3KDPB

Crystal structure of the sodium-potassium pump
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
286
structure length
286
Chain Sequence
b'NSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRSRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Crystal structure of the sodium-potassium pump.
pubmed doi rcsb
molecule tags Hydrolase
total genus 33
structure length 286
sequence length 286
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3kdpB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 3kdpB02
1GTWA 3NXSA 2KP8A 2Q3IA 3A7OA 3NMDA 4C46A 4JYCA 2Q5UA 4GKGA 1OWAA 1SLQA 1SP4A 2QM8A 2W6AA 5AW8B 2WPRA 4DZOA 4EOTA 1HWTC 2E42A 3WGVB 5APVA 2WWWA 5AW4B 2E43A 3M06A 1GD2E 5AVSB 3VTPC 4RETB 3LIEA 5AVWB 2YO3A 3V4QA 1MFZA 3I5CA 1X8YA 3MGNA 5AVXB 3V4WA 1IO4A 2BASA 5AVZB 2C9NY 1G2CB 3TYYA 1S9KD 3M0DA 3HE5B 4M3LA 4I2LC 2R32A 3HE4B 3M91A 4LC1A 1MUUA 4XE5B 5AW0B 1GU4A 4GT1A 2H7HA 2P2UA 4B86A 3O8ZA 3L37A 2IPPA 1GU5A 1DH3A 1A02F 2N9BA 2ZXEB 1GZLA 3NTNA 3T97A 2JJLA 3KDPB 3SWFA 4KHXA 1FAVA 3P8MC 1CI6B 5AW5B 1T2KD 5APWA 3M9BA 5APQA 5APUA 3HE5A 3V5BA 4C7NB 3HTKA 2R3CA 3NFQA 1JUNA 2YNYA 5AVRB 5AW9B 5AVUB 1YYCA 1CZQA 5AVQB 3WGUB 1A02J 5AVTB 1CI6A 3UIAA 1S9KE 1H8AA 1CSBA 5AW3B 1GK4A 3VMYA 1OXZA 4HYTB 2P67A 2YO2A 2XZRA 5APSA 3IR9A 1JNMA 1FOSE 2WPQA 2W27A 3OAKA 3TK1A 5AW2B 3L35A 4AUWA 3L36A 1MV8A 3KQGA 3P32A 5APXA 2Q7CA 2R5DA 3HE4A 1HUCA 5AW6B 3A3YB 2WT7B 2XU6A 3TNUB 4I6MC 5AVYB 3A5TA 3MD0A 3VMXA 3M0AA 2Z5IA 4RESB 1NWQA 5AVVB 2VRSA 3VMZA 3VN0A 2C9LY 5AW7B 3VYIA 4C7NA 2WPSA 5APTA 2XV5A 5APYA 2WT7A 1NAFA 4AYCA 3TNUA 2R5BA 1HBWA 2P7JA 5CMZA 2Z5HA 3B8EB 3M9HA 3P7KA 4AQRD 1HJBA 2ZFCA 5AW1B 3LIDA 4JYBA 1KQLA 1GK6A 3A2AA 1H88A 1FOSF 2QM7A 1H89A 1J2JB 1T2KC 2WTYA
chains in the Genus database with same CATH superfamily
3SE3C 5T33L 1MDAA 1QFWL 4MXVF 3EHBD 4M9OA 3LVTA 1KCVH 2V2XB 3DVIA 4RMWA 2E4FA 3VFPA 3QAZC 3OMAB 1SQQD 3IGAA 1BMZA 1ZVSA 3SDDB 3UDWA 1YI2P 4Q6KA 3CCUP 5BRZE 5LQBH 3WCYA 5F70A 2C1PA 3V95A 5INCB 1CR9L 3KE0A 3PABA 2EIZA 1FJ1A 1U8OB 2J55A 3B37A 2BVEA 1TQSA 5DHVH 1JGEA 2UVFA 5T3ZE 1MF2L 2X4PA 1FAIL 3GSWA 1Q0YL 1A9BA 1W8OA 3EWKA 2YGOA 1NQBA 4P04A 4P2QE 2OSXA 1E4JA 5EOCH 5GZND 5ICXA 5ITFA 2FWOB 4XPHL 4GUCA 1LEIB 2HG5B 1XXFC 1RZFL 1QTYT 1ZV5A 3MRJA 3GIVA 1AO7D 4HPYH 3UZVA 3WJJA 1QBAA 1P1VA 1TU2B 4GMTH 3IE9A 2HPCA 4JFSA 5INDB 3EZ8A 1IT9H 1JVOA 1UD6A 2XDJA 5FGCB 1BQHG 4NM4H 5I66A 5GTHH 3RY5A 3QUHA 3TS8A 1CGVA 2YUVA 5BVZA 3CFKB 4X6CF 5CMAA 5DQJA 4LSQL 1NDMB 2KYVA 4N90E 4R97C 3CSBA 1QP1A 2FB4L 4Z7UF 1U3HC 4HWZA 3NJNA 4ASWA 4OV5B 2F7IA 3L4VA 3DURA 1QSEE 3FTXA 3T2PA 1HF9A 4RSYA 3PWPD 1EO8H 5CEYA 3GXFA 3VH8A 3HMWL 3U4BL 4R2GD 1AZZC 2ALAA 3FQTA 5J89A 5DHVB 1CO1A 3O9WD 3IETB 3Q9PA 4KAQL 1HTLC 1M4KA 1K85A 1D7BA 3EXLA 2EDJA 4OF7A 3W9DA 3E1IA 3GQFA 3C5SB 4PRPB 4KXBA 2ADGA 4W81A 4RJTA 4JFXA 3LXAA 1RJZB 3FFDB 3IWVA 1T1YB 1JY2P 4GSUA 4NOBA 5BRZD 3RDTB 3T6XA 4QLWA 3CCSP 3B34A 4JRLA 3WNNA 2WKLA 3M17B 2A4EA 2H9GB 3VWJC 5IVXA 1XCTB 2BINA 4HKXA 2R2EB 4CVZB 5T3ZD 1S3RA 1A1MB 3WTYA 3BZEA 2FHBA 1QEWA 3FT3B 3ZZLA 4PV1C 3AWEA 4P2QD 3KDMB 5D2LF 2WO4A 3HUJB 3INUH 2W8ZA 1MLCB 2CGRH 1LTXA 1T3FA 5ELIA 4DH2A 4KU1A 1H88A 5KOVC 2N1KA 1NTZE 3ZIMA 5I1EH 2HR3A 1FE8L 2A6DB 5EZLB 1JGVL 4MJ2A 1B9ZA 4LPUA 1D2OA 2XACC 3SGEH 3S9OA 4V1DA 1DCLA 1KGWA 1FZCB 3EJYC 4HMEA 3L4ZA 5C0FB 4H25A 2W90A 1FZMB 5BZDA 3CUPB 3VGHA 3CCVP 1DQLH 1RUML 2CBOA 4HKBB 5F9JA 1L9OA 4Y19A 5EBLB 3SGDI 2CPBA 4ABUA 3PJNA 3DX2A 2XZQH 1FDIA 4U3FG 4KKBD 1SBBA 2PCPB 4GT0A 4AQ1A 1S9YB 1MOEA 3CV5A 3LS5L 1FHGA 1MKMA 1DP0A 2LR2A 1QSED 4QXGL 2R2BA 3BI9X 1FS0E 5D6CA 3BKMH 1KBKA 1O9VA 4NPEA 2WPGA 4WJKB 5HDWA 1S7SB 2JKNA 1HHIA 2AXFA 4FL4C 3RK3C 1I4FB 2OSLB 4QRSB 5D71L 4K8RC 2CKBA 5MEPB 3KDPB 3AC0A 1BWWA 2E75D 4BWWA 1H9DA 2JJSA 3FBKA 1FRGH 2JCCE 1UM5H 4G70B 4HLZG 3ZW3A 3IF4A 3AE3C 3CD4A 3L3GA 1NDTA 5J13B 1Q72H 1XTLA 3RVUD 4ZMPA 2H8PA 2Z0UA 2D7OA 4FQPA 3NQKA 3GXDA 1I8KB 1JB0J 4R7DB 2WVSA 2X4QA 5B1JC 1TPXB 1C8PA 2RTTA 4GP8B 5GGSY 4BE6A 2IGTA 5FDWB 1EVUA 4KH2A 3CZFA 2JLPA 3QR1A 1VL2A 3VQLA 2RA1A 4ZK8A 5IESL 3UJTH 2HX9A 3RK2B 2F7QA 3J07A 4GBXC 5E6IA 5FGBC 4BSJA 2QLVB 2E6QA 1CXLA 1NTZD 1AGCB 1ICTA 1KT2A 2JNZA 2AEOA 4Q2ZA 1SYSB 4M5YH 1OF2B 2BVQA 2C34A 5JDSB 1AFVL 2EQDA 1ACCA 2AGJH 2ZPKL 4G43B 4NT6A 3PYCA 4L37B 3L72D 1UB5B 1U8LB 3MSPA 1Q38A 5DO2D 4KZEL 1JEKA 1OIOA 2XVKA 3FQ4A 4XZUA 1BFVL 3KPQA 1AOZA 5APTA 2NRGA 4R4FH 1MFDH 5EOQH 1IFHL 1QPPA 3IAPA 2ZD0A 4MNQE 5AOLA 3UAJA 4L1LA 1FC1A 3FN3A 4RBPH 5AG8A 2BP5M 1XB3A 3RWFA 5DS2A 3VD0A 3JTTA 2QKIA 1U8KA 5TPWH 3KGSA 4Z7VB 2XI9A 5T3XH 4FQ1L 5AKTA 2EVJA 3UIYA 3K2IA 3RL1A 5MI0C 3AROA 4HK0B 4M93B 1T0NB 1XSJA 2GJZA 3S48A 4JKNA 3WE6A 3PXHA 1L7IL 5CIPA 1QLRA 2YD6A 3H1KG 1FZJA 1OVRA 4JKKA 5KJRH 1E28A 2I9LA 1N64L 3T04D 3HS0C 3AS1A 4RSVA 4WWID 3FO0H 1A6AB 1CD8A 3VOPA 3N9GL 2VABB 4GKNB 1LJMA 2Q8BH 5HXMA 2YGPA 3LMJL 3EXJA 4I88A 2BASA 1W0WA 4JO2H 2NW3A 4DEUA 4F9PC 2R4SH 3QXVA 1JJUA 3EGSA 4M3LA 4ZW6A 4OD2B 5I9QC 3O2DL 3QH3A 3QXWA 3DNKA 1BXVA 2J6EA 3I9GH 4U1GB 5K9OA 3SO5A 3VFSA 5KVFE 4P3CL 4Z77A 4XN7A 3GXTA 1LQSR 2Y5TB 4K9EH 5HD8D 3RVWC 3SCMD 1PGPA 3ETTA 5GRJL 1CI6B 2OQJB 3MCKB 3HE5A 4FXGA 2AFNA 4YC2C 2AJUL 5EU5B 4GKZB 1AGFA 4U1IB 4IRJB 1LWUC 4QRQB 2K7PA 3ARBA 2SEBB 2YNYA 2LU5A 3MHZA 4KVNH 5DRNB 1KCUL 1T20B 2H3NB 2J88L 4BFEA 1I8LC 4X80L 5D1ZC 4I3RH 3U46B 3KJ6H 3BRFA 4MNQD 1HHGB 4JM2C 4Y2OA 2VZOA 4GQ9H 4NC2B 4QGTA 2Q86B 3UO1H 1MCFA 3WTVA 4WAFA 1CSBA 4G6JL 4YSQA 1KILE 2WSSH 1ND0B 3AE8C 4RNRA 1EHKB 2OX5B 2DBJA 1GW0A 1USDA 1NSNH 4EI5B 4I18B 2X05A 4Z95L 4M6NH 1G9MC 4I4WA 3DGGB 1N2RB 2BW5A 3GPSA 4OQTA 2X38A 3SDCA 3HN3A 4ONFL 5CUSL 1DQDL 2O5YH 3ULUH 4OKVA 1OAYL 4FG6D 4JG1L 3M8OL 4ZFOA 1CW5A 3K6DA 4P46B 1UT9A 4WGVB 2HTLC 4KKRA 4QRPE 4TUJB 1KN2L 5AVVB 2FWSA 2M5AB 1TCRA 1WS8A 3PJSB 4WW2C 3BUYA 1Q86Q 4KRLB 4XNDA 5DJ2A 4GEJA 1ACXA 4NFCA 3WAJA 1OP5K 2OL3H 3KBFA 1BEYL 1TT6A 3SKJL 1BVNT 4TOYL 2Z93B 4GXVL 5DK0A 5GISH 4I0PC 4KK6C 1NC2A 4YH6A 2PO6C 3MBXL 1YITP 2P4AB 4Z7VF 3O3BB 2XV3A 2C5DC 4TNVK 4OVUA 5CSZB 4WU7A 3RIAK 2GW5A 1CIUA 4LEBA 2ZJSH 5C0EB 2CO2A 1N19A 3CU1A 4HU8A 2N1TE 3H4FA 2BRRL 3KLKA 4CGUB 4FRWA 4X5RA 1E9PA 3OF6A 3GLDA 2ZX5A 2XXCB 3BESR 1L0QA 3L3JA 4Q9QL 3O81A 2MCAA 1UT2A 1NWPA 1ONQB 4NO5A 3KL0A 2V7QH 3WJLA 2NZ2A 1IC7L 3DJSA 1CBVH 1HS6A 2NY5L 2C3VA 3WDJA 2WBJD 1UM6L 2J25A 2XA8L 5IHBA 1VQKP 2NOYA 3OGCA 3MKKA 3TEXA 1TTCA 4D0CA 4NBXB 2IBZI 3S0PA 5D6DC 4KGLA 4BHUA 4WUUE 2PTVA 3K2UL 2DLHA 2IJ0C 3SKOB 3GC3A 3IDNB 3BVWA 2OMZB 1KILD 1GW4A 3BATA 3C09B 4Z18A 4D9LL 4JO4H 2VDLH 2NNAA 2V7QJ 2OL3B 2DLFH 4I0CC 3TH3T 4FNPA 3NTNA 4CC0A 3FAWA 3P3UA 4LVNC 2EXTA 5IHUH 4C7NB 1CD9B 1KNOA 1ZT4A 2PCXA 3N1FC 3CZGA 1S46A 2BCCJ 2KHAA 3QIBA 4QRPD 3BSZH 5D1QB 2FRGP 2LU4A 4IM8A 4P4KC 4QOKB 3E6FA 2ISDA 1U93A 2VDKH 3B3IA 1KCVL 3NZ8B 3IDMA 2PMZA 1QATA 3ZQWA 4YDLB 3UPCA 3RURA 5C6PB 3MOBH 3EJCA 4S1DC 1IQDA 1V3MA 3I75A 4Z3JA 5LQBL 1I3VA 3FQWA 3GBDA 3VI4B 1CFQA 3WIHH 5L4MA 3KPNB 4AQ8A 1JV5A 3P77B 3SPCA 1I53A 1H0DB 2I07B 2UZPA 3CSTA 3TX4A 1DSFH 3MRRA 3P02A 3H3KA 4EXPX 4PJGA 2CR3A 4JHAH 3MDJA 2DJSA 3NIDB 5KYUA 4G6AC 2CLRA 3W38A 2F8OA 2WINB 4W9EC 4NKOA 1OD7A 3GSNH 1F4AA 1VZIA 2LT9A 1NHLA 3NH7H 4NAJA 4RESB 1IT9L 2V3FA 5DZJA 5SX5H 3SZKC 3F7RA 4NM4L 3VXTA 2VYRE 2UY7B 3SDXA 1X0TA 2J72A 2HJFB 4J8RB 4LESA 4XR8C 2JI3A 3C8HA 4UT7H 4A1RA 4WUUD 1OAKL 3FSWA 3SJVA 3MV8B 1A2YA 1D5ZB 1F6FB 4YWGH 2GHZA 1DEEG 4X6BA 4NI6A 3ZTDC 2IIJA 4FQXC 4LCIH 3ZQXA 1JGDA 2JB6A 4YR6B 4APQD 5I8CB 5LGJA 1A6ZA 2MNUA 3U0PA 2IDTA 3IKCB 1AZUA 4WSKA 5C0CE 1YEWA 4XCYB 5FK9A 5JZ7C 1KYOD 1AD9A 2FECI 1XTCC 4QDGA 1EO8L 4NPKA 3CXHD 1NGXA 1W91A 2ZWYA 4PHZA 4TSCL 3HZYA 3SDDC 1X5JA 3BVHA 1EZSA 1Z1WA 2CJ3A 4FFZH 4KRMB 5GGTH 4L1SA 1YQ2A 1HJCA 5CEXB 4RMBA 3P3TA 4XX1E 3RDJA 2WWKT 5SWSB 4Y4FC 1LLAA 4MQTB 2XVLA 3QEGH 2EIEA 5BUAA 1I1AA 1QSZA 3FU9A 3GSNB 1KPUA 1KB9H 1DDHA 4HIJB 5B8CB 1BBDH 5ISZA 3TYFA 4QRRE 2KC0A 3BWAA 4WJ5B 2FVNA 4UTAL 1G7JB 4MQ7B 3ISRA 4LDLB 1SYVA 2RFXA 3WUVA 2PF6A 4G9FA 1AZBA 3HTKB 4L76A 1VKXB 3H1JG 4KNQA 3DTUB 1OKEA 5CJ5A 5LN8A 1NBQA 3CDZB 3G08B 4DEPB 2VGLM 5ID1B 2QGDA 1MUJA 4K7FA 1NCIA 1KB9J 3INUL 4O2EA 4PJCE 3MV7E 4Q6IB 1UA7A 2CGRL 2WQ8A 4KHXA 1QR1A 3P8MC 1T2KD 1IGFL 5I1GH 2EVFA 1PZSA 4AJYV 5I1EL 1O6SA 1EBAA 2BIIA 3JC22 2HN7B 1D5IH 5EU3B 4Z5RA 3WTTA 2ZOKB 5FEBA 2ZTBA 1PP9J 1WGOA 1RV6X 1XGTB 3A6BH 3GMQB 3IJHB 4OZHE 3RHWF 2Z35B 1L3NA 3CC7P 2QT6A 3WTUA 1I8MA 1U3JA 3DETD 2ARJQ 2UZYA 2DICA 2UY6A 3C2AL 2AV1A 4TTDC 4U3FD 2GPZA 2FZ3B 3L7FB 1FHNA 2EH8H 2BFGA 2A38A 3VI4F 2WMPA 1WRGA 3HI6L 3NEXA 3GRWL 5LUMA 2IGFH 3X1GA 3G5VB 4P2OD 2AMUA 2FL5A 4NQCB 1ZS2A 2ZUUA 5C0CD 5BO1H 3NIDF 1P5UA 1NTKJ 2GVYA 3BKML 4L0ZA 4WTXA 2YOAA 5I16A 3CCEP 3CFBA 2YHGA 4X8XA 4PREB 4NQVA 1T21B 2BIMA 3VFGH 5IJDC 3RDTC 3TLRA 4AYMC 4EDFA 3NN8B 1YY9D 1N6VA 3REWB 1FRGL 1UM5L 2C9SA 3QGVA 3V2RA 1W72B 4XXCC 4U6XB 3ZKNC 4AUYA 2R69L 1C08A 1Q72L 2R7EB 2LAGB 4YHPA 3T1FA 4QRRD 2CRYA 4HZLA 1PYWA 2AC0A 2WT7A 3KVPA 2WKGA 3GG2A 3N1MC 1K4DB 5IM7B 2HKFH 4YSRA 1UCTA 1M7UA 2VISB 5GRUL 4GG8B 5DFVC 1BW8A 3FB6B 3UADA 1NCTA 4QTIH 1YJDH 4FJYA 4WCYH 4X0KA 4JUTA 4MQSB 5IK3A 2A6IB 1NCNA 5E8PB 2E5YA 1FZCC 1R0AH 1BSHA 5AAMA 1JZ4A 1U8CA 5CZVH 1WYJA 1KB5A 2KERA 2QVFB 4WQOA 1NU1G 1IBHA 2CLZB 1HKFA 2QVMA 1KLFA 3F7YB 4GKSA 4O51B 5TE7H 4YDKH 4C56A 4R4BA 1AGDB 1E50A 3B2MA 1U3YA 3DI3B 1PG7W 1UIIA 3OKDB 3AREC 2Y7MA 1KELL 1THCA 3BOVA 4CADB 4FHKA 1ZWIB 1KPRA 3IJSA 3TPUB 3QISA 2Y0DA 1NIAA 2L0DA 5ACMA 1OTSD 1TVBA 4JZOA 2HPOA 1URZA 2E4TA 1CN4A 2CDEA 5JHLA 1ZANH 4MLSA 4R4FL 3MJ9H 1MFDL 5EOQL 1MRDH 4NUGH 3RKDD 1RFDH 2VL5A 2DWEB 1RUPH 2NXZB 3L9BA 5CSBA 3EYFA 5IVOA 1AP2B 2D4FA 2H88C 2FJGB 3BAWA 4PR5B 5D7JA 1VESA 1VB9A 2H4EA 2H0PA 1P6AB 3BVNA 4NZRH 1RHHB 5TPWL 1A8ZA 5T3XL 3MLVH 5J13C 4ONHB 1L0LG 5D8JL 5ALCL 4MMZB 5BOZG 2N59A 3FH8A 4CU7A 1YUKB 5F89A 3EBIA 1WAAE 4P5SA 1AQTA 1IARB 3BC9A 1J1DB 4WDIB 2OW7A 4LRIC 4L1TA 4KNUA 1TPXC 1IGMH 5BJTB 4X4YB 1QLED 1GGYA 1N5YH 5I1DB 2EEFA 5KJRL 1CI3M 1WCBB 2XG5B 2VE6B 3FO0L 3N50A 1OGAB 5L2KD 5F3BB 3RK2C 3CVDA 5C08B 4Y2DC 4R96B 4G7SB 1MWAA 4OM1H 1OAZH 1E4XH 3EIFA 2J8UB 4IBLT 4JO2L 1AV1A 1IM9A 4L3AA 4ZMWA 2R4SL 3AQYA 3L4XA 2K9YA 3KPOB 3BE1H 4B0MB 3PHOA 3PF2A 3CFQA 3VXSA 1B0GA 2G9HB 2A77H 2RR3A 3GLMA 1LM8V 5JHDB 1YN6A 4PJDB 3RWGA 2YGQA 4GLRH 5IP4A 4B5EA 5JQ6L 4MNHB 3N55A 3LRLA 4K9EL 4AXWA 1OP4A 2NZ9D 4RWHA 1RHFA 2ITCA 3U6XS 3KBPA 1E40A 2X2IA 3MRMB 1S7WA 3V5KB 4N2NA 3QCVH 3ME0A 3U7YH 3AQXA 3OAUH 4KVNL 2ED7A 2BNRB 2XPGB 1FVCA 2AQTA 1KJMB 4I3RL 4M93C 3KJ6L 4POYA 2M3BA 1HFUA 1QNZL 2Y7SA 2R1YA 3LH2H 4GOFA 2W94A 3UO1L 5D7IE 4AY0A 3C6LB 1FNAA 4PG2A 2AJZB 1G94A 2ICWB 2E9IA 3H9YA 4HCRA 5H2BA 1PKQB 2C9XA 1NLBH 4FZEH 3IFMA 1LVEA 1J9RA 1PS3A 1NSNL 2F6AA 2F8VA 3QNYB 4PAZA 3S37H 4X5XA 1JNHA 4M6NL 1YPZA 1NIFA 3ZL2A 5J6HB 1BF8A 3GJFA 3WY3A 2QSVA 4KZ0A 2IADA 2WAHA 3V6FB 2Z8VC 3A47A 1EZLA 2O5YL 1H15B 4KJYA 3ULUL 4XPTH 1GD2E 1CQYA 2XFGB 1XGUA 4MKTA 2P5WE 3QJOA 1DTUA 3AB0B 4JFPB 4ORGA 5T1KA 1I85C 2H6PB 3CHSA 2B87A 1SN2A 1SY6L 2O5ZL 3O6KH 4XBPA 4D8PA 2JCWA 4E0RB 1TUPA 4NHUB 4WI5A 3JYBA 4HKJA 4K94H 3OVUB 3RWCB 2X4RB 2P5EA 3MI6A 4L3EA 4XVSH 1OB1A 3KYMB 3RQ3A 4U1GC 4UOZA 3QUXC 1PZBA 1YEJL 5AW0B 1QQDB 1FJPA 2X7LB 3M1OA 3ZDWA 3C60C 4NFDA 1F97A 2MKWA 3MOQA 3LXCA 4HISA 2IZ1A 1F45A 2E8ZA 3QFJB 5GISL 5KAIH 2APVA 3CLQA 4O2CB 2EE9A 5DYOA 1CICD 4AJ0A 4UMSA 1HCZA 3AEDC 2D31A 1NU1K 1O7DC 3F5WA 1XT5A 4O5LL 2BP8B 4UUJB 3KGRA 1NZRA 1WK0A 3WU2E 4JY5H 2MCMA 3KS0J 3SPIA 4DN4H 5HBBA 1GGIL 3L1OH 1J12A 4IRJC 5SX4I 4B9GA 4YSCA 3JVGC 2I1JA 3QG6B 5H2FH 2NUPB 3HD7D 1T1ZB 1ZLSL 3T0EB 2OMWB 2JIXB 2IALA 1C5CH 4WEMB 2PTTB 5E9DE 4LGPB 1SLXA 1VZGA 5CP3A 2AVGA 1IL1B 2W0LA 3QZWB 2EADA 3FTGB 1GKEA 5IHHA 4OT1L 4K73A 4UNVA 1WE5A 4UF7C 4UQDA 1LTSC 4EI5C 3TIEA 1RE4A 4I18C 4I5BB 4Q74A 5JIKA 2XFXA 3FQYA 3FO1B 1A6WL 1N67A 3W0WE 2IOIA 2J8UF 4MD5B 4ETYA 3DTDA 1KUMA 2BVUA 5K1VA 3DUSB 3Q1EA 2CBTA 2V4LA 3GK8H 5ESAA 1G7PB 2APXA 3G6JA 2DYPA 4K2UH 1PEZA 4KRPB 3RWDA 4R5TA 1JO5A 4JO4L 2VDLL 1XVSA 4P46C 1C9SA 1XGRB 3GF8A 3RY4A 2NY2B 2B59A 4U3SB 5E5LA 3OAWA 1NTMK 2EE2A 5HHMB 4DKFL 3WFHB 4QHLB 4NAQA 4YHKH 5F0LB 3BH9B 4JFFD 4PYGA 3CLWA 2P5WD 4UQEA 5IT2H 1DEBA 3QDMB 4IHOB 2XBTA 5IHUL 4X98B 4JBSA 4WY4B 2DEWX 3OD3A 3U0TA 1L0NK 4JB9L 4ZS6D 3BSZL 5TE6H 1I82A 2VDKL 4HMDA 1ZLDA 4HOZA 3O3EB 2UYLA 3UTSB 3QUMB 5I75C 4Z6AT 3MOBL 4H0LB 1ZLLA 2E76B 4FXKC 4FNUA 4F2EA 2F1EA 3B9KB 4X5QA 4KO6A 1KD1Q 3MV01 3PLYA 1SDDB 4OVNF 4J1UB 3W3BA 3KYAA 3CCJP 5EFIB 1EJ8A 2NY4B 5F7NC 1M7DB 1ETZB 1DSFL 4D8OA 3C8DA 1BAFH 2XWEA 1G7MA 1IE4A 1S5LE 2OJZH 5FA3A 4RO0A 2XIDA 4ZXBA 2GUSA 3IJ7A 1MNNA 1BG9A 1ZHBA 2Z4EA 1LNQA 1LDPH 4N5ED 5EC1B 2FUQA 3DXAB 2OMTB 3H1IE 4GW4B 1E30A 1G7HA 3CMEP 5E9DD 2YO3A 4JPZB 5AZUA 1KJ2B 3NH7L 2JDIH 4YN3A 4F57H 2DMCA 1GZPB 1BYOA 3PDGA 3BZFB 3C09C 3NA9L 1VFBA 1WLHA 3APNA 2P43B 5F7MC 3WFBH 4DO6A 4QJ3B 4QCIA 3BX7C 1H5BC 1SXCA 3KYKL 4MVBC 5F7HA 2FYNB 1BFSA 2R0WH 1I8UA 5GZOC 3AMLA 5IQ9B 4JMXA 2D7QA 2CUAA 2ZX8A 4U1NB 3UPRB 3BAYA 4D9RD 2P49B 1IC2A 4LCIL 5IGXH 4EZMA 1JF1B 3B7TA 1RCYA 5I2IA 3SBQA 3VGAB 1KBBA 1MXGA 1X4XA 1ZD6A 2A6JA 1GC1C 3EH1A 1OPGH 5D1QC 4EE2A 5FO9A 15C8H 1JMXA 5IMLA 5TE4H 3JWOH 2XICA 5ENWA 2V7NB 5IHLB 1H6FA 2IQ9L 3TNMB 1FLRL 3PHQA 3U48A 5A16A 5I71B 5J9PB 2A45I 4LLWA 1QRNA 4FFZL 5GGTL 3QUYB 4PJ5E 5AW9B 1F2XK 2NY0D 3VFUA 3K1DA 1KTDA 1ZSDB 3LPOA 4HS6B 5AVQB 5B4MC 3TN0D 2DQUH 3D07A 1XZ0B 1MVUA 2AAVA 1NPUA 2BZ7A 2G3NA 2Q2EB 2N1TC 1JTPA 4GW1A 3FNKA 1CIDA 3ECBB 3IN2A 4HH9A 4XO5A 3QO0B 1CLVA 1EFXB 2XZZA 3PWNA 1X9LA 1CFSA 2ZWNA 3KWVA 4QT5B 2VIRB 1BD2E 3NCWA 2D9CA 1I7RB 3OKKA 4YDIH 3EDEA 2EKSA 2GBVA 3UP6A 2BVPB 1PMYA 3ROLB 2HTKC 4CSTA 4BEIA 4R3SA 5DRWB 1FZOB 1JMMA 4DERA 1NU1E 4PRNA 3ZY7A 2H3KA 1QD0A 5EB9A 1JWSA 3CVBA 3SE6A 4L48A 4B0MM 5I1GL 2CO1A 4OV6F 2HJLB 4H26B 4S10A 1M56D 1CFMA 4I1LA 3L70E 1BLIA 5IEHA 3IDGB 3A6BL 1S9KC 3ARGA 2V9RA 3DV6A 3KPRE 2R5BA 2J73A 1Y7VA 4KX8A 3SKNB 1INQA 1F8TL 4L5FH 5CP7B 3QIUC 1JYVA 1FFNA 3CFJA 5KTBA 2EH8L 4G9DB 5JXED 1DQJA 4L1BA 2FT8A 4NHCH 3DMMD 3JT0A 2H1LM 5HGBB 5BXFB 1A1OB 2ZSVB 4H5SA 2SODB 3CSYB 5E51A 2OYOA 2WLIB 2VWEE 1Z9LA 2FSEB 1SXNA 2K8MA 3WL9A 1JSYA 3D5OF 3PWLB 5K9KB 4GAJH 2OBGA 4QO1A 1RZ8A 4M8UA 1P84H 5GZNA 1S7XB 2ZVOB 3HW7A 5B8CC 3NCBB 5IB3A 1KIRB 2V7HA 4MDJB 4PJ5D 1HQRB 1CGWA 1NTME 5J57B 3VXNA 1AO7A 3F12A 5GTIE 2YBRA 2O01H 3RVTD 1F4XH 1T04B 4HDIB 2Q7YA 4PJBB 5EUOE 4F7CA 2HB0A 1SBSL 2X4NB 3B7RL 3QJUB 3QJTB 3M0DA 1AYRA 4PP2A 4QRBA 4XTRD 3G04B 3GLEA 4DEPC 1WAEA 4YAQA 5CBEB 2IAAC 1L0NE 3UZQB 2XIIA 1AQ5A 1GZQB 1U6AH 2B4CC 5AOIA 2WTRB 3GJEB 3CIQA 3L1EA 3MLXH 3T65B 1AFOA 3ABMB 1BF5A 1FDLL 4F7MA 4TMPA 2XV6B 2HKFL 4ELME 2O01J 3E1F1 1BD2D 3H54A 1IBGH 4L4TE 3BP5B 4BK5A 1YJDL 3UTTB 1COBA 3QORB 1NU1D 5TDPB 2WOBA 1TTRA 2WWNA 3HE7D 3JUZA 2NXYD 5TDOA 3REVA 4KZDH 1EHAA 5CZVL 3PWPA 3SQOH 4N0YH 4YDKL 4GQPH 5IY5B 3RL0D 3GEFA 5TE7L 1M57D 4Z1MH 2XWBB 3LY6A 3O9WA 4AG4L 1MFNA 3L70D 1WFOA 4HC1L 1RIVL 5L9DL 3JWDC 4G8GB 4Z7NF 2VZVA 1S7TA 4UIKH 1CG9B 2BSDA 5KG9B 1S7QA 4KX7A 1K73Q 1CJYA 1P7QD 3FTUA 3U1CA 4HUMB 4IU2A 4JDTL 4PJ7E 3F05A 3HFFA 5I1KH 1N0LB 4R5VA 5BRZA 5B39B 2ZT9D 1ZANL 3VWKD 2ICES 3MJ9L 4FFYH 1MRDL 3FQNB 4NUGL 5JOPE 1UH2A 3DLQR 4GB9A 4S1QH 3PGFH 4ODTH 1LT1A 4N9GA 4YQXH 1RUPL 5F72S 4NIKB 3QR0A 4ODUA 1PL3A 5GGVH 1JZFA 2A9DA 1URLA 4P2QA 3MLVL 4RWYH 1E2VA 1KEMH 4Y7MA 2GCYA 5KSVA 3HI1A 1E9QB 4GRLB 2G60H 4N0FA 5EWIL 1YNKH 5HHVH 3LIZA 1DBMH 4P3WA 1IBDA 4LBEA 3VFTA 3A24A 1IGML 2CIIA 3DWTA 2VERN 2A74B 5C09E 3R8BB 1SOQA 1F58H 3FTZA 1N5YL 2DBLL 1L0ND 4GIPD 3U7WL 2X0UA 3DOHA 1ZIBA 3RNKA 2WC7A 4MYPA 4S11A 3CFIC 5J6SA 5KVDH 3O2WH 3OTTA 5DVNA 4EF3A 2RKLA 2EDHA 2ZXQA 4HS3B 4OM1L 5KVEH 1OAZL 2R2HB 2CA4A 3H6PA 2YR3A 4L4TD 3EZJB 3L71J 2J12B 4NUMA 4GAFB 2AEIT 1RF1A 1U33A 1U0QA 3BE1L 4FQJH 5ESVB 5G4MA 1IEAB 3NCMA 2OR7A 2QMKA 3EYVB 4FFWD 4KMLB 4N1CA 3WY1A 5EO0B 1QSEA 3SQBA 3ZLQC 3MNVB 1MI5D 4XN1A 5EZJB 3P4LA 2A77L 2I8DA 1VQ7P 1B2WH 3HN8A 4JPKH 1M71B 3A4DA 1Q9WA 3HRZB 3UL4A 4CVWA 1YN7A 5JW5A 2G5BA 1G2CB 4PJBF 3U4EA 2YGNA 2ZSWB 1G6RA 4JFEB 2ZCHL 5HHPA 3APCA 2NSMA 2EJ1A 2NXZC 1AJ7H 4AC2A 4OCSL 2OS7A 1MCBA 4PRIB 1FZKA 3CFUA 3QCVL 2ZWKA 4JFYB 3S5LA 4FULA 3U7YL 3C5ZB 3OAUL 4LEEA 4MMZC 4PGBA 5FECB 2VR8A 3NJKA 2JKJA 2LVCA 4MQXC 3O0RH 4MS8C 1BYNA 3PL6D 3LH2L 4M9PA 4DEWA 1KTKE 1T7YA 4Z7UE 5EZOL 2Z1PA 1NLBL 2N0KA 4MJ6B 1AJYA 4FZEL 5F8RC 5CHXA 2YN3A 3SBWC 1DQIA 4OZFH 1MFMA 1UB6B 5KKZB 2IANB 3GTTA 3HZMA 1PX4A 3GS0A 1S7RB 4E41E 2GJ6E 4PRBB 4KK6D 5FCUL 2P42B 3FFCE 5C09D 2ITDA 3KLAA 1TR7A 4PUBH 3CU7A 4WSGA 1NAKL 3Q2YA 4N3TA 3ZR5A 2QLYA 4WGWB 3MRIB 1E27B 3AEFC 5LBSH 4XVSL 1RZKH 2TSAA 4X6EA 3L36A 3G6AA 2K3TA 2WCPA 3M88A 3STLA 2GK0A 4URTB 5IJBC 1HOCA 1FORH 3WIIL 1AQKH 4LKCA 4JY5L 4DN4L 2ADYA 3DUUA 5D2LE 3L1OL 4JVUA 4OSUH 3KYNB 4XMKH 1TVHB 3PLNA 2A6KA 1J5OH 2KZ1B 2XZAH 5F1KC 3RGVC 4K3EH 1HQ4B 3IDIA 2IO5A 2W65A 2JCCA 2PCFB 3L2NA 3RJQB 5K9QI 3C6LC 2GTWA 3BPNB 3HG2A 4YSOA 4EZKA 4MX7A 4GW5B 3SGDH 2EP6A 3HBQA 4FMFA 3OKLB 4JAMB 3FZUC 3VGGA 1F4HA 2VZ1A 1KENH 3OHMB 2OP4H 5L88H 3OX8A 4WWIA 4DFHA 3BPCA 5CBAB 3FRPB 5C9JA 5DK3A 1PLCA 4LSSH 4NNPH 3GK8L 4Z76A 5FYKL 2WLYA 2Z31B 4K2UL 5KYYA 4FN0A 4FNRA 4Q4EA 4M7KL 2EYTB 3AT9A 1KDIA 4BCYA 1E8XA 4NN7B 2W6JH 5K1JA 5GS1A 4WV1A 2OTWA 4WK4B 4U31A 4E9TA 2EVIA 1YTZI 3BDXA 1MY5A 4YHKL 1ZE3H 3IBOA 1TZIB 2C4XA 1BBJA 1LEGA 3SCMA 3EO0A 6FABH 4CMHC 3EOBB 4HQQH 2FEEL 2J43A 5KLVJ 2AJ3A 3CLEL 5TE6L 2AQ3A 4LVOC 4WUKH 4HT1H 4E2OA 5KYWB 1XO8A 4LXFA 1DH3A 3AMKA 4G59C 4HKZA 1NFDE 1BE3G 4P05A 4MZRA 1QI5A 1JZHA 2Y72A 1T8ZA 4PLOB 5GGUB 1GZHA 3VFNA 3CFDB 1W2BO 2IFGA 2RMNA 5JPMB 2OKMA 3MRPA 4IHBA 3L45A 1Z3GH 4MNQA 3OZ9H 3RVXC 3NRFA 1JZ6A 1PLAA 3T0EC 2W07B 3SZ6A 1BAFL 5F7AA 2C1OB 1AOHA 4UV7H 4H40A 4MWFB 2OJZL 4XVUD 3KW8A 3ULAB 3GKWH 5GHWH 4A7GA 1WGVA 5CN1A 1R3HB 3FPYA 3QXDA 1N7LA 4FQXD 1LDPL 3UG4A 5ECGA 1I1YB 4XXDA 4F33B 4GI9A 5ITBH 3DX8A 4GQQA 3VTMA 5ETUA 2VUKA 4F57L 4KRPC 2OR9H 4IK6A 3WFBL 2YN5A 1R5WA 2JLLA 1Q81Q 1WP6A 5E4EB 5FS5A 1BCCG 3CIAA 2X1QA 1NGWB 3UZEC 2Q9OA 4YMPA 2WZ0A 4YPGA 4MJHA 5E95B 2ZUQB 5GTHE 5IGXL 4Z9KB 3LKSA 4G71B 3LQZA 4CU8A 1UWEH 3AY4A 4WY4C 3VFVA 1YTZT 1VPOL 4JO1H 1OPGL 3LKPA 4K3DH 4QJ4B 4RMRA 15C8L 5EEYA 1WZMA 4WU5A 3HG4A 5TE4L 3JWOL 2OAAA 4OGQD 3QZBA 1LK3H 3ORJA 1NH4A 2W0KA 4GNKB 2W9DH 2BERA 1C12A 4FXLA 4H0LC 3QEHA 3TBYB 5FGRA 1FFPA 3B9KC 5DWPA 1ADQA 1FC2C 5A1AA 5JNYB 1DUZA 1M2VA 3LSOA 1ZS8A 4W7ZA 1H3TA 2ZG3A 2RAMA 1RF0A 3L7EA 4N20A 1UJ3A 2EICA 3ZKMD 1ZP0C 1S8DB 5EZPA 3IMWA 1RIHH 1UACL 4AENA 1HC1A 2WBJA 5L8RJ 2B16A 3QUGA 2PUQT 5HHXH 4XVTH 2GSIA 4HD5A 4PQXA 4J39A 4JYCA 1OCOB 2FSDA 5DJ8B 5KBMA 1IKOP 3VX1A 2XWTB 5AFAA 2WUBH 4XMLH 3WHXB 2P8LB 4XCFL 3FXIC 1KILA 2WWWA 1I1FA 4NOFA 4PP1C 3UABA 25C8H 1XEDA 2MQGA 4JG9A 5C0JA 4LCCA 4MCMA 4NN6B 4BKSC 1U2CA 2ERJB 4K15A 1X5AA 5D7LB 3D2UB 5CJXC 4LSTH 3PXLA 5IMOB 2FYNC 4ENZA 2PTUA 3OG4B 1HYSD 4TPRH 2BIQA 2JJTC 3AS0A 4X9GA 3O6FB 1EPFA 3L73J 1L9QA 2VLME 1UXSA 2B77A 3QZLA 4AYFB 4PRPD 1FVEA 1WZLA 4YHNA 3NJIA 4IRSB 2Q3AA 3LN9A 1PGQA 1DVYA 1OANA 2ZCKL 2J1WA 4QRPA 4U1JB 3VGAC 3ZUNC 2QZ5A 5CKAA 1X44A 3MA7A 4X0NA 5TDNA 4L5FL 3VG0H 5HY9B 1U8HA 4ZUUB 5EF2A 2NR6D 2OTKE 4ERSH 2AEJA 4N0CC 3I6KB 5I71C 1RL1A 5T1JA 5E4AA 1AD0A 4NHCL 4KQ3L 3QUYC 3FQUA 2FBOJ 1NKRA 4UDUA 2AEFA 3W2DH 2DMGA 5CR1A 5DD1H 1EQ7A 2AXTH 3P8CE 3WJMB 4PJAF 3RWHA 3X1FA 1WZKA 3I3EA 4LOEA 4AQAB 3BEWA 3O3DB 3OWRA 4KKNA 1LD9A 1CDGA 2E9WA 1Z3RA 8FABA 1KG0B 5CGBA 4DOJA 2R44A 1N3NA 1IUZA 1EHXA 1CLYH 3X3FH 4N0RA 1BQHA 1N5AA 3RTQD 2WZ7A 2YIUB 4X7TA 5ANMB 4LVHB 5DC0A 5DD0L 3MX0B 1NC4D 4HSCX 4NM8L 4QXTA 5F88A 3FU0A 4Y0GA 4CC4C 1DJGA 4ZOBA 4Y5VB 3MLXL 1AC6A 2WWMC 4FJ6A 3QUKA 4WUUA 3V4LA 2EXYD 4HEME 1H6UA 1RPQA 2WP3T 3OJDA 4APQA 4KMTH 2VH5L 4P3DA 4HHAA 4AIZB 3Q44A 3GS4A 4FMKA 1TG8A 4DGYL 1JI1A 4YGVA 4KZDL 2AJSL 3KZIH 4J3VA 3S3CB 2WAQA 2XV5A 3B5TA 4I87A 4P9HC 4R83A 4J7RA 5E8OA 3SQOL 2DH2A 1KCBA 3DHPA 2VDNL 5CFHA 4L18A 1U9KA 1QUPA 2VLMD 5EC2B 2IFFH 2XWJA 5TD4A 3V0DA 3Q5SA 1KGJA 2KXPB 3LKRB 2GAZB 2CO6B 1RU9H 1VQ6P 3CQFA 4MCNA 3BRGC 1GGTA 2YZ1A 4L75A 4FNLH 5EU6E 1PZUB 4M7LT 1OTUD 1A7RH 3CSPA 1D6EA 4UIKL 1AIFA 4NPYB 2KP8A 4MAZA 4LLDB 1A3LH 5I1KL 3KXFE 4G8FA 4GYBA 1KQFB 2WPRA 2Y07H 3WAKA 3ZKSD 4FFYL 4HH2A 4I2XE 3MGOB 5CFAA 4S1QL 1I9IH 1HE7A 3PGFL 4ODTL 3PIQA 2B1OA 3P8CD 1EHNA 4GOSA 4GI8A 4ZUSB 4YQXL 1D7CA 4OFQA 1JTTA 2YWYA 2EO1A 4HD9A 1QGKB 3V4WA 3G9AB 4OLVH 1N7SD 1FZAA 4RWYL 4XP9L 1KEML 4BK4A 1TJGH 1JHTA 2EC8A 3TYYA 3CZSA 1D5BB 2HKHH 5AL0A 2F8XC 5IKCA 4G8IB 3WE1A 1ZV9A 5I1CH 3Q3DA 2P8MB 1YNKL 4GXUM 1X5YA 1DBML 5T3XE 1I3GH 1YNTB 4M61A 3T0WA 4LB8A 1SS1A 3JV6A 1EANA 35C8H 2YD7A 4MXQD 1TENA 2BY2A 1NGZB 3MTRA 1B4LA 4LCWE 4F2FA 3QCUH 3N4XA 4YEFA 3M9BA 5KVDL 4UQ2A 1NMCB 5KVEL 4TNFA 1EK3A 3S4SB 2CM6A 4R8WL 2C3XA 1FL3A 2BNQE 4QHUB 4PWEA 3FO9B 3L2LA 4P2OA 2FATH 4DW2L 4O9HH 3WGUB 5C0CA 3TJEH 1S2EA 5DVLA 5DHYA 1YY8B 4KK8D 1IBFA 2YKPA 5IOKA 3ZPDA 1O9ZA 4K7PH 5FYJL 5HPMA 3D6ZA 2EEBA 1PEWA 3QQ4B 4IMLB 2WXRA 2TSBA 2CKBL 3OMZA 3QWOB 4OZIF 3KVQA 3AS2A 1BIHA 3EJTA 5EU6D 2MMXA 3HI5H 5G55A 2NX5B 4HUKB 1AJ7L 5JOFA 2BPBA 4A7QA 3EOTH 4U6VH 5SX5K 4PV9A 4HUXA 4QRRA 1CZ8H 2ATPB 2DQ6A 2Y1VA 3KXFD 3TNUB 4PB9H 5EH1A 3IF1A 1U91A 4DCQB 1A21A 3WN5B 3X3GH 1HEJC 1DLHB 3F89A 3O0RL 4L3FA 1BGYG 2CH8A 4YL4A 1XF3A 4W4OA 4GAAA 2KS0A 5K5YA 4LOVA 4PY8J 4FP8H 1MAJA 4J5VA 4HUNB 5F7LB 3WOVA 4Z7AA 1EIBA 2VQ1B 4XXWC 3TXAA 4PJCA 1JRHI 3HNVL 3ARDD 3RJOA 5I6XB 3OAYH 4PD4I 2KDYA 4JFQA 5FHBH 1KJ3H 4I85A 3HG1B 4K4KA 3HCVB 3G6EP 3OXRB 3O6QB 1GHFH 1YNLL 5E0QA 5T3XD 3WO3B 1IVTA 3I9PA 4YXDC 1TIUA 4HIHB 4PJIB 4PUBL 4OZHA 4IBSA 2K4WA 4M8RA 3Q5PA 1HESA 1BE3E 4JFDE 2C7FA 2EVGA 4L4VB 4F8PA 3ULUE 4NKIH 3WKMH 2A3TA 5BU5A 2H6OA 5FA4A 1HH6B 5IVZB 3GSQA 4JHBA 1KB9K 3I85A 1VCAA 4IOIB 1RUAH 2BNQD 1AR2A 2WK2A 3W9EA 4K3JH 1BMGA 1J0YA 4PJHB 4BZ2H 2R23A 1ULVA 2QJKB 1FORL 5CS7A 4UB8H 1X7SA 5IR1A 3IGKA 4QJ5B 2VL4A 1CD1A 1YEIH 1AQKL 3L75J 3F2LA 4YDJA 5DMGC 3UROR 4CC1A 4K0OA 3HR5B 2WVVB 5GGVY 3LDBB 5TK4A 4OSUL 1HINH 2JI1A 3C5ZC 3K8KA 4XMKL 4KJWD 4MGXA 4MJIB 5D7HA 1J5OL 1MCPH 2XZAL 4K3EL 5F97E 3OC8A 1R3JB 3K71A 1YNTF 4P46D 2WLMA 4P2RE 2K6WA 3RL2B 1R24A 3MP7B 2XWZA 2XQYK 2WLZA 2HODA 1PZAA 5AOKA 1HT6A 5IROC 2IDQA 5HDQH 1OAXH 2OP4L 1FO0A 2X1XR 5L2KA 3H1HJ 2BS8A 2ZIDA 5KKZC 3UTOA 1NTKK 3B7UX 2CRIA 3HHMA 1FYTE 4LSSL 4A6YH 3VFTB 1BOGB 2F8IA 1I7TA 1A47A 1BX2A 3STBA 4YBQC 3PNWB 1A9EB 2MTPA 1FL6B 4X8JA 4PJFE 1OW0C 5C07E 3VXQB 2FY8A 1SFHA 1AZVA 3TDKA 1R5IA 3CDGA 2J6EL 3NFPA 4U1MB 5I1IH 1X3DA 2BCCE 3H9SE 2FHCA 3VQ2C 5EFWB 5C0GA 2WPQA 1FNLA 2HT3C 6FABL 4HWBA 2YMXL 2ENSA 3V4VA 5KSAC 2O4EA 9PCYA 1BE3D 5EORH 2OI9B 4IL6X 3ULUD 4YIQA 2JVUA 4HT1L 1IGYA 1HHHA 1ZV8A 1NANI 1QG3A 3QZWG 5E8EB 5JO5B 43CAA 2C4FU 1ZHLB 2XX1A 1JPST 3P4OA 4MHHG 2NT1A 1SEBA 4O02A 5FKAA 4I1PA 4G8EA 1NEZB 1PNCA 3D9AL 4EUPB 5F9OL 1RZJC 3ATBA 4F7EA 2BSCA 4AUUA 1HNGA 3OZ9L 3C87A 3L95A 3PJLA 3V4PH 2CHNA 3BPNC 3U9UB 2IG2H 1K2DB 1SHMA 4MVBD 3WDIA 3ROOA 1LTJB 4UV7L 4ZKUA 3GKWL 5GHWL 1UD3A 4XCEB 1TSRA 3FT2B 4DAGH 2HFED 2OMNA 1WAAA 3DOIA 5DRZB 4OQTL 4HJJH 4UQIM 2K4AA 3RX8A 4CNIB 4PJIF 5ITBL 1N8RQ 2G8YA 1XIWD 3KM1A 1THAA 2XCMC 3BZDA 3S8WA 3T77B 1QHOA 1RZKC 2Z31C 1AANA 4HJEA 2EIKB 3VXRB 4WNQA 4BSWA 3MXVL 2OR9L 2GQHA 1BGXH 4MA3A 4RVBA 4XNUH 2ADFL 1G1YA 4JANA 1ZOYC 1P4LA 2FXPA 1CXEA 1FYTD 4R7LA 3BH4A 4W9HC 5C0AE 3MJGX 4PJHF 3E9UA 3QARA 3MUHL 2WVTA 1ZA6A 2XJLA 3F83A 3BISA 3QEUB 1RH8A 3AZUA 5C07D 3QULB 1CICA 3EFFK 4K3DL 4Q58C 4PWKA 4JY4B 2C3WA 3Q2CA 4C7RA 2GJPA 4XOCA 2BCCD 1LK3L 4BH7B 4BKTC 2LTQB 4L73A 2W9DL 3L37A 2AI0H 1X5ZA 3LXUX 1EO7A 3ZE1B 5CD5C 4TNEA 1N0XH 2OYKA 3UJJL 1NH6A 4O58H 3HD7A 2CO3A 1JDAA 1DJSA 4U1SB 1XH2A 4NUQA 4ALAC 2EO7A 1S7UA 4A2HA 5FUCE 1Z2KA 3ESPA 1JYNA 3D6GA 3J8F7 2HLAB 5CILH 1YYLH 3IPFA 5CHNB 3C8KB 1RIHL 4GKOA 2PXYC 2DMKA 5H94A 5HHXL 4XVTL 1RVFL 2QQNH 3TBVB 2DIAA 3KXDA 3D85D 3WBDA 1NCDL 4IGBD 2WIIA 1KB9E 2WUBL 4XMLL 2YXRB 5D7IA 1UZ8A 5DS8B 2O1KA 5AOMA 3Q3GA 5IIEB 1TJXA 1ZTXH 1T5XA 5JLZA 1YAZA 2MQ0A 1OGSA 3KPPA 3P73B 5DZ9A 2M26A 3TBTA 4YLQT 3FB8A 2X1PA 2IDUA 4FE9A 2XQBH 1WT5C 2FO4A 4XO8A 3BH8A 4MS6A 5E4EC 4LSTL 1PP9E 5HDBE 3K8MA 1V3JA 4TPRL 1G87A 1J1PL 3AM8A 3QK0A 4JFFA 1UD5A 2ZUQC 2P5WA 4XFJA 4YOKA 3RLSA 1IKNC 1PJWA 5SWSD 4AQOA 7PCYA 4AL8L 2Q3EA 2DWDB 3DKHA 4E9WA 3B2VH 3LPPA 1OAQL 4ZUVB 3FWNA 1LT9A 3WLBA 5ICYB 3VG0L 1TZ8A 3RILA 4G82A 2B20A 5C0AD 4LLAA 1U58B 4ERSL 1J8HB 2I27N 4HETA 4YSTA 4JLRA 3VD7A 3VSTA 3G3ZA 4U6HB 3PAVA 5I26A 5DFTA 2N4IA 4D3CH 1DANU 1YEKH 2D9QB 3W2DL 3II2A 2IH8A 1RJCA 5CM1A 4W70A 2DLTA 4M3HA 1UASA 2APTA 3GSRA 4NGHH 2AK1H 2FDBP 2WXLA 4P49A 2ARJB 1FBIH 5I19H 2AITA 3IGLA 4UOW0 3IXTA 3BSHA 2YXVA 1C7TA 3AY2A 2VLKB 2ZF8A 4P48A 4F1ZA 3MRQB 2E7LC 2YEZA 1CLYL 3C2SA 3X3FL 3T2OA 3VO0A 2GBAA 1CQKA 1Y07A 5E9DA 4F7TA 4FQLH 3O45A 3JTSA 1HILA 1N59B 4D0BB 2KIKA 1FN4A 3STZB 2FNWA 3OC5A 4FD0A 2QIWA 3DK2A 2SPZA 4PJXE 4YDZA 1NFIA 4NN6C 4EBQL 2HCZX 1F6AB 2E42A 1JZ3A 4RAHA 1DEEA 2ERJC 1YMHB 3FT4A 5KJ7C 5LAXA 1MJ8H 1JXKA 1KB9D 5D2NB 2CXKA 3DBXA 2YQ2A 3O6FC 4L1DA 3RUGE 4Q97A 1C5DB 1UXWA 4LSDA 1KCWA 3DSNB 4KMTL 2N0MA 4ZS7L 5FC9A 3VX0A 4BWUA 4IRSC 3NJJA 1AXTH 2VDMH 1M05B 2UWEE 4RRPM 2D0FA 2FH6A 1RZIB 3EGXB 5A2FA 4BJLA 4WB4A 4JN2A 2ZYDA 5BOPA 1EUUA 5MHSE 1BZ9B 1NDGA 3H53A 4E42A 3BKJH 3ZE1F 3DJRA 5GSVB 3Q5OA 3HZVB 2E74C 1LE9B 2R1WB 3WTXA 3B9DA 3FB7A 2ENQA 1I31A 1RZQA 3Q9QA 4KOBA 4POZD 5K39A 1M2OA 1RU9L 2LQRA 4BFBD 1XH3B 4HEPA 5IB5B 1YMMB 3TN0A 1E90A 4A55A 4HG4J 5AQ0A 3L6FA 4FNLL 4Q7DA 4XNZC 2V17L 1KTLB 1A7RL 4BRYB 3WUTA 4AT6A 7TAAA 3MC0A 3MRNA 1T4WA 1OGAE 4XODA 4OCMC 1Y0LA 3DROA 2XTJB 1A3LL 3D0AA 3ZTJH 1G0DA 2P10A 2AK4B 3FU5A 4YGAB 4YVNA 5M1BA 2Y07L 3QH9A 2J8UE 3JSVC 2KZWA 4L8CB 1I9IL 2Z4TA 3HC4H 4HX1B 3QI9C 4CRPA 2L8AA 3ECWA 2MKVA 1HH9B 1OLLA 4LPWA 3RYMA 3KYQA 3EH4B 4LVHC 3B9AA 4QKTA 4NQUA 4MLIA 3AU1B 4OLVL 2P67A 4JQXA 4YFDB 1TJGL 2HVKB 3GBNH 3FS9A 2HKHL 3C9NA 3L9EA 3MFFB 3WEXA 4Y5VC 3M45A 5TISH 5I1CL 2AKRA 5ID0A 5JHMA 4NYLB 4KUCF 5HDLA 1IM3B 2GT9A 3E0GA 5IMKB 2HT2C 3TBBA 2DEXX 1TO4A 35C8L 5MEOB 1NICA 4UT9A 3B5NB 1P4IL 4FOMA 5GS0C 4PVBA 4UIMB 1S9XB 3LNDA 3QA3B 2IPUK 3QCUL 3DVFA 4JG5A 1JK8A 4JPVH 3KPMB 4WKXA 1PCXA 2Z91B 1SQBG 4PY7A 5T1LD 4LGRB 2PP9A 2YEVB 5JXEA 1B6UA 7CGTA 4PWIA 1L4AB 5E94A 3F6LA 3AEBC 4YVUA 3DMMA 5B39G 5SWQA 1CTOA 5JW4N 3RY6C 4LP5A 4NC0B 4M7JH 2BWIA 4D94A 2FATL 4AV4A 2P7JA 4O9HL 3TJEL 4OCLC 2X1WL 3FDWA 1LO5B 5MHSD 3OSKA 1GL2B 3IN0A 3U1AA 3VI3F 2XNAA 1L9NA 1SQQJ 3FFOA 4NQEB 4PJ5A 1S4IA 1LTAC 4B95C 3KM2A 4G1EA 3WELA 1Q0XL 2CLVA 3NAAH 3SE9H 3MUY1 2HVBA 2QR0A 1ACYH 2XPYA 5D1ZI 3ZMRA 4QNPF 4I9XA 4AQZA 2XU9A 1OGAD 3EOTL 4U6VL 5B5EH 4WIQA 1IAMA 1CZ8L 1BGYD 4PB9L 1LNUA 1EEZA 2OSWA 1MELA 5KN5B 3X3GL 2VR9A 5HDOA 1R4XA 1JGUH 2WXOA 2FECL 1NPJA 5IB1B 5C0BB 2W88A 3PWJB 4NRXB 1UT1A 2R9HC 1BD2A 4UZUA 4BD4A 5E4OA 3O41B 2A45H 4MAYD 4FP8L 4PG9A 1OTTC 3I9AA 2AQPA 1DVFD 5KEZA 1MIMH 5JHDD 2B88A 3HE7A 4KK9D 3DC0A 4F3FB 2IGLA 4XHQA 5FHBL 3ATAA 1KJ3L 1KB5L 3H2QA 1BMWA 1SVFA 1H9VA 1NMCC 4B50A 1KTBA 2BIHA 5D7SH 3LB6C 1YHQP 3ASWA 5EA0L 1K6QH 3MUGB 5EG6C 3SY0B 3HNTH 4QXVA 4ETQA 3CVHH 2IBZY 3A23A 4NKIL 2O01N 4ODHL 3GTNA 3WKYA 1P7QA 5GGRB 3QDJB 3S3JA 2CDFA 4OWFA 3IYLW 5DJCA 2C4FT 4TNGA 3ECQA 4QRTA 3ZQ9A 4L9LC 3QWRD 1E4KA 1RJYB 1TZHA 3O6LL 3VWKA 4D0DA 1ZSHA 4X6FB 3QWOC 5C0RH 5C86A 3OKNA 3HS8A 5FW8A 1YEIL 3VMAA 2EILB 2NTFA 3EJPA 2FAUA 4Y1AE 5BS0B 2AJVH 2QL1A 4LP8A 3SOTA 5I74B 5KAIE 3KPLB 3X12B 4XNYL 5F7KC 3V5HA 3D3VE 4XGZA 3I9IA 5B21A 2EVHA 5DQ9A 1A8JH 3WN5C 1NEPA 2Z8SA 4FQHA 4OH2A 2JQZA 1MNUH 3H2WA 4WTZG 2K8QA 4BH8B 5EUOA 4XA4A 4GIOA 1XGYH 3FCTB 3K5SA 1HAWA 5FF6A 3MR9A 3BHBB 3CN0A 4BUHA 5H2FE 4ATTA 3HB3D 1EX0A 2Z7YA 1OY3B 3MLYH 4OFPA 5IWLC 1OAXL 3G9VA 4YPJA 3BRVB 2JXMB 3AACA 4FCHA 4BYHA 1DL7H 4LE8A 2ZWZA 3FQRA 4A6YL 2HFGH 4L4TA 1QASA 4JRYB 2WSCJ 2Y25A 1VPCA 3WNOA 2B1AL 1F4WH 1BAWA 2N3JA 3KPSE 4KI5C 1LGVA 2EINB 1KIUA 1MI5A 3UBFA 4F8QA 5FYKE 3L13A 3KWWA 4C8XA 5I1IL 3K4DA 1GMJA 2YARA 3GSXB 3I2CH 2L7UA 4WKZB 4Y4HB 4D7BA 5EIIB 4OIIL 1CXKA 2ESVE 2JIXD 1T0MA 1TETH 5DTFB 4EZLA 2GBUA 4K7PY 3H7BB 4XHJC 2QJKC 4FMVA 1SQBK 1T1WA 5HJBA 4MMYB 1XF5B 2AQ2A 4OZFG 5CGTA 3RI5K 4NNXA 5E03A 1DJWA 5AVSB 3BASA 5LGYA 2WV3A 3LDBC 4J23A 3DO4A 4PJ7A 1JZGA 2NQ3A 2NY7H 5L8KB 2OK0H 1BVLB 3F04A 1TOXA 2V2WA 1JGIA 4LGDE 4K55A 3O8XB 2NPSC 2BC4B 1UCBH 3PL6A 4S1SH 1MCKA 3ECUA 1PZQA 1G7IB 2D0GA 1OT4A 2YOCA 1KTRL 2BCKB 3V4PL 3CX2A 5EU7E 2IG2L 2NY2D 5CLXA 5HHMD 4XBGA 3KBHE 1M42A 2Y5QA 3D3VD 2V9UA 5I1LA 4GT7A 3IJEA 5E00A 3L3KB 4P5MA 4S1RL 2V2TA 4JDVA 2AEWA 4PCSA 3QDMD 4A7PA 1EXJA 2RHEA 3QQ9C 4JKWA 4OZ4A 3TM6A 1AR1B 1FVDB 5FM8A 5ABZA 4Y5YB 4FTDA 5C09A 3KVDD 2H32A 1RULH 1RLBA 4M8VA 2J2ZB 1WFUA 3TZVD 2P44B 5EBWA 1U2YA 4XNQA 4A66A 4BZYA 1N73B 5D1XB 1BGXL 4Z7NE 4UV4L 4LLMB 4XNUL 2XVGA 4EQ3A 2UZXB 2YSTA 2E76D 2AZUA 1URQB 4R7NB 1WJ3A 1ID2A 3RZCD 1CVSC 4UZSA 5CN3A 4HHGA 2LU3A 2EO9A 1LO3H 4HW6A 4X5WA 2NY4D 3OM3B 4MZIA 5H8DA 5CF3A 1S5LX 3VXPA 2QMJA 3QS2A 5LVEA 4JK0D 3KPSD 2WD0A 5ILTH 3T0DA 3L72J 4WHYH 2HP4A 5I28A 2YS4A 2AV7B 3DXAD 1T3UA 5GRWA 2AI0L 2ESVD 8PAZA 4HIXH 1UWGH 1CFBA 1JNLH 3CPLB 4M4RB 1N0XL 4NUJB 4HOWA 5BW7A 4M02A 4ZUTB 1X79B 1MDTA 5L6YH 2IH1A 2EC9U 4HHWA 3CCMP 1GS7A 2BP0B 5B1BB 2HPTA 1ES0A 3QRBA 5CILL 3JWNH 2ZXGA 3BZ4A 1LTJC 3JV0A 4Y9EA 3CFTA 3LRSB 1P2CA 4CL7A 3U0WH 1DN0B 1YECL 2QQNL 2DAVA 4JNXA 1CUOA 4EI0A 3FSOA 1MHEA 1I7UB 4HPOH 1OGTB 1ZTXL 4Z7UA 2ZFCA 1DQQB 4G7QB 4PJ8D 5DJDB 4JL2A 2JJUA 1PL5A 3NUKA 4I1RA 4ELDA 4OF8A 2RACA 3F85A 4ZW8A 5C0DA 1YUHA 1YG9A 4WJG3 1GY2A 4X83A 3VGEA 3U2SA 5FO8B 3W39A 4F8LA 2CIKB 1JV2B 3B2VL 1FG2B 2FE0A 3ESUF 4FQIH 5DQDH 4IOFC 1MREH 3LIEA 2EDWA 5CJ8A 1RE3A 2W60A 5MEQB 1HZHH 3T97B 2BP3A 4NPJA 3OHXA 2LTQC 5F71A 1MCWM 1XTGB 3P54A 3X13A 1JF6A 3ZOAA 5C3LD 4D3CL 3HR6A 4L5FE 2I5YL 3AJ7A 4MZ2A 2DJ4A 3D34A 4BINA 4GUPB 4NGHL 2AK1L 1PZ5A 1KXVA 1UEYA 4GRWB 3BVDB 1E8YA 5D2LA 1FBIL 3EBGA 5I19L 1A4KA 1AACA 2K9UA 3B1UA 2R29H 2ZXWB 3Q6FB 4HWNA 2J57A 1XX9C 3EG9B 4FQXA 4HGMA 1RJLA 1XSOA 3V0HA 1FA4A 3AGWA 2CG9X 2K9JB 4HUWA 1I3RA 4M1CC 5LGHH 4FQLL 3TVMA 1E4WH 4FABH 3UACA 2NY1B 1CFVH 5D9SA 5IMMA 2C9AA 1T22A 4YXHH 1SQBE 1JZ7A 3E7KA 5IG7A 3SB3A 3AQZA 1IEBA 4OCXH 1SHXA 3KEDA 5A40E 1E43A 2F5AH 3BAIA 3PWVA 4AYDC 1MJ8L 1LK2A 3Q7JA 4PV8B 5EEXA 3FUIA 3KG5A 2WMMA 1HXYB 3UBXB 2NY6D 3A0BH 1R5VB 4IIQA 4KKAD 3VAEA 1U8OA 1W8NA 3SKUD 5KS9E 1O7VA 2PNDA 2VDML 3L35A 2G3MA 4J3OH 2Y6SC 4BK5C 3WY2A 4FS0A 1Z9MA 2ZUXA 3RVVC 4N68A 1PY4A 4RAUB 1LEIA 2NSQA 3GI8L 3F5HA 5EF0A 2EUXA 4KX9A 5SV3A 1JZ8A 1MIEL 1PD0A 5FM5M 1A5FH 1QSVA 1TU2A 2BLFA 2WCSA 3GFUA 3FOLB 3E2HB 1UA6H 3CC5B 2X87A 2IAMB 3KNBB 1FNSL 3B7YA 4WW1A 5E1QA 3FT1A 1NFDA 1RQUA 2GUOA 3FF8A 4Z7WE 3U6XA 4Y4KC 3VVWA 3P30H 3K8LA 1PFCA 3CH8A 2WXFA 2XPZA 3ZYJA 3VFPB 5TQ0H 1ZLVH 2Z65C 1ZVSB 1TTFA 5JA9A 4KQ0A 1UATA 2F7PA 3IFNH 4HA1A 5AWNH 3HC4L 1E3XA 3QORD 4OV5A 3RBZA 4B9FA 5C6TL 3VU2A 4EN3D 1ZK9A 2C1PB 2WXGA 2EIZB 4LHUG 2YD2A 1HOEA 3GBNL 3RL0g 1JGEB 3BN9D 2KS1A 4FDWA 2G2RA 3GSWB 1DBAL 1XEUA 5DHVA 5ITFB 1KYUA 5ICXB 2Y06H 4YO0B 1WZ1H 3ZO0A 1J11A 1QFOA 3G5YB 1P84D 3GMLB 2YD5A 4TF4A 4WO4D 5EEWA 3QQNA 4PRPA 3DX7A 3MRJB 2MKLC 1TYJA 1MJUH 3FSVA 2X42A 4M1GH 1GW6A 1SQBD 2HPCB 4XOAA 5I30H 1KFAH 1OW6A 4JPVL 4PRHB 4NKDA 3SDAD 3FFDA 4K71C 5CCHE 1T1YA 5JR1H 3WUWG 5DA4A 1FSKC 1OE2A 2NR6A 1M6UA 3MPCA 4HUVA 5DQJB 4V1DE 2OMYA 1ORSB 2Y22A 1IC5H 4QUOA 2DM4A 2YUXA 2QE7H 2EZ0D 2R2EA 4Y89A 4M7JL 1MCIA 5KVDE 4GRWF 2ITEA 4IJ3B 1VACA 2IDSA 5KVEE 4EXKA 1JM0A 1MLCA 4CMMA 2BS9A 1X5HA 4JR9L 1NVOA 4IEFB 5HYQA 2A1WH 4DVRH 4GRLD 3DURB 4J3BA 4LKXA 4GPVA 3MODH 2D2CB 2KT6A 4M56A 5CEYB 3VH8B 3TEUA 43C9B 1XHHA 2YBGA 3HKFA 4YK4C 3RTQA 3NAAL 2VERA 3SE9L 2G0LA 3DVGA 1ACYL 2VUYA 4AOFA 3A22A 3D52A 4L1HA 1Z5YD 4JQIH 5FYJE 1NC4A 3W9DB 1USZA 1FZMA 3HG0A 2QRXA 2IQAA 4ZFQA 4IL6H 4FHBD 2MTAA 4PW4A 1OCZB 3GZPA 5JQIB 5EBLA 3CXDL 2ADGB 4OY9A 1JGUL 2IBZG 5HI5C 3X1NA 2PCPA 2LHAA 5TFSH 2ED9A 4JPWL 3S4SG 3RKPA 3G3LA 3BW9B 2V6HA 3VD5A 3WFEL 5IVXB 2L7JA 1KJVA 3B5NC 2OMVA 1MIML 2OZ4H 2OSYA 1GDTA 1G9NC 3EH3B 3H2PA 3QT2A 1S7SA 3GINA 5JIHA 5T8IA 5HDRA 3BZEB 5C1MB 1LP9E 3ABVC 1QEWB 1I4FA 2OSLA 1RAMA 1TKWA 3DYMA 3WS3A 3H0TA 4AIEA 2C26A 2FYUG 2VDOL 1L4AC 3Q01A 1ZDQA 5EDXA 3ZMEA 1K6QL 1XSIA 3HNTL 3CVHL 1NMBL 1E5YA 2VNCA 5CCHD 3U59A 3BQUD 5C92A 1YQ4C 2Q76A 3VDAA 1I9JH 1GL2C 1KYOJ 4D9QE 3TF7C 1AXIB 2NNFA 3CXHJ 2EXWC 4R7DA 2MCG1 4H25B 5JUEL 2VXQH 2HLFD 3SY6A 5BZDB 2YQGA 2O61A 4F7KA 2JEEA 3IWUA 4Y19B 5C0RL 5DHEA 1JZ2A 2BXZA 2FGWL 1TO5A 2MPVA 4KV5F 2AJVL 4LOUC 2IAND 4AQ1B 4BWNA 1N7SA 2E8YA 4WI0A 4GQZA 2X0WA 2R2BB 5D6CB 1EBPA 1ED3A 3NCEB 3TV3L 4J3OF 3TBSA 1HHIB 1MNUL 1OF2A 2AXFB 5LDSA 3UGXA 4NC1C 4RETB 2G3XA 4L9DA 4M7LH 4G43A 1OQXA 2GUVA 1XGYL 5JYMA 3RRQA 1BQUA 2Q1KA 1YC7A 3VD1A 1HHKB 1MW0A 4I2LC 1DFXA 2VDQB 1JDDA 3L3GB 3HBZA 2VN6A 3TESA 4IBZA 4HEMA 1DL7L 2IPTL 3MBED 4RX4D 3O8ZA 3WEMA 5EPMA 1S3KH 4RRPG 2H8PB 2R27A 2HFGL 4R5XA 4CBPA 4ZFGH 4ZUWA 2COVD 2IWKA 2Q10A 2X4QB 2O6PA 4J12A 4WWKD 4YHZH 4YJZL 4Z7VA 5GXBB 1U8MB 4PJAE 1EQWA 4XBEH 2F74A 3H6AA 5C0IA 4H88H 5FWQA 1WWAX 3B9VA 1T0NA 3I2CL 4U3FJ 4MKMA 4MCYA 3WFZA 1QZNA 4AK1A 2EDEA 1TETL 4HLZH 3L48A 1KT2B 1NYHA 4P5RA 1G6RL 3EF7A 5EU6A 2UXVA 4Q2ZB 3CVIH 4HXBH 2BVQB 5GGRY 1BDCA 4LHJB 1K72A 4JCWA 1V8HA 4GKNA 4NT6B 4D9QD 4NQSA 3UERA 3WIFA 3ZN6A 5I74C 4N86A 2VLRE 1R3LB 4IMKA 3KXFA 2OK0L 2NY3B 2X5PA 3C6EA 5JHBA 4BKLA 3DI2B 4I2XA 1UCBL 5HYEA 4FKHA 1QLFA 4S1SL 4LO9A 3C9IA 1NKNA 2WXKA 3KPQB 1XF1A 3KMDA 2E7HA 1A7QH 2R0KL 2NPLX 1XZWA 1UKQA 3WNJA 1OCRB 3F6JA 4JEGB 4S0HA 1KQSO 1F90H 1I9EA 1CE1L 3ARDA 3JTTB 2QKIB 1U8KB 3BYYA 3M7OA 3OB0K 2BY3A 3LW5J 1D6VH 5C2BH 1G1KA 4PS8A 3UBHA 4AQEA 1RULL 5DHMC 3WE6B 1KB3A 4KUZL 1M1JA 4L8DA 4IS6B 2NYYD 1UXLA 2CKNA 3EDJA 4IW4C 2YJLA 2CHZA 4OJDH 1ESOA 2SEBA 4JPIB 1JS4A 4N25A 2H3NA 2WQXA 1E28B 2LR4A 4OM0H 3U46A 1FL5B 1N26A 2P1JA 1LO3L 4MD4B 5GS2H 1F1AA 2Q86A 4Y4HC 5AL8A 4EUPG 1HXMB 1BFOA 2BNQA 4DT0A 5FFLA 2WKOA 1CFTA 1JN6B 2DM2A 3GZQA 1NKOA 2OX5A 5CBNA 1W0WB 1NOAA 3HZ3A 4N6RA 4UINH 4YL9A 3ULVH 4PCKA 3W37A 1T3JA 3EGSB 1S9VA 1N2RA 4JHUA 3QH3B 2DI9A 3D06A 1HWHB 4KXCA 4HIXL 1ZEAL 2KKQA 4YHIA 5J1AA 3W11C 3KWXA 3VFSB 1JE6A 2QQLH 3O8XC 4Z77B 5L6YL 2B1HH 3TFKC 4BWTA 3HHSB 5D4HA 2WBXA 1Y8AA 3PP3K 3TEZA 3HE6B 4NO3A 4P99A 4AW7A 5CCGE 3ZVVA 3T1WA 2L04A 3ARZA 3HE5B 2VLRD 1TQBB 1IBYA 2DLEA 5CR8A 5E6YA 3U0WL 2DW3A 1J1XH 3MBWA 3QFGA 4ABQA 5CO1A 3D25B 2KYIA 4LLUB 3ARBB 3NTCL 3H1KJ 1ZT1B 3PUUA 3GBMH 2ZXXA 1AR1C 2GJRA 2Q9IA 2FEJA 4N2GA 4Y5YC 4JQVA 4XWOC 4HPOL 3ETBF 4TS6A 4Y2OB 3ABLB 4BQCA 4C4KT 3O3BA 2XBZA 5APUA 4M6ML 1XR9B 2N01B 3F6IA 3ZDXE 3WFCH 4OZGF 4QYOA 1N73C 4RNRB 4IBWA 4GRMA 3PGCB 4WFHE 3EAKA 5EBMB 4ISVA 4AVKA 1URQC 4AEFA 1GRWA 3LZOA 4JDEB 2OPCA 4UNIA 3SDCB 1ONQA 2EEDA 4QY8B 4OZIE 4OKVB 2DQCH 3FUNA 3LYRA 2R3SA 1ZAGA 3GSUB 4LFHG 4P5TD 2Y23A 3DOSB 4ZFOB 5IBTH 1HZHL 5A2BA 2WLLA 4KTEH 4HAFA 1BZOA 1PX8A 4CUCA 4Z7OB 3TK1A 1TCRB 4GAYB 1JRHH 3SKOA 4QRAA 5HI4D 4PD4H 4XMWA 4OGAC 3EJZD 4I7ZC 2A0LD 4PTUA 4IU3A 4DKAA 1KGIA 5DK0B 2ZAHA 2ICEA 5HYJB 1AHWA 1NC2B 3ULSA 4BFIA 1YDPB 2W0FB 3D2UD 5KJ7D 1IIIA 1TTBA 3V55A 1I3UA 3VUAA 2FX9L 2HX8A 1U3ZA 2NDGA 2AXTE 1XF4A 2HFEA 4WU7B 2BVOB 3OAYK 5ESQA 4C7NA 4OGYH 4H8WH 2O6DA 4XNXH 4PJGE 3VYOA 5EU7C 5I8KH 5LGHL 1XIWA 1E9PB 4A2DA 3A4AA 5CCGD 1E4WL 2X4UA 4JZJB 2R1XA 5TGBB 3LRGA 4DP1X 2DQHL 1CFVL 1JPSH 4UDTA 3NZ8A 1CB4A 1FH2A 1WFIA 4NO5B 4OCXL 4OTXH 1WA0X 2F5AL 3T2NH 4EIGB 1F3DJ 2C3VB 2ZKWA 1J05A 3VI4A 1FYTA 5BVJA 2OLDA 3PG2A 3ARFD 3OGCB 4D0CB 2EUWA 4XH2A 5DVMA 2I69A 3IAGC 4U6YA 1OW7A 5KBDA 1HL8A 2EYRB 3E6HA 1A6VH 5C07A 2Q1EA 3P2TA 3CX5I 3V8CA 4GXFA 3L9YA 4NO0D 2ATKB 2NNAB 2WNKA 4G42A 4HH8A 2HLEB 3NVQA 2XLLA 2K6YA 2FX7H 4MMXC 3RPIA 4EDWH 1N8ZA 5J4MA 1A5FL 1RUQH 2BSTA 1S1CX 5IBUB 3TNNA 2ZXDA 1ZMEC 1ADQL 1LDSA 2Y9YA 1UA6L 4FF9A 5PAZA 2C3HA 3TWCH 2C0WA 4TT3H 1HX0A 4BRVA 4HS8H 1EDQA 2ZYAA 3BFQG 1KNOB 3FL7A 5DMKA 2HJFA 2O93L 4XE5B 3WMM0 3QIBB 1SXZA 1DZBA 3A4FA 2VN3A 3P30L 2HT4C 3E6FB 1IFNA 1OE3A 1U93B 3B3IB 3BSZA 4H8QA 3IDMB 3ESMA 3D85A 2JJLA 2ZF9A 5DJAB 1H8OA 4IGBA 5AWNL 1VFOA 3IFNL 3E1ZA 4J3XA 4B6ZA 3V9FA 4LL4A 1PLGH 1IQDB 3EF4A 2XKMA 1H6TA 3I75B 4KKCC 4LHUD 3FQWB 1VGEL 3QJVB 1CFQB 4BXLA 1JV5B 3SPGA 4NQDE 5LWYH 3WIHA 4WY7H 3HLAA 4XC1H 4ZG1A 4HB1A 2J56A 3CFCL 1FGVL 3DPBB 3MRRB 4YXKH 4HUUA 4X9FA 2XXGA 5HHNA 2E46A 3ULVF 3IU4L 1NANH 3DYOA 2RN0A 2XY1A 1WZ1L 1UIXA 3GDBA 4DP5X 5JMRA 5KYUB 2CLRB 2J4WH 3GXMA 3SYOA 5SWSA 4X5LA 2FQDA 3FUMA 1MJUL 3GSNA 1AS7A 2W5PA 1MQ8A 3UOAB 1KFAL 1YRKA 2YKQA 4JX0A 3NEEA 3VXTB 3GMOA 3WNLA 5JR1L 1G7JA 4MQ7A 4Z7OF 5JORA 5F3FA 3SDXB 5C0AA 5B7EA 4UANA 4PHXA 1VKXA 2BJMH 1B0RA 1HYRC 1IC5L 2OYMA 3PCYA 5BOJA 3SJVB 5BQ7A 2V37A 3EGDA 3E2HC 4N2CA 2X3CA 4X6BB 3MUUA 1YBKA 1JGDB 1F6LL 1QSFE 2IAMC 2JB6B 1RURH 2VO5A 5D7EA 1A6ZB 4Q6IA 3PP4H 3U0PB 4X9YA 5FFGA 3IAOA 3GSOB 2A1WL 1UEMA 3V10A 2IFMA 5IW6A 2P28B 5FK9B 3IK2A 2KDGA 3EBHA 4KFZC 4H44B 1NGXB 2YLKA 1OTTD 2APWA 2ZOKA 2QADB 2ZXCA 3GJFK 3HZYB 5FOJA 3SPHA 3UDWC 4UOJA 3WS6A 2Z35A 3N0AA 2WOYA 4FFZA 1AS6A 5GGTA 4L4VE 3VSQA 3T3PB 4JQIL 2MOGA 2A99A 3BWSA 5IFJB 1OCWL 3PTZA 2MJWA 2IBZD 1MKFA 4N1EA 4PGEA 2FJHA 1I1AB 2ALWA 1RZ7H 1JPFA 1KPUB 2IEPA 3F7QA 3VD2A 1DDHB 2IDCA 1VA9A 2CBMA 3TYFB 4BFOA 5TFSL 2C8NA 1R3KA 2DI7A 2RFXB 3IDXH 4H7VA 2W6AA 4NQDD 3H85A 4G9FB 5I17B 4AZ8A 4W9JC 1MCNA 3KHOA 4M3JA 3WJJC 4QWWD 1JZDC 3ZTJG 5B66H 3MRLB 1GJIA 3II6A 1QZ1A 4N4YB 1XL6A 4XMZA 3GD1C 3K2MC 1GYAA 1MUJB 4PREA 4K7FB 4O2EB 1S9WA 1J88A 3S3SA 3MLWH 1INEL 1MVYA 3AU0A 4NNYB 1U42A 4WI9A 2QGCA 1O6SB 3ABKB 2H47C 4I77H 4DQOL 4P2AA 2D8KA 4IJ3C 1BM3H 1YVLA 3MNZA 4GG6E 1GCYA 1E2WA 1CYWA 1I9JL 4ZMNA 2CK3H 4ZFFA 2DQDH 3HLKA 1U3HB 3QAQA 1I8MB 1AQDB 1BDYA 1K4DA 2UZYB 4JRWA 3ZDYB 2UY6B 2AV1B 2AAAA 3B2XA 2GBTA 1OSZA 1L7TL 4D6TG 2RH0A 4B97A 2CRZA 2DYRB 4UAHA 2WMPB 1QSFD 4BSVA 2A6IA 1YJWP 4Z3HA 1RPUA 5F1NA 1IGTA 4ADJA 2FL5B 3F7YA 4O51A 1DO5A 3U4AA 1P5UB 1HL4A 1ASQA 3SBPA 3H1JJ 4DUWA 2ICWI 4UQ3B 3CFBB 4BFNA 4NQVB 2VC2B 1A7OH 3OKDA 4M7LL 2N7BA 4APXA 2X6BA 1M1XA 1GK4A 3VMYA 4L4VD 2W38A 3H1HE 2WSKA 4KQ4H 4PJXA 3TPUA 3BGFB 2CCLA 3SDXF 5I6NA 4W68A 1DYZA 3T1FB 1C08B 1MG3C 5T1LA 4YHPB 4DKTA 4XOEA 4K8RH 3IBEA 4DP9X 1IAIM 3RUGA 2WT7B 1F56A 4ZFGL 1DCEA 1KXTA 1U7JA 1JXGA 3K5RA 3A5TA 1JHLL 4V2BA 2Q3ZA 3FN0L 1MCJA 1ORQA 4XBEL 1MCOH 2V0AA 3MAWA 4ONHA 3ZE0B 4H88L 2AXHA 4X0KB 4GMSL 4OLWL 3SGJA 3C1LA 3U1SL 2YRLA 1HGVA 1FE6A 2A9MH 2WCGA 1BVZA 2XTSA 1U8CB 5F7WC 2A45G 2QVIA 3BP4B 3ILQD 2TRYA 4JFUA 3V7AG 3BDYH 1EDIA 1CDHA 4YFEA 5BJTA 4GKSB 3TU6A 1J7VR 2X4TA 3CVIL 3T3PF 1WCBA 4C56B 4BXSV 4HXBL 3HKZA 2NNCA 1WBXA 3AG1B 1ZY9A 2UXTA 1IAKA 1OGAA 2H2PC 5F3BA 4GUOA 4AQ1C 2DIJA 1MCDA 3SBRA 5DURD 5M7QA 1KPRB 3IJSB 1A25A 2J8UA 1OZUA 5DJTB 2DQJH 4MHHI 1TVBB 4DNLA 2UV3A 2JKLA 2CDEB 2C9UA 2TAAA 4XCCH 1IJ9A 4FL4B 1A7QL 5J3HD 1HWTC 4MAYA 5DR5H 3PAUA 1P7KA 2CR0A 3MJ9A 2VL5B 4KJQC 1DVFA 2VDPB 4HG4K 2JJSC 3EYFB 3EFFA 1F90L 5JHDA 4FLSA 3BVNB 2WITA 5L2JA 4HJGA 1D6VL 2F53E 1MPAH 5LO7A 4A67A 1NJIQ 1QNIA 4QRUA 1FCCA 2YK1H 2A4CA 3NSFA 5F89B 3DTXA 4JHVA 1CS6A 2CSPA 3BVUA 1BZ7B 1GU5A 2XN0A 1YJNP 5CZXD 1NU1J 4AYGA 3D12B 2VDRL 1UA3A 3EJQA 3MLUL 5DGQA 4OM0L 3ZDYF 4YHYB 2QQKH 2V33A 2PCYA 3Q1MA 1AVAA 1M3IA 1P1ZA 2NT0A 1AHKA 5LCVH 5IB4A 3ZDZB 2X6VA 5E6IC 1GOFA 3QWRA 3L08A 3S3DB 2HUHA 1MWAB 3ELAT 3KYOB 3ITKA 4FTVE 4GBXB 1AG6A 2AJZA 2XYCA 4P57A 4UINL 3ULVL 1Y6NR 5BRPA 3QNYA 2K37A 5J6HA 5IF0A 2B3RA 1QI3A 4TSAL 3UAEA 2YD0A 2NW2A 3V6FA 3VXSB 4OCNC 2K70A 1MHCA 1H15A 2IV8A 1VF5B 3GDCA 3NJMA 2KNCA 2ZUVA 4ONOA 3QJFA 1YN6B 3FQXA 1PV3A 3D87B 1MHHA 1L0LJ 4P5KB 1ECZA 3NIFF 4JKPH 4OB5H 3EFDH 1U4FA 1NCCH 4IKJA 3UAJC 1UUSA 2Z7UA 3WENA 2F61A 5IREA 2VN5A 1FO0L 1HHJA 1S7WB 2X7LA 4JFOB 4MB5A 1J1XL 3ME0B 2QKIC 3BRTB 4E5XG 3GBML 1HEZA 1FVCB 1M8OB 4O2CA 5FR3A 4W93A 1SQQK 4IOFD 5KVGH 5E08H 1DFBH 2CHXA 2R1YB 1Z7JA 3Q2LA 1LE5A 2F54E 3FYEB 4NB7A 3ZE0F 2DJUA 5EO1A 4GEIA 1EJ6A 1SLUA 3AECC 1QX1A 1ZTXE 2VM3A 2KSEA 3JZYA 4JKLA 4MNGE 3VI3E 3VVVA 4KNTA 2NUPA 4X5XB 1YPZB 2F53D 4N0UE 3L3OA 1FPTL 5CP3H 2OMWA 2JIXA 3OR6A 1K3IA 3QO1A 2PTTA 3RWIA 3GHEH 4LFHD 5B3JF 2PWDA 5AOZA 3QZWA 2DQCL 2OJEB 3FTGA 1XGUB 4ORGB 5T1KB 1UM4H 1T6AA 3WO4C 4JHZA 1FOSF 3SE4A 5J8OA 2B87B 4H8UA 4XBPB 5IBTL 4D8PB 1OPOA 1H89A 1QVGO 4HKJB 2FO1A 2P5EB 5I9QB 4L3EB 4B9JA 4KO7A 1A6UH 5AW8B 1OB1B 1JRHL 3MJWA 4RGOH 4HLJA 4FTVD 4XWGH 4M43H 3BIBX 2WSFJ 3D48R 1NCJA 1AHMA 5FCSH 1HVXA 3Q2NA 3GRGA 1J18A 1RK1A 1YEGH 1MJ7L 2FX8H 1MXDA 1XGRA 3WXWH 1A7PL 4LDCA 5DYOB 4XRCB 5KSUA 3I5CA 4FXGC 2KI6A 2D31B 3D3VA 3FK3A 4JFTA 1TQBC 3F5WB 3WFHA 4QHLA 2EIMB 4YC2B 2CCVA 4BDVA 3AQDA 3QDMA 4IHOA 3ARBC 4OGYL 1BSIA 4XNXL 2ZKHH 1T4KB 3MGTA 4Q9CA 4OJFH 2QSCH 2BNUA 2YXFA 1DJIA 2Y6SD 1F1GA 1U3NA 4RMSA 4WHYG 4TQPA 3D18A 1JPSL 1N68A 3TZVA 2XA3A 4H2CA 1PGJA 1DUYB 3V7MA 4LL1A 3B8SA 4DP4X 2XTJE 4AGNA 1KN7A 4G11A 3NCYP 4OTXL 3T2NL 1KZYA 4L2YA 3ZDZF 1NBCA 3RZCA 1BV8A 2D03L 3TIEB 1BG1A 5F7BA 4J1UA 2XFXB 4NKMB