Q3AA 3N3EA 4ALAC 1S9KD 2ZOKA 3M9BA 1RI8A 1I4FB 4G8IB 2J8OA 4UT7L 4HLJA 1LO4H 1EZVG 3A67L 1BD2B 4L4TD 5HDBE 2JJTC 2D03L 3PV6A 5J9PA 1NGQL 2E6JA 4BBWA 1N6QH 5ERWA 3RYMA 4JUSA 1BBDL 4NNXA 3WDHA 4AQ1A 3NSJA 4PD4D 1ZT4A 2LR4A 4OCLC 4MDIB 4DQOL 4MA8L 2Y7SA 1OF2A 1SUHA 3VXPB 1DBJL 3FO0L 1SFCC 5C0AB 2W81C 4JM2C 3VFTA 5IMKB 2E4TA 4DGWC 3IAPA 4K7FB 5TQ2L 3RK2D 1XV8A 5DD1L 5IVOA 1X7TA 3N1MC 3EJRA 3FB5B 1U8JA 2E9WA 4DQOH 1FI8C 3IE9A 4LFHD 5I6XB 4LVHC 1NL0H 1M57D 1HAUA 3D70A 3D9AH 2JKJA 1YY9C 3NPZB 3CFKA 5JPMC 3BAEL 2ZKYA 1WFMA 4HAFA 2Q76B 1F4AA 1JZ6A 4B9PA 1F58H 3VMYA 2F7IA 1M7LA 2MHAA 3D39B 3EYSH 3K0YA 4HJJL 3QQDA 3ZTNH 2P8PA 5KLIB 1EUTA 4BWNA 4BK5A 5E99H 2H1PH 2IDCA 3STLA 2J8UA 4YDLC 1QTPA 3BEVA 4FXKA 5TGBA 2VDLB 2R0KL 1C5DA 1E6JH 4L3CB 1S7XA 1RZKL 4B0MB 1PG7L 1U8NA 2NYYD 1B0GA 2VWEE 3INUL 4CN1A 5CGMA 1MRCH 1W8EA 4MZ3A 1AXSA 1UXSA 2HT2C 1MDTA 4J3OG 3VXUA 1PGPA 3UXFA 4K5OA 5L2KE 4PRPB 2YAMA 1FJ1B 3HEIB 4WY7L 1S5LH 1MCKA 2ZXBA 3GMLA 3FONA 4OLVH 4WUUA 4HUXB 4B9ZA 3QR2A 3PE9A 3ELAT 2CDFB 2WLIB 4RZCA 1FIGL 3RKPA 2NY3D 3TV3H 2O6DA 2VUKA 4Z7OE 1T83A 1TG8A 1MLCB 2VR6A 1X3DA 1XH0A 3UTTD 4NQEA 5EEXA 3SO3B 1ASOA 5DHDA 3IU4H 5HDQH 1Z0MA 3OBAA 3MR9B 4R4BA 5DMYA 2CBMA 5IVNA 4XN5A 3UO1L 4Q9CA 1BM3H 1EUUA 3D3VE 4FFVC 4L37B 3R1GL 2ENSA 4U1SB 3VG0H 4IRJC 5SWQB 2C7FA 1CL7L 1CLZL 3ARSA 5IQ7L 3B7TA 3BKYL 4PG9B 1SXSA 1B0WA 3T8VA 5I17B 3EDFA 5IJVA 4PGZA 3MGAA 1LT9A 1M6OB 4DESA 5IF0A 1ZGLM 2WTYA 2W8CA 3U0TB 4QRTA 4IL6E 1QSZA 4HJSA 3ZDXE 4NPEA 5C07A 4KO5A 4ONFH 2GT9B 4LSSH 2IOMA 2FYUK 3CG8A 5DK3A 1QZNA 2GJRA 5CJBA 3NN8B 3H8NA 1L0LG 4KKAD 5AOJA 5TF0A 1T1YA 5GS1C 1DBML 4K71C 5GS2D 2XNDH 1IGYB 1KTRL 1ROWA 2FX8H 3K2MC 4Y5YC 1NAYA 2H1XA 3L71G 3FQTA 2QJKB 3BAYA 4ZX3A 4GIFA 1XSIA 3UX9B 3AY4A 2F7PA 3BSHA 1AKJD 4IU2A 1L0LD 2N4IA 4IOSD 4OD1L 3H1HE 3DK2A 2EIDA 1CE6A 1BQSA 3GLDA 1JI2A 3VYPA 3WTVA 4O58H 2R1WB 1A02F 3AMKA 3DDFA 3TH2T 5I0YA 1U3HB 4BYHA 1FYHB 4Y1AA 4EYYQ 1GS7A 4YJZL 1NMCC 2C34A 2P46B 3QUXD 2OMXA 2R27A 1LP1A 2X70B 1JXGA 2KNCA 2CDEB 2D7MA 2P5PA 3C5JA 3F8UB 3L1OL 3O11A 4N2GA 3RJDA 1SQPE 4QOKE 4A2HA 2VRKA 1TCMA 5T1KD 1P5UC 3DVNA 1U2HA 3CX5E 5DEGB 4TUUA 2VLKA 4G5AA 1UWEL 2Q86B 2YD2A 2DQIH 4FXLA 1QSEE 4HXBL 3CFCH 4G1MB 2VXQL 3VFWA 4TQPA 1D5MB 1DN2A 5DMGC 3REWB 2I26N 4ZTPL 3RDTB 1ESOA 4K9JA 1RUAL 4RWYH 5D2LF 2W60B 5CZXD 3PUCA 4HSQA 1FYTE 3B2DC 2ZXGA 3BATA 5KVFH 1NHLA 5JPMB 5JHMA 3DIVA 3PQYB 5ITBH 3HUJF 2FGWL 2JFCA 5D6DA 4XNDA 4ZW3A 5C97A 2OTPA 1KPUB 4JFWA 5I30H 3B9DA 4PH8A 1HFUA 1U3ZA 2DWTA 2F8VA 3FWNA 4GAJL 4JX0A 4OZFB 3QWOC 2CCWA 3BKJL 1Q9LB 2DICA 2DEYX 3V5KB 4WV1B 1GZLA 2DIAA 1GGIH 3DUUA 4MXWH 3U0WH 1YQ2A 2IH8A 4WHYG 3OB0K 3L3GA 3QE5A 4GRLB 4B7IA 5I71C 4FKHA 4RRPA 4IK6A 5A2KH 1GH7A 4GAJH 1HKLL 4E9XA 1X9LA 3IWVA 1KBPA 1QEXA 4BZ2A 2LTQC 3QDJE 4JFEB 1HS6A 1PF3A 1WGOA 3L2NA 2D0HA 4JYBA 3H3BC 1FZFA 5DUPH 2HJFA 2IQ9H 1DJHA 3KVQA 5HVHC 1V3MA 3K6SB 1HKFA 1H5BB 1KJ3L 4FQHA 3SQOL 3RZWA 4Y2DB 3ARDA 3LN5B 4A7SA 2PRRA 4LRIA 4Y4FD 2HN7B 4I89A 2ZWSA 2WZ6A 1OP9A 3DV6B 1TU2A 1MCRA 5HYQB 2DLFH 1G9MC 3GRWA 5BW7C 6TAAA 1TUPA 2QVMA 1HL9A 2VDNH 4DKFL 1V54B 4G6JL 2ZD0A 4LEXL 3HVDA 1QX8A 3MNZB 2E4FA 3RBXA 3C5ZA 2F58L 1TCRA 1UFUA 5FGSA 5EEUA 1RH8A 1GYCA 3CH8A 5TDNB 3R4YA 1RUKL 2FRGP 2BP8B 2NZ1A 3OJAB 5C08A 1BV8A 1QR1A 2XXMB 4JFED 4OJEH 3CVBA 4GQRA 3V55A 6PAZA 1E2VA 1AO7A 1KJ3H 4P9HL 3EJZC 2ZAIA 4Y16B 3MREB 3SDDD 1E7VA 4RNRA 3SIKA 1FDLH 3UBXA 3NP3A 4JHWH 3WFDL 1K73Q 2AXWA 2AXGB 2FWOB 2AQTA 2VABB 3OG4B 2NX5D 4OTXH 4NUJB 1PJWA 3V5HA 4JHUA 1VPCA 4P2OA 5C0JB 3L70D 4U1GB 2EYRB 1P84J 3L3OB 5DC2A 5CGBA 1HQ4A 4NN6C 1J05B 1G9MH 1BVLA 1ZJAA 1UWFA 2VDLL 4PU2A 3IXAB 1F2QA 1MI5A 5FECA 3T6QC 1R5VA 4WI6A 1PJ9A 2BY3A 4NOBA 2MH4A 5KLVK 2IJ0C 4FZEH 3MA9L 1XF4A 3LH2H 3C2AL 3KPMA 5ICZB 1W72B 4WI9A 2HVKB 1N7MH 3IDXL 2QR0B 1SLXA 3BWSA 4W9FC 1URQA 3WJJA 5EF3A 4IIQA 1BGYD 1EDKA 2W90A 2R2EB 3WIIH 4LSSL 3WUWA 1TO5A 1U91A 1JNLL 3ASWA 3SQBA 3QUKB 4N0UB 5IUCA 1CDIA 4QGTA 1F45A 3ARQA 3OQ3B 4UYQA 4EOWH 1AOZA 4XRCA 3BFOA 2I1JA 2UZYB 1JY3P 4OUUA 4YR6B 4IBZA 5E5RB 3KWUA 2G60H 4XNXH 4GSXA 4XB8A 3EYFB 4LESA 4MNHB 2YC1A 1D9KA 4P3WA 1TQWA 3BISA 3OWRA 1KIUB 1OSZB 1QNZH 3QZMA 4AM0A 3ECWA 4YHNB 2UVEA 5ISZA 1R8EA 3ULVC 4FYQA 5CIPB 3T1WA 4MJIA 4HCFA 1AV1A 4IYKA 1QHOA 4L2YA 1OAUL 5KBNC 3O2DA 4RBPH 3BP7B 5DVLA 5C0RH 1TQCC 1MQKH 3T3PB 5F7MC 1F0LA 1HCFX 5HI5D 4KTYA 3G71P 3N43B 1ZA3A 1MDAA 1OWWA 4U1JB 4TQIA 1MNUL 3T2PA 1M9SA 1SFHA 3L73D 1FQ9C 4CVWA 2CWRA 1CR9H 1JPTL 4NI3A 4ZW8A 1LL1A 3QIWD 2EXWC 3CCRP 1BVNP 1WPCA 3BAIA 4OGYH 5F8QC 4KY1L 1E3FA 1T04B 1BQLL 2I85A 2WKOA 2OCCB 5HJ3A 5GGRB 3VGEA 4IQHA 1VQ7P 5EU7E 3K72B 4Q2ZB 2EIBA 4TNVK 2CLRA 3PAVA 3D3VB 4KH2A 2DQTH 3BDXA 1JHTB 3S3DB 3SGEH 3QR0A 3VD2A 4FXGC 3RK3C 4LSRH 2E74C 3U25A 3S8GB 1SM3L 1EEUA 1NEZG 2AABL 3U9UB 4I1RA 3WO4B 1OCRB 4JFFE 2VJ0A 2WSEH 1MFUA 4ZRGA 1JV2A 4ERSH 4QJ5B 1EJFA 1VIWA 3FFDB 3PREA 5DLML 4G2AA 3U79A 2KSJA 3UAEA 4JFHE 2R0LL 4F15B 3S35L 2BJML 1NBVL 3HHSA 1W0VA 2D31B 1LT1A 4W6XB 4LHUD 4GW5B 4DT0A 1FVCB 4MA8H 5BV7L 5I1JH 4LVHB 5D1XB 3B3IB 4JANA 3UJTL 1OAYH 2A3TA 3GSOB 4X4KA 3VRIA 3OLGA 2FBRA 3NIFB 3QUYA 1IKNC 3DYPA 5D72L 3E38A 3D69A 4Q0XL 3DIDA 4NQQA 3TJEL 2VE6B 2NTSP 5I24A 4IEFB 3GS7A 1G5AA 1W72H 4X6CB 4YBQC 5EO0B 1EVUA 4TUKH 5BJTA 1WA0X 2CBQA 2J5LC 1HYSD 3KLAB 4X6CF 2DQMA 4W7ZA 5C3LD 1BD2E 3L74E 4HZLB 2G60L 5I1GL 4HHGA 4EXPX 2B87B 1FVDA 3L3KA 1DVXA 3QI9A 3QULA 3D30A 1KN7A 3R7RA 2AW2A 4OF5A 1BHGA 5D7SL 3NZ8A 1NPJA 1YMMA 1ZMEC 3KPTA 4U1MB 5BUPA 5DYOA 3L9YA 3UTTB 2NY0B 4BINA 4EAEA 1PDKB 1J5DA 5IM7A 4P5KA 1YUKB 4QRRB 1S1CX 1MJ7H 4UCFA 1G7MB 3R2PA 3V5DB 2OSLA 2D7TL 2YEZB 4YGVA 4EPSA 5IGXH 4JRYA 1WD9A 5T1LB 1G9NL 3KYKL 4XPTL 1J5OH 3SCMB 3K6FA 1JNHB 2JKLA 1SN0A 1MI5E 4AC2A 1LO0H 1J1OL 3MUJA 5I1DB 1U6AH 3ETBF 2HR3A 4JFXA 4M48L 4H7VA 2WWMD 1TYJA 3VG9C 4ODUB 2FZ3B 2WGXA 1C16A 5BS0D 4BXSV 4QRUA 1JD9A 3RL2A 1PIXA 2LAGB 2AQ1A 2ADJA 2WGNB 3GSNL 1RQVA 5B8CB 4M5ZL 3OB8A 1JPFA 1NFAA 1NUDA 3U4AA 1FDLL 2BP3A 3HB3D 1GZPA 1OWRM 5ICYB 5DFVD 3ABGA 2P52A 3GTVA 4X6DF 5F1IA 2Q1KA 2OFQA 4N4YB 2XG5A 1VZIA 2VLMD 2FYUJ 1KNOA 3FOLA 3LNFA 2X4UA 1KB9K 5AW2B 4F7MA 5I0ZA 4JFZH 1D7MA 1EDLA 1ZMYA 4PCYA 4WWID 3KLSA 1AD0B 4JEGB 2W0LA 2HZHA 5T3ZL 3HZKB 3ILQD 4OZHE 2OTJP 2R4SL 4N1EA 4JO3H 5BRZA 3S34L 3CVHA 3VD0A 1RH5B 1KT2B 3FTVA 4KMLB 1VPOH 2HJLB 4RMSA 1E4XL 1IC1A 3WXVL 2UUDH 2QSTA 4U7SA 3RL1B 3AT0A 2R2HA 1IGMH 5FO8A 1G1YA 2JCCB 2LU4A 2QDWA 4XC1H 4IGBD 4JAMB 5IW6B 2HWZL 2OMTB 1NGWB 3Q2WA 1XH1A 1KCRL 2NY6C 5DI8A 2Q10A 3RZCD 4PJFF 4X8JA 4LVNC 3IF1B 2VB5A 1ZSDB 3H1JG 1JGEB 3EGSA 4KTGA 5C6WH 1NGZB 4BUHA 3OR7B 3AB0C 4H26A 3JZYA 1ZGLP 1KORA 3IDIB 1Q9OB 4ALAH 4LKCB 2IGTA 4MWFA 3O4LE 1IQWL 4QYOB 5EO9A 3ZE1E 2EZ0D 4UQEA 4A2FA 1FZCB 4HHAB 1EEZA 5I28A 3QWQB 1SDYA 1F3JB 1KILE 2HKFH 2EABA 4PJ8B 4YK4B 3GHGA 5AVWB 2I5YL 3H1JD 3MBEC 4DCQA 2WQXA 1J0HA 43C9B 5FDYA 1FDIA 5CMAB 1QVGO 2J44A 3MXWL 2O61A 3F62A 1CU4H 1AS6A 1A6VL 1VGKA 3B2PA 1A9VA 3PAYA 3FQTB 5KSBB 1YNKH 3ULVF 3EDDA 1K8IA 4N1CA 3FTUA 4R6UA 1AHWC 2LVEA 1LO2H 1I85A 2DF3A 3ZHNA 3QNXA 4MJ5A 4HK0A 4Y4HD 3AREA 2EJ1A 1DFBL 1RL1A 3TJHC 2E75B 2V2TB 4HJEA 3QO0A 1KJ2A 4PJ9C 3A24A 4N3TA 4NRYA 1YTZT 1FNEA 3DIFA 4M5YH 1LO2L 2D3LA 2E3VA 1BJ1J 3BGFC 3MACL 1IE4A 3BZFB 4QHMB 1VACB 2M5AA 3C2AH 5FCUH 3TF5A 5B8CC 1BP3B 3EUUA 1HHJA 3BPOB 2H26B 2YJQA 1WFOA 3L95A 5AYQA 3Q6FB 4OFYD 4TL5A 4P4KA 1N5YH 5G5DB 4YXLH 4I77H 3UADA 2X0VA 2WYZA 3D0AA 4MA7L 5F0MB 2KB7P 3EFDH 4NC2B 2VSMB 1BPLB 5FOJA 4EF3A 5FHAH 4F8NA 4X4YB 4HMDA 1D5MA 1UATA 4Q6IC 1WWAX 3FSZA 2RFXA 3U82B 3VFMA 1J10A 5SWSE 3ZIMA 2EE6A 3PV6B 5J9PB 4EO5A 2QHLA 1XB3A 2VLJA 5K5YA 1DBKH 5H4YA 4ZW5A 1E6OL 1RFDH 2A5UA 2IG2H 1HEJC 1GHFL 3L7FA 2ZXXA<