3KF8A

Crystal structure of c. tropicalis stn1-ten1 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
207
structure length
207
Chain Sequence
LYPKTKIDWGPGENHICLKTPFKNFYVIELFHQAPTFDKTIPLFISDINNSPNLYGIYNYIADHLRHVVLVNNYPVNQINIFGKIVYEQYKEKEFNGVEESYVILVISDFIGIDSKIRVRLSQEQFKEVGLTLDKKNYGKIVELEGEIYNWYDSINVSKKPDRELKVSKITVLSHRPDGLHFEFEQWKKRMEFRKNNLVEPWVFIPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein stn1
publication title Stn1-Ten1 is an Rpa2-Rpa3-like complex at telomeres.
pubmed doi rcsb
source organism Candida tropicalis mya-3404
molecule tags Structural protein
total genus 52
structure length 207
sequence length 207
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1040 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3kf8A00
3KF8A
chains in the Genus database with same CATH superfamily
1FJGQ 4DXGA 1CTMA 3TMEA 1LTLA 1GVPA 2AHOB 3HRZC 5IE8A 3HGBA 3I72A 5IYCG 2Z9HA 3BVZA 1GUSA 2B2YC 2E2HH 4YCVA 2VNUD 5IP7G 1G91A 3V96A 2B2UC 2F0PA 1EFWA 2XIWA 3S1QH 2LXJA 1VQMA 1STNA 2ZJPA 4B3SQ 4OX9L 2EJMA 1E1OA 4R4TA 1BDOA 2I46A 2Z6KC 4KY6A 3H3VI 1O7YA 4GKKL 1SYBA 3NQIA 3E3XA 4DK1A 3RN5A 4Y52H 2D62A 4DXFA 3C3LA 2OCEA 3J80i 3NHHA 1GHKA 1XMOQ 4JI7Q 2VB2X 4LF9Q 4F87A 4DR3Q 1U4MA 2F4IA 1G6PA 4DR6Q 3H09A 1EZ6A 4A3CH 2CWAA 5FO7B 4A3LH 3HKZB 3GD7A 3KBGA 5KIXA 1UE1A 4BBSH 3PIOA 3LWEA 2JA8H 3UE0A 1I4GA 1BBUA 4EQ5A 5IYBH 1J6QA 1YITA 1GXDC 5ELNA 1WTXA 1VQDA 2DJFC 5J3BA 2JN4A 1HUNA 5C44H 4A3LG 1ILQA 1XXGA 4TQUS 1CA6A 5IYBG 5EPKA 3PUVA 3M4OH 1IL2A 5GAEC 3L7ZC 1F9SA 2J7ZA 3D4DA 1IYJB 1PTOF 1YNJD 3S2HH 1EIHA 1Q3LA 2E2HB 5C44G 3DEPA 4A3IH 4OIJA 3MWYW 3NBHB 2SDFA 4UHVA 1Q82C 3AU7A 2B3GA 2O2LD 1B8AA 2BA1A 2VUMH 5KNDA 1K0SA 2B2VC 3K5NA 2KA7A 3ICEA 2PZWA 3PSIA 5M3FH 2XN9C 2CWPA 3BDOA 4H7BA 1BBWA 1K3BC 5LMNQ 2K04A 4KKTA 2L9HA 1SYGA 4N9PA 1L2FA 4A3IG 2PCFB 1CZWA 4R8NA 4P72A 1X3EA 1H9KA 4DNTB 2AWNA 3LGJA 1YJNA 1TY0A 3BDCA 3W1GA 4A3EH 1WD1A 3J7YW 1I4RA 3U50C 1W6KA 4DAVA 5IT9L 2DJGC 4CBVA 2TMPA 2G9HD 2F0SA 3OWEB 1S3OA 3U9SA 4CHTB 3IKJA 2YU9B 1IKLA 2F0NA 3KUPA 3MZ5A 3OTOQ 2UUAL 1UEBA 2PZTA 5FLMH 1OXXK 5CV5A 4A3EG 1M8AA 1CK1A 2UUCL 4HEDA 2E5LL 4DV4L 4EQNA 4FF4A 4KD4A 4LFCL 1RF2D 2AMCB 2YTYA 2E76C 5C44B 1VQBA 4JI4L 2A69D 1IBLL 2K05A 2KOLA 4XYOA 2Z1CA 4KJNA 4YY3L 2K28A 1N36L 1EQRA 1L1OA 2K50A 4A3KH 2WACA 2FXQA 3IFTA 4ULLA 4AQYL 5JEAJ 4I7ZC 2R6GA 4DA2A 4GKKQ 1HA5A 3D31A 2CKZB 3A5ZB 1VQKA 1MSHA 2JA7G 3GTPB 4A3IB 2JA9A 1A63A 1PH3A 4NXML 4A3KG 1NNXA 1EIGA 1Y8PB 4A3BH 1IBML 3KK7A 5I2YA 1D5XC 2HHHL 2F4VQ 4P74A 1X3PA 1NCVA 2CW0D 1LM0A 4IJHA 2LSSA 5FKAC 2EDGA 1QVCA 2K5QA 4XIGS 4X66L 3KYHC 3J80c 3CMAA 3W3AA 4B3MQ 4A3BG 1PRTF 5JPNC 4KI0A 3ER0A 3NWTA 1WTQA 5C5LA 2WIIB 1IHZA 1ICFB 3PV0A 4DR5L 2K5VA 1SEBD 1SYDA 3J81E 2CCZA 3OOCA 3ND9A 5IGFA 4IJLA 1W2BA 3PO3H 2PZUA 4CKEA 2R7DA 2KJXA 5CR3A 1TS3A 5CYUA 2JA7B 1EY5A 5CC4A 3SDZA 1UE7A 1PFBA 3JAME 2WAQE 4HJ7A 1R9TB 2UXCQ 1E2ZA 4L5TA 3I56A 1PH1A 1PH4A 3NWSA 3PO3G 2E2IH 4GN4B 3UDIA 4DUYL 2EJGC 1SFOB 4LWCA 1Y8NB 4X64Q 3LNNA 5IIFA 3QB3A 2L12A 4IPGA 4X62L 1RHPA 2GN5A 1N34L 4BA2I 1KTKA 1XTCD 5I9PA 2EY6A 3A8IE 3SXHA 4A3BB 5CV8A 1EY4A 4DUZQ 1C8CA 1UEAB 2R7ZG 3AB9A 2PQEA 1U0LA 2KHJA 2E2JH 3DEOA 3T4AC 5FLXL 2UUAQ 2MQHA 1V1PA 5GADC 1JWSD 2EQSA 4JPBW 4DV2Q 2FINB 3RLFA 2UUCQ 2E5LQ 3S24A 3QIAA 4F88A 5IT9c 1STBA 4IUPA 4DV4Q 1VQLA 4NDXA 5ELFA 4LFCQ 2A74C 3C2PA 2LXKA 1TWCB 1E2VA 3HP3A 4R1JA 2I07B 1D1KA 5C4XH 4R9WA 2NB0A 2ENBA 4ZLTF 4JI4Q 4CDCC 1NMFA 4NMZA 1XPRA 3T1YQ 2YYZA 3TEHB 4LK1C 4HJ8A 3PMFA 4A75A 1OXTA 1RIPA 5BN5A 3PO3B 5C3EH 2C9OA 5C4XG 4HTHA 1HZBA 1SN8A 4B08A 2G5DA 4RGNA 2E8GA 5NUCA 4LAAA 4ZKBB 2K75A 4RKLA 1D7QA 5CV9A 3LWUA 3OMGA 3DWQA 4X3TA 3H91A 4YWMA 3A5UA 1DYQA 1UE6A 3GTQH 3I8ZA 5C3EG 5K5PA 1BCPC 1PHJA 3KLSX 4QGUA 1IBMQ 1MBYA 3DHQA 2R7ZB 2ICEC 1DOKA 1LV9A 3G6EA 2XSCA 5I2XA 4DR4Q 3VR3A 1WCMG 1JMCA 1K8AC 3C1EA 3SK8A 3GV6A 1NE3A 1QWYA 2JSOA 4X66Q 4KMUC 3U4ZA 3SVMA 2ATWA 3PQIA 1E24A 4DR5Q 2L11A 3GV3A 2WKDA 3RD4A 3DXJC 4HSVA 4NP5A 1KRTA 3AFQA 2XRSD 3I91A 5ELBA 3V05A 2KCTA 5C4XB 2B2WC 1V1OA 1JOQA 1BR9A 1AE3A 2WP8J 2R7FA 4BBRH 5KGUA 4EGVA 3BDLA 2A6EC 3HOYH 4MHEA 4JG2A 4HJ5A 2I5LX 1WVLA 4BY1G 5HGTA 1S4ZA 3FP9A 2K5HA 5C3EB 3PGZA 4KHPL 1PDQA 3T51B 3N52A 4H0LC 4AYBG 1EWIA 4DV5Q 5FK9C 1QOHA 2EYLA 4A3DH 4X62Q 1ET6A 3HOYG 5DEHA 2F0MA 5I4DA 4N8FA 1WCMB 3EA6A 3PF5A 3K7AH 4S3SA 1CHQD 4DR7L 2EYFA 3LX0A 5M5WH 1KABA 2FMCA 3AEVA 2R92H 2D0PA 1IYUA 1P16A 2QCPX 1VQAA 1R4PB 5I6WA 4JI5Q 2MO0A 4A3DG 3OW7A 5DM63 4IUTA 1MJCA 4TVAB 3S1MH 1PFNA 1RKNA 2IW3A 1Y1WH 1EQQA 1NR2A 2JA5G 3A56A 1EIFA 4RAUC 2K6AA 1ML0D 4GS3A 3K5MA 2R92G 3KBXA 4C3IG 3H3VC 4JI2L 5CV4A 1CKNA 2F0GA 2CVRA 2GVAA 1VQGA 3J81i 5GROA 1VQJA 1B4OA 3QR8A 4ZYSA 1ICWA 5E4WC 1WYDA 3K57A 4HIDA 3GTJB 4IFDH 1F9QA 1TWHB 4Z9CB 1S40A 1M4VA 2NN6G 4BY1B 1PH8A 2ZXOA 4V0BA 1H95A 1JB3A 4IQZA 1DZ1A 4AYBB 2I5HA 5C3WA 1T5XD 1K28A 5KRUA 2B29A 5JPMC 4JI1L 3S1RB 3HOYB 1SNMA 3VR2A 2KHIA 1H9SA 4QIWE 4IFDG 2B2TA 4FXKC 3BJUA 4K8IA 2CQAA 3RLOA 1Q86C 1K9MC 3I70A 3IL8A 3H15A 3PIPA 2J0TD 1GJXA 4PMCA 2F3VA 4A3DB 1HQRD 1EU4A 4M1UB 4DK3C 1TY2A 1CM9A 3NE5B 1YZ6A 4WFN3 5IGEA 2NN6I 2JA5B 5M5WB 2RCFA 2R92B 1U4LA 5C5MA 4C3IB 1UAPA 2M00A 2PO4A 1Q12A 3TQYA 2HIXA 1LTTD 3CW2C 1HHVA 3ND8A 2H1EA 1C4QA 2QDLA 2ZXPA 4JBJA 5EKLA 4WJ4A 1J8IA 4LF4L 2OXPA 2A19A 4NXNQ 3FHWA 3R2TA 2WV6D 1VQNA 5IP9G 3URYA 3S17B 2PMZE 2CFMA 2PW7A 3L9AX 5G3LF 1HNZL 3KF8B 1XYIA 5EGTA 1PTOB 1HA6A 1LTSD 2ZTDA 2NVXH 1GM5A 3CRKC 2Q2TA 4R4CA 1AW7A 2O4XA 4C56C 2NVTH 1VF5C 3L2PA 2F3IA 3M7GA 1T5EA 4EQPA 1EFID 5JVH3 4QMGA 4DR7Q 1F2YA 1BF4A 1HJPA 3S16B 1Q81C 4PV1C 2OTLA 1SXTA 3KF6A 1VQ5A 1QE6A 2C5CA 4MIUA 1HR0L 1B9MA 2HDLA 3PCOB 3MXNA 1I4QA 1GD7A 2F0KA 4XXEA 1SBBB 1JJ2A 3C46A 3L3OC 2EIFA 1ILPA 1FNUA 1Y1VH 2DNCA 1TS4A 2BDOA 1EEFD 3H0GG 1SDFA 4YCWA 2N88A 3C1FA 4CGYB 1KDBA 1RTOA 2Q2HA 3NEMA 4ME5A 1SNPA 2Y0SE 1XNRL 4BXXH 3SK4A 1B2TA 3A7AB 2WKCA 3M9BA 4DV0L 3TRZA 1ASYA 1Y1VG 1D1IA 3M4QA 1K73C 3GTGH 4DN4M 3ULLA 1WTHA 2RVLA 3E5SA 1YI2A 1CHPD 4JI1Q 1Q1EA 1YHBA 3VDYA 2R61A 1ENCA 1WTWA 3KLWA 3WWVA 3J81c 1RODA 1Z6HA 1M1KC 1KC8C 2ZT9C 3I55A 1BXTA 2NVXB 5C0XH 5HURA 1E22A 3VR6A 1PMRA 4HJAA 4I7AA 3S2DH 4JK1C 1I3QH 4PQXA 3MXNB 1X55A 2R93H 4DPGA 3WOEA 1CSPA 1SMXA 3JAMc 2OQ0A 2KEDA 1SNQA 3HOVH 1SE4A 4HMJA 2NZ1D 3H6MA 3J80L 3BU2A 2A6HD 4HJ9A 2ES2A 2K03A 4LFAL 4DNRB 2RQXA 3H0GB 1EEID 1JCKB 2QEXA 3CCLA 1OO9B 3DM3A 2K1BA 4ILWA 2B63H 3MA2B 1LT3D 4A3MB 4WJ3M 4DV3L 4QY7A 3K5OA 3JC66 4V190 4P73A 1NAPA 2BDNA 4JW0A 4LF4Q 1K0RA 4NB3A 3S15B 1KXLA 4Y7NB 4A3CG 1PRTB 5C6AA 5T1GA 1AZPA 4GNXA 4BBSG 2JA8G 1W6JA 3PUXA 2OTJA 4OONA 3T16A 1HNZQ 4JI0L 4U673 1DOMA 1FR3A 1NSNS 3BS1A 1EQTA 1XJVA 1LYLA 3ERQA 1VQEA 2HUGA 4ZAIA 3DWAA 4KTAA 3GTGB 3U58A 3TZUA 4IO9A 3CQZH 1T9HA 5EJWA 2IJ0A 4DGZA 5M3MH 5COYA 1L0WA 3S1QB 1S5FD 1L0XB 1ONLA 3UE1A 3KLRA 3RZOH 2KHSA 4FDBA 2VQFQ 2IWHA 4IOCA 1N33Q 5M5XH 1H9JA 3X3NA 5E4XA 1W3SA 1TWAH 1HR0Q 1TXYA 3P20A 1VQPA 1I3QB 1JOKA 2GA4B 3CC7A 4LF5Q 4CDDC 2X6GA 2D0OA 5JOBA 3EQLC 3MHBA 4JC0A 2VUMG 5ELDA 1Q90A 1QZHA 1JJGA 4IALA 2UUBQ 5IY0A 5M3FG 1SJHD 2F0UA 3I90A 5GQOA 2HDMA 4CJ2C 4WORA 1CFMA 4A3GH 2VY3A 1C9OA 2RDHA 4F8MA 3I4NH 4BBSB 2BE5C 5KYLA 4GNXB 2JA8B 1TS2A 3D4RA 3GO5A 1B50A 2OQKA 1MKHA 1QZGA 3AQQA 5M5YH 4CDEC 4WRDA 5DLQE 3PIP3 4OEMB 4DNIA 2JE6I 4ZRZA 4DV0Q 1GHJA 4A3GG 2X69A 3PUYA 5LHY1 2E74C 1P8LA 5FLMG 3CU7A 3M4OB 5IGBA 5LMUL 4DV1L 3ZJYC 4OX9Q 4H13C 4X65L 2A8VA 3UDXA 3S2HB 3K7UC 2KVMA 3RR5A 1X3GA 3UDGA 1X9NA 2IHEA 1D5ZC 1GO3E 2B2UA 4J6HA 2VUMB 3PO2H 5E3FA 5M5XB 5M3FB 2KBNA 2L15A 5FOBB 3NPPA 3NTHA 1DJRD 4X3SA 5IODA 1YHAA 2JK8A 5ELEA 2IY5B 2Z6KA 4H44C 1TS5A 5JVG3 1JT8A 1TVXA 1QG7A 4OWTB 1OXSC 5HGQA 5DM73 4BY7H 2NZHA 1E1TA 3TP8A 4ZQ3A 3PO2G 4DV3Q 2SNMA 4A3EB 2DNEA 4O1NA 4DV6L 1EYDA 2EYPA 2N55A 1EYGA 2F0IA 4OIKA 1TWGH 2RKSA 3GDEA 4RH6A 3J7AF 2PNRC 5JAVA 1I94L 1NMGA 4C1NK 3Q24A 1EIYB 2HQLA 1KD1C 1U9RA 3L0OA 3M3YH 1HTLD 2QA4A 3G48A 2Q8IB 1VQIA 1A0IA 2UXBL 5EAYA 1L1OB 1NR4A 4MZ9A 4C2MH 2PW5A 5HY6A 2YTVA 2B39A 1Q8KA 2KCNA 3O13A 4RCOA 2ZM6L 2O5IC 1FYCA 3T56B 4QUFA 2CH4A 4JV5L 1ZYRD 2NTSA 4UY8C 2JEBI 4GOPA 1O7ZA 4GZYC 2UU9L 2NTTA 4Q0FA 2IPKD 4A3KB 1G291 4C3HH 2L4NA 1SMYC 4IFDJ 2M2LA 1PA6A 4NKLA 1GUOA 2F0HA 3ULPA 4PZ7A 3NP8A 1VCIA 5IYDH 3CCEA 1HZAA 4LUZA 4KN4C 1II3A 3K80C 2EPBA 3W2DA 1V1QA 4K5VA 4BS9A 4C3HG 4HIKA 2KECA 4FXGC 4U68A 1XPOA 1N9WA 2B2VA 4TSSA 4XQNA 1PYWD 4QIWB 5BR8L 2DGYA 4JVZA 2RA4A 4UDUC 4XT1B 3RZDH 4R4OA 4R4QA 1FGBD 4UP9A 1C7YA 1MIUA 2A5HA 4FF1A 1TWGB 1F2LA 1IBLQ 4JCVE 4JBKA 2ID0A 5EBCA 4L5RC 2WINB 3V2TA 1EYCA 1F9PA 1D6EC 4YY3Q 4GOPB 1O78A 5LMUQ 4DV1Q 1N36Q 4TRDA 4X65Q 1HPCA 1EL0A 4CJ1B 3CP0A 4XQQA 4AQYQ 1JWMD 2N49A 2SEBD 1KAAA 1UNSA 5M9OA 3GTMH 2XVSA 2SNSA 4FVMA 5ELCA 3TSSA 4A3JH 3FKIH 3I7FA 3W1BA 1PTOC 4NXMQ 3SHLA 4LFBL 1KLGD 4DK6C 5KNCA 3MFGA 2VQEL 3CPFA 4C3HB 2E2IB 1HQMC 2EOTA 2ASBA 3OHXC 3SGIA 2QF7A 3OYYA 1U5KA 3KDFA 3GTLH 2HHHQ 3FKIG 1EYAA 2IX1A 1EY8A 4PG3A 1WI5A 4HCEA 3W5OA 5A2QE 2L5TA 1BQQT 1V1PB 3TP5A 2JA6H 1HZ9A 4ZUJA 4DV6Q 4Q5VA 1N32L 2K4KA 5AJ3L 3CHBD 2M9VA 3VYTA 2G9DA 4L5QA 1RTNA 2E2JB 4OL7A 3DWPA 1KQSA 4OO1H 1TKWB 3D0FA 1RCVD 4KJOA 1XTDA 1H9RA 2UXBQ 4O42A 3K81C 2OF1A 1B9NA 1JE5A 3CCUA 1MGSA 3I4OA 2ZM6Q 2BA0A 2NVQH 2PQAA 2MHVA 3BZKA 4JV5Q 1XMQL 3HOUH 3MTSA 4PZ8A 4OO1G 3FVQA 2BE5D 3DLLA 3NSWA 2UU9Q 4I65A 3M7NA 3QO2A 4YHHL 1E0BA 4DUYQ 1A2TA 1ENFA 5A35A 4O0AA 5C4JH 3EIVA 2FFKB 3DUZA 1AN8A 3M4PA 4DR1L 3MC0B 1J5EL 4BBRG 1MD2D 3HOUG 2CHBD 1AZQA 3Q22A 1PXUA 1N34Q 1AP0A 2RBMA 1A3VA 4RG1A 2MPMA 3N6RA 3VYUA 3GTQB 5DNFA 2KCMA 5C3XA 4DV7L 1SLJA 2Q2UA 1B53A 3NTIA 4K2KA 5F2DA 4GKJL 4OO1I 5C0XJ 1ET9A 3CKIB 5JJLA 2RDFA 1X3QA 2LS01 4FF2A 3SEBA 1F2ZA 1SNCA 4XT3B 3HOXH 3D3RA 1JORA 4LW1A 3OPOA 3IFDA 4DAYA 2EY1A 3MFYA 1PFMA 1LT6D 3UI2A 2QW7A 4UPAA 1STYA 3BZDB 3CF5A 2MNAA 4R4IA 1Y1WG 4MN3A 5FO8B 3J81L 1YNJC 3HOXG 1XNQL 1PRTC 3CCRA 3J7ZC 2EVBA 5IWAL 1O80A 3EN2A 1EU3A 2NVQB 1IXRA 2BH2A 4OWWB 4BBRB 1B3AA 4DU9A 3HOUB 4YWKA 5CBAE 3BYYB 1K83H 3F2CA 4APVA 2A68C 2V4DA 2F0LA 5EQ0A 3JAML 4LFBQ 3A55A 2VQEQ 3D6WA 1WFQA 4OELB 4IUUA 2H4OA 1X54A 1A3TA 2JP1A 1BNZA 2Q8TA 4DAMA 4JBMA 2Z4HA 4CJ0B 3J81j 3NXWA 4ALPA 4AH6A 4JOIA 1PZID 4K2LA 1IW7C 1Y69U 3FEWX 4GN5A 4POGA 3K7AB 2KCCA 3MVVA 2DY8A 4B3SL 5AJ3Q 3R93A 1SSOA 4JI6L 4KD3A 3S1NH 1CKNB 1HNWL 4JBWA 1SMYD 3OWFA 4KY7A 4IFDI 4N8X1 3S1MB 4CKBA 2B8FA 1NTGA 2FMMA 2EXDA 1E3PA 1Y1WB 3S14H 5J39A 5E7NA 3HOXB 1XMOL 4LF9L 4KHVA 1F77A 1GKHA 2F0DA 4DR3L 3GQBA 2YTXA 5JJKA 3MXPA 4DR6L 2A69C 4QUCA 5EBDA 4DFAA 1S5ED 3CCVA 4GNXC 4GLAC 5C4HA 5LL6S 1JJCB 3SK5A 2EY2A 4PMBA 2RSNA 2I5MX 1H9SB 2A73B 3I73A 3A54A 4YHHQ 3MEFA 4F7XA 4ZK9B 1NBWA 5ISRA 3GTKH 4KHPQ 1G6ZA 1J5EQ 1VS0A 2NZOA 5D65A 3VR4A 5LMNW 4FNFA 2AQ3B 4K6DA 1K83B 1B70B 1WTRA 2H5XA 1XPUA 1G2TA 1DONA 4JYAL 1R4QB 4RHSA 5K36H 3EBEA 1VMPA 2Q8RE 1KDAA 2EYJA 1PV4A 4RWSC 3TDQA 3VYRA 1GUWA 4RKBA 4GKJQ 2PYKA 3Q0AA 1FL0A 1SYCA 1O7LA 2CW0C 1JR0D 2WB1E 1X6OA 1YEZA 4LUOA 4KLKA 3OIPA 4LF6L 5GAGC 3TS2A 3K6OA 5K36G 3VA7A 1PTOD 2TSSA 2D9UA 4L6TB 1A8VA 3ULJA 4QCLA 4JI2Q 5EKKA 1EY0A 3S1NB 3K0YA 4HN7A 3PUZA 4IURA 2WAQG 1BCPD 1A6XA 3AYHB 1K8MA 2I0QA 3NQTA 3G7LA 1F9RA 2ALYB 2XRQD 3MXGA 2Z6BA 3J7A5 3KJPA 1DOLA 3S14B 1UUPA 4RCNA 4G7ZC 2KENA 3KOJA 3QWNA 1EUJA 4J1MA 5LL6X 1Q8IA 5IWAQ 3TS0A 1DCZA 2VB3X 2ZJRA 4MTKA 3CAMA 1ZXTA 3AFPA 3BVMA 4J15A 2L1BA 2LY7A 2NWGA 1EQVA 3F1ZA 3E0JA 1S72A 1ENAA 3R3OA 2F3WA 1L1OC 4BXXG 3I2ZA 1FD7D 3SE0A 1KL9A 1VQ4A 1OTCA 1YIJA 5H1SE 3GTKB 3KF6B 4L5SA 2D2CC 1Z7TA 2NVTB 3I4MH 5AFWA 4XYQA 1EWCA 2NVYH 1UWVA 5TSSA 1M90C 1HZCA 4KY5A 1ESRA 2RSOA 1Y14B 3FRPB 2A6ED 1VDZA 5IGDA 1V9PA 2ZTEA 3S9WA 5C0XG 2EXZA 4EX5A 4JI6Q 5BN4A 3QOJA 3CCQA 3I4MG 1HNWQ 3TREA 2VXWA 2WAQB 4ODGA 2R93G 3NBHA 4DR2L 3FPUB 2JEAI 3TZDA 3HOVG 4HSPA 1PLFA 2AUKA 3PUWA 3T53B 2PI2E 3E6ZX 3K58A 3PF4A 1Y1VB 2YU9H 4IOAA 5KEEA 2DN8A 2B63G 1XX8A 5FLXE 3CXCA 2F4VL 4AYBE 2KQ3A 1QCBD 5C0XI 4MTNA 1HNXL 1HFGA 2CH4W 1HXYD 2RF4A 2E75C 2CQOA 3K59A 4B3ML 3A0JA 1CQVA 2MJ8A 4A3FH 4GOPC 3B6YA 4P2CB 2C35B 1SRUA 4KK7A 1YNNC 4X3KA 5IOCA 3KJOA 4JYAQ 4LUVA 5CGKA 3FPPA 1C0AA 1WTVA 2ZJQA 2EJFC 4K8JA 5ELOA 4MNOA 3VA5A 1QNUA 4LF7L 2NYZD 2HQEA 1PRTD 1LABA 3I4MB 3TP6A 1HUMA 2MO1A 5M3MG 3S2DB 4A3FG 1GUTA 1A15A 5T1IA 2R93B 2NVYB 4AIMA 1VQHA 3GTPH 2F03A 1BCPF 1I50H 4LF6Q 3HOVB 5J1ZA 5D3DA 2UXCL 3NUCA 1VMCA 1CT1D 2A68D 4CDFC 2HIVA 3OW2A 4L8JA 2BOSA 4OGQC 1TIID 2IX0A 2KEEA 4X64L 2QDBA 2EYHA 4KKUA 2B63B 1QUQA 2AKWB 3E9IA 3RLNA 1XNRQ 5JJZA 5E1FA 4UAIA 2K5WA 1IW7D 1SROA 1SAPA 2N3SA 4EVOA 3D6CA 4ABNA 1LLRD 2F0FA 4JI8L 4G7OC 3TP7A 2F52A 1WD0A 1YBYA 3P1HA 1FNWA 5CV7A 1LTAD 4DUZL 3I4NG 5IGCA 2RCNA 1RJTA 3NK9A 4FO2A 2AQ2B 2AWOA 3VR5A 4DV2L 1BUVT 4YCUA 1QVFA 1Z9FA 2WFWA 1FVIA 4IPDA 1VQ8A 3CQZB 1QVGA 2AUJD 3I3CA 5M3MB 3G71A 2B2YA 4A3FB 4A4IA 2JA7H 4XDXA 2EZVA 3RZOB 2R3ZA 4PMWA 1STHA 2LFNA 3T1YL 1CQFA 4ZUIA 2UXDL 3D4WA 1R9TH 1ZEQX 1HH2P 1VF7A 3MEHA 2L55A 2K01A 1VQCA 1MJEA 2LKVA 2RHQB 1KNAA 2Z0SA 1TWAB 1X65A 4LFAQ 3RN2A 1QB5D 4QB4A 1SFOH 3BVGA 1GOZA 1LTGD 1DGSA 3X3MA 1I50B 1X32A 4DR2Q 3E0EA 1CI3M 1QUQB 1EY7A 1RL2A 1SR3A 3HFZB 4A3GB 1NY4A 2VS1A 3H94A 5IGGA 1SYFA 5EKIA 1LTRD 1D8LA 3D8GA 3I4NB 4C3JH 1PH9A 4PZ6A 4BY7G 4K5XA 3TN2A 2AQ1B 4KHZA 4B3RL 1TU2B 1VQOA 4JI0Q 5M5YB 3CCMA 1HNXQ 4DR4L 2O5JC 4YIJA 1KHIA 3OSOA 1BBXC 3BG3A 3HOZH 1MHWC 3DM1A 4IUQA 4HR7B 5I9OA 1MI2A 1TWCH 1STAA 2XWBB 3HOWH 1I5FA 4C3JG 3SR1A 4HCSA 3HS0C 4OXPA 4RGMA 1JC7A 1LTID 1C48A 1B1ZA 1EOVA 1YHQA 2QILA 2Z4IA 3NENA 1FNVA 4DKAC 4NPSA 4X6AH 4LF7Q 3HOZG 4K5WA 1S5CD 1KAWA 2K7VA 1WJJA 3HOWG 1CKMA 2ICIA 3STBC 1X3FA 3HKZE 2BCOA 1JWUD 2MP1A 3PO2B 1J9OA 4LF8L 2RHSB 4XTCS 3M85A 1WTPA 3VYSA 1Q7YC 1SE8A 2RDGA 2F0OA 2D5DA 1G8ZD 4CKCA 4GN3B 4HIMA 1TQOA 1V43A 5BN3A 2R7ZH 4BY7B 4DV5L 5CBEE 3ZYYX 5IYDG 2MFIA 3G4SA 1EY6A 2HCCA 4BWGB 5KNBA 3EVQA 4JI8Q 5CORA 1LT4D 1KNEA 4O2DA 2MUYA 4GLXA 4C3JB 4JI5L 2DUDA 1BVSA 5EPJA 5D14A 4FF3A 3M3YB 3NBIA 1SNDA 4ZKCB 4P71A 1HFNA 1SE2A 4X3UA 1E7ZA 4C2MB 3HOZB 2XNAC 1B7YB 3U4VA 4G7HC 1I4PA 3HOWB 2VL6A 2WB1G 1VQ7A 4YWLA 2OWOA 1V8QA 2B2TC 2F0QA 4E6IA 2F1MA 1JICA 3HKSA 2UXDQ 2Z8LA 2K5DA 4A76A 4M8AA 1STGA 3NTKA 2JXMB 1TR5A 2EE1A 3Q8DA 3PIO3 2FHTA 4IN3A 3T1HL 4JOIC 2DY7A 1CKOA 3MXUA 4K0KL 2PMZB 3CCJA 4FP5D 4A3JG 1EOTA 4ID6A 3F2BA 4KKSA 2Y0SG 4IZ8A 3P75A 1N8RC 3RMHA 2N78A 4RMFA 5I6YA 4B9XA 1WCMH 1STEA 1YNND 4P75A 3A74A 1ASZA 1PFSA 2B8GA 1I94Q 1RD9D 4B9WA 2K33A 2OT2A 3K8AA 4LMQD 1GUGA 4B3RQ 2K5NA 4ZCKA 3DMUA 3CRLC 3WDNA 1A3UA 3RZDB 2JA6G 1MSGA 1SJED 1LACA 1PH2A 5DAUA 1I4XA 5CMDA 3A7LA 1AH9A 1VQ6A 4EQOA 3EROA 1TWFH 1YJWA 3FDTA 2F0JA 3Q23A 1IL8A 3P7JA 3CC4A 1EWHA 2WB1B 1U4RA 2PPBC 1DD2A 1Z47A 2MGSA 1SNOA 1CUKA 4KN7C 3M4YA 5JEAH 1U4PA 3GTJH 4XQJA 1TWHH 1JOOA 1AE2A 4BY1H 3SK6A 3GTMB 3F8TA 4J8QA 4NW2A 1XWEA 3F2UA 3KDFB 2XWJB 4A3JB 3FKIB 4NXNL 2PI2A 2Y0SB 2Q2IA 4IUNA 3EFXD 1PVOA 2PNHA 3S1RH 5J22A 4LF8Q 5JEAG 3ITPA 4QJFA 1O7IA 5C4ZA 1TT2A 3GP7A 3A8KE 4G57A 2A6HC 2KUMA 4OWXB 1RDPD 4DAPA 3GTOH 2NUCA 1VQ9A 3GTLB 1VQFA 1B3QA 3EJIA 3CD6A 5JJIA 2GVBA 5BR8Q 1K3RA 2QKIC 2OEOA 2ZTCA 5CV6A 5G3LD 4KV6A 2JA6B 2ZXRA 2LMCB 2XGTA 4B3TL 2BH8A 2JA5H 4RA8A 3U9OA 3K5LA 3J80E 5KYIA 4HIOA 4C3IH 2HD3A 3J7AV 4JI3L 4QF4A 4FXDA 2PQAB 1PH5A 1IKMA 5L37A 4LJZC 1IBKL 1BOSA 1QJOA 3ERSX 2XTIA 4QL5A 1PZKD 3HZXA 4WJWA 1QNKA 4C1NI 4K14A 3IRBA 1LTBD 1LT5D 2NN6H 3QOLA 1DXMA 4HAEA 2E2DC 4GLVB 1TWFB 4A93H 4TKOB 3NELA 1B44D 1BO0A 2JYOA 5FLXc 1HTPA 1CSQA 4PNYA 1SE3A 3R2IA 1KIXA 2YV5A 1OXUA 3S17H 4BA1I 1FJGL 2SOBA 1AFPA 1IZ6A 1D2BA 1D5MC 3CCSA 3G6JB 3K0XA 1PTOH 5C4JB 1H9MA 2EY5A 2F0TA 4RGTA 3CMEA 3T1HQ 4A93G 2F0VA 1CZGA 2EYOA 1QILA 4QQBX 4K0KQ 2IT1A 3ONAB 3JAMi 3RNUA 1PH6A 3F2DA 2P5ZX 3WOFA 1ESFA 4HMIA 4UP7A 4DK0A 5FJ8H 2IL8A 1G51A 1OXVA 3KF8A 3BYTB 3R8BA 3KFUA 1ZKOA 1N32Q 1WTOA 1YNXA 1HCZA 3CC2A 3S16H 3GTOB 4DAYB 1SYEA 1YJ9A 1I6HH 1KLUD 1PYBA 2N8NA 5FJ8G 2K32A 2QEJC 3OIQA 2IX3A 3STBD 3E9HA 2JJQA 4JI7L 2VZAA 5IT9E 4IUVA 1I4HA 1K8GA 1JQYD 1A62A 1PH7A 3QG1A 4DF7A 1XMQQ 1Q46A 2IHFA 2K14A 3RUZA 3AMUA 4POFA 4RFBA 1Q1BA 5IP9H 3T13A 2JQOA 5GAHC 1JE4A 2J4XA 3OMCA 2F0EA 1WOCA 1S5DD 2NBFA 1S5BD 4RHRA 2QGQA 2VW9A 4A93B 4DR1Q 1YVCA 1K8OA 1HR0W 2B2WA 4UP8A 5FO9B 1UE5A 1DM0B 4R8IA 4K6LA 1I6VC 2FJ2A 4IPHA 4L63B 4DV7Q 1IYVA 4H02A 1CA5A 2X6LA 2A1AA 1KDCA 3A8JE 1KRSA 5EPLA 4OHJA 3QJYA 1BKBA 1BCPB 3HG9A 4G4KA 3FMCA 3UDFA 2V1CC 1Y8OB 1JB7A 5D3IB 5A2QL 2VQFL 4B3TQ 1N33L 3HEJA 1L0YB 2HT1A 4N9TA 4RGOS 3CPWA 1NJIC 2EYMA 1F2MA 5LMNL 4JI3Q 2K52A 3H0GH 3H3VH 1A2UA 2F0WA 1IBKQ 3IAYA 1I6HB 1HRJA 1G2SA 1EY9A 4IPCA 1EZ8A 1FGUA 4LF5L 4FYDA 4A3MH 1LO5D 1XNQQ 3I4LA 3TBIB 3MAQA 4LNQA 1GUNA 2UUBL 2HCIA 2L0CA 1E2WA 5IYCH 3BZCA 3S15H 3KLSA 4Y7NH 1AEXA 3Q6SA 1ZYRC 3HKZG 1X56A 4ME3A 1PYSB 5IP7H 1PZJD 1LUZA 3OTOL 1NUCA 4A3MG
chains in the Genus database with same CATH topology
4DXGA 1CTMA 3TMEA 3HRZC 3HGBA 3I72A 3BVZA 1GUSA 2B2YC 2VNUD 1G91A 3V96A 2B2UC 2F0PA 2XIWA 1STNA 2EJMA 1BDOA 2I46A 4KY6A 1O7YA 1SYBA 3NQIA 4DK1A 2D62A 4DXFA 3C3LA 3NHHA 1GHKA 2VB2X 4F87A 1U4MA 2F4IA 3H09A 1EZ6A 5FO7B 3HKZB 3GD7A 3KBGA 5KIXA 3LWEA 1I4GA 1GXDC 1WTXA 1HUNA 1ILQA 1XXGA 4TQUS 1CA6A 5EPKA 3PUVA 3L7ZC 1F9SA 2J7ZA 3D4DA 1PTOF 1YNJD 1EIHA 1Q3LA 2E2HB 3DEPA 4OIJA 3MWYW 2SDFA 3AU7A 2O2LD 2BA1A 5KNDA 2B2VC 3K5NA 2KA7A 2PZWA 2XN9C 3BDOA 4H7BA 2K04A 4KKTA 2L9HA 1SYGA 4N9PA 2PCFB 1CZWA 4R8NA 1H9KA 4DNTB 2AWNA 1TY0A 3BDCA 1WD1A 3J7YW 1I4RA 1W6KA 4DAVA 5IT9L 4CBVA 2TMPA 2G9HD 2F0SA 3OWEB 4CHTB 3U9SA 3IKJA 2YU9B 1IKLA 2F0NA 3KUPA 3MZ5A 2PZTA 1OXXK 5CV5A 1M8AA 1CK1A 4HEDA 4EQNA 4FF4A 4KD4A 1RF2D 2E76C 5C44B 2A69D 2K05A 2KOLA 4XYOA 2Z1CA 4KJNA 2K28A 2WACA 3IFTA 4ULLA 5JEAJ 4I7ZC 2R6GA 4DA2A 1HA5A 3D31A 1MSHA 3GTPB 4A3IB 1EIGA 1Y8PB 3KK7A 5I2YA 1D5XC 1X3PA 1NCVA 2CW0D 5FKAC 2EDGA 2K5QA 4XIGS 3W3AA 1PRTF 5JPNC 4KI0A 1WTQA 3NWTA 5C5LA 2WIIB 1IHZA 3PV0A 1SEBD 1SYDA 3J81E 3OOCA 3ND9A 5IGFA 2PZUA 4CKEA 2KJXA 5CR3A 1TS3A 5CYUA 2JA7B 1EY5A 5CC4A 3SDZA 1PFBA 3JAME 1R9TB 1E2ZA 3NWSA 2EJGC 1SFOB 1Y8NB 3LNNA 5IIFA 3QB3A 2L12A 1RHPA 4BA2I 1KTKA 1XTCD 5I9PA 2EY6A 3A8IE 3SXHA 4A3BB 5CV8A 1EY4A 1C8CA 1UEAB 3AB9A 2PQEA 3DEOA 3T4AC 5FLXL 1V1PA 1JWSD 2FINB 3RLFA 3QIAA 4F88A 1STBA 4IUPA 4NDXA 5ELFA 2A74C 3C2PA 1TWCB 1E2VA 3HP3A 2I07B 1D1KA 4R9WA 2NB0A 2ENBA 4ZLTF 4NMZA 2YYZA 4LK1C 3PMFA 1OXTA 5BN5A 3PO3B 2C9OA 4HTHA 4B08A 4RGNA 5NUCA 4LAAA 4ZKBB 4RKLA 5CV9A 3LWUA 3OMGA 3DWQA 4X3TA 3H91A 1DYQA 3I8ZA 5K5PA 1BCPC 3KLSX 1MBYA 3DHQA 2R7ZB 2ICEC 1DOKA 1LV9A 2XSCA 5I2XA 3VR3A 3C1EA 3SK8A 3GV6A 1QWYA 2JSOA 4KMUC 3SVMA 2L11A 3GV3A 2WKDA 3RD4A 3DXJC 4HSVA 4NP5A 2XRSD 3I91A 5ELBA 3V05A 5C4XB 2B2WC 1V1OA 1JOQA 1BR9A 2WP8J 5KGUA 4EGVA 3BDLA 2A6EC 4MHEA 1WVLA 5HGTA 1S4ZA 5C3EB 1PDQA 3T51B 3N52A 4H0LC 5FK9C 1QOHA 2EYLA 1ET6A 5DEHA 2F0MA 5I4DA 1WCMB 3EA6A 4S3SA 1CHQD 2EYFA 3LX0A 1KABA 2FMCA 1IYUA 2QCPX 1R4PB 5I6WA 3OW7A 5DM63 4IUTA 1PFNA 1RKNA 2IW3A 1NR2A 3A56A 4RAUC 2K6AA 1ML0D 3K5MA 3KBXA 4C3IG 3H3VC 5CV4A 2F0GA 2CVRA 1B4OA 4ZYSA 1ICWA 5E4WC 3K57A 3GTJB 4IFDH 1F9QA 1TWHB 4Z9CB 4BY1B 1M4VA 2NN6G 2ZXOA 4V0BA 1JB3A 4IQZA 1DZ1A 4AYBB 5C3WA 1T5XD 5KRUA 5JPMC 3S1RB 3HOYB 1SNMA 3VR2A 1H9SA 4IFDG 2B2TA 4FXKC 4K8IA 2CQAA 3I70A 3IL8A 2J0TD 1GJXA 4PMCA 2F3VA 4A3DB 1HQRD 1EU4A 4M1UB 1TY2A 1CM9A 3NE5B 4WFN3 5IGEA 2NN6I 2JA5B 5M5WB 2R92B 1U4LA 5C5MA 4C3IB 1UAPA 2M00A 2PO4A 1Q12A 1LTTD 1HHVA 3ND8A 2H1EA 1C4QA 2ZXPA 5EKLA 1J8IA 2OXPA 3R2TA 2WV6D 3URYA 3S17B 2PW7A 3L9AX 5G3LF 1XYIA 5EGTA 1PTOB 1HA6A 1LTSD 3CRKC 1AW7A 2O4XA 4C56C 1VF5C 3M7GA 1T5EA 4EQPA 1EFID 5JVH3 4QMGA 1F2YA 1BF4A 3S16B 4PV1C 1SXTA 1QE6A 2C5CA 4MIUA 1B9MA 2HDLA 3MXNA 1I4QA 2F0KA 4XXEA 1SBBB 3C46A 3L3OC 1ILPA 1FNUA 2DNCA 1TS4A 2BDOA 1EEFD 1SDFA 2N88A 3C1FA 4CGYB 1KDBA 1RTOA 4ME5A 1SNPA 3SK4A 1B2TA 3A7AB 2WKCA 1D1IA 4DN4M 2RVLA 3E5SA 1CHPD 1Q1EA 1WTWA 2R61A 1ENCA 1RODA 1Z6HA 2ZT9C 1BXTA 2NVXB 5C0XH 5HURA 3VR6A 1PMRA 4JK1C 4PQXA 3WOEA 2KEDA 1SNQA 1SE4A 4HMJA 2NZ1D 3H6MA 3J80L 2A6HD 2K03A 4DNRB 2RQXA 3H0GB 1EEID 1JCKB 1OO9B 2K1BA 4ILWA 3MA2B 1LT3D 4A3MB 3K5OA 4V190 1NAPA 2BDNA 3S15B 4Y7NB 1PRTB 5C6AA 5T1GA 1AZPA 1W6JA 3PUXA 3T16A 4U673 1DOMA 1FR3A 1NSNS 3BS1A 1EQTA 3ERQA 2HUGA 4ZAIA 3DWAA 4KTAA 3GTGB 3TZUA 5EJWA 2IJ0A 4DGZA 5COYA 3S1QB 1S5FD 1L0XB 1ONLA 3KLRA 2KHSA 2IWHA 1H9JA 3X3NA 5E4XA 3P20A 1I3QB 1JOKA 2GA4B 2X6GA 5JOBA 3EQLC 3MHBA 5ELDA 1Q90A 4IALA 1SJHD 2F0UA 3I90A 2HDMA 4CJ2C 4WORA 1CFMA 2RDHA 4F8MA 4BBSB 2BE5C 5KYLA 2JA8B 1TS2A 3D4RA 3GO5A 1B50A 4WRDA 3PIP3 4ZRZA 2JE6I 1GHJA 2X69A 3PUYA 5LHY1 2E74C 3CU7A 3M4OB 5IGBA 4H13C 3S2HB 2KVMA 1D5ZC 2B2UA 4J6HA 2VUMB 5E3FA 5M5XB 5M3FB 5FOBB 3NPPA 3NTHA 1DJRD 4X3SA 5IODA 5ELEA 4H44C 1TS5A 5JVG3 1TVXA 1QG7A 1OXSC 5DM73 3TP8A 4ZQ3A 2SNMA 4A3EB 2DNEA 4O1NA 1EYDA 2EYPA 2N55A 2F0IA 4OIKA 2RKSA 4RH6A 3J7AF 2PNRC 5JAVA 4C1NK 3Q24A 1U9RA 1HTLD 2Q8IB 1NR4A 2PW5A 2B39A 2KCNA 3O13A 4RCOA 2O5IC 1FYCA 3T56B 4QUFA 1ZYRD 2NTSA 2JEBI 1O7ZA 4GZYC 2NTTA 4Q0FA 2IPKD 4A3KB 1G291 2L4NA 1SMYC 4IFDJ 2M2LA 4NKLA 1GUOA 2F0HA 3NP8A 1VCIA 4KN4C 1II3A 2EPBA 3W2DA 4K5VA 4BS9A 4C3HG 2KECA 4FXGC 4U68A 2B2VA 4TSSA 4XQNA 1PYWD 4QIWB 2RA4A 4UDUC 4XT1B 1FGBD 2A5HA 4FF1A 1TWGB 1F2LA 2ID0A 5EBCA 2WINB 3V2TA 1EYCA 1F9PA 1D6EC 1O78A 4TRDA 1HPCA 1EL0A 4CJ1B 4XQQA 1JWMD 2SEBD 1KAAA 1UNSA 5M9OA 2XVSA 2SNSA 4FVMA 5ELCA 3TSSA 1PTOC 3SHLA 1KLGD 5KNCA 3MFGA 4C3HB 2E2IB 1HQMC 2EOTA 3OHXC 2QF7A 1EYAA 2IX1A 1EY8A 4HCEA 5A2QE 2L5TA 1BQQT 1V1PB 3TP5A 4ZUJA 4Q5VA 3CHBD 2M9VA 3VYTA 2G9DA 1RTNA 2E2JB 4OL7A 3DWPA 4OO1H 1TKWB 1RCVD 4KJOA 1H9RA 4O42A 2OF1A 1B9NA 1MGSA 2BA0A 2MHVA 3MTSA 4OO1G 3FVQA 2BE5D 3NSWA 4I65A 3M7NA 3QO2A 1E0BA 1A2TA 1ENFA 5A35A 2FFKB 3DUZA 1AN8A 3MC0B 1MD2D 2CHBD 1AZQA 3Q22A 1PXUA 1AP0A 2RBMA 1A3VA 3VYUA 2MPMA 3N6RA 3GTQB 5DNFA 5C3XA 1B53A 3NTIA 4K2KA 5F2DA 4OO1I 5C0XJ 1ET9A 3CKIB 2RDFA 1X3QA 2LS01 4FF2A 3SEBA 1F2ZA 1SNCA 4XT3B 3D3RA 1JORA 3OPOA 3IFDA 4DAYA 2EY1A 3MFYA 1PFMA 1LT6D 3UI2A 1STYA 3BZDB 4MN3A 5FO8B 3J81L 1YNJC 1PRTC 2EVBA 1O80A 1EU3A 2NVQB 4BBRB 1B3AA 4DU9A 3HOUB 5CBAE 3BYYB 3JAML 2A68C 2V4DA 2F0LA 5EQ0A 3A55A 3D6WA 4IUUA 2H4OA 1A3TA 2JP1A 1BNZA 2Q8TA 2Z4HA 4CJ0B 3NXWA 1PZID 4K2LA 1IW7C 1Y69U 3FEWX 3K7AB 2KCCA 3MVVA 2DY8A 3R93A 1SSOA 4KD3A 4JBWA 1SMYD 3OWFA 4KY7A 4IFDI 3S1MB 4CKBA 2B8FA 2FMMA 1Y1WB 5J39A 3HOXB 4KHVA 1F77A 2F0DA 3GQBA 3MXPA 2A69C 4QUCA 5EBDA 4DFAA 1S5ED 5C4HA 5LL6S 3SK5A 2EY2A 4PMBA 2RSNA 1H9SB 2A73B 3I73A 3A54A 4F7XA 4ZK9B 5ISRA 1G6ZA 5D65A 3VR4A 4FNFA 2AQ3B 4K6DA 1K83B 1WTRA 1G2TA 1DONA 1R4QB 4RHSA 5K36H 1VMPA 2Q8RE 1KDAA 2EYJA 4RWSC 3TDQA 3VYRA 1GUWA 4RKBA 2PYKA 3Q0AA 1SYCA 1O7LA 2CW0C 1JR0D 3OIPA 3K6OA 5K36G 3VA7A 1PTOD 2TSSA 2D9UA 4L6TB 4QCLA 5EKKA 1EY0A 3S1NB 3K0YA 4HN7A 3PUZA 4IURA 1BCPD 1A6XA 1K8MA 3NQTA 1F9RA 3G7LA 2XRQD 3MXGA 3S14B 1DOLA 1UUPA 4RCNA 4G7ZC 3QWNA 4J1MA 5LL6X 1Q8IA 1DCZA 2VB3X 1ZXTA 3BVMA 2L1BA 2LY7A 2NWGA 1EQVA 3E0JA 1ENAA 3R3OA 2F3WA 1FD7D 3SE0A 3GTKB 2D2CC 1Z7TA 2NVTB 5AFWA 4XYQA 1EWCA 5TSSA 4KY5A 1ESRA 2RSOA 3FRPB 2A6ED 1VDZA 5IGDA 3S9WA 5C0XG 2EXZA 5BN4A 3QOJA 2VXWA 2WAQB 4ODGA 3NBHA 3FPUB 2JEAI 3TZDA 4HSPA 1PLFA 2AUKA 3PUWA 3T53B 3E6ZX 3K58A 1Y1VB 5KEEA 2DN8A 1XX8A 5FLXE 2KQ3A 1QCBD 5C0XI 1HFGA 1HXYD 2E75C 3K59A 1CQVA 2MJ8A 4P2CB 4KK7A 1YNNC 4X3KA 5IOCA 5CGKA 3FPPA 1WTVA 2EJFC 4K8JA 3VA5A 1QNUA 2NYZD 2HQEA 1PRTD 1LABA 3I4MB 3TP6A 1HUMA 3S2DB 1GUTA 1A15A 5T1IA 2R93B 2NVYB 2F03A 1BCPF 3HOVB 5J1ZA 5D3DA 3NUCA 1VMCA 1CT1D 2A68D 4L8JA 2BOSA 4OGQC 1TIID 2IX0A 2KEEA 2QDBA 2EYHA 4KKUA 2B63B 5JJZA 5E1FA 4UAIA 2K5WA 1IW7D 4EVOA 1SAPA 3D6CA 4ABNA 1LLRD 2F0FA 4G7OC 3TP7A 1WD0A 3P1HA 1FNWA 5CV7A 1LTAD 5IGCA 3NK9A 1RJTA 4FO2A 2AQ2B 2AWOA 3VR5A 1BUVT 3CQZB 2AUJD 3I3CA 5M3MB 2B2YA 4A3FB 4XDXA 2EZVA 3RZOB 2R3ZA 4PMWA 1STHA 2LFNA 1CQFA 4ZUIA 3D4WA 1ZEQX 1VF7A 3MEHA 2L55A 2K01A 2LKVA 1KNAA 1TWAB 1QB5D 4QB4A 3BVGA 1GOZA 1LTGD 3X3MA 1I50B 1X32A 1CI3M 1EY7A 4A3GB 3H94A 5IGGA 1SYFA 5EKIA 1LTRD 3D8GA 3I4NB 4K5XA 3TN2A 2AQ1B 4KHZA 1TU2B 5M5YB 2O5JC 4YIJA 3OSOA 1BBXC 3BG3A 3DM1A 4IUQA 5I9OA 4HR7B 1MI2A 1STAA 2XWBB 4C3JG 3SR1A 4HCSA 3HS0C 4RGMA 1JC7A 1LTID 1C48A 1B1ZA 2QILA 2Z4IA 1FNVA 4K5WA 1S5CD 2K7VA 2ICIA 2BCOA 1JWUD 2MP1A 3PO2B 1J9OA 4XTCS 3M85A 1WTPA 3VYSA 2RDGA 2F0OA 2D5DA 1G8ZD 4CKCA 1TQOA 1V43A 5BN3A 4BY7B 5CBEE 3ZYYX 1EY6A 2HCCA 4BWGB 5KNBA 3EVQA 5CORA 1LT4D 1KNEA 2MUYA 4C3JB 5EPJA 5D14A 4FF3A 3M3YB 3NBIA 1SNDA 4ZKCB 1HFNA 1SE2A 4X3UA 4C2MB 3HOZB 2XNAC 4G7HC 1I4PA 3HOWB 1V8QA 2B2TC 2F0QA 4E6IA 2F1MA 1JICA 2Z8LA 2K5DA 4M8AA 1STGA 3NTKA 2JXMB 1TR5A 2EE1A 3PIO3 2FHTA 4IN3A 2DY7A 3MXUA 2PMZB 4FP5D 1EOTA 4ID6A 4KKSA 4IZ8A 3P75A 3RMHA 5I6YA 4B9XA 1STEA 1YNND 2B8GA 1RD9D 4B9WA 2K33A 2OT2A 4LMQD 1GUGA 3DMUA 3CRLC 3WDNA 1A3UA 3RZDB 1MSGA 1SJED 1LACA 5DAUA 1I4XA 5CMDA 3A7LA 4EQOA 3EROA 3FDTA 2F0JA 3Q23A 1IL8A 3P7JA 1EWHA 2WB1B 1U4RA 2PPBC 1DD2A 1Z47A 2MGSA 1SNOA 4KN7C 3M4YA 5JEAH 1U4PA 4XQJA 1JOOA 3SK6A 3GTMB 4J8QA 4NW2A 1XWEA 3F2UA 2XWJB 4A3JB 3FKIB 2Y0SB 4IUNA 3EFXD 5J22A 5JEAG 3ITPA 5C4ZA 1TT2A 3GP7A 3A8KE 4G57A 2A6HC 2KUMA 1RDPD 4DAPA 2NUCA 3GTLB 3EJIA 2QKIC 2OEOA 5CV6A 5G3LD 4KV6A 2JA6B 2ZXRA 2LMCB 4RA8A 3U9OA 3K5LA 3J80E 5KYIA 3J7AV 4FXDA 4QF4A 1IKMA 4LJZC 1BOSA 1QJOA 1PZKD 3HZXA 4WJWA 1QNKA 4C1NI 4K14A 1LTBD 1LT5D 2NN6H 3QOLA 1DXMA 4HAEA 2E2DC 1TWFB 4TKOB 1B44D 1BO0A 2JYOA 1HTPA 4PNYA 1SE3A 3R2IA 1OXUA 4BA1I 2SOBA 1AFPA 1D2BA 1D5MC 3G6JB 1PTOH 5C4JB 1H9MA 2EY5A 2F0TA 4RGTA 2F0VA 1CZGA 2EYOA 1QILA 2IT1A 3ONAB 3WOFA 1ESFA 4HMIA 4DK0A 2IL8A 1OXVA 3KF8A 3BYTB 3R8BA 1ZKOA 1WTOA 1HCZA 3GTOB 1SYEA 1KLUD 2K32A 2QEJC 3OIQA 2IX3A 5IT9E 4IUVA 1I4HA 1JQYD 3QG1A 4DF7A 3RUZA 3AMUA 4RFBA 1Q1BA 3T13A 1JE4A 2J4XA 3OMCA 2F0EA 1S5DD 2NBFA 1S5BD 4RHRA 4A93B 1K8OA 2B2WA 5FO9B 1DM0B 4R8IA 4K6LA 1I6VC 2FJ2A 4L63B 1IYVA 1CA5A 2X6LA 1KDCA 3A8JE 5EPLA 4OHJA 3QJYA 1BCPB 3HG9A 4G4KA 3FMCA 1Y8OB 5D3IB 5A2QL 3HEJA 1L0YB 4N9TA 4RGOS 2EYMA 1F2MA 1A2UA 2F0WA 1HRJA 3IAYA 1I6HB 1G2SA 1EY9A 1EZ8A 4FYDA 1LO5D 3TBIB 3I4LA 3MAQA 1GUNA 2HCIA 2L0CA 1E2WA 3KLSA 1AEXA 3Q6SA 1ZYRC 1PZJD 1NUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KF8 A; 
#chains in the Genus database with same CATH topology
 1FJG Q;  4DXG A;  1CTM A;  3TME A;  1LTL A;  1GVP A;  2AHO B;  3HRZ C;  5IE8 A;  3HGB A;  3I72 A;  5IYC G;  2Z9H A;  3BVZ A;  1GUS A;  2B2Y C;  2E2H H;  4YCV A;  2VNU D;  5IP7 G;  1G91 A;  3V96 A;  2B2U C;  2F0P A;  1EFW A;  2XIW A;  3S1Q H;  2LXJ A;  1VQM A;  1STN A;  2ZJP A;  4B3S Q;  4OX9 L;  2EJM A;  1E1O A;  4R4T A;  1BDO A;  2I46 A;  2Z6K C;  4KY6 A;  3H3V I;  1O7Y A;  4GKK L;  1SYB A;  3NQI A;  3E3X A;  4DK1 A;  3RN5 A;  4Y52 H;  2D62 A;  4DXF A;  3C3L A;  2OCE A;  3J80 i;  3NHH A;  1GHK A;  1XMO Q;  4JI7 Q;  2VB2 X;  4LF9 Q;  4F87 A;  4DR3 Q;  1U4M A;  2F4I A;  1G6P A;  4DR6 Q;  3H09 A;  1EZ6 A;  4A3C H;  2CWA A;  5FO7 B;  4A3L H;  3HKZ B;  3GD7 A;  3KBG A;  5KIX A;  1UE1 A;  4BBS H;  3PIO A;  3LWE A;  2JA8 H;  3UE0 A;  1I4G A;  1BBU A;  4EQ5 A;  5IYB H;  1J6Q A;  1YIT A;  1GXD C;  5ELN A;  1WTX A;  1VQD A;  2DJF C;  5J3B A;  2JN4 A;  1HUN A;  5C44 H;  4A3L G;  1ILQ A;  1XXG A;  4TQU S;  1CA6 A;  5IYB G;  5EPK A;  3PUV A;  3M4O H;  1IL2 A;  5GAE C;  3L7Z C;  1F9S A;  2J7Z A;  3D4D A;  1IYJ B;  1PTO F;  1YNJ D;  3S2H H;  1EIH A;  1Q3L A;  2E2H B;  5C44 G;  3DEP A;  4A3I H;  4OIJ A;  3MWY W;  3NBH B;  2SDF A;  4UHV A;  1Q82 C;  3AU7 A;  2B3G A;  2O2L D;  1B8A A;  2BA1 A;  2VUM H;  5KND A;  1K0S A;  2B2V C;  3K5N A;  2KA7 A;  3ICE A;  2PZW A;  3PSI A;  5M3F H;  2XN9 C;  2CWP A;  3BDO A;  4H7B A;  1BBW A;  1K3B C;  5LMN Q;  2K04 A;  4KKT A;  2L9H A;  1SYG A;  4N9P A;  1L2F A;  4A3I G;  2PCF B;  1CZW A;  4R8N A;  4P72 A;  1X3E A;  1H9K A;  4DNT B;  2AWN A;  3LGJ A;  1YJN A;  1TY0 A;  3BDC A;  3W1G A;  4A3E H;  1WD1 A;  3J7Y W;  1I4R A;  3U50 C;  1W6K A;  4DAV A;  5IT9 L;  2DJG C;  4CBV A;  2TMP A;  2G9H D;  2F0S A;  3OWE B;  1S3O A;  3U9S A;  4CHT B;  3IKJ A;  2YU9 B;  1IKL A;  2F0N A;  3KUP A;  3MZ5 A;  3OTO Q;  2UUA L;  1UEB A;  2PZT A;  5FLM H;  1OXX K;  5CV5 A;  4A3E G;  1M8A A;  1CK1 A;  2UUC L;  4HED A;  2E5L L;  4DV4 L;  4EQN A;  4FF4 A;  4KD4 A;  4LFC L;  1RF2 D;  2AMC B;  2YTY A;  2E76 C;  5C44 B;  1VQB A;  4JI4 L;  2A69 D;  1IBL L;  2K05 A;  2KOL A;  4XYO A;  2Z1C A;  4KJN A;  4YY3 L;  2K28 A;  1N36 L;  1EQR A;  1L1O A;  2K50 A;  4A3K H;  2WAC A;  2FXQ A;  3IFT A;  4ULL A;  4AQY L;  5JEA J;  4I7Z C;  2R6G A;  4DA2 A;  4GKK Q;  1HA5 A;  3D31 A;  2CKZ B;  3A5Z B;  1VQK A;  1MSH A;  2JA7 G;  3GTP B;  4A3I B;  2JA9 A;  1A63 A;  1PH3 A;  4NXM L;  4A3K G;  1NNX A;  1EIG A;  1Y8P B;  4A3B H;  1IBM L;  3KK7 A;  5I2Y A;  1D5X C;  2HHH L;  2F4V Q;  4P74 A;  1X3P A;  1NCV A;  2CW0 D;  1LM0 A;  4IJH A;  2LSS A;  5FKA C;  2EDG A;  1QVC A;  2K5Q A;  4XIG S;  4X66 L;  3KYH C;  3J80 c;  3CMA A;  3W3A A;  4B3M Q;  4A3B G;  1PRT F;  5JPN C;  4KI0 A;  3ER0 A;  3NWT A;  1WTQ A;  5C5L A;  2WII B;  1IHZ A;  1ICF B;  3PV0 A;  4DR5 L;  2K5V A;  1SEB D;  1SYD A;  3J81 E;  2CCZ A;  3OOC A;  3ND9 A;  5IGF A;  4IJL A;  1W2B A;  3PO3 H;  2PZU A;  4CKE A;  2R7D A;  2KJX A;  5CR3 A;  1TS3 A;  5CYU A;  2JA7 B;  1EY5 A;  5CC4 A;  3SDZ A;  1UE7 A;  1PFB A;  3JAM E;  2WAQ E;  4HJ7 A;  1R9T B;  2UXC Q;  1E2Z A;  4L5T A;  3I56 A;  1PH1 A;  1PH4 A;  3NWS A;  3PO3 G;  2E2I H;  4GN4 B;  3UDI A;  4DUY L;  2EJG C;  1SFO B;  4LWC A;  1Y8N B;  4X64 Q;  3LNN A;  5IIF A;  3QB3 A;  2L12 A;  4IPG A;  4X62 L;  1RHP A;  2GN5 A;  1N34 L;  4BA2 I;  1KTK A;  1XTC D;  5I9P A;  2EY6 A;  3A8I E;  3SXH A;  4A3B B;  5CV8 A;  1EY4 A;  4DUZ Q;  1C8C A;  1UEA B;  2R7Z G;  3AB9 A;  2PQE A;  1U0L A;  2KHJ A;  2E2J H;  3DEO A;  3T4A C;  5FLX L;  2UUA Q;  2MQH A;  1V1P A;  5GAD C;  1JWS D;  2EQS A;  4JPB W;  4DV2 Q;  2FIN B;  3RLF A;  2UUC Q;  2E5L Q;  3S24 A;  3QIA A;  4F88 A;  5IT9 c;  1STB A;  4IUP A;  4DV4 Q;  1VQL A;  4NDX A;  5ELF A;  4LFC Q;  2A74 C;  3C2P A;  2LXK A;  1TWC B;  1E2V A;  3HP3 A;  4R1J A;  2I07 B;  1D1K A;  5C4X H;  4R9W A;  2NB0 A;  2ENB A;  4ZLT F;  4JI4 Q;  4CDC C;  1NMF A;  4NMZ A;  1XPR A;  3T1Y Q;  2YYZ A;  3TEH B;  4LK1 C;  4HJ8 A;  3PMF A;  4A75 A;  1OXT A;  1RIP A;  5BN5 A;  3PO3 B;  5C3E H;  2C9O A;  5C4X G;  4HTH A;  1HZB A;  1SN8 A;  4B08 A;  2G5D A;  4RGN A;  2E8G A;  5NUC A;  4LAA A;  4ZKB B;  2K75 A;  4RKL A;  1D7Q A;  5CV9 A;  3LWU A;  3OMG A;  3DWQ A;  4X3T A;  3H91 A;  4YWM A;  3A5U A;  1DYQ A;  1UE6 A;  3GTQ H;  3I8Z A;  5C3E G;  5K5P A;  1BCP C;  1PHJ A;  3KLS X;  4QGU A;  1IBM Q;  1MBY A;  3DHQ A;  2R7Z B;  2ICE C;  1DOK A;  1LV9 A;  3G6E A;  2XSC A;  5I2X A;  4DR4 Q;  3VR3 A;  1WCM G;  1JMC A;  1K8A C;  3C1E A;  3SK8 A;  3GV6 A;  1NE3 A;  1QWY A;  2JSO A;  4X66 Q;  4KMU C;  3U4Z A;  3SVM A;  2ATW A;  3PQI A;  1E24 A;  4DR5 Q;  2L11 A;  3GV3 A;  2WKD A;  3RD4 A;  3DXJ C;  4HSV A;  4NP5 A;  1KRT A;  3AFQ A;  2XRS D;  3I91 A;  5ELB A;  3V05 A;  2KCT A;  5C4X B;  2B2W C;  1V1O A;  1JOQ A;  1BR9 A;  1AE3 A;  2WP8 J;  2R7F A;  4BBR H;  5KGU A;  4EGV A;  3BDL A;  2A6E C;  3HOY H;  4MHE A;  4JG2 A;  4HJ5 A;  2I5L X;  1WVL A;  4BY1 G;  5HGT A;  1S4Z A;  3FP9 A;  2K5H A;  5C3E B;  3PGZ A;  4KHP L;  1PDQ A;  3T51 B;  3N52 A;  4H0L C;  4AYB G;  1EWI A;  4DV5 Q;  5FK9 C;  1QOH A;  2EYL A;  4A3D H;  4X62 Q;  1ET6 A;  3HOY G;  5DEH A;  2F0M A;  5I4D A;  4N8F A;  1WCM B;  3EA6 A;  3PF5 A;  3K7A H;  4S3S A;  1CHQ D;  4DR7 L;  2EYF A;  3LX0 A;  5M5W H;  1KAB A;  2FMC A;  3AEV A;  2R92 H;  2D0P A;  1IYU A;  1P16 A;  2QCP X;  1VQA A;  1R4P B;  5I6W A;  4JI5 Q;  2MO0 A;  4A3D G;  3OW7 A;  5DM6 3;  4IUT A;  1MJC A;  4TVA B;  3S1M H;  1PFN A;  1RKN A;  2IW3 A;  1Y1W H;  1EQQ A;  1NR2 A;  2JA5 G;  3A56 A;  1EIF A;  4RAU C;  2K6A A;  1ML0 D;  4GS3 A;  3K5M A;  2R92 G;  3KBX A;  4C3I G;  3H3V C;  4JI2 L;  5CV4 A;  1CKN A;  2F0G A;  2CVR A;  2GVA A;  1VQG A;  3J81 i;  5GRO A;  1VQJ A;  1B4O A;  3QR8 A;  4ZYS A;  1ICW A;  5E4W C;  1WYD A;  3K57 A;  4HID A;  3GTJ B;  4IFD H;  1F9Q A;  1TWH B;  4Z9C B;  1S40 A;  1M4V A;  2NN6 G;  4BY1 B;  1PH8 A;  2ZXO A;  4V0B A;  1H95 A;  1JB3 A;  4IQZ A;  1DZ1 A;  4AYB B;  2I5H A;  5C3W A;  1T5X D;  1K28 A;  5KRU A;  2B29 A;  5JPM C;  4JI1 L;  3S1R B;  3HOY B;  1SNM A;  3VR2 A;  2KHI A;  1H9S A;  4QIW E;  4IFD G;  2B2T A;  4FXK C;  3BJU A;  4K8I A;  2CQA A;  3RLO A;  1Q86 C;  1K9M C;  3I70 A;  3IL8 A;  3H15 A;  3PIP A;  2J0T D;  1GJX A;  4PMC A;  2F3V A;  4A3D B;  1HQR D;  1EU4 A;  4M1U B;  4DK3 C;  1TY2 A;  1CM9 A;  3NE5 B;  1YZ6 A;  4WFN 3;  5IGE A;  2NN6 I;  2JA5 B;  5M5W B;  2RCF A;  2R92 B;  1U4L A;  5C5M A;  4C3I B;  1UAP A;  2M00 A;  2PO4 A;  1Q12 A;  3TQY A;  2HIX A;  1LTT D;  3CW2 C;  1HHV A;  3ND8 A;  2H1E A;  1C4Q A;  2QDL A;  2ZXP A;  4JBJ A;  5EKL A;  4WJ4 A;  1J8I A;  4LF4 L;  2OXP A;  2A19 A;  4NXN Q;  3FHW A;  3R2T A;  2WV6 D;  1VQN A;  5IP9 G;  3URY A;  3S17 B;  2PMZ E;  2CFM A;  2PW7 A;  3L9A X;  5G3L F;  1HNZ L;  3KF8 B;  1XYI A;  5EGT A;  1PTO B;  1HA6 A;  1LTS D;  2ZTD A;  2NVX H;  1GM5 A;  3CRK C;  2Q2T A;  4R4C A;  1AW7 A;  2O4X A;  4C56 C;  2NVT H;  1VF5 C;  3L2P A;  2F3I A;  3M7G A;  1T5E A;  4EQP A;  1EFI D;  5JVH 3;  4QMG A;  4DR7 Q;  1F2Y A;  1BF4 A;  1HJP A;  3S16 B;  1Q81 C;  4PV1 C;  2OTL A;  1SXT A;  3KF6 A;  1VQ5 A;  1QE6 A;  2C5C A;  4MIU A;  1HR0 L;  1B9M A;  2HDL A;  3PCO B;  3MXN A;  1I4Q A;  1GD7 A;  2F0K A;  4XXE A;  1SBB B;  1JJ2 A;  3C46 A;  3L3O C;  2EIF A;  1ILP A;  1FNU A;  1Y1V H;  2DNC A;  1TS4 A;  2BDO A;  1EEF D;  3H0G G;  1SDF A;  4YCW A;  2N88 A;  3C1F A;  4CGY B;  1KDB A;  1RTO A;  2Q2H A;  3NEM A;  4ME5 A;  1SNP A;  2Y0S E;  1XNR L;  4BXX H;  3SK4 A;  1B2T A;  3A7A B;  2WKC A;  3M9B A;  4DV0 L;  3TRZ A;  1ASY A;  1Y1V G;  1D1I A;  3M4Q A;  1K73 C;  3GTG H;  4DN4 M;  3ULL A;  1WTH A;  2RVL A;  3E5S A;  1YI2 A;  1CHP D;  4JI1 Q;  1Q1E A;  1YHB A;  3VDY A;  2R61 A;  1ENC A;  1WTW A;  3KLW A;  3WWV A;  3J81 c;  1ROD A;  1Z6H A;  1M1K C;  1KC8 C;  2ZT9 C;  3I55 A;  1BXT A;  2NVX B;  5C0X H;  5HUR A;  1E22 A;  3VR6 A;  1PMR A;  4HJA A;  4I7A A;  3S2D H;  4JK1 C;  1I3Q H;  4PQX A;  3MXN B;  1X55 A;  2R93 H;  4DPG A;  3WOE A;  1CSP A;  1SMX A;  3JAM c;  2OQ0 A;  2KED A;  1SNQ A;  3HOV H;  1SE4 A;  4HMJ A;  2NZ1 D;  3H6M A;  3J80 L;  3BU2 A;  2A6H D;  4HJ9 A;  2ES2 A;  2K03 A;  4LFA L;  4DNR B;  2RQX A;  3H0G B;  1EEI D;  1JCK B;  2QEX A;  3CCL A;  1OO9 B;  3DM3 A;  2K1B A;  4ILW A;  2B63 H;  3MA2 B;  1LT3 D;  4A3M B;  4WJ3 M;  4DV3 L;  4QY7 A;  3K5O A;  3JC6 6;  4V19 0;  4P73 A;  1NAP A;  2BDN A;  4JW0 A;  4LF4 Q;  1K0R A;  4NB3 A;  3S15 B;  1KXL A;  4Y7N B;  4A3C G;  1PRT B;  5C6A A;  5T1G A;  1AZP A;  4GNX A;  4BBS G;  2JA8 G;  1W6J A;  3PUX A;  2OTJ A;  4OON A;  3T16 A;  1HNZ Q;  4JI0 L;  4U67 3;  1DOM A;  1FR3 A;  1NSN S;  3BS1 A;  1EQT A;  1XJV A;  1LYL A;  3ERQ A;  1VQE A;  2HUG A;  4ZAI A;  3DWA A;  4KTA A;  3GTG B;  3U58 A;  3TZU A;  4IO9 A;  3CQZ H;  1T9H A;  5EJW A;  2IJ0 A;  4DGZ A;  5M3M H;  5COY A;  1L0W A;  3S1Q B;  1S5F D;  1L0X B;  1ONL A;  3UE1 A;  3KLR A;  3RZO H;  2KHS A;  4FDB A;  2VQF Q;  2IWH A;  4IOC A;  1N33 Q;  5M5X H;  1H9J A;  3X3N A;  5E4X A;  1W3S A;  1TWA H;  1HR0 Q;  1TXY A;  3P20 A;  1VQP A;  1I3Q B;  1JOK A;  2GA4 B;  3CC7 A;  4LF5 Q;  4CDD C;  2X6G A;  2D0O A;  5JOB A;  3EQL C;  3MHB A;  4JC0 A;  2VUM G;  5ELD A;  1Q90 A;  1QZH A;  1JJG A;  4IAL A;  2UUB Q;  5IY0 A;  5M3F G;  1SJH D;  2F0U A;  3I90 A;  5GQO A;  2HDM A;  4CJ2 C;  4WOR A;  1CFM A;  4A3G H;  2VY3 A;  1C9O A;  2RDH A;  4F8M A;  3I4N H;  4BBS B;  2BE5 C;  5KYL A;  4GNX B;  2JA8 B;  1TS2 A;  3D4R A;  3GO5 A;  1B50 A;  2OQK A;  1MKH A;  1QZG A;  3AQQ A;  5M5Y H;  4CDE C;  4WRD A;  5DLQ E;  3PIP 3;  4OEM B;  4DNI A;  2JE6 I;  4ZRZ A;  4DV0 Q;  1GHJ A;  4A3G G;  2X69 A;  3PUY A;  5LHY 1;  2E74 C;  1P8L A;  5FLM G;  3CU7 A;  3M4O B;  5IGB A;  5LMU L;  4DV1 L;  3ZJY C;  4OX9 Q;  4H13 C;  4X65 L;  2A8V A;  3UDX A;  3S2H B;  3K7U C;  2KVM A;  3RR5 A;  1X3G A;  3UDG A;  1X9N A;  2IHE A;  1D5Z C;  1GO3 E;  2B2U A;  4J6H A;  2VUM B;  3PO2 H;  5E3F A;  5M5X B;  5M3F B;  2KBN A;  2L15 A;  5FOB B;  3NPP A;  3NTH A;  1DJR D;  4X3S A;  5IOD A;  1YHA A;  2JK8 A;  5ELE A;  2IY5 B;  2Z6K A;  4H44 C;  1TS5 A;  5JVG 3;  1JT8 A;  1TVX A;  1QG7 A;  4OWT B;  1OXS C;  5HGQ A;  5DM7 3;  4BY7 H;  2NZH A;  1E1T A;  3TP8 A;  4ZQ3 A;  3PO2 G;  4DV3 Q;  2SNM A;  4A3E B;  2DNE A;  4O1N A;  4DV6 L;  1EYD A;  2EYP A;  2N55 A;  1EYG A;  2F0I A;  4OIK A;  1TWG H;  2RKS A;  3GDE A;  4RH6 A;  3J7A F;  2PNR C;  5JAV A;  1I94 L;  1NMG A;  4C1N K;  3Q24 A;  1EIY B;  2HQL A;  1KD1 C;  1U9R A;  3L0O A;  3M3Y H;  1HTL D;  2QA4 A;  3G48 A;  2Q8I B;  1VQI A;  1A0I A;  2UXB L;  5EAY A;  1L1O B;  1NR4 A;  4MZ9 A;  4C2M H;  2PW5 A;  5HY6 A;  2YTV A;  2B39 A;  1Q8K A;  2KCN A;  3O13 A;  4RCO A;  2ZM6 L;  2O5I C;  1FYC A;  3T56 B;  4QUF A;  2CH4 A;  4JV5 L;  1ZYR D;  2NTS A;  4UY8 C;  2JEB I;  4GOP A;  1O7Z A;  4GZY C;  2UU9 L;  2NTT A;  4Q0F A;  2IPK D;  4A3K B;  1G29 1;  4C3H H;  2L4N A;  1SMY C;  4IFD J;  2M2L A;  1PA6 A;  4NKL A;  1GUO A;  2F0H A;  3ULP A;  4PZ7 A;  3NP8 A;  1VCI A;  5IYD H;  3CCE A;  1HZA A;  4LUZ A;  4KN4 C;  1II3 A;  3K80 C;  2EPB A;  3W2D A;  1V1Q A;  4K5V A;  4BS9 A;  4C3H G;  4HIK A;  2KEC A;  4FXG C;  4U68 A;  1XPO A;  1N9W A;  2B2V A;  4TSS A;  4XQN A;  1PYW D;  4QIW B;  5BR8 L;  2DGY A;  4JVZ A;  2RA4 A;  4UDU C;  4XT1 B;  3RZD H;  4R4O A;  4R4Q A;  1FGB D;  4UP9 A;  1C7Y A;  1MIU A;  2A5H A;  4FF1 A;  1TWG B;  1F2L A;  1IBL Q;  4JCV E;  4JBK A;  2ID0 A;  5EBC A;  4L5R C;  2WIN B;  3V2T A;  1EYC A;  1F9P A;  1D6E C;  4YY3 Q;  4GOP B;  1O78 A;  5LMU Q;  4DV1 Q;  1N36 Q;  4TRD A;  4X65 Q;  1HPC A;  1EL0 A;  4CJ1 B;  3CP0 A;  4XQQ A;  4AQY Q;  1JWM D;  2N49 A;  2SEB D;  1KAA A;  1UNS A;  5M9O A;  3GTM H;  2XVS A;  2SNS A;  4FVM A;  5ELC A;  3TSS A;  4A3J H;  3FKI H;  3I7F A;  3W1B A;  1PTO C;  4NXM Q;  3SHL A;  4LFB L;  1KLG D;  4DK6 C;  5KNC A;  3MFG A;  2VQE L;  3CPF A;  4C3H B;  2E2I B;  1HQM C;  2EOT A;  2ASB A;  3OHX C;  3SGI A;  2QF7 A;  3OYY A;  1U5K A;  3KDF A;  3GTL H;  2HHH Q;  3FKI G;  1EYA A;  2IX1 A;  1EY8 A;  4PG3 A;  1WI5 A;  4HCE A;  3W5O A;  5A2Q E;  2L5T A;  1BQQ T;  1V1P B;  3TP5 A;  2JA6 H;  1HZ9 A;  4ZUJ A;  4DV6 Q;  4Q5V A;  1N32 L;  2K4K A;  5AJ3 L;  3CHB D;  2M9V A;  3VYT A;  2G9D A;  4L5Q A;  1RTN A;  2E2J B;  4OL7 A;  3DWP A;  1KQS A;  4OO1 H;  1TKW B;  3D0F A;  1RCV D;  4KJO A;  1XTD A;  1H9R A;  2UXB Q;  4O42 A;  3K81 C;  2OF1 A;  1B9N A;  1JE5 A;  3CCU A;  1MGS A;  3I4O A;  2ZM6 Q;  2BA0 A;  2NVQ H;  2PQA A;  2MHV A;  3BZK A;  4JV5 Q;  1XMQ L;  3HOU H;  3MTS A;  4PZ8 A;  4OO1 G;  3FVQ A;  2BE5 D;  3DLL A;  3NSW A;  2UU9 Q;  4I65 A;  3M7N A;  3QO2 A;  4YHH L;  1E0B A;  4DUY Q;  1A2T A;  1ENF A;  5A35 A;  4O0A A;  5C4J H;  3EIV A;  2FFK B;  3DUZ A;  1AN8 A;  3M4P A;  4DR1 L;  3MC0 B;  1J5E L;  4BBR G;  1MD2 D;  3HOU G;  2CHB D;  1AZQ A;  3Q22 A;  1PXU A;  1N34 Q;  1AP0 A;  2RBM A;  1A3V A;  4RG1 A;  2MPM A;  3N6R A;  3VYU A;  3GTQ B;  5DNF A;  2KCM A;  5C3X A;  4DV7 L;  1SLJ A;  2Q2U A;  1B53 A;  3NTI A;  4K2K A;  5F2D A;  4GKJ L;  4OO1 I;  5C0X J;  1ET9 A;  3CKI B;  5JJL A;  2RDF A;  1X3Q A;  2LS0 1;  4FF2 A;  3SEB A;  1F2Z A;  1SNC A;  4XT3 B;  3HOX H;  3D3R A;  1JOR A;  4LW1 A;  3OPO A;  3IFD A;  4DAY A;  2EY1 A;  3MFY A;  1PFM A;  1LT6 D;  3UI2 A;  2QW7 A;  4UPA A;  1STY A;  3BZD B;  3CF5 A;  2MNA A;  4R4I A;  1Y1W G;  4MN3 A;  5FO8 B;  3J81 L;  1YNJ C;  3HOX G;  1XNQ L;  1PRT C;  3CCR A;  3J7Z C;  2EVB A;  5IWA L;  1O80 A;  3EN2 A;  1EU3 A;  2NVQ B;  1IXR A;  2BH2 A;  4OWW B;  4BBR B;  1B3A A;  4DU9 A;  3HOU B;  4YWK A;  5CBA E;  3BYY B;  1K83 H;  3F2C A;  4APV A;  2A68 C;  2V4D A;  2F0L A;  5EQ0 A;  3JAM L;  4LFB Q;  3A55 A;  2VQE Q;  3D6W A;  1WFQ A;  4OEL B;  4IUU A;  2H4O A;  1X54 A;  1A3T A;  2JP1 A;  1BNZ A;  2Q8T A;  4DAM A;  4JBM A;  2Z4H A;  4CJ0 B;  3J81 j;  3NXW A;  4ALP A;  4AH6 A;  4JOI A;  1PZI D;  4K2L A;  1IW7 C;  1Y69 U;  3FEW X;  4GN5 A;  4POG A;  3K7A B;  2KCC A;  3MVV A;  2DY8 A;  4B3S L;  5AJ3 Q;  3R93 A;  1SSO A;  4JI6 L;  4KD3 A;  3S1N H;  1CKN B;  1HNW L;  4JBW A;  1SMY D;  3OWF A;  4KY7 A;  4IFD I;  4N8X 1;  3S1M B;  4CKB A;  2B8F A;  1NTG A;  2FMM A;  2EXD A;  1E3P A;  1Y1W B;  3S14 H;  5J39 A;  5E7N A;  3HOX B;  1XMO L;  4LF9 L;  4KHV A;  1F77 A;  1GKH A;  2F0D A;  4DR3 L;  3GQB A;  2YTX A;  5JJK A;  3MXP A;  4DR6 L;  2A69 C;  4QUC A;  5EBD A;  4DFA A;  1S5E D;  3CCV A;  4GNX C;  4GLA C;  5C4H A;  5LL6 S;  1JJC B;  3SK5 A;  2EY2 A;  4PMB A;  2RSN A;  2I5M X;  1H9S B;  2A73 B;  3I73 A;  3A54 A;  4YHH Q;  3MEF A;  4F7X A;  4ZK9 B;  1NBW A;  5ISR A;  3GTK H;  4KHP Q;  1G6Z A;  1J5E Q;  1VS0 A;  2NZO A;  5D65 A;  3VR4 A;  5LMN W;  4FNF A;  2AQ3 B;  4K6D A;  1K83 B;  1B70 B;  1WTR A;  2H5X A;  1XPU A;  1G2T A;  1DON A;  4JYA L;  1R4Q B;  4RHS A;  5K36 H;  3EBE A;  1VMP A;  2Q8R E;  1KDA A;  2EYJ A;  1PV4 A;  4RWS C;  3TDQ A;  3VYR A;  1GUW A;  4RKB A;  4GKJ Q;  2PYK A;  3Q0A A;  1FL0 A;  1SYC A;  1O7L A;  2CW0 C;  1JR0 D;  2WB1 E;  1X6O A;  1YEZ A;  4LUO A;  4KLK A;  3OIP A;  4LF6 L;  5GAG C;  3TS2 A;  3K6O A;  5K36 G;  3VA7 A;  1PTO D;  2TSS A;  2D9U A;  4L6T B;  1A8V A;  3ULJ A;  4QCL A;  4JI2 Q;  5EKK A;  1EY0 A;  3S1N B;  3K0Y A;  4HN7 A;  3PUZ A;  4IUR A;  2WAQ G;  1BCP D;  1A6X A;  3AYH B;  1K8M A;  2I0Q A;  3NQT A;  3G7L A;  1F9R A;  2ALY B;  2XRQ D;  3MXG A;  2Z6B A;  3J7A 5;  3KJP A;  1DOL A;  3S14 B;  1UUP A;  4RCN A;  4G7Z C;  2KEN A;  3KOJ A;  3QWN A;  1EUJ A;  4J1M A;  5LL6 X;  1Q8I A;  5IWA Q;  3TS0 A;  1DCZ A;  2VB3 X;  2ZJR A;  4MTK A;  3CAM A;  1ZXT A;  3AFP A;  3BVM A;  4J15 A;  2L1B A;  2LY7 A;  2NWG A;  1EQV A;  3F1Z A;  3E0J A;  1S72 A;  1ENA A;  3R3O A;  2F3W A;  1L1O C;  4BXX G;  3I2Z A;  1FD7 D;  3SE0 A;  1KL9 A;  1VQ4 A;  1OTC A;  1YIJ A;  5H1S E;  3GTK B;  3KF6 B;  4L5S A;  2D2C C;  1Z7T A;  2NVT B;  3I4M H;  5AFW A;  4XYQ A;  1EWC A;  2NVY H;  1UWV A;  5TSS A;  1M90 C;  1HZC A;  4KY5 A;  1ESR A;  2RSO A;  1Y14 B;  3FRP B;  2A6E D;  1VDZ A;  5IGD A;  1V9P A;  2ZTE A;  3S9W A;  5C0X G;  2EXZ A;  4EX5 A;  4JI6 Q;  5BN4 A;  3QOJ A;  3CCQ A;  3I4M G;  1HNW Q;  3TRE A;  2VXW A;  2WAQ B;  4ODG A;  2R93 G;  3NBH A;  4DR2 L;  3FPU B;  2JEA I;  3TZD A;  3HOV G;  4HSP A;  1PLF A;  2AUK A;  3PUW A;  3T53 B;  2PI2 E;  3E6Z X;  3K58 A;  3PF4 A;  1Y1V B;  2YU9 H;  4IOA A;  5KEE A;  2DN8 A;  2B63 G;  1XX8 A;  5FLX E;  3CXC A;  2F4V L;  4AYB E;  2KQ3 A;  1QCB D;  5C0X I;  4MTN A;  1HNX L;  1HFG A;  2CH4 W;  1HXY D;  2RF4 A;  2E75 C;  2CQO A;  3K59 A;  4B3M L;  3A0J A;  1CQV A;  2MJ8 A;  4A3F H;  4GOP C;  3B6Y A;  4P2C B;  2C35 B;  1SRU A;  4KK7 A;  1YNN C;  4X3K A;  5IOC A;  3KJO A;  4JYA Q;  4LUV A;  5CGK A;  3FPP A;  1C0A A;  1WTV A;  2ZJQ A;  2EJF C;  4K8J A;  5ELO A;  4MNO A;  3VA5 A;  1QNU A;  4LF7 L;  2NYZ D;  2HQE A;  1PRT D;  1LAB A;  3I4M B;  3TP6 A;  1HUM A;  2MO1 A;  5M3M G;  3S2D B;  4A3F G;  1GUT A;  1A15 A;  5T1I A;  2R93 B;  2NVY B;  4AIM A;  1VQH A;  3GTP H;  2F03 A;  1BCP F;  1I50 H;  4LF6 Q;  3HOV B;  5J1Z A;  5D3D A;  2UXC L;  3NUC A;  1VMC A;  1CT1 D;  2A68 D;  4CDF C;  2HIV A;  3OW2 A;  4L8J A;  2BOS A;  4OGQ C;  1TII D;  2IX0 A;  2KEE A;  4X64 L;  2QDB A;  2EYH A;  4KKU A;  2B63 B;  1QUQ A;  2AKW B;  3E9I A;  3RLN A;  1XNR Q;  5JJZ A;  5E1F A;  4UAI A;  2K5W A;  1IW7 D;  1SRO A;  1SAP A;  2N3S A;  4EVO A;  3D6C A;  4ABN A;  1LLR D;  2F0F A;  4JI8 L;  4G7O C;  3TP7 A;  2F52 A;  1WD0 A;  1YBY A;  3P1H A;  1FNW A;  5CV7 A;  1LTA D;  4DUZ L;  3I4N G;  5IGC A;  2RCN A;  1RJT A;  3NK9 A;  4FO2 A;  2AQ2 B;  2AWO A;  3VR5 A;  4DV2 L;  1BUV T;  4YCU A;  1QVF A;  1Z9F A;  2WFW A;  1FVI A;  4IPD A;  1VQ8 A;  3CQZ B;  1QVG A;  2AUJ D;  3I3C A;  5M3M B;  3G71 A;  2B2Y A;  4A3F B;  4A4I A;  2JA7 H;  4XDX A;  2EZV A;  3RZO B;  2R3Z A;  4PMW A;  1STH A;  2LFN A;  3T1Y L;  1CQF A;  4ZUI A;  2UXD L;  3D4W A;  1R9T H;  1ZEQ X;  1HH2 P;  1VF7 A;  3MEH A;  2L55 A;  2K01 A;  1VQC A;  1MJE A;  2LKV A;  2RHQ B;  1KNA A;  2Z0S A;  1TWA B;  1X65 A;  4LFA Q;  3RN2 A;  1QB5 D;  4QB4 A;  1SFO H;  3BVG A;  1GOZ A;  1LTG D;  1DGS A;  3X3M A;  1I50 B;  1X32 A;  4DR2 Q;  3E0E A;  1CI3 M;  1QUQ B;  1EY7 A;  1RL2 A;  1SR3 A;  3HFZ B;  4A3G B;  1NY4 A;  2VS1 A;  3H94 A;  5IGG A;  1SYF A;  5EKI A;  1LTR D;  1D8L A;  3D8G A;  3I4N B;  4C3J H;  1PH9 A;  4PZ6 A;  4BY7 G;  4K5X A;  3TN2 A;  2AQ1 B;  4KHZ A;  4B3R L;  1TU2 B;  1VQO A;  4JI0 Q;  5M5Y B;  3CCM A;  1HNX Q;  4DR4 L;  2O5J C;  4YIJ A;  1KHI A;  3OSO A;  1BBX C;  3BG3 A;  3HOZ H;  1MHW C;  3DM1 A;  4IUQ A;  4HR7 B;  5I9O A;  1MI2 A;  1TWC H;  1STA A;  2XWB B;  3HOW H;  1I5F A;  4C3J G;  3SR1 A;  4HCS A;  3HS0 C;  4OXP A;  4RGM A;  1JC7 A;  1LTI D;  1C48 A;  1B1Z A;  1EOV A;  1YHQ A;  2QIL A;  2Z4I A;  3NEN A;  1FNV A;  4DKA C;  4NPS A;  4X6A H;  4LF7 Q;  3HOZ G;  4K5W A;  1S5C D;  1KAW A;  2K7V A;  1WJJ A;  3HOW G;  1CKM A;  2ICI A;  3STB C;  1X3F A;  3HKZ E;  2BCO A;  1JWU D;  2MP1 A;  3PO2 B;  1J9O A;  4LF8 L;  2RHS B;  4XTC S;  3M85 A;  1WTP A;  3VYS A;  1Q7Y C;  1SE8 A;  2RDG A;  2F0O A;  2D5D A;  1G8Z D;  4CKC A;  4GN3 B;  4HIM A;  1TQO A;  1V43 A;  5BN3 A;  2R7Z H;  4BY7 B;  4DV5 L;  5CBE E;  3ZYY X;  5IYD G;  2MFI A;  3G4S A;  1EY6 A;  2HCC A;  4BWG B;  5KNB A;  3EVQ A;  4JI8 Q;  5COR A;  1LT4 D;  1KNE A;  4O2D A;  2MUY A;  4GLX A;  4C3J B;  4JI5 L;  2DUD A;  1BVS A;  5EPJ A;  5D14 A;  4FF3 A;  3M3Y B;  3NBI A;  1SND A;  4ZKC B;  4P71 A;  1HFN A;  1SE2 A;  4X3U A;  1E7Z A;  4C2M B;  3HOZ B;  2XNA C;  1B7Y B;  3U4V A;  4G7H C;  1I4P A;  3HOW B;  2VL6 A;  2WB1 G;  1VQ7 A;  4YWL A;  2OWO A;  1V8Q A;  2B2T C;  2F0Q A;  4E6I A;  2F1M A;  1JIC A;  3HKS A;  2UXD Q;  2Z8L A;  2K5D A;  4A76 A;  4M8A A;  1STG A;  3NTK A;  2JXM B;  1TR5 A;  2EE1 A;  3Q8D A;  3PIO 3;  2FHT A;  4IN3 A;  3T1H L;  4JOI C;  2DY7 A;  1CKO A;  3MXU A;  4K0K L;  2PMZ B;  3CCJ A;  4FP5 D;  4A3J G;  1EOT A;  4ID6 A;  3F2B A;  4KKS A;  2Y0S G;  4IZ8 A;  3P75 A;  1N8R C;  3RMH A;  2N78 A;  4RMF A;  5I6Y A;  4B9X A;  1WCM H;  1STE A;  1YNN D;  4P75 A;  3A74 A;  1ASZ A;  1PFS A;  2B8G A;  1I94 Q;  1RD9 D;  4B9W A;  2K33 A;  2OT2 A;  3K8A A;  4LMQ D;  1GUG A;  4B3R Q;  2K5N A;  4ZCK A;  3DMU A;  3CRL C;  3WDN A;  1A3U A;  3RZD B;  2JA6 G;  1MSG A;  1SJE D;  1LAC A;  1PH2 A;  5DAU A;  1I4X A;  5CMD A;  3A7L A;  1AH9 A;  1VQ6 A;  4EQO A;  3ERO A;  1TWF H;  1YJW A;  3FDT A;  2F0J A;  3Q23 A;  1IL8 A;  3P7J A;  3CC4 A;  1EWH A;  2WB1 B;  1U4R A;  2PPB C;  1DD2 A;  1Z47 A;  2MGS A;  1SNO A;  1CUK A;  4KN7 C;  3M4Y A;  5JEA H;  1U4P A;  3GTJ H;  4XQJ A;  1TWH H;  1JOO A;  1AE2 A;  4BY1 H;  3SK6 A;  3GTM B;  3F8T A;  4J8Q A;  4NW2 A;  1XWE A;  3F2U A;  3KDF B;  2XWJ B;  4A3J B;  3FKI B;  4NXN L;  2PI2 A;  2Y0S B;  2Q2I A;  4IUN A;  3EFX D;  1PVO A;  2PNH A;  3S1R H;  5J22 A;  4LF8 Q;  5JEA G;  3ITP A;  4QJF A;  1O7I A;  5C4Z A;  1TT2 A;  3GP7 A;  3A8K E;  4G57 A;  2A6H C;  2KUM A;  4OWX B;  1RDP D;  4DAP A;  3GTO H;  2NUC A;  1VQ9 A;  3GTL B;  1VQF A;  1B3Q A;  3EJI A;  3CD6 A;  5JJI A;  2GVB A;  5BR8 Q;  1K3R A;  2QKI C;  2OEO A;  2ZTC A;  5CV6 A;  5G3L D;  4KV6 A;  2JA6 B;  2ZXR A;  2LMC B;  2XGT A;  4B3T L;  2BH8 A;  2JA5 H;  4RA8 A;  3U9O A;  3K5L A;  3J80 E;  5KYI A;  4HIO A;  4C3I H;  2HD3 A;  3J7A V;  4JI3 L;  4QF4 A;  4FXD A;  2PQA B;  1PH5 A;  1IKM A;  5L37 A;  4LJZ C;  1IBK L;  1BOS A;  1QJO A;  3ERS X;  2XTI A;  4QL5 A;  1PZK D;  3HZX A;  4WJW A;  1QNK A;  4C1N I;  4K14 A;  3IRB A;  1LTB D;  1LT5 D;  2NN6 H;  3QOL A;  1DXM A;  4HAE A;  2E2D C;  4GLV B;  1TWF B;  4A93 H;  4TKO B;  3NEL A;  1B44 D;  1BO0 A;  2JYO A;  5FLX c;  1HTP A;  1CSQ A;  4PNY A;  1SE3 A;  3R2I A;  1KIX A;  2YV5 A;  1OXU A;  3S17 H;  4BA1 I;  1FJG L;  2SOB A;  1AFP A;  1IZ6 A;  1D2B A;  1D5M C;  3CCS A;  3G6J B;  3K0X A;  1PTO H;  5C4J B;  1H9M A;  2EY5 A;  2F0T A;  4RGT A;  3CME A;  3T1H Q;  4A93 G;  2F0V A;  1CZG A;  2EYO A;  1QIL A;  4QQB X;  4K0K Q;  2IT1 A;  3ONA B;  3JAM i;  3RNU A;  1PH6 A;  3F2D A;  2P5Z X;  3WOF A;  1ESF A;  4HMI A;  4UP7 A;  4DK0 A;  5FJ8 H;  2IL8 A;  1G51 A;  1OXV A;  3KF8 A;  3BYT B;  3R8B A;  3KFU A;  1ZKO A;  1N32 Q;  1WTO A;  1YNX A;  1HCZ A;  3CC2 A;  3S16 H;  3GTO B;  4DAY B;  1SYE A;  1YJ9 A;  1I6H H;  1KLU D;  1PYB A;  2N8N A;  5FJ8 G;  2K32 A;  2QEJ C;  3OIQ A;  2IX3 A;  3STB D;  3E9H A;  2JJQ A;  4JI7 L;  2VZA A;  5IT9 E;  4IUV A;  1I4H A;  1K8G A;  1JQY D;  1A62 A;  1PH7 A;  3QG1 A;  4DF7 A;  1XMQ Q;  1Q46 A;  2IHF A;  2K14 A;  3RUZ A;  3AMU A;  4POF A;  4RFB A;  1Q1B A;  5IP9 H;  3T13 A;  2JQO A;  5GAH C;  1JE4 A;  2J4X A;  3OMC A;  2F0E A;  1WOC A;  1S5D D;  2NBF A;  1S5B D;  4RHR A;  2QGQ A;  2VW9 A;  4A93 B;  4DR1 Q;  1YVC A;  1K8O A;  1HR0 W;  2B2W A;  4UP8 A;  5FO9 B;  1UE5 A;  1DM0 B;  4R8I A;  4K6L A;  1I6V C;  2FJ2 A;  4IPH A;  4L63 B;  4DV7 Q;  1IYV A;  4H02 A;  1CA5 A;  2X6L A;  2A1A A;  1KDC A;  3A8J E;  1KRS A;  5EPL A;  4OHJ A;  3QJY A;  1BKB A;  1BCP B;  3HG9 A;  4G4K A;  3FMC A;  3UDF A;  2V1C C;  1Y8O B;  1JB7 A;  5D3I B;  5A2Q L;  2VQF L;  4B3T Q;  1N33 L;  3HEJ A;  1L0Y B;  2HT1 A;  4N9T A;  4RGO S;  3CPW A;  1NJI C;  2EYM A;  1F2M A;  5LMN L;  4JI3 Q;  2K52 A;  3H0G H;  3H3V H;  1A2U A;  2F0W A;  1IBK Q;  3IAY A;  1I6H B;  1HRJ A;  1G2S A;  1EY9 A;  4IPC A;  1EZ8 A;  1FGU A;  4LF5 L;  4FYD A;  4A3M H;  1LO5 D;  1XNQ Q;  3I4L A;  3TBI B;  3MAQ A;  4LNQ A;  1GUN A;  2UUB L;  2HCI A;  2L0C A;  1E2W A;  5IYC H;  3BZC A;  3S15 H;  3KLS A;  4Y7N H;  1AEX A;  3Q6S A;  1ZYR C;  3HKZ G;  1X56 A;  4ME3 A;  1PYS B;  5IP7 H;  1PZJ D;  1LUZ A;  3OTO L;  1NUC A;  4A3M G; 
#chains in the Genus database with same CATH homology
 4DXG A;  1CTM A;  3TME A;  3HRZ C;  3HGB A;  3I72 A;  3BVZ A;  1GUS A;  2B2Y C;  2VNU D;  1G91 A;  3V96 A;  2B2U C;  2F0P A;  2XIW A;  1STN A;  2EJM A;  1BDO A;  2I46 A;  4KY6 A;  1O7Y A;  1SYB A;  3NQI A;  4DK1 A;  2D62 A;  4DXF A;  3C3L A;  3NHH A;  1GHK A;  2VB2 X;  4F87 A;  1U4M A;  2F4I A;  3H09 A;  1EZ6 A;  5FO7 B;  3HKZ B;  3GD7 A;  3KBG A;  5KIX A;  3LWE A;  1I4G A;  1GXD C;  1WTX A;  1HUN A;  1ILQ A;  1XXG A;  4TQU S;  1CA6 A;  5EPK A;  3PUV A;  3L7Z C;  1F9S A;  2J7Z A;  3D4D A;  1PTO F;  1YNJ D;  1EIH A;  1Q3L A;  2E2H B;  3DEP A;  4OIJ A;  3MWY W;  2SDF A;  3AU7 A;  2O2L D;  2BA1 A;  5KND A;  2B2V C;  3K5N A;  2KA7 A;  2PZW A;  2XN9 C;  3BDO A;  4H7B A;  2K04 A;  4KKT A;  2L9H A;  1SYG A;  4N9P A;  2PCF B;  1CZW A;  4R8N A;  1H9K A;  4DNT B;  2AWN A;  1TY0 A;  3BDC A;  1WD1 A;  3J7Y W;  1I4R A;  1W6K A;  4DAV A;  5IT9 L;  4CBV A;  2TMP A;  2G9H D;  2F0S A;  3OWE B;  4CHT B;  3U9S A;  3IKJ A;  2YU9 B;  1IKL A;  2F0N A;  3KUP A;  3MZ5 A;  2PZT A;  1OXX K;  5CV5 A;  1M8A A;  1CK1 A;  4HED A;  4EQN A;  4FF4 A;  4KD4 A;  1RF2 D;  2E76 C;  5C44 B;  2A69 D;  2K05 A;  2KOL A;  4XYO A;  2Z1C A;  4KJN A;  2K28 A;  2WAC A;  3IFT A;  4ULL A;  5JEA J;  4I7Z C;  2R6G A;  4DA2 A;  1HA5 A;  3D31 A;  1MSH A;  3GTP B;  4A3I B;  1EIG A;  1Y8P B;  3KK7 A;  5I2Y A;  1D5X C;  1X3P A;  1NCV A;  2CW0 D;  5FKA C;  2EDG A;  2K5Q A;  4XIG S;  3W3A A;  1PRT F;  5JPN C;  4KI0 A;  1WTQ A;  3NWT A;  5C5L A;  2WII B;  1IHZ A;  3PV0 A;  1SEB D;  1SYD A;  3J81 E;  3OOC A;  3ND9 A;  5IGF A;  2PZU A;  4CKE A;  2KJX A;  5CR3 A;  1TS3 A;  5CYU A;  2JA7 B;  1EY5 A;  5CC4 A;  3SDZ A;  1PFB A;  3JAM E;  1R9T B;  1E2Z A;  3NWS A;  2EJG C;  1SFO B;  1Y8N B;  3LNN A;  5IIF A;  3QB3 A;  2L12 A;  1RHP A;  4BA2 I;  1KTK A;  1XTC D;  5I9P A;  2EY6 A;  3A8I E;  3SXH A;  4A3B B;  5CV8 A;  1EY4 A;  1C8C A;  1UEA B;  3AB9 A;  2PQE A;  3DEO A;  3T4A C;  5FLX L;  1V1P A;  1JWS D;  2FIN B;  3RLF A;  3QIA A;  4F88 A;  1STB A;  4IUP A;  4NDX A;  5ELF A;  2A74 C;  3C2P A;  1TWC B;  1E2V A;  3HP3 A;  2I07 B;  1D1K A;  4R9W A;  2NB0 A;  2ENB A;  4ZLT F;  4NMZ A;  2YYZ A;  4LK1 C;  3PMF A;  1OXT A;  5BN5 A;  3PO3 B;  2C9O A;  4HTH A;  4B08 A;  4RGN A;  5NUC A;  4LAA A;  4ZKB B;  4RKL A;  5CV9 A;  3LWU A;  3OMG A;  3DWQ A;  4X3T A;  3H91 A;  1DYQ A;  3I8Z A;  5K5P A;  1BCP C;  3KLS X;  1MBY A;  3DHQ A;  2R7Z B;  2ICE C;  1DOK A;  1LV9 A;  2XSC A;  5I2X A;  3VR3 A;  3C1E A;  3SK8 A;  3GV6 A;  1QWY A;  2JSO A;  4KMU C;  3SVM A;  2L11 A;  3GV3 A;  2WKD A;  3RD4 A;  3DXJ C;  4HSV A;  4NP5 A;  2XRS D;  3I91 A;  5ELB A;  3V05 A;  5C4X B;  2B2W C;  1V1O A;  1JOQ A;  1BR9 A;  2WP8 J;  5KGU A;  4EGV A;  3BDL A;  2A6E C;  4MHE A;  1WVL A;  5HGT A;  1S4Z A;  5C3E B;  1PDQ A;  3T51 B;  3N52 A;  4H0L C;  5FK9 C;  1QOH A;  2EYL A;  1ET6 A;  5DEH A;  2F0M A;  5I4D A;  1WCM B;  3EA6 A;  4S3S A;  1CHQ D;  2EYF A;  3LX0 A;  1KAB A;  2FMC A;  1IYU A;  2QCP X;  1R4P B;  5I6W A;  3OW7 A;  5DM6 3;  4IUT A;  1PFN A;  1RKN A;  2IW3 A;  1NR2 A;  3A56 A;  4RAU C;  2K6A A;  1ML0 D;  3K5M A;  3KBX A;  4C3I G;  3H3V C;  5CV4 A;  2F0G A;  2CVR A;  1B4O A;  4ZYS A;  1ICW A;  5E4W C;  3K57 A;  3GTJ B;  4IFD H;  1F9Q A;  1TWH B;  4Z9C B;  4BY1 B;  1M4V A;  2NN6 G;  2ZXO A;  4V0B A;  1JB3 A;  4IQZ A;  1DZ1 A;  4AYB B;  5C3W A;  1T5X D;  5KRU A;  5JPM C;  3S1R B;  3HOY B;  1SNM A;  3VR2 A;  1H9S A;  4IFD G;  2B2T A;  4FXK C;  4K8I A;  2CQA A;  3I70 A;  3IL8 A;  2J0T D;  1GJX A;  4PMC A;  2F3V A;  4A3D B;  1HQR D;  1EU4 A;  4M1U B;  1TY2 A;  1CM9 A;  3NE5 B;  4WFN 3;  5IGE A;  2NN6 I;  2JA5 B;  5M5W B;  2R92 B;  1U4L A;  5C5M A;  4C3I B;  1UAP A;  2M00 A;  2PO4 A;  1Q12 A;  1LTT D;  1HHV A;  3ND8 A;  2H1E A;  1C4Q A;  2ZXP A;  5EKL A;  1J8I A;  2OXP A;  3R2T A;  2WV6 D;  3URY A;  3S17 B;  2PW7 A;  3L9A X;  5G3L F;  1XYI A;  5EGT A;  1PTO B;  1HA6 A;  1LTS D;  3CRK C;  1AW7 A;  2O4X A;  4C56 C;  1VF5 C;  3M7G A;  1T5E A;  4EQP A;  1EFI D;  5JVH 3;  4QMG A;  1F2Y A;  1BF4 A;  3S16 B;  4PV1 C;  1SXT A;  1QE6 A;  2C5C A;  4MIU A;  1B9M A;  2HDL A;  3MXN A;  1I4Q A;  2F0K A;  4XXE A;  1SBB B;  3C46 A;  3L3O C;  1ILP A;  1FNU A;  2DNC A;  1TS4 A;  2BDO A;  1EEF D;  1SDF A;  2N88 A;  3C1F A;  4CGY B;  1KDB A;  1RTO A;  4ME5 A;  1SNP A;  3SK4 A;  1B2T A;  3A7A B;  2WKC A;  1D1I A;  4DN4 M;  2RVL A;  3E5S A;  1CHP D;  1Q1E A;  1WTW A;  2R61 A;  1ENC A;  1ROD A;  1Z6H A;  2ZT9 C;  1BXT A;  2NVX B;  5C0X H;  5HUR A;  3VR6 A;  1PMR A;  4JK1 C;  4PQX A;  3WOE A;  2KED A;  1SNQ A;  1SE4 A;  4HMJ A;  2NZ1 D;  3H6M A;  3J80 L;  2A6H D;  2K03 A;  4DNR B;  2RQX A;  3H0G B;  1EEI D;  1JCK B;  1OO9 B;  2K1B A;  4ILW A;  3MA2 B;  1LT3 D;  4A3M B;  3K5O A;  4V19 0;  1NAP A;  2BDN A;  3S15 B;  4Y7N B;  1PRT B;  5C6A A;  5T1G A;  1AZP A;  1W6J A;  3PUX A;  3T16 A;  4U67 3;  1DOM A;  1FR3 A;  1NSN S;  3BS1 A;  1EQT A;  3ERQ A;  2HUG A;  4ZAI A;  3DWA A;  4KTA A;  3GTG B;  3TZU A;  5EJW A;  2IJ0 A;  4DGZ A;  5COY A;  3S1Q B;  1S5F D;  1L0X B;  1ONL A;  3KLR A;  2KHS A;  2IWH A;  1H9J A;  3X3N A;  5E4X A;  3P20 A;  1I3Q B;  1JOK A;  2GA4 B;  2X6G A;  5JOB A;  3EQL C;  3MHB A;  5ELD A;  1Q90 A;  4IAL A;  1SJH D;  2F0U A;  3I90 A;  2HDM A;  4CJ2 C;  4WOR A;  1CFM A;  2RDH A;  4F8M A;  4BBS B;  2BE5 C;  5KYL A;  2JA8 B;  1TS2 A;  3D4R A;  3GO5 A;  1B50 A;  4WRD A;  3PIP 3;  4ZRZ A;  2JE6 I;  1GHJ A;  2X69 A;  3PUY A;  5LHY 1;  2E74 C;  3CU7 A;  3M4O B;  5IGB A;  4H13 C;  3S2H B;  2KVM A;  1D5Z C;  2B2U A;  4J6H A;  2VUM B;  5E3F A;  5M5X B;  5M3F B;  5FOB B;  3NPP A;  3NTH A;  1DJR D;  4X3S A;  5IOD A;  5ELE A;  4H44 C;  1TS5 A;  5JVG 3;  1TVX A;  1QG7 A;  1OXS C;  5DM7 3;  3TP8 A;  4ZQ3 A;  2SNM A;  4A3E B;  2DNE A;  4O1N A;  1EYD A;  2EYP A;  2N55 A;  2F0I A;  4OIK A;  2RKS A;  4RH6 A;  3J7A F;  2PNR C;  5JAV A;  4C1N K;  3Q24 A;  1U9R A;  1HTL D;  2Q8I B;  1NR4 A;  2PW5 A;  2B39 A;  2KCN A;  3O13 A;  4RCO A;  2O5I C;  1FYC A;  3T56 B;  4QUF A;  1ZYR D;  2NTS A;  2JEB I;  1O7Z A;  4GZY C;  2NTT A;  4Q0F A;  2IPK D;  4A3K B;  1G29 1;  2L4N A;  1SMY C;  4IFD J;  2M2L A;  4NKL A;  1GUO A;  2F0H A;  3NP8 A;  1VCI A;  4KN4 C;  1II3 A;  2EPB A;  3W2D A;  4K5V A;  4BS9 A;  4C3H G;  2KEC A;  4FXG C;  4U68 A;  2B2V A;  4TSS A;  4XQN A;  1PYW D;  4QIW B;  2RA4 A;  4UDU C;  4XT1 B;  1FGB D;  2A5H A;  4FF1 A;  1TWG B;  1F2L A;  2ID0 A;  5EBC A;  2WIN B;  3V2T A;  1EYC A;  1F9P A;  1D6E C;  1O78 A;  4TRD A;  1HPC A;  1EL0 A;  4CJ1 B;  4XQQ A;  1JWM D;  2SEB D;  1KAA A;  1UNS A;  5M9O A;  2XVS A;  2SNS A;  4FVM A;  5ELC A;  3TSS A;  1PTO C;  3SHL A;  1KLG D;  5KNC A;  3MFG A;  4C3H B;  2E2I B;  1HQM C;  2EOT A;  3OHX C;  2QF7 A;  1EYA A;  2IX1 A;  1EY8 A;  4HCE A;  5A2Q E;  2L5T A;  1BQQ T;  1V1P B;  3TP5 A;  4ZUJ A;  4Q5V A;  3CHB D;  2M9V A;  3VYT A;  2G9D A;  1RTN A;  2E2J B;  4OL7 A;  3DWP A;  4OO1 H;  1TKW B;  1RCV D;  4KJO A;  1H9R A;  4O42 A;  2OF1 A;  1B9N A;  1MGS A;  2BA0 A;  2MHV A;  3MTS A;  4OO1 G;  3FVQ A;  2BE5 D;  3NSW A;  4I65 A;  3M7N A;  3QO2 A;  1E0B A;  1A2T A;  1ENF A;  5A35 A;  2FFK B;  3DUZ A;  1AN8 A;  3MC0 B;  1MD2 D;  2CHB D;  1AZQ A;  3Q22 A;  1PXU A;  1AP0 A;  2RBM A;  1A3V A;  3VYU A;  2MPM A;  3N6R A;  3GTQ B;  5DNF A;  5C3X A;  1B53 A;  3NTI A;  4K2K A;  5F2D A;  4OO1 I;  5C0X J;  1ET9 A;  3CKI B;  2RDF A;  1X3Q A;  2LS0 1;  4FF2 A;  3SEB A;  1F2Z A;  1SNC A;  4XT3 B;  3D3R A;  1JOR A;  3OPO A;  3IFD A;  4DAY A;  2EY1 A;  3MFY A;  1PFM A;  1LT6 D;  3UI2 A;  1STY A;  3BZD B;  4MN3 A;  5FO8 B;  3J81 L;  1YNJ C;  1PRT C;  2EVB A;  1O80 A;  1EU3 A;  2NVQ B;  4BBR B;  1B3A A;  4DU9 A;  3HOU B;  5CBA E;  3BYY B;  3JAM L;  2A68 C;  2V4D A;  2F0L A;  5EQ0 A;  3A55 A;  3D6W A;  4IUU A;  2H4O A;  1A3T A;  2JP1 A;  1BNZ A;  2Q8T A;  2Z4H A;  4CJ0 B;  3NXW A;  1PZI D;  4K2L A;  1IW7 C;  1Y69 U;  3FEW X;  3K7A B;  2KCC A;  3MVV A;  2DY8 A;  3R93 A;  1SSO A;  4KD3 A;  4JBW A;  1SMY D;  3OWF A;  4KY7 A;  4IFD I;  3S1M B;  4CKB A;  2B8F A;  2FMM A;  1Y1W B;  5J39 A;  3HOX B;  4KHV A;  1F77 A;  2F0D A;  3GQB A;  3MXP A;  2A69 C;  4QUC A;  5EBD A;  4DFA A;  1S5E D;  5C4H A;  5LL6 S;  3SK5 A;  2EY2 A;  4PMB A;  2RSN A;  1H9S B;  2A73 B;  3I73 A;  3A54 A;  4F7X A;  4ZK9 B;  5ISR A;  1G6Z A;  5D65 A;  3VR4 A;  4FNF A;  2AQ3 B;  4K6D A;  1K83 B;  1WTR A;  1G2T A;  1DON A;  1R4Q B;  4RHS A;  5K36 H;  1VMP A;  2Q8R E;  1KDA A;  2EYJ A;  4RWS C;  3TDQ A;  3VYR A;  1GUW A;  4RKB A;  2PYK A;  3Q0A A;  1SYC A;  1O7L A;  2CW0 C;  1JR0 D;  3OIP A;  3K6O A;  5K36 G;  3VA7 A;  1PTO D;  2TSS A;  2D9U A;  4L6T B;  4QCL A;  5EKK A;  1EY0 A;  3S1N B;  3K0Y A;  4HN7 A;  3PUZ A;  4IUR A;  1BCP D;  1A6X A;  1K8M A;  3NQT A;  1F9R A;  3G7L A;  2XRQ D;  3MXG A;  3S14 B;  1DOL A;  1UUP A;  4RCN A;  4G7Z C;  3QWN A;  4J1M A;  5LL6 X;  1Q8I A;  1DCZ A;  2VB3 X;  1ZXT A;  3BVM A;  2L1B A;  2LY7 A;  2NWG A;  1EQV A;  3E0J A;  1ENA A;  3R3O A;  2F3W A;  1FD7 D;  3SE0 A;  3GTK B;  2D2C C;  1Z7T A;  2NVT B;  5AFW A;  4XYQ A;  1EWC A;  5TSS A;  4KY5 A;  1ESR A;  2RSO A;  3FRP B;  2A6E D;  1VDZ A;  5IGD A;  3S9W A;  5C0X G;  2EXZ A;  5BN4 A;  3QOJ A;  2VXW A;  2WAQ B;  4ODG A;  3NBH A;  3FPU B;  2JEA I;  3TZD A;  4HSP A;  1PLF A;  2AUK A;  3PUW A;  3T53 B;  3E6Z X;  3K58 A;  1Y1V B;  5KEE A;  2DN8 A;  1XX8 A;  5FLX E;  2KQ3 A;  1QCB D;  5C0X I;  1HFG A;  1HXY D;  2E75 C;  3K59 A;  1CQV A;  2MJ8 A;  4P2C B;  4KK7 A;  1YNN C;  4X3K A;  5IOC A;  5CGK A;  3FPP A;  1WTV A;  2EJF C;  4K8J A;  3VA5 A;  1QNU A;  2NYZ D;  2HQE A;  1PRT D;  1LAB A;  3I4M B;  3TP6 A;  1HUM A;  3S2D B;  1GUT A;  1A15 A;  5T1I A;  2R93 B;  2NVY B;  2F03 A;  1BCP F;  3HOV B;  5J1Z A;  5D3D A;  3NUC A;  1VMC A;  1CT1 D;  2A68 D;  4L8J A;  2BOS A;  4OGQ C;  1TII D;  2IX0 A;  2KEE A;  2QDB A;  2EYH A;  4KKU A;  2B63 B;  5JJZ A;  5E1F A;  4UAI A;  2K5W A;  1IW7 D;  4EVO A;  1SAP A;  3D6C A;  4ABN A;  1LLR D;  2F0F A;  4G7O C;  3TP7 A;  1WD0 A;  3P1H A;  1FNW A;  5CV7 A;  1LTA D;  5IGC A;  3NK9 A;  1RJT A;  4FO2 A;  2AQ2 B;  2AWO A;  3VR5 A;  1BUV T;  3CQZ B;  2AUJ D;  3I3C A;  5M3M B;  2B2Y A;  4A3F B;  4XDX A;  2EZV A;  3RZO B;  2R3Z A;  4PMW A;  1STH A;  2LFN A;  1CQF A;  4ZUI A;  3D4W A;  1ZEQ X;  1VF7 A;  3MEH A;  2L55 A;  2K01 A;  2LKV A;  1KNA A;  1TWA B;  1QB5 D;  4QB4 A;  3BVG A;  1GOZ A;  1LTG D;  3X3M A;  1I50 B;  1X32 A;  1CI3 M;  1EY7 A;  4A3G B;  3H94 A;  5IGG A;  1SYF A;  5EKI A;  1LTR D;  3D8G A;  3I4N B;  4K5X A;  3TN2 A;  2AQ1 B;  4KHZ A;  1TU2 B;  5M5Y B;  2O5J C;  4YIJ A;  3OSO A;  1BBX C;  3BG3 A;  3DM1 A;  4IUQ A;  5I9O A;  4HR7 B;  1MI2 A;  1STA A;  2XWB B;  4C3J G;  3SR1 A;  4HCS A;  3HS0 C;  4RGM A;  1JC7 A;  1LTI D;  1C48 A;  1B1Z A;  2QIL A;  2Z4I A;  1FNV A;  4K5W A;  1S5C D;  2K7V A;  2ICI A;  2BCO A;  1JWU D;  2MP1 A;  3PO2 B;  1J9O A;  4XTC S;  3M85 A;  1WTP A;  3VYS A;  2RDG A;  2F0O A;  2D5D A;  1G8Z D;  4CKC A;  1TQO A;  1V43 A;  5BN3 A;  4BY7 B;  5CBE E;  3ZYY X;  1EY6 A;  2HCC A;  4BWG B;  5KNB A;  3EVQ A;  5COR A;  1LT4 D;  1KNE A;  2MUY A;  4C3J B;  5EPJ A;  5D14 A;  4FF3 A;  3M3Y B;  3NBI A;  1SND A;  4ZKC B;  1HFN A;  1SE2 A;  4X3U A;  4C2M B;  3HOZ B;  2XNA C;  4G7H C;  1I4P A;  3HOW B;  1V8Q A;  2B2T C;  2F0Q A;  4E6I A;  2F1M A;  1JIC A;  2Z8L A;  2K5D A;  4M8A A;  1STG A;  3NTK A;  2JXM B;  1TR5 A;  2EE1 A;  3PIO 3;  2FHT A;  4IN3 A;  2DY7 A;  3MXU A;  2PMZ B;  4FP5 D;  1EOT A;  4ID6 A;  4KKS A;  4IZ8 A;  3P75 A;  3RMH A;  5I6Y A;  4B9X A;  1STE A;  1YNN D;  2B8G A;  1RD9 D;  4B9W A;  2K33 A;  2OT2 A;  4LMQ D;  1GUG A;  3DMU A;  3CRL C;  3WDN A;  1A3U A;  3RZD B;  1MSG A;  1SJE D;  1LAC A;  5DAU A;  1I4X A;  5CMD A;  3A7L A;  4EQO A;  3ERO A;  3FDT A;  2F0J A;  3Q23 A;  1IL8 A;  3P7J A;  1EWH A;  2WB1 B;  1U4R A;  2PPB C;  1DD2 A;  1Z47 A;  2MGS A;  1SNO A;  4KN7 C;  3M4Y A;  5JEA H;  1U4P A;  4XQJ A;  1JOO A;  3SK6 A;  3GTM B;  4J8Q A;  4NW2 A;  1XWE A;  3F2U A;  2XWJ B;  4A3J B;  3FKI B;  2Y0S B;  4IUN A;  3EFX D;  5J22 A;  5JEA G;  3ITP A;  5C4Z A;  1TT2 A;  3GP7 A;  3A8K E;  4G57 A;  2A6H C;  2KUM A;  1RDP D;  4DAP A;  2NUC A;  3GTL B;  3EJI A;  2QKI C;  2OEO A;  5CV6 A;  5G3L D;  4KV6 A;  2JA6 B;  2ZXR A;  2LMC B;  4RA8 A;  3U9O A;  3K5L A;  3J80 E;  5KYI A;  3J7A V;  4FXD A;  4QF4 A;  1IKM A;  4LJZ C;  1BOS A;  1QJO A;  1PZK D;  3HZX A;  4WJW A;  1QNK A;  4C1N I;  4K14 A;  1LTB D;  1LT5 D;  2NN6 H;  3QOL A;  1DXM A;  4HAE A;  2E2D C;  1TWF B;  4TKO B;  1B44 D;  1BO0 A;  2JYO A;  1HTP A;  4PNY A;  1SE3 A;  3R2I A;  1OXU A;  4BA1 I;  2SOB A;  1AFP A;  1D2B A;  1D5M C;  3G6J B;  1PTO H;  5C4J B;  1H9M A;  2EY5 A;  2F0T A;  4RGT A;  2F0V A;  1CZG A;  2EYO A;  1QIL A;  2IT1 A;  3ONA B;  3WOF A;  1ESF A;  4HMI A;  4DK0 A;  2IL8 A;  1OXV A;  3KF8 A;  3BYT B;  3R8B A;  1ZKO A;  1WTO A;  1HCZ A;  3GTO B;  1SYE A;  1KLU D;  2K32 A;  2QEJ C;  3OIQ A;  2IX3 A;  5IT9 E;  4IUV A;  1I4H A;  1JQY D;  3QG1 A;  4DF7 A;  3RUZ A;  3AMU A;  4RFB A;  1Q1B A;  3T13 A;  1JE4 A;  2J4X A;  3OMC A;  2F0E A;  1S5D D;  2NBF A;  1S5B D;  4RHR A;  4A93 B;  1K8O A;  2B2W A;  5FO9 B;  1DM0 B;  4R8I A;  4K6L A;  1I6V C;  2FJ2 A;  4L63 B;  1IYV A;  1CA5 A;  2X6L A;  1KDC A;  3A8J E;  5EPL A;  4OHJ A;  3QJY A;  1BCP B;  3HG9 A;  4G4K A;  3FMC A;  1Y8O B;  5D3I B;  5A2Q L;  3HEJ A;  1L0Y B;  4N9T A;  4RGO S;  2EYM A;  1F2M A;  1A2U A;  2F0W A;  1HRJ A;  3IAY A;  1I6H B;  1G2S A;  1EY9 A;  1EZ8 A;  4FYD A;  1LO5 D;  3TBI B;  3I4L A;  3MAQ A;  1GUN A;  2HCI A;  2L0C A;  1E2W A;  3KLS A;  1AEX A;  3Q6S A;  1ZYR C;  1PZJ D;  1NUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...