3KDQA

Crystal structure of a functionally unknown conserved protein from corynebacterium diphtheriae.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
152
structure length
152
Chain Sequence
AMYLAEALAQRVEAQRRYSELNQLLLDVAKVQEGDQPAENPHEILTELEELTTRINDLVRRINRTNSVTEFSEGMTLADALSVRDALLKKRTLYSDLADQLTSRQDRYSRSEIKYVATMDAREIRKKADLAAKEYRQLDVDIQRLNWQTELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized conserved protein
publication title Crystal structure of a functionally unknown conserved protein from Corynebacterium diphtheriae.
rcsb
source organism Corynebacterium diphtheriae
molecule tags Structural genomics, unknown function
total genus 56
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.50 Mainly Alpha Up-down Bundle Ferritin Ferritin 3kdqA00
3KDQA
chains in the Genus database with same CATH superfamily
4ITTA 1DVBA 5GU1X 3EGMA 1NNQA 3QVDA 3VNXA 4CMYA 3SHXA 3F33A 2Z5PA 3QB9A 2YJJA 3HL1A 4ML5A 3FI6A 3Q4QA 5C6FA 3IQ1A 3FVBA 2VXXA 1S3QA 3A9QA 3PW1B 2V2IA 3KA8A 5FFDA 5D8XA 1YV1A 3UOFA 3AJOA 2ZA6A 2CN7A 4Z3BA 2ZURX 3JZ9A 5I4JA 3ES3A 5E1UA 3N6OA 4YXJA 5GU2X 2JD60 3Q4OA 2CIHA 4KVSA 3FRRA 3GHQA 3ISFA 2Z5QA 4A25A 2PYBA 4TOBA 3F34A 4XKUA 1YUXA 5GU3X 2V8UA 2VZBA 4ZMCA 5HJFA 3WVVA 1L8IA 4TOHA 4YXMA 2WLAA 2V2NA 3OGHA 5FFBA 3R2KA 1RCIA 2XJMA 5D8YA 4OYNA 4ZLWA 3PWQC 3KA3A 3IS8A 1XZ1A 2UX1A 3PVRA 2ZA7A 4PG1A 1EUMA 4CYBA 3PWFA 3AK9A 5J93A 1VEQA 2Z6MA 2XGWA 5D8SA 3C1ZA 3E1JA 3PVYB 1TKOA 3V3KB 1MFRA 2OC5A 4XKTA 4E6KA 2FG8A 3KDQA 3E2CA 5JKMA 4MXPA 1JI5A 2V2SA 3PVTB 4E40A 4X0JA 5D8RA 3DBYA 4EVDA 2XJNA 2FHAA 2FL0A 4TOGA 4RC7A 3E1PA 2IU2A 3A68A 2D5KA 4EVBA 1KRQA 2IB0A 1IERA 4LPNA 3NP0X 4MY7A 2ITBA 4CY9A 2Y44A 4RC7B 3GGZA 2Z5RA 4CMYV 2ZG7X 4RC5B 3R2MA 5JACA 5LBHA 1S30A 1BFRA 3NOZX 3KXUA 2V2MA 3VV9A 1DPSA 3SH6A 3QD8A 2GYDA 4ISPA 1JKVA 4ZL5A 3QZ3A 5FFCA 5CZUA 5J8SA 3OJ5A 3BVIA 3F37A 3O7SA 1Z6OA 2ZG8X 1XZ3A 3MPSA 3PW8A 5JKLA 3R2RA 3R2OA 3LKDA 5HJHA 3FRSA 1HRSA 4AM4A 4LQVA 4CVRA 4M33A 1AEWA 4ZKHA 2CWLA 3E1QA 5CMQA 5JKMG 3GGYA 3E1NA 2C2JA 3Q4RA 4AM5A 1JI4A 1OTKA 3WNWA 3GVYA 3R2LA 5D8QA 1Z4AA 1RYTA 3E6RA 2WLUA 2F7NA 2IY4A 3BVLA 3BT5A 1F30A 1Z6OM 4ZJKA 2FJCA 2C2FA 3WVWA 4LQJA 4TOAA 4U3GA 4YVZA 3E1LA 1RCCA 3GE4A 5GN8A 1QGHA 3BKNA 4MUDA 1BG7A 1BCFA 1NFVA 4PG0A 4Y08A 1TK6A 3AF9X 4ITWA 1VEIA 2AR0A 3PVRB 3RE7A 5LG8A 2C41A 4QUWA 3D19A 3EZ0A 4Z5SA 4CVSA 1RCDA 1TJOA 4PGIA 2V2RA 2Y3QA 5FFEA 1TKPA 1IESA 4TW3A 5JDOA 3NP2X 1JREA 1J30A 1N1QA 4LPJA 4II4A 5JKLG 3UFBA 2Z90A 4MJYA 5LS9A 2WTLA 4WJG4 3VVAA 1S2ZA 3AF7X 1R03A 3RGDA 2YW6A 5J8WA 1O9RA 1YUZA 3QHCA 3E6SA 4M35A 4RC8A 4IWKA 3UOIA 4DYYA 5E2DA 4ZKWA 4LQNA 2CHIA 1QYBA 2RBDA 2ZG9X 2BW1A 3H7GA 3T9JA 3RAVA 4KXRB 1O9IA 4KVQA 4RC6A 3RBCA 1LKPA 2BK6A 3W54A 5AXSA 1H96A 3ERZA 1VELA 3KA9A 1ZUJA 1MOJA 2GS4A 2C2UA 1DATA 4P18A 3FSEA 3KA6A 4DYZA 4ETRA 5ERKA 4DE6A 5D8PA 2HTNA 5HU6D 2MGYA 3F35A 4TO9A 3U90A 3QHBA 4IXKA 4LYXA 4MKUA 3F39A 1RCGA 3KX9A 3M6JA 4XGSA 3AF8X 3PW1A 3RD0A 1L8HA 2OKCA 4PGKA 5HQOA 2CEIA 2V2LA 3E1MA 3SIDA 5GOUA 5ERJA 4ZKXA 4MN9A 3R2SA 1JKUA 2GYQA 2V2JA 3KHKA 4DYXA 1RCEA 1JGCA 4LPMA 1NF4A 4ZL6A 2CN6A 2ZA8A 5J9VA 4AM2A 3WVUA 2N02A 1UMNA 4ISMA 3ISEA 4YKHA 4DZ0A 3O7RA 4CVTA 2QF9A 2WWXB 4KVRA 2V8TA 4ERUA 5GU0X 3C1YA 2C6RA 3BVFA 5LG2A 2HR5A 2VXIA 3F32A 4CVPA 5IX6A 4EVCA 5CMRA 5K53A 2CLUA 3SE1A 1FHAA 1NF6A 4TOCA 1LKMA 2OH3A 4M34A 2XKQA 1SQ3A 3TA8A 4EVEA 3F36A 2BKCA 5GN8B 2FFXJ 1JTSA 3Q4NA 2G4HA 3L0MA 2X170 2JD80 1GWGA 3KA4A 2YW7A 1ZS3A 3AK8A 2G38B 3PVYA 2W0OA 2V2PA 1JYBA 4DYUA 1JIGA 1LB3A 3C23A 4TODA 3C21A 2CF7A 3PVTA 1SOFA 3JZAB 3AJQA 5D8OA 5JDOB 3KWOA 2FZFA 1LKOA 5K52A 4CYAA 4II4B 4TOFA 1VJXA 3BVKA 2CLBA 3PW8C 4LYUA 1VLGA 2FG4A 3F38A 4DI0A 4IWJA 2V15A 2V2OA 2CHPA 2FKZA 2BJYA 4M32A 4W4LB 4XKSA 3HIUA 4TOEA 2JD70 2YJKA 4ZTTA 3PWQA 1B71A 4W4KB 3E1OA 4RC5A 3PZAA 5FFAA 1UVHA 4R42A 4DASA 3BVEA 3EZUA 4LQHA 3IS7A 2XJOA 3AJPA 5FEJA 2QQYA 3R2HA 4RC6B 3UNOA 4REUA 1F33A
chains in the Genus database with same CATH topology
4ITTA 1DVBA 5GU1X 3EGMA 1NNQA 3QVDA 3VNXA 4CMYA 3SHXA 3F33A 2Z5PA 3QB9A 2YJJA 3HL1A 4ML5A 3FI6A 3Q4QA 5C6FA 3IQ1A 3FVBA 2VXXA 1S3QA 3A9QA 3PW1B 2V2IA 3KA8A 5FFDA 5D8XA 1YV1A 3UOFA 3AJOA 2ZA6A 2CN7A 4Z3BA 2ZURX 3JZ9A 5I4JA 3ES3A 5E1UA 3N6OA 4YXJA 5GU2X 2JD60 3Q4OA 2CIHA 4KVSA 3FRRA 3GHQA 3ISFA 2Z5QA 4A25A 2PYBA 4TOBA 3F34A 4XKUA 1YUXA 5GU3X 2V8UA 2VZBA 4ZMCA 5HJFA 3WVVA 1L8IA 4TOHA 4YXMA 2WLAA 2V2NA 3OGHA 5FFBA 3R2KA 1RCIA 2XJMA 5D8YA 4OYNA 4ZLWA 3PWQC 3KA3A 3IS8A 1XZ1A 2UX1A 3PVRA 2ZA7A 4PG1A 1EUMA 4CYBA 3PWFA 3AK9A 5J93A 1VEQA 2Z6MA 2XGWA 5D8SA 3C1ZA 3E1JA 3PVYB 1TKOA 3V3KB 1MFRA 2OC5A 4XKTA 4E6KA 2FG8A 3KDQA 3E2CA 5JKMA 4MXPA 1JI5A 2V2SA 3PVTB 4E40A 4X0JA 5D8RA 3DBYA 4EVDA 2XJNA 2FHAA 2FL0A 4TOGA 4RC7A 3E1PA 2IU2A 3A68A 2D5KA 4EVBA 1KRQA 2IB0A 1IERA 4LPNA 3NP0X 4MY7A 2ITBA 4CY9A 2Y44A 4RC7B 3GGZA 2Z5RA 4CMYV 2ZG7X 4RC5B 3R2MA 5JACA 5LBHA 1S30A 1BFRA 3NOZX 3KXUA 2V2MA 3VV9A 1DPSA 3SH6A 3QD8A 2GYDA 4ISPA 1JKVA 4ZL5A 3QZ3A 5FFCA 5CZUA 5J8SA 3OJ5A 3BVIA 3F37A 3O7SA 1Z6OA 2ZG8X 1XZ3A 3MPSA 3PW8A 5JKLA 3R2RA 3R2OA 3LKDA 5HJHA 3FRSA 1HRSA 4AM4A 4LQVA 4CVRA 4M33A 1AEWA 4ZKHA 2CWLA 3E1QA 5CMQA 5JKMG 3GGYA 3E1NA 2C2JA 3Q4RA 4AM5A 1JI4A 1OTKA 3WNWA 3GVYA 3R2LA 5D8QA 1Z4AA 1RYTA 3E6RA 2WLUA 2F7NA 2IY4A 3BVLA 3BT5A 1F30A 1Z6OM 4ZJKA 2FJCA 2C2FA 3WVWA 4LQJA 4TOAA 4U3GA 4YVZA 3E1LA 1RCCA 3GE4A 5GN8A 1QGHA 3BKNA 4MUDA 1BG7A 1BCFA 1NFVA 4PG0A 4Y08A 1TK6A 3AF9X 4ITWA 1VEIA 2AR0A 3PVRB 3RE7A 5LG8A 2C41A 4QUWA 3D19A 3EZ0A 4Z5SA 4CVSA 1RCDA 1TJOA 4PGIA 2V2RA 2Y3QA 5FFEA 1TKPA 1IESA 4TW3A 5JDOA 3NP2X 1JREA 1J30A 1N1QA 4LPJA 4II4A 5JKLG 3UFBA 2Z90A 4MJYA 5LS9A 2WTLA 4WJG4 3VVAA 1S2ZA 3AF7X 1R03A 3RGDA 2YW6A 5J8WA 1O9RA 1YUZA 3QHCA 3E6SA 4M35A 4RC8A 4IWKA 3UOIA 4DYYA 5E2DA 4ZKWA 4LQNA 2CHIA 1QYBA 2RBDA 2ZG9X 2BW1A 3H7GA 3T9JA 3RAVA 4KXRB 1O9IA 4KVQA 4RC6A 3RBCA 1LKPA 2BK6A 3W54A 5AXSA 1H96A 3ERZA 1VELA 3KA9A 1ZUJA 1MOJA 2GS4A 2C2UA 1DATA 4P18A 3FSEA 3KA6A 4DYZA 4ETRA 5ERKA 4DE6A 5D8PA 2HTNA 5HU6D 2MGYA 3F35A 4TO9A 3U90A 3QHBA 4IXKA 4LYXA 4MKUA 3F39A 1RCGA 3KX9A 3M6JA 4XGSA 3AF8X 3PW1A 3RD0A 1L8HA 2OKCA 4PGKA 5HQOA 2CEIA 2V2LA 3E1MA 3SIDA 5GOUA 5ERJA 4ZKXA 4MN9A 3R2SA 1JKUA 2GYQA 2V2JA 3KHKA 4DYXA 1RCEA 1JGCA 4LPMA 1NF4A 4ZL6A 2CN6A 2ZA8A 5J9VA 4AM2A 3WVUA 2N02A 1UMNA 4ISMA 3ISEA 4YKHA 4DZ0A 3O7RA 4CVTA 2QF9A 2WWXB 4KVRA 2V8TA 4ERUA 5GU0X 3C1YA 2C6RA 3BVFA 5LG2A 2HR5A 2VXIA 3F32A 4CVPA 5IX6A 4EVCA 5CMRA 5K53A 2CLUA 3SE1A 1FHAA 1NF6A 4TOCA 1LKMA 2OH3A 4M34A 2XKQA 1SQ3A 3TA8A 4EVEA 3F36A 2BKCA 5GN8B 2FFXJ 1JTSA 3Q4NA 2G4HA 3L0MA 2X170 2JD80 1GWGA 3KA4A 2YW7A 1ZS3A 3AK8A 2G38B 3PVYA 2W0OA 2V2PA 1JYBA 4DYUA 1JIGA 1LB3A 3C23A 4TODA 3C21A 2CF7A 3PVTA 1SOFA 3JZAB 3AJQA 5D8OA 5JDOB 3KWOA 2FZFA 1LKOA 5K52A 4CYAA 4II4B 4TOFA 1VJXA 3BVKA 2CLBA 3PW8C 4LYUA 1VLGA 2FG4A 3F38A 4DI0A 4IWJA 2V15A 2V2OA 2CHPA 2FKZA 2BJYA 4M32A 4W4LB 4XKSA 3HIUA 4TOEA 2JD70 2YJKA 4ZTTA 3PWQA 1B71A 4W4KB 3E1OA 4RC5A 3PZAA 5FFAA 1UVHA 4R42A 4DASA 3BVEA 3EZUA 4LQHA 3IS7A 2XJOA 3AJPA 5FEJA 2QQYA 3R2HA 4RC6B 3UNOA 4REUA 1F33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KDQ A; 
#chains in the Genus database with same CATH topology
 4ITT A;  1DVB A;  5GU1 X;  3EGM A;  1NNQ A;  3QVD A;  3VNX A;  4CMY A;  3SHX A;  3F33 A;  2Z5P A;  3QB9 A;  2YJJ A;  3HL1 A;  4ML5 A;  3FI6 A;  3Q4Q A;  5C6F A;  3IQ1 A;  3FVB A;  2VXX A;  1S3Q A;  3A9Q A;  3PW1 B;  2V2I A;  3KA8 A;  5FFD A;  5D8X A;  1YV1 A;  3UOF A;  3AJO A;  2ZA6 A;  2CN7 A;  4Z3B A;  2ZUR X;  3JZ9 A;  5I4J A;  3ES3 A;  5E1U A;  3N6O A;  4YXJ A;  5GU2 X;  2JD6 0;  3Q4O A;  2CIH A;  4KVS A;  3FRR A;  3GHQ A;  3ISF A;  2Z5Q A;  4A25 A;  2PYB A;  4TOB A;  3F34 A;  4XKU A;  1YUX A;  5GU3 X;  2V8U A;  2VZB A;  4ZMC A;  5HJF A;  3WVV A;  1L8I A;  4TOH A;  4YXM A;  2WLA A;  2V2N A;  3OGH A;  5FFB A;  3R2K A;  1RCI A;  2XJM A;  5D8Y A;  4OYN A;  4ZLW A;  3PWQ C;  3KA3 A;  3IS8 A;  1XZ1 A;  2UX1 A;  3PVR A;  2ZA7 A;  4PG1 A;  1EUM A;  4CYB A;  3PWF A;  3AK9 A;  5J93 A;  1VEQ A;  2Z6M A;  2XGW A;  5D8S A;  3C1Z A;  3E1J A;  3PVY B;  1TKO A;  3V3K B;  1MFR A;  2OC5 A;  4XKT A;  4E6K A;  2FG8 A;  3KDQ A;  3E2C A;  5JKM A;  4MXP A;  1JI5 A;  2V2S A;  3PVT B;  4E40 A;  4X0J A;  5D8R A;  3DBY A;  4EVD A;  2XJN A;  2FHA A;  2FL0 A;  4TOG A;  4RC7 A;  3E1P A;  2IU2 A;  3A68 A;  2D5K A;  4EVB A;  1KRQ A;  2IB0 A;  1IER A;  4LPN A;  3NP0 X;  4MY7 A;  2ITB A;  4CY9 A;  2Y44 A;  4RC7 B;  3GGZ A;  2Z5R A;  4CMY V;  2ZG7 X;  4RC5 B;  3R2M A;  5JAC A;  5LBH A;  1S30 A;  1BFR A;  3NOZ X;  3KXU A;  2V2M A;  3VV9 A;  1DPS A;  3SH6 A;  3QD8 A;  2GYD A;  4ISP A;  1JKV A;  4ZL5 A;  3QZ3 A;  5FFC A;  5CZU A;  5J8S A;  3OJ5 A;  3BVI A;  3F37 A;  3O7S A;  1Z6O A;  2ZG8 X;  1XZ3 A;  3MPS A;  3PW8 A;  5JKL A;  3R2R A;  3R2O A;  3LKD A;  5HJH A;  3FRS A;  1HRS A;  4AM4 A;  4LQV A;  4CVR A;  4M33 A;  1AEW A;  4ZKH A;  2CWL A;  3E1Q A;  5CMQ A;  5JKM G;  3GGY A;  3E1N A;  2C2J A;  3Q4R A;  4AM5 A;  1JI4 A;  1OTK A;  3WNW A;  3GVY A;  3R2L A;  5D8Q A;  1Z4A A;  1RYT A;  3E6R A;  2WLU A;  2F7N A;  2IY4 A;  3BVL A;  3BT5 A;  1F30 A;  1Z6O M;  4ZJK A;  2FJC A;  2C2F A;  3WVW A;  4LQJ A;  4TOA A;  4U3G A;  4YVZ A;  3E1L A;  1RCC A;  3GE4 A;  5GN8 A;  1QGH A;  3BKN A;  4MUD A;  1BG7 A;  1BCF A;  1NFV A;  4PG0 A;  4Y08 A;  1TK6 A;  3AF9 X;  4ITW A;  1VEI A;  2AR0 A;  3PVR B;  3RE7 A;  5LG8 A;  2C41 A;  4QUW A;  3D19 A;  3EZ0 A;  4Z5S A;  4CVS A;  1RCD A;  1TJO A;  4PGI A;  2V2R A;  2Y3Q A;  5FFE A;  1TKP A;  1IES A;  4TW3 A;  5JDO A;  3NP2 X;  1JRE A;  1J30 A;  1N1Q A;  4LPJ A;  4II4 A;  5JKL G;  3UFB A;  2Z90 A;  4MJY A;  5LS9 A;  2WTL A;  4WJG 4;  3VVA A;  1S2Z A;  3AF7 X;  1R03 A;  3RGD A;  2YW6 A;  5J8W A;  1O9R A;  1YUZ A;  3QHC A;  3E6S A;  4M35 A;  4RC8 A;  4IWK A;  3UOI A;  4DYY A;  5E2D A;  4ZKW A;  4LQN A;  2CHI A;  1QYB A;  2RBD A;  2ZG9 X;  2BW1 A;  3H7G A;  3T9J A;  3RAV A;  4KXR B;  1O9I A;  4KVQ A;  4RC6 A;  3RBC A;  1LKP A;  2BK6 A;  3W54 A;  5AXS A;  1H96 A;  3ERZ A;  1VEL A;  3KA9 A;  1ZUJ A;  1MOJ A;  2GS4 A;  2C2U A;  1DAT A;  4P18 A;  3FSE A;  3KA6 A;  4DYZ A;  4ETR A;  5ERK A;  4DE6 A;  5D8P A;  2HTN A;  5HU6 D;  2MGY A;  3F35 A;  4TO9 A;  3U90 A;  3QHB A;  4IXK A;  4LYX A;  4MKU A;  3F39 A;  1RCG A;  3KX9 A;  3M6J A;  4XGS A;  3AF8 X;  3PW1 A;  3RD0 A;  1L8H A;  2OKC A;  4PGK A;  5HQO A;  2CEI A;  2V2L A;  3E1M A;  3SID A;  5GOU A;  5ERJ A;  4ZKX A;  4MN9 A;  3R2S A;  1JKU A;  2GYQ A;  2V2J A;  3KHK A;  4DYX A;  1RCE A;  1JGC A;  4LPM A;  1NF4 A;  4ZL6 A;  2CN6 A;  2ZA8 A;  5J9V A;  4AM2 A;  3WVU A;  2N02 A;  1UMN A;  4ISM A;  3ISE A;  4YKH A;  4DZ0 A;  3O7R A;  4CVT A;  2QF9 A;  2WWX B;  4KVR A;  2V8T A;  4ERU A;  5GU0 X;  3C1Y A;  2C6R A;  3BVF A;  5LG2 A;  2HR5 A;  2VXI A;  3F32 A;  4CVP A;  5IX6 A;  4EVC A;  5CMR A;  5K53 A;  2CLU A;  3SE1 A;  1FHA A;  1NF6 A;  4TOC A;  1LKM A;  2OH3 A;  4M34 A;  2XKQ A;  1SQ3 A;  3TA8 A;  4EVE A;  3F36 A;  2BKC A;  5GN8 B;  2FFX J;  1JTS A;  3Q4N A;  2G4H A;  3L0M A;  2X17 0;  2JD8 0;  1GWG A;  3KA4 A;  2YW7 A;  1ZS3 A;  3AK8 A;  2G38 B;  3PVY A;  2W0O A;  2V2P A;  1JYB A;  4DYU A;  1JIG A;  1LB3 A;  3C23 A;  4TOD A;  3C21 A;  2CF7 A;  3PVT A;  1SOF A;  3JZA B;  3AJQ A;  5D8O A;  5JDO B;  3KWO A;  2FZF A;  1LKO A;  5K52 A;  4CYA A;  4II4 B;  4TOF A;  1VJX A;  3BVK A;  2CLB A;  3PW8 C;  4LYU A;  1VLG A;  2FG4 A;  3F38 A;  4DI0 A;  4IWJ A;  2V15 A;  2V2O A;  2CHP A;  2FKZ A;  2BJY A;  4M32 A;  4W4L B;  4XKS A;  3HIU A;  4TOE A;  2JD7 0;  2YJK A;  4ZTT A;  3PWQ A;  1B71 A;  4W4K B;  3E1O A;  4RC5 A;  3PZA A;  5FFA A;  1UVH A;  4R42 A;  4DAS A;  3BVE A;  3EZU A;  4LQH A;  3IS7 A;  2XJO A;  3AJP A;  5FEJ A;  2QQY A;  3R2H A;  4RC6 B;  3UNO A;  4REU A;  1F33 A; 
#chains in the Genus database with same CATH homology
 4ITT A;  1DVB A;  5GU1 X;  3EGM A;  1NNQ A;  3QVD A;  3VNX A;  4CMY A;  3SHX A;  3F33 A;  2Z5P A;  3QB9 A;  2YJJ A;  3HL1 A;  4ML5 A;  3FI6 A;  3Q4Q A;  5C6F A;  3IQ1 A;  3FVB A;  2VXX A;  1S3Q A;  3A9Q A;  3PW1 B;  2V2I A;  3KA8 A;  5FFD A;  5D8X A;  1YV1 A;  3UOF A;  3AJO A;  2ZA6 A;  2CN7 A;  4Z3B A;  2ZUR X;  3JZ9 A;  5I4J A;  3ES3 A;  5E1U A;  3N6O A;  4YXJ A;  5GU2 X;  2JD6 0;  3Q4O A;  2CIH A;  4KVS A;  3FRR A;  3GHQ A;  3ISF A;  2Z5Q A;  4A25 A;  2PYB A;  4TOB A;  3F34 A;  4XKU A;  1YUX A;  5GU3 X;  2V8U A;  2VZB A;  4ZMC A;  5HJF A;  3WVV A;  1L8I A;  4TOH A;  4YXM A;  2WLA A;  2V2N A;  3OGH A;  5FFB A;  3R2K A;  1RCI A;  2XJM A;  5D8Y A;  4OYN A;  4ZLW A;  3PWQ C;  3KA3 A;  3IS8 A;  1XZ1 A;  2UX1 A;  3PVR A;  2ZA7 A;  4PG1 A;  1EUM A;  4CYB A;  3PWF A;  3AK9 A;  5J93 A;  1VEQ A;  2Z6M A;  2XGW A;  5D8S A;  3C1Z A;  3E1J A;  3PVY B;  1TKO A;  3V3K B;  1MFR A;  2OC5 A;  4XKT A;  4E6K A;  2FG8 A;  3KDQ A;  3E2C A;  5JKM A;  4MXP A;  1JI5 A;  2V2S A;  3PVT B;  4E40 A;  4X0J A;  5D8R A;  3DBY A;  4EVD A;  2XJN A;  2FHA A;  2FL0 A;  4TOG A;  4RC7 A;  3E1P A;  2IU2 A;  3A68 A;  2D5K A;  4EVB A;  1KRQ A;  2IB0 A;  1IER A;  4LPN A;  3NP0 X;  4MY7 A;  2ITB A;  4CY9 A;  2Y44 A;  4RC7 B;  3GGZ A;  2Z5R A;  4CMY V;  2ZG7 X;  4RC5 B;  3R2M A;  5JAC A;  5LBH A;  1S30 A;  1BFR A;  3NOZ X;  3KXU A;  2V2M A;  3VV9 A;  1DPS A;  3SH6 A;  3QD8 A;  2GYD A;  4ISP A;  1JKV A;  4ZL5 A;  3QZ3 A;  5FFC A;  5CZU A;  5J8S A;  3OJ5 A;  3BVI A;  3F37 A;  3O7S A;  1Z6O A;  2ZG8 X;  1XZ3 A;  3MPS A;  3PW8 A;  5JKL A;  3R2R A;  3R2O A;  3LKD A;  5HJH A;  3FRS A;  1HRS A;  4AM4 A;  4LQV A;  4CVR A;  4M33 A;  1AEW A;  4ZKH A;  2CWL A;  3E1Q A;  5CMQ A;  5JKM G;  3GGY A;  3E1N A;  2C2J A;  3Q4R A;  4AM5 A;  1JI4 A;  1OTK A;  3WNW A;  3GVY A;  3R2L A;  5D8Q A;  1Z4A A;  1RYT A;  3E6R A;  2WLU A;  2F7N A;  2IY4 A;  3BVL A;  3BT5 A;  1F30 A;  1Z6O M;  4ZJK A;  2FJC A;  2C2F A;  3WVW A;  4LQJ A;  4TOA A;  4U3G A;  4YVZ A;  3E1L A;  1RCC A;  3GE4 A;  5GN8 A;  1QGH A;  3BKN A;  4MUD A;  1BG7 A;  1BCF A;  1NFV A;  4PG0 A;  4Y08 A;  1TK6 A;  3AF9 X;  4ITW A;  1VEI A;  2AR0 A;  3PVR B;  3RE7 A;  5LG8 A;  2C41 A;  4QUW A;  3D19 A;  3EZ0 A;  4Z5S A;  4CVS A;  1RCD A;  1TJO A;  4PGI A;  2V2R A;  2Y3Q A;  5FFE A;  1TKP A;  1IES A;  4TW3 A;  5JDO A;  3NP2 X;  1JRE A;  1J30 A;  1N1Q A;  4LPJ A;  4II4 A;  5JKL G;  3UFB A;  2Z90 A;  4MJY A;  5LS9 A;  2WTL A;  4WJG 4;  3VVA A;  1S2Z A;  3AF7 X;  1R03 A;  3RGD A;  2YW6 A;  5J8W A;  1O9R A;  1YUZ A;  3QHC A;  3E6S A;  4M35 A;  4RC8 A;  4IWK A;  3UOI A;  4DYY A;  5E2D A;  4ZKW A;  4LQN A;  2CHI A;  1QYB A;  2RBD A;  2ZG9 X;  2BW1 A;  3H7G A;  3T9J A;  3RAV A;  4KXR B;  1O9I A;  4KVQ A;  4RC6 A;  3RBC A;  1LKP A;  2BK6 A;  3W54 A;  5AXS A;  1H96 A;  3ERZ A;  1VEL A;  3KA9 A;  1ZUJ A;  1MOJ A;  2GS4 A;  2C2U A;  1DAT A;  4P18 A;  3FSE A;  3KA6 A;  4DYZ A;  4ETR A;  5ERK A;  4DE6 A;  5D8P A;  2HTN A;  5HU6 D;  2MGY A;  3F35 A;  4TO9 A;  3U90 A;  3QHB A;  4IXK A;  4LYX A;  4MKU A;  3F39 A;  1RCG A;  3KX9 A;  3M6J A;  4XGS A;  3AF8 X;  3PW1 A;  3RD0 A;  1L8H A;  2OKC A;  4PGK A;  5HQO A;  2CEI A;  2V2L A;  3E1M A;  3SID A;  5GOU A;  5ERJ A;  4ZKX A;  4MN9 A;  3R2S A;  1JKU A;  2GYQ A;  2V2J A;  3KHK A;  4DYX A;  1RCE A;  1JGC A;  4LPM A;  1NF4 A;  4ZL6 A;  2CN6 A;  2ZA8 A;  5J9V A;  4AM2 A;  3WVU A;  2N02 A;  1UMN A;  4ISM A;  3ISE A;  4YKH A;  4DZ0 A;  3O7R A;  4CVT A;  2QF9 A;  2WWX B;  4KVR A;  2V8T A;  4ERU A;  5GU0 X;  3C1Y A;  2C6R A;  3BVF A;  5LG2 A;  2HR5 A;  2VXI A;  3F32 A;  4CVP A;  5IX6 A;  4EVC A;  5CMR A;  5K53 A;  2CLU A;  3SE1 A;  1FHA A;  1NF6 A;  4TOC A;  1LKM A;  2OH3 A;  4M34 A;  2XKQ A;  1SQ3 A;  3TA8 A;  4EVE A;  3F36 A;  2BKC A;  5GN8 B;  2FFX J;  1JTS A;  3Q4N A;  2G4H A;  3L0M A;  2X17 0;  2JD8 0;  1GWG A;  3KA4 A;  2YW7 A;  1ZS3 A;  3AK8 A;  2G38 B;  3PVY A;  2W0O A;  2V2P A;  1JYB A;  4DYU A;  1JIG A;  1LB3 A;  3C23 A;  4TOD A;  3C21 A;  2CF7 A;  3PVT A;  1SOF A;  3JZA B;  3AJQ A;  5D8O A;  5JDO B;  3KWO A;  2FZF A;  1LKO A;  5K52 A;  4CYA A;  4II4 B;  4TOF A;  1VJX A;  3BVK A;  2CLB A;  3PW8 C;  4LYU A;  1VLG A;  2FG4 A;  3F38 A;  4DI0 A;  4IWJ A;  2V15 A;  2V2O A;  2CHP A;  2FKZ A;  2BJY A;  4M32 A;  4W4L B;  4XKS A;  3HIU A;  4TOE A;  2JD7 0;  2YJK A;  4ZTT A;  3PWQ A;  1B71 A;  4W4K B;  3E1O A;  4RC5 A;  3PZA A;  5FFA A;  1UVH A;  4R42 A;  4DAS A;  3BVE A;  3EZU A;  4LQH A;  3IS7 A;  2XJO A;  3AJP A;  5FEJ A;  2QQY A;  3R2H A;  4RC6 B;  3UNO A;  4REU A;  1F33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...