3KDPB

Crystal structure of the sodium-potassium pump
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
286
structure length
286
Chain Sequence
NSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRSRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the sodium-potassium pump.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
total genus 33
structure length 286
sequence length 286
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3kdpB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 3kdpB02
5APQA 3VN0A 5APVA 1OWAA 3IR9A 3MD0A 4AYCA 5AVUB 3LIDA 3M91A 2KP8A 4EOTA 5AW5B 3NTNA 4GT1A 1IO4A 4B86A 1T2KC 2QM7A 4C46A 2R5BA 3KDPB 3LIEA 4JYBA 1T2KD 1JUNA 1HJBA 3TK1A 3L35A 3A2AA 2H7HA 5APUA 5AW6B 5APYA 3V5BA 5AW0B 5AVQB 3P32A 1H89A 5AW7B 1MFZA 2Q3IA 4RETB 1J2JB 2ZXEB 5AW4B 3TNUB 3VMXA 1S9KE 1DH3A 3A5TA 5AVYB 5AVXB 2P2UA 5AW2B 2C9LY 4LC1A 1NWQA 3O8ZA 5AVRB 2R32A 2ZFCA 2WWWA 1OXZA 3OAKA 5AVVB 2YO3A 1KQLA 2Q5UA 3VYIA 2R5DA 2YO2A 1G2CB 3HTKA 3WGVB 3L37A 3A3YB 3M0DA 2JJLA 1HWTC 3I5CA 1CZQA 1CSBA 4JYCA 5APSA 5APXA 5AVTB 2BASA 4GKGA 1NAFA 2E43A 2N9BA 5APWA 3VMZA 4AUWA 1GK4A 1HBWA 1X8YA 3V4QA 3V4WA 3TNUA 1JNMA 2R3CA 3A7OA 4KHXA 2WPRA 1GU5A 3HE4A 1MV8A 1FOSE 3HE5A 1HUCA 3NXSA 4C7NA 1H88A 3B8EB 2WPSA 5APTA 5AW1B 1SP4A 3T97A 4XE5B 3M06A 3VMYA 3M0AA 3M9HA 1GU4A 5AW9B 1GZLA 1S9KD 2Z5IA 2W6AA 2QM8A 2WT7A 3NFQA 1FAVA 2WPQA 1FOSF 3UIAA 2Q7CA 1GTWA 3P7KA 4DZOA 4RESB 2E42A 3VTPC 2XV5A 3L36A 2XZRA 2IPPA 2Z5HA 1GD2E 4HYTB 2P7JA 2WTYA 3P8MC 3M9BA 2WT7B 1CI6A 1MUUA 3MGNA 3TYYA 5CMZA 3NMDA 1YYCA 3SWFA 1A02J 1SLQA 2P67A 2VRSA 2YNYA 4I2LC 5AVZB 5AW8B 3WGUB 5AVWB 5AW3B 2C9NY 1CI6B 2W27A 4M3LA 1H8AA 5AVSB 1GK6A 4AQRD 4I6MC 1A02F 4C7NB 3KQGA 3HE5B 2XU6A 3HE4B
chains in the Genus database with same CATH superfamily
1P7BA 3EYFA 1EZVG 1FC2D 1DN0B 1FE8H 2FJFB 2K78A 3DV4B 3LKSA 2EE3A 4MJ5A 1UEYA 2CKBA 1O6VA 1X5AA 2ITFA 3A0OA 4JJ5A 1A9BB 3ULUE 3VXMB 1PY4A 2ATPB 4YE0A 4MDJA 3VFGL 3VG0L 3QPXH 1YJ9P 1WTGT 5DJXB 4ASVA 5AYUL 4XXDB 3LIZA 4XBEL 4HQQL 2D03L 3DX7B 2G5RA 4C58B 4G6FD 1M7UA 3SDXE 1U58A 1S8DA 1NCOA 4NAJA 4Y16B 3WXVH 4M1DL 2LAAA 4LCIL 3EFGA 2NLJB 2A1WL 4G9FA 5TQ0L 4YHLH 5C86A 5AVQB 2VW6A 1RVFL 2M0BA 2CO7A 4MYWB 5TK2A 2FATH 4H25B 4IU3A 5T3ZL 4S2SA 2ESVA 4LC1A 4OFIA 5ICXB 1ZLWK 3CD4A 1N7SB 1JV2B 4PRAA 4JFDD 4LEOB 3I6SA 3WFHA 4QRPE 3SOBL 2E5EA 3BP6A 2X6MA 4GI8A 4L29A 2GTWA 4YIQA 4FF9A 2VC2B 1YQ4C 3C75A 1RJCA 1C5BL 4L76A 2F54E 2DQCH 3KXFD 4QRAA 2BIOA 1IEBB 2R7EB 5F96H 5I75C 1KSRA 1OGPA 3SKMB 3MN8A 4IMKA 4UTAL 2H89C 4N5EC 2O5XL 5C92A 1N7SA 4P5MB 1JGDB 1OY3B 2IC2A 3DVGB 1FBIH 4AQEB 4UDUB 2CO7B 3KAAA 4OZIA 2R3CA 4ANVA 2W88A 3RWDB 2O6FA 2DBJA 1A7NH 3BGAA 5E1IA 3EJJX 5I8EB 3WU2E 2FR4A 3SWKA 3MO1B 1MWOA 5FUCC 1SFDA 3V4UH 4JAMB 3QISA 1AGEA 3UABA 1QA9B 3UROR 2WZPA 2WWNA 4PJIA 1W8EA 3VWJC 3MDJA 3D0VA 1SJXA 2IYPA 4U2YA 3UZEA 4A7TA 3F2LA 2C0XA 3UERA 1A9BA 3SDXA 2R15A 1S5LH 2LVCA 2QFPA 2Y69B 4WW1B 3GUTB 2B4CH 5J12C 4FFVD 4OCYH 3ZO9A 1QR4A 2PXYC 2F1BA 3LH2L 4TSBL 2YPLE 4RX4D 3MBEB 1QBAA 3ZDXE 3KPMB 4LL4A 3UH8A 1KCSL 2R2EA 1N0XL 3CDFA 4M4RB 3MOQA 3MUZ1 1KIUA 4AM0A 1LO0H 1Y18B 3FT1A 3O9WA 1LEKA 1DJIA 3CN3A 1ROWA 3QQ9D 5JOFA 1I85A 2XBTA 3TA3B 2ORBL 4PLKD 5IZ7A 3ZVVA 4ZKPA 1EHNA 1XQ4A 5DC9B 3RX8A 1BYOA 4J8RB 3DX4A 4C7NB 2OPCA 1HZKA 1KC5L 1UENA 4OLYH 1DSWA 5CP7A 3UTTD 2W83C 4P4KB 4DFHA 4O02B 3MRCA 5A7BA 4M6AA 1NCGA 3L1GA 3CWGA 3QQNA 5T1LA 3EDDA 3VGBA 1AOZA 3U0PA 2JKIS 1KQFB 1JPFB 4JM2A 5DMIH 3TC9A 4PJEB 3FUIA 3QAQA 2OYLA 2WSSH 2XV2A 1SM3H 3ARGA 4S1RL 1MKMA 1NFIB 2GHWB 5FECA 1H3PL 5APUA 3MV8A 2CLRB 3W11D 3MBXH 4AI7A 5EG6C 3AXLB 1H8LA 2G3AA 1QP1A 4KX8A 2DKMA 3LHAA 2EDMA 3OAZH 2Y9ZA 1GS7A 2BY2A 4OH8B 2WSDA 3ZMNA 3L3IA 1PFOA 4MDIA 4OQTH 5HHVL 5IVZA 2FGZA 3FFCE 3TYGL 4ONHA 2ENQA 3CD6P 2BVOA 4XXWA 1QEWB 2VH5L 4XH2B 3QNZB 4FTVE 1FORL 4PTTB 5EA0L 4AH2B 3BLPX 3B5ND 3MRPB 4ELMA 4WI3A 4HKBA 2QSCL 3HTKB 3M46A 4JFXA 5D1XE 1OLLA 4WI0B 4CSSA 5JQ6H 4JJOA 4D6TD 4ODSL 1E9QB 1AZZC 3TVMA 4NUGH 4NHCH 4U7JA 1DQTA 2EKSA 1J10A 3TCLB 1PZUB 5ADOL 3DUSB 4KI5D 2Y0EA 4J12A 4YDKL 2AJ3A 3PV6B 4Z7QE 1J0HA 4WEBH 2AKRA 4B9JA 1SVZA 5DSCA 5AOIA 1G7QB 5IB1B 1KMIZ 4FLQA 4OQTL 5HHVH 5DVPA 1QYGH 3WXWH 4W6XB 1IUZA 2Y0CA 2XWJB 1MFCL 5BNXD 4G9DB 4JZNB 1E28B 1JF5A 1HSBB 5EN2B 1GU4A 2NQ3A 3L95A 3OKMB 3R06A 1K73Q 3MFFB 5ESAB 5A16B 5CCHE 3QORD 3O2DL 4XN1A 5F2FA 5KSAB 3BP7B 1LP9E 1SOKA 1JK9A 5LG1A 4BKSC 3UIZA 4WUUE 1MJJB 2VDMB 4DO5A 2NY1D 1OSYA 2VDLH 3U1SL 1RCYA 2CKBL 4H13B 3CSBA 1I1AA 3FRUA 3UYOD 1MJ8L 3GBNL 3G5ZA 5FYJU 2V5TA 3UCRA 3MGNA 2Y0SA 1S7QA 1C5DB 2WLIB 1PLGH 4AIOA 5FOBB 2W5PA 4I8DA 4WFFE 1SS1A 2IDFA 2VXUL 2VRSA 3CMAP 2H9GB 2P5EB 3AU1B 2ARJB 4R4BA 3W9EB 3IGKA 3VD1A 2J2ZA 4GYBA 5GS0H 1ZV9A 1URLA 3WTVA 2IDUA 3HE7B 1VQ6P 1SQPJ 1WFTA 2WW8A 3W38A 2CCLA 4HMDA 3O4OB 4FFYA 4M3KB 3SFDC 1JN6A 3RZCB 3NFPA 3KVPA 4YPJA 3Q5YA 1GKOA 4OLXL 3W2DH 3S97C 5DJUB 2OQQA 2IH3A 1BVLA 2EO7A 3TDKA 2PO6A 1NIFA 1DUZB 1AR2A 1TQVA 4W4OA 2WXOA 2WIIA 3MV9E 2AI0L 5FWRA 5AOMA 1ACXA 1IE4A 1BCCJ 2A45I 2EC9U 2FBJH 2KT6A 2WNKA 4GAGL 3RTQB 5C8JA 4O4YL 2NY4B 4FEMA 1OW8A 4TVUA 2O72A 3GMLA 5EBLB 5FK9B 5HP5A 1NWOA 5GS0D 2WBKA 1CIUA 2DY2A 3OB8A 4QPEA 2VXVL 3D12B 3QAZC 2EEDA 2F15A 2BNRB 1RK1B 2K70A 4RCAA 5T5FA 3PV6A 4Y4FD 2F5BH 2KUBA 4KTDL 4YO0A 2X0VA 3RDTB 4P4KD 1ZTXE 2XC8A 4TSAH 3TTSA 5AVYB 1KZQA 1UH2A 1PZBA 3HFFA 4Z9KB 1NHLA 2XOTA 3NEOA 3RA7L 4NQCB 1XF1A 4U1NB 5JQHC 3F65A 5F0MB 4TUKL 3APCA 1V3JA 1ZXQA 5AQ0A 1A6PA 4YX2L 2E27L 4JFOB 1IM3A 4NUMA 3ULVC 1RE4C 5EUOF 3EOTL 5MERB 2WJ7A 3POCA 1XGPA 4P07A 3RTQC 4JKKA 5MP6L 2FEDC 4HJIA 1KB9K 3LVEA 3N41B 4ONHB 3SKNA 4MNQE 4L4TD 3NJVA 5HGBB 3AITA 2VR3A 3O4OC 4KO7A 4NHUA 4RMTA 3T08A 2CDFA 3BP5A 4IHOB 4ZMPA 1DBML 1X22A 3UJIL 3P3RA 5ABZA 1VQNP 3DO7B 1U7JA 2CIKB 5ISZE 2C9PA 4R83A 1EDHA 1MQKL 5KAIH 4UT6L 4LGDE 1IGFH 1R0AL 2ZOTA 1E8YA 5F93C 1OGSA 4ISVA 1INEL 3QA3B 1PZAA 3EJYD 3FB6A 1A64A 4WVRA 1SQMA 1OARL 1LO3H 1LLAA 2B59A 3X14A 4CW1A 1T04B 2LE9A 1LO3L 5F7KC 4MJ4A 3ARTA 2X3BA 3IJSB 1KEGH 2C3XA 4DN4L 2XG4B 4ZAKB 2OYHA 5D1QD 3EFDL 1DVTA 1G6VK 2RMNA 3UAJD 2YAOA 3EYQC 2YMOA 1U8HA 1WIUA 1I7RB 4AT6B 5IW6B 3M17B 4Q2ZB 4QRUB 4ZQKA 5F1NA 2K6YA 1ED3B 2XZCL 3GS0A 2K1AA 4QNPE 1XR9B 5DURD 4F1SA 1Y47A 5KKZC 1W16A 5JOFB 1OL0A 1NTKD 2EXYC 3PIQA 2C9NY 4MAUL 2K88A 4I18A 2DS4A 3CN1A 4BSWA 5ICYA 1ZOXA 3P9LA 3E9TA 5JORB 4I6MC 3O3EA 1A3ZA 2XNAB 3WHXB 4N1CA 5F1SA 2RQEA 1DZBA 2AVFA 1ZTXL 4N8PA 2I7SA 4XP9L 3SBWC 2GK0A 4PJIE 1DD3A 2XWTB 3TOPA 3QZBA 2WNGA 1ID5I 1JXDA 3SPJA 3V5DB 4Z7VA 1OCWL 1IGTA 5CHXA 4QRTA 1MFEH 2BMKB 3SDXB 1E50A 3GUTA 4JGNA 2AJXL 2H8PB 3IDIB 3WXWL 3L74J 1JGEA 5DQJB 3KWXA 4AGPA 4S0SD 2E4TA 4PJ5E 4KVNL 1AGEB 2YAEA 4B60A 5KLIC 2NX5D 4XB3A 5IBUG 3RGVD 5ISZB 1F4WH 3QEQD 2QJKC 2PLTA 4BH7A 3F00A 4FCAA 4UIKH 3F01A 4PJFF 4LSQH 5F7YC 5AW0B 2CK0H 3VD7A 5CEZL 5ADOH 2RALA 3PWNB 3IMWA 1OW0A 2BCCG 4JY5H 1NWQA 2B4CC 2A6IB 3F7PC 4X4MA 2DKUA 5D5MB 3SSUA 1BBJA 3KWWA 3HA0A 2V4HA 2I5YL 4DAGL 3BH4A 1BVKA 1IFPA 3O81A 5EZLA 2VLJB 5J6GB 2FQDA 3EGDB 1UT9A 2GTWB 1N68A 2YGQA 4GMTH 2YEVB 3HI1A 2VZUA 2VR6A 3VP8A 2YPKA 3KCPB 2MNJB 1N2DC 5LLIC 2UUDH 2ZNXA 4J3SA 3MMEB 4U3FG 3G6JE 3FN3A 2AJSH 3P54A 4D2NA 2AVGA 3GMQA 4YC2C 4NRZA 1Q9KA 3HZKB 1Q94A 2OTJP 4O02H 3SYOA 4ENEC 5HYJD 1R34A 2FEEI 2YXRB 4Z7WB 3AUWB 3H1LG 3HE5A 4KK8D 4XNUH 2E46A 5BXFA 4K7FB 3L73J 2BOCA 2J55A 4K15A 4MD0A 1U8OA 2P58A 1HILA 1EDQA 1DLHB 2DH2A 2APBA 2MPAL 2QADD 4M02A 5FF6B 4DOHB 2ADIA 1CICB 2CE6A 2IAMC 5DUJA 3WDIA 2DYPB 1TITA 5E94B 1CF8L 4KK9D 1JZ5A 2RHEA 4G6ML 2XVLA 5I1CH 5T1KA 1RSYA 3N0AA 4HSQA 2KLUA 3KYOA 3MUY1 3OF6A 3L36A 3RDTD 1A4CA 1FG2B 4Z8FL 1GSKA 4M8QA 2CMRH 1OVVA 4WHYG 3L3JB 1YA5A 2ORBH 4U3SA 2YUVA 3NESA 3RWIB 5HVHB 4IKJA 1D2OA 1SN2A 2L0DA 2P5WA 3H1JG 1SY6A 3KLLA 4RAHA 4B9FA 2J43A 1YAIA 4BJLA 1D7DA 5HJ3B 4OF6A 5IMLB 4YK4C 2W27A 4M1CD 2BWDA 5GRJH 4R4MA 3BVUA 1ZIAA 4XP6H 2D7OA 3L3DB 2W07A 2W91A 2NY6C 4FNUA 4G6KL 4XMXA 5IHHA 3PHQA 1OWAA 1A3RL 4OSUL 1KYOJ 2BSRB 2OTWB 1AIFB 1BQKA 1LTJA 2BXZA 3OX8A 4LHUA 2Y06L 5LAXB 2X4NB 5AZEL 5EF1A 1VADA 4XAWH 1MREH 1YO4A 3OMIB 3R7RA 4ODXB 3HAEB 3ZE0F 4UB8H 4E9QA 3T8MA 3QR0A 3QJZA 4U33A 1NGMB 3BP4A 2H0EA 3BWAB 2H7HA 3TIEA 4A6YL 4EI6B 4XMTA 1B88A 3TO4A 4K3EL 2ITCA 4BDVA 2BERA 5PCYA 1HTYA 3GWJA 5CP3H 1DH3A 4CADB 3E6FA 3ZYJA 3A6BH 3EOBA 5B22A 5CZXD 3ZDYE 1MCPH 4PB9L 1RF1A 4MX7A 2WSPA 3IAOA 3B71A 3EFFB 3EJPA 4AYFA 4Q9CA 2IPKA 4AEIL 4K8RD 5B3JF 2DKSA 1MCWW 2KQMA 4BZ1L 2QJYC 4D0BA 3H1ID 3NPSC 3QZNA 1OARH 4MCMA 2UXFA 4GIFA 4AYSA 4JO8A 2XJKA 4P46C 3EYSL 4O2CA 2VO5A 4O51A 1PG7X 2W95A 2MPVA 1SF3A 5EUOA 3CSGA 2BP5M 4GKNA 4N2OA 4NCC2 5E6IA 2A9CA 1U3YA 3CXHI 1CIDA 1DR9A 1HH6A 5D1QB 1KIQB 3C8KA 3KLHC 5ACLA 3MGTB 1QSFA 3TNNB 1WA1X 5C08A 4PJAE 2IGFH 3CZFA 1JSYA 1KGUA 5DRXB 1WITA 1N0LB 3RK3D 2GAZA 4P5TC 4UNUA 3MV7D 5BV7B 1KCVL 3B9KC 2BW4A 1JVKA 3V95A 1NTZG 2V3DA 4ZMWA 2CLZB 2XV6B 1HDMB 4PLNC 4Z3IA 2NX5B 3RGVB 5JW3L 5KVFL 3GKZA 3KEDA 3CC5B 4KXZI 3HNSH 5E6RB 1J0IA 1FL5B 3RKDC 2Z31C 5DVNA 2XWDA 2JI1A 4FQXA 4KKCD 4HIQA 1AGFA 4FQCL 1BMWA 4IJ3C 2CUIA 4QKXB 3WKPA 4EN3D 4M93C 5HYJE 4P8QA 3H0TB 5I23A 2YK1L 1G4MA 3MV7B 4Y8AA 4Y19E 1ZEAH 3K2IA 1BA9A 1NYHA 3QFJD 1L7TH 4ZZKA 3BLKA 2YRLA 2Z92A 2AERT 4NQED 3VXPA 3CXHK 3HR5A 3SKJH 1I8LA 1A1NB 1LQBC 1QPXA 2R56H 5D7KD 1ZT1B 3QG7L 4OZGA 1NDTA 4WFHD 5SV4A 4AGMA 2XDJA 4I1NB 3TCTA 4Q6KA 1A02F 4R97B 5F96L 3KPRD 1R5WB 3WU1A 1XGYL 5FYLE 3GMOB 2X2UA 3OWRA 1UYWL 3MZWB 5CSZA 2Y7OA 3QO1B 5I8OH 1NIBA 2FK9A 4PJHE 1SXAA 5DJ6B 3KPPA 2MCPL 3KBEA 3QS3A 5DRNB 2F0CA 1KJMB 4PJDA 4F7CB 5JMRA 3I9PA 4A04A 4I88A 3RBZA 4E41A 4LRNL 1L4IA 3VYPA 1SEBB 4YPGB 4RDQF 5LNEA 2BCCD 4EIGB 1DEEB 1MLBB 5AL8A 2X4RA 2E76B 4PP1C 1RD6A 2CRZA 2DL9A 5HGAA 3H1LE 1SGKA 3VD2A 4HCRH 2XHNA 4LCWB 4OTXL 4LCCA 5ADPH 4L8DB 5LO7A 4KZEL 2MSPA 3S3DB 4KV5E 1JHTB 5E7BA 1LP9B 1JWMA 4L1HA 4N90E 1MJ8H 3GBNH 3QWRD 3LHPL 1JHLL 4CILA 1MCHA 2P1YA 4RAUA 1NTKG 1QGKB 3Q5RA 1QSVA 4BFBD 3QARA 1UD8A 2WWOA 4GP4B 1Y0LA 1CD8A 1YPZB 3MCG1 3BSZA 3LRSB 2VXUH 4MS6A 1XF3B 4Z3FA 1NPUA 3NUKA 3W82A 2FT8A 4OCXH 2VO8A 1MWAA 3DJ9A 3T0EB 4DGUA 4FTVD 4PV9B 1AGDB 1NICA 1TZGH 2GCYA 5CHNA 1NU1E 4LFHD 1BWWA 2PP8A 5BRQA 4LBEA 5KUMA 4ZW3A 3L17A 5HVFB 3VRLE 3EOYG 1P4BL 4YR6B 4MJIA 5KS9B 1NC4D 1MNNA 3AE2C 3QJOA 1X5MA 3GJFK 2MWCA 2ZP0T 2VUYA 4NQDB 2GIYA 4BK5C 1R3KB 4Z8FH 3X1BA 3VRIB 3HE4A 4JFFA 5E56A 5AYQA 4N68A 5ALCH 5JQ6L 1WS8A 3JC22 3LB6C 3PWPB 3MOBL 2ICWA 3GF7A 3DA0A 3EJQA 4EKJA 1NGPL 1M1KQ 1LWRA 2E9WA 1Q1JL 2F53D 3KNBB 3QO0A 5HHME 4MA8H 1AD9A 1U4FA 1GC1L 1IBGH 2IAND 2NNAB 3MTUE 3I9IA 3AW5A 4LCCC 3JV6B 2C5DC 3MRGA 4OZHA 2OL3B 2X53A 4HIJB 5FC9A 3VG9C 2GY5A 2G4GA 2VL5B 3L3HA 1YQVL 4PJ7A 3FHEA 3QWQB 1TCRA 2NUPB 2K7QA 4WO4A 4DZOA 3VI3B 5D9SB 1M71A 2DM4A 4OIIL 3FB5A 4HWUA 1X5KA 4AWJC 2DD8L 4U4IA 3VFMB 5FYJE 4GY4A 2VAAA 4B0MM 3GZKA 3K72A 1K8DA 3VSQA 5L9DL 3FUNA 3Q13A 2XTJD 3Q8CA 3SGEI 1YN6A 5AB9A 2XXCB 1AMYA 2MKVA 2MCAA 1P7QD 4U1SB 3CHXA 3ECBB 1HWWA 2ZCZA 4MMZB 4XO3A 5E0FA 1MH5B 4RMRA 2NR6A 5KVGL 4M3JA 1EHXA 3BDXA 5IROC 2KLSA 3BEVB 4UTAA 1HHJB 3FT3A 1YN7B 5DT1L 3M0DC 2FHCA 3VP9A 3LDBB 4N3UA 4JFQB 1A6WH 2E7MA 1W8NA 2AEMA 2KLRA 3L9RB 3TPUB 2PNDA 2RJMA 3KDMB 2WQAA 1Q82Q 4FL4C 1LP1A 1O6SA 1Z9PA 1GZQA 2YLHA 2ZXCA 3QWRA 4WU7A 1QLEH 2G3ZA 5EU6B 4JFTA 1S1CX 5B66H 1Q1JH 1G5GA 3VH8B 5C9JA 2YD4A 2XTLA 1EGJH 5IQ7L 1WAPA 4RIRA 3GG2A 3AMLA 3K46A 5CINL 2DV6A 5C0CE 1LQSR 3WYRA 5FIEA 3I50L 2X4QA 5D1QC 2YIUB 1HINL 1NOFA 1X5LA 5JA8B 5CGYD 1KB9H 1K8AQ 1J0ZA 1QRNA 2I9TB 2RIKA 4AVIA 1AANA 1NMCC 4NENA 4W6YB 3UG4A 4ATWA 1QLED 1KBBA 1BEYH 2GTQA 2OK0L 3G04B 4ODHL 1URQB 2AXHA 1XSJA 3L4TA 2HODA 1FAKT 3NDYE 4HHGA 2KZIA 1W0WA 4NERA 5IQLA 3BKJH 3OKOB 3PWLA 3UXFA 1ZA6A 5IR1B 3ATEA 1C12B 4LLWA 4KZEH 4WZ9A 2B0SL 2YSSB 1LDPH 4DK6A 3D2TA 4NT6A 1SQBJ 2DPKA 3APDA 2YD9A 1N19A 5KBMA 1M9WA 3ZKXC 4ZTOL 2JJTC 5AFAA 5HYJB 3SGJA 4XC1H 5CLWA 2QKSA 4OCMC 3RZWA 3JSVC 2CRMA 3WV0A 4I3GA 4GBXD 5GTHE 5EWIH 4KRLB 3BCCG 1AKJA 1HC1A 3JWOH 3MLWL 1NGQH 3DIFA 1T5XB 1XX9C 2MCPH 1HOCB 3DGCR 3PJSA 5I28A 2Y24A 3ZZQA 5LGHL 1IEAB 1JCKA 4X6DB 2P52A 1NBZB 2Z35A 2PWGA 3D25B 1FJPA 3LRMA 5EN3A 2OZNA 3QRLA 3ROLB 5FDYA 5IBTH 4I4WA 1XH2A 3AREA 5FCSH 2IXQA 3W0WA 5CR1A 3P2BA 5HI5D 4AZ8B 3FWLA 2IAAC 4U7SA 1U93B 3QDME 1ZSDA 4UQBA 3U83A 1CFVL 4FNQA 1GGUA 3ULUL 1LTJC 4XCEB 4OUOA 4QXVA 2G75B 1FNFA 1CVSC 4G7QB 5CZKA 1T6AA 4Y4FC 5I76B 5D2NC 1PQZB 3HS9A 3WAKA 2N0MA 1SPDA 1YYCA 5FKPA 1H8OA 1ZXKA 2IANA 3NCFB 1BCCE 1NTMD 5GSVB 2R0LL 1TJIL 2J4WH 3DUUB 1L0LD 4WUKH 3UJJH 1NBCA 1YY8A 1KB9I 4TLTA 2NY2D 2I1JA 3S4SA 4UM9B 1P4IH 3IDYC 1GZHC 3KZIH 3ULUF 1SUHA 2Y9RT 4JHAL 1Z9NA 2I7OA 1NSNL 4ANXA 1VPCA 3B7TA 5GGQL 1OAYH 1YEKL 3FYIB 4NM8L 2CD0A 1CFSA 4Y9EA 4ZOAA 2G30A 2BP3A 1HL9A 4G82A 3DTXB 3MXVL 3MKGA 4QIRA 4JBSA 1FAIH 5F44A 3O4LA 1QR1A 1UOLA 4HAGA 1MCEA 4NDMB 3L3KA 3KXFE 5CIPH 2OLDA 1ASPA 3G5VB 4R8WL 2WVRA 4J2XA 4P2QD 4ZD3L 2X88A 4MD5B 1OTSD 4PYGA 1ZGLB 5E9DA 4H44B 3UYPB 3GJFB 1QSEE 1X7QB 4HV8A 2WLJA 4U31A 4DP7X 3QXVA 5BRZA 2YZ1A 3ESNA 3BN9D 2YXMA 2Y7LA 2HVKA 2XT1B 4PGDB 4M5YL 4YXKL 2OI9B 1GL2A 1OV8A 4NO3A 3P77B 1LTAC 4KITB 1N5AB 2HFTA 4YDVA 3ZTNH 4MZIA 3GT6A 2P80A 5DD6A 2OBGA 3RJOA 1URQC 2WJ5A 2WQSA 2DQEL 3X11B 1J9QA 4JRXE 2X4PB 5D7IB 4ADIA 3PRJA 1BJ1J 3C2SA 2A4ZA 2KUTA 3EG9B 3I2CL 3I6LE 5D96C 3K6SB 5DT1H 3JUZA 4BFFA 2G60H 1TJIH 4XHQA 3A67L 3FPXA 2EXWD 1VAHA 1KDIA 4N9GB 4N85A 3WG7B 2Z31D 3VSUA 3GSRA 1VQOP 3KW8A 5KYWB 1KYOH 2FJUB 1YEIH 2YPLD 3QPQD 4QHNB 4C4UA 3OJMB 1ZA3A 3HMWH 2JKTM 4RFEA 5I19L 2VT0A 1HNYA 1PAZA 3LXUX 4FP8L 5K9QI 5JZ7D 2X1QA 1CFVH 1SBSL 4C83B 2C4FT 5I9QB 5MHSE 2E7CA 1IL1A 5E8PA 3RE0A 3O6FC 4OW6A 1CDCA 4FNRA 2QM8A 5DD5H 4MAYC 4G80A 3DWTA 4AK1A 3QCUH 3T3MB 3UIAA 1PY9A 4X7FC 1BGYD 1AGCA 2OKMA 4R7XA 3U0TB 3QULA 1L5GB 3K2UH 3ZDZF 2LKMA 5FYLH 2WVTA 2DMHA 4XP4H 4I1LA 5CEZH 2DQIH 2BP0B 4LEEA 3MX0A 4FFZL 2C9XA 3PGDB 4DGVH 1FYTB 2OAAA 3PWJA 4ANWA 1HH9B 4H7VA 3SBRA 5LDSA 3AQYA 4WWIA 3WJLC 4HFUL 5LGJB 4HOXA 5D7IF 1MZYA 1N6QL 3EOAA 3KQGA 4HETA 3UBXI 3DHPA 1CDJA 1IAIH 2AEJA 2A77L 1FGNH 1NEUA 4GOFA 3BCCJ 1FJKA 1GL2C 1DCEA 1F4XL 3QQ4B 4KUCD 4DP6X 5IWLC 5LWYH 3FB7A 4OZ4A 2NY2C 1PX8A 4HWBA 3UTQB 4NQXA 3SCMC 2LABA 1FZGA 1G6RB 3MRBA 5A43C 1BZ9B 5ESVA 5AW5B 2Z6FA 3HFML 3ZE2B 4D0CB 2QM7A 4Z7NF 5I6OA 4EF3A 3IPFA 4HKXA 1VLXA 3ESMA 1NCCL 4Y1AA 1MRCL 1MHEA 2VLLA 2KI7B 2X9ZA 5GGUB 3MLYL 3WEOA 4JO2L 1J1PL 4MQ7A 4RAVB 3GMPA 4CA4A 5AYTA 4UQ9A 2R2BA 3ZYOA 3GI9H 4ZFZB 1KZUB 3F5WA 5HI4D 6FABH 1VKXA 2DDQL 2E7HA 4OGXL 3SQOH 4WSKA 1QUNA 4EZJA 1M57D 2WLNA 3FQXA 1RJLB 4AT6A 4YFEA 2Y7QA 5L4MA 3PDOA 4ZO8A 4H40A 5F1IB 3Q9QA 5E99H 1MG2C 1MFTA 2DQTL 5FYKE 3JCUH 5FPIA 1OB1A 4WF7A 4PJGE 5L2KE 4ZFFA 3JVGC 1V54B 1PCXA 2WZ5A 2DQTH 3AWEA 3QDJE 2ZKHL 5KWYC 2OSYA 2ZUUA 1SXBA 2JH2A 5D2NB 2FWUA 4LSQL 1FZKB 4AZUA 3HW7A 4Y19D 3RY6C 4LHUD 5CEXB 1KOAA 3IRCA 2ERJB 1DQLH 4OCNC 4W9IC 4Z7UE 3F7YB 4JY5L 3HPJA 1WRGA 1G7PB 1V3LA 3AACA 3N43F 4Z3JA 3W39B 2DMBA 3A21A 4PRPA 5BMFL 1R46A 1ACYH 1DQDL 4B9CA 3UJTH 5LQBL 2QQNL 5DRWA 5B38B 3S5LG 3L7FA 1D5MA 5HYQA 1G87A 3HFMH 3Q5SA 4PJ8B 1CFNB 1L4AA 3FQRB 4IS6A 4HUWA 3TZVC 3Q8FA 4LPCA 4P59L 4U1MA 43C9A 3GIVA 4APQD 4NWUL 2O01J 3AY4C 2Z5IA 4HBCL 4DZ8B 3FO9B 4PJBB 4RFOL 1JMZA 4N6JA 1TZOA 3CC1A 5KBLA 3O2VL 1HKLL 2Q7CA 4HGKC 1ZDSA 5GS1A 3MGOA 4BKLB 3RNQA 2DOCA 3MGOB 4BKLA 3LMJH 3GEWB 2VRKA 4Z7OE 2XZCH 3O3BA 3QZPA 3QJSB 1ZTMA 2BEQD 5C3IA 1RZFL 2BFVH 5B66E 4LCYA 3DHMA 5DMJB 4H8PA 5HHNB 4LSUL 3ARBB 4CKVX 3BW9B 3MP7B 5ICZA 5DEGA 3ILPA 4GQPH 4ORGA 4L4TA 1L9PA 1WIPA 3E1RA 1XGZA 2DLEA 3R1GL 1THAA 2NZ1A 5EOTB 4NZJA 5KAFH 3CDCA 4BUQA 3CVDA 1Q0XH 3P4OB 1JO5A 2E7DA 5F7FA 2YN5A 2VDNH 2OZ4A 4GOEA 5CGTA 3L3GB 4JG9A 2D0FA 1RUPH 4P48A 4X5QA 5ANMB 5KSVA 2VITB 3ENEA 3SYCA 3U4BL 3RGVC 3BLBA 2W6BA 1DJZA 3MRQB 1JYNA 2WSCH 3E2HC 5E5MA 1PEWA 2HA1A 3DMMB 4WY4D 2HJFB 3FUMA 2YBGA 2IZ1A 4E5XA 3MHVA 1V05A 2G2PA 4MB3A 4BFRA 1TLMA 1TMQA 4JFZL 2C7FA 2YPVA 2FYUE 1NCUA 2VDOB 2YHGA 4QD2E 5DZJA 1YHQP 4LKXA 4PD4K 3TNUB 1LWUA 3AM8A 1VKXB 1NCNA 1DN2A 1BX2B 3VGDA 5KYXB 4OLVH 4L3AA 3OA7A 3BAEH 2G9HB 3LMJL 3U7WH 3OKDA 4L73A 3STZA 2VERN 2X09A 3U9PH 2FQEA 5BV7L 5DZAA 5KZCB 1JNHB 1RZ7H 4Y2NA 5CIPB 3TEWA 3KG5A 4V2BA 5JHDB 4XTRD 4HKXB 3N1QC 3THML 1YUHB 1AC0A 1QHQA 1FQ9C 5E00A 2E6PA 1LK3L 2OXHA 2YAHA 4PV1C 1AV1A 4XP1L 3QRBA 4LVEA 4B95C 3SB3A 4IFFA 1F56A 5GJSL 5FA3B 2CK3H 1H15A 4GSQA 4AENA 3RL0B 4W70A 2QVKA 3RYMA 3VXNA 2D7QA 2EIBA 1EEZA 3ZDYB 1GGCH 3BRGC 2KSJA 3MNMA 4ZW5A 2K9YA 1OCOB 5D2NE 3F12A 2A4EA 4NHCL 1EUTA 1NC2B 1J8HA 1AR1B 2BOBB 4F7EB 4TNWF 3RIKA 3G9VA 4HEPA 2ZWLT 4JO1L 2QSCH 4IEFB 3IFMA 3QJVB 1N73B 2F74B 1FYTA 3FT9A 2IDTA 1NTKE 1I9IL 3BUQA 4N0CC 3LNEA 1PPJD 3QW9A 1EDYA 4JN2A 3ZKQD 4ZNEA 3KPQA 2VC2L 5KLVK 3OZ9H 4QYOB 2AI0H 3AT0A 2ATKB 5E99L 1PZCA 4P9ML 2FQFA 2NSQA 2BRQA 1XCQB 3FRPG 4XWOD 4K5MA 3LEXA 1ZK9A 2WO2B 1P84D 1HQ4B 2LTQC 3ESOA 3GINA 4P0DA 4PW3A 5AUMB 2VOTA 4H26A 4KK6C 3R8QA 5E8PB 3ITKA 1IARB 3U7WL 3G3LA 5GS0L 3L6FA 2R8SH 2HUEA 3OTTA 1L0NE 2IBZG 3CBJB 2DMKA 2XRAH 3NYKA 4NNYA 3CU7A 3S34H 1OT1A 1Q72H 3DX9B 2DI8A 3QAZB 3H9YA 4POUB 3D3VB 3T1FA 4P2QA 1RE3A 1LO2L 1L9OA 1XMEB 3VXSB 1PX4A 5EMYA 1RMFH 4GW4A 4N0UB 1KYFA 4X5RA 4GQRA 3S36X 4AMXA 1KELH 1RUKL 1RZIA 4H8WL 5KYYB 4YDIH 2ZCHL 1ZR2A 3D87B 4U1KB 1LD9B 2CHZA 2BIQA 3GMRB 3CSYB 3UBGA 3MQIA 1VEPA 2E74B 4RFNC 3HMXH 3MNVB 4YXLL 2VZ1A 5DFTA 5DFVC 3T71A 1DHKA 2YPLA 2NTFA 4KTYA 3RG1C 3A24A 5KOVC 1LT9C 2JK5B 2AXFB 2EYTB 3KVDD 3QXUA 4HPYL 2Q3XA 5J9PA 5DJAA 1NAMA 3GBMH 1P4BH 4JKLA 4JDZA 3U59A 1RSFA 1YEGL 2ZWKA 3T0EE 1MFZA 1JZIA 2HVKB 2BVEA 1AXSB 3T3ME 4DP2X 4WJKB 4RMSA 2BO0A 2XKNA 3ASWA 2O1AA 3AABA 4M03A 2O5YH 3AGVA 5BZDA 3CVBA 4TL4A 1OGAB 3ZSSA 5D1XD 3FXDA 2CRIA 4HXAH 4D7BA 2WWMC 4DKTA 5DJAB 2K45A 4HGWB 2SPZA 4DWHA 4K9EC 1P53A 3I6GB 4XZUA 3I9GL 4J3WA 4PVMA 3CLFL 4PWEA 2EDQA 3MUUA 4CSZA 5CGMA 1R4XA 3MHZA 1BFSA 2I07A 4ANUA 4PV1B 3CC2P 3W0WD 4FI8A 1F00I 1IBZA 3BD5A 4PTUB 3H7LA 2E75D 4AUWA 3WNIA 3NFSL 1DVFB 4XPBL 1NBVH 3RI5K 1EZVY 3CZEA 1EV2E 2CWRA 2BIHA 1QRKA 4GW4B 1EMTL 3U48A 4LL1A 2WAQA 1WEJL 2E75C 3B8SA 4HIXH 4L3EB 4LLUA 4MAUH 3II6A 1LEIB 3AE5C 1KJ2A 4RX4A 4NNYB 4DW2L 2I26N 3NSCA 3BUBA 2FZ3A 4HIEB 3UTZA 1W0VB 4QUOA 4UT6A 4YH6A 1SM3L 2A6JB 3UP1A 4PRIE 2Q86B 1Q90D 2CGRH 4P57A 3CXHJ 4QRPA 1IGJB 5KEZA 2CXKA 4PCTA 5J3HC 3E2HB 3GSQB 4C4KT 5CKAA 1BF2A 3F64A 3NJXA 4ODWA 5D1ZA 5I73C 2GSGB 3HUJE 5D8JL 1O5DT 3IF1B 3VI3F 2EEXA 1VSCA 2ZF9A 3S5ZA 1U3HB 3WY4A 4A39A 2W65A 2FWOA 2KMWA 1UZ6E 3II3A 2XTJB 5E8OA 1KCUL 3L5WB 3FUDA 3O11A 4F8QA 5BRZE 4OGQC 3PJSB 1WWAX 3EADA 6TAAA 4GG6E 3IN0A 1CUOA 2PMZA 1S6NA 3ABZA 4OCWH 2WTRA 4XNYH 2ED6A 3LN5B 3CLFH 4JRLA 5T3XE 4F7TB 2X6VA 5DJDA 1YMMD 5C0AB 4J6IA 3WD5H 3OG6B 3FQ1A 3S3CB 1KJ3L 3QUZC 2QZQA 1N7ML 2WN2A 4IFMA 4NWTH 1KCVH 2VDQL 4X80L 3ZRSA 2NY6D 4BWTA 2V2XA 4JFDA 5C0BD 4P2RE 2VZ3A 2OMWA 1CLOH 2WP3T 3VNYA 1Q38A 5GTIE 2ESVD 1IJ9A 1T6WA 2XV0A 4HS6A 4MXQD 4Z7IA 1W0WB 5I1GL 5I0WA 3VDBA 2ADFL 2CO6A 4G8GE 5HVWA 4TRPH 5GSRB 3HS0A 5J6HB 1ZLEA 4NIKB 3JWDC 5JW5A 2NR6D 4U0RB 4XWGL 2R2CA 2WUCL 5I1HH 32C2A 2W6JH 1BX2A 5KYXA 5CBNA 3PRZA 3HMXL 4U3CA 5DFAA 3A6CL 1HQRA 1G4RA 4GEIA 2NXYD 5E8EB 1XSIA 3C8DA 4RIRB 4KJYA 4HIHA 1Y6NR 2E74D 2Q2LA 1TETH 1OVUA 4QOKD 5C9JB 1ZPUA 3PQYD 3BO8A 3QCTL 2A83A 1OK0A 2OMVA 4UTAH 1EHLH 5SX4I 1BQLL 2VUKA 1DJSA 3ARGD 3AAZA 4V1DD 1C7TA 4YHLL 1KXHA 2VERA 2NYKA 3LB6D 1MF2H 2V4LA 4R97C 4U3HA 4L37B 4AL8L 4JM2D 2XTJE 3IJ9A 2AEFA 3VNZA 5IMKB 1DO6A 4PY8I 3BEVA 3AEEC 4ZUTB 1SQXG 1I3RB 3GHGB 1U8MA 1M90Q 4JG0L 2PPEA 3CX2A 3P30H 3X2QB 3L9YA 1M42A 1VF5D 2J8UB 4ORGB 4QRRD 3VWJD 2APWA 12E8L 2X1OA 3GMNB 3VTTA 4G42A 4G6KH 3IFPA 4N1EA 3K72B 4FKKA 4XBEH 1KEGL 3D48R 1CK0L 2H3NB 3GUFA 4QHKI 3VD4A 2E74C 3CZUB 3U6RA 5I71C 3NJJA 3NFQA 3KR3H 3GJEA 3SQBB 1R3JB 4Z3TA 4UB8E 1KD1Q 1ZHKB 5ITBH 5GS2H 5E4IA 1GTFA 5DK0B 1CLYL 2DQHL 3ATDA 2R44A 4O5LH 4LO9A 3E8UL 4KMQA 3BWSA 3N44B 1ZHBA 4P49A 2V2WA 4KK5C 2VDRL 2B3IA 5BQDA 2YRBA 2L7JA 1AI1L 3ZRCC 4NC1C 2ARWA 4JVUA 2NZ2A 5BZWA 4D9QD 1M9SA 5MEQA 1A0QL 2Y07H 2AMUA 1DX7A 4ZMVA 3UTOA 4OFYD 5B38A 2NPSC 2GJZA 1UWGH 5HI3C 4X9YA 2HVBA 1A7BA 5FGBA 4U1LA 2VXTH 4X9IA 1R3KA 5IWLA 3NABH 4WV1C 3F7YA 2FT7A 1DFXA 2VDML 4IRSB 1ZANL 2DQHH 1OGAE 2EUWA 1F0LA 5JIKA 3VXTB 2VLKD 4OM1H 1YTZT 3L7EA 2IPTL 4GT1A 1Q0YH 4DK5A 2KNCA 1E0OB 4A55A 3DV6B 4ORZC 3WFEH 5A3IC 1YEJH 4ERSH 1Q9OA 2WSFJ 4JFZH 2IPUK 2B89A 2NY3B 5H94B 1H0TB 1NU1D 1QX1A 4WNSA 12E8H 1NC4A 3GRWL 4GW5A 3LKPA 1TR7A 3KPRA 4WW2F 5AW6B 2YPVH 4DP5X 1VPOL 3BZDA 3P32A 1G7HA 3L8QA 2JKNA 5DZVA 3SO5A 3SGJC 5IV2B 1IC4L 1AFVH 1Y0LB 3CSFA 3BUPA 4PS3A 5D7KE 3WJMA 5IROD 4GQ9H 4HCRA 2D7TH 5FHAH 3TFKD 5J3HD 4RAVA 2WWWA 3FUJA 3GZOA 4QY8A 4APXB 5JIQA 1P84K 3WEMA 1JXKA 4BINA 1KPRB 3DHUA 3I9AA 5GZNC 1K04A 5B5EE 2MKLC 3S6CA 2NY3D 4G1EB 4KI5F 3H7BA 2CHDA 1I8IB 1BGXH 4NKIH 4PJ0H 1BQRA 3EFFK 2HLFC 4HS6B 4MQSB 5DLLA 1M3JA 1XXDC 3IS1X 3G5XA 3USSA 3HG3A 4PJHA 5B1AB 3T6QC 4XC1L 1RKRA 2CO4A 5HYSA 3KLSA 2UX6A 1KC5H 4OLYL 1VACA 1R1CA 3CFKB 3R0NA 5D6CA 3ISYA 2AEWA 4F8TA 4JQ0D 1T5WB 3O0RL 4Y5XC 3MLSL 4WVZA 3MV7E 3IMSA 4EDWH 5BVJA 2QSIA 1ZJAA 2ENSA 3FC8A 3PNWA 1V7NH 2MQGA 4XWGH 2CG9X 3F85A 3WKQA 1S7UA 2QKIC 5C09B 4WI2A 4N2AA 3IMUA 5E9AA 1Z6JT 3CK0L 3L5WA 2OJ1A 3VXPB 1HWHB 3CH8A 3DOIA 2DWEB 1DQKA 2ZX5A 3T0XA 2BWQA 4CC4C 2WT7A 4UNVA 1U8PA 2AF2A 4POZD 1M7DA 1DBJH 4UTBL 2DJSA 2OTUA 2X2YA 3EGXB 3Q9PA 4NQQA 4Y7MA 2UZYA 4XNXL 4N1HB 4NPYA 2YKPA 4PVBA 3KBFA 2DL2A 2EUXA 4JR9H 4G80B 4DP1X 5TFSH 2YUWA 4I3SL 4L74A 2KXPB 2NX5A 3RGVA 4CC0A 3FTXA 1DFBH 2CLVA 2C3HA 4K3HA 4JRXA 3MLTA 1M3IA 4HKJB 3NN8B 1JZJA 4DKFL 2SODB 2WLZA 4FQXD 4HD5A 4Q4EA 1GGYA 5I1LB 1ND0A 4LVNC 3QI9A 2FEJA 4ZUVA 2L4OA 2L04A 4FTVB 1CJYA 5AALA 1G7IB 3T0VA 3D85B 3FQYA 2QJPC 2QTVA 3QC6X 4WO4C 3RWEB 3T1WA 1FA4A 3EYOA 4QR7A 5DHEA 2BSSB 3JWNE 1BQSA 4QF1B 2N1KA 4GG8A 1OGTB 4L8BB 5T5NF 2E7LA 4HUNB 2HG5D 3MV9A 1OSEA 4YXLH 1BLNA 5I6LA 2KP8A 4NKDA 5I8OL 2OMUB 5H37H 4AW7A 1KQSO 3FBQA 3S35H 3GTVA 3HNTH 4KNQA 4JREC 1RFDH 1INQA 3UJIH 4Y4KA 2X89A 3QZMA 5KOMC 2R8SL 2AXTE 3MLVH 1TQCC 3LZOA 4X98B 5L4FA 1YNTB 1J1OL 4JDVB 4JQIL 2UY6B 4QOKB 1K5NB 1X5XA 5E6ID 4XPAL 3NZHL 1HK6A 3K1DA 2LVEA 3GBEA 3DRTA 1NOLA 2ICWJ 1SDDA 4N8UA 1NJ9B 5L2JA 5HDQL 5D1ZI 3SKUD 3MOAL 2NQCA 3B9EA 4BRJA 4N5UA 1PSKL 1KBKA 4BFKA 4QTHA 3SPCA 3KGSA 5KVDL 5BS0A 3APMA 3O6KL 3L1OL 4ZNEE 4R96A 1YNTA 1PZ3A 2F5AH 3T65B 1LT1A 4JANB 3CCHB 2BCMA 4JANA 4G83A 4PJGB 2NTFB 2Y3NA 4GSDL 3RX9A 2ZCLH 3F5HA 1S5HA 2PCXA 3C9NA 3IU3B 3N42F 5C07D 4F5CA 1KB5A 1M8OB 4QMAA 1CFSB 1U33A 1LD9A 1ZANH 3HZYB 3QIWC 1LTJB 5LAXA 2HAZA 3TO4D 4UBDD 3W68A 4AQ8A 4Z5RB 4GUQA 1VENA 1KQGB 2BIPA 3PHQB 3VE0A 3TX4A 2AP2A 5DQ9A 2ZT9D 3WE1A 1FFNB 1CG9B 4LLDB 3L3DA 3NIDB 2XQYK 4RGNB 3US1A 3NXSA 2R9HC 1BMGA 4OI7A 4R6UA 3S37L 1RULH 4NZFA 4MA7L 1AI1H 5JO5A 3EAKA 2FO1A 4DKAA 4AQZA 1SJMA 2YKLL 3L6FB 5CCHC 1IM3D 2MOVA 3VOPA 1JF1A 2WINA 4JCLA 1U36A 2B7DT 3K6NA 3EYSH 1UWGL 1IAIM 2LXBA 3QUMB 4ZS7L 5K69A 1OGTA 4U1IA 3EHBD 3KBPA 3L2NA 4N2KA 1H3XA 3MUDA 3J7HA 3AEDC 3ES6B 1G7IA 2OTUB 3D4ZA 3L74G 3EGXA 5GXBB 5GJTL 1JZFA 1W9XA 1VFUA 3UACA 3W11C 3SZKC 1NCHA 4GRMA 1AHWA 3BAKA 4A2DA 3Q5PA 3TO2B 4PJXB 5EZJA 2PYEA 2ZCKL 2FSDA 4A66A 1RZJH 3MLTB 4CU7A 4OLVL 2ZOWA 2A4CA 1NKZB 2DTML 1Z0NA 3CFJA 3P73B 1HOCA 3L9EA 5D7JC 4CVUA 1T5XA 4BQCA 4NBXB 3K3QA 1Y1UA 1GPOH 4PGCB 3QDJD 2WMMA 2WVSA 3RURA 4JPWL 2J6EA 4FKEA 1XVSA 4RGMB 4NGHL 4K4KA 1XSOA 1Y6MR 3VXNB 3DROA 5ANHA 5AVUB 2WSKA 2B9BA 1KLFB 1HI6A 1PY0A 2GI7A 3ZUNC 3SDXF 1XR8B 1KPUA 4AMKL 5CILL 2Y6TE 1SHXA 5JPMA 3S8WA 1CW5A 4Y1AD 4N28A 1X3DA 1XH3A 2J12B 1N3NA 5TDNB 3IDXL 2YWYA 1UT2A 1LEGB 4Z7VF 1YJNP 4CN1A 3DTDA 4UIMB 1RZKC 2R69A 1SFCA 2LTQB 5L8JB 4XN9A 3V6OC 5TISE 4PJEF 3SBWA 4KQ3L 4D9LH 3TWYA 4PJHB 5I1JL 2EDFA 3SY0B 2FE0A 3SKJL 1ZVSB 1L0LK 3HKZA 5I6NA 1A7OL 5C0RL 3CGTA 3KGTA 2D9CA 4RGNE 5D4JA 2D2CB 2Q5UA 1GAFH 4OLUH 2ISDA 1NC4B 4GW5B 1H0TA 1NH4A 4HWEL 2ZXWB 2Y0DA 1JV5A 2UVEA 1RUAH 2D4FA 3JQOB 4PJ9C 5MEPB 3BASA 2O4EA 4K3JL 2OW7A 2DWDA 2VDQH 4M3HA 4ZFQA 5B1BB 4Y19B 1PVHA 1GHFL 3RGBA 2Q9IA 1ZWIA 1R47A 1YN7A 3FXIC 3GXIA 3HOGA 4OFQA 1UM4H 3A5VA 3S35L 1HAUA 1FH5H 4LVNB 4AEEA 2BJML 4OF8A 2BCCJ 2PP9A 3D4GA 2EH7L 1L9TA 3BE1H 2H1LM 4U1SA 1CR9H 4CNIB 4TQEH 2QG4A 5ICZB 2DQUH 3W56A 3B43A 3DV6A 2EH8H 3GDBA 5EO9B 1FBMA 1DEDA 3ZT5A 2EDJA 4XRCB 5I1IH 1UJTA 1MW1A 5I17B 1OZHA 1I1YA 5DJ8B 1FIGL 5LGHH 2FFDC 4NM4H 1ITCA 5F21B 4WKZA 5BCAA 4WWKD 4R2GC 3G5YB 5IW6A 3UTPD 5EOCL 3SBQA 3JUYA 1A47A 4BWNA 1BD2B 2DQDL 3FGAD 3FCGA 3WIHH 4O9HH 3FOMA 3QWOA 2GJZB 3LRKA 1S46A 1X5YA 1KJ2L 43CAB 4CPGA 5BZWB 5MEQB 3MRGB 1BPVA 2VZTA 2AK4B 2HFEB 2YMXL 2X12A 4TQEL 4LIQE 1QFWH 2CUHA 2HFEA 4JZJA 3UPRB 1PGRB 1X9LA 4KKNA 1G84A 3SE4A 4F3FB 4JQIA 3K6OA 2HX7A 5D70H 2ZAHA 4GS7C 4UB0L 1DJXA 5DRWB 1EMTH 3F6IA 3U25A 4NZUL 1W72L 3OJAB 2PPFA 4PRPB 4N8VG 4JFYA 3NEXA 1LTSC 5A2IH 4PVLA 1TMCB 2JJTA 5F8QC 4DP8X 5B5EH 5EOQL 1VL2A 4PRDB 4N0YL 2GG1A 3QDGA 4LLVA 2Z4EA 4XAWL 4GAAA 3FSAA 3QNXB 3P4MB 2IEPA 2P42B 4FS0A 3OGCB 2P8LA 1JPSL 2Z91B 3O4LD 4OJCA 1PU0A 4MBRA 2P24B 5B38G 1A7OH 5C0RH 3QEQB 2Z8WC 4Z23A 4F92B 2VUOA 3EF4A 2Y25A 1D9KA 2HRPL 1IC7L 3LKRB 1X9QA 3LTVA 3FCUB 1N18A 5E08H 1ZWIB 2KYIA 4G6MH 4JUSA 1TVHB 4S0TD 3APFA 3WKML 5ACZB 3FXEA 1L0NG 3PS6A 3S37X 4JPZB 5GTIH 3EHBC 4G7VL 1QVGO 1A3LL 2WSEH 4FXKC 1XB6A 3WLBB 2WZPD 2CHXA 5DEFB 1JB0J 2FO4B 5GSRA 3V5KB 4AC4A 2VLLB 5DD1H 1L9MA 1MW2A 1IEHA 3GMLB 5FK9A 1KGYE 5LNGA 4XNZB 1TG8A 2VXQL 3CMOH 5E1AB 3P0GB 5SWSD 2W8ZA 5D7EA 3K81A 4OF3A 3SY0A 2PO6B 4GW1B 1SHSA 1KILC 2AK4E 4FFYH 3KL5A 1FZEA 1R0AH 2YIHA 2W1NA 1N7SD 2P28B 4R4FL 4BRYB 2WXQA 2AITA 3EOAB 5H4YA 1FVEB 1T0MB 3OZLA 2BS8A 3UTSE 1ZRUA 3L4XA 4HIIB 3DX8B 2VSMB 3FU6A 3O8XB 2IVFC 4E9WA 3VGFA 3OPZH 1QSZA 2KZJA 1L0PA 4Q4IA 1KPUB 3MRJB 2AEOA 5GGTH 2AGJH 3QFJB 3N91A 1SJHB 2VLRB 1B2WH 2OXGA 3QGVA 4KQ4L 3O6LL 1FV1B 4GBXA 3GRGA 4M61A 1S7WB 4IBWA 4JFPA 5F6HJ 4GMSL 1A8JH 3VMAA 3WFBH 2VMCA 2YKOA 1FL5A 3KPSE 4DN3H 3LN5A 1NTME 4QRPB 4FTDA 2X1WL 2IG2H 3CFJB 3P73A 1EFXB 4TM9A 2XPZA 1WE5A 3OB0K 1OAUH 2A9NL 4KJQD 4OZIE 2HT4C 4OD2A 4ES9A 3V55A 3HI6L 2BNRE 1J1XL 2C9UA 2XWJA 3T8XA 2ENYA 3G71P 3TJHD 1B4JH 4WI5A 4FFZA 4MCZA 4FFZH 3SEPA 1F3DH 5D93B 1PFCA 5INCA 4ADJA 2V5MA 4PJAB 2Y22A 3VCLB 4HHWA 1HE8A 3B1TA 5APQA 1OTUD 4ONOA 2RFXA 3UAFA 3KMDA 1BQ5A 2OYHC 3ES6A 3PQYE 5I2IB 3B83A 3QDHA 3VXRD 4R3SB 1AY1L 1FI8C 1T0NB 2W60A 3TNMB 2LXCB 3TVMB 4OQTA 2EDLA 3MXVH 3RAJL 3MUDC 3JZYA 1KV4A 4WI0A 3ZL1A 2ZONA 1B0RA 2CH8A 4KNSA 5D7IA 3D51A 1IKOP 4MVBC 1N73C 3PHLA 1ZK5A 4Y2DC 1X0TA 5CJQL 1OE1A 4LMQI 4HGWA 4WI8A 5HHOB 3UTTA 1A7NL 4FNLH 5GGTA 3P77A 3PUUA 4AVHA 1FFNA 2L7EA 5I74C 3NCYS 4HC1A 3UJJL 4LGPB 4B9IA 1FNHA 1B2WL 1UJ3C 2WZ6A 1FBIL 1RZKH 3BH8A 1RIVH 4X7TB 3KH3A 4ZFGH 3MCLL 2G5UA 3PCYA 4S1QL 3B5NA 1LM8V 2BSCA 2ZOKB 1BZOA 1JE6A 5GZOA 4KROD 3JWDL 5FYJD 3IU3A 2J21A 2H43A 1K4DA 1P7QA 1QSEB 2F53E 2UZPA 1X79B 5HHMD 5D6DA 3SD2A 2CA4A 2QLVB 2CO3A 4GDOA 4M7KL 3RFZA 1P7QB 4WV1B 1E4JA 3N9GH 4FXKA 5F7NC 2APVA 4DHLA 5APXA 3GMRA 3JWOL 2ZOKA 8PAZA 2Y1VA 3L5XL 3QJHB 3BFQG 4Z7NB 4F15C 4F2MB 5IHZB 4CGUB 4P5KB 1TT6A 4LVOC 4M43L 3BH8B 1JWSB 3EH1A 1O75A 4TS6A 1J05B 4N0UA 4I7ZC 1SDDB 1BQUA 5K59E 5DUBB 4E9XA 4LCWE 1KCKA 3CVIL 1K5NA 1NAMB 4LP8A 3FO1B 1TQBC 1NBYA 3X1GA 3LQAH 3PLYA 3O8XC 4NOFA 3VO0A 5HJ3A 3UGUA 3MREB 4XO5A 2XG5B 1F58L 2OSWA 4ELDA 1KN2L 5J57B 4PS4L 2ZCLL 1EAJA 2Q6QA 3ARPA 4OZHE 1KIRA 5GIRB 4G8IA 3AREC 4KJPD 3PWUB 1A21A 1H3UA 3QXTA 2AJZA 1J7VR 5DMGD 5C08E 3D0AA 2F58L 2RFXB 3MV01 4G8AC 1N64L 2XV5A 1XGTB 2XNDH 4RGND 1G5AA 5ERWB 4QT5B 5MENB 4KRPD 1ND0B 5G4NA 2YZ8A 35C8H 4BCZA 3L4FA 5AAWA 2M8RA 4Z0XB 3H1LD 3D39E 5TK4A 4IOFD 1IQWL 4LSRH 4WHYH 2AXJA 2DYPA 1ADQA 2JXMA 3V6ZA 5K9KA 1QL2A 2Z35B 1TTRA 3OG4B 3AGWA 4PJIB 2F5AL 2EUVA 1QA9A 4AYID 1U8OB 2OR9H 4XCFL 4PJIF 4ZMOA 2BOCB 1J5OL 1TF4A 3BDYL 1IFHH 5I9QC 2QFRA 4XPHH 1N4XH 5KSBA 5HTSA 3IR9A 1YSOA 2DEWX 3TIDA 1CMOA 3GM0A 4XPAH 3BAXA 3N41F 1IIIA 5E6IC 1JXFA 1IFIA 2K6WA 4IRJD 2X2JA 4P5MA 1SYSA 1NAMH 4GO8A 1KGIA 4KKBD 1N73A 1A5FH 2CGRL 1QWNA 3GKWH 3K8LA 1KYOD 1S7UB 3VFPA 1NTKK 3K8MA 4K3GA 4NENB 4GSRA 1NC2A 2OTPA 4JE0A 1NCWL 5BVJB 1D7MA 1E5ZA 1OZTG 3OKDB 5D5ME 5FV2A 2F61A 4XMUA 2NY7H 3VXUE 3I9GH 2R1WB 1GYVA 4PIBA 5DK3A 3HG1B 3V6IA 3NJGA 1E65A 5CSGA 1WV7T 1AQ8A 2YPVL 1EAQA 2JIXB 1S4IA 1KJVB 3QIUB 2AQSA 3DSNB 1DJYA 5J1AB 1N64H 1AJ7H 4JFEA 5I30L 4DKFH 3SQRA 1YUKB 2BFGA 3B7YA 1S8DB 4Y16A 1S78D 5EO1A 5ISZD 1ZLVH 1NOAA 3BKJL 1MNUH 4FQ1H 4HWNA 5EU6A 5SX5K 3V5KA 2DW5A 3BUDA 3M0DA 2CKBH 2M26A 5B4MC 3HLKA 2BHZA 4X50A 4QY8B 4APXA 5LHDA 5E6YA 2D3LA 1F4XH 4JR9L 1N59B 3OJ2C 3WE6A 5DR5L 4GAJH 4HXAL 1TVHA 1GK4A 4QRTB 4LSTH 1MAJA 1KC8Q 2OX5B 5J0BA 3NIFE 4WWKC 4P46A 3MBED 3LKPB 3FOLB 1H88A 1FWXA 2OQJB 4H8UA 2DI7A 3ECBA 5K1VA 2XZQH 3LOWA 3U2SA 3MCYA 3ILPB 3ARGC 1YITP 4RMUA 4B5ZA 3VMOA 5DD0L 4ABVA 2JIXD 5HHNA 2FNBA 1CI5A 1A4JA 2VLKE 4CSPA 4U3FE 1H6UA 2VAAB 5ANMA 2DEYX 3OM3B 4QCIA 5FUCE 3T6VA 3S3BB 1AS7A 2ZXGA 4N3YB 4OVNF 1VQMP 4RDBA 1QSFD 1SQQK 1UC6A 5CJ0A 1M71B 4TF4A 4Z7QB 4P04A 2WVUA 2OYHB 5DD5L 4JPIB 2BWIA 5FHBH 5JOPE 4AQ1B 1GL4B 3ZL4L 1K9MQ 1AS6A 4I77H 4W6WB 5JPNB 3U2IA 4DZ8A 1UWFA 1L0ND 1RIVL 3JV6A 4OGYL 4XN4A 3NMEA 1AJ7L 2OMZB 2J6EH 2YGOA 2AABH 2PUQT 5AVZB 5E70A 2YA2A 3RIAF 2IOMA 2GW5A 4G5ZH 4MS8D 4OF7A 5SWZB 1HGZA 1D5MB 2VN5A 3CC4P 4NJ9H 1YZZA 3DO3A 3K80A 4W4OC 2ZD0A 4K55A 2XU6A 3LD8B 3KJ6H 3V7AE 2WKOA 2Y6SD 5DZ9A 4NQDA 2OARA 1ZHKA 1R3JA 1HS6A 1H3VA 5HGHA 2AJYL 4AG4H 3LNFA 1XGYH 4YHOL 4QJ5B 1K05A 3LD8C 4X6BB 1DBAL 2BXYA 3KPLB 1LNQA 2G2RB 1T22B 2G4EA 3MRRA 3IDJA 4MNGE 3H1KD 1TVBB 4UWQB 4NZ8A 4XPFL 5IF0B 2G0KA 2YD5A 3CDGA 2Q8BH 5HYQB 4JRXD 1Z66A 1J5IA 1MVFA 5FW8A 5FWQA 1U3JA 4FYRA 1J8RA 2QR0B 1IM3B 4WDIB 5C7ZA 1O7DE 4N8VA 3G3ZA 2W0LA 4QXUH 4X7EC 2VXTL 1A1OA 2EICA 3BXNB 4NXKA 4XCNA 4GFXA 2FJGA 1X4ZA 1N59A 3WE6B 1NMAH 2R32A 4RFNB 5HHQA 1X9UA 5JW3H 1I9RH 4RRPG 1SQPG 5A6MA 1N0XH 3H9SA 4PHXA 3TZVD 3SPVB 1GIGL 1MI5B 2IBZY 4HEPG 3EJYC 2X4RB 2KZKA 3Q1SL 4NQUA 5EBLA 3I3EA 2FECL 4LU5H 4Y1SA 2ZYSA 1UIXA 1SEBA 1KB5H 1AYRA 4X2UA 1KG0B 3IDGB 2E43A 3IRZA 4KHTH 1FCCA 2JIXA 4K73A 1INDL 4MQTB 2H45A 2FIKB 1U8JB 3EBIA 1OHZA 3B2UD 4JLRA 3GMPB 3NIFF 3ABGA 2IWGA 4KTGA 3QH3A 5KTEH 4QGYA 3EBGA 5B1JC 3LV3B 2E5YA 5LGJA 2FBWC 4IM8A 4Y1AB 2J2ZB 2WKLA 2F8IA 2WQ8A 2OYIA 5KSUB 4HK0A 3HD7D 4XBGB 3T77B 1TTUA 1CLZH 3ILQD 1BZ9A 5ESVB 3RVVD 1HGVA 3OMAB 4MJ6B 2X05A 5EU7C 5CD5C 1V8HA 4UCFA 5CJBA 4DOHE 4E9LA 2LT9A 4OV5A 2R0WL 1DSFH 4Y16D 5KSBB 3FH8A 3LKOA 2R29A 3PREA 4PJCB 4H44C 3PXJA 3BT0A 1HL8A 4YBHA 2KL6A 3BVXA 1WBZA 4EXKA 4I87A 3O11B 3BKCH 4C83A 3KYAA 4X9FA 2PCYA 4XNMB 1DE4A 2BP0A 4FABL 1WUZA 2GAZB 3CZFB 1G7QA 3AG1B 1BE3G 3B56A 3H1HJ 2L7QA 4KKRA 3SCMD 3X3GH 1E6JL 3HG2A 2ZAEB 3IBOA 3U0TA 1H9VA 5HPMA 1AH1A 4ZMYA 4ZI8A 2ZX9A 4FI7A 3GXDA 1PLAA 3NAAH 5GIRA 4OT1L 1K85A 3Q05A 3KLKA 1BAWA 3NP3A 5AL0A 3UC0H 1W8OA 5KS9F 1UFGA 2CUMA 2WQXA 2XWXA 5J13B 3QNZA 4AH2A 4PJ7E 4UTBH 1KFMA 4KZ0A 1LEIA 2HR3A 3GF3A 2CJSA 2HTLC 1L2PA 3MRKB 4I9WD 4PY8J 1GL2B 4N20A 1J2JB 3QUZD 1KJ3H 1NA8A 4ZSOB 1BQHB 3LNDA 3FTYA 4HF5H 3V0HA 2DYPD 1CE6B 4Z5RA 4HALA 1V27A 2WANA 2A38A 3D39D 1F8TL 4HV8B 4LHUG 1ICTA 2PYEE 3IWUA 5KSAC 4M5ZL 2C4FU 4WV1A 5D70L 3RFZB 3AEFC 3DXAB 4LCWD 2C1OA 1GMIA 4WKXA 5SX4H 3VWJA 4E9RA 4QRRA 3H85A 4ZYKA 1TSRA 3T65A 1WYJA 3MC0A 2P47B 1HHGB 3H1HD 3AS1A 1V7MH 4F5CE 4G3YL 5A2BA 2FXPA 7CGTA 2CJUH 2JFCA 1JPFA 4JM2B 4Y2DB 4RGNC 4UYPA 4AIEA 5FFOA 2NQDA 1SXZA 3T4YA 1KBVA 3SFEC 5KLVE 2Z4QA 2CBPA 2EDHA 4Z95L 1JXJA 1QBML 3IYLW 3K5SA 3OLGA 3E3QE 1IFNA 2EDTA 3U79A 1INQB 3H6PA 3LZFL 2Y1ZA 3PQYA 1B0RB 4BIKA 1TQWA 2QQLH 4FHJA 1X4XA 4FOMA 4AY0A 1FS0E 1S4XA 3POHA 3D07A 3UBXG 5C0CA 3MV9B 5KYYA 4Y0GA 1B6DA 3EDEA 4ZBJA 5MHSD 1FAVA 4YPCA 1JY3N 2IDSA 4OIIH 3WFZA 2XX0A 3IFLL 4BA0A 1KTDA 3MBEA 4UOQA 1F3JA 3L70E 3MZTA 4G8GA 3HI5L 4OB5L 4ZOCA 4AQ8C 5LBGA 5LBVA 4ZUVB 5HGDA 1RHZB 3UMTA 1M56D 5INCB 4XP5L 1CL7H 4M00A 5E2WL 3V0WL 2FXMA 1RZ8B 4TUUA 3U1AA 2PCFB 1PD6A 4XI5C 4CRPA 1E4WL 2BDNL 1UD4A 3D0VB 1Q9WB 3AS2A 5FKPB 5KVGE 3N85L 1XH0A 1OMIA 4LF3A 1WGOA 3LAFA 4J1UA 5C9KA 2QQKH 4QHUA 4EQ2A 2IQ9L 4K8RC 5DWUL 4GXUM 1OSZA 1GKEA 2IALA 4JO5A 1P5VA 4M8UA 2YGPA 4JUTA 1HXYB 2C0WA 3F04A 4XCEA 2J8HA 4Z7WA 4PJXF 2HH0H 4FEIA 2ED8A 4JCWA 1W6LA 2J1ZA 2QV2A 4XO9A 5EZIL 3SN6N 3APNA 2IH1B 3AY2A 4MB1A 3KPQB 4AQEA 2ICES 4YDJB 2AZAA 2OXGB 1LK3H 4JG5A 3PP4H 2WVVB 4DEPB 2XU9A 1FO0B 3OAWA 2WXKA 2EVHA 1ZA6B 2XQBL 1T2KC 1QLFA 1U91A 3ZKSD 2WCPA 5C09A 1I7UB 5E8NB 5A3ID 4HUVA 4N0YH 3PHSA 3HJ0A 2BIIA 4LVHC 5EZLB 3PNWB 4DH2A 3DI3B 3BPOC 4PJ7F 1FRGL 3HZ3A 3FN0H 1Q7YQ 4JY6B 3EJUA 4YK4B 5JTWA 1M2VA 3HR6A 2BNQD 1J5CA 4NPEA 5JIMA 1VACB 3CFKA 3V0VB 2VN3A 3K4ZA 1LT9B 2BCKA 5ECJE 4L3FA 1GA2A 1YAZA 2JSFA 2QJYB 3FJTA 4WJ5B 2M83A 4FFVC 5DGQA 2CRYA 2GPZA 5FA3A 3B2PA 3ESPA 1WGVA 3LS4H 5EOCJ 4ODTH 4G9FB 4X8JA 3OKOA 2NLJA 5E00B 5IP4A 1T5KA 3IGAA 4MS8C 2C8NA 2GBUA 4N22A 1J0YA 5JXEA 1JNLH 4JFFE 2Q10A 1SRDA 3DDFA 3Q2NA 3WY2A 1MFDH 2DM3A 2WXGA 4JB9L 3STZB 3FO0L 3BVVA 3TPUA 1YYLH 5GRUH 5SWZE 3QUXB 3H6JA 3O3AA 1CU4L 4PHZA 4LDEB 1WZ1H 3BJ91 3KPTA 1ZD6A 3EO0A 4M5ZH 4X6CF 1GYAA 3QQ3B 3FT4B 5A2FA 3LKRA 3C5SB 4HDIA 2N1TE 3BT2H 2BP8B 3HC4H 1OFCX 5DJTB 3EYFB 3IDUA 1MQ8A 4POYA 2FGWL 1LP9F 3O3EB 2Y36L 1PGPA 3C2AH 4JFWA 2IAMD 1AQKH 1LWUC 2OM5A 3LN4B 4U7MA 4Q9RH 2H32B 4PAZA 1JTPA 3QNXA 1BOGB 1MELA 4W9LC 4KI5E 4ODVL 4L1LA 1RQVA 5SWSE 1OZUA 1ZHNB 2YEZA 1EFXD 4TTDD 2DZEA 3BAWA 2X4OB 4G43B 4NM8H 4FQLL 1U8HB 2J1KA 2FT6A 3P4OA 1R3LA 2QGBA 4WO4B 5EULV 4YJZL 5C0FB 5KVFH 2WNXA 5B7FA 2VL5A 1LGVA 5KLVD 2FSEA 4L8CA 1P1ZA 2I32A 1BZEA 1B4RA 5DEGB 1CLOL 4CW1B 1BYPA 1OD7A 2Z64C 3KNBA 3QO0B 4AVJA 3QA3A 4LCYB 4XN2A 4PD4D 4JQIH 4DO6A 4NS0A 1XF4A 5DUPH 3VSTA 2V6HA 5D1XB 5F9JB 2VDRB 1MHPH 2A3TA 3QUYC 4MJ2A 1KYOI 3RP1A 4ZUSA 2W80C 1VGKA 3H1ZA 1BD2A 3D3VE 5IBLD 1FFQA 2NUPA 4OCWL 1WZ1L 2OYOA 2LU7A 3R18A 3RVTD 4HX1B 1P84I 1B2YA 5CCKL 3BP5B 3WIHA 5EU4B 1NGQL 4OZIF 2YQBA 4NHUB 4YR6A 1FZBA 3GIVB 3VFUB 4P4RA 1VQ4P 1RE4A 3KYNA 5EWIL 5EO9A 1DO5A 3LQAC 4KKLD 4HWZB 3A47A 1F1GA 3MRLB 4M43H 1YNKL 2KS1A 1SEQL 4PIRF 1XSKA 3ZIMA 5TDPA 2XZAL 2OCJA 2A9BA 2CR3A 4JFOA 3NK3A 3MYJB 3W39A 1XB8A 1XZ0A 2EDDA 2H1XA 2GUSA 3MYZA 5T1LD 2NPLX 5E4EC 4TNFA 1FZJA 4IJ3B 5IJKC 1HVVA 3GO1L 3MJ9H 2NUTA 1L0NJ 1NM4A 1JDAA 2J71A 4XNXH 4AMWA 2N4IA 4L8DA 4OGQD 4FMFA 1JV5B 4LCWA 1I8AA 4EPSA 2PO6C 4X6CA 4BXSV 1MW0A 3A4DA 1EQ7A 2O6CA 1SQQE 3V2PA 1UB6A 5DU7A 1AYOA 5F1IA 1F4YH 5GGVY 2H0JA 3EYUH 2M5AB 4L75A 1NBVL 3IE9A 1FRGH 3QUYB 3CWBG 2CO2A 3LRSA 5IEKB 2VR4A 1QUNB 5TE6H 5L8RJ 3V4QA 5A2KH 3NPZB 3TXAA 1Q81Q 4IMKC 4E2OA 2P43B 2Z8RA 1SFCB 1TPXC 2NZ9D 3D71A 3G6JF 4L4JA 3W0WE 4J23A 1CBJA 5T5NG 5CR8A 2ZWSA 4ZXBB 1H0DB 1ZMYA 3PY9A 4APQC 5J6HA 3HG4A 1C5CL 1O7VA 3CFDB 2R69H 3ZE0B 4WK0B 2ICCA 5CU9A 5IQNA 2P5EE 3M06A 3BPLC 4LLAA 1DEEA 3KJ4B 1XMWA 3B5NC 3FT2B 4KRNA 3RIAK 1VGEL 3NJKA 5FOBA 3WNKA 1QZNA 1CL7L 2QQNH 1PNDA 2VIRA 4J8QA 1BSIA 5IB2A 1T8ZA 2KIKA 1IZKA 3R4DA 2FGWH 4F2FA 4JFDB 2BHFA 3TS8A 2EJ1A 3NBNA 1NANI 5EF2A 4IRSC 3UMNA 2ZYDA 3PGCB 1XGRA 1H6EA 3LPWA 4PGCA 3SCMA 4ZNCA 3IE4A 3SY6A 1IGIH 1HCVA 2QMJA 2QGDA 4IKNA 4UM8B 2LGNA 3CC5A 1CE1L 1CI6A 3HE6D 4MTMA 4TQ8A 5IKCA 1NFKA 1CURA 3PHOA 5SWSA 1SBSH 5IHWA 4YDLB 4NKMA 3JSSA 1AFOA 4P06A 4PP1D 2Z92B 5EFIB 1J9RA 1M7LA 2ZP9A 1JWUB 2IZ0A 1KT2A 2FWOB 2CHNA 5I6MA 1TQTA 1AHWB 1U3HA 3QEQE 1G1YA 1BREA 3GEFA 3TVMC 4M5TA 3NFNB 4C8XA 4PGEA 3TNNA 3DYMA 4S0HA 4FQXB 3FQ4A 1HH6B 4JHWH 3FU3A 5HGGS 4S1RH 1M57B 2Y1AA 3DDGA 5JW4R 4GKNB 1NMCB 1TLKA 2K3HA 4BUGA 1R17A 1HDMA 2BNQE 3CLWA 4YAQB 4NN5C 4AITA 4U4BA 4O51B 2IF7A 2R5BA 5FXCH 2H2SC 4HJJL 5JO5B 1SQBE 1NGZB 2B1AL 2X0UA 4PB0L 1G2CA 3QJQB 1QEXA 2OZ4H 4HJUA 2TSBA 5C07A 5JYLA 4WY7L 1AHMA 4LLYA 5KYWA 3FFCD 2OULB 3P0YH 1QFUH 3NCBB 3L1FA 1DVFD 1WJ3A 4ZFOA 4UIKL 1WK0A 3VXME 4PTUA 3S3JA 4OCXL 5J7CC 5HDRA 1LO5A 3TBVA 2BVPA 1Q0EA 2HB0A 3GSUB 3HZVA 3LKQA 4MNQB 4BH8A 2OR8A 3VYIA 3TJEH 4B50A 1DQMH 3D30A 4MCYB 4R5VA 5SV3A 4ODSH 5TPWL 1MJ7L 3H9SD 4XZUB 2F54A 2R2HA 3LRGA 1KDJA 2Q8AL 3TESA 4PJEA 3L5XH 1GGCL 4CDHA 4OI8A 4EI5A 4BFNA 1XAKA 3HC2A 1BJMA 4M7LT 4PRPD 2BEZF 4LHUB 1KPVB 2RCSL 4QTHB 4Y4KD 5BZDB 4TKWA 1RF1B 4MX7B 3WEBA 2ZXQA 4LSPL 2K0RA 3T0AA 1V10A 3KPNB 4O02A 1IFMA 2B20A 4XP1H 2FX9L 5DLML 4KMLB 5IGXL 4JG0H 4MNHA 4AVKA 4NPKA 3UAAA 2OJZH 4AQOA 5CJ8A 2R0LH 4AUYA 4N0CD 4UOZA 3WUTA 4OWFA 2Q76A 1CPUA 4HEME 4QYAA 4XE5B 3MLSH 3DTXA 1FFOB 3KEHA 5JZ7C 5EORH 4RBPK 1B9KA 3RVXD 4U6TA 5E2TH 1Y18A 3O9WB 2X9XA 5IM7A 3OX8B 2HRLA 4XVOA 3L3JA 3Q8EA 5IB3A 4WWKB 4L8BA 1URIA 4ZSOE 4MB4A 4PWJA 2WBWB 3EYOB 1G9ML 3NSJA 4XCCL 1EXGA 3D85A 3VXSE 1EX0A 3WMPA 1TJGL 2DQFB 2XWRA 1KF9B 4G6FB 4KY2A 5FGSA 1LTXA 2VXSH 1JZ6A 5E2UL 1E7VA 3QUML 1LTBC 1B0GA 5LBSH 3M9BA 4HS8L 3NN8A 3OKEB 5H4ZA 1NKRA 1H8NA 3CXDL 4OH2A 2ADIB 5DJ0B 2XTSA 4Z76B 3LYRA 2Y5QA 3F7VA 5FO9A 3NDZE 3UBXA 4Y4HC 1UM5H 1AXTL 5I76A 4K94H 2WZ7A 2ETWA 1QHOA 1XCQA 3OWEA 2KHAA 1T3FB 1Q1PA 4Q8BA 5HYFA 1A6AA 5DUPL 2ZIDA 2JCCA 1OAUL 2A9NH 2XBDA 5HVGB 5JDJA 1T03L 2UZXA 3SE4C 4OUUA 1IGFL 2B77A 4QJ3B 3VDCA 2QEJA 3IFNH 3LCYA 1GOGA 2YAMA 3RNKB 3VTAA 2BW5A 1I1FB 3LNHA 3MLZH 4UV7L 4U49A 1SQXE 5J6GA 1UFUA 3FHQA 4HWBH 3AE6C 3MLZL 2PYFB 4KY1L 3TA3C 4F7EA 4L29B 1RPKA 1IKFL 1UD3A 2AV1A 2VWEE 3CZSA 3V4UL 5CNHA 5D5MA 1SMDA 1JV2A 4PRAB 3ZKMD 2FFDA 2DMCA 3SGDH 2XPYA 2ESVB 2GJ6B 1EEZB 2I60H 4EIBA 5GRWA 1BXXA 4DPRA 3GMQB 1Q9LA 1J12A 1AS8A 3QUKB 4XN7A 4NUPA 4OLUL 1AA0A 1OP5K 3RVUC 2R23A 4KUZH 2D7PA 2JJWA 4KK9C 3CFMA 4U7KA 3V4PA 3TGUJ 1B90A 3AZUA 4PJGF 3L37A 5ISZA 3G9RA 7FABH 4YSRA 2RTTA 4TVPL 3HVNA 3NJNA 1C5BH 4FX5A 5GISH 5DJXA 4U1HA 4HK3N 4K3EH 4ZX6A 2OP4H 2H8PA 2R29L 3ZZSA 4OU3A 3P69A 3VG9B 3CQPA 3HG1D 3WNJA 1FNGA 5CAYB 2P5WE 3LKSB 5GGRA 5I0XA 5KVGH 3PWNA 3TNUA 3C60D 1FYHB 3PPEA 4GXVL 5MEOA 1G7HB 4HJTA 1U8LA 4HPOH 2YQ2A 5T1DL 1NANH 2EEBA 1E5WA 4BH7B 2FAUA 1CTOA 2J8UE 3P9LB 3DMMA 4HKZB 4U6XB 5CS7A 4LQ1A 4HUKB 3BVWA 5DYOA 3VWKA 1RJZA 3M0AA 4AUUA 2VMEA 5A2CA 3KDMA 3X12A 1JGEB 5DQJA 1RJYA 5FFLA 4GSXA 2PTUA 1B4TA 4BK8A 2QT6A 4WHCA 3VXTA 3MODH 3AT8A 4Z7VB 2WYZA 2IFNA 3ARWA 3V5DA 3FN0L 2AXCA 2XWTA 4QRBA 4RISH 3ZYIA 1YQVH 2E42A 2PGDA 2XNAA 3WHXA 5EOTA 1KIPB 5ICYB 4Y2OA 2KBGA 3GTTA 4UV4L 4N6RA 3HE7C 1L0QA 1CYWA 1MFCH 3QP3A 5GJTH 5IROA 1NCTA 3BHBA 2Y9YA 4NEHB 3ARBA 3O6QB 3E3QC 1ZLSL 4MA1B 2GVYA 2W9DL 2BSBA 4ISVB 3WS6C 1DQML 1MKFA 2XWCA 3MRIB 4OQ1A 4Y4HB 4Q2ZA 1XL6A 1ZHBB 4U6HA 2PAJA 3O3BB 1J87A 3VXRE 5EHFA 1YMHA 3K2MC 1QACA 3EW3B 3ZQWA 2FYYA 2YKLH 3KPOB 1R33A 4UILL 2D2OA 4HFUH 3SDDA 2X41A 1FIEA 5D7JA 2VB5A 5FDWB 1UZ6F 4PJ7B 1GS8A 4MAYA 3IXTB 4PW4A 5DVKA 3DYOA 2QPFA 1KB9E 4NKQB 5DHYA 3TEUA 4JRYD 5AKRA 4IIQB 3X14B 4IS6B 1I9EA 4OCSL 3VWKC 3B2VL 4J3UA 2A74C 2X89D 4PD4I 1T2KD 2D9QB 4ONFL 3S34L 4MQXC 1DJHA 1BFTA 1JXGA 3PWPA 3O6FB 1S5LE 3Q6FA 1RIHL 5APYA 3GHGA 2P49B 2ZOUA 4X9GA 5I1IL 4FQ2H 3LVTA 4PBDA 1C8QA 1KGWA 1XBDA 2X10A 3FUEA 2CDFB 4KKCC 1OT4A 1PFIA 1PYWB 3ARED 4KJPC 3L1OH 4YO0B 3JBG7 1W72B 3TBTA 5ID1A 3F83A 3AAZB 2N1TA 3TTYA 2EVIA 1XCTB 2R4SH 2XRAL 5FR3A 2XNXA 2P1JA 2X1XR 4JS7A 4DTGH 2C3WA 5BW7A 4WGKA 4HKZH 2HKFL 3I5CA 1TCMA 5ENWB 5GZOD 2FVNA 2XWBB 4TNEA 3N04A 1XF3A 4Z3EA 1D6EA 3NZHH 1BG9A 5E8EA 1EEYB 3FQXB 4I0KA 3NIGF 2V9QA 4I1PA 4W9GC 5DWPA 1H9DA 3AQXA 1IFRA 3PL6D 32C2B 2CPBA 1B4LA 4S1DD 3NFPB 3BDBA 5C0BA 1RE3C 4XVSH 1KGJA 4FJYA 4DW2H 1RK1A 3TT3L 4WAFA 3HS0B 2WQWA 4MGXA 2LV4A 5HGAB 1UWYA 1ZRTD 4NAMA 3N1GC 4D9LL 3AU1A 1JNJA 3QEGH 1YMMA 5C8JB 1UB5A 1D5XA 2PW1B 2CO1A 2WHVA 3MJ6A 3MOBH 4WTWA 4YPGA 4X4XA 3U36A 1SJEB 3BKMH 1CO1A 3UTQA 3GYRA 4ZMNA 4V1DA 1VFAA 1NU1J 4UV4H 4GODA 2R83A 3RPIA 4OLWH 1GZHA 4XMKH 5A2LH 3ATAA 4KI5C 4WFGE 3MUGB 2H0PA 4PJ5B 3CTTA 4GLRI 3VTPC 3MUGA 1TQSA 2D7MA 1JN6B 4P3CL 2YD1A 2HJLA 5C0AA 3RL1A 3RPIB 4HYTB 2Y72A 3GO1H 3CJJA 3QEHA 4NZUH 3V4VB 1F2QA 4IRJA 4NPDA 3MODL 3WEXB 3DETD 2H9GA 3W9EA 3GI8H 3VVWA 5EN2A 3H32B 4MA1C 1S7TB 2R59A 1YNLH 1QL1A 1AO7A 2OS7A 5KBNC 3DUHA 5AKSA 1CTMA 3P3UA 2FCBA 5CU5A 3N0PB 4ODWB 2LU4A 5LUMA 2XN9E 1EGJA 1IGJA 3HHMA 4YFLI 4ZK8A 1X5HA 1IAOA 4GRLB 4P57B 4UTCA 3ELQA 4JQVA 5H8DA 2QV4A 1IL1B 1SF5A 3SO3B 2P9RA 2J44A 2X0WA 4JZNA 4M6NH 3TV3L 1L0YA 2MEJB 3HC0B 2ZG3A 3AG2B 3V5HA 4ALAL 4PTTA 2P48B 3D1MC 2OYMA 3FTVA 4G7RB 4G8FA 4W68A 1KXVA 1MVYA 2BVOB 4XNAA 5TQ2L 4XHJD 5GGSA 3VI4B 3ZMEA 4WK4B 2H6PB 1ZVNA 3R2PA 2EH7H 3GSRB 3CFTA 5JR1L 5T33H 2CK2A 4P5TA 4RH4A 3UTPE 4WO4D 4YHPA 2VZVA 1YTZI 4LMQE 3C5ZB 1AR1C 3FB8B 4NNPH 1M1XA 1NEPA 2Y5TB 1WZKA 4MJHA 4OV6F 2LQRA 3S3PA 3X11A 4CVWA 4XBPA 4ALAC 3CVHA 2YUZA 4X9BA 4FQLH 4ELMB 1KFNA 4IRZL 1XXFC 1NKNA 3GI8L 4LGRB 2D7NA 4MZ3A 4YHNB 4QRFA 4LSSH 1DUYB 4EOWH 3L3IB 5IVZB 2IGTA 1JZ7A 4HMCA 2WTOA 4PRHA 3U0PB 3IXTA 2QPDB 2B16A 5IQMA 4DPBX 2WUBH 1AXSA 3C8VA 5L7XH 4CMHB 3UYPA 4KHXH 4X8CA 3QPXL 1XFPA 4BZYA 2UWJE 3AQDA 3C08L 1PEZA 1J8HE 2F7OA 3MJ8A 1QUPA 3B8EB 8FABB 3FWNA 2AANA 3E9UA 3AEGC 5T3ZE 4U0RC 4J4PD 3O4LB 1TO4A 2R4RH 5D71L 3L16A 4JQXC 2F53B 3BIKB 2WD0A 3ARYA 1FP5A<