3KF8A

Crystal structure of c. tropicalis stn1-ten1 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
207
structure length
207
Chain Sequence
LYPKTKIDWGPGENHICLKTPFKNFYVIELFHQAPTFDKTIPLFISDINNSPNLYGIYNYIADHLRHVVLVNNYPVNQINIFGKIVYEQYKEKEFNGVEESYVILVISDFIGIDSKIRVRLSQEQFKEVGLTLDKKNYGKIVELEGEIYNWYDSINVSKKPDRELKVSKITVLSHRPDGLHFEFEQWKKRMEFRKNNLVEPWVFIPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stn1-Ten1 is an Rpa2-Rpa3-like complex at telomeres.
pubmed doi rcsb
source organism Candida tropicalis mya-3404
molecule tags Structural protein
molecule keywords Protein stn1
total genus 52
structure length 207
sequence length 207
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1040 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3kf8A00
3KF8A
chains in the Genus database with same CATH superfamily
4K5WA 2R7ZB 4QCLA 1SYBA 4X64Q 4RAUC 1EQTA 1L2FA 4DAPA 3HOXG 1G8ZD 4H13C 1L0XB 3W3AA 1AFPA 2RKSA 3GO5A 3ERSX 3I4NB 1J5EL 4DXGA 5IODA 4LF8Q 3MEFA 4IJHA 4LF5L 4MZ9A 2WAQB 1STBA 2H4OA 4R4TA 1TR5A 5IGGA 1NAPA 5FO7B 5J39A 4DF7A 1YNND 3CPWA 4FXGC 4IQZA 1G6PA 1SSOA 1TWHB 2G9DA 4XTCS 2BE5D 3VA5A 5LMUL 1IYVA 5F2DA 1SNOA 1WFQA 1I94L 3GV3A 4NKLA 1QVGA 4JI7L 1F9RA 3E9IA 3F2UA 4G7HC 2EDGA 2YV5A 5EJWA 1XXGA 2Z9HA 4XQJA 3MXPA 3GP7A 1RKNA 4DR4Q 4DKAC 4KY7A 2D0PA 1F2MA 2K5DA 3OW7A 3SK5A 2B2UA 1VMCA 1KTKA 1SE8A 3P20A 2AQ1B 2UU9L 3K81C 3DM3A 3TEHB 3T16A 1MJEA 4KHZA 2KCTA 5AJ3L 1STAA 2WP8J 2F0QA 4HCEA 1G2SA 2NVXB 1SE3A 1K73C 1CFMA 1S5ED 1VQGA 5EQ0A 4LFCL 4B08A 2UU9Q 4IUPA 2EXDA 3M4YA 1U4MA 1ZEQX 2NVQH 1Y1WB 1EUJA 1HZBA 4O2DA 4HTHA 3KLSX 1MBYA 5AJ3Q 5EPKA 4K8IA 2BCOA 5T1GA 1ENAA 2QEXA 3CCSA 4I7ZC 2I5LX 2LXJA 3T4AC 3OWEB 3ULLA 1F2LA 1TWCH 1IYJB 2JA6B 3TP6A 1L1OC 1DOLA 4A3IB 2ZXPA 3I55A 1A3TA 4CKCA 4LK1C 1CHPD 3UE1A 1OXVA 2K5QA 3VA7A 3KF8B 4OELB 4DV1L 4C3JG 1XMQL 3K5NA 1I6VC 5M3MB 2QCPX 1YNNC 1VQ6A 3I4MH 3N52A 1B50A 1PZJD 1I3QH 3I4OA 3E3XA 2F0VA 4KMUC 4HEDA 1AN8A 3IFDA 1P8LA 4F88A 1HJPA 4U68A 4OXPA 3DWPA 4H02A 2ATWA 1N34L 3IAYA 4JYAL 3PIO3 4HCSA 5C4XG 2Z0SA 4J15A 3HG9A 5I6YA 2CH4W 2E2IB 4JBMA 4IO9A 2E5LQ 5K36G 3K7UC 5COYA 4OIKA 4BY7B 3BDLA 3U9SA 1GUSA 3EFXD 1GUGA 1G6ZA 3L2PA 3N6RA 2HQEA 2JN4A 4BY1B 4LFBQ 2MGSA 3K7AB 3TSSA 1XWEA 4QUFA 4BS9A 1G2TA 2PPBC 4KKSA 1XTCD 2RA4A 4RHRA 2L11A 4Q0FA 2R7ZH 1EZ8A 4KD3A 1WCMH 1PFNA 1V1PA 4BWGB 3UI2A 1LUZA 5FLXc 2CVRA 1CSQA 4WORA 1SYDA 3NBHA 1WCMB 3H09A 1IYUA 1UEAB 2B2VC 2JEBI 1HUNA 4F87A 2Q8TA 4FF1A 1I6HH 1VQEA 4RFBA 3HOYG 2F0EA 1HRJA 1KLUD 1VQFA 5IGCA 2X6LA 1B70B 1NNXA 2RBMA 2VS1A 4DFAA 1O7LA 3HOWG 3ULPA 5KRUA 4DR6L 3BDOA 1OXTA 1CSPA 1B3AA 3KFUA 4PMWA 1HNZQ 4K8JA 1B44D 1EWHA 4PNYA 4AYBB 4KV6A 1IBMQ 1O80A 4GS3A 4O42A 1TQOA 4O0AA 5C3EG 3PCOB 4DR5Q 2I5HA 2LFNA 4M1UB 4R4QA 3VYRA 4BBRG 2CKZB 2X6GA 4JI3Q 4FF3A 4KHPQ 4DNTB 1F9PA 3HKZB 2JA8H 1A2UA 3GTOB 2J7ZA 1HNZL 3I4MB 4LF6Q 3TP7A 5KNCA 1V1OA 3AFQA 3A8JE 3PV0A 2B39A 2UXCL 3M4PA 1WTWA 2EYFA 5T1IA 4UP9A 2Q2IA 4JW0A 1TS3A 2B2UC 1DZ1A 3R8BA 4L5SA 2SNMA 5IGBA 1TWAB 5LMNQ 1I4XA 1XTDA 1CHQD 4CKEA 4B3RQ 1SRUA 4PQXA 3KDFB 4K6DA 4I65A 1OO9B 2R7DA 3OOCA 4Q5VA 1SMXA 3ER0A 2XVSA 4YHHQ 1EYCA 2F0LA 2CCZA 1QNKA 2ZM6Q 2VQFQ 5FLMG 2NWGA 1BNZA 5HY6A 2HIVA 2N78A 3CQZH 5IWAQ 1QCBD 3V96A 4KK7A 2VXWA 3E0EA 3PUZA 4HMIA 3A7LA 1JR0D 3KUPA 4RKBA 3Q22A 1K8OA 1V1PB 2I46A 2X69A 5FJ8H 1BKBA 5FO9B 3K58A 3Q24A 2GVBA 1W3SA 2KHIA 1ILPA 2SOBA 1SFOB 1D5MC 1NTGA 3I8ZA 1BCPB 5BN3A 1I94Q 1DCZA 2EJMA 1SEBD 1TT2A 4C3HB 1EL0A 1D5XC 4RWSC 4YCUA 3T53B 2K04A 4DR3L 5E4XA 1NY4A 1Y8NB 2L1BA 4TQUS 1RF2D 4ABNA 2VUMB 1YHAA 2K5NA 1VF5C 2ZTDA 1F9QA 1AE3A 1H9SB 4GLAC 4DR3Q 1SXTA 4A93H 5J3BA 2NYZD 1XX8A 4R4OA 2J4XA 4JI3L 4XQNA 5CV5A 1TKWB 3WDNA 1A63A 3CCUA 3J80i 4DNRB 1Y1WH 2ZJQA 4MIUA 4R4CA 1EIFA 4KN4C 3P7JA 2P5ZX 4UDUC 4IOAA 1I3QB 1ENFA 1IHZA 1JT8A 1KNAA 5DNFA 2RSNA 3HP3A 3TN2A 3SGIA 4JI8L 3TS0A 5ELDA 1X32A 4PZ8A 3X3NA 2OEOA 2QF7A 2F0IA 1LYLA 1NE3A 3BDCA 4DV0Q 1J5EQ 1D7QA 1YVCA 4YCVA 5FK9C 3KJOA 3J81c 3IL8A 1ESFA 4PMBA 1Q90A 1XMQQ 2WKDA 2PI2A 1ZYRD 1NSNS 3I4LA 1CZWA 2WAQE 2PCFB 3FDTA 4N8X1 3H91A 5K36H 1PYBA 2RSOA 3AMUA 2RVLA 3K5LA 2OCEA 3H94A 4NW2A 1OXUA 3HGBA 2HDMA 4JI0L 4A3JH 4JI7Q 3AEVA 4FF4A 3K5OA 3UDIA 1C4QA 4K5VA 1L1OA 1M1KC 3NENA 2K75A 3G6JB 1HQRD 3FEWX 2VUMG 1ZKOA 5C5LA 5IIFA 4C2MH 5M3FG 4A3FH 3CHBD 5GQOA 1D1IA 3PUXA 3G4SA 3RZDH 4A3DG 4BBRH 3CCQA 5CC4A 4RA8A 3FHWA 4ZAIA 1S4ZA 2B3GA 3CCVA 2Z6BA 2K1BA 2IHFA 1XYIA 4X3UA 4XT1B 1UE6A 5H1SE 3A5UA 1KAAA 4A3MH 2B63B 1ICFB 4LMQD 4P2CB 3S2HB 1IZ6A 4XIGS 4AQYL 4EGVA 2EY6A 2CWAA 2QILA 2E74C 4DV6L 1GHJA 3GTMB 1FL0A 1PH6A 4ZRZA 3TBIB 3MXNB 4B3MQ 2YU9H 3CRLC 3NQTA 1O78A 1NCVA 1X3PA 2ZXRA 2E75C 3W1BA 3C46A 1QVCA 1EYGA 3GTMH 2IX1A 4C3HH 3J80E 3PUVA 2SDFA 1TWAH 4X3TA 1N32L 5JEAG 3RR5A 1UAPA 2KECA 4B3ML 4TVAB 2VQEL 1Q3LA 3EN2A 5IT9E 2EVBA 1VQDA 4P72A 4FNFA 4QJFA 5EKLA 4ZQ3A 2F0SA 2JXMB 1I4GA 2K4KA 3OTOL 1AW7A 2B8GA 1CA6A 5ELFA 2JYOA 4BY7G 4JYAQ 2A6HD 5CV8A 3HOWB 1VQMA 5LL6X 3S15H 1E1OA 4QF4A 4UAIA 4X6AH 5I9PA 3A8KE 4GZYC 2EQSA 3QOJA 3HEJA 1FJGQ 1SN8A 2K50A 3UDFA 2BDOA 3F1ZA 3OPOA 4X3SA 4DU9A 4DV7L 1IXRA 1D5ZC 2AUKA 2WACA 1SJHD 4HJAA 4QB4A 1HTLD 1HQMC 1Y1VG 1W2BA 3T56B 4DAMA 2AWNA 3DM1A 4H0LC 2RCFA 3AQQA 3ERQA 1QZGA 4P71A 1FR3A 3A8IE 3NELA 3V05A 2B2YC 3SE0A 2O5JC 2D2CC 3KF6A 3F2CA 3PSIA 1PFSA 4EVOA 1JOOA 4JI4Q 1TU2B 1RL2A 4FXKC 5IYBH 3HOVG 3T1HL 3LGJA 4A4IA 4C3IB 2CFMA 3QJYA 4A3LH 1A15A 1EOVA 1Q8KA 2K03A 3S14B 3KF6B 1N36Q 2L0CA 2XIWA 3GD7A 4KKTA 3H3VI 4HJ7A 2RDFA 2V4DA 3S1MB 4N9PA 3PUWA 4ZKCB 2F4IA 2HIXA 2A19A 3J81j 3PIP3 1R4PB 4A3MG 1TS4A 2BA1A 1YNJD 2K05A 1GD7A 1SMYD 1GKHA 1WJJA 2PNRC 4A3GH 1JC7A 4X62Q 5JAVA 1DONA 1E2WA 3NBHB 5IGFA 2Z1CA 4CDFC 4LF6L 1AE2A 5EPJA 1X3GA 1Q82C 4OIJA 1SDFA 4JK1C 2UUAQ 4A3CG 5JOBA 4DV4Q 5FO8B 5IGDA 4RCOA 2YTXA 2GA4B 4C1NI 1GHKA 1UE5A 4CGYB 2R6GA 3GTKB 1KL9A 3A54A 5BN4A 2R92G 1E2VA 1ONLA 5JJIA 3WOFA 4A3BG 2UUCL 1K0RA 1BUVT 1M90C 5ELCA 3L7ZC 4GN4B 1YEZA 4J6HA 4LWCA 1FJGL 5KNBA 1IBLL 3S1QH 1EFWA 5FLXL 2K01A 2KHSA 3MVVA 4HIOA 2ASBA 3JC66 5E3FA 4BY7H 1VS0A 4YIJA 4J8QA 3HOZH 2Q2UA 4LF8L 3CPFA 3RN2A 3TP8A 1JWSD 4KD4A 4WFN3 1YJWA 4B3SL 3QWNA 3GTLH 1EWCA 2AQ2B 1QUQA 4IZ8A 1IBLQ 1N8RC 1F77A 4NDXA 4DA2A 3EIVA 4DR1Q 1CKMA 1LTBD 1LTSD 5NUCA 4DV3Q 2O4XA 5IYBG 5C0XG 1KAWA 1W6KA 2WV6D 2HT1A 3F2BA 2R7ZG 4A3BH 3J7YW 1ET6A 2Q2TA 1WCMG 4YY3Q 1GJXA 4LUVA 2N8NA 4R1JA 2PQAA 4A3DH 3CC2A 1SBBB 3MXGA 1TY0A 3KYHC 3A0JA 3DWQA 2OXPA 4L5RC 2JA6H 3CCMA 2K32A 4TSSA 5JVG3 5C3EB 4JOIC 2Z4IA 3RLNA 1TWFB 1MKHA 4PZ6A 5IYCG 4NXML 1TS5A 1L1OB 2E2HH 4P74A 1CM9A 2B2WA 1CI3M 2Q2HA 3S1RH 4RKLA 3C1FA 1A0IA 2AKWB 2EY2A 1VQIA 1RDPD 1P16A 1PTOC 2EZVA 3OWFA 3A74A 3OSOA 3SHLA 1JJGA 1SYEA 1JE4A 3X3MA 3Q0AA 5J1ZA 4GNXB 2OTLA 5ELEA 1EQVA 5I2YA 4BBSB 3PMFA 2F0GA 5D3IB 1C0AA 3SK4A 2L4NA 2IX3A 1EEFD 2N49A 2PZTA 2KCNA 4QY7A 3C2PA 3NSWA 4RCNA 1B8AA 4V0BA 1CA5A 4XQQA 2PQAB 5I9OA 5C44G 3U58A 1VCIA 4APVA 2ZTEA 3NHHA 1U4PA 5CV4A 2QEJC 2QA4A 3WOEA 2NVYH 2KVMA 4JI5L 4XT3B 2JA7B 3MXNA 2KQ3A 2NZOA 1DJRD 1EYDA 3J80c 1STNA 3H0GH 1VQ8A 1FVIA 1NR4A 1QB5D 2YU9B 1D2BA 5C5MA 4CHTB 1ZXTA 2B2VA 3M85A 3RNUA 3IKJA 3CC4A 3K5MA 1HH2P 1S3OA 5C4JH 3TMEA 3ITPA 5GADC 3F8TA 3GTJH 1UEBA 3JAME 1EIGA 1Y8PB 1TS2A 2IHEA 5FJ8G 4LF7Q 3MXUA 1TWGH 3EVQA 4NXNQ 3ULJA 4GNXA 2QKIC 1B7YB 3E5SA 3K57A 3BS1A 1TIID 4QMGA 4WJWA 5IY0A 2RHQB 3HOUH 1Y1VB 5ELBA 1C48A 2Y0SB 1KRTA 2B8FA 1VMPA 1VQJA 3I90A 1N9WA 2G5DA 2VW9A 2KJXA 3T1HQ 4A3IH 2IJ0A 4ALPA 1AH9A 1TWCB 1HZAA 4K2KA 1S5CD 3BZCA 5IYCH 1KC8C 3U50C 2HD3A 1BBWA 4C3IG 1I4RA 4DV1Q 5ELOA 2K6AA 5M5YH 4MN3A 4HIKA 3S17H 3NEMA 1J6QA 5C6AA 3D3RA 3H15A 5C0XI 1XPOA 1U4RA 1XJVA 2UUBQ 4LJZC 4WRDA 1GUWA 2DJFC 4K2LA 4HMJA 5JJLA 3O13A 5CV9A 3H3VC 4RH6A 5IP7G 3S17B 3T51B 1U9RA 4ZUIA 3VR3A 1CKNA 4R8NA 4UP8A 1SMYC 4CDCC 2A6ED 2UXCQ 3TZDA 2D0OA 2L12A 4IFDH 1U4LA 3S24A 4LW1A 2WAQG 4OHJA 3SR1A 1VQPA 2PW5A 3CMEA 4DV2Q 3EJIA 4ILWA 4OO1G 5C4HA 4G57A 3AYHB 5M3FB 5JPMC 1KDBA 4KHVA 1JJ2A 4LF5Q 2I07B 1PH1A 1PTOB 4A93B 2UXDL 2PW7A 1HA5A 3H0GG 1UE1A 3GTGB 1UE7A 4DV2L 3CXCA 1QNUA 2Y0SE 3K0XA 3I4MG 1IKLA 3E0JA 2MP1A 3STBD 4DAYB 1AP0A 1I5FA 4YCWA 1NJIC 2B2WC 1B53A 2JA5H 2PMZB 2EYMA 2ZTCA 3JAMi 2A69D 1N36L 3S16H 2M9VA 1PMRA 4OONA 1C8CA 4NP5A 3CCRA 4OX9Q 2ENBA 4S3SA 1WTQA 4DAYA 2LS01 3VR6A 1T5XD 5C44H 4EQPA 4LF9L 4AIMA 3R2TA 4POFA 1HCZA 1LT4D 1TVXA 1X3QA 5IOCA 2H1EA 3W2DA 3KLWA 4TRDA 2E2DC 4ULLA 2EXZA 2HDLA 1CZGA 1S40A 2N55A 3BYYB 1DYQA 3CRKC 3KJPA 2AWOA 2WB1E 1PRTF 2NZ1D 1JOQA 4A3IG 1SYCA 1V8QA 2E76C 1FGBD 1VQNA 4LF9Q 3QOLA 3RZDB 1AZPA 2K14A 4F7XA 1YHQA 4JOIA 5KEEA 1FGUA 5FOBB 2F0PA 3DUZA 4YWMA 4GKJQ 4I7AA 3UDXA 1DOMA 3MHBA 2F3WA 5E1FA 2RCNA 1JCKB 3GTGH 1SJED 4NB3A 5I4DA 2D62A 2ICIA 4A93G 2MJ8A 2DNCA 4A3JB 2XNAC 2EYLA 1HFNA 1GUTA 2RQXA 4DR7Q 1KNEA 3UE0A 3NTIA 1CKNB 2N3SA 4GKJL 4F8MA 1YJNA 2JA8B 1S5FD 3GTQH 2LSSA 3STBC 2V1CC 2B2TA 4JI1Q 4IN3A 4Z9CB 1YITA 1JJCB 3PO2H 5JVH3 1PTOF 4BXXG 2R93B 3U4ZA 2JA8G 4DR1L 1Q8IA 4MNOA 4DV3L 2Z4HA 2E5LL 3QO2A 5GAGC 1KXLA 5LHY1 4RGOS 5DM73 1F9SA 3M7GA 1LACA 1Y1VH 1HZ9A 2JA5G 2DNEA 1JB7A 2A5HA 1KQSA 3T13A 2O2LD 2EYHA 3CCLA 4JPBW 4L5TA 5D14A 1ZYRC 1PH2A 1LT5D 1FNWA 4XXEA 1K8MA 4U673 3DEOA 1I4PA 4JI2L 1TWGB 4OO1I 2K52A 4N8FA 2MQHA 2PQEA 1BCPD 4DR2L 1GUNA 3HOVH 2JA5B 4GOPC 1Q1EA 4LFCQ 3M4OH 4JV5Q 2MUYA 3GTJB 4FXDA 4FO2A 4EQOA 1YBYA 4PMCA 4FYDA 4K0KQ 1ML0D 2NTTA 3PUYA 4C3HG 2KCCA 2J0TD 4CJ0B 3HOUG 1EY0A 1Y8OB 3U4VA 3MTSA 3ONAB 1PA6A 3EQLC 2WB1G 5TSSA 4GOPA 4ZUJA 2CHBD 2OT2A 3FMCA 1RHPA 5ISRA 2A73B 2AHOB 4JC0A 1PTOH 1CTMA 4QUCA 3FKIH 3GV6A 3TDQA 1X54A 2CQOA 4A3EB 1H9RA 3I7FA 1JB3A 1YIJA 3CC7A 2CQAA 2HCCA 3S2DH 2E2IH 3CAMA 4Y7NB 4IUQA 1EY7A 2F0KA 1VQ4A 2M2LA 1EIYB 1F2YA 2FHTA 1JQYD 4IPGA 3VYUA 4X64L 1Y69U 4Y7NH 1L0WA 1HUMA 1VDZA 3D6WA 3CQZB 3HS0C 4UY8C 4A3KB 3RZOB 1LTID 3NPPA 2C9OA 4JI5Q 4A3EH 4XDXA 2AMCB 3HRZC 2UUBL 4MHEA 1QVFA 4JI1L 1O7ZA 2E2JB 2BOSA 3FKIB 1EY6A 5A2QL 4JI0Q 2ID0A 3SK8A 1DOKA 4L5QA 4G7ZC 5IYDH 4K14A 2R93H 4LFBL 3S1MH 2FINB 1MI2A 1Y1WG 3M9BA 2L55A 3E6ZX 4KN7C 4POGA 3AFPA 1TXYA 1J9OA 2R3ZA 4DK6C 2VZAA 2K7VA 1JORA 1JE5A 1XMOL 4DK0A 3GDEA 1Q46A 1N34Q 3ND9A 1S5BD 2NN6G 2A6HC 5EKIA 2HHHQ 3HOUB 4KJOA 5IGEA 1RODA 3D0FA 4Y52H 3KK7A 3OIPA 2EYPA 1WTVA 3HKSA 2R92B 1QILA 1G51A 2NVTB 5C3WA 4A3KH 5A2QE 2IPKD 1K28A 3RZOH 2VNUD 3P1HA 4ID6A 3CU7A 1K8AC 2EY1A 3M3YH 3FVQA 4PZ7A 2HHHL 4JBJA 4X65L 1KHIA 3D4WA 5J22A 2MPMA 1HR0Q 1KDAA 3VR4A 2JQOA 1PH8A 2C5CA 1PYWD 2JE6I 1H9SA 3I91A 3MA2B 4HJ9A 1A2TA 5M5WH 1E7ZA 3S15B 1SNDA 4IALA 1LABA 5GROA 1RTNA 4DR5L 2OTJA 2E2HB 1BR9A 4X65Q 5CBEE 1QUQB 1UUPA 2A69C 3K59A 4V190 3HOZB 1I6HB 5C44B 1SNQA 3S1NB 1NMFA 3TZUA 4H7BA 3PGZA 3D4RA 2IWHA 4KKUA 5L37A 1CK1A 1H9JA 3OTOQ 1OTCA 4C56C 2FXQA 2F4VQ 2NZHA 1MSHA 4ZLTF 4H44C 4RGNA 4KJNA 1SLJA 3K7AH 1U5KA 1YNJC 5G3LD 2ZJRA 4ZKBB 3HFZB 3B6YA 5ELNA 4JI8Q 1PRTB 1N33Q 3DXJC 1OXXK 5KYIA 3HKZE 3I4NG 3M3YB 3SDZA 2I0QA 2WKCA 1NR2A 3D31A 3S2DB 2JEAI 1VF7A 2F0HA 2ZXOA 5M5XB 1Q86C 1EY5A 2PYKA 1NMGA 1LTAD 3EBEA 3ZJYC 5I2XA 1A3UA 1LTTD 4CDDC 4KY6A 2JK8A 2NB0A 3LNNA 5EPLA 1GXDC 4EX5A 4DUZQ 1K0SA 1R9TB 2GVAA 2Q8RE 5M3MH 4IPHA 4AH6A 3SK6A 3E9HA 4LF4L 2UXBQ 1J8IA 5FKAC 4LFAQ 2BH8A 1BO0A 3UDGA 4B3TQ 1PXUA 2KUMA 4YHHL 4JBWA 3JAML 4NPSA 3R3OA 5EAYA 3MC0B 3CMAA 1PH7A 1A62A 1WYDA 2PZWA 5LMNW 3HOZG 1E24A 3OW2A 3D8GA 3J81i 2JP1A 3NBIA 4UHVA 4A3BB 2FFKB 1IBKL 2HCIA 3I56A 2B2YA 5DAUA 4B3TL 4HAEA 2B63G 4ZCKA 1EYAA 4GN3B 1C9OA 3T1YQ 1PFMA 4YWLA 3Q23A 4X62L 5KIXA 3GTPB 5C0XH 4EQNA 4JG2A 4DR2Q 3U9OA 1Z7TA 2QDLA 1ET9A 4WJ3M 4L63B 4TKOB 3NQIA 4JV5L 1A6XA 3HZXA 3QG1A 1R4QB 3PO2B 3GTPH 1V9PA 1IL2A 2HQLA 5GAEC 4KHPL 3C3LA 2C35B 1X3EA 4HR7B 2XGTA 2F3IA 1EY4A 1CQFA 1PYSB 1BQQT 1CT1D 1EOTA 3RD4A 4ME5A 4KLKA 4CKBA 4A3JG 4QIWE 3HKZG 4DV5L 2KEEA 1LTLA 4JI6L 2SEBD 2RDHA 4GKKL 2TMPA 1PTOD 2F0FA 3CCEA 4A3EG 3K80C 5IT9c 3G6EA 4CJ1B 5CYUA 4IFDI 1EU3A 2VY3A 2BE5C 3RMHA 2VL6A 3EA6A 3H3VH 4DGZA 5EKKA 1UNSA 4FDBA 1Z9FA 4JI6Q 1SAPA 5GAHC 2MFIA 5HURA 1GVPA 2KHJA 3TS2A 1SROA 3ZYYX 2BA0A 1QE6A 4QGUA 3LX0A 1Q7YC 2YTYA 2KOLA 3MAQA 4GOPB 4BA2I 3IFTA 3CD6A 1Q81C 1S5DD 4OWXB 2F0DA 4LAAA 3BU2A 2DUDA 1K8GA 3JAMc 3G71A 4LUZA 1PFBA 4P75A 1WTHA 1B9MA 3M4OB 4KI0A 1V1QA 3I73A 4KTAA 4RGTA 2L5TA 1HR0W 3F2DA 1WTPA 1IBKQ 1PH5A 3S16B 2MO0A 1VQBA 3PO2G 3VR5A 4B9WA 1HNXQ 3BYTB 4BXXH 4RHSA 1E2ZA 2LMCB 3ND8A 4CJ2C 3T1YL 4JI4L 3J81E 4AYBE 1IW7D 1HA6A 4RG1A 4R4IA 1SR3A 2CW0C 3TREA 3CF5A 2A8VA 1RCVD 5CR3A 1CQVA 3K0YA 2EJFC 3W5OA 1VQKA 3IRBA 5D3DA 3K6OA 1WD0A 1TY2A 2G9HD 4JBKA 1HXYD 1KD1C 1LT3D 5DM63 1E1TA 4FP5D 2XWJB 4XYOA 2IX0A 4ME3A 5C3EH 5EBCA 3GTQB 1HFGA 3OMGA 3LWUA 5M5XH 1SE2A 4DV5Q 3TRZA 3NUCA 1X55A 1JICA 2PMZE 1DXMA 4OO1H 3W1GA 5IT9L 2DGYA 2IW3A 4IUNA 1JOKA 4L8JA 3J80L 3K8AA 2M00A 1AZQA 2AUJD 2XTIA 3CW2C 3MFYA 1SNCA 4B9XA 1CUKA 4A76A 3RN5A 4DV4L 2Y0SG 3V2TA 3HOXH 2R7FA 2RDGA 4JVZA 1BCPF 2Z6KC 1MJCA 2FJ2A 5HGTA 1ASZA 1K83H 3MZ5A 4MTNA 4OGQC 3SVMA 4GNXC 1H9KA 2A68C 3GTLB 1KLGD 1XNQL 1TWFH 1Z6HA 3TP5A 3DEPA 2CH4A 1EQRA 5DEHA 2ALYB 3DWAA 5AFWA 1N33L 1BCPC 4J1MA 3CP0A 5FLMH 1NUCA 1L0YB 1G91A 2VUMH 2A6EC 3BZDB 4IPCA 4LF7L 2IT1A 1IW7C 4IOCA 1OXSC 2D5DA 5CV7A 5M3FH 3HOYH 4B3RL 2KEDA 1BOSA 3I72A 2B29A 5M5WB 4DAVA 1H95A 5K5PA 2OF1A 1PDQA 3FP9A 3PIOA 1MD2D 1DD2A 2F3VA 2WFWA 4DV7Q 4HJ5A 1FNVA 2KBNA 1WD1A 1F2ZA 1HR0L 1JMCA 1SFOH 4ZK9B 5CMDA 1A8VA 3J7AF 1K9MC 5BN5A 2A74C 2CWPA 4RGMA 5IWAL 5BR8Q 2K5VA 2K5HA 3P75A 3CCJA 4BBSH 1PH9A 4WJ4A 5E4WC 1XPRA 5M9OA 4CBVA 2LXKA 5C4JB 1EZ6A 4DUYL 3GQBA 3S1NH 1VQ7A 5JJKA 2R92H 4IUUA 1G291 1QOHA 3I2ZA 3SXHA 3S1RB 1O7IA 1H9MA 1MHWC 1STYA 1IBML 4R8IA 2AQ3B 1SNPA 3MWYW 2FMCA 1PHJA 5JEAJ 1STGA 1X65A 1K3BC 4DUYQ 1QWYA 1FYCA 1STEA 3NWSA 1X56A 1WTOA 4K5XA 4DNIA 1VQCA 2VQEQ 2NVYB 2A68D 4HIDA 4L6TB 1LTGD 2KENA 4X3KA 4JCVE 1VQ9A 2ES2A 5FLXE 1HHVA 2E2JH 5CGKA 4C3JH 1ILQA 1BBUA 5CV6A 2MNAA 5I6WA 2WIIB 1LTRD 1WOCA 3OIQA 4GLXA 5IE8A 5LMNL 4IUTA 4C3JB 2O5IC 2EE1A 5M3MG 3OYYA 3L0OA 1Y14B 3PF5A 1E0BA 2K5WA 1KIXA 1I4QA 4GN5A 1HNWL 3NTKA 1EEID 2BH2A 2ZM6L 3BVGA 1BF4A 1R9TH 4DUZL 1XNRQ 3S1QB 3C1EA 2EOTA 4LF4Q 2UXBL 2Z8LA 1HNWQ 1PRTD 1RD9D 1KRSA 1PZKD 3PO3G 2NBFA 3H0GB 4YWKA 4A3KG 1HTPA 2NN6I 4BBSG 2HUGA 4IURA 3FKIG 2LKVA 2JA7H 2EIFA 4NXMQ 2LY7A 2IY5B 2QW7A 3BG3A 3WWVA 2PI2E 2A1AA 4P73A 2DN8A 4JI2Q 3HOVB 2QDBA 5G3LF 1YZ6A 3D4DA 1RJTA 1V43A 1ESRA 2VB2X 4IPDA 4PG3A 1XPUA 2F0TA 1ENCA 4X66Q 1E3PA 4K0KL 2YTVA 1B1ZA 2OWOA 3A5ZB 1E22A 3BVZA 3FPUB 1HNXL 3R2IA 3HOYB 1BVSA 1HPCA 3HOWH 2K33A 2XSCA 2F0NA 1FD7D 2SNSA 3PF4A 4OWWB 1YJ9A 3S2HH 1PLFA 1M4VA 1MIUA 3BVMA 1EY8A 1YHBA 4A3MB 4G7OC 1B9NA 3R93A 2OQ0A 2R61A 5HGQA 4OEMB 1UWVA 2L9HA 3DHQA 4NMZA 3DLLA 4A3CH 3H6MA 4HN7A 2OQKA 4LUOA 5KYLA 2PO4A 4DV6Q 4C3IH 2CW0D 1S72A 4GKKQ 2XWBB 3NWTA 4N9TA 2D9UA 2EPBA 5CBAE 3GTKH 1I50H 2F0UA 3A55A 4MTKA 1Z47A 1STHA 4DV0L 2UUCQ 4O1NA 4BY1H 2ICEC 3VYTA 1EQQA 1PRTC 1BDOA 2XN9C 3FRPB 4A3DB 1GO3E 5EBDA 3NE5B 2EJGC 1T5EA 1SYGA 3M4QA 2DJGC 1XNRL 3J7ZC 2NVTH 2B2TC 4IFDG 3QB3A 4ZYSA 2MO1A 1II3A 3I70A 4DK3C 1EWIA 2PZUA 3TQYA 3NTHA 2DY8A 2L15A 3Q8DA 1XNQQ 3VR2A 2F0JA 4C2MB 2UXDQ 5IP9H 4YY3L 1D8LA 4PV1C 1M8AA 1IKMA 1QG7A 4A3GG 2JA6G 4QIWB 4HIMA 4EQ5A 3PIPA 1Q1BA 1WI5A 1D6EC 1NBWA 3RUZA 2DY7A 3CKIB 3ICEA 4GLVB 4G4KA 2N88A 3Q6SA 4HSPA 5JJZA 4X66L 4BA1I 1I4HA 2JA7G 2XRQD 2WINB 1WTXA 3J7AV 4AQYQ 3S9WA 5M5YB 2NVQB 1K3RA 5LL6S 1VQ5A 1RTOA 2EY5A 2KCMA 3AU7A 3DMUA 2NUCA 3KOJA 5JEAH 1TWHH 3AB9A 4HSVA 5E7NA 1X6OA 4NXNL 1JWUD 4RMFA 2NVXH 3G7LA 3NXWA 4A3FG 3KLRA 1B4OA 1VQAA 4R9WA 1SE4A 2TSSA 1EIHA 5KNDA 3I4NH 1N32Q 1JWMD 1SNMA 3A7AB 3J7A5 1FNUA 5D65A 1ICWA 4OL7A 1WTRA 1EU4A 4UPAA 3MEHA 3L9AX 2ZJPA 1B3QA 4BY1G 3OMCA 1MGSA 2JSOA 3J81L 1KDCA 3I3CA 3L3OC 1Q12A 3VYSA 1DM0B 1PH4A 4FVMA 3VDYA 4FF2A 3S14H 2IL8A 1C7YA 2F0OA 3EROA 1EFID 1ASYA 4QQBX 3QIAA 1LV9A 2F03A 3FPPA 3G48A 3D6CA 3A56A 1XMOQ 1LO5D 3QR8A 4IUVA 2RHSB 1B2TA 5IYDG 3LWEA 3KBGA 4A3GB 1SYFA 4UP7A 2R93G 3NP8A 1PZID 1YI2A 1K83B 1PVOA 5KGUA 5C4ZA 1HZCA 2EYJA 4DN4M 5IP9G 4A3LG 3HOXB 3KDFA 2RF4A 5C0XJ 1EY9A 5JPNC 1BBXC 1AEXA 3PQIA 3KF8A 1YNXA 3URYA 2B63H 2QGQA 3M7NA 4QL5A 3PO3H 1GM5A 2E8GA 2NN6H 2VQFL 4A75A 3SEBA 1QJOA 1RIPA 5LMUQ 1VQLA 4XYQA 3BZKA 5BR8L 4B3SQ 4BBRB 1MSGA 1PH3A 3NK9A 2Q8IB 4KY5A 2VB3X 5EGTA 4LFAL 5C3XA 3GTOH 1DGSA 4DPGA 2JA9A 5A35A 4A3FB 1QZHA 1A3VA 1KABA 3RLFA 4AYBG 5C4XH 1WVLA 4DR6Q 2F52A 5CORA 4DK1A 4HJ8A 4DR4L 4M8AA 1U0LA 1VQOA 2JJQA 4C1NK 2WB1B 3BJUA 5DLQE 2FMMA 1T9HA 1LT6D 1LM0A 3KLSA 1D1KA 3PO3B 2F0MA 2KA7A 2MHVA 1X9NA 4OWTB 1IL8A 2ZT9C 3MFGA 2NTSA 1W6JA 4CDEC 1X3FA 2YYZA 1CKOA 2F4VL 4K6LA 4LNQA 3RLOA 4OX9L 2PNHA 2Z6KA 2K28A 2H5XA 1GUOA 4E6IA 5C4XB 2I5MX 1I50B 4IFDJ 4IJLA 5IP7H 1O7YA 2UUAL 3OHXC 2GN5A 4DR7L 2XRSD 2EYOA 2BDNA 1PV4A 1VQHA 1BXTA 4DXFA 4ODGA 1LLRD 1GOZA 2F0WA 2F1MA 3KBXA
chains in the Genus database with same CATH topology
4K5WA 2R7ZB 4QCLA 1SYBA 4RAUC 1EQTA 4DAPA 1G8ZD 4H13C 1L0XB 3W3AA 1AFPA 2RKSA 3GO5A 3I4NB 4DXGA 5IODA 2WAQB 1STBA 2H4OA 1TR5A 5IGGA 1NAPA 5FO7B 5J39A 4DF7A 1YNND 4FXGC 4IQZA 1SSOA 1TWHB 2G9DA 4XTCS 2BE5D 3VA5A 1IYVA 5F2DA 1SNOA 3GV3A 4NKLA 1F9RA 3F2UA 4G7HC 2EDGA 5EJWA 1XXGA 4XQJA 3MXPA 3GP7A 1RKNA 4KY7A 1F2MA 2K5DA 3OW7A 3SK5A 2B2UA 1VMCA 1KTKA 3P20A 2AQ1B 3T16A 4KHZA 1STAA 2WP8J 2F0QA 4HCEA 1G2SA 2NVXB 1SE3A 1CFMA 1S5ED 5EQ0A 4B08A 4IUPA 3M4YA 1U4MA 1ZEQX 1Y1WB 3KLSX 4HTHA 1MBYA 5EPKA 4K8IA 2BCOA 5T1GA 1ENAA 4I7ZC 3T4AC 3OWEB 1F2LA 2JA6B 3TP6A 1DOLA 4A3IB 2ZXPA 1A3TA 4CKCA 4LK1C 1CHPD 1OXVA 2K5QA 3VA7A 4C3JG 3K5NA 5M3MB 1I6VC 2QCPX 1YNNC 3N52A 1B50A 1PZJD 2F0VA 4KMUC 4HEDA 1AN8A 3IFDA 4F88A 4U68A 3DWPA 3IAYA 3PIO3 4HCSA 3HG9A 5I6YA 2E2IB 5K36G 5COYA 4BY7B 4OIKA 3BDLA 3U9SA 1GUSA 3EFXD 1GUGA 1G6ZA 3N6RA 2HQEA 4BY1B 2MGSA 3K7AB 3TSSA 1XWEA 4QUFA 4BS9A 1G2TA 2PPBC 4KKSA 1XTCD 2RA4A 4RHRA 2L11A 4Q0FA 1EZ8A 4KD3A 1PFNA 1V1PA 4BWGB 3UI2A 2CVRA 4WORA 1SYDA 3NBHA 1WCMB 3H09A 1IYUA 1UEAB 2B2VC 2JEBI 1HUNA 4F87A 2Q8TA 4FF1A 4RFBA 1HRJA 2F0EA 1KLUD 5IGCA 2X6LA 4DFAA 2RBMA 1O7LA 5KRUA 3BDOA 1OXTA 1B3AA 4PMWA 4K8JA 1B44D 1EWHA 4PNYA 4AYBB 4KV6A 1O80A 1TQOA 4O42A 2LFNA 4M1UB 3VYRA 2X6GA 4FF3A 4DNTB 1F9PA 3HKZB 1A2UA 3GTOB 2J7ZA 3I4MB 3TP7A 5KNCA 1V1OA 3A8JE 3PV0A 2B39A 1WTWA 2EYFA 5T1IA 1TS3A 2B2UC 1DZ1A 3R8BA 2SNMA 5IGBA 1TWAB 1I4XA 1CHQD 4CKEA 4PQXA 4K6DA 4I65A 1OO9B 3OOCA 4Q5VA 2XVSA 1EYCA 2F0LA 1QNKA 2NWGA 1BNZA 1QCBD 3V96A 4KK7A 2VXWA 3PUZA 4HMIA 3A7LA 1JR0D 3KUPA 4RKBA 3Q22A 1K8OA 1V1PB 2I46A 2X69A 5FO9B 3K58A 3Q24A 1ILPA 2SOBA 1SFOB 1D5MC 3I8ZA 1BCPB 5BN3A 1DCZA 2EJMA 1SEBD 1TT2A 4C3HB 1EL0A 1D5XC 4RWSC 3T53B 2K04A 5E4XA 1Y8NB 2L1BA 4TQUS 1RF2D 4ABNA 2VUMB 1VF5C 1F9QA 1H9SB 1SXTA 2NYZD 1XX8A 2J4XA 4XQNA 5CV5A 1TKWB 3WDNA 4DNRB 4MIUA 4KN4C 3P7JA 4UDUC 1I3QB 1ENFA 1IHZA 1KNAA 5DNFA 2RSNA 3HP3A 3TN2A 5ELDA 1X32A 3X3NA 2OEOA 2QF7A 2F0IA 3BDCA 5FK9C 3IL8A 1ESFA 4PMBA 1Q90A 2WKDA 1ZYRD 1NSNS 3I4LA 1CZWA 2PCFB 3FDTA 3H91A 5K36H 2RSOA 3AMUA 2RVLA 3K5LA 3H94A 4NW2A 1OXUA 3HGBA 2HDMA 4FF4A 3K5OA 1C4QA 4K5VA 3G6JB 1HQRD 3FEWX 1ZKOA 5C5LA 5IIFA 3CHBD 1D1IA 3PUXA 5CC4A 4RA8A 4ZAIA 1S4ZA 2K1BA 1XYIA 4X3UA 4XT1B 1KAAA 2B63B 4LMQD 4P2CB 3S2HB 4XIGS 4EGVA 2EY6A 2QILA 2E74C 1GHJA 3GTMB 4ZRZA 3TBIB 3NQTA 1O78A 3CRLC 1NCVA 1X3PA 2ZXRA 2E75C 3C46A 2IX1A 3J80E 3PUVA 2SDFA 4X3TA 5JEAG 1UAPA 2KECA 1Q3LA 5IT9E 2EVBA 4FNFA 5EKLA 4ZQ3A 2F0SA 2JXMB 1I4GA 1AW7A 2B8GA 1CA6A 5ELFA 2JYOA 2A6HD 5CV8A 3HOWB 5LL6X 4QF4A 4UAIA 5I9PA 3A8KE 4GZYC 3QOJA 3HEJA 2BDOA 3OPOA 4X3SA 4DU9A 1D5ZC 2AUKA 2WACA 1SJHD 4QB4A 1HTLD 1HQMC 3T56B 2AWNA 3DM1A 4H0LC 3ERQA 1FR3A 3A8IE 3V05A 2B2YC 3SE0A 2O5JC 2D2CC 4EVOA 1JOOA 1TU2B 4FXKC 4C3IB 3QJYA 1A15A 2K03A 3S14B 2L0CA 2XIWA 3GD7A 4KKTA 2RDFA 2V4DA 3S1MB 4N9PA 3PUWA 4ZKCB 2F4IA 3PIP3 1R4PB 1TS4A 2BA1A 1YNJD 2K05A 1SMYD 2PNRC 1JC7A 5JAVA 1DONA 1E2WA 5IGFA 2Z1CA 5EPJA 4OIJA 1SDFA 4JK1C 5JOBA 5FO8B 5IGDA 4RCOA 4C1NI 2GA4B 1GHKA 4CGYB 2R6GA 3GTKB 3A54A 5BN4A 1E2VA 1ONLA 3WOFA 1BUVT 5ELCA 3L7ZC 4J6HA 5KNBA 5FLXL 2K01A 2KHSA 3MVVA 5E3FA 4YIJA 4J8QA 3TP8A 1JWSD 4KD4A 4WFN3 3QWNA 1EWCA 2AQ2B 4IZ8A 1F77A 4NDXA 4DA2A 1LTBD 1LTSD 5NUCA 2O4XA 5C0XG 1W6KA 2WV6D 3J7YW 1ET6A 1GJXA 1SBBB 3MXGA 1TY0A 3DWQA 2OXPA 2K32A 4TSSA 5JVG3 5C3EB 2Z4IA 1TWFB 1TS5A 1CM9A 2B2WA 1CI3M 4RKLA 3C1FA 2EY2A 1RDPD 1PTOC 2EZVA 3OWFA 3OSOA 3SHLA 1SYEA 1JE4A 3X3MA 3Q0AA 5J1ZA 5ELEA 1EQVA 5I2YA 4BBSB 3PMFA 2F0GA 5D3IB 3SK4A 2L4NA 2IX3A 1EEFD 2PZTA 2KCNA 3C2PA 3NSWA 4RCNA 4V0BA 1CA5A 4XQQA 5I9OA 1VCIA 3NHHA 1U4PA 5CV4A 2QEJC 3WOEA 2KVMA 2JA7B 4XT3B 3MXNA 2KQ3A 1DJRD 1EYDA 1STNA 1NR4A 1QB5D 2YU9B 1D2BA 5C5MA 4CHTB 1ZXTA 2B2VA 3M85A 3IKJA 3K5MA 3TMEA 3ITPA 3JAME 1EIGA 1Y8PB 1TS2A 3MXUA 3EVQA 2QKIC 3E5SA 3K57A 3BS1A 1TIID 4QMGA 4WJWA 1Y1VB 5ELBA 1C48A 2Y0SB 2B8FA 1VMPA 3I90A 2KJXA 2IJ0A 1TWCB 4K2KA 1S5CD 4C3IG 1I4RA 2K6AA 4MN3A 5C6AA 3D3RA 5C0XI 1U4RA 4LJZC 4WRDA 1GUWA 4K2LA 4HMJA 3O13A 5CV9A 3H3VC 4RH6A 3S17B 3T51B 1U9RA 4ZUIA 3VR3A 4R8NA 1SMYC 2A6ED 3TZDA 2L12A 4IFDH 1U4LA 4OHJA 3SR1A 2PW5A 3EJIA 4ILWA 4OO1G 5C4HA 4G57A 5M3FB 5JPMC 1KDBA 4KHVA 2I07B 1PTOB 4A93B 2PW7A 1HA5A 3GTGB 1QNUA 1IKLA 3E0JA 2MP1A 1AP0A 2B2WC 1B53A 2PMZB 2EYMA 2A69D 2M9VA 1PMRA 1C8CA 4NP5A 2ENBA 4S3SA 1WTQA 4DAYA 2LS01 3VR6A 1T5XD 4EQPA 3R2TA 1HCZA 1LT4D 1TVXA 1X3QA 5IOCA 2H1EA 3W2DA 4TRDA 2E2DC 4ULLA 2EXZA 2HDLA 1CZGA 2N55A 3BYYB 1DYQA 3CRKC 2AWOA 1PRTF 2NZ1D 1JOQA 1SYCA 1V8QA 2E76C 1FGBD 3QOLA 3RZDB 1AZPA 4F7XA 5KEEA 5FOBB 2F0PA 3DUZA 1DOMA 3MHBA 2F3WA 5E1FA 1JCKB 1SJED 5I4DA 2D62A 2ICIA 2MJ8A 2DNCA 4A3JB 2XNAC 2EYLA 1HFNA 1GUTA 2RQXA 1KNEA 3NTIA 4F8MA 2JA8B 1S5FD 2B2TA 4IN3A 4Z9CB 5JVH3 1PTOF 2R93B 1Q8IA 2Z4HA 3QO2A 5LHY1 4RGOS 5DM73 1F9SA 3M7GA 1LACA 2DNEA 2A5HA 3T13A 2O2LD 2EYHA 5D14A 1ZYRC 1LT5D 1FNWA 4XXEA 1K8MA 4U673 3DEOA 1I4PA 1TWGB 4OO1I 2PQEA 1BCPD 1GUNA 2JA5B 1Q1EA 2MUYA 3GTJB 4FXDA 4FO2A 4EQOA 4PMCA 4FYDA 1ML0D 2NTTA 3PUYA 4C3HG 2KCCA 2J0TD 4CJ0B 1EY0A 1Y8OB 3MTSA 3ONAB 3EQLC 5TSSA 4ZUJA 2CHBD 2OT2A 3FMCA 1RHPA 5ISRA 2A73B 1PTOH 1CTMA 4QUCA 3GV6A 3TDQA 4A3EB 1H9RA 1JB3A 2CQAA 2HCCA 4Y7NB 4IUQA 1EY7A 2F0KA 2M2LA 1F2YA 2FHTA 1JQYD 3VYUA 1Y69U 1HUMA 1VDZA 3D6WA 3CQZB 3HS0C 4A3KB 3RZOB 1LTID 3NPPA 2C9OA 4XDXA 3HRZC 4MHEA 1O7ZA 2E2JB 2BOSA 3FKIB 1EY6A 5A2QL 2ID0A 3SK8A 1DOKA 4G7ZC 4K14A 2FINB 1MI2A 2L55A 3E6ZX 4KN7C 1J9OA 2R3ZA 2K7VA 1JORA 4DK0A 3ND9A 1S5BD 2NN6G 2A6HC 5EKIA 3HOUB 4KJOA 5IGEA 1RODA 3KK7A 3OIPA 2EYPA 1WTVA 2R92B 1QILA 2NVTB 5C3WA 5A2QE 2IPKD 2VNUD 3P1HA 4ID6A 3CU7A 2EY1A 3FVQA 3D4WA 5J22A 2MPMA 1KDAA 3VR4A 2C5CA 1PYWD 2JE6I 1H9SA 3I91A 3MA2B 1A2TA 3S15B 1SNDA 4IALA 1LABA 1RTNA 2E2HB 1BR9A 5CBEE 1UUPA 2A69C 3K59A 4V190 3HOZB 1I6HB 5C44B 1SNQA 3S1NB 3TZUA 4H7BA 2IWHA 3D4RA 4KKUA 1CK1A 1H9JA 4C56C 1MSHA 4ZLTF 4H44C 4RGNA 4KJNA 1YNJC 5G3LD 4ZKBB 1PRTB 3DXJC 1OXXK 5KYIA 3M3YB 3SDZA 2WKCA 1NR2A 3D31A 3S2DB 2JEAI 1VF7A 2F0HA 2ZXOA 5M5XB 1EY5A 2PYKA 1LTAD 5I2XA 1A3UA 1LTTD 4KY6A 2NB0A 3LNNA 5EPLA 1GXDC 1R9TB 2Q8RE 3SK6A 1J8IA 5FKAC 1BO0A 1PXUA 2KUMA 4JBWA 3JAML 3R3OA 3MC0B 2PZWA 3D8GA 2JP1A 3NBIA 4A3BB 2FFKB 2HCIA 2B2YA 5DAUA 4HAEA 1EYAA 1PFMA 3Q23A 5KIXA 3GTPB 5C0XH 4EQNA 3U9OA 1Z7TA 1ET9A 4L63B 4TKOB 3NQIA 1A6XA 3HZXA 3QG1A 1R4QB 3PO2B 3C3LA 4HR7B 1EY4A 1CQFA 1BQQT 1CT1D 1EOTA 3RD4A 4ME5A 4CKBA 2KEEA 2SEBD 2RDHA 2TMPA 1PTOD 2F0FA 4CJ1B 5CYUA 4IFDI 1EU3A 2BE5C 3RMHA 3EA6A 4DGZA 5EKKA 1UNSA 1SAPA 5HURA 3ZYYX 2BA0A 1QE6A 3LX0A 2KOLA 3MAQA 4BA2I 3IFTA 1S5DD 2F0DA 4LAAA 1PFBA 1B9MA 3M4OB 4KI0A 3I73A 4KTAA 4RGTA 2L5TA 1WTPA 3S16B 3VR5A 4B9WA 3BYTB 4RHSA 1E2ZA 2LMCB 3ND8A 4CJ2C 3J81E 1IW7D 1HA6A 2CW0C 1RCVD 5CR3A 1CQVA 3K0YA 2EJFC 5D3DA 3K6OA 1WD0A 1TY2A 2G9HD 1HXYD 1LT3D 5DM63 4FP5D 2XWJB 4XYOA 2IX0A 3GTQB 5EBCA 1HFGA 3OMGA 3LWUA 1SE2A 3NUCA 1JICA 1DXMA 4OO1H 5IT9L 2IW3A 4IUNA 1JOKA 4L8JA 3J80L 2M00A 1AZQA 2AUJD 3MFYA 1SNCA 4B9XA 3V2TA 2RDGA 1BCPF 2FJ2A 5HGTA 4OGQC 3MZ5A 3SVMA 1H9KA 2A68C 3GTLB 1KLGD 1Z6HA 3TP5A 3DEPA 5DEHA 3DWAA 5AFWA 1BCPC 4J1MA 1NUCA 1L0YB 1G91A 2A6EC 3BZDB 2IT1A 1IW7C 1OXSC 2D5DA 5CV7A 2KEDA 1BOSA 3I72A 5M5WB 4DAVA 5K5PA 2OF1A 1PDQA 1MD2D 1DD2A 2F3VA 1FNVA 1WD1A 1F2ZA 4ZK9B 5CMDA 3J7AF 5BN5A 2A74C 4RGMA 3P75A 5E4WC 5M9OA 4CBVA 5C4JB 1EZ6A 3GQBA 4IUUA 1G291 1QOHA 3SXHA 3S1RB 1H9MA 1STYA 4R8IA 2AQ3B 1SNPA 3MWYW 2FMCA 5JEAJ 1STGA 1QWYA 1FYCA 1STEA 3NWSA 1WTOA 4K5XA 2NVYB 2A68D 4L6TB 1LTGD 4X3KA 5FLXE 1HHVA 5CGKA 1ILQA 5CV6A 5I6WA 2WIIB 1LTRD 3OIQA 4IUTA 4C3JB 2O5IC 2EE1A 1E0BA 2K5WA 1I4QA 3NTKA 1EEID 3BVGA 1BF4A 3S1QB 3C1EA 2EOTA 2Z8LA 1PRTD 1RD9D 1PZKD 2NBFA 3H0GB 1HTPA 2NN6I 2HUGA 4IURA 2LKVA 2LY7A 3BG3A 2DN8A 3HOVB 2QDBA 5G3LF 3D4DA 1RJTA 1V43A 1ESRA 2VB2X 2F0TA 1ENCA 1B1ZA 3BVZA 3FPUB 3R2IA 3HOYB 1HPCA 2K33A 2XSCA 2F0NA 1FD7D 2SNSA 1PLFA 1M4VA 3BVMA 1EY8A 4A3MB 4G7OC 1B9NA 3R93A 2R61A 2L9HA 3DHQA 4NMZA 3H6MA 4HN7A 5KYLA 2PO4A 2CW0D 2XWBB 3NWTA 4N9TA 2D9UA 2EPBA 5CBAE 2F0UA 3A55A 1Z47A 1STHA 4O1NA 2ICEC 3VYTA 1PRTC 1BDOA 2XN9C 3FRPB 4A3DB 5EBDA 3NE5B 2EJGC 1T5EA 1SYGA 2B2TC 4IFDG 3QB3A 4ZYSA 1II3A 3I70A 2PZUA 3NTHA 2DY8A 3VR2A 2F0JA 4C2MB 4PV1C 1M8AA 1IKMA 1QG7A 4QIWB 1Q1BA 1D6EC 3RUZA 2DY7A 3CKIB 4G4KA 2N88A 3Q6SA 4HSPA 5JJZA 4BA1I 1I4HA 2XRQD 2WINB 1WTXA 3J7AV 3S9WA 5M5YB 2NVQB 5LL6S 1RTOA 2EY5A 3AU7A 3DMUA 2NUCA 5JEAH 3AB9A 4HSVA 1JWUD 3G7LA 3NXWA 3KLRA 1B4OA 4R9WA 1SE4A 2TSSA 1EIHA 5KNDA 1JWMD 1SNMA 3A7AB 1FNUA 5D65A 1ICWA 4OL7A 1WTRA 1EU4A 3MEHA 3L9AX 3OMCA 1MGSA 2JSOA 3J81L 1KDCA 3I3CA 3L3OC 1Q12A 3VYSA 1DM0B 4FVMA 4FF2A 2IL8A 2F0OA 3EROA 1EFID 3QIAA 1LV9A 2F03A 3FPPA 3D6CA 3A56A 1LO5D 4IUVA 1B2TA 4A3GB 3LWEA 3KBGA 1SYFA 3NP8A 1PZID 1K83B 5KGUA 5C4ZA 2EYJA 4DN4M 3HOXB 5C0XJ 1EY9A 5JPNC 1BBXC 1AEXA 3KF8A 3URYA 3M7NA 2NN6H 3SEBA 1QJOA 4XYQA 4BBRB 1MSGA 3NK9A 2Q8IB 4KY5A 2VB3X 5EGTA 5C3XA 4A3FB 5A35A 1A3VA 1KABA 3RLFA 1WVLA 5CORA 4DK1A 4M8AA 4C1NK 2WB1B 2FMMA 1LT6D 3KLSA 1D1KA 3PO3B 2F0MA 2KA7A 2MHVA 1IL8A 2ZT9C 3MFGA 2NTSA 1W6JA 2YYZA 4K6LA 2K28A 1GUOA 4E6IA 5C4XB 1I50B 4IFDJ 1O7YA 3OHXC 2XRSD 2EYOA 2BDNA 1BXTA 4DXFA 4ODGA 1LLRD 1GOZA 2F0WA 2F1MA 3KBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KF8 A; 
#chains in the Genus database with same CATH topology
 4K5W A;  2R7Z B;  4QCL A;  1SYB A;  4X64 Q;  4RAU C;  1EQT A;  1L2F A;  4DAP A;  3HOX G;  1G8Z D;  4H13 C;  1L0X B;  3W3A A;  1AFP A;  2RKS A;  3GO5 A;  3ERS X;  3I4N B;  1J5E L;  4DXG A;  5IOD A;  4LF8 Q;  3MEF A;  4IJH A;  4LF5 L;  4MZ9 A;  2WAQ B;  1STB A;  2H4O A;  4R4T A;  1TR5 A;  5IGG A;  1NAP A;  5FO7 B;  5J39 A;  4DF7 A;  1YNN D;  3CPW A;  4FXG C;  4IQZ A;  1G6P A;  1SSO A;  1TWH B;  2G9D A;  4XTC S;  2BE5 D;  3VA5 A;  5LMU L;  1IYV A;  5F2D A;  1SNO A;  1WFQ A;  1I94 L;  3GV3 A;  4NKL A;  1QVG A;  4JI7 L;  1F9R A;  3E9I A;  3F2U A;  4G7H C;  2EDG A;  2YV5 A;  5EJW A;  1XXG A;  2Z9H A;  4XQJ A;  3MXP A;  3GP7 A;  1RKN A;  4DR4 Q;  4DKA C;  4KY7 A;  2D0P A;  1F2M A;  2K5D A;  3OW7 A;  3SK5 A;  2B2U A;  1VMC A;  1KTK A;  1SE8 A;  3P20 A;  2AQ1 B;  2UU9 L;  3K81 C;  3DM3 A;  3TEH B;  3T16 A;  1MJE A;  4KHZ A;  2KCT A;  5AJ3 L;  1STA A;  2WP8 J;  2F0Q A;  4HCE A;  1G2S A;  2NVX B;  1SE3 A;  1K73 C;  1CFM A;  1S5E D;  1VQG A;  5EQ0 A;  4LFC L;  4B08 A;  2UU9 Q;  4IUP A;  2EXD A;  3M4Y A;  1U4M A;  1ZEQ X;  2NVQ H;  1Y1W B;  1EUJ A;  1HZB A;  4O2D A;  4HTH A;  3KLS X;  1MBY A;  5AJ3 Q;  5EPK A;  4K8I A;  2BCO A;  5T1G A;  1ENA A;  2QEX A;  3CCS A;  4I7Z C;  2I5L X;  2LXJ A;  3T4A C;  3OWE B;  3ULL A;  1F2L A;  1TWC H;  1IYJ B;  2JA6 B;  3TP6 A;  1L1O C;  1DOL A;  4A3I B;  2ZXP A;  3I55 A;  1A3T A;  4CKC A;  4LK1 C;  1CHP D;  3UE1 A;  1OXV A;  2K5Q A;  3VA7 A;  3KF8 B;  4OEL B;  4DV1 L;  4C3J G;  1XMQ L;  3K5N A;  1I6V C;  5M3M B;  2QCP X;  1YNN C;  1VQ6 A;  3I4M H;  3N52 A;  1B50 A;  1PZJ D;  1I3Q H;  3I4O A;  3E3X A;  2F0V A;  4KMU C;  4HED A;  1AN8 A;  3IFD A;  1P8L A;  4F88 A;  1HJP A;  4U68 A;  4OXP A;  3DWP A;  4H02 A;  2ATW A;  1N34 L;  3IAY A;  4JYA L;  3PIO 3;  4HCS A;  5C4X G;  2Z0S A;  4J15 A;  3HG9 A;  5I6Y A;  2CH4 W;  2E2I B;  4JBM A;  4IO9 A;  2E5L Q;  5K36 G;  3K7U C;  5COY A;  4OIK A;  4BY7 B;  3BDL A;  3U9S A;  1GUS A;  3EFX D;  1GUG A;  1G6Z A;  3L2P A;  3N6R A;  2HQE A;  2JN4 A;  4BY1 B;  4LFB Q;  2MGS A;  3K7A B;  3TSS A;  1XWE A;  4QUF A;  4BS9 A;  1G2T A;  2PPB C;  4KKS A;  1XTC D;  2RA4 A;  4RHR A;  2L11 A;  4Q0F A;  2R7Z H;  1EZ8 A;  4KD3 A;  1WCM H;  1PFN A;  1V1P A;  4BWG B;  3UI2 A;  1LUZ A;  5FLX c;  2CVR A;  1CSQ A;  4WOR A;  1SYD A;  3NBH A;  1WCM B;  3H09 A;  1IYU A;  1UEA B;  2B2V C;  2JEB I;  1HUN A;  4F87 A;  2Q8T A;  4FF1 A;  1I6H H;  1VQE A;  4RFB A;  3HOY G;  2F0E A;  1HRJ A;  1KLU D;  1VQF A;  5IGC A;  2X6L A;  1B70 B;  1NNX A;  2RBM A;  2VS1 A;  4DFA A;  1O7L A;  3HOW G;  3ULP A;  5KRU A;  4DR6 L;  3BDO A;  1OXT A;  1CSP A;  1B3A A;  3KFU A;  4PMW A;  1HNZ Q;  4K8J A;  1B44 D;  1EWH A;  4PNY A;  4AYB B;  4KV6 A;  1IBM Q;  1O80 A;  4GS3 A;  4O42 A;  1TQO A;  4O0A A;  5C3E G;  3PCO B;  4DR5 Q;  2I5H A;  2LFN A;  4M1U B;  4R4Q A;  3VYR A;  4BBR G;  2CKZ B;  2X6G A;  4JI3 Q;  4FF3 A;  4KHP Q;  4DNT B;  1F9P A;  3HKZ B;  2JA8 H;  1A2U A;  3GTO B;  2J7Z A;  1HNZ L;  3I4M B;  4LF6 Q;  3TP7 A;  5KNC A;  1V1O A;  3AFQ A;  3A8J E;  3PV0 A;  2B39 A;  2UXC L;  3M4P A;  1WTW A;  2EYF A;  5T1I A;  4UP9 A;  2Q2I A;  4JW0 A;  1TS3 A;  2B2U C;  1DZ1 A;  3R8B A;  4L5S A;  2SNM A;  5IGB A;  1TWA B;  5LMN Q;  1I4X A;  1XTD A;  1CHQ D;  4CKE A;  4B3R Q;  1SRU A;  4PQX A;  3KDF B;  4K6D A;  4I65 A;  1OO9 B;  2R7D A;  3OOC A;  4Q5V A;  1SMX A;  3ER0 A;  2XVS A;  4YHH Q;  1EYC A;  2F0L A;  2CCZ A;  1QNK A;  2ZM6 Q;  2VQF Q;  5FLM G;  2NWG A;  1BNZ A;  5HY6 A;  2HIV A;  2N78 A;  3CQZ H;  5IWA Q;  1QCB D;  3V96 A;  4KK7 A;  2VXW A;  3E0E A;  3PUZ A;  4HMI A;  3A7L A;  1JR0 D;  3KUP A;  4RKB A;  3Q22 A;  1K8O A;  1V1P B;  2I46 A;  2X69 A;  5FJ8 H;  1BKB A;  5FO9 B;  3K58 A;  3Q24 A;  2GVB A;  1W3S A;  2KHI A;  1ILP A;  2SOB A;  1SFO B;  1D5M C;  1NTG A;  3I8Z A;  1BCP B;  5BN3 A;  1I94 Q;  1DCZ A;  2EJM A;  1SEB D;  1TT2 A;  4C3H B;  1EL0 A;  1D5X C;  4RWS C;  4YCU A;  3T53 B;  2K04 A;  4DR3 L;  5E4X A;  1NY4 A;  1Y8N B;  2L1B A;  4TQU S;  1RF2 D;  4ABN A;  2VUM B;  1YHA A;  2K5N A;  1VF5 C;  2ZTD A;  1F9Q A;  1AE3 A;  1H9S B;  4GLA C;  4DR3 Q;  1SXT A;  4A93 H;  5J3B A;  2NYZ D;  1XX8 A;  4R4O A;  2J4X A;  4JI3 L;  4XQN A;  5CV5 A;  1TKW B;  3WDN A;  1A63 A;  3CCU A;  3J80 i;  4DNR B;  1Y1W H;  2ZJQ A;  4MIU A;  4R4C A;  1EIF A;  4KN4 C;  3P7J A;  2P5Z X;  4UDU C;  4IOA A;  1I3Q B;  1ENF A;  1IHZ A;  1JT8 A;  1KNA A;  5DNF A;  2RSN A;  3HP3 A;  3TN2 A;  3SGI A;  4JI8 L;  3TS0 A;  5ELD A;  1X32 A;  4PZ8 A;  3X3N A;  2OEO A;  2QF7 A;  2F0I A;  1LYL A;  1NE3 A;  3BDC A;  4DV0 Q;  1J5E Q;  1D7Q A;  1YVC A;  4YCV A;  5FK9 C;  3KJO A;  3J81 c;  3IL8 A;  1ESF A;  4PMB A;  1Q90 A;  1XMQ Q;  2WKD A;  2PI2 A;  1ZYR D;  1NSN S;  3I4L A;  1CZW A;  2WAQ E;  2PCF B;  3FDT A;  4N8X 1;  3H91 A;  5K36 H;  1PYB A;  2RSO A;  3AMU A;  2RVL A;  3K5L A;  2OCE A;  3H94 A;  4NW2 A;  1OXU A;  3HGB A;  2HDM A;  4JI0 L;  4A3J H;  4JI7 Q;  3AEV A;  4FF4 A;  3K5O A;  3UDI A;  1C4Q A;  4K5V A;  1L1O A;  1M1K C;  3NEN A;  2K75 A;  3G6J B;  1HQR D;  3FEW X;  2VUM G;  1ZKO A;  5C5L A;  5IIF A;  4C2M H;  5M3F G;  4A3F H;  3CHB D;  5GQO A;  1D1I A;  3PUX A;  3G4S A;  3RZD H;  4A3D G;  4BBR H;  3CCQ A;  5CC4 A;  4RA8 A;  3FHW A;  4ZAI A;  1S4Z A;  2B3G A;  3CCV A;  2Z6B A;  2K1B A;  2IHF A;  1XYI A;  4X3U A;  4XT1 B;  1UE6 A;  5H1S E;  3A5U A;  1KAA A;  4A3M H;  2B63 B;  1ICF B;  4LMQ D;  4P2C B;  3S2H B;  1IZ6 A;  4XIG S;  4AQY L;  4EGV A;  2EY6 A;  2CWA A;  2QIL A;  2E74 C;  4DV6 L;  1GHJ A;  3GTM B;  1FL0 A;  1PH6 A;  4ZRZ A;  3TBI B;  3MXN B;  4B3M Q;  2YU9 H;  3CRL C;  3NQT A;  1O78 A;  1NCV A;  1X3P A;  2ZXR A;  2E75 C;  3W1B A;  3C46 A;  1QVC A;  1EYG A;  3GTM H;  2IX1 A;  4C3H H;  3J80 E;  3PUV A;  2SDF A;  1TWA H;  4X3T A;  1N32 L;  5JEA G;  3RR5 A;  1UAP A;  2KEC A;  4B3M L;  4TVA B;  2VQE L;  1Q3L A;  3EN2 A;  5IT9 E;  2EVB A;  1VQD A;  4P72 A;  4FNF A;  4QJF A;  5EKL A;  4ZQ3 A;  2F0S A;  2JXM B;  1I4G A;  2K4K A;  3OTO L;  1AW7 A;  2B8G A;  1CA6 A;  5ELF A;  2JYO A;  4BY7 G;  4JYA Q;  2A6H D;  5CV8 A;  3HOW B;  1VQM A;  5LL6 X;  3S15 H;  1E1O A;  4QF4 A;  4UAI A;  4X6A H;  5I9P A;  3A8K E;  4GZY C;  2EQS A;  3QOJ A;  3HEJ A;  1FJG Q;  1SN8 A;  2K50 A;  3UDF A;  2BDO A;  3F1Z A;  3OPO A;  4X3S A;  4DU9 A;  4DV7 L;  1IXR A;  1D5Z C;  2AUK A;  2WAC A;  1SJH D;  4HJA A;  4QB4 A;  1HTL D;  1HQM C;  1Y1V G;  1W2B A;  3T56 B;  4DAM A;  2AWN A;  3DM1 A;  4H0L C;  2RCF A;  3AQQ A;  3ERQ A;  1QZG A;  4P71 A;  1FR3 A;  3A8I E;  3NEL A;  3V05 A;  2B2Y C;  3SE0 A;  2O5J C;  2D2C C;  3KF6 A;  3F2C A;  3PSI A;  1PFS A;  4EVO A;  1JOO A;  4JI4 Q;  1TU2 B;  1RL2 A;  4FXK C;  5IYB H;  3HOV G;  3T1H L;  3LGJ A;  4A4I A;  4C3I B;  2CFM A;  3QJY A;  4A3L H;  1A15 A;  1EOV A;  1Q8K A;  2K03 A;  3S14 B;  3KF6 B;  1N36 Q;  2L0C A;  2XIW A;  3GD7 A;  4KKT A;  3H3V I;  4HJ7 A;  2RDF A;  2V4D A;  3S1M B;  4N9P A;  3PUW A;  4ZKC B;  2F4I A;  2HIX A;  2A19 A;  3J81 j;  3PIP 3;  1R4P B;  4A3M G;  1TS4 A;  2BA1 A;  1YNJ D;  2K05 A;  1GD7 A;  1SMY D;  1GKH A;  1WJJ A;  2PNR C;  4A3G H;  1JC7 A;  4X62 Q;  5JAV A;  1DON A;  1E2W A;  3NBH B;  5IGF A;  2Z1C A;  4CDF C;  4LF6 L;  1AE2 A;  5EPJ A;  1X3G A;  1Q82 C;  4OIJ A;  1SDF A;  4JK1 C;  2UUA Q;  4A3C G;  5JOB A;  4DV4 Q;  5FO8 B;  5IGD A;  4RCO A;  2YTX A;  2GA4 B;  4C1N I;  1GHK A;  1UE5 A;  4CGY B;  2R6G A;  3GTK B;  1KL9 A;  3A54 A;  5BN4 A;  2R92 G;  1E2V A;  1ONL A;  5JJI A;  3WOF A;  4A3B G;  2UUC L;  1K0R A;  1BUV T;  1M90 C;  5ELC A;  3L7Z C;  4GN4 B;  1YEZ A;  4J6H A;  4LWC A;  1FJG L;  5KNB A;  1IBL L;  3S1Q H;  1EFW A;  5FLX L;  2K01 A;  2KHS A;  3MVV A;  4HIO A;  2ASB A;  3JC6 6;  5E3F A;  4BY7 H;  1VS0 A;  4YIJ A;  4J8Q A;  3HOZ H;  2Q2U A;  4LF8 L;  3CPF A;  3RN2 A;  3TP8 A;  1JWS D;  4KD4 A;  4WFN 3;  1YJW A;  4B3S L;  3QWN A;  3GTL H;  1EWC A;  2AQ2 B;  1QUQ A;  4IZ8 A;  1IBL Q;  1N8R C;  1F77 A;  4NDX A;  4DA2 A;  3EIV A;  4DR1 Q;  1CKM A;  1LTB D;  1LTS D;  5NUC A;  4DV3 Q;  2O4X A;  5IYB G;  5C0X G;  1KAW A;  1W6K A;  2WV6 D;  2HT1 A;  3F2B A;  2R7Z G;  4A3B H;  3J7Y W;  1ET6 A;  2Q2T A;  1WCM G;  4YY3 Q;  1GJX A;  4LUV A;  2N8N A;  4R1J A;  2PQA A;  4A3D H;  3CC2 A;  1SBB B;  3MXG A;  1TY0 A;  3KYH C;  3A0J A;  3DWQ A;  2OXP A;  4L5R C;  2JA6 H;  3CCM A;  2K32 A;  4TSS A;  5JVG 3;  5C3E B;  4JOI C;  2Z4I A;  3RLN A;  1TWF B;  1MKH A;  4PZ6 A;  5IYC G;  4NXM L;  1TS5 A;  1L1O B;  2E2H H;  4P74 A;  1CM9 A;  2B2W A;  1CI3 M;  2Q2H A;  3S1R H;  4RKL A;  3C1F A;  1A0I A;  2AKW B;  2EY2 A;  1VQI A;  1RDP D;  1P16 A;  1PTO C;  2EZV A;  3OWF A;  3A74 A;  3OSO A;  3SHL A;  1JJG A;  1SYE A;  1JE4 A;  3X3M A;  3Q0A A;  5J1Z A;  4GNX B;  2OTL A;  5ELE A;  1EQV A;  5I2Y A;  4BBS B;  3PMF A;  2F0G A;  5D3I B;  1C0A A;  3SK4 A;  2L4N A;  2IX3 A;  1EEF D;  2N49 A;  2PZT A;  2KCN A;  4QY7 A;  3C2P A;  3NSW A;  4RCN A;  1B8A A;  4V0B A;  1CA5 A;  4XQQ A;  2PQA B;  5I9O A;  5C44 G;  3U58 A;  1VCI A;  4APV A;  2ZTE A;  3NHH A;  1U4P A;  5CV4 A;  2QEJ C;  2QA4 A;  3WOE A;  2NVY H;  2KVM A;  4JI5 L;  4XT3 B;  2JA7 B;  3MXN A;  2KQ3 A;  2NZO A;  1DJR D;  1EYD A;  3J80 c;  1STN A;  3H0G H;  1VQ8 A;  1FVI A;  1NR4 A;  1QB5 D;  2YU9 B;  1D2B A;  5C5M A;  4CHT B;  1ZXT A;  2B2V A;  3M85 A;  3RNU A;  3IKJ A;  3CC4 A;  3K5M A;  1HH2 P;  1S3O A;  5C4J H;  3TME A;  3ITP A;  5GAD C;  3F8T A;  3GTJ H;  1UEB A;  3JAM E;  1EIG A;  1Y8P B;  1TS2 A;  2IHE A;  5FJ8 G;  4LF7 Q;  3MXU A;  1TWG H;  3EVQ A;  4NXN Q;  3ULJ A;  4GNX A;  2QKI C;  1B7Y B;  3E5S A;  3K57 A;  3BS1 A;  1TII D;  4QMG A;  4WJW A;  5IY0 A;  2RHQ B;  3HOU H;  1Y1V B;  5ELB A;  1C48 A;  2Y0S B;  1KRT A;  2B8F A;  1VMP A;  1VQJ A;  3I90 A;  1N9W A;  2G5D A;  2VW9 A;  2KJX A;  3T1H Q;  4A3I H;  2IJ0 A;  4ALP A;  1AH9 A;  1TWC B;  1HZA A;  4K2K A;  1S5C D;  3BZC A;  5IYC H;  1KC8 C;  3U50 C;  2HD3 A;  1BBW A;  4C3I G;  1I4R A;  4DV1 Q;  5ELO A;  2K6A A;  5M5Y H;  4MN3 A;  4HIK A;  3S17 H;  3NEM A;  1J6Q A;  5C6A A;  3D3R A;  3H15 A;  5C0X I;  1XPO A;  1U4R A;  1XJV A;  2UUB Q;  4LJZ C;  4WRD A;  1GUW A;  2DJF C;  4K2L A;  4HMJ A;  5JJL A;  3O13 A;  5CV9 A;  3H3V C;  4RH6 A;  5IP7 G;  3S17 B;  3T51 B;  1U9R A;  4ZUI A;  3VR3 A;  1CKN A;  4R8N A;  4UP8 A;  1SMY C;  4CDC C;  2A6E D;  2UXC Q;  3TZD A;  2D0O A;  2L12 A;  4IFD H;  1U4L A;  3S24 A;  4LW1 A;  2WAQ G;  4OHJ A;  3SR1 A;  1VQP A;  2PW5 A;  3CME A;  4DV2 Q;  3EJI A;  4ILW A;  4OO1 G;  5C4H A;  4G57 A;  3AYH B;  5M3F B;  5JPM C;  1KDB A;  4KHV A;  1JJ2 A;  4LF5 Q;  2I07 B;  1PH1 A;  1PTO B;  4A93 B;  2UXD L;  2PW7 A;  1HA5 A;  3H0G G;  1UE1 A;  3GTG B;  1UE7 A;  4DV2 L;  3CXC A;  1QNU A;  2Y0S E;  3K0X A;  3I4M G;  1IKL A;  3E0J A;  2MP1 A;  3STB D;  4DAY B;  1AP0 A;  1I5F A;  4YCW A;  1NJI C;  2B2W C;  1B53 A;  2JA5 H;  2PMZ B;  2EYM A;  2ZTC A;  3JAM i;  2A69 D;  1N36 L;  3S16 H;  2M9V A;  1PMR A;  4OON A;  1C8C A;  4NP5 A;  3CCR A;  4OX9 Q;  2ENB A;  4S3S A;  1WTQ A;  4DAY A;  2LS0 1;  3VR6 A;  1T5X D;  5C44 H;  4EQP A;  4LF9 L;  4AIM A;  3R2T A;  4POF A;  1HCZ A;  1LT4 D;  1TVX A;  1X3Q A;  5IOC A;  2H1E A;  3W2D A;  3KLW A;  4TRD A;  2E2D C;  4ULL A;  2EXZ A;  2HDL A;  1CZG A;  1S40 A;  2N55 A;  3BYY B;  1DYQ A;  3CRK C;  3KJP A;  2AWO A;  2WB1 E;  1PRT F;  2NZ1 D;  1JOQ A;  4A3I G;  1SYC A;  1V8Q A;  2E76 C;  1FGB D;  1VQN A;  4LF9 Q;  3QOL A;  3RZD B;  1AZP A;  2K14 A;  4F7X A;  1YHQ A;  4JOI A;  5KEE A;  1FGU A;  5FOB B;  2F0P A;  3DUZ A;  4YWM A;  4GKJ Q;  4I7A A;  3UDX A;  1DOM A;  3MHB A;  2F3W A;  5E1F A;  2RCN A;  1JCK B;  3GTG H;  1SJE D;  4NB3 A;  5I4D A;  2D62 A;  2ICI A;  4A93 G;  2MJ8 A;  2DNC A;  4A3J B;  2XNA C;  2EYL A;  1HFN A;  1GUT A;  2RQX A;  4DR7 Q;  1KNE A;  3UE0 A;  3NTI A;  1CKN B;  2N3S A;  4GKJ L;  4F8M A;  1YJN A;  2JA8 B;  1S5F D;  3GTQ H;  2LSS A;  3STB C;  2V1C C;  2B2T A;  4JI1 Q;  4IN3 A;  4Z9C B;  1YIT A;  1JJC B;  3PO2 H;  5JVH 3;  1PTO F;  4BXX G;  2R93 B;  3U4Z A;  2JA8 G;  4DR1 L;  1Q8I A;  4MNO A;  4DV3 L;  2Z4H A;  2E5L L;  3QO2 A;  5GAG C;  1KXL A;  5LHY 1;  4RGO S;  5DM7 3;  1F9S A;  3M7G A;  1LAC A;  1Y1V H;  1HZ9 A;  2JA5 G;  2DNE A;  1JB7 A;  2A5H A;  1KQS A;  3T13 A;  2O2L D;  2EYH A;  3CCL A;  4JPB W;  4L5T A;  5D14 A;  1ZYR C;  1PH2 A;  1LT5 D;  1FNW A;  4XXE A;  1K8M A;  4U67 3;  3DEO A;  1I4P A;  4JI2 L;  1TWG B;  4OO1 I;  2K52 A;  4N8F A;  2MQH A;  2PQE A;  1BCP D;  4DR2 L;  1GUN A;  3HOV H;  2JA5 B;  4GOP C;  1Q1E A;  4LFC Q;  3M4O H;  4JV5 Q;  2MUY A;  3GTJ B;  4FXD A;  4FO2 A;  4EQO A;  1YBY A;  4PMC A;  4FYD A;  4K0K Q;  1ML0 D;  2NTT A;  3PUY A;  4C3H G;  2KCC A;  2J0T D;  4CJ0 B;  3HOU G;  1EY0 A;  1Y8O B;  3U4V A;  3MTS A;  3ONA B;  1PA6 A;  3EQL C;  2WB1 G;  5TSS A;  4GOP A;  4ZUJ A;  2CHB D;  2OT2 A;  3FMC A;  1RHP A;  5ISR A;  2A73 B;  2AHO B;  4JC0 A;  1PTO H;  1CTM A;  4QUC A;  3FKI H;  3GV6 A;  3TDQ A;  1X54 A;  2CQO A;  4A3E B;  1H9R A;  3I7F A;  1JB3 A;  1YIJ A;  3CC7 A;  2CQA A;  2HCC A;  3S2D H;  2E2I H;  3CAM A;  4Y7N B;  4IUQ A;  1EY7 A;  2F0K A;  1VQ4 A;  2M2L A;  1EIY B;  1F2Y A;  2FHT A;  1JQY D;  4IPG A;  3VYU A;  4X64 L;  1Y69 U;  4Y7N H;  1L0W A;  1HUM A;  1VDZ A;  3D6W A;  3CQZ B;  3HS0 C;  4UY8 C;  4A3K B;  3RZO B;  1LTI D;  3NPP A;  2C9O A;  4JI5 Q;  4A3E H;  4XDX A;  2AMC B;  3HRZ C;  2UUB L;  4MHE A;  1QVF A;  4JI1 L;  1O7Z A;  2E2J B;  2BOS A;  3FKI B;  1EY6 A;  5A2Q L;  4JI0 Q;  2ID0 A;  3SK8 A;  1DOK A;  4L5Q A;  4G7Z C;  5IYD H;  4K14 A;  2R93 H;  4LFB L;  3S1M H;  2FIN B;  1MI2 A;  1Y1W G;  3M9B A;  2L55 A;  3E6Z X;  4KN7 C;  4POG A;  3AFP A;  1TXY A;  1J9O A;  2R3Z A;  4DK6 C;  2VZA A;  2K7V A;  1JOR A;  1JE5 A;  1XMO L;  4DK0 A;  3GDE A;  1Q46 A;  1N34 Q;  3ND9 A;  1S5B D;  2NN6 G;  2A6H C;  5EKI A;  2HHH Q;  3HOU B;  4KJO A;  5IGE A;  1ROD A;  3D0F A;  4Y52 H;  3KK7 A;  3OIP A;  2EYP A;  1WTV A;  3HKS A;  2R92 B;  1QIL A;  1G51 A;  2NVT B;  5C3W A;  4A3K H;  5A2Q E;  2IPK D;  1K28 A;  3RZO H;  2VNU D;  3P1H A;  4ID6 A;  3CU7 A;  1K8A C;  2EY1 A;  3M3Y H;  3FVQ A;  4PZ7 A;  2HHH L;  4JBJ A;  4X65 L;  1KHI A;  3D4W A;  5J22 A;  2MPM A;  1HR0 Q;  1KDA A;  3VR4 A;  2JQO A;  1PH8 A;  2C5C A;  1PYW D;  2JE6 I;  1H9S A;  3I91 A;  3MA2 B;  4HJ9 A;  1A2T A;  5M5W H;  1E7Z A;  3S15 B;  1SND A;  4IAL A;  1LAB A;  5GRO A;  1RTN A;  4DR5 L;  2OTJ A;  2E2H B;  1BR9 A;  4X65 Q;  5CBE E;  1QUQ B;  1UUP A;  2A69 C;  3K59 A;  4V19 0;  3HOZ B;  1I6H B;  5C44 B;  1SNQ A;  3S1N B;  1NMF A;  3TZU A;  4H7B A;  3PGZ A;  3D4R A;  2IWH A;  4KKU A;  5L37 A;  1CK1 A;  1H9J A;  3OTO Q;  1OTC A;  4C56 C;  2FXQ A;  2F4V Q;  2NZH A;  1MSH A;  4ZLT F;  4H44 C;  4RGN A;  4KJN A;  1SLJ A;  3K7A H;  1U5K A;  1YNJ C;  5G3L D;  2ZJR A;  4ZKB B;  3HFZ B;  3B6Y A;  5ELN A;  4JI8 Q;  1PRT B;  1N33 Q;  3DXJ C;  1OXX K;  5KYI A;  3HKZ E;  3I4N G;  3M3Y B;  3SDZ A;  2I0Q A;  2WKC A;  1NR2 A;  3D31 A;  3S2D B;  2JEA I;  1VF7 A;  2F0H A;  2ZXO A;  5M5X B;  1Q86 C;  1EY5 A;  2PYK A;  1NMG A;  1LTA D;  3EBE A;  3ZJY C;  5I2X A;  1A3U A;  1LTT D;  4CDD C;  4KY6 A;  2JK8 A;  2NB0 A;  3LNN A;  5EPL A;  1GXD C;  4EX5 A;  4DUZ Q;  1K0S A;  1R9T B;  2GVA A;  2Q8R E;  5M3M H;  4IPH A;  4AH6 A;  3SK6 A;  3E9H A;  4LF4 L;  2UXB Q;  1J8I A;  5FKA C;  4LFA Q;  2BH8 A;  1BO0 A;  3UDG A;  4B3T Q;  1PXU A;  2KUM A;  4YHH L;  4JBW A;  3JAM L;  4NPS A;  3R3O A;  5EAY A;  3MC0 B;  3CMA A;  1PH7 A;  1A62 A;  1WYD A;  2PZW A;  5LMN W;  3HOZ G;  1E24 A;  3OW2 A;  3D8G A;  3J81 i;  2JP1 A;  3NBI A;  4UHV A;  4A3B B;  2FFK B;  1IBK L;  2HCI A;  3I56 A;  2B2Y A;  5DAU A;  4B3T L;  4HAE A;  2B63 G;  4ZCK A;  1EYA A;  4GN3 B;  1C9O A;  3T1Y Q;  1PFM A;  4YWL A;  3Q23 A;  4X62 L;  5KIX A;  3GTP B;  5C0X H;  4EQN A;  4JG2 A;  4DR2 Q;  3U9O A;  1Z7T A;  2QDL A;  1ET9 A;  4WJ3 M;  4L63 B;  4TKO B;  3NQI A;  4JV5 L;  1A6X A;  3HZX A;  3QG1 A;  1R4Q B;  3PO2 B;  3GTP H;  1V9P A;  1IL2 A;  2HQL A;  5GAE C;  4KHP L;  3C3L A;  2C35 B;  1X3E A;  4HR7 B;  2XGT A;  2F3I A;  1EY4 A;  1CQF A;  1PYS B;  1BQQ T;  1CT1 D;  1EOT A;  3RD4 A;  4ME5 A;  4KLK A;  4CKB A;  4A3J G;  4QIW E;  3HKZ G;  4DV5 L;  2KEE A;  1LTL A;  4JI6 L;  2SEB D;  2RDH A;  4GKK L;  2TMP A;  1PTO D;  2F0F A;  3CCE A;  4A3E G;  3K80 C;  5IT9 c;  3G6E A;  4CJ1 B;  5CYU A;  4IFD I;  1EU3 A;  2VY3 A;  2BE5 C;  3RMH A;  2VL6 A;  3EA6 A;  3H3V H;  4DGZ A;  5EKK A;  1UNS A;  4FDB A;  1Z9F A;  4JI6 Q;  1SAP A;  5GAH C;  2MFI A;  5HUR A;  1GVP A;  2KHJ A;  3TS2 A;  1SRO A;  3ZYY X;  2BA0 A;  1QE6 A;  4QGU A;  3LX0 A;  1Q7Y C;  2YTY A;  2KOL A;  3MAQ A;  4GOP B;  4BA2 I;  3IFT A;  3CD6 A;  1Q81 C;  1S5D D;  4OWX B;  2F0D A;  4LAA A;  3BU2 A;  2DUD A;  1K8G A;  3JAM c;  3G71 A;  4LUZ A;  1PFB A;  4P75 A;  1WTH A;  1B9M A;  3M4O B;  4KI0 A;  1V1Q A;  3I73 A;  4KTA A;  4RGT A;  2L5T A;  1HR0 W;  3F2D A;  1WTP A;  1IBK Q;  1PH5 A;  3S16 B;  2MO0 A;  1VQB A;  3PO2 G;  3VR5 A;  4B9W A;  1HNX Q;  3BYT B;  4BXX H;  4RHS A;  1E2Z A;  2LMC B;  3ND8 A;  4CJ2 C;  3T1Y L;  4JI4 L;  3J81 E;  4AYB E;  1IW7 D;  1HA6 A;  4RG1 A;  4R4I A;  1SR3 A;  2CW0 C;  3TRE A;  3CF5 A;  2A8V A;  1RCV D;  5CR3 A;  1CQV A;  3K0Y A;  2EJF C;  3W5O A;  1VQK A;  3IRB A;  5D3D A;  3K6O A;  1WD0 A;  1TY2 A;  2G9H D;  4JBK A;  1HXY D;  1KD1 C;  1LT3 D;  5DM6 3;  1E1T A;  4FP5 D;  2XWJ B;  4XYO A;  2IX0 A;  4ME3 A;  5C3E H;  5EBC A;  3GTQ B;  1HFG A;  3OMG A;  3LWU A;  5M5X H;  1SE2 A;  4DV5 Q;  3TRZ A;  3NUC A;  1X55 A;  1JIC A;  2PMZ E;  1DXM A;  4OO1 H;  3W1G A;  5IT9 L;  2DGY A;  2IW3 A;  4IUN A;  1JOK A;  4L8J A;  3J80 L;  3K8A A;  2M00 A;  1AZQ A;  2AUJ D;  2XTI A;  3CW2 C;  3MFY A;  1SNC A;  4B9X A;  1CUK A;  4A76 A;  3RN5 A;  4DV4 L;  2Y0S G;  3V2T A;  3HOX H;  2R7F A;  2RDG A;  4JVZ A;  1BCP F;  2Z6K C;  1MJC A;  2FJ2 A;  5HGT A;  1ASZ A;  1K83 H;  3MZ5 A;  4MTN A;  4OGQ C;  3SVM A;  4GNX C;  1H9K A;  2A68 C;  3GTL B;  1KLG D;  1XNQ L;  1TWF H;  1Z6H A;  3TP5 A;  3DEP A;  2CH4 A;  1EQR A;  5DEH A;  2ALY B;  3DWA A;  5AFW A;  1N33 L;  1BCP C;  4J1M A;  3CP0 A;  5FLM H;  1NUC A;  1L0Y B;  1G91 A;  2VUM H;  2A6E C;  3BZD B;  4IPC A;  4LF7 L;  2IT1 A;  1IW7 C;  4IOC A;  1OXS C;  2D5D A;  5CV7 A;  5M3F H;  3HOY H;  4B3R L;  2KED A;  1BOS A;  3I72 A;  2B29 A;  5M5W B;  4DAV A;  1H95 A;  5K5P A;  2OF1 A;  1PDQ A;  3FP9 A;  3PIO A;  1MD2 D;  1DD2 A;  2F3V A;  2WFW A;  4DV7 Q;  4HJ5 A;  1FNV A;  2KBN A;  1WD1 A;  1F2Z A;  1HR0 L;  1JMC A;  1SFO H;  4ZK9 B;  5CMD A;  1A8V A;  3J7A F;  1K9M C;  5BN5 A;  2A74 C;  2CWP A;  4RGM A;  5IWA L;  5BR8 Q;  2K5V A;  2K5H A;  3P75 A;  3CCJ A;  4BBS H;  1PH9 A;  4WJ4 A;  5E4W C;  1XPR A;  5M9O A;  4CBV A;  2LXK A;  5C4J B;  1EZ6 A;  4DUY L;  3GQB A;  3S1N H;  1VQ7 A;  5JJK A;  2R92 H;  4IUU A;  1G29 1;  1QOH A;  3I2Z A;  3SXH A;  3S1R B;  1O7I A;  1H9M A;  1MHW C;  1STY A;  1IBM L;  4R8I A;  2AQ3 B;  1SNP A;  3MWY W;  2FMC A;  1PHJ A;  5JEA J;  1STG A;  1X65 A;  1K3B C;  4DUY Q;  1QWY A;  1FYC A;  1STE A;  3NWS A;  1X56 A;  1WTO A;  4K5X A;  4DNI A;  1VQC A;  2VQE Q;  2NVY B;  2A68 D;  4HID A;  4L6T B;  1LTG D;  2KEN A;  4X3K A;  4JCV E;  1VQ9 A;  2ES2 A;  5FLX E;  1HHV A;  2E2J H;  5CGK A;  4C3J H;  1ILQ A;  1BBU A;  5CV6 A;  2MNA A;  5I6W A;  2WII B;  1LTR D;  1WOC A;  3OIQ A;  4GLX A;  5IE8 A;  5LMN L;  4IUT A;  4C3J B;  2O5I C;  2EE1 A;  5M3M G;  3OYY A;  3L0O A;  1Y14 B;  3PF5 A;  1E0B A;  2K5W A;  1KIX A;  1I4Q A;  4GN5 A;  1HNW L;  3NTK A;  1EEI D;  2BH2 A;  2ZM6 L;  3BVG A;  1BF4 A;  1R9T H;  4DUZ L;  1XNR Q;  3S1Q B;  3C1E A;  2EOT A;  4LF4 Q;  2UXB L;  2Z8L A;  1HNW Q;  1PRT D;  1RD9 D;  1KRS A;  1PZK D;  3PO3 G;  2NBF A;  3H0G B;  4YWK A;  4A3K G;  1HTP A;  2NN6 I;  4BBS G;  2HUG A;  4IUR A;  3FKI G;  2LKV A;  2JA7 H;  2EIF A;  4NXM Q;  2LY7 A;  2IY5 B;  2QW7 A;  3BG3 A;  3WWV A;  2PI2 E;  2A1A A;  4P73 A;  2DN8 A;  4JI2 Q;  3HOV B;  2QDB A;  5G3L F;  1YZ6 A;  3D4D A;  1RJT A;  1V43 A;  1ESR A;  2VB2 X;  4IPD A;  4PG3 A;  1XPU A;  2F0T A;  1ENC A;  4X66 Q;  1E3P A;  4K0K L;  2YTV A;  1B1Z A;  2OWO A;  3A5Z B;  1E22 A;  3BVZ A;  3FPU B;  1HNX L;  3R2I A;  3HOY B;  1BVS A;  1HPC A;  3HOW H;  2K33 A;  2XSC A;  2F0N A;  1FD7 D;  2SNS A;  3PF4 A;  4OWW B;  1YJ9 A;  3S2H H;  1PLF A;  1M4V A;  1MIU A;  3BVM A;  1EY8 A;  1YHB A;  4A3M B;  4G7O C;  1B9N A;  3R93 A;  2OQ0 A;  2R61 A;  5HGQ A;  4OEM B;  1UWV A;  2L9H A;  3DHQ A;  4NMZ A;  3DLL A;  4A3C H;  3H6M A;  4HN7 A;  2OQK A;  4LUO A;  5KYL A;  2PO4 A;  4DV6 Q;  4C3I H;  2CW0 D;  1S72 A;  4GKK Q;  2XWB B;  3NWT A;  4N9T A;  2D9U A;  2EPB A;  5CBA E;  3GTK H;  1I50 H;  2F0U A;  3A55 A;  4MTK A;  1Z47 A;  1STH A;  4DV0 L;  2UUC Q;  4O1N A;  4BY1 H;  2ICE C;  3VYT A;  1EQQ A;  1PRT C;  1BDO A;  2XN9 C;  3FRP B;  4A3D B;  1GO3 E;  5EBD A;  3NE5 B;  2EJG C;  1T5E A;  1SYG A;  3M4Q A;  2DJG C;  1XNR L;  3J7Z C;  2NVT H;  2B2T C;  4IFD G;  3QB3 A;  4ZYS A;  2MO1 A;  1II3 A;  3I70 A;  4DK3 C;  1EWI A;  2PZU A;  3TQY A;  3NTH A;  2DY8 A;  2L15 A;  3Q8D A;  1XNQ Q;  3VR2 A;  2F0J A;  4C2M B;  2UXD Q;  5IP9 H;  4YY3 L;  1D8L A;  4PV1 C;  1M8A A;  1IKM A;  1QG7 A;  4A3G G;  2JA6 G;  4QIW B;  4HIM A;  4EQ5 A;  3PIP A;  1Q1B A;  1WI5 A;  1D6E C;  1NBW A;  3RUZ A;  2DY7 A;  3CKI B;  3ICE A;  4GLV B;  4G4K A;  2N88 A;  3Q6S A;  4HSP A;  5JJZ A;  4X66 L;  4BA1 I;  1I4H A;  2JA7 G;  2XRQ D;  2WIN B;  1WTX A;  3J7A V;  4AQY Q;  3S9W A;  5M5Y B;  2NVQ B;  1K3R A;  5LL6 S;  1VQ5 A;  1RTO A;  2EY5 A;  2KCM A;  3AU7 A;  3DMU A;  2NUC A;  3KOJ A;  5JEA H;  1TWH H;  3AB9 A;  4HSV A;  5E7N A;  1X6O A;  4NXN L;  1JWU D;  4RMF A;  2NVX H;  3G7L A;  3NXW A;  4A3F G;  3KLR A;  1B4O A;  1VQA A;  4R9W A;  1SE4 A;  2TSS A;  1EIH A;  5KND A;  3I4N H;  1N32 Q;  1JWM D;  1SNM A;  3A7A B;  3J7A 5;  1FNU A;  5D65 A;  1ICW A;  4OL7 A;  1WTR A;  1EU4 A;  4UPA A;  3MEH A;  3L9A X;  2ZJP A;  1B3Q A;  4BY1 G;  3OMC A;  1MGS A;  2JSO A;  3J81 L;  1KDC A;  3I3C A;  3L3O C;  1Q12 A;  3VYS A;  1DM0 B;  1PH4 A;  4FVM A;  3VDY A;  4FF2 A;  3S14 H;  2IL8 A;  1C7Y A;  2F0O A;  3ERO A;  1EFI D;  1ASY A;  4QQB X;  3QIA A;  1LV9 A;  2F03 A;  3FPP A;  3G48 A;  3D6C A;  3A56 A;  1XMO Q;  1LO5 D;  3QR8 A;  4IUV A;  2RHS B;  1B2T A;  5IYD G;  3LWE A;  3KBG A;  4A3G B;  1SYF A;  4UP7 A;  2R93 G;  3NP8 A;  1PZI D;  1YI2 A;  1K83 B;  1PVO A;  5KGU A;  5C4Z A;  1HZC A;  2EYJ A;  4DN4 M;  5IP9 G;  4A3L G;  3HOX B;  3KDF A;  2RF4 A;  5C0X J;  1EY9 A;  5JPN C;  1BBX C;  1AEX A;  3PQI A;  3KF8 A;  1YNX A;  3URY A;  2B63 H;  2QGQ A;  3M7N A;  4QL5 A;  3PO3 H;  1GM5 A;  2E8G A;  2NN6 H;  2VQF L;  4A75 A;  3SEB A;  1QJO A;  1RIP A;  5LMU Q;  1VQL A;  4XYQ A;  3BZK A;  5BR8 L;  4B3S Q;  4BBR B;  1MSG A;  1PH3 A;  3NK9 A;  2Q8I B;  4KY5 A;  2VB3 X;  5EGT A;  4LFA L;  5C3X A;  3GTO H;  1DGS A;  4DPG A;  2JA9 A;  5A35 A;  4A3F B;  1QZH A;  1A3V A;  1KAB A;  3RLF A;  4AYB G;  5C4X H;  1WVL A;  4DR6 Q;  2F52 A;  5COR A;  4DK1 A;  4HJ8 A;  4DR4 L;  4M8A A;  1U0L A;  1VQO A;  2JJQ A;  4C1N K;  2WB1 B;  3BJU A;  5DLQ E;  2FMM A;  1T9H A;  1LT6 D;  1LM0 A;  3KLS A;  1D1K A;  3PO3 B;  2F0M A;  2KA7 A;  2MHV A;  1X9N A;  4OWT B;  1IL8 A;  2ZT9 C;  3MFG A;  2NTS A;  1W6J A;  4CDE C;  1X3F A;  2YYZ A;  1CKO A;  2F4V L;  4K6L A;  4LNQ A;  3RLO A;  4OX9 L;  2PNH A;  2Z6K A;  2K28 A;  2H5X A;  1GUO A;  4E6I A;  5C4X B;  2I5M X;  1I50 B;  4IFD J;  4IJL A;  5IP7 H;  1O7Y A;  2UUA L;  3OHX C;  2GN5 A;  4DR7 L;  2XRS D;  2EYO A;  2BDN A;  1PV4 A;  1VQH A;  1BXT A;  4DXF A;  4ODG A;  1LLR D;  1GOZ A;  2F0W A;  2F1M A;  3KBX A; 
#chains in the Genus database with same CATH homology
 4K5W A;  2R7Z B;  4QCL A;  1SYB A;  4RAU C;  1EQT A;  4DAP A;  1G8Z D;  4H13 C;  1L0X B;  3W3A A;  1AFP A;  2RKS A;  3GO5 A;  3I4N B;  4DXG A;  5IOD A;  2WAQ B;  1STB A;  2H4O A;  1TR5 A;  5IGG A;  1NAP A;  5FO7 B;  5J39 A;  4DF7 A;  1YNN D;  4FXG C;  4IQZ A;  1SSO A;  1TWH B;  2G9D A;  4XTC S;  2BE5 D;  3VA5 A;  1IYV A;  5F2D A;  1SNO A;  3GV3 A;  4NKL A;  1F9R A;  3F2U A;  4G7H C;  2EDG A;  5EJW A;  1XXG A;  4XQJ A;  3MXP A;  3GP7 A;  1RKN A;  4KY7 A;  1F2M A;  2K5D A;  3OW7 A;  3SK5 A;  2B2U A;  1VMC A;  1KTK A;  3P20 A;  2AQ1 B;  3T16 A;  4KHZ A;  1STA A;  2WP8 J;  2F0Q A;  4HCE A;  1G2S A;  2NVX B;  1SE3 A;  1CFM A;  1S5E D;  5EQ0 A;  4B08 A;  4IUP A;  3M4Y A;  1U4M A;  1ZEQ X;  1Y1W B;  3KLS X;  4HTH A;  1MBY A;  5EPK A;  4K8I A;  2BCO A;  5T1G A;  1ENA A;  4I7Z C;  3T4A C;  3OWE B;  1F2L A;  2JA6 B;  3TP6 A;  1DOL A;  4A3I B;  2ZXP A;  1A3T A;  4CKC A;  4LK1 C;  1CHP D;  1OXV A;  2K5Q A;  3VA7 A;  4C3J G;  3K5N A;  5M3M B;  1I6V C;  2QCP X;  1YNN C;  3N52 A;  1B50 A;  1PZJ D;  2F0V A;  4KMU C;  4HED A;  1AN8 A;  3IFD A;  4F88 A;  4U68 A;  3DWP A;  3IAY A;  3PIO 3;  4HCS A;  3HG9 A;  5I6Y A;  2E2I B;  5K36 G;  5COY A;  4BY7 B;  4OIK A;  3BDL A;  3U9S A;  1GUS A;  3EFX D;  1GUG A;  1G6Z A;  3N6R A;  2HQE A;  4BY1 B;  2MGS A;  3K7A B;  3TSS A;  1XWE A;  4QUF A;  4BS9 A;  1G2T A;  2PPB C;  4KKS A;  1XTC D;  2RA4 A;  4RHR A;  2L11 A;  4Q0F A;  1EZ8 A;  4KD3 A;  1PFN A;  1V1P A;  4BWG B;  3UI2 A;  2CVR A;  4WOR A;  1SYD A;  3NBH A;  1WCM B;  3H09 A;  1IYU A;  1UEA B;  2B2V C;  2JEB I;  1HUN A;  4F87 A;  2Q8T A;  4FF1 A;  4RFB A;  1HRJ A;  2F0E A;  1KLU D;  5IGC A;  2X6L A;  4DFA A;  2RBM A;  1O7L A;  5KRU A;  3BDO A;  1OXT A;  1B3A A;  4PMW A;  4K8J A;  1B44 D;  1EWH A;  4PNY A;  4AYB B;  4KV6 A;  1O80 A;  1TQO A;  4O42 A;  2LFN A;  4M1U B;  3VYR A;  2X6G A;  4FF3 A;  4DNT B;  1F9P A;  3HKZ B;  1A2U A;  3GTO B;  2J7Z A;  3I4M B;  3TP7 A;  5KNC A;  1V1O A;  3A8J E;  3PV0 A;  2B39 A;  1WTW A;  2EYF A;  5T1I A;  1TS3 A;  2B2U C;  1DZ1 A;  3R8B A;  2SNM A;  5IGB A;  1TWA B;  1I4X A;  1CHQ D;  4CKE A;  4PQX A;  4K6D A;  4I65 A;  1OO9 B;  3OOC A;  4Q5V A;  2XVS A;  1EYC A;  2F0L A;  1QNK A;  2NWG A;  1BNZ A;  1QCB D;  3V96 A;  4KK7 A;  2VXW A;  3PUZ A;  4HMI A;  3A7L A;  1JR0 D;  3KUP A;  4RKB A;  3Q22 A;  1K8O A;  1V1P B;  2I46 A;  2X69 A;  5FO9 B;  3K58 A;  3Q24 A;  1ILP A;  2SOB A;  1SFO B;  1D5M C;  3I8Z A;  1BCP B;  5BN3 A;  1DCZ A;  2EJM A;  1SEB D;  1TT2 A;  4C3H B;  1EL0 A;  1D5X C;  4RWS C;  3T53 B;  2K04 A;  5E4X A;  1Y8N B;  2L1B A;  4TQU S;  1RF2 D;  4ABN A;  2VUM B;  1VF5 C;  1F9Q A;  1H9S B;  1SXT A;  2NYZ D;  1XX8 A;  2J4X A;  4XQN A;  5CV5 A;  1TKW B;  3WDN A;  4DNR B;  4MIU A;  4KN4 C;  3P7J A;  4UDU C;  1I3Q B;  1ENF A;  1IHZ A;  1KNA A;  5DNF A;  2RSN A;  3HP3 A;  3TN2 A;  5ELD A;  1X32 A;  3X3N A;  2OEO A;  2QF7 A;  2F0I A;  3BDC A;  5FK9 C;  3IL8 A;  1ESF A;  4PMB A;  1Q90 A;  2WKD A;  1ZYR D;  1NSN S;  3I4L A;  1CZW A;  2PCF B;  3FDT A;  3H91 A;  5K36 H;  2RSO A;  3AMU A;  2RVL A;  3K5L A;  3H94 A;  4NW2 A;  1OXU A;  3HGB A;  2HDM A;  4FF4 A;  3K5O A;  1C4Q A;  4K5V A;  3G6J B;  1HQR D;  3FEW X;  1ZKO A;  5C5L A;  5IIF A;  3CHB D;  1D1I A;  3PUX A;  5CC4 A;  4RA8 A;  4ZAI A;  1S4Z A;  2K1B A;  1XYI A;  4X3U A;  4XT1 B;  1KAA A;  2B63 B;  4LMQ D;  4P2C B;  3S2H B;  4XIG S;  4EGV A;  2EY6 A;  2QIL A;  2E74 C;  1GHJ A;  3GTM B;  4ZRZ A;  3TBI B;  3NQT A;  1O78 A;  3CRL C;  1NCV A;  1X3P A;  2ZXR A;  2E75 C;  3C46 A;  2IX1 A;  3J80 E;  3PUV A;  2SDF A;  4X3T A;  5JEA G;  1UAP A;  2KEC A;  1Q3L A;  5IT9 E;  2EVB A;  4FNF A;  5EKL A;  4ZQ3 A;  2F0S A;  2JXM B;  1I4G A;  1AW7 A;  2B8G A;  1CA6 A;  5ELF A;  2JYO A;  2A6H D;  5CV8 A;  3HOW B;  5LL6 X;  4QF4 A;  4UAI A;  5I9P A;  3A8K E;  4GZY C;  3QOJ A;  3HEJ A;  2BDO A;  3OPO A;  4X3S A;  4DU9 A;  1D5Z C;  2AUK A;  2WAC A;  1SJH D;  4QB4 A;  1HTL D;  1HQM C;  3T56 B;  2AWN A;  3DM1 A;  4H0L C;  3ERQ A;  1FR3 A;  3A8I E;  3V05 A;  2B2Y C;  3SE0 A;  2O5J C;  2D2C C;  4EVO A;  1JOO A;  1TU2 B;  4FXK C;  4C3I B;  3QJY A;  1A15 A;  2K03 A;  3S14 B;  2L0C A;  2XIW A;  3GD7 A;  4KKT A;  2RDF A;  2V4D A;  3S1M B;  4N9P A;  3PUW A;  4ZKC B;  2F4I A;  3PIP 3;  1R4P B;  1TS4 A;  2BA1 A;  1YNJ D;  2K05 A;  1SMY D;  2PNR C;  1JC7 A;  5JAV A;  1DON A;  1E2W A;  5IGF A;  2Z1C A;  5EPJ A;  4OIJ A;  1SDF A;  4JK1 C;  5JOB A;  5FO8 B;  5IGD A;  4RCO A;  4C1N I;  2GA4 B;  1GHK A;  4CGY B;  2R6G A;  3GTK B;  3A54 A;  5BN4 A;  1E2V A;  1ONL A;  3WOF A;  1BUV T;  5ELC A;  3L7Z C;  4J6H A;  5KNB A;  5FLX L;  2K01 A;  2KHS A;  3MVV A;  5E3F A;  4YIJ A;  4J8Q A;  3TP8 A;  1JWS D;  4KD4 A;  4WFN 3;  3QWN A;  1EWC A;  2AQ2 B;  4IZ8 A;  1F77 A;  4NDX A;  4DA2 A;  1LTB D;  1LTS D;  5NUC A;  2O4X A;  5C0X G;  1W6K A;  2WV6 D;  3J7Y W;  1ET6 A;  1GJX A;  1SBB B;  3MXG A;  1TY0 A;  3DWQ A;  2OXP A;  2K32 A;  4TSS A;  5JVG 3;  5C3E B;  2Z4I A;  1TWF B;  1TS5 A;  1CM9 A;  2B2W A;  1CI3 M;  4RKL A;  3C1F A;  2EY2 A;  1RDP D;  1PTO C;  2EZV A;  3OWF A;  3OSO A;  3SHL A;  1SYE A;  1JE4 A;  3X3M A;  3Q0A A;  5J1Z A;  5ELE A;  1EQV A;  5I2Y A;  4BBS B;  3PMF A;  2F0G A;  5D3I B;  3SK4 A;  2L4N A;  2IX3 A;  1EEF D;  2PZT A;  2KCN A;  3C2P A;  3NSW A;  4RCN A;  4V0B A;  1CA5 A;  4XQQ A;  5I9O A;  1VCI A;  3NHH A;  1U4P A;  5CV4 A;  2QEJ C;  3WOE A;  2KVM A;  2JA7 B;  4XT3 B;  3MXN A;  2KQ3 A;  1DJR D;  1EYD A;  1STN A;  1NR4 A;  1QB5 D;  2YU9 B;  1D2B A;  5C5M A;  4CHT B;  1ZXT A;  2B2V A;  3M85 A;  3IKJ A;  3K5M A;  3TME A;  3ITP A;  3JAM E;  1EIG A;  1Y8P B;  1TS2 A;  3MXU A;  3EVQ A;  2QKI C;  3E5S A;  3K57 A;  3BS1 A;  1TII D;  4QMG A;  4WJW A;  1Y1V B;  5ELB A;  1C48 A;  2Y0S B;  2B8F A;  1VMP A;  3I90 A;  2KJX A;  2IJ0 A;  1TWC B;  4K2K A;  1S5C D;  4C3I G;  1I4R A;  2K6A A;  4MN3 A;  5C6A A;  3D3R A;  5C0X I;  1U4R A;  4LJZ C;  4WRD A;  1GUW A;  4K2L A;  4HMJ A;  3O13 A;  5CV9 A;  3H3V C;  4RH6 A;  3S17 B;  3T51 B;  1U9R A;  4ZUI A;  3VR3 A;  4R8N A;  1SMY C;  2A6E D;  3TZD A;  2L12 A;  4IFD H;  1U4L A;  4OHJ A;  3SR1 A;  2PW5 A;  3EJI A;  4ILW A;  4OO1 G;  5C4H A;  4G57 A;  5M3F B;  5JPM C;  1KDB A;  4KHV A;  2I07 B;  1PTO B;  4A93 B;  2PW7 A;  1HA5 A;  3GTG B;  1QNU A;  1IKL A;  3E0J A;  2MP1 A;  1AP0 A;  2B2W C;  1B53 A;  2PMZ B;  2EYM A;  2A69 D;  2M9V A;  1PMR A;  1C8C A;  4NP5 A;  2ENB A;  4S3S A;  1WTQ A;  4DAY A;  2LS0 1;  3VR6 A;  1T5X D;  4EQP A;  3R2T A;  1HCZ A;  1LT4 D;  1TVX A;  1X3Q A;  5IOC A;  2H1E A;  3W2D A;  4TRD A;  2E2D C;  4ULL A;  2EXZ A;  2HDL A;  1CZG A;  2N55 A;  3BYY B;  1DYQ A;  3CRK C;  2AWO A;  1PRT F;  2NZ1 D;  1JOQ A;  1SYC A;  1V8Q A;  2E76 C;  1FGB D;  3QOL A;  3RZD B;  1AZP A;  4F7X A;  5KEE A;  5FOB B;  2F0P A;  3DUZ A;  1DOM A;  3MHB A;  2F3W A;  5E1F A;  1JCK B;  1SJE D;  5I4D A;  2D62 A;  2ICI A;  2MJ8 A;  2DNC A;  4A3J B;  2XNA C;  2EYL A;  1HFN A;  1GUT A;  2RQX A;  1KNE A;  3NTI A;  4F8M A;  2JA8 B;  1S5F D;  2B2T A;  4IN3 A;  4Z9C B;  5JVH 3;  1PTO F;  2R93 B;  1Q8I A;  2Z4H A;  3QO2 A;  5LHY 1;  4RGO S;  5DM7 3;  1F9S A;  3M7G A;  1LAC A;  2DNE A;  2A5H A;  3T13 A;  2O2L D;  2EYH A;  5D14 A;  1ZYR C;  1LT5 D;  1FNW A;  4XXE A;  1K8M A;  4U67 3;  3DEO A;  1I4P A;  1TWG B;  4OO1 I;  2PQE A;  1BCP D;  1GUN A;  2JA5 B;  1Q1E A;  2MUY A;  3GTJ B;  4FXD A;  4FO2 A;  4EQO A;  4PMC A;  4FYD A;  1ML0 D;  2NTT A;  3PUY A;  4C3H G;  2KCC A;  2J0T D;  4CJ0 B;  1EY0 A;  1Y8O B;  3MTS A;  3ONA B;  3EQL C;  5TSS A;  4ZUJ A;  2CHB D;  2OT2 A;  3FMC A;  1RHP A;  5ISR A;  2A73 B;  1PTO H;  1CTM A;  4QUC A;  3GV6 A;  3TDQ A;  4A3E B;  1H9R A;  1JB3 A;  2CQA A;  2HCC A;  4Y7N B;  4IUQ A;  1EY7 A;  2F0K A;  2M2L A;  1F2Y A;  2FHT A;  1JQY D;  3VYU A;  1Y69 U;  1HUM A;  1VDZ A;  3D6W A;  3CQZ B;  3HS0 C;  4A3K B;  3RZO B;  1LTI D;  3NPP A;  2C9O A;  4XDX A;  3HRZ C;  4MHE A;  1O7Z A;  2E2J B;  2BOS A;  3FKI B;  1EY6 A;  5A2Q L;  2ID0 A;  3SK8 A;  1DOK A;  4G7Z C;  4K14 A;  2FIN B;  1MI2 A;  2L55 A;  3E6Z X;  4KN7 C;  1J9O A;  2R3Z A;  2K7V A;  1JOR A;  4DK0 A;  3ND9 A;  1S5B D;  2NN6 G;  2A6H C;  5EKI A;  3HOU B;  4KJO A;  5IGE A;  1ROD A;  3KK7 A;  3OIP A;  2EYP A;  1WTV A;  2R92 B;  1QIL A;  2NVT B;  5C3W A;  5A2Q E;  2IPK D;  2VNU D;  3P1H A;  4ID6 A;  3CU7 A;  2EY1 A;  3FVQ A;  3D4W A;  5J22 A;  2MPM A;  1KDA A;  3VR4 A;  2C5C A;  1PYW D;  2JE6 I;  1H9S A;  3I91 A;  3MA2 B;  1A2T A;  3S15 B;  1SND A;  4IAL A;  1LAB A;  1RTN A;  2E2H B;  1BR9 A;  5CBE E;  1UUP A;  2A69 C;  3K59 A;  4V19 0;  3HOZ B;  1I6H B;  5C44 B;  1SNQ A;  3S1N B;  3TZU A;  4H7B A;  2IWH A;  3D4R A;  4KKU A;  1CK1 A;  1H9J A;  4C56 C;  1MSH A;  4ZLT F;  4H44 C;  4RGN A;  4KJN A;  1YNJ C;  5G3L D;  4ZKB B;  1PRT B;  3DXJ C;  1OXX K;  5KYI A;  3M3Y B;  3SDZ A;  2WKC A;  1NR2 A;  3D31 A;  3S2D B;  2JEA I;  1VF7 A;  2F0H A;  2ZXO A;  5M5X B;  1EY5 A;  2PYK A;  1LTA D;  5I2X A;  1A3U A;  1LTT D;  4KY6 A;  2NB0 A;  3LNN A;  5EPL A;  1GXD C;  1R9T B;  2Q8R E;  3SK6 A;  1J8I A;  5FKA C;  1BO0 A;  1PXU A;  2KUM A;  4JBW A;  3JAM L;  3R3O A;  3MC0 B;  2PZW A;  3D8G A;  2JP1 A;  3NBI A;  4A3B B;  2FFK B;  2HCI A;  2B2Y A;  5DAU A;  4HAE A;  1EYA A;  1PFM A;  3Q23 A;  5KIX A;  3GTP B;  5C0X H;  4EQN A;  3U9O A;  1Z7T A;  1ET9 A;  4L63 B;  4TKO B;  3NQI A;  1A6X A;  3HZX A;  3QG1 A;  1R4Q B;  3PO2 B;  3C3L A;  4HR7 B;  1EY4 A;  1CQF A;  1BQQ T;  1CT1 D;  1EOT A;  3RD4 A;  4ME5 A;  4CKB A;  2KEE A;  2SEB D;  2RDH A;  2TMP A;  1PTO D;  2F0F A;  4CJ1 B;  5CYU A;  4IFD I;  1EU3 A;  2BE5 C;  3RMH A;  3EA6 A;  4DGZ A;  5EKK A;  1UNS A;  1SAP A;  5HUR A;  3ZYY X;  2BA0 A;  1QE6 A;  3LX0 A;  2KOL A;  3MAQ A;  4BA2 I;  3IFT A;  1S5D D;  2F0D A;  4LAA A;  1PFB A;  1B9M A;  3M4O B;  4KI0 A;  3I73 A;  4KTA A;  4RGT A;  2L5T A;  1WTP A;  3S16 B;  3VR5 A;  4B9W A;  3BYT B;  4RHS A;  1E2Z A;  2LMC B;  3ND8 A;  4CJ2 C;  3J81 E;  1IW7 D;  1HA6 A;  2CW0 C;  1RCV D;  5CR3 A;  1CQV A;  3K0Y A;  2EJF C;  5D3D A;  3K6O A;  1WD0 A;  1TY2 A;  2G9H D;  1HXY D;  1LT3 D;  5DM6 3;  4FP5 D;  2XWJ B;  4XYO A;  2IX0 A;  3GTQ B;  5EBC A;  1HFG A;  3OMG A;  3LWU A;  1SE2 A;  3NUC A;  1JIC A;  1DXM A;  4OO1 H;  5IT9 L;  2IW3 A;  4IUN A;  1JOK A;  4L8J A;  3J80 L;  2M00 A;  1AZQ A;  2AUJ D;  3MFY A;  1SNC A;  4B9X A;  3V2T A;  2RDG A;  1BCP F;  2FJ2 A;  5HGT A;  4OGQ C;  3MZ5 A;  3SVM A;  1H9K A;  2A68 C;  3GTL B;  1KLG D;  1Z6H A;  3TP5 A;  3DEP A;  5DEH A;  3DWA A;  5AFW A;  1BCP C;  4J1M A;  1NUC A;  1L0Y B;  1G91 A;  2A6E C;  3BZD B;  2IT1 A;  1IW7 C;  1OXS C;  2D5D A;  5CV7 A;  2KED A;  1BOS A;  3I72 A;  5M5W B;  4DAV A;  5K5P A;  2OF1 A;  1PDQ A;  1MD2 D;  1DD2 A;  2F3V A;  1FNV A;  1WD1 A;  1F2Z A;  4ZK9 B;  5CMD A;  3J7A F;  5BN5 A;  2A74 C;  4RGM A;  3P75 A;  5E4W C;  5M9O A;  4CBV A;  5C4J B;  1EZ6 A;  3GQB A;  4IUU A;  1G29 1;  1QOH A;  3SXH A;  3S1R B;  1H9M A;  1STY A;  4R8I A;  2AQ3 B;  1SNP A;  3MWY W;  2FMC A;  5JEA J;  1STG A;  1QWY A;  1FYC A;  1STE A;  3NWS A;  1WTO A;  4K5X A;  2NVY B;  2A68 D;  4L6T B;  1LTG D;  4X3K A;  5FLX E;  1HHV A;  5CGK A;  1ILQ A;  5CV6 A;  5I6W A;  2WII B;  1LTR D;  3OIQ A;  4IUT A;  4C3J B;  2O5I C;  2EE1 A;  1E0B A;  2K5W A;  1I4Q A;  3NTK A;  1EEI D;  3BVG A;  1BF4 A;  3S1Q B;  3C1E A;  2EOT A;  2Z8L A;  1PRT D;  1RD9 D;  1PZK D;  2NBF A;  3H0G B;  1HTP A;  2NN6 I;  2HUG A;  4IUR A;  2LKV A;  2LY7 A;  3BG3 A;  2DN8 A;  3HOV B;  2QDB A;  5G3L F;  3D4D A;  1RJT A;  1V43 A;  1ESR A;  2VB2 X;  2F0T A;  1ENC A;  1B1Z A;  3BVZ A;  3FPU B;  3R2I A;  3HOY B;  1HPC A;  2K33 A;  2XSC A;  2F0N A;  1FD7 D;  2SNS A;  1PLF A;  1M4V A;  3BVM A;  1EY8 A;  4A3M B;  4G7O C;  1B9N A;  3R93 A;  2R61 A;  2L9H A;  3DHQ A;  4NMZ A;  3H6M A;  4HN7 A;  5KYL A;  2PO4 A;  2CW0 D;  2XWB B;  3NWT A;  4N9T A;  2D9U A;  2EPB A;  5CBA E;  2F0U A;  3A55 A;  1Z47 A;  1STH A;  4O1N A;  2ICE C;  3VYT A;  1PRT C;  1BDO A;  2XN9 C;  3FRP B;  4A3D B;  5EBD A;  3NE5 B;  2EJG C;  1T5E A;  1SYG A;  2B2T C;  4IFD G;  3QB3 A;  4ZYS A;  1II3 A;  3I70 A;  2PZU A;  3NTH A;  2DY8 A;  3VR2 A;  2F0J A;  4C2M B;  4PV1 C;  1M8A A;  1IKM A;  1QG7 A;  4QIW B;  1Q1B A;  1D6E C;  3RUZ A;  2DY7 A;  3CKI B;  4G4K A;  2N88 A;  3Q6S A;  4HSP A;  5JJZ A;  4BA1 I;  1I4H A;  2XRQ D;  2WIN B;  1WTX A;  3J7A V;  3S9W A;  5M5Y B;  2NVQ B;  5LL6 S;  1RTO A;  2EY5 A;  3AU7 A;  3DMU A;  2NUC A;  5JEA H;  3AB9 A;  4HSV A;  1JWU D;  3G7L A;  3NXW A;  3KLR A;  1B4O A;  4R9W A;  1SE4 A;  2TSS A;  1EIH A;  5KND A;  1JWM D;  1SNM A;  3A7A B;  1FNU A;  5D65 A;  1ICW A;  4OL7 A;  1WTR A;  1EU4 A;  3MEH A;  3L9A X;  3OMC A;  1MGS A;  2JSO A;  3J81 L;  1KDC A;  3I3C A;  3L3O C;  1Q12 A;  3VYS A;  1DM0 B;  4FVM A;  4FF2 A;  2IL8 A;  2F0O A;  3ERO A;  1EFI D;  3QIA A;  1LV9 A;  2F03 A;  3FPP A;  3D6C A;  3A56 A;  1LO5 D;  4IUV A;  1B2T A;  4A3G B;  3LWE A;  3KBG A;  1SYF A;  3NP8 A;  1PZI D;  1K83 B;  5KGU A;  5C4Z A;  2EYJ A;  4DN4 M;  3HOX B;  5C0X J;  1EY9 A;  5JPN C;  1BBX C;  1AEX A;  3KF8 A;  3URY A;  3M7N A;  2NN6 H;  3SEB A;  1QJO A;  4XYQ A;  4BBR B;  1MSG A;  3NK9 A;  2Q8I B;  4KY5 A;  2VB3 X;  5EGT A;  5C3X A;  4A3F B;  5A35 A;  1A3V A;  1KAB A;  3RLF A;  1WVL A;  5COR A;  4DK1 A;  4M8A A;  4C1N K;  2WB1 B;  2FMM A;  1LT6 D;  3KLS A;  1D1K A;  3PO3 B;  2F0M A;  2KA7 A;  2MHV A;  1IL8 A;  2ZT9 C;  3MFG A;  2NTS A;  1W6J A;  2YYZ A;  4K6L A;  2K28 A;  1GUO A;  4E6I A;  5C4X B;  1I50 B;  4IFD J;  1O7Y A;  3OHX C;  2XRS D;  2EYO A;  2BDN A;  1BXT A;  4DXF A;  4ODG A;  1LLR D;  1GOZ A;  2F0W A;  2F1M A;  3KBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...