3KF8A

Crystal structure of c. tropicalis stn1-ten1 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
207
structure length
207
Chain Sequence
LYPKTKIDWGPGENHICLKTPFKNFYVIELFHQAPTFDKTIPLFISDINNSPNLYGIYNYIADHLRHVVLVNNYPVNQINIFGKIVYEQYKEKEFNGVEESYVILVISDFIGIDSKIRVRLSQEQFKEVGLTLDKKNYGKIVELEGEIYNWYDSINVSKKPDRELKVSKITVLSHRPDGLHFEFEQWKKRMEFRKNNLVEPWVFIPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stn1-Ten1 is an Rpa2-Rpa3-like complex at telomeres.
pubmed doi rcsb
source organism Candida tropicalis mya-3404
molecule tags Structural protein
molecule keywords Protein stn1
total genus 52
structure length 207
sequence length 207
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1040 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3kf8A00
3KF8A
chains in the Genus database with same CATH superfamily
5A2QL 3FKIH 4CJ2C 1K0SA 2B2WA 1STGA 2UUCQ 4JBKA 1STHA 4DV2L 1D5XC 1SE8A 4H02A 2EDGA 1B9NA 5FO8B 1IW7D 2SEBD 3SXHA 1PFSA 4YCUA 2IHEA 5BN3A 4XXEA 2X6GA 1EIFA 2PZTA 2VUMG 2MQHA 3KF6B 2F03A 4ZKCB 1AE2A 5JJIA 2D9UA 4L5QA 2KOLA 1HFNA 1MHWC 1CQFA 1QZGA 1X32A 5CYUA 3UDIA 1UE1A 4HN7A 3PV0A 4FF3A 3GP7A 1HTPA 3KYHC 1IL2A 3RZOH 4A93G 3A7AB 1SE4A 2VB3X 4OWTB 4LF8L 2SDFA 4YCWA 5EJWA 4MTKA 1HNXQ 2KCMA 3M7NA 4BA1I 1I50H 2KECA 2VQFL 1X65A 1C7YA 1EY0A 2NUCA 4LUOA 2Z6KC 2ZXOA 5E4XA 2C9OA 1UUPA 2AWNA 1P8LA 4A3MH 4A3IH 5DNFA 1TR5A 3OSOA 3M4OB 1I94L 1JOKA 2RKSA 3EQLC 3T16A 1G6ZA 1ILQA 3W1GA 2F1MA 2A69D 5CV4A 3OW2A 1LTLA 2I5MX 1W6JA 4RG1A 1K0RA 3T1HL 1QVFA 1UEAB 3K5LA 1CQVA 2R92G 5DM63 4B3SQ 4IFDJ 2PW7A 4LMQD 1TWCH 2KEEA 2N55A 1OXVA 4B08A 2AUKA 3S17B 3IRBA 2UXCQ 4IZ8A 3OTOL 2QA4A 1I4GA 3H91A 4GOPA 1CSQA 1HQRD 2F0MA 4K5WA 4KKSA 4BBSB 1V1PA 1PVOA 5IP9G 2XWJB 1BR9A 2NN6H 3J81c 1FL0A 5G3LF 5ELOA 4J1MA 1C0AA 3Q0AA 2BDNA 2L55A 3SE0A 4TSSA 1NUCA 1PTOC 4EQPA 1JB7A 2HHHL 3S24A 3URYA 4MNOA 2HUGA 3K5OA 1IBKL 3CHBD 3CCJA 2F3VA 3MFGA 1JWUD 1XNRQ 4DR2L 1TS2A 4X64L 3I4LA 3R8BA 3I91A 3MXNB 5GADC 1PH6A 3Q8DA 2E74C 2RHQB 5IP7H 2ICEC 1SE3A 4A3KB 1MGSA 3E3XA 5M3MB 3HOXB 5IYCH 4YWKA 1Q7YC 2EJMA 4RH6A 3D3RA 1Q8IA 5IWAQ 2KA7A 4YWMA 5EGTA 4DKAC 3PUYA 1JJ2A 3SK4A 3VA7A 1TXYA 1PYBA 2HQLA 4UY8C 4H44C 1NY4A 2ZJPA 2CHBD 4QCLA 5FLXc 2B2UC 3CQZH 4X3TA 3RR5A 2SNSA 2VB2X 3A0JA 4BS9A 4C3IH 4KD4A 4Q0FA 2R93G 2ZT9C 3D0FA 4UP7A 1V9PA 4DK0A 5C4XH 2CKZB 1XMQQ 3T51B 1K9MC 3KLSA 4DR4Q 2E2JH 1N9WA 1VQBA 3J81i 2OCEA 2TMPA 4A3LH 4DV1L 5CGKA 4HR7B 4CHTB 4PZ7A 4GKJL 3K8AA 3VR2A 4DK6C 5K36G 2MP1A 2NZOA 3N52A 1YJNA 4QGUA 1X55A 2EY1A 3RN5A 5IYBH 3VYSA 2L4NA 3M3YB 3F8TA 5E4WC 1PFMA 1TWFH 4DV0L 2WB1B 3CCUA 1XPOA 3NELA 1HHVA 3A55A 1L0YB 4I65A 1F2MA 2VY3A 3J7YW 3H3VC 3ERSX 3MA2B 3CPFA 3H94A 4EX5A 2G9HD 4DV4L 1GXDC 4LFBQ 4WJ4A 3STBD 4LF9Q 4M1UB 1JR0D 1S5ED 1SYEA 2RBMA 2MFIA 3NXWA 5ELEA 3NUCA 3GTMB 3NK9A 2E2JB 1A15A 1K83B 2FMMA 4BWGB 2OTLA 5C0XI 2JA6G 4OGQC 2ASBA 3J81j 1VQ9A 4PNYA 1G51A 3RNUA 2B2YA 2XSCA 4IN3A 2KVMA 1QZHA 3CCEA 2JP1A 5CV8A 1XTDA 2N88A 2IX1A 4ODGA 4RCOA 4FP5D 1DOLA 1TT2A 5JVG3 2UUBL 3K0XA 1LTAD 1E7ZA 2EY5A 4DR1Q 4YHHQ 4I7ZC 2CW0D 2UXDL 5JJKA 1FD7D 1L1OB 4KN7C 4JBWA 3DWPA 3MXUA 4X66Q 1X3PA 1N33Q 3K5NA 2N8NA 1B1ZA 1N32Q 2TSSA 4QUFA 4K5VA 3SVMA 1SNMA 4EQOA 4A3MB 1C9OA 1EZ6A 5C6AA 4C1NK 5JVH3 1H95A 5FK9C 3ONAB 2L1BA 3BYYB 4GLXA 5EBDA 4B3RQ 4BY1H 1S5BD 3I7FA 3CC7A 4FNFA 2R92H 1BBUA 5I4DA 5JJLA 4JI7L 1BUVT 4A3BB 3EA6A 4POGA 1PTOD 3K5MA 2ES2A 1VF5C 2F3IA 1NAPA 4B3ML 1X3FA 4CDDC 4BY1B 1GUSA 1PH2A 5L37A 1W6KA 1EOVA 5C44G 2EPBA 2EYLA 4L5RC 2VUMH 4JI2Q 4PMBA 5M5YB 5FO9B 1AFPA 1MSHA 1YNJC 1E22A 4IUVA 3HOYG 4K0KL 1EY7A 1YI2A 1IKLA 1Q82C 4NXNL 4F8MA 4AQYL 5M5YH 1HZAA 1F2YA 3PUZA 1SNOA 1PH8A 3TZDA 2FINB 2DY8A 4IOCA 3NWSA 2UXBL 2WFWA 5CBAE 3OWEB 3SHLA 1WD0A 1MIUA 1EL0A 2ZTCA 1Q3LA 1FR3A 4DA2A 2EIFA 1F2LA 2E2IH 3GTQH 2FMCA 2F4IA 4R4CA 4K14A 4JYAL 1S3OA 5IYCG 2EQSA 4IUTA 4JV5L 1RODA 1XJVA 1N36Q 4XTCS 3ULLA 4HCSA 4QL5A 1K8AC 2A73B 3ZYYX 1EYAA 4F88A 2VXWA 1Q86C 1JT8A 4LFCQ 5K36H 1VQDA 1TS3A 4X65Q 2NVXH 1I4PA 1UAPA 2CVRA 2BE5C 4WFN3 2LXJA 2I07B 1KNAA 1H9MA 3N6RA 1Q46A 4IPHA 5C3EH 1QE6A 1EQVA 2B39A 3AFPA 4XDXA 2R61A 5KYIA 1PH4A 4GN3B 3NTKA 5FLXL 1SJED 1HZ9A 1LACA 4NP5A 1Z47A 4BY7H 1E2ZA 1UEBA 1J8IA 3I56A 3OHXC 3RLOA 2Q2TA 2JA6H 2K03A 2ALYB 2DY7A 4A3CG 3FMCA 1TWHH 3SK6A 3GO5A 1BVSA 1TS5A 4R4IA 1SSOA 4P75A 1CSPA 2JA5H 3J80i 1YZ6A 2A5HA 2XIWA 4DF7A 1SYDA 3S2DH 5EPJA 2L11A 1KDCA 1H9RA 2A68C 1LV9A 1MSGA 4M8AA 3I4MH 1O7LA 3G4SA 3HOYB 3HKSA 1RDPD 4RKBA 2K33A 3GQBA 4XIGS 1VQ7A 4KTAA 3H15A 1HNXL 2RQXA 2CCZA 3H6MA 2OEOA 2F3WA 1C4QA 4RCNA 1BNZA 1EU3A 3RN2A 1EY8A 1S5CD 2WINB 3E0JA 1NSNS 2J4XA 1AW7A 3OWFA 1G8ZD 2IW3A 1CI3M 5C5LA 2F0UA 2NVQB 1AEXA 1CHQD 1VF7A 4DXFA 2AKWB 1YJWA 1GUGA 1YHBA 2ZXRA 1TWAH 1UE5A 3R93A 1I94Q 4GS3A 4AH6A 4HTHA 1XPUA 1WTVA 5JEAJ 4JI4L 1EY4A 1VQCA 2ENBA 1D1KA 2I46A 4G7HC 2LS01 2PQEA 2MHVA 3TMEA 1BBWA 5C4XG 1W3SA 1BCPD 4ID6A 4O0AA 4JI8Q 4A3GG 1QVGA 3SK5A 2PQAB 3CC4A 2UXCL 3VDYA 1GHJA 1YBYA 3MXPA 2N3SA 3P20A 1IHZA 4K8JA 1JQYD 2K4KA 4OELB 3KF6A 2F0OA 3RLNA 1E0BA 4DAMA 4IOAA 2C35B 4A3FH 1VMCA 2AQ1B 5IOCA 3CD6A 1RJTA 3EN2A 5KIXA 1IBLL 4ABNA 5C44H 5CC4A 2KUMA 1JCKB 4ZK9B 3T1YL 2HHHQ 5CMDA 1KRTA 3OYYA 1SN8A 4OIKA 1IBKQ 4JBMA 2PZWA 3BDLA 4AYBG 1OXTA 3Q6SA 3H3VI 2K50A 1U0LA 4OEMB 1F9PA 1SNDA 1F9SA 3D6WA 5EKKA 1Y8NB 1PA6A 3CCLA 2LFNA 1HZCA 1KDBA 4DR6Q 1WFQA 2GVBA 3NE5B 4ZLTF 1OXXK 4C3HB 2UUAL 3I72A 5C3WA 3GTJH 1KD1C 3F2BA 1D1IA 4ME5A 4A3JH 1PXUA 1VQEA 4LF6Q 1W2BA 1SROA 4HIMA 2AMCB 1EY9A 4KV6A 2R3ZA 3S14B 3ULPA 3I55A 3ICEA 2E76C 3HKZB 1XMOQ 4NMZA 3HKZG 2B2VA 4QUCA 1NR2A 3HZXA 1Q1EA 4K2LA 3DXJC 4P2CB 1WCMH 4C2MH 2RA4A 1NNXA 2QF7A 4KHPL 4CDEC 1AH9A 3S1NH 4RMFA 2B63H 4MTNA 4Y52H 1HH2P 3A8KE 5EBCA 4XT1B 2PQAA 2Z9HA 4C3HG 4DUYQ 2B8FA 2HD3A 1QJOA 2IHFA 5BR8Q 3TZUA 3Q23A 5C0XG 5I9OA 4HMIA 1Y1VG 4MIUA 4C3IB 3A8JE 4A3GB 1Y1WB 2VNUD 3K7AB 1Y1WG 4LF5Q 1TIID 2DJFC 4C3JH 2JN4A 1ZYRD 3I4OA 4GOPC 3U9OA 4DV0Q 2NVXB 2VQEQ 5HGTA 3T53B 2R7FA 3GTGB 3BZDB 4PV1C 3HRZC 4GZYC 1KLUD 3K0YA 1I6HB 3BYTB 3NBHA 2XNAC 4V190 5CV6A 1IBML 4Z9CB 1LUZA 4DV7Q 1D2BA 2XTIA 4J15A 2IJ0A 2MJ8A 3S2DB 2VZAA 3EJIA 1PDQA 1I4HA 2EOTA 1WTRA 5M5XH 4LF7Q 2AQ3B 1SMYC 4IJLA 4DR5L 1G6PA 2VQFQ 3HOYH 2RDFA 1STNA 3I4MB 5J39A 1RTOA 1KNEA 4KKUA 1KLGD 3G7LA 4BBSH 1KXLA 2B2UA 3KOJA 4JI5L 1IXRA 5AJ3L 4JBJA 1F9RA 4LWCA 4BA2I 1OXUA 3G71A 3RD4A 4X3KA 1CZWA 4LJZC 1AN8A 3D6CA 1Q8KA 5CV7A 2X69A 1F2ZA 1K8OA 5DLQE 1Z9FA 3CF5A 4DR1L 2G9DA 1ONLA 4L6TB 1LTRD 1EEFD 4ZQ3A 2UXDQ 1AZQA 3M4OH 1DJRD 3PIP3 3KBXA 3TN2A 5K5PA 2H1EA 5EQ0A 3J7AV 5FLXE 4A3KG 3G6JB 4R4OA 5IT9L 2Q2HA 5JOBA 4E6IA 3QG1A 1VS0A 4EQ5A 2SOBA 1V1OA 3WOFA 2A6HC 1STBA 3HOUB 1IKMA 1D8LA 4XYQA 2QEXA 2HCIA 1KC8C 5LMUQ 4DAYB 1AE3A 1KHIA 3F1ZA 2AWOA 3K80C 4X62Q 1XNRL 1WTOA 1K8MA 3KJOA 4KKTA 3J81E 5DEHA 4XQJA 4WRDA 1SYGA 2Q8RE 4IPDA 3BZCA 4C56C 3E9IA 4B3TL 2L12A 1XYIA 4DU9A 1B7YB 5GQOA 3HOVH 1NMFA 3HS0C 4G7OC 3TREA 3J7ZC 2H5XA 4JC0A 5IWAL 2XRSD 4HIDA 1X9NA 3KLWA 1PRTB 1O78A 1VQJA 2RCFA 1YNJD 3D4RA 3HOUH 4IUUA 1GM5A 2EE1A 2X6LA 1HZBA 3TDQA 4C1NI 4FF1A 2A6HD 4K5XA 3I8ZA 4ME3A 2GN5A 3PO2H 2B2TA 1DOKA 4NW2A 2ATWA 4JI3L 1WCMG 1TS4A 2E5LL 3V05A 4RGOS 1TQOA 1WJJA 3Q22A 2VUMB 3KUPA 3FP9A 1BXTA 3SDZA 4Q5VA 1Y8OB 1G91A 4A93H 2ICIA 3BG3A 4OWXB 2K5DA 2EY6A 1Z7TA 4DR3Q 3C2PA 1BCPC 1JE5A 2JQOA 3NENA 4KLKA 4DR4L 2IX3A 3GTJB 4YY3Q 3RMHA 1VQNA 3ITPA 4IURA 5KNCA 2J0TD 1SE2A 2A74C 2XWBB 5EAYA 4BY7B 2O4XA 3H0GB 2UUCL 2K05A 4DV2Q 5IE8A 3GV6A 4LFAQ 1EYDA 1M8AA 5LMNQ 1EIYB 4IALA 2RSOA 4GNXB 1V43A 2RDHA 1Z6HA 3S1QB 4GKKL 3CU7A 5A35A 3HOWH 4CKCA 4QQBX 1HNZL 5IP7G 4DFAA 1ILPA 3FRPB 1E24A 1N34Q 3P1HA 2K5QA 4K2KA 3K59A 3I73A 1NCVA 3BZKA 4HJAA 2PPBC 5FJ8G 3KK7A 1UNSA 1PLFA 4DR7Q 4LF9L 5FKAC 2YTVA 2LY7A 2O5IC 3VA5A 4BXXH 1DYQA 2JA8H 1Q90A 5I6YA 2HQEA 3F2CA 3X3NA 5KYLA 4BBSG 4ZAIA 1SR3A 2A6ED 2MPMA 1LTGD 1KL9A 2RHSB 3S2HB 4ZYSA 1EY6A 3HG9A 3K7AH 2OQ0A 3WDNA 4GNXC 5IIFA 2B29A 3F2DA 2JJQA 1DD2A 3GTMH 1GVPA 4J8QA 3MHBA 3PIOA 2JK8A 1VQ6A 2VL6A 1B70B 2WKCA 3S2HH 2F0VA 2R93H 5I9PA 1B44D 2E2DC 3AFQA 1WTWA 4HSPA 1RL2A 5E7NA 1LT6D 4QIWB 5ELNA 2XN9C 1VQAA 1I6HH 4L5TA 2R92B 3UDGA 2KCNA 1PTOF 2F4VQ 4G7ZC 4FXGC 2Q8TA 3M4PA 5M5WH 2CQOA 5IYBG 1NR4A 3F2UA 1M90C 1QUQB 4IUPA 2NN6I 4X3SA 1O7YA 2VW9A 1HCZA 5C4ZA 4JCVE 3ULJA 1U4MA 3J80L 2EYJA 2CWAA 2NZ1D 1S72A 3A74A 1Y1VB 4H7BA 5IP9H 1A3UA 1SJHD 4DGZA 1LYLA 2EJGC 1B3AA 3DM1A 2Y0SG 5KNDA 2Y0SB 5J22A 1VQKA 1PRTF 2FJ2A 3NWTA 1X3EA 3IAYA 1HR0W 3CCSA 3FDTA 3DHQA 2EZVA 4FXDA 3NPPA 4R4QA 1IBLQ 4OX9L 4A3KH 4R1JA 3S1RB 1JICA 4A3DH 4JI2L 4CDCC 1I3QB 1YIJA 2LXKA 3CW2C 2NVTB 1TWGB 1PYWD 1MKHA 2XRQD 3S1RH 4NXNQ 1EEID 4DV6L 4AQYQ 5IYDH 3U9SA 1F77A 1QNUA 1WCMB 4DN4M 1PHJA 2HCCA 4DR6L 3A5UA 1V1PB 4FVMA 4P73A 4A3BG 2OQKA 2MUYA 1S5DD 2JEAI 4KI0A 3K57A 1CKNA 4K6LA 1VCIA 1D7QA 3Q24A 4UDUC 5I2XA 1L1OC 1G2SA 1KAWA 4RKLA 5C0XJ 4JYAQ 1Y8PB 4Y7NB 2L5TA 3U4VA 1GD7A 1GOZA 5LHY1 3LWEA 4LF6L 2F0HA 2DN8A 5A2QE 2JYOA 2YV5A 1B8AA 1XMOL 4LFCL 1I3QH 3UE0A 4DV3L 3AQQA 1J5EL 1VQOA 4HJ7A 4K8IA 3C46A 1FJGL 5EPKA 4GLAC 4ZCKA 4IQZA 2PYKA 1PH9A 3MFYA 4H0LC 1IL8A 4KJNA 1X56A 1JJGA 1NJIC 1YEZA 4A3LG 2O5JC 1SLJA 1T5EA 1YJ9A 1YHAA 1HNWL 3CXCA 2K32A 1X3QA 1XTCD 4B9XA 1XNQL 2Z6BA 4LF4L 4DV4Q 2F0EA 5FO7B 2NVYB 1PMRA 3DLLA 4RAUC 3K58A 3C1EA 2M00A 5BN5A 2A69C 2BDOA 3I4NB 2EXDA 2F0IA 3HOUG 4H13C 4DV5L 1WTHA 1ENCA 3TP5A 4LF5L 1X3GA 2Q8IB 2I0QA 2R7ZH 2D62A 2KCCA 3GTPH 1I4XA 1PFNA 1TWCB 1G2TA 3J80c 2PMZE 1YITA 4OWWB 3OOCA 1QG7A 1EYGA 4QMGA 1E1TA 4DK3C 1R9TB 2QCPX 3FPPA 3QO2A 1OO9B 1LTSD 4DNRB 1ENAA 3P7JA 3STBC 5KGUA 3FKIB 1J9OA 5LL6X 2WAQE 5FJ8H 5COYA 2FHTA 2K5VA 2DNEA 4FO2A 5BN4A 4ZKBB 1EFWA 3CP0A 3LNNA 5M3MG 3HOXG 3CRKC 3HKZE 1PH1A 4LF8Q 4X66L 1CZGA 2DNCA 2H4OA 4A3FB 3BS1A 4A3IB 3HOWG 2KHIA 1PZJD 4OO1I 1MD2D 2IPKD 3U4ZA 5C4JB 3S15B 2LMCB 2CH4W 2F0DA 3NQTA 2Z1CA 2IY5B 5C3EG 4GNXA 3V96A 1EIGA 1QCBD 1BDOA 3QJYA 4KY6A 5M5WB 3PUWA 1U4PA 1CFMA 3RZOB 3JAME 4DR2Q 3OW7A 1LTBD 3JAMi 1BF4A 1LTID 4B3RL 1MBYA 3CCMA 4A3EH 1UE7A 4KHVA 2A8VA 2JA7B 1Q81C 4B3SL 1HUMA 2KJXA 1JC7A 3WWVA 4B3MQ 3HOVB 3PQIA 1DM0B 1S4ZA 4A3EB 5TSSA 2EXZA 2B2WC 3HFZB 2KCTA 1STYA 3CCVA 2D5DA 3T1YQ 4UHVA 3H3VH 2PZUA 3GDEA 3PCOB 4BY1G 1PZID 3HOZH 3PIO3 4KMUC 4TKOB 2Q2IA 4JVZA 3RUZA 2CWPA 3CCQA 4K0KQ 3GTOB 1RD9D 3S1MB 1TY0A 1CM9A 3I4NG 2KBNA 2XGTA 3B6YA 2OTJA 3JC66 4JI1Q 2JSOA 4OHJA 3ER0A 2MNAA 3CMEA 4AYBE 1X6OA 3AEVA 1B53A 1E2VA 3I90A 4PQXA 2EYFA 1WD1A 1L0XB 2K14A 4DNIA 2NTSA 3D4DA 4RA8A 1ZYRC 2F0SA 4TRDA 1P16A 4EGVA 2E75C 4IFDI 4JV5Q 1O7ZA 2PO4A 1VDZA 4DV1Q 1ZEQX 1RIPA 4R8IA 4GKJQ 1RF2D 1C48A 4DNTB 4X6AH 3HOZB 2QDLA 3PUVA 1B9MA 5IT9c 2NVTH 2Z6KA 2J7ZA 3MZ5A 2E5LQ 4ALPA 1GHKA 1D6EC 5IYDG 4GN4B 4LAAA 1GUOA 5IODA 5ELDA 4BBRB 5GAGC 4LK1C 1BO0A 4IPGA 1YHQA 3FKIG 1A3TA 2WKDA 4JW0A 1BQQT 2WB1E 1VQ5A 2WAQB 2UU9L 1JORA 4DAVA 1MJCA 3U58A 1HRJA 3HEJA 5D3IB 2HIXA 3LX0A 1XMQL 3M85A 1HA6A 4R4TA 2F0FA 3W1BA 4EVOA 4IFDH 1ET9A 2K75A 1XPRA 3PO3G 5LL6S 3V2TA 2PMZB 2QILA 4NB3A 3GTPB 2ZM6Q 2PW5A 1HNZQ 1A3VA 1T9HA 3IL8A 4RHRA 3PUXA 5M3FB 1EWIA 1WVLA 4A3GH 3HP3A 1NMGA 3QR8A 1HQMC 1CKOA 1TWAB 3UDXA 1X54A 4A3CH 3NBHB 1SMXA 4DR7L 1A6XA 4OL7A 3ERQA 2UUBQ 4A4IA 1B2TA 4C3JB 1SRUA 1R9TH 1KQSA 2Q2UA 5IGEA 1K83H 3KF8B 2IWHA 3DWQA 4LFBL 3S16H 4LNQA 2F52A 1JJCB 3GTLB 1K3BC 4ILWA 1RTNA 1ET6A 1LO5D 3MXGA 3L2PA 1LT5D 1TWFB 1WI5A 4HSVA 3TQYA 1LTTD 4HIKA 1N33L 3MWYW 5C4JH 3BVZA 3IKJA 1E3PA 1VQLA 1L1OA 4CJ0B 4MN3A 1ML0D 4AYBB 1ZKOA 3S15H 5D14A 1BCPB 1HJPA 3MC0B 1J6QA 3VR4A 2Z4IA 5FLMH 4OO1G 4CKEA 1SDFA 3T1HQ 4WJ3M 2AHOB 4A76A 4N9PA 4OXPA 1QUQA 3IFDA 3W2DA 2EY2A 1IYUA 1I4RA 1OXSC 2P5ZX 3ZJYC 5IT9E 1KTKA 4HIOA 3GD7A 1GO3E 1LM0A 3KDFA 4CKBA 1L0WA 2CW0C 1JOOA 3KBGA 2F0KA 1RKNA 3JAMc 1O80A 3PSIA 3EFXD 1H9JA 5I2YA 1PH5A 5CORA 1U9RA 2A68D 4OIJA 2HT1A 3A8IE 1SFOB 1YVCA 1QNKA 3S1MH 3NTHA 4RGNA 1GJXA 1STAA 2NN6G 2UUAQ 1TY2A 1EWCA 5C0XH 4JI7Q 4PG3A 1Y1VH 4DAPA 3NBIA 2JA9A 1JWMD 5H1SE 1KAAA 1HR0L 2B63B 4O1NA 1YNXA 4R9WA 3KJPA 1ASYA 2ZTEA 4CGYB 5C3XA 5J3BA 2GA4B 4MZ9A 1NBWA 1XX8A 3HOZG 1D5MC 1NTGA 1U5KA 2D2CC 2CQAA 2QW7A 3O13A 4WORA 3BU2A 3GTKH 1VQGA 3VR5A 4NKLA 3E0EA 2I5HA 2B2VC 3A7LA 4JI6L 1LT4D 4A3JG 2K1BA 2IL8A 4A3JB 4A3IG 3NHHA 3HOWB 4BBRH 2WV6D 2K04A 4RGMA 4UP8A 2XVSA 4R8NA 3S1NB 2UXBQ 2Z4HA 4OONA 1SNQA 1EZ8A 5C3EB 2KHJA 1EU4A 2Z8LA 1CKMA 3OIPA 2R7DA 4QJFA 1EY5A 4DV3Q 3I4NH 2DUDA 1Y69U 1FJGQ 3VR6A 4A93B 3H0GG 1K73C 2JXMB 1CTMA 4L63B 2WB1G 3VYTA 4JI0L 2FXQA 1MI2A 1N34L 5D3DA 1TKWB 3NEMA 4P71A 3TP8A 1SBBB 1MJEA 4FF4A 1L2FA 1PTOB 2BH8A 4UPAA 2RVLA 3HOVG 1VQ4A 2L9HA 1Y1WH 4WJWA 2R93B 4C3JG 4IJHA 2F0GA 3S1QH 4LF7L 5CR3A 4B9WA 2JA6B 1E2WA 3I3CA 2WP8J 4IFDG 5ELBA 1FGUA 4JI5Q 2NVYH 2RF4A 4KHZA 4MHEA 2L15A 2JA5B 1C8CA 3S16B 2ZXPA 5F2DA 3D8GA 4HAEA 1DOMA 3SGIA 1LABA 1D5ZC 1JMCA 2JA8B 1TU2B 5CBEE 1FYCA 4HJ8A 1STEA 5ISRA 1A63A 3K81C 3CRLC 3PF5A 2B2TC 1JOQA 4JI8L 1V8QA 3QB3A 3BVMA 2F0LA 2M2LA 4NXMQ 3PO3H 2GVAA 2YYZA 3PIPA 3L9AX 3TBIB 4KN4C 4YHHL 2F4VL 4DUZQ 1WYDA 3PF4A 3OMCA 2OWOA 3DEOA 5IY0A 4IUNA 2NZHA 4QF4A 3J81L 3FPUB 3ND8A 1S5FD 1QB5D 4TQUS 3AU7A 4JG2A 3GTOH 1II3A 1RHPA 2EYHA 5J1ZA 3OPOA 3D31A 1RCVD 3DM3A 3R2IA 5T1GA 2ZJRA 3G48A 4CDFC 4F87A 4X64Q 3M4QA 4A75A 3KLRA 4ZUIA 5T1IA 1CKNB 3P75A 3RLFA 3G6EA 2O2LD 4HEDA 1U4LA 4ZRZA 1ENFA 2YU9B 3KF8A 2AQ2B 3J7A5 2A1AA 4YCVA 4HCEA 3NP8A 3CQZB 4XYOA 2MGSA 4DXGA 3IFTA 2PI2E 3HGBA 3L0OA 3A54A 3MTSA 5IGFA 1HTLD 3TEHB 3WOEA 5C4XB 1ASZA 2HDMA 3JAML 2F0JA 3KFUA 3J80E 4CBVA 1A62A 1R4PB 3X3MA 4APVA 3S9WA 1FNVA 4BXXG 3EROA 2BE5D 5GROA 2BOSA 1UWVA 4YY3L 1DCZA 1WTXA 3M9BA 2EVBA 5BR8L 1AZPA 2IX0A 2KENA 2EYOA 4KJOA 2L0CA 3T4AC 2SNMA 4O42A 1N36L 4LFAL 5LMNL 1LLRD 1QVCA 2B3GA 4G57A 4JOIC 4N8X1 2Z0SA 4U673 1KDAA 2K7VA 1KIXA 3H0GH 1HXYD 1SMYD 2RDGA 3MEHA 5FLMG 1EIHA 1K8GA 3BVGA 2RCNA 3PGZA 3GTQB 4JK1C 1H9SB 4KHPQ 2ZTDA 5M3FH 2F0NA 4G4KA 2UU9Q 1XNQQ 4LF4Q 1NE3A 1QWYA 1PRTC 2NYZD 1TWHB 3K7UC 2G5DA 4UAIA 2WACA 1VQPA 1I4QA 1CK1A 3GTGH 4DUYL 1PYSB 1FNUA 3UDFA 1F9QA 4PMCA 1K3RA 3CCRA 3GTLH 1H9SA 3U50C 2DGYA 1VQFA 4IPCA 4RFBA 1GKHA 4BBRG 3M7GA 5HGQA 5AJ3Q 3CMAA 3RZDH 4DK1A 5GAEC 1DXMA 4ULLA 4IO9A 1JE4A 1SYFA 1ICFB 2JA8G 2MO0A 3A5ZB 3FEWX 3QOJA 1B3QA 1EQRA 2F0WA 1M4VA 4NPSA 2WIIB 1PTOH 1GUWA 4N8FA 1IBMQ 2D0PA 3TP6A 1E1OA 1T5XD 5CV5A 1PH3A 2JA7H 4ZUJA 1I5FA 2K5HA 3E5SA 3TP7A 5ELCA 3KDFB 4K6DA 3OTOQ 3FHWA 3BJUA 1EQQA 3R2TA 1WOCA 1KABA 3D4WA 3SR1A 3EBEA 3LWUA 4JPBW 1PFBA 4A3BH 4X62L 3PMFA 4RHSA 1CA6A 1N32L 4IUQA 5M5XB 4A3DG 1ESRA 1JWSD 3UE1A 3KLSX 1PV4A 4NDXA 3VYUA 1Q12A 2JEBI 2B2YC 2EJFC 4LUVA 3C3LA 3I4MG 3PO3B 1HA5A 3DUZA 2K01A 5C44B 2PI2A 3MAQA 4QY7A 3L7ZC 4V0BA 4XQNA 4PZ8A 5G3LD 4BY7G 5HURA 5JEAG 5DM73 4J6HA 4Y7NH 1K28A 3GTKB 3AMUA 2F0TA 5GAHC 2BA0A 2Y0SE 4XQQA 3QIAA 3J7AF 1FVIA 2K6AA 2MO1A 2JA5G 4QB4A 1BBXC 3A56A 1YNND 1QILA 1HPCA 4DR3L 1SNPA 5M3MH 3HOXH 4B3TQ 1VQ8A 4KK7A 4LW1A 4PZ6A 5JPNC 1B50A 1HR0Q 2OT2A 3UI2A 1DZ1A 2N49A 2VS1A 4C2MB 3W5OA 1XWEA 3TRZA 5EKIA 3TSSA 5E3FA 2HIVA 2FFKB 1J5EQ 2BCOA 5LMNW 4KD3A 3T56B 3CPWA 4PMWA 2OXPA 2ID0A 1ZXTA 1DONA 2K5NA 4C3HH 1CUKA 1G291 3MEFA 2LKVA 2BA1A 3GV3A 3CAMA 4JI3Q 2YTXA 3NTIA 3MVVA 4A3MG 3DWAA 4XT3B 3NSWA 3LGJA 1WTPA 1EYCA 3E9HA 1VQIA 1AP0A 3C1FA 3ND9A 3QWNA 1A2TA 1IYVA 2NWGA 3BDCA 2A19A 4DPGA 5AFWA 3CKIB 5C4HA 4DV5Q 5HY6A 2I5LX 2DJGC 1TVXA 1VQHA 1I6VC 5IGBA 3TS2A 3OIQA 2ZM6L 1HUNA 1BCPF 4A3FG 3EVQA 1Y14B 2QGQA 5DAUA 5D65A 1PH7A 1SYCA 1YNNC 2B8GA 1WTQA 2LSSA 4JI0Q 4RGTA 3M3YH 5FOBB 2EYPA 4L8JA 5JPMC 4GKKQ 4F7XA 1SEBD 1UE6A 2KEDA 4O2DA 2CH4A 3AYHB 2VQEL 1EUJA 3H09A 5M3FG 3RZDB 1A2UA 1GUTA 5NUCA 2R7ZG 1M1KC 1CHPD 3FVQA 2NVQH 4UP9A 4FDBA 5M9OA 4JOIA 1KRSA 2B63G 1BOSA 1OTCA 2KHSA 3VR3A 2NB0A 4DV7L 1HFGA 2QEJC 1PRTD 3BDOA 4EQNA 4CJ1B 3DEPA 3L3OC 1SNCA 2D0OA 4C3IG 3CC2A 2JE6I 5KRUA 4DR5Q 4A3EG 1ESFA 1I50B 1VQMA 3K6OA 3SEBA 1GUNA 1IZ6A 5IGDA 2R6GA 5C5MA 3SK8A 1Q1BA 4DAYA 3I2ZA 3I70A 1SAPA 2KQ3A 2PCFB 4A3DB 4JI4Q 4P72A 5CV9A 2A6EC 2C5CA 1TWGH 4N9TA 4NXML 2NBFA 4KY5A 2PNRC 5JAVA 1QOHA 4HJ5A 3T13A 2F0PA 2PNHA 1BKBA 3VYRA 2JA7G 4FF2A 3S17H 3EIVA 4DUZL 4OX9Q 2YU9H 1EFID 3E6ZX 1V1QA 4FXKC 2M9VA 4FYDA 3NQIA 1SXTA 1A0IA 3W3AA 4S3SA 2CFMA 5KEEA 3TS0A 2K5WA 3M4YA 2EYMA 2QKIC 5JEAH 5IGGA 4DV6Q 4QIWE 4GLVB 4L5SA 4JI1L 4HJ9A 2RSNA 4TVAB 5LMUL 3R3OA 2ZJQA 1EWHA 2V4DA 2OF1A 2F0QA 5EKLA 1LT3D 3DMUA 4RWSC 4LUZA 1DGSA 3S14H 4GN5A 1XXGA 5EPLA 1IW7C 1FNWA 2WAQG 5I6WA 4I7AA 1CT1D 2NTTA 2AUJD 4YIJA 2HDLA 1CA5A 2QDBA 5JJZA 1SFOH 5IGCA 2E2HB 3MXNA 1U4RA 1FGBD 4U68A 2E8GA 1EOTA 1A8VA 2YTYA 2E2HH 1H9KA 4JI6Q 1SYBA 1ICWA 4X3UA 4AIMA 1N8RC 4X65L 4POFA 4HMJA 4OO1H 2BH2A 3OMGA 2IT1A 1HNWQ 1B4OA 2R7ZB 4YWLA 5ELFA 1JB3A 3QOLA 2K28A 1R4QB 1PZKD 1EQTA 1O7IA 4KY7A 4GOPB 2N78A 1VMPA 2E2IB 1IYJB 5E1FA 2K52A 2V1CC 5KNBA 1S40A 3AB9A 3PO2G 4P74A 3PO2B
chains in the Genus database with same CATH topology
5A2QL 4CJ2C 2B2WA 1STGA 1STHA 1D5XC 2EDGA 1B9NA 5FO8B 1IW7D 2SEBD 3SXHA 5BN3A 4XXEA 2X6GA 2PZTA 2F03A 4ZKCB 2D9UA 2KOLA 1HFNA 1CQFA 1X32A 5CYUA 4FF3A 4HN7A 3PV0A 3GP7A 1HTPA 3A7AB 1SE4A 2VB3X 2SDFA 5EJWA 3M7NA 4BA1I 2KECA 1EY0A 2NUCA 2ZXOA 5E4XA 2C9OA 1UUPA 2AWNA 5DNFA 1TR5A 3OSOA 3M4OB 1JOKA 2RKSA 3EQLC 3T16A 1G6ZA 1ILQA 2F1MA 2A69D 5CV4A 1W6JA 1UEAB 3K5LA 1CQVA 5DM63 4IFDJ 2PW7A 4LMQD 2KEEA 2N55A 1OXVA 4B08A 2AUKA 3S17B 4IZ8A 1I4GA 3H91A 2F0MA 1HQRD 4K5WA 4KKSA 4BBSB 1V1PA 2XWJB 1BR9A 2NN6H 5G3LF 4J1MA 3Q0AA 2BDNA 2L55A 3SE0A 4TSSA 1NUCA 1PTOC 4EQPA 3URYA 2HUGA 3K5OA 3CHBD 2F3VA 3MFGA 1JWUD 1TS2A 3I4LA 3R8BA 3I91A 2E74C 2ICEC 1SE3A 4A3KB 1MGSA 5M3MB 3HOXB 2EJMA 4RH6A 3D3RA 1Q8IA 2KA7A 5EGTA 3PUYA 3SK4A 3VA7A 4H44C 2CHBD 4QCLA 2B2UC 4X3TA 2SNSA 2VB2X 4BS9A 4KD4A 4Q0FA 2ZT9C 4DK0A 3T51B 3KLSA 2TMPA 5CGKA 4HR7B 4CHTB 3VR2A 5K36G 2MP1A 3N52A 2EY1A 3VYSA 2L4NA 3M3YB 5E4WC 1PFMA 2WB1B 1HHVA 3A55A 1L0YB 4I65A 1F2MA 3J7YW 3H3VC 3MA2B 3H94A 2G9HD 1GXDC 4M1UB 1JR0D 1S5ED 1SYEA 2RBMA 3NXWA 5ELEA 3NUCA 3GTMB 3NK9A 2E2JB 1A15A 1K83B 2FMMA 4BWGB 5C0XI 4OGQC 4PNYA 2B2YA 2XSCA 4IN3A 2KVMA 2JP1A 5CV8A 2N88A 2IX1A 4ODGA 4RCOA 4FP5D 1DOLA 1TT2A 5JVG3 1LTAD 2EY5A 4I7ZC 2CW0D 1FD7D 4KN7C 4JBWA 3DWPA 3MXUA 1X3PA 3K5NA 1B1ZA 2TSSA 4QUFA 4K5VA 3SVMA 1SNMA 4EQOA 4A3MB 1EZ6A 5C6AA 4C1NK 5JVH3 5FK9C 3ONAB 2L1BA 3BYYB 5EBDA 1S5BD 4FNFA 5I4DA 1BUVT 4A3BB 3EA6A 1PTOD 3K5MA 1VF5C 1NAPA 4BY1B 1GUSA 1W6KA 2EPBA 2EYLA 4PMBA 5M5YB 5FO9B 1AFPA 1MSHA 1YNJC 4IUVA 1EY7A 1IKLA 4F8MA 1F2YA 3PUZA 1SNOA 3TZDA 2FINB 2DY8A 3NWSA 5CBAE 3OWEB 3SHLA 1WD0A 1EL0A 1Q3LA 1FR3A 4DA2A 1F2LA 2FMCA 2F4IA 4K14A 4IUTA 1RODA 4XTCS 4HCSA 2A73B 3ZYYX 1EYAA 4F88A 2VXWA 5K36H 1TS3A 1I4PA 1UAPA 2CVRA 2BE5C 4WFN3 2I07B 1KNAA 1H9MA 3N6RA 1QE6A 1EQVA 2B39A 4XDXA 2R61A 5KYIA 3NTKA 5FLXL 1SJED 1LACA 4NP5A 1Z47A 1E2ZA 1J8IA 3OHXC 2K03A 2DY7A 3FMCA 3SK6A 3GO5A 1TS5A 1SSOA 4DF7A 2A5HA 2XIWA 1SYDA 5EPJA 2L11A 1KDCA 1H9RA 2A68C 1LV9A 1MSGA 4M8AA 3HOYB 1O7LA 1RDPD 4RKBA 2K33A 3GQBA 4XIGS 4KTAA 2RQXA 3H6MA 2OEOA 2F3WA 1C4QA 4RCNA 1BNZA 1EU3A 1EY8A 1S5CD 2WINB 3E0JA 1NSNS 2J4XA 1AW7A 3OWFA 1G8ZD 2IW3A 1CI3M 5C5LA 2F0UA 2NVQB 1AEXA 1CHQD 1VF7A 4DXFA 1GUGA 2ZXRA 3R93A 4HTHA 1WTVA 5JEAJ 1EY4A 2ENBA 1D1KA 2I46A 4G7HC 2LS01 2PQEA 2MHVA 3TMEA 1BCPD 4ID6A 3SK5A 1GHJA 3MXPA 3P20A 1IHZA 4K8JA 1JQYD 2F0OA 1E0BA 1VMCA 2AQ1B 5IOCA 1RJTA 5KIXA 4ABNA 5CC4A 2KUMA 1JCKB 4ZK9B 5CMDA 4OIKA 2PZWA 3BDLA 1OXTA 3Q6SA 1F9PA 1SNDA 1F9SA 3D6WA 5EKKA 1Y8NB 2LFNA 1KDBA 4ZLTF 3NE5B 1OXXK 4C3HB 3I72A 5C3WA 1D1IA 4ME5A 1PXUA 1EY9A 4KV6A 2R3ZA 3S14B 2E76C 3HKZB 4NMZA 2B2VA 4QUCA 1NR2A 3HZXA 1Q1EA 4K2LA 3DXJC 4P2CB 2RA4A 2QF7A 3A8KE 5EBCA 4XT1B 4C3HG 2B8FA 1QJOA 3TZUA 3Q23A 5C0XG 5I9OA 4HMIA 4MIUA 4C3IB 3A8JE 4A3GB 1Y1WB 2VNUD 3K7AB 1TIID 1ZYRD 3U9OA 2NVXB 5HGTA 3T53B 3GTGB 3BZDB 4PV1C 3HRZC 4GZYC 1KLUD 3K0YA 1I6HB 3BYTB 3NBHA 2XNAC 4V190 5CV6A 4Z9CB 1D2BA 2IJ0A 2MJ8A 3S2DB 3EJIA 1PDQA 1I4HA 2EOTA 1WTRA 2AQ3B 1SMYC 3I4MB 2RDFA 1STNA 5J39A 1RTOA 1KNEA 4KKUA 1KLGD 3G7LA 2B2UA 1F9RA 4BA2I 1OXUA 3RD4A 4X3KA 1CZWA 4LJZC 1AN8A 3D6CA 5CV7A 2X69A 1F2ZA 1K8OA 2G9DA 1ONLA 4L6TB 1LTRD 1EEFD 4ZQ3A 1AZQA 1DJRD 3PIP3 3KBXA 3TN2A 5K5PA 2H1EA 5EQ0A 3J7AV 5FLXE 3G6JB 5IT9L 5JOBA 4E6IA 3QG1A 2SOBA 1V1OA 3WOFA 2A6HC 3HOUB 1STBA 1IKMA 4XYQA 2HCIA 2AWOA 1WTOA 1K8MA 4KKTA 3J81E 5DEHA 4XQJA 4WRDA 1SYGA 2Q8RE 4C56C 2L12A 1XYIA 4DU9A 3HS0C 4G7OC 2XRSD 1PRTB 1O78A 1YNJD 3D4RA 4IUUA 2EE1A 2X6LA 3TDQA 4C1NI 4FF1A 2A6HD 4K5XA 3I8ZA 2B2TA 1DOKA 4NW2A 1TS4A 3V05A 4RGOS 1TQOA 3Q22A 2VUMB 3KUPA 1BXTA 3SDZA 4Q5VA 1Y8OB 1G91A 2ICIA 3BG3A 2K5DA 2EY6A 1Z7TA 3C2PA 1BCPC 2IX3A 3GTJB 3RMHA 3ITPA 4IURA 5KNCA 2J0TD 1SE2A 2A74C 2XWBB 4BY7B 2O4XA 3H0GB 2K05A 3GV6A 1EYDA 1M8AA 4IALA 2RSOA 1V43A 2RDHA 1Z6HA 3S1QB 3CU7A 5A35A 4CKCA 4DFAA 1ILPA 3FRPB 3P1HA 2K5QA 4K2KA 3K59A 3I73A 1NCVA 2PPBC 3KK7A 1UNSA 1PLFA 5FKAC 2LY7A 2O5IC 3VA5A 1DYQA 1Q90A 5I6YA 2HQEA 3X3NA 5KYLA 4ZAIA 2A6ED 2MPMA 1LTGD 3S2HB 4ZYSA 1EY6A 3HG9A 3WDNA 5IIFA 1DD2A 4J8QA 3MHBA 2WKCA 2F0VA 5I9PA 1B44D 2E2DC 1WTWA 4HSPA 1LT6D 4QIWB 2XN9C 2R92B 2KCNA 1PTOF 4G7ZC 4FXGC 2Q8TA 1NR4A 3F2UA 4IUPA 2NN6I 4X3SA 1O7YA 1HCZA 5C4ZA 1U4MA 3J80L 2EYJA 2NZ1D 1Y1VB 4H7BA 1A3UA 1SJHD 4DGZA 2EJGC 1B3AA 3DM1A 5KNDA 2Y0SB 5J22A 1PRTF 2FJ2A 3NWTA 3IAYA 3FDTA 3DHQA 2EZVA 4FXDA 3NPPA 3S1RB 1JICA 1I3QB 2NVTB 1TWGB 1PYWD 2XRQD 1EEID 3U9SA 1F77A 1QNUA 1WCMB 4DN4M 2HCCA 1V1PB 4FVMA 2MUYA 1S5DD 2JEAI 4KI0A 3K57A 4K6LA 1VCIA 3Q24A 4UDUC 5I2XA 1G2SA 4RKLA 5C0XJ 1Y8PB 4Y7NB 2L5TA 1GOZA 5LHY1 3LWEA 2F0HA 2DN8A 5A2QE 2JYOA 4K8IA 3C46A 5EPKA 4IQZA 2PYKA 3MFYA 4H0LC 1IL8A 4KJNA 2O5JC 1T5EA 2K32A 1X3QA 1XTCD 4B9XA 2F0EA 5FO7B 2NVYB 1PMRA 4RAUC 3K58A 3C1EA 2M00A 5BN5A 2A69C 2BDOA 3I4NB 2F0IA 4H13C 1ENCA 3TP5A 2Q8IB 2D62A 2KCCA 1I4XA 1PFNA 1TWCB 1G2TA 3OOCA 1QG7A 4QMGA 1R9TB 2QCPX 3FPPA 3QO2A 1OO9B 1LTSD 4DNRB 1ENAA 3P7JA 5KGUA 3FKIB 1J9OA 5LL6X 5COYA 2FHTA 4FO2A 2DNEA 5BN4A 4ZKBB 3LNNA 3CRKC 1CZGA 2DNCA 2H4OA 4A3FB 3BS1A 4A3IB 1PZJD 4OO1I 1MD2D 2IPKD 3S15B 5C4JB 2LMCB 2F0DA 3NQTA 2Z1CA 3V96A 1EIGA 1QCBD 1BDOA 3QJYA 4KY6A 5M5WB 3PUWA 1U4PA 1CFMA 3RZOB 3JAME 3OW7A 1LTBD 1BF4A 1LTID 1MBYA 4KHVA 2JA7B 1HUMA 2KJXA 1JC7A 3HOVB 1DM0B 1S4ZA 4A3EB 5TSSA 2EXZA 2B2WC 1STYA 2D5DA 2PZUA 1PZID 3PIO3 4KMUC 4TKOB 3RUZA 3GTOB 1RD9D 3S1MB 1TY0A 1CM9A 2JSOA 4OHJA 1B53A 1E2VA 3I90A 4PQXA 2EYFA 1WD1A 1L0XB 2NTSA 3D4DA 4RA8A 1ZYRC 2F0SA 4TRDA 4EGVA 2E75C 4IFDI 1O7ZA 2PO4A 1VDZA 1ZEQX 4R8IA 1RF2D 1C48A 4DNTB 3HOZB 3PUVA 1B9MA 2J7ZA 3MZ5A 1GHKA 1D6EC 4LAAA 1GUOA 5IODA 5ELDA 4BBRB 4LK1C 1BO0A 1A3TA 2WKDA 1BQQT 1JORA 2WAQB 4DAVA 1HRJA 3HEJA 5D3IB 3LX0A 3M85A 1HA6A 2F0FA 4EVOA 4IFDH 1ET9A 5LL6S 3V2TA 2PMZB 2QILA 3GTPB 2PW5A 1A3VA 4RHRA 3IL8A 3PUXA 5M3FB 1WVLA 3HP3A 1HQMC 1TWAB 1A6XA 4OL7A 3ERQA 1B2TA 4C3JB 5IGEA 2IWHA 3DWQA 3GTLB 4ILWA 1RTNA 1ET6A 1LO5D 3MXGA 1LT5D 1TWFB 4HSVA 1LTTD 3MWYW 3BVZA 3IKJA 4CJ0B 4MN3A 1ML0D 4AYBB 1ZKOA 5D14A 1BCPB 3MC0B 3VR4A 2Z4IA 4OO1G 4CKEA 1SDFA 4N9PA 3IFDA 3W2DA 2EY2A 1IYUA 1I4RA 1OXSC 5IT9E 1KTKA 3GD7A 4CKBA 2CW0C 1JOOA 3KBGA 2F0KA 1RKNA 1O80A 3EFXD 1H9JA 5I2YA 5CORA 1U9RA 2A68D 4OIJA 3A8IE 1SFOB 1QNKA 3NTHA 4RGNA 1GJXA 1STAA 2NN6G 1TY2A 1EWCA 5C0XH 4DAPA 3NBIA 1JWMD 1KAAA 2B63B 4O1NA 4R9WA 4CGYB 5C3XA 2GA4B 1XX8A 1D5MC 2D2CC 2CQAA 3O13A 4WORA 3VR5A 4NKLA 2B2VC 3A7LA 1LT4D 2K1BA 2IL8A 4A3JB 3HOWB 3NHHA 2WV6D 2K04A 4RGMA 2XVSA 4R8NA 3S1NB 2Z4HA 1SNQA 1EZ8A 5C3EB 1EU4A 2Z8LA 3OIPA 1EY5A 1Y69U 3VR6A 4A93B 2JXMB 1CTMA 4L63B 3VYTA 1MI2A 5D3DA 1TKWB 3TP8A 1SBBB 4FF4A 1PTOB 2RVLA 2L9HA 4WJWA 2R93B 4C3JG 2F0GA 5CR3A 4B9WA 2JA6B 1E2WA 3I3CA 2WP8J 4IFDG 5ELBA 4KHZA 4MHEA 2JA5B 1C8CA 3S16B 5F2DA 2ZXPA 3D8GA 4HAEA 1DOMA 1LABA 1D5ZC 2JA8B 1TU2B 5CBEE 1FYCA 1STEA 5ISRA 3CRLC 2B2TC 1JOQA 1V8QA 3QB3A 3BVMA 2F0LA 2M2LA 2YYZA 3L9AX 3TBIB 4KN4C 3OMCA 3DEOA 4IUNA 4QF4A 3J81L 3FPUB 3ND8A 1S5FD 1QB5D 4TQUS 3AU7A 1II3A 1RHPA 2EYHA 5J1ZA 3OPOA 3D31A 1RCVD 3R2IA 5T1GA 4F87A 3KLRA 4ZUIA 5T1IA 3P75A 3RLFA 2O2LD 4HEDA 1U4LA 4ZRZA 1ENFA 2YU9B 3KF8A 2AQ2B 4HCEA 3NP8A 3CQZB 4XYOA 2MGSA 4DXGA 3IFTA 3HGBA 3A54A 3MTSA 5IGFA 1HTLD 3WOEA 5C4XB 2HDMA 3JAML 2F0JA 3J80E 4CBVA 1R4PB 3X3MA 3S9WA 1FNVA 3EROA 2BE5D 2BOSA 1DCZA 1WTXA 2EVBA 1AZPA 2IX0A 2EYOA 4KJOA 2L0CA 3T4AC 2SNMA 4O42A 1LLRD 4G57A 4U673 1KDAA 2K7VA 1HXYD 1SMYD 2RDGA 3MEHA 1EIHA 3BVGA 3GTQB 4JK1C 1H9SB 2F0NA 4G4KA 1QWYA 1PRTC 2NYZD 1TWHB 4UAIA 2WACA 1I4QA 1CK1A 1FNUA 1F9QA 4PMCA 1H9SA 4RFBA 3M7GA 4DK1A 1DXMA 4ULLA 1JE4A 1SYFA 3FEWX 3QOJA 2F0WA 1M4VA 2WIIB 1PTOH 1GUWA 3TP6A 1T5XD 5CV5A 4ZUJA 3E5SA 3TP7A 5ELCA 4K6DA 3R2TA 3D4WA 1KABA 3SR1A 3LWUA 1PFBA 3PMFA 4RHSA 1CA6A 4IUQA 5M5XB 1ESRA 1JWSD 3KLSX 4NDXA 3VYUA 1Q12A 2JEBI 2B2YC 2EJFC 3C3LA 3PO3B 1HA5A 3DUZA 2K01A 5C44B 3MAQA 3L7ZC 4V0BA 4XQNA 5G3LD 5HURA 5JEAG 5DM73 4J6HA 3GTKB 3AMUA 2F0TA 2BA0A 4XQQA 3QIAA 3J7AF 2K6AA 4QB4A 1BBXC 3A56A 1YNND 1QILA 1HPCA 1SNPA 4KK7A 1B50A 5JPNC 2OT2A 3UI2A 1DZ1A 4C2MB 1XWEA 5EKIA 3TSSA 5E3FA 2FFKB 2BCOA 4KD3A 3T56B 4PMWA 2OXPA 2ID0A 1ZXTA 1DONA 1G291 2LKVA 2BA1A 3GV3A 3NTIA 3MVVA 3DWAA 4XT3B 3NSWA 1WTPA 1EYCA 1AP0A 3C1FA 3ND9A 3QWNA 1A2TA 1IYVA 2NWGA 3BDCA 5AFWA 3CKIB 5C4HA 1TVXA 1I6VC 5IGBA 3OIQA 1HUNA 1BCPF 3EVQA 5DAUA 5D65A 1SYCA 1YNNC 2B8GA 1WTQA 4RGTA 5FOBB 2EYPA 4L8JA 5JPMC 4F7XA 1SEBD 2KEDA 3H09A 3RZDB 1A2UA 1GUTA 5NUCA 1CHPD 3FVQA 5M9OA 1BOSA 2KHSA 3VR3A 2NB0A 1HFGA 2QEJC 1PRTD 3BDOA 4EQNA 4CJ1B 3DEPA 3L3OC 1SNCA 4C3IG 2JE6I 5KRUA 1ESFA 1I50B 3K6OA 3SEBA 1GUNA 5IGDA 2R6GA 5C5MA 3SK8A 1Q1BA 4DAYA 3I70A 1SAPA 2KQ3A 2PCFB 4A3DB 5CV9A 2A6EC 2C5CA 4N9TA 2NBFA 4KY5A 2PNRC 5JAVA 1QOHA 3T13A 2F0PA 3VYRA 4FF2A 1EFID 3E6ZX 4FXKC 2M9VA 4FYDA 3NQIA 1SXTA 3W3AA 4S3SA 5KEEA 2K5WA 3M4YA 2EYMA 2QKIC 5JEAH 5IGGA 2RSNA 3R3OA 1EWHA 2V4DA 2OF1A 2F0QA 5EKLA 1LT3D 3DMUA 4RWSC 1XXGA 5EPLA 1IW7C 1FNWA 5I6WA 1CT1D 2NTTA 2AUJD 4YIJA 2HDLA 1CA5A 5JJZA 2QDBA 5IGCA 2E2HB 3MXNA 1U4RA 1FGBD 4U68A 1EOTA 1H9KA 1SYBA 1ICWA 4X3UA 4OO1H 4HMJA 3OMGA 2IT1A 1B4OA 2R7ZB 5ELFA 1JB3A 3QOLA 2K28A 1R4QB 1EQTA 1PZKD 4KY7A 1VMPA 2E2IB 5E1FA 5KNBA 3AB9A 3PO2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KF8 A; 
#chains in the Genus database with same CATH topology
 5A2Q L;  3FKI H;  4CJ2 C;  1K0S A;  2B2W A;  1STG A;  2UUC Q;  4JBK A;  1STH A;  4DV2 L;  1D5X C;  1SE8 A;  4H02 A;  2EDG A;  1B9N A;  5FO8 B;  1IW7 D;  2SEB D;  3SXH A;  1PFS A;  4YCU A;  2IHE A;  5BN3 A;  4XXE A;  2X6G A;  1EIF A;  2PZT A;  2VUM G;  2MQH A;  3KF6 B;  2F03 A;  4ZKC B;  1AE2 A;  5JJI A;  2D9U A;  4L5Q A;  2KOL A;  1HFN A;  1MHW C;  1CQF A;  1QZG A;  1X32 A;  5CYU A;  3UDI A;  1UE1 A;  4HN7 A;  3PV0 A;  4FF3 A;  3GP7 A;  1HTP A;  3KYH C;  1IL2 A;  3RZO H;  4A93 G;  3A7A B;  1SE4 A;  2VB3 X;  4OWT B;  4LF8 L;  2SDF A;  4YCW A;  5EJW A;  4MTK A;  1HNX Q;  2KCM A;  3M7N A;  4BA1 I;  1I50 H;  2KEC A;  2VQF L;  1X65 A;  1C7Y A;  1EY0 A;  2NUC A;  4LUO A;  2Z6K C;  2ZXO A;  5E4X A;  2C9O A;  1UUP A;  2AWN A;  1P8L A;  4A3M H;  4A3I H;  5DNF A;  1TR5 A;  3OSO A;  3M4O B;  1I94 L;  1JOK A;  2RKS A;  3EQL C;  3T16 A;  1G6Z A;  1ILQ A;  3W1G A;  2F1M A;  2A69 D;  5CV4 A;  3OW2 A;  1LTL A;  2I5M X;  1W6J A;  4RG1 A;  1K0R A;  3T1H L;  1QVF A;  1UEA B;  3K5L A;  1CQV A;  2R92 G;  5DM6 3;  4B3S Q;  4IFD J;  2PW7 A;  4LMQ D;  1TWC H;  2KEE A;  2N55 A;  1OXV A;  4B08 A;  2AUK A;  3S17 B;  3IRB A;  2UXC Q;  4IZ8 A;  3OTO L;  2QA4 A;  1I4G A;  3H91 A;  4GOP A;  1CSQ A;  1HQR D;  2F0M A;  4K5W A;  4KKS A;  4BBS B;  1V1P A;  1PVO A;  5IP9 G;  2XWJ B;  1BR9 A;  2NN6 H;  3J81 c;  1FL0 A;  5G3L F;  5ELO A;  4J1M A;  1C0A A;  3Q0A A;  2BDN A;  2L55 A;  3SE0 A;  4TSS A;  1NUC A;  1PTO C;  4EQP A;  1JB7 A;  2HHH L;  3S24 A;  3URY A;  4MNO A;  2HUG A;  3K5O A;  1IBK L;  3CHB D;  3CCJ A;  2F3V A;  3MFG A;  1JWU D;  1XNR Q;  4DR2 L;  1TS2 A;  4X64 L;  3I4L A;  3R8B A;  3I91 A;  3MXN B;  5GAD C;  1PH6 A;  3Q8D A;  2E74 C;  2RHQ B;  5IP7 H;  2ICE C;  1SE3 A;  4A3K B;  1MGS A;  3E3X A;  5M3M B;  3HOX B;  5IYC H;  4YWK A;  1Q7Y C;  2EJM A;  4RH6 A;  3D3R A;  1Q8I A;  5IWA Q;  2KA7 A;  4YWM A;  5EGT A;  4DKA C;  3PUY A;  1JJ2 A;  3SK4 A;  3VA7 A;  1TXY A;  1PYB A;  2HQL A;  4UY8 C;  4H44 C;  1NY4 A;  2ZJP A;  2CHB D;  4QCL A;  5FLX c;  2B2U C;  3CQZ H;  4X3T A;  3RR5 A;  2SNS A;  2VB2 X;  3A0J A;  4BS9 A;  4C3I H;  4KD4 A;  4Q0F A;  2R93 G;  2ZT9 C;  3D0F A;  4UP7 A;  1V9P A;  4DK0 A;  5C4X H;  2CKZ B;  1XMQ Q;  3T51 B;  1K9M C;  3KLS A;  4DR4 Q;  2E2J H;  1N9W A;  1VQB A;  3J81 i;  2OCE A;  2TMP A;  4A3L H;  4DV1 L;  5CGK A;  4HR7 B;  4CHT B;  4PZ7 A;  4GKJ L;  3K8A A;  3VR2 A;  4DK6 C;  5K36 G;  2MP1 A;  2NZO A;  3N52 A;  1YJN A;  4QGU A;  1X55 A;  2EY1 A;  3RN5 A;  5IYB H;  3VYS A;  2L4N A;  3M3Y B;  3F8T A;  5E4W C;  1PFM A;  1TWF H;  4DV0 L;  2WB1 B;  3CCU A;  1XPO A;  3NEL A;  1HHV A;  3A55 A;  1L0Y B;  4I65 A;  1F2M A;  2VY3 A;  3J7Y W;  3H3V C;  3ERS X;  3MA2 B;  3CPF A;  3H94 A;  4EX5 A;  2G9H D;  4DV4 L;  1GXD C;  4LFB Q;  4WJ4 A;  3STB D;  4LF9 Q;  4M1U B;  1JR0 D;  1S5E D;  1SYE A;  2RBM A;  2MFI A;  3NXW A;  5ELE A;  3NUC A;  3GTM B;  3NK9 A;  2E2J B;  1A15 A;  1K83 B;  2FMM A;  4BWG B;  2OTL A;  5C0X I;  2JA6 G;  4OGQ C;  2ASB A;  3J81 j;  1VQ9 A;  4PNY A;  1G51 A;  3RNU A;  2B2Y A;  2XSC A;  4IN3 A;  2KVM A;  1QZH A;  3CCE A;  2JP1 A;  5CV8 A;  1XTD A;  2N88 A;  2IX1 A;  4ODG A;  4RCO A;  4FP5 D;  1DOL A;  1TT2 A;  5JVG 3;  2UUB L;  3K0X A;  1LTA D;  1E7Z A;  2EY5 A;  4DR1 Q;  4YHH Q;  4I7Z C;  2CW0 D;  2UXD L;  5JJK A;  1FD7 D;  1L1O B;  4KN7 C;  4JBW A;  3DWP A;  3MXU A;  4X66 Q;  1X3P A;  1N33 Q;  3K5N A;  2N8N A;  1B1Z A;  1N32 Q;  2TSS A;  4QUF A;  4K5V A;  3SVM A;  1SNM A;  4EQO A;  4A3M B;  1C9O A;  1EZ6 A;  5C6A A;  4C1N K;  5JVH 3;  1H95 A;  5FK9 C;  3ONA B;  2L1B A;  3BYY B;  4GLX A;  5EBD A;  4B3R Q;  4BY1 H;  1S5B D;  3I7F A;  3CC7 A;  4FNF A;  2R92 H;  1BBU A;  5I4D A;  5JJL A;  4JI7 L;  1BUV T;  4A3B B;  3EA6 A;  4POG A;  1PTO D;  3K5M A;  2ES2 A;  1VF5 C;  2F3I A;  1NAP A;  4B3M L;  1X3F A;  4CDD C;  4BY1 B;  1GUS A;  1PH2 A;  5L37 A;  1W6K A;  1EOV A;  5C44 G;  2EPB A;  2EYL A;  4L5R C;  2VUM H;  4JI2 Q;  4PMB A;  5M5Y B;  5FO9 B;  1AFP A;  1MSH A;  1YNJ C;  1E22 A;  4IUV A;  3HOY G;  4K0K L;  1EY7 A;  1YI2 A;  1IKL A;  1Q82 C;  4NXN L;  4F8M A;  4AQY L;  5M5Y H;  1HZA A;  1F2Y A;  3PUZ A;  1SNO A;  1PH8 A;  3TZD A;  2FIN B;  2DY8 A;  4IOC A;  3NWS A;  2UXB L;  2WFW A;  5CBA E;  3OWE B;  3SHL A;  1WD0 A;  1MIU A;  1EL0 A;  2ZTC A;  1Q3L A;  1FR3 A;  4DA2 A;  2EIF A;  1F2L A;  2E2I H;  3GTQ H;  2FMC A;  2F4I A;  4R4C A;  4K14 A;  4JYA L;  1S3O A;  5IYC G;  2EQS A;  4IUT A;  4JV5 L;  1ROD A;  1XJV A;  1N36 Q;  4XTC S;  3ULL A;  4HCS A;  4QL5 A;  1K8A C;  2A73 B;  3ZYY X;  1EYA A;  4F88 A;  2VXW A;  1Q86 C;  1JT8 A;  4LFC Q;  5K36 H;  1VQD A;  1TS3 A;  4X65 Q;  2NVX H;  1I4P A;  1UAP A;  2CVR A;  2BE5 C;  4WFN 3;  2LXJ A;  2I07 B;  1KNA A;  1H9M A;  3N6R A;  1Q46 A;  4IPH A;  5C3E H;  1QE6 A;  1EQV A;  2B39 A;  3AFP A;  4XDX A;  2R61 A;  5KYI A;  1PH4 A;  4GN3 B;  3NTK A;  5FLX L;  1SJE D;  1HZ9 A;  1LAC A;  4NP5 A;  1Z47 A;  4BY7 H;  1E2Z A;  1UEB A;  1J8I A;  3I56 A;  3OHX C;  3RLO A;  2Q2T A;  2JA6 H;  2K03 A;  2ALY B;  2DY7 A;  4A3C G;  3FMC A;  1TWH H;  3SK6 A;  3GO5 A;  1BVS A;  1TS5 A;  4R4I A;  1SSO A;  4P75 A;  1CSP A;  2JA5 H;  3J80 i;  1YZ6 A;  2A5H A;  2XIW A;  4DF7 A;  1SYD A;  3S2D H;  5EPJ A;  2L11 A;  1KDC A;  1H9R A;  2A68 C;  1LV9 A;  1MSG A;  4M8A A;  3I4M H;  1O7L A;  3G4S A;  3HOY B;  3HKS A;  1RDP D;  4RKB A;  2K33 A;  3GQB A;  4XIG S;  1VQ7 A;  4KTA A;  3H15 A;  1HNX L;  2RQX A;  2CCZ A;  3H6M A;  2OEO A;  2F3W A;  1C4Q A;  4RCN A;  1BNZ A;  1EU3 A;  3RN2 A;  1EY8 A;  1S5C D;  2WIN B;  3E0J A;  1NSN S;  2J4X A;  1AW7 A;  3OWF A;  1G8Z D;  2IW3 A;  1CI3 M;  5C5L A;  2F0U A;  2NVQ B;  1AEX A;  1CHQ D;  1VF7 A;  4DXF A;  2AKW B;  1YJW A;  1GUG A;  1YHB A;  2ZXR A;  1TWA H;  1UE5 A;  3R93 A;  1I94 Q;  4GS3 A;  4AH6 A;  4HTH A;  1XPU A;  1WTV A;  5JEA J;  4JI4 L;  1EY4 A;  1VQC A;  2ENB A;  1D1K A;  2I46 A;  4G7H C;  2LS0 1;  2PQE A;  2MHV A;  3TME A;  1BBW A;  5C4X G;  1W3S A;  1BCP D;  4ID6 A;  4O0A A;  4JI8 Q;  4A3G G;  1QVG A;  3SK5 A;  2PQA B;  3CC4 A;  2UXC L;  3VDY A;  1GHJ A;  1YBY A;  3MXP A;  2N3S A;  3P20 A;  1IHZ A;  4K8J A;  1JQY D;  2K4K A;  4OEL B;  3KF6 A;  2F0O A;  3RLN A;  1E0B A;  4DAM A;  4IOA A;  2C35 B;  4A3F H;  1VMC A;  2AQ1 B;  5IOC A;  3CD6 A;  1RJT A;  3EN2 A;  5KIX A;  1IBL L;  4ABN A;  5C44 H;  5CC4 A;  2KUM A;  1JCK B;  4ZK9 B;  3T1Y L;  2HHH Q;  5CMD A;  1KRT A;  3OYY A;  1SN8 A;  4OIK A;  1IBK Q;  4JBM A;  2PZW A;  3BDL A;  4AYB G;  1OXT A;  3Q6S A;  3H3V I;  2K50 A;  1U0L A;  4OEM B;  1F9P A;  1SND A;  1F9S A;  3D6W A;  5EKK A;  1Y8N B;  1PA6 A;  3CCL A;  2LFN A;  1HZC A;  1KDB A;  4DR6 Q;  1WFQ A;  2GVB A;  3NE5 B;  4ZLT F;  1OXX K;  4C3H B;  2UUA L;  3I72 A;  5C3W A;  3GTJ H;  1KD1 C;  3F2B A;  1D1I A;  4ME5 A;  4A3J H;  1PXU A;  1VQE A;  4LF6 Q;  1W2B A;  1SRO A;  4HIM A;  2AMC B;  1EY9 A;  4KV6 A;  2R3Z A;  3S14 B;  3ULP A;  3I55 A;  3ICE A;  2E76 C;  3HKZ B;  1XMO Q;  4NMZ A;  3HKZ G;  2B2V A;  4QUC A;  1NR2 A;  3HZX A;  1Q1E A;  4K2L A;  3DXJ C;  4P2C B;  1WCM H;  4C2M H;  2RA4 A;  1NNX A;  2QF7 A;  4KHP L;  4CDE C;  1AH9 A;  3S1N H;  4RMF A;  2B63 H;  4MTN A;  4Y52 H;  1HH2 P;  3A8K E;  5EBC A;  4XT1 B;  2PQA A;  2Z9H A;  4C3H G;  4DUY Q;  2B8F A;  2HD3 A;  1QJO A;  2IHF A;  5BR8 Q;  3TZU A;  3Q23 A;  5C0X G;  5I9O A;  4HMI A;  1Y1V G;  4MIU A;  4C3I B;  3A8J E;  4A3G B;  1Y1W B;  2VNU D;  3K7A B;  1Y1W G;  4LF5 Q;  1TII D;  2DJF C;  4C3J H;  2JN4 A;  1ZYR D;  3I4O A;  4GOP C;  3U9O A;  4DV0 Q;  2NVX B;  2VQE Q;  5HGT A;  3T53 B;  2R7F A;  3GTG B;  3BZD B;  4PV1 C;  3HRZ C;  4GZY C;  1KLU D;  3K0Y A;  1I6H B;  3BYT B;  3NBH A;  2XNA C;  4V19 0;  5CV6 A;  1IBM L;  4Z9C B;  1LUZ A;  4DV7 Q;  1D2B A;  2XTI A;  4J15 A;  2IJ0 A;  2MJ8 A;  3S2D B;  2VZA A;  3EJI A;  1PDQ A;  1I4H A;  2EOT A;  1WTR A;  5M5X H;  4LF7 Q;  2AQ3 B;  1SMY C;  4IJL A;  4DR5 L;  1G6P A;  2VQF Q;  3HOY H;  2RDF A;  1STN A;  3I4M B;  5J39 A;  1RTO A;  1KNE A;  4KKU A;  1KLG D;  3G7L A;  4BBS H;  1KXL A;  2B2U A;  3KOJ A;  4JI5 L;  1IXR A;  5AJ3 L;  4JBJ A;  1F9R A;  4LWC A;  4BA2 I;  1OXU A;  3G71 A;  3RD4 A;  4X3K A;  1CZW A;  4LJZ C;  1AN8 A;  3D6C A;  1Q8K A;  5CV7 A;  2X69 A;  1F2Z A;  1K8O A;  5DLQ E;  1Z9F A;  3CF5 A;  4DR1 L;  2G9D A;  1ONL A;  4L6T B;  1LTR D;  1EEF D;  4ZQ3 A;  2UXD Q;  1AZQ A;  3M4O H;  1DJR D;  3PIP 3;  3KBX A;  3TN2 A;  5K5P A;  2H1E A;  5EQ0 A;  3J7A V;  5FLX E;  4A3K G;  3G6J B;  4R4O A;  5IT9 L;  2Q2H A;  5JOB A;  4E6I A;  3QG1 A;  1VS0 A;  4EQ5 A;  2SOB A;  1V1O A;  3WOF A;  2A6H C;  1STB A;  3HOU B;  1IKM A;  1D8L A;  4XYQ A;  2QEX A;  2HCI A;  1KC8 C;  5LMU Q;  4DAY B;  1AE3 A;  1KHI A;  3F1Z A;  2AWO A;  3K80 C;  4X62 Q;  1XNR L;  1WTO A;  1K8M A;  3KJO A;  4KKT A;  3J81 E;  5DEH A;  4XQJ A;  4WRD A;  1SYG A;  2Q8R E;  4IPD A;  3BZC A;  4C56 C;  3E9I A;  4B3T L;  2L12 A;  1XYI A;  4DU9 A;  1B7Y B;  5GQO A;  3HOV H;  1NMF A;  3HS0 C;  4G7O C;  3TRE A;  3J7Z C;  2H5X A;  4JC0 A;  5IWA L;  2XRS D;  4HID A;  1X9N A;  3KLW A;  1PRT B;  1O78 A;  1VQJ A;  2RCF A;  1YNJ D;  3D4R A;  3HOU H;  4IUU A;  1GM5 A;  2EE1 A;  2X6L A;  1HZB A;  3TDQ A;  4C1N I;  4FF1 A;  2A6H D;  4K5X A;  3I8Z A;  4ME3 A;  2GN5 A;  3PO2 H;  2B2T A;  1DOK A;  4NW2 A;  2ATW A;  4JI3 L;  1WCM G;  1TS4 A;  2E5L L;  3V05 A;  4RGO S;  1TQO A;  1WJJ A;  3Q22 A;  2VUM B;  3KUP A;  3FP9 A;  1BXT A;  3SDZ A;  4Q5V A;  1Y8O B;  1G91 A;  4A93 H;  2ICI A;  3BG3 A;  4OWX B;  2K5D A;  2EY6 A;  1Z7T A;  4DR3 Q;  3C2P A;  1BCP C;  1JE5 A;  2JQO A;  3NEN A;  4KLK A;  4DR4 L;  2IX3 A;  3GTJ B;  4YY3 Q;  3RMH A;  1VQN A;  3ITP A;  4IUR A;  5KNC A;  2J0T D;  1SE2 A;  2A74 C;  2XWB B;  5EAY A;  4BY7 B;  2O4X A;  3H0G B;  2UUC L;  2K05 A;  4DV2 Q;  5IE8 A;  3GV6 A;  4LFA Q;  1EYD A;  1M8A A;  5LMN Q;  1EIY B;  4IAL A;  2RSO A;  4GNX B;  1V43 A;  2RDH A;  1Z6H A;  3S1Q B;  4GKK L;  3CU7 A;  5A35 A;  3HOW H;  4CKC A;  4QQB X;  1HNZ L;  5IP7 G;  4DFA A;  1ILP A;  3FRP B;  1E24 A;  1N34 Q;  3P1H A;  2K5Q A;  4K2K A;  3K59 A;  3I73 A;  1NCV A;  3BZK A;  4HJA A;  2PPB C;  5FJ8 G;  3KK7 A;  1UNS A;  1PLF A;  4DR7 Q;  4LF9 L;  5FKA C;  2YTV A;  2LY7 A;  2O5I C;  3VA5 A;  4BXX H;  1DYQ A;  2JA8 H;  1Q90 A;  5I6Y A;  2HQE A;  3F2C A;  3X3N A;  5KYL A;  4BBS G;  4ZAI A;  1SR3 A;  2A6E D;  2MPM A;  1LTG D;  1KL9 A;  2RHS B;  3S2H B;  4ZYS A;  1EY6 A;  3HG9 A;  3K7A H;  2OQ0 A;  3WDN A;  4GNX C;  5IIF A;  2B29 A;  3F2D A;  2JJQ A;  1DD2 A;  3GTM H;  1GVP A;  4J8Q A;  3MHB A;  3PIO A;  2JK8 A;  1VQ6 A;  2VL6 A;  1B70 B;  2WKC A;  3S2H H;  2F0V A;  2R93 H;  5I9P A;  1B44 D;  2E2D C;  3AFQ A;  1WTW A;  4HSP A;  1RL2 A;  5E7N A;  1LT6 D;  4QIW B;  5ELN A;  2XN9 C;  1VQA A;  1I6H H;  4L5T A;  2R92 B;  3UDG A;  2KCN A;  1PTO F;  2F4V Q;  4G7Z C;  4FXG C;  2Q8T A;  3M4P A;  5M5W H;  2CQO A;  5IYB G;  1NR4 A;  3F2U A;  1M90 C;  1QUQ B;  4IUP A;  2NN6 I;  4X3S A;  1O7Y A;  2VW9 A;  1HCZ A;  5C4Z A;  4JCV E;  3ULJ A;  1U4M A;  3J80 L;  2EYJ A;  2CWA A;  2NZ1 D;  1S72 A;  3A74 A;  1Y1V B;  4H7B A;  5IP9 H;  1A3U A;  1SJH D;  4DGZ A;  1LYL A;  2EJG C;  1B3A A;  3DM1 A;  2Y0S G;  5KND A;  2Y0S B;  5J22 A;  1VQK A;  1PRT F;  2FJ2 A;  3NWT A;  1X3E A;  3IAY A;  1HR0 W;  3CCS A;  3FDT A;  3DHQ A;  2EZV A;  4FXD A;  3NPP A;  4R4Q A;  1IBL Q;  4OX9 L;  4A3K H;  4R1J A;  3S1R B;  1JIC A;  4A3D H;  4JI2 L;  4CDC C;  1I3Q B;  1YIJ A;  2LXK A;  3CW2 C;  2NVT B;  1TWG B;  1PYW D;  1MKH A;  2XRQ D;  3S1R H;  4NXN Q;  1EEI D;  4DV6 L;  4AQY Q;  5IYD H;  3U9S A;  1F77 A;  1QNU A;  1WCM B;  4DN4 M;  1PHJ A;  2HCC A;  4DR6 L;  3A5U A;  1V1P B;  4FVM A;  4P73 A;  4A3B G;  2OQK A;  2MUY A;  1S5D D;  2JEA I;  4KI0 A;  3K57 A;  1CKN A;  4K6L A;  1VCI A;  1D7Q A;  3Q24 A;  4UDU C;  5I2X A;  1L1O C;  1G2S A;  1KAW A;  4RKL A;  5C0X J;  4JYA Q;  1Y8P B;  4Y7N B;  2L5T A;  3U4V A;  1GD7 A;  1GOZ A;  5LHY 1;  3LWE A;  4LF6 L;  2F0H A;  2DN8 A;  5A2Q E;  2JYO A;  2YV5 A;  1B8A A;  1XMO L;  4LFC L;  1I3Q H;  3UE0 A;  4DV3 L;  3AQQ A;  1J5E L;  1VQO A;  4HJ7 A;  4K8I A;  3C46 A;  1FJG L;  5EPK A;  4GLA C;  4ZCK A;  4IQZ A;  2PYK A;  1PH9 A;  3MFY A;  4H0L C;  1IL8 A;  4KJN A;  1X56 A;  1JJG A;  1NJI C;  1YEZ A;  4A3L G;  2O5J C;  1SLJ A;  1T5E A;  1YJ9 A;  1YHA A;  1HNW L;  3CXC A;  2K32 A;  1X3Q A;  1XTC D;  4B9X A;  1XNQ L;  2Z6B A;  4LF4 L;  4DV4 Q;  2F0E A;  5FO7 B;  2NVY B;  1PMR A;  3DLL A;  4RAU C;  3K58 A;  3C1E A;  2M00 A;  5BN5 A;  2A69 C;  2BDO A;  3I4N B;  2EXD A;  2F0I A;  3HOU G;  4H13 C;  4DV5 L;  1WTH A;  1ENC A;  3TP5 A;  4LF5 L;  1X3G A;  2Q8I B;  2I0Q A;  2R7Z H;  2D62 A;  2KCC A;  3GTP H;  1I4X A;  1PFN A;  1TWC B;  1G2T A;  3J80 c;  2PMZ E;  1YIT A;  4OWW B;  3OOC A;  1QG7 A;  1EYG A;  4QMG A;  1E1T A;  4DK3 C;  1R9T B;  2QCP X;  3FPP A;  3QO2 A;  1OO9 B;  1LTS D;  4DNR B;  1ENA A;  3P7J A;  3STB C;  5KGU A;  3FKI B;  1J9O A;  5LL6 X;  2WAQ E;  5FJ8 H;  5COY A;  2FHT A;  2K5V A;  2DNE A;  4FO2 A;  5BN4 A;  4ZKB B;  1EFW A;  3CP0 A;  3LNN A;  5M3M G;  3HOX G;  3CRK C;  3HKZ E;  1PH1 A;  4LF8 Q;  4X66 L;  1CZG A;  2DNC A;  2H4O A;  4A3F B;  3BS1 A;  4A3I B;  3HOW G;  2KHI A;  1PZJ D;  4OO1 I;  1MD2 D;  2IPK D;  3U4Z A;  5C4J B;  3S15 B;  2LMC B;  2CH4 W;  2F0D A;  3NQT A;  2Z1C A;  2IY5 B;  5C3E G;  4GNX A;  3V96 A;  1EIG A;  1QCB D;  1BDO A;  3QJY A;  4KY6 A;  5M5W B;  3PUW A;  1U4P A;  1CFM A;  3RZO B;  3JAM E;  4DR2 Q;  3OW7 A;  1LTB D;  3JAM i;  1BF4 A;  1LTI D;  4B3R L;  1MBY A;  3CCM A;  4A3E H;  1UE7 A;  4KHV A;  2A8V A;  2JA7 B;  1Q81 C;  4B3S L;  1HUM A;  2KJX A;  1JC7 A;  3WWV A;  4B3M Q;  3HOV B;  3PQI A;  1DM0 B;  1S4Z A;  4A3E B;  5TSS A;  2EXZ A;  2B2W C;  3HFZ B;  2KCT A;  1STY A;  3CCV A;  2D5D A;  3T1Y Q;  4UHV A;  3H3V H;  2PZU A;  3GDE A;  3PCO B;  4BY1 G;  1PZI D;  3HOZ H;  3PIO 3;  4KMU C;  4TKO B;  2Q2I A;  4JVZ A;  3RUZ A;  2CWP A;  3CCQ A;  4K0K Q;  3GTO B;  1RD9 D;  3S1M B;  1TY0 A;  1CM9 A;  3I4N G;  2KBN A;  2XGT A;  3B6Y A;  2OTJ A;  3JC6 6;  4JI1 Q;  2JSO A;  4OHJ A;  3ER0 A;  2MNA A;  3CME A;  4AYB E;  1X6O A;  3AEV A;  1B53 A;  1E2V A;  3I90 A;  4PQX A;  2EYF A;  1WD1 A;  1L0X B;  2K14 A;  4DNI A;  2NTS A;  3D4D A;  4RA8 A;  1ZYR C;  2F0S A;  4TRD A;  1P16 A;  4EGV A;  2E75 C;  4IFD I;  4JV5 Q;  1O7Z A;  2PO4 A;  1VDZ A;  4DV1 Q;  1ZEQ X;  1RIP A;  4R8I A;  4GKJ Q;  1RF2 D;  1C48 A;  4DNT B;  4X6A H;  3HOZ B;  2QDL A;  3PUV A;  1B9M A;  5IT9 c;  2NVT H;  2Z6K A;  2J7Z A;  3MZ5 A;  2E5L Q;  4ALP A;  1GHK A;  1D6E C;  5IYD G;  4GN4 B;  4LAA A;  1GUO A;  5IOD A;  5ELD A;  4BBR B;  5GAG C;  4LK1 C;  1BO0 A;  4IPG A;  1YHQ A;  3FKI G;  1A3T A;  2WKD A;  4JW0 A;  1BQQ T;  2WB1 E;  1VQ5 A;  2WAQ B;  2UU9 L;  1JOR A;  4DAV A;  1MJC A;  3U58 A;  1HRJ A;  3HEJ A;  5D3I B;  2HIX A;  3LX0 A;  1XMQ L;  3M85 A;  1HA6 A;  4R4T A;  2F0F A;  3W1B A;  4EVO A;  4IFD H;  1ET9 A;  2K75 A;  1XPR A;  3PO3 G;  5LL6 S;  3V2T A;  2PMZ B;  2QIL A;  4NB3 A;  3GTP B;  2ZM6 Q;  2PW5 A;  1HNZ Q;  1A3V A;  1T9H A;  3IL8 A;  4RHR A;  3PUX A;  5M3F B;  1EWI A;  1WVL A;  4A3G H;  3HP3 A;  1NMG A;  3QR8 A;  1HQM C;  1CKO A;  1TWA B;  3UDX A;  1X54 A;  4A3C H;  3NBH B;  1SMX A;  4DR7 L;  1A6X A;  4OL7 A;  3ERQ A;  2UUB Q;  4A4I A;  1B2T A;  4C3J B;  1SRU A;  1R9T H;  1KQS A;  2Q2U A;  5IGE A;  1K83 H;  3KF8 B;  2IWH A;  3DWQ A;  4LFB L;  3S16 H;  4LNQ A;  2F52 A;  1JJC B;  3GTL B;  1K3B C;  4ILW A;  1RTN A;  1ET6 A;  1LO5 D;  3MXG A;  3L2P A;  1LT5 D;  1TWF B;  1WI5 A;  4HSV A;  3TQY A;  1LTT D;  4HIK A;  1N33 L;  3MWY W;  5C4J H;  3BVZ A;  3IKJ A;  1E3P A;  1VQL A;  1L1O A;  4CJ0 B;  4MN3 A;  1ML0 D;  4AYB B;  1ZKO A;  3S15 H;  5D14 A;  1BCP B;  1HJP A;  3MC0 B;  1J6Q A;  3VR4 A;  2Z4I A;  5FLM H;  4OO1 G;  4CKE A;  1SDF A;  3T1H Q;  4WJ3 M;  2AHO B;  4A76 A;  4N9P A;  4OXP A;  1QUQ A;  3IFD A;  3W2D A;  2EY2 A;  1IYU A;  1I4R A;  1OXS C;  2P5Z X;  3ZJY C;  5IT9 E;  1KTK A;  4HIO A;  3GD7 A;  1GO3 E;  1LM0 A;  3KDF A;  4CKB A;  1L0W A;  2CW0 C;  1JOO A;  3KBG A;  2F0K A;  1RKN A;  3JAM c;  1O80 A;  3PSI A;  3EFX D;  1H9J A;  5I2Y A;  1PH5 A;  5COR A;  1U9R A;  2A68 D;  4OIJ A;  2HT1 A;  3A8I E;  1SFO B;  1YVC A;  1QNK A;  3S1M H;  3NTH A;  4RGN A;  1GJX A;  1STA A;  2NN6 G;  2UUA Q;  1TY2 A;  1EWC A;  5C0X H;  4JI7 Q;  4PG3 A;  1Y1V H;  4DAP A;  3NBI A;  2JA9 A;  1JWM D;  5H1S E;  1KAA A;  1HR0 L;  2B63 B;  4O1N A;  1YNX A;  4R9W A;  3KJP A;  1ASY A;  2ZTE A;  4CGY B;  5C3X A;  5J3B A;  2GA4 B;  4MZ9 A;  1NBW A;  1XX8 A;  3HOZ G;  1D5M C;  1NTG A;  1U5K A;  2D2C C;  2CQA A;  2QW7 A;  3O13 A;  4WOR A;  3BU2 A;  3GTK H;  1VQG A;  3VR5 A;  4NKL A;  3E0E A;  2I5H A;  2B2V C;  3A7L A;  4JI6 L;  1LT4 D;  4A3J G;  2K1B A;  2IL8 A;  4A3J B;  4A3I G;  3NHH A;  3HOW B;  4BBR H;  2WV6 D;  2K04 A;  4RGM A;  4UP8 A;  2XVS A;  4R8N A;  3S1N B;  2UXB Q;  2Z4H A;  4OON A;  1SNQ A;  1EZ8 A;  5C3E B;  2KHJ A;  1EU4 A;  2Z8L A;  1CKM A;  3OIP A;  2R7D A;  4QJF A;  1EY5 A;  4DV3 Q;  3I4N H;  2DUD A;  1Y69 U;  1FJG Q;  3VR6 A;  4A93 B;  3H0G G;  1K73 C;  2JXM B;  1CTM A;  4L63 B;  2WB1 G;  3VYT A;  4JI0 L;  2FXQ A;  1MI2 A;  1N34 L;  5D3D A;  1TKW B;  3NEM A;  4P71 A;  3TP8 A;  1SBB B;  1MJE A;  4FF4 A;  1L2F A;  1PTO B;  2BH8 A;  4UPA A;  2RVL A;  3HOV G;  1VQ4 A;  2L9H A;  1Y1W H;  4WJW A;  2R93 B;  4C3J G;  4IJH A;  2F0G A;  3S1Q H;  4LF7 L;  5CR3 A;  4B9W A;  2JA6 B;  1E2W A;  3I3C A;  2WP8 J;  4IFD G;  5ELB A;  1FGU A;  4JI5 Q;  2NVY H;  2RF4 A;  4KHZ A;  4MHE A;  2L15 A;  2JA5 B;  1C8C A;  3S16 B;  2ZXP A;  5F2D A;  3D8G A;  4HAE A;  1DOM A;  3SGI A;  1LAB A;  1D5Z C;  1JMC A;  2JA8 B;  1TU2 B;  5CBE E;  1FYC A;  4HJ8 A;  1STE A;  5ISR A;  1A63 A;  3K81 C;  3CRL C;  3PF5 A;  2B2T C;  1JOQ A;  4JI8 L;  1V8Q A;  3QB3 A;  3BVM A;  2F0L A;  2M2L A;  4NXM Q;  3PO3 H;  2GVA A;  2YYZ A;  3PIP A;  3L9A X;  3TBI B;  4KN4 C;  4YHH L;  2F4V L;  4DUZ Q;  1WYD A;  3PF4 A;  3OMC A;  2OWO A;  3DEO A;  5IY0 A;  4IUN A;  2NZH A;  4QF4 A;  3J81 L;  3FPU B;  3ND8 A;  1S5F D;  1QB5 D;  4TQU S;  3AU7 A;  4JG2 A;  3GTO H;  1II3 A;  1RHP A;  2EYH A;  5J1Z A;  3OPO A;  3D31 A;  1RCV D;  3DM3 A;  3R2I A;  5T1G A;  2ZJR A;  3G48 A;  4CDF C;  4F87 A;  4X64 Q;  3M4Q A;  4A75 A;  3KLR A;  4ZUI A;  5T1I A;  1CKN B;  3P75 A;  3RLF A;  3G6E A;  2O2L D;  4HED A;  1U4L A;  4ZRZ A;  1ENF A;  2YU9 B;  3KF8 A;  2AQ2 B;  3J7A 5;  2A1A A;  4YCV A;  4HCE A;  3NP8 A;  3CQZ B;  4XYO A;  2MGS A;  4DXG A;  3IFT A;  2PI2 E;  3HGB A;  3L0O A;  3A54 A;  3MTS A;  5IGF A;  1HTL D;  3TEH B;  3WOE A;  5C4X B;  1ASZ A;  2HDM A;  3JAM L;  2F0J A;  3KFU A;  3J80 E;  4CBV A;  1A62 A;  1R4P B;  3X3M A;  4APV A;  3S9W A;  1FNV A;  4BXX G;  3ERO A;  2BE5 D;  5GRO A;  2BOS A;  1UWV A;  4YY3 L;  1DCZ A;  1WTX A;  3M9B A;  2EVB A;  5BR8 L;  1AZP A;  2IX0 A;  2KEN A;  2EYO A;  4KJO A;  2L0C A;  3T4A C;  2SNM A;  4O42 A;  1N36 L;  4LFA L;  5LMN L;  1LLR D;  1QVC A;  2B3G A;  4G57 A;  4JOI C;  4N8X 1;  2Z0S A;  4U67 3;  1KDA A;  2K7V A;  1KIX A;  3H0G H;  1HXY D;  1SMY D;  2RDG A;  3MEH A;  5FLM G;  1EIH A;  1K8G A;  3BVG A;  2RCN A;  3PGZ A;  3GTQ B;  4JK1 C;  1H9S B;  4KHP Q;  2ZTD A;  5M3F H;  2F0N A;  4G4K A;  2UU9 Q;  1XNQ Q;  4LF4 Q;  1NE3 A;  1QWY A;  1PRT C;  2NYZ D;  1TWH B;  3K7U C;  2G5D A;  4UAI A;  2WAC A;  1VQP A;  1I4Q A;  1CK1 A;  3GTG H;  4DUY L;  1PYS B;  1FNU A;  3UDF A;  1F9Q A;  4PMC A;  1K3R A;  3CCR A;  3GTL H;  1H9S A;  3U50 C;  2DGY A;  1VQF A;  4IPC A;  4RFB A;  1GKH A;  4BBR G;  3M7G A;  5HGQ A;  5AJ3 Q;  3CMA A;  3RZD H;  4DK1 A;  5GAE C;  1DXM A;  4ULL A;  4IO9 A;  1JE4 A;  1SYF A;  1ICF B;  2JA8 G;  2MO0 A;  3A5Z B;  3FEW X;  3QOJ A;  1B3Q A;  1EQR A;  2F0W A;  1M4V A;  4NPS A;  2WII B;  1PTO H;  1GUW A;  4N8F A;  1IBM Q;  2D0P A;  3TP6 A;  1E1O A;  1T5X D;  5CV5 A;  1PH3 A;  2JA7 H;  4ZUJ A;  1I5F A;  2K5H A;  3E5S A;  3TP7 A;  5ELC A;  3KDF B;  4K6D A;  3OTO Q;  3FHW A;  3BJU A;  1EQQ A;  3R2T A;  1WOC A;  1KAB A;  3D4W A;  3SR1 A;  3EBE A;  3LWU A;  4JPB W;  1PFB A;  4A3B H;  4X62 L;  3PMF A;  4RHS A;  1CA6 A;  1N32 L;  4IUQ A;  5M5X B;  4A3D G;  1ESR A;  1JWS D;  3UE1 A;  3KLS X;  1PV4 A;  4NDX A;  3VYU A;  1Q12 A;  2JEB I;  2B2Y C;  2EJF C;  4LUV A;  3C3L A;  3I4M G;  3PO3 B;  1HA5 A;  3DUZ A;  2K01 A;  5C44 B;  2PI2 A;  3MAQ A;  4QY7 A;  3L7Z C;  4V0B A;  4XQN A;  4PZ8 A;  5G3L D;  4BY7 G;  5HUR A;  5JEA G;  5DM7 3;  4J6H A;  4Y7N H;  1K28 A;  3GTK B;  3AMU A;  2F0T A;  5GAH C;  2BA0 A;  2Y0S E;  4XQQ A;  3QIA A;  3J7A F;  1FVI A;  2K6A A;  2MO1 A;  2JA5 G;  4QB4 A;  1BBX C;  3A56 A;  1YNN D;  1QIL A;  1HPC A;  4DR3 L;  1SNP A;  5M3M H;  3HOX H;  4B3T Q;  1VQ8 A;  4KK7 A;  4LW1 A;  4PZ6 A;  5JPN C;  1B50 A;  1HR0 Q;  2OT2 A;  3UI2 A;  1DZ1 A;  2N49 A;  2VS1 A;  4C2M B;  3W5O A;  1XWE A;  3TRZ A;  5EKI A;  3TSS A;  5E3F A;  2HIV A;  2FFK B;  1J5E Q;  2BCO A;  5LMN W;  4KD3 A;  3T56 B;  3CPW A;  4PMW A;  2OXP A;  2ID0 A;  1ZXT A;  1DON A;  2K5N A;  4C3H H;  1CUK A;  1G29 1;  3MEF A;  2LKV A;  2BA1 A;  3GV3 A;  3CAM A;  4JI3 Q;  2YTX A;  3NTI A;  3MVV A;  4A3M G;  3DWA A;  4XT3 B;  3NSW A;  3LGJ A;  1WTP A;  1EYC A;  3E9H A;  1VQI A;  1AP0 A;  3C1F A;  3ND9 A;  3QWN A;  1A2T A;  1IYV A;  2NWG A;  3BDC A;  2A19 A;  4DPG A;  5AFW A;  3CKI B;  5C4H A;  4DV5 Q;  5HY6 A;  2I5L X;  2DJG C;  1TVX A;  1VQH A;  1I6V C;  5IGB A;  3TS2 A;  3OIQ A;  2ZM6 L;  1HUN A;  1BCP F;  4A3F G;  3EVQ A;  1Y14 B;  2QGQ A;  5DAU A;  5D65 A;  1PH7 A;  1SYC A;  1YNN C;  2B8G A;  1WTQ A;  2LSS A;  4JI0 Q;  4RGT A;  3M3Y H;  5FOB B;  2EYP A;  4L8J A;  5JPM C;  4GKK Q;  4F7X A;  1SEB D;  1UE6 A;  2KED A;  4O2D A;  2CH4 A;  3AYH B;  2VQE L;  1EUJ A;  3H09 A;  5M3F G;  3RZD B;  1A2U A;  1GUT A;  5NUC A;  2R7Z G;  1M1K C;  1CHP D;  3FVQ A;  2NVQ H;  4UP9 A;  4FDB A;  5M9O A;  4JOI A;  1KRS A;  2B63 G;  1BOS A;  1OTC A;  2KHS A;  3VR3 A;  2NB0 A;  4DV7 L;  1HFG A;  2QEJ C;  1PRT D;  3BDO A;  4EQN A;  4CJ1 B;  3DEP A;  3L3O C;  1SNC A;  2D0O A;  4C3I G;  3CC2 A;  2JE6 I;  5KRU A;  4DR5 Q;  4A3E G;  1ESF A;  1I50 B;  1VQM A;  3K6O A;  3SEB A;  1GUN A;  1IZ6 A;  5IGD A;  2R6G A;  5C5M A;  3SK8 A;  1Q1B A;  4DAY A;  3I2Z A;  3I70 A;  1SAP A;  2KQ3 A;  2PCF B;  4A3D B;  4JI4 Q;  4P72 A;  5CV9 A;  2A6E C;  2C5C A;  1TWG H;  4N9T A;  4NXM L;  2NBF A;  4KY5 A;  2PNR C;  5JAV A;  1QOH A;  4HJ5 A;  3T13 A;  2F0P A;  2PNH A;  1BKB A;  3VYR A;  2JA7 G;  4FF2 A;  3S17 H;  3EIV A;  4DUZ L;  4OX9 Q;  2YU9 H;  1EFI D;  3E6Z X;  1V1Q A;  4FXK C;  2M9V A;  4FYD A;  3NQI A;  1SXT A;  1A0I A;  3W3A A;  4S3S A;  2CFM A;  5KEE A;  3TS0 A;  2K5W A;  3M4Y A;  2EYM A;  2QKI C;  5JEA H;  5IGG A;  4DV6 Q;  4QIW E;  4GLV B;  4L5S A;  4JI1 L;  4HJ9 A;  2RSN A;  4TVA B;  5LMU L;  3R3O A;  2ZJQ A;  1EWH A;  2V4D A;  2OF1 A;  2F0Q A;  5EKL A;  1LT3 D;  3DMU A;  4RWS C;  4LUZ A;  1DGS A;  3S14 H;  4GN5 A;  1XXG A;  5EPL A;  1IW7 C;  1FNW A;  2WAQ G;  5I6W A;  4I7A A;  1CT1 D;  2NTT A;  2AUJ D;  4YIJ A;  2HDL A;  1CA5 A;  2QDB A;  5JJZ A;  1SFO H;  5IGC A;  2E2H B;  3MXN A;  1U4R A;  1FGB D;  4U68 A;  2E8G A;  1EOT A;  1A8V A;  2YTY A;  2E2H H;  1H9K A;  4JI6 Q;  1SYB A;  1ICW A;  4X3U A;  4AIM A;  1N8R C;  4X65 L;  4POF A;  4HMJ A;  4OO1 H;  2BH2 A;  3OMG A;  2IT1 A;  1HNW Q;  1B4O A;  2R7Z B;  4YWL A;  5ELF A;  1JB3 A;  3QOL A;  2K28 A;  1R4Q B;  1PZK D;  1EQT A;  1O7I A;  4KY7 A;  4GOP B;  2N78 A;  1VMP A;  2E2I B;  1IYJ B;  5E1F A;  2K52 A;  2V1C C;  5KNB A;  1S40 A;  3AB9 A;  3PO2 G;  4P74 A;  3PO2 B; 
#chains in the Genus database with same CATH homology
 5A2Q L;  4CJ2 C;  2B2W A;  1STG A;  1STH A;  1D5X C;  2EDG A;  1B9N A;  5FO8 B;  1IW7 D;  2SEB D;  3SXH A;  5BN3 A;  4XXE A;  2X6G A;  2PZT A;  2F03 A;  4ZKC B;  2D9U A;  2KOL A;  1HFN A;  1CQF A;  1X32 A;  5CYU A;  4FF3 A;  4HN7 A;  3PV0 A;  3GP7 A;  1HTP A;  3A7A B;  1SE4 A;  2VB3 X;  2SDF A;  5EJW A;  3M7N A;  4BA1 I;  2KEC A;  1EY0 A;  2NUC A;  2ZXO A;  5E4X A;  2C9O A;  1UUP A;  2AWN A;  5DNF A;  1TR5 A;  3OSO A;  3M4O B;  1JOK A;  2RKS A;  3EQL C;  3T16 A;  1G6Z A;  1ILQ A;  2F1M A;  2A69 D;  5CV4 A;  1W6J A;  1UEA B;  3K5L A;  1CQV A;  5DM6 3;  4IFD J;  2PW7 A;  4LMQ D;  2KEE A;  2N55 A;  1OXV A;  4B08 A;  2AUK A;  3S17 B;  4IZ8 A;  1I4G A;  3H91 A;  2F0M A;  1HQR D;  4K5W A;  4KKS A;  4BBS B;  1V1P A;  2XWJ B;  1BR9 A;  2NN6 H;  5G3L F;  4J1M A;  3Q0A A;  2BDN A;  2L55 A;  3SE0 A;  4TSS A;  1NUC A;  1PTO C;  4EQP A;  3URY A;  2HUG A;  3K5O A;  3CHB D;  2F3V A;  3MFG A;  1JWU D;  1TS2 A;  3I4L A;  3R8B A;  3I91 A;  2E74 C;  2ICE C;  1SE3 A;  4A3K B;  1MGS A;  5M3M B;  3HOX B;  2EJM A;  4RH6 A;  3D3R A;  1Q8I A;  2KA7 A;  5EGT A;  3PUY A;  3SK4 A;  3VA7 A;  4H44 C;  2CHB D;  4QCL A;  2B2U C;  4X3T A;  2SNS A;  2VB2 X;  4BS9 A;  4KD4 A;  4Q0F A;  2ZT9 C;  4DK0 A;  3T51 B;  3KLS A;  2TMP A;  5CGK A;  4HR7 B;  4CHT B;  3VR2 A;  5K36 G;  2MP1 A;  3N52 A;  2EY1 A;  3VYS A;  2L4N A;  3M3Y B;  5E4W C;  1PFM A;  2WB1 B;  1HHV A;  3A55 A;  1L0Y B;  4I65 A;  1F2M A;  3J7Y W;  3H3V C;  3MA2 B;  3H94 A;  2G9H D;  1GXD C;  4M1U B;  1JR0 D;  1S5E D;  1SYE A;  2RBM A;  3NXW A;  5ELE A;  3NUC A;  3GTM B;  3NK9 A;  2E2J B;  1A15 A;  1K83 B;  2FMM A;  4BWG B;  5C0X I;  4OGQ C;  4PNY A;  2B2Y A;  2XSC A;  4IN3 A;  2KVM A;  2JP1 A;  5CV8 A;  2N88 A;  2IX1 A;  4ODG A;  4RCO A;  4FP5 D;  1DOL A;  1TT2 A;  5JVG 3;  1LTA D;  2EY5 A;  4I7Z C;  2CW0 D;  1FD7 D;  4KN7 C;  4JBW A;  3DWP A;  3MXU A;  1X3P A;  3K5N A;  1B1Z A;  2TSS A;  4QUF A;  4K5V A;  3SVM A;  1SNM A;  4EQO A;  4A3M B;  1EZ6 A;  5C6A A;  4C1N K;  5JVH 3;  5FK9 C;  3ONA B;  2L1B A;  3BYY B;  5EBD A;  1S5B D;  4FNF A;  5I4D A;  1BUV T;  4A3B B;  3EA6 A;  1PTO D;  3K5M A;  1VF5 C;  1NAP A;  4BY1 B;  1GUS A;  1W6K A;  2EPB A;  2EYL A;  4PMB A;  5M5Y B;  5FO9 B;  1AFP A;  1MSH A;  1YNJ C;  4IUV A;  1EY7 A;  1IKL A;  4F8M A;  1F2Y A;  3PUZ A;  1SNO A;  3TZD A;  2FIN B;  2DY8 A;  3NWS A;  5CBA E;  3OWE B;  3SHL A;  1WD0 A;  1EL0 A;  1Q3L A;  1FR3 A;  4DA2 A;  1F2L A;  2FMC A;  2F4I A;  4K14 A;  4IUT A;  1ROD A;  4XTC S;  4HCS A;  2A73 B;  3ZYY X;  1EYA A;  4F88 A;  2VXW A;  5K36 H;  1TS3 A;  1I4P A;  1UAP A;  2CVR A;  2BE5 C;  4WFN 3;  2I07 B;  1KNA A;  1H9M A;  3N6R A;  1QE6 A;  1EQV A;  2B39 A;  4XDX A;  2R61 A;  5KYI A;  3NTK A;  5FLX L;  1SJE D;  1LAC A;  4NP5 A;  1Z47 A;  1E2Z A;  1J8I A;  3OHX C;  2K03 A;  2DY7 A;  3FMC A;  3SK6 A;  3GO5 A;  1TS5 A;  1SSO A;  4DF7 A;  2A5H A;  2XIW A;  1SYD A;  5EPJ A;  2L11 A;  1KDC A;  1H9R A;  2A68 C;  1LV9 A;  1MSG A;  4M8A A;  3HOY B;  1O7L A;  1RDP D;  4RKB A;  2K33 A;  3GQB A;  4XIG S;  4KTA A;  2RQX A;  3H6M A;  2OEO A;  2F3W A;  1C4Q A;  4RCN A;  1BNZ A;  1EU3 A;  1EY8 A;  1S5C D;  2WIN B;  3E0J A;  1NSN S;  2J4X A;  1AW7 A;  3OWF A;  1G8Z D;  2IW3 A;  1CI3 M;  5C5L A;  2F0U A;  2NVQ B;  1AEX A;  1CHQ D;  1VF7 A;  4DXF A;  1GUG A;  2ZXR A;  3R93 A;  4HTH A;  1WTV A;  5JEA J;  1EY4 A;  2ENB A;  1D1K A;  2I46 A;  4G7H C;  2LS0 1;  2PQE A;  2MHV A;  3TME A;  1BCP D;  4ID6 A;  3SK5 A;  1GHJ A;  3MXP A;  3P20 A;  1IHZ A;  4K8J A;  1JQY D;  2F0O A;  1E0B A;  1VMC A;  2AQ1 B;  5IOC A;  1RJT A;  5KIX A;  4ABN A;  5CC4 A;  2KUM A;  1JCK B;  4ZK9 B;  5CMD A;  4OIK A;  2PZW A;  3BDL A;  1OXT A;  3Q6S A;  1F9P A;  1SND A;  1F9S A;  3D6W A;  5EKK A;  1Y8N B;  2LFN A;  1KDB A;  4ZLT F;  3NE5 B;  1OXX K;  4C3H B;  3I72 A;  5C3W A;  1D1I A;  4ME5 A;  1PXU A;  1EY9 A;  4KV6 A;  2R3Z A;  3S14 B;  2E76 C;  3HKZ B;  4NMZ A;  2B2V A;  4QUC A;  1NR2 A;  3HZX A;  1Q1E A;  4K2L A;  3DXJ C;  4P2C B;  2RA4 A;  2QF7 A;  3A8K E;  5EBC A;  4XT1 B;  4C3H G;  2B8F A;  1QJO A;  3TZU A;  3Q23 A;  5C0X G;  5I9O A;  4HMI A;  4MIU A;  4C3I B;  3A8J E;  4A3G B;  1Y1W B;  2VNU D;  3K7A B;  1TII D;  1ZYR D;  3U9O A;  2NVX B;  5HGT A;  3T53 B;  3GTG B;  3BZD B;  4PV1 C;  3HRZ C;  4GZY C;  1KLU D;  3K0Y A;  1I6H B;  3BYT B;  3NBH A;  2XNA C;  4V19 0;  5CV6 A;  4Z9C B;  1D2B A;  2IJ0 A;  2MJ8 A;  3S2D B;  3EJI A;  1PDQ A;  1I4H A;  2EOT A;  1WTR A;  2AQ3 B;  1SMY C;  3I4M B;  2RDF A;  1STN A;  5J39 A;  1RTO A;  1KNE A;  4KKU A;  1KLG D;  3G7L A;  2B2U A;  1F9R A;  4BA2 I;  1OXU A;  3RD4 A;  4X3K A;  1CZW A;  4LJZ C;  1AN8 A;  3D6C A;  5CV7 A;  2X69 A;  1F2Z A;  1K8O A;  2G9D A;  1ONL A;  4L6T B;  1LTR D;  1EEF D;  4ZQ3 A;  1AZQ A;  1DJR D;  3PIP 3;  3KBX A;  3TN2 A;  5K5P A;  2H1E A;  5EQ0 A;  3J7A V;  5FLX E;  3G6J B;  5IT9 L;  5JOB A;  4E6I A;  3QG1 A;  2SOB A;  1V1O A;  3WOF A;  2A6H C;  3HOU B;  1STB A;  1IKM A;  4XYQ A;  2HCI A;  2AWO A;  1WTO A;  1K8M A;  4KKT A;  3J81 E;  5DEH A;  4XQJ A;  4WRD A;  1SYG A;  2Q8R E;  4C56 C;  2L12 A;  1XYI A;  4DU9 A;  3HS0 C;  4G7O C;  2XRS D;  1PRT B;  1O78 A;  1YNJ D;  3D4R A;  4IUU A;  2EE1 A;  2X6L A;  3TDQ A;  4C1N I;  4FF1 A;  2A6H D;  4K5X A;  3I8Z A;  2B2T A;  1DOK A;  4NW2 A;  1TS4 A;  3V05 A;  4RGO S;  1TQO A;  3Q22 A;  2VUM B;  3KUP A;  1BXT A;  3SDZ A;  4Q5V A;  1Y8O B;  1G91 A;  2ICI A;  3BG3 A;  2K5D A;  2EY6 A;  1Z7T A;  3C2P A;  1BCP C;  2IX3 A;  3GTJ B;  3RMH A;  3ITP A;  4IUR A;  5KNC A;  2J0T D;  1SE2 A;  2A74 C;  2XWB B;  4BY7 B;  2O4X A;  3H0G B;  2K05 A;  3GV6 A;  1EYD A;  1M8A A;  4IAL A;  2RSO A;  1V43 A;  2RDH A;  1Z6H A;  3S1Q B;  3CU7 A;  5A35 A;  4CKC A;  4DFA A;  1ILP A;  3FRP B;  3P1H A;  2K5Q A;  4K2K A;  3K59 A;  3I73 A;  1NCV A;  2PPB C;  3KK7 A;  1UNS A;  1PLF A;  5FKA C;  2LY7 A;  2O5I C;  3VA5 A;  1DYQ A;  1Q90 A;  5I6Y A;  2HQE A;  3X3N A;  5KYL A;  4ZAI A;  2A6E D;  2MPM A;  1LTG D;  3S2H B;  4ZYS A;  1EY6 A;  3HG9 A;  3WDN A;  5IIF A;  1DD2 A;  4J8Q A;  3MHB A;  2WKC A;  2F0V A;  5I9P A;  1B44 D;  2E2D C;  1WTW A;  4HSP A;  1LT6 D;  4QIW B;  2XN9 C;  2R92 B;  2KCN A;  1PTO F;  4G7Z C;  4FXG C;  2Q8T A;  1NR4 A;  3F2U A;  4IUP A;  2NN6 I;  4X3S A;  1O7Y A;  1HCZ A;  5C4Z A;  1U4M A;  3J80 L;  2EYJ A;  2NZ1 D;  1Y1V B;  4H7B A;  1A3U A;  1SJH D;  4DGZ A;  2EJG C;  1B3A A;  3DM1 A;  5KND A;  2Y0S B;  5J22 A;  1PRT F;  2FJ2 A;  3NWT A;  3IAY A;  3FDT A;  3DHQ A;  2EZV A;  4FXD A;  3NPP A;  3S1R B;  1JIC A;  1I3Q B;  2NVT B;  1TWG B;  1PYW D;  2XRQ D;  1EEI D;  3U9S A;  1F77 A;  1QNU A;  1WCM B;  4DN4 M;  2HCC A;  1V1P B;  4FVM A;  2MUY A;  1S5D D;  2JEA I;  4KI0 A;  3K57 A;  4K6L A;  1VCI A;  3Q24 A;  4UDU C;  5I2X A;  1G2S A;  4RKL A;  5C0X J;  1Y8P B;  4Y7N B;  2L5T A;  1GOZ A;  5LHY 1;  3LWE A;  2F0H A;  2DN8 A;  5A2Q E;  2JYO A;  4K8I A;  3C46 A;  5EPK A;  4IQZ A;  2PYK A;  3MFY A;  4H0L C;  1IL8 A;  4KJN A;  2O5J C;  1T5E A;  2K32 A;  1X3Q A;  1XTC D;  4B9X A;  2F0E A;  5FO7 B;  2NVY B;  1PMR A;  4RAU C;  3K58 A;  3C1E A;  2M00 A;  5BN5 A;  2A69 C;  2BDO A;  3I4N B;  2F0I A;  4H13 C;  1ENC A;  3TP5 A;  2Q8I B;  2D62 A;  2KCC A;  1I4X A;  1PFN A;  1TWC B;  1G2T A;  3OOC A;  1QG7 A;  4QMG A;  1R9T B;  2QCP X;  3FPP A;  3QO2 A;  1OO9 B;  1LTS D;  4DNR B;  1ENA A;  3P7J A;  5KGU A;  3FKI B;  1J9O A;  5LL6 X;  5COY A;  2FHT A;  4FO2 A;  2DNE A;  5BN4 A;  4ZKB B;  3LNN A;  3CRK C;  1CZG A;  2DNC A;  2H4O A;  4A3F B;  3BS1 A;  4A3I B;  1PZJ D;  4OO1 I;  1MD2 D;  2IPK D;  3S15 B;  5C4J B;  2LMC B;  2F0D A;  3NQT A;  2Z1C A;  3V96 A;  1EIG A;  1QCB D;  1BDO A;  3QJY A;  4KY6 A;  5M5W B;  3PUW A;  1U4P A;  1CFM A;  3RZO B;  3JAM E;  3OW7 A;  1LTB D;  1BF4 A;  1LTI D;  1MBY A;  4KHV A;  2JA7 B;  1HUM A;  2KJX A;  1JC7 A;  3HOV B;  1DM0 B;  1S4Z A;  4A3E B;  5TSS A;  2EXZ A;  2B2W C;  1STY A;  2D5D A;  2PZU A;  1PZI D;  3PIO 3;  4KMU C;  4TKO B;  3RUZ A;  3GTO B;  1RD9 D;  3S1M B;  1TY0 A;  1CM9 A;  2JSO A;  4OHJ A;  1B53 A;  1E2V A;  3I90 A;  4PQX A;  2EYF A;  1WD1 A;  1L0X B;  2NTS A;  3D4D A;  4RA8 A;  1ZYR C;  2F0S A;  4TRD A;  4EGV A;  2E75 C;  4IFD I;  1O7Z A;  2PO4 A;  1VDZ A;  1ZEQ X;  4R8I A;  1RF2 D;  1C48 A;  4DNT B;  3HOZ B;  3PUV A;  1B9M A;  2J7Z A;  3MZ5 A;  1GHK A;  1D6E C;  4LAA A;  1GUO A;  5IOD A;  5ELD A;  4BBR B;  4LK1 C;  1BO0 A;  1A3T A;  2WKD A;  1BQQ T;  1JOR A;  2WAQ B;  4DAV A;  1HRJ A;  3HEJ A;  5D3I B;  3LX0 A;  3M85 A;  1HA6 A;  2F0F A;  4EVO A;  4IFD H;  1ET9 A;  5LL6 S;  3V2T A;  2PMZ B;  2QIL A;  3GTP B;  2PW5 A;  1A3V A;  4RHR A;  3IL8 A;  3PUX A;  5M3F B;  1WVL A;  3HP3 A;  1HQM C;  1TWA B;  1A6X A;  4OL7 A;  3ERQ A;  1B2T A;  4C3J B;  5IGE A;  2IWH A;  3DWQ A;  3GTL B;  4ILW A;  1RTN A;  1ET6 A;  1LO5 D;  3MXG A;  1LT5 D;  1TWF B;  4HSV A;  1LTT D;  3MWY W;  3BVZ A;  3IKJ A;  4CJ0 B;  4MN3 A;  1ML0 D;  4AYB B;  1ZKO A;  5D14 A;  1BCP B;  3MC0 B;  3VR4 A;  2Z4I A;  4OO1 G;  4CKE A;  1SDF A;  4N9P A;  3IFD A;  3W2D A;  2EY2 A;  1IYU A;  1I4R A;  1OXS C;  5IT9 E;  1KTK A;  3GD7 A;  4CKB A;  2CW0 C;  1JOO A;  3KBG A;  2F0K A;  1RKN A;  1O80 A;  3EFX D;  1H9J A;  5I2Y A;  5COR A;  1U9R A;  2A68 D;  4OIJ A;  3A8I E;  1SFO B;  1QNK A;  3NTH A;  4RGN A;  1GJX A;  1STA A;  2NN6 G;  1TY2 A;  1EWC A;  5C0X H;  4DAP A;  3NBI A;  1JWM D;  1KAA A;  2B63 B;  4O1N A;  4R9W A;  4CGY B;  5C3X A;  2GA4 B;  1XX8 A;  1D5M C;  2D2C C;  2CQA A;  3O13 A;  4WOR A;  3VR5 A;  4NKL A;  2B2V C;  3A7L A;  1LT4 D;  2K1B A;  2IL8 A;  4A3J B;  3HOW B;  3NHH A;  2WV6 D;  2K04 A;  4RGM A;  2XVS A;  4R8N A;  3S1N B;  2Z4H A;  1SNQ A;  1EZ8 A;  5C3E B;  1EU4 A;  2Z8L A;  3OIP A;  1EY5 A;  1Y69 U;  3VR6 A;  4A93 B;  2JXM B;  1CTM A;  4L63 B;  3VYT A;  1MI2 A;  5D3D A;  1TKW B;  3TP8 A;  1SBB B;  4FF4 A;  1PTO B;  2RVL A;  2L9H A;  4WJW A;  2R93 B;  4C3J G;  2F0G A;  5CR3 A;  4B9W A;  2JA6 B;  1E2W A;  3I3C A;  2WP8 J;  4IFD G;  5ELB A;  4KHZ A;  4MHE A;  2JA5 B;  1C8C A;  3S16 B;  5F2D A;  2ZXP A;  3D8G A;  4HAE A;  1DOM A;  1LAB A;  1D5Z C;  2JA8 B;  1TU2 B;  5CBE E;  1FYC A;  1STE A;  5ISR A;  3CRL C;  2B2T C;  1JOQ A;  1V8Q A;  3QB3 A;  3BVM A;  2F0L A;  2M2L A;  2YYZ A;  3L9A X;  3TBI B;  4KN4 C;  3OMC A;  3DEO A;  4IUN A;  4QF4 A;  3J81 L;  3FPU B;  3ND8 A;  1S5F D;  1QB5 D;  4TQU S;  3AU7 A;  1II3 A;  1RHP A;  2EYH A;  5J1Z A;  3OPO A;  3D31 A;  1RCV D;  3R2I A;  5T1G A;  4F87 A;  3KLR A;  4ZUI A;  5T1I A;  3P75 A;  3RLF A;  2O2L D;  4HED A;  1U4L A;  4ZRZ A;  1ENF A;  2YU9 B;  3KF8 A;  2AQ2 B;  4HCE A;  3NP8 A;  3CQZ B;  4XYO A;  2MGS A;  4DXG A;  3IFT A;  3HGB A;  3A54 A;  3MTS A;  5IGF A;  1HTL D;  3WOE A;  5C4X B;  2HDM A;  3JAM L;  2F0J A;  3J80 E;  4CBV A;  1R4P B;  3X3M A;  3S9W A;  1FNV A;  3ERO A;  2BE5 D;  2BOS A;  1DCZ A;  1WTX A;  2EVB A;  1AZP A;  2IX0 A;  2EYO A;  4KJO A;  2L0C A;  3T4A C;  2SNM A;  4O42 A;  1LLR D;  4G57 A;  4U67 3;  1KDA A;  2K7V A;  1HXY D;  1SMY D;  2RDG A;  3MEH A;  1EIH A;  3BVG A;  3GTQ B;  4JK1 C;  1H9S B;  2F0N A;  4G4K A;  1QWY A;  1PRT C;  2NYZ D;  1TWH B;  4UAI A;  2WAC A;  1I4Q A;  1CK1 A;  1FNU A;  1F9Q A;  4PMC A;  1H9S A;  4RFB A;  3M7G A;  4DK1 A;  1DXM A;  4ULL A;  1JE4 A;  1SYF A;  3FEW X;  3QOJ A;  2F0W A;  1M4V A;  2WII B;  1PTO H;  1GUW A;  3TP6 A;  1T5X D;  5CV5 A;  4ZUJ A;  3E5S A;  3TP7 A;  5ELC A;  4K6D A;  3R2T A;  3D4W A;  1KAB A;  3SR1 A;  3LWU A;  1PFB A;  3PMF A;  4RHS A;  1CA6 A;  4IUQ A;  5M5X B;  1ESR A;  1JWS D;  3KLS X;  4NDX A;  3VYU A;  1Q12 A;  2JEB I;  2B2Y C;  2EJF C;  3C3L A;  3PO3 B;  1HA5 A;  3DUZ A;  2K01 A;  5C44 B;  3MAQ A;  3L7Z C;  4V0B A;  4XQN A;  5G3L D;  5HUR A;  5JEA G;  5DM7 3;  4J6H A;  3GTK B;  3AMU A;  2F0T A;  2BA0 A;  4XQQ A;  3QIA A;  3J7A F;  2K6A A;  4QB4 A;  1BBX C;  3A56 A;  1YNN D;  1QIL A;  1HPC A;  1SNP A;  4KK7 A;  1B50 A;  5JPN C;  2OT2 A;  3UI2 A;  1DZ1 A;  4C2M B;  1XWE A;  5EKI A;  3TSS A;  5E3F A;  2FFK B;  2BCO A;  4KD3 A;  3T56 B;  4PMW A;  2OXP A;  2ID0 A;  1ZXT A;  1DON A;  1G29 1;  2LKV A;  2BA1 A;  3GV3 A;  3NTI A;  3MVV A;  3DWA A;  4XT3 B;  3NSW A;  1WTP A;  1EYC A;  1AP0 A;  3C1F A;  3ND9 A;  3QWN A;  1A2T A;  1IYV A;  2NWG A;  3BDC A;  5AFW A;  3CKI B;  5C4H A;  1TVX A;  1I6V C;  5IGB A;  3OIQ A;  1HUN A;  1BCP F;  3EVQ A;  5DAU A;  5D65 A;  1SYC A;  1YNN C;  2B8G A;  1WTQ A;  4RGT A;  5FOB B;  2EYP A;  4L8J A;  5JPM C;  4F7X A;  1SEB D;  2KED A;  3H09 A;  3RZD B;  1A2U A;  1GUT A;  5NUC A;  1CHP D;  3FVQ A;  5M9O A;  1BOS A;  2KHS A;  3VR3 A;  2NB0 A;  1HFG A;  2QEJ C;  1PRT D;  3BDO A;  4EQN A;  4CJ1 B;  3DEP A;  3L3O C;  1SNC A;  4C3I G;  2JE6 I;  5KRU A;  1ESF A;  1I50 B;  3K6O A;  3SEB A;  1GUN A;  5IGD A;  2R6G A;  5C5M A;  3SK8 A;  1Q1B A;  4DAY A;  3I70 A;  1SAP A;  2KQ3 A;  2PCF B;  4A3D B;  5CV9 A;  2A6E C;  2C5C A;  4N9T A;  2NBF A;  4KY5 A;  2PNR C;  5JAV A;  1QOH A;  3T13 A;  2F0P A;  3VYR A;  4FF2 A;  1EFI D;  3E6Z X;  4FXK C;  2M9V A;  4FYD A;  3NQI A;  1SXT A;  3W3A A;  4S3S A;  5KEE A;  2K5W A;  3M4Y A;  2EYM A;  2QKI C;  5JEA H;  5IGG A;  2RSN A;  3R3O A;  1EWH A;  2V4D A;  2OF1 A;  2F0Q A;  5EKL A;  1LT3 D;  3DMU A;  4RWS C;  1XXG A;  5EPL A;  1IW7 C;  1FNW A;  5I6W A;  1CT1 D;  2NTT A;  2AUJ D;  4YIJ A;  2HDL A;  1CA5 A;  5JJZ A;  2QDB A;  5IGC A;  2E2H B;  3MXN A;  1U4R A;  1FGB D;  4U68 A;  1EOT A;  1H9K A;  1SYB A;  1ICW A;  4X3U A;  4OO1 H;  4HMJ A;  3OMG A;  2IT1 A;  1B4O A;  2R7Z B;  5ELF A;  1JB3 A;  3QOL A;  2K28 A;  1R4Q B;  1EQT A;  1PZK D;  4KY7 A;  1VMP A;  2E2I B;  5E1F A;  5KNB A;  3AB9 A;  3PO2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...