3KFIA

Major mouse urinary protein iv complexed with 2,5-dimethylpyrazine
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
152
structure length
152
Chain Sequence
b'LNVEKINGEWFSILLASDKREKIEEHGSMRVFVEHIHVLENSLAFKFHTVIDGECSEIFLVADKTEKAGEYSVMYDGFNTFTILKTDYDNYIMFHLINEKDGKTFQLMELYGRKADLNSDIKEKFVKLCEEHGIIKENIIDLTKTNRCLKAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major urinary protein 4
publication title High resolution X-ray structures of mouse major urinary protein nasal isoform in complex with pheromones.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 44
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2009-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3kfiA00
1CBIA 2G7BA 3D95A 3STKA 1BEBA 1T68X 2AT3X 1FTPA 2RA6A 2O62A 2ALLX 1QY2A 1Z24A 2A2GA 4ZHDA 1HMRA 1FELA 3BX8A 2BLGA 4AZQA 1X8PA 5D45A 1JYJA 5B29A 5HAEA 1I04A 1ZRYA 3GAQA 5EEDA 3KFIA 3FR5A 1LKEA 3FEKA 1EALA 3C77X 1KQWA 4NYRA 1BLRA 4HPBA 1ERXA 2WR6A 1U17A 3ELXA 2G78A 1YUPA 2L9CA 4MVIA 5HCCC 1QABE 1G74A 5HA0A 2OZQA 1GKAB 2FRSA 5D47A 2FS7A 2LFOA 4YCEA 1O8VA 3FENA 4XMHA 1A3YA 2MO5A 4ZFXA 1BSQA 2Q2MA 3UEXA 1ICMA 2FWVA 2ACPX 4AZPA 1VYFA 1UREA 1QFTA 5LJCA 1SY3A 2FR2A 1GX8A 4WBKA 5HZQA 5KHPA 3CQRA 2N93A 4IB7A 1DF3A 5IO5A 1KGLA 3EYCA 1EIOA 1FE3A 1TOWA 1NP4A 3C78X 4GNYA 5H9AA 3FMZA 2Q2PA 2JU3A 4AW8A 5F1EA 4NYQA 1I06A 1ZNHA 1A57A 3KFGA 3ZUOA 3WJBA 1JJXA 1GM6A 1GT4A 2XSTA 4IAWA 4LKTA 4OMXA 4BVMA 1H91A 3U9PC 4ORUA 1SY1A 4M7MA 1U0XA 4RUNA 3WJGA 1G5WA 2FS6A 1LPJA 1PEEA 2NNDA 4CK4A 1AB0A 1B4MA 3FR4A 3STMX 2WSJA 3IFBA 2LB6A 3FA6A 3EM0A 2R73A 4Y0SA 4GRJA 3PECA 2AT8X 1BWYA 3EBKA 4UU3A 4GE1A 4YBPA 1JV4A 1L6MA 5HCDC 2JOZA 3VG2A 1G85A 1FDQA 1X71A 3IA8A 2QO6A 3PEDA 4XMGA 3B2KA 4ZR2A 1MUPA 1HBPA 2OFRX 4YKMA 5EEEA 4KIIA 4YGZA 1KT5A 1JZUA 1IKEA 1OEJA 1E02A 4HPAA 2JU7A 3C76X 1KT3A 3NX1A 1BBPA 1JJJA 1ZNEA 4YH0A 3RZYA 3UEUA 3CQNA 1OPAA 2W2AA 2F73A 3APUA 1EIIA 2K23A 3B2IA 3DSZA 4NLJA 1E5PA 3BDRA 2WUTA 4ZH6A 2NP1A 5BVQA 5L8OA 1CBQA 1KOIA 5L8IA 5FAZA 4HPDA 1IW2A 3O2YA 1KQXA 3CR6A 2QOSC 3T1DA 1TOUA 1X8UA 1YWAA 5L8NA 1BRQA 5LJHA 5HA1A 3WJFA 1DZKA 4ORXA 2RD7C 2X46A 3NR3A 3WJEA 1ML7A 2QM9A 3CMPA 1VYGA 4YKOA 5BVSA 4OS8A 3OJYC 1KXOA 1SXWA 5K06A 2YG2A 4ALBA 2NNEA 1D2UA 1LIBA 2GJ5A 2X45A 3B2HA 4QYNA 5HZ6A 4ORSA 4QGXA 1G7NA 1HMTA 2A0AA 4ALOA 1KT4A 5LKEA 2ACOA 4QZTA 4YDBA 5FENA 2CM9A 1IFCA 1YP6A 4AZOA 3NQ3A 3B2JA 5HCEC 1TVQA 4YFQA 1GX9A 1OBQA 3HWFA 1OEKA 3PPTA 1QFVA 1P6PA 2LBVA 1CBRA 1MX8A 4WFUA 3BU1A 3APXA 1CBSA 4A60A 4ZHFA 1SA8A 3ELZA 5HTEA 5IO6A 1ZNGA 1B56A 3FW5A 3BSZE 5C0NA 2AT0X 4YFPA 4AYHA 4I3BA 1IFBA 2L68A 4HPCA 3WBGA 1NP1A 1GT3A 3D97A 5HZ5A 2WEWA 1ERBA 5CE4A 2HZQA 3NP1A 1R0UA 4YGGA 1BM5A 2JU8A 3FIQA 3P6DA 5D4AA 1AELA 2EU7X 1E00A 2CBSA 3PP6A 4ORRA 1UZ2X 5D48A 4YDAA 1DZPA 2HNXA 2WQ9A 2Q4NA 1O1VA 2KTDA 2WWPA 2AH7X 4AZRA 4YMYA 1FEMA 2Q9SA 4UU2A 1ALBA 3ZUIA 2CZUA 1PBOA 2KT4B 2PY1A 3F9DA 1YWBA 4EXZA 3BS2A 1SXYA 3HWGA 2ANSA 4QGVA 3U0DA 3D96A 2K62A 3P6HA 1IIUA 1OEEA 5HBSA 3VG5A 3I0AA 4TLJA 4A8ZA 1SXXA 1D3SA 2A3FX 4Y0QA 4Y0PA 3AKNA 2P8GA 4MVKA 3S26A 5F7GA 5FFHA 3BX7A 4I3DA 1S7DA 2HYSA 1CJ5A 1FENA 4GETA 4QZUA 3VG6A 3O19A 5EPQA 5H9LA 2GTFX 2QO5A 4ODDA 4WFVA 2Q39A 5HWZA 1X89A 1EPBA 2FR3A 2A2UA 1IKJA 1X8OA 3BU9A 3NPOA 4GNWA 4XMCA 1PMPA 3U03A 4YGHA 1GT1A 1OBUA 3KFFA 1KT7A 2WQAE 4YCHA 3HWDA 3TF6A 4QGWA 2OVEA 3NQ9A 1JYDA 4XMFA 4IB6A 3FA9A 2A13A 3BLGA 1ICNA 1GGLA 3FA8A 4D6BA 1HBQA 1DV9A 1PM1X 3MBTA 1HN2A 3Q6LA 1RBPA 3CWKA 4TNNA 2G79A 1O1UA 1BRPA 2W2BA 1EPAA 3TGCA 4IB9A 1AVGI 3ZQ3A 1EUOA 2CZTA 2JN3A 4N7CA 3FR2A 4OMWA 2AT5X 2WEXA 2E4JA 4XMEA 2W2FA 4QAEA 4RUUA 1CRBA 5DG4A 2AKQA 2RQ0A 2AMMX 5H9NA 1MVGA 2FLJA 1S2PA 3KZAA 2OFMX 5EZ2A 4TKHA 2DM5A 4AZMA 5LJKA 4XMDA 1XCAA 2FTBA 4DQ3A 4IBAA 1AQBA 3UEVA 1EXSA 4N7DA 4IAXA 4ZHGA 2L67A 2CBRA 5F6ZA 2MJIA 1I05A 1LIDA 5LKFA 3WVMA 4EFGA 5KIDA 1GT5A 4ZJ0A 4OS3A 1RLBE 5F58A 4TKBA 1YP7A 3FLLA 3QKGA 1LF7A 3KFHA 2XKLA 1QY0A 3RSWA 1KZXA 2ASNX 2R56A 1LICA 1MDCA 3APWA 4GKCA 2CM4A 4OS0A 1ADLA 3K3LA 1TXLA 1YIVA 3VG4A 4EDEA 3NADA 1T0VA 3O22A 3TZSA 1SY0A 1T8VA 4K19A 1QY1A 1NGLA 3DTQA 3CBCA 4IMOA 3WJDA 5HZ9A 3CBSA 1OPBA 1OBPA 4I9SA 4TQ2A 1DZMA 3BRNA 3UEWA 3PH6A 4R0BA 5D8JA 2HLVA 3EMMA 4I9RA 1DZJA 4AZNA 3MVFA 4M6SA 3JS1A 4ORYA 2OVDA 4ZHCA 1B8EA 3PH5A 4QYPA 2R74A 1BJ7A 1HMSA 3HK1A 3WJCA 1TW4A 3FELA 2MM3A 3G7XA 3KQ0A 4ZH9A 5BVTA 3VG3A 2GC9A 3L4RA 1SY2A 4D6AA 4HFOA 4A1HA 1DFVA 5B27A 4Y0RA 5HZ8A 2NNQA 1X8QA 1QG5A 4ZCBA 4NNTA 3F8AA 4TJZA 2QO4A 1KZWA 1VPRA 1QQSA 2FT9A 4PSQA 4BQUA 1QWDA 5HTDA 4YFRA 3P6EA 1XKIA 1N0SA 1JBHA 4NNSA 3EBWA 1HQPA 3P6FA 3VG7A 3FA7A 5IO7A 2LKKA 3STNA 1EQDA 2LBAA 5LJGA 1U18A 1E06A 1LNMA 4NLIA 3FEPA 5H8TA 1SXUA 4MVLA 4ORWA 3WXQA 1YWDA 2HMBA 3HWEA 4O9SA 4YBUA 1KT6A 2RCQA 5F6BA 1S44A 4A1YA 2AL0X 1I4UA 3TGAA 4DQ4A 4IMNA 3FW4A 1B0OA 1BSOA 1YWCA 5KICA 1LFOA 2RCTA 1EW3A 2AT6X 3NX2A 3P6GA 3P6CA 4TKJA 5H9KA 4LKPA 1BSYA 4ARHA 4NP1A 5AQ6A 1ZNLA 1A18A 5LJBA 3JSQA 4I3CA 3B2LA 3BY0A 1ZNKA 1GXAA 1X8NA 3SAOA 1DC9A 5LJEA 1ACDA 4EEJA 1GKAA 3APVA 5JR8A 4LZVA 4ZHHA 3I17A 1LIEA 1ZNDA 4GH7A 5DPQA 4ES7A 1MX7A 4IB8A 5EDBA 1A2DA 2POAA 4ZGUA 2L5PA 2OVAA 2HZRA 5LJDA 5EDCA 1LIFA 4LZUA 2IFBA 3TGBA 4BOEA 3AKMA
chains in the Genus database with same CATH superfamily
2IZLB 3PQSA 2OVSA 1CBIA 2G7BA 1VWPB 3D95A 1UYOX 3RDUA 3STKA 1BEBA 3VE2A 1T68X 1I78A 2AT3X 2OL8O 4Z2VA 1FTPA 2RA6A 1SWTA 2O62A 4U3QA 1NC9A 1Y9LA 1QY2A 2ALLX 1Z24A 2A2GA 3VG6A 4ZHDA 1HMRA 4Y59A 1FELA 3BX8A 1LCZA 2BLGA 4AZQA 1X8PA 5D45A 2FHNX 1JYJA 2Y3EA 5B29A 1VWNB 5HAEA 4I6SA 4CPFA 1I04A 1ZRYA 3GAQA 5EEDA 3ZWEA 3KFIA 3FR5A 1LKEA 3D4RA 3FEKA 2QCBA 1KQWA 3C77X 3E3CA 4IRWA 4ML7B 4NYRA 1EALA 3WZNA 1BLRA 4HPBA 1ERXA 2WR6A 4FQBB 3VHIA 4ID2A 4KC7A 2UZ2A 5AJBA 1U17A 3ELXA 2G78A 1YUPA 4ZGFA 2L9CA 4MVIA 4ON1A 1QABE 1G74A 1SLGB 2RTBB 3S5VA 2HKDA 5HA0A 2OZQA 4JGLA 1GKAB 2VFBA 1SWOA 1VYOA 2FRSA 1VWQB 3SZJA 4Z6JA 5D47A 2FS7A 2LFOA 4YCEA 1O8VA 1LDOA 3VPJE 1PTSA 2WPUA 3FENA 4XMHA 3EW2A 3RE5A 2GTLM 3RKGA 1A3YA 4BX5A 1SWHA 2MO5A 4ZFXA 1BSQA 1SWFA 2FGSA 2Q2MA 1ICMA 2FWVA 1VWCB 2ACPX 1VYFA 2OF9A 1UREA 1QFTA 2IZGB 4AZPA 5LJCA 3SLOA 1SY3A 2FR2A 1GX8A 4WBKA 1N7YA 1N4JA 5HZQA 5KHPA 2FKJA 3CQRA 5CYBA 2X8SA 2N93A 4IB7A 1DF3A 2GH7A 5IO5A 1KGLA 3EYCA 1EIOA 1FE3A 3NBXX 1TOWA 2X55A 2BS5A 4I60A 1NP4A 4DCBA 3C78X 4GNYA 5H9AA 3FMZA 4GUZA 2Q2PA 1VWDB 2JU3A 4AW8A 5F1EA 4NYQA 1I06A 1ZNHA 1A57A 3KFGA 3ZUOA 3WJBA 5AJCA 1GM6A 1GT4A 2XSTA 4IAWA 4LKTA 4OMXA 4BVMA 1H91A 3U9PC 2IZJA 1KL5A 1SY1A 2YMSA 4GGRA 1U0XA 4M7MA 4ORUA 4RUNA 2FS6A 1Y52X 1LPJA 3WJGA 1G5WA 1PEEA 1AVEA 2NNDA 4CK4A 3ZI8A 1SRGA 1AB0A 3PDFA 1B4MA 3FR4A 3STMX 1SRHA 2OYBO 4JHQA 2F01A 2WSJA 1KL4A 3IFBA 2LB6A 3FA6A 3EM0A 2A8GA 2ZAGA 3V8UA 4CPHA 2R73A 2IZEB 4Y0SA 1E2TA 2RTOB 4GRJA 3PECA 2AT8X 5IRUA 1BWYA 2RTGB 1LDQA 3EBKA 4UU3A 4GE1A 3T2XA 4YBPA 3RWXA 3LHNA 3RDMA 1JV4A 1L6MA 1STSB 2QOMA 5HCDC 2X32A 4GDAA 2JOZA 5CHKA 1IJ8A 1G85A 3VG2A 4KH8A 1FDQA 1SLFB 3SZHA 1X71A 3IA8A 2QO6A 3FDCA 3PEDA 3B2KA 4XMGA 2C1QA 2RTDB 3MM0A 4GZVA 1MUPA 4ZR2A 1HBPA 2OFRX 4BX5B 1VWBB 4CDCA 4YKMA 5EEEA 4KIIA 4YGZA 1KT5A 2PI3O 1JZUA 1IKEA 4EKVA 1OEJA 4NW4A 1E02A 4HPAA 2JU7A 3C76X 1KT3A 3NX1A 1BBPA 1JJJA 2RTPB 1ZNEA 4YH0A 3RZYA 3UEUA 3CQNA 1KFFA 1OPAA 2F73A 2W2AA 3APUA 1EIIA 2K23A 3B2IA 3DSZA 4NLJA 1SWAA 1E5PA 3WYQA 3AUMO 2WUTA 3BDRA 4ZH6A 1HXLA 2NP1A 3OBLA 5BVQA 1CBQA 5L8OA 1LUQA 3RE6A 1KOIA 2BC3A 5FAZA 4KC8A 1VWJB 3QQ2A 1IW2A 3O2YA 4HPDA 5L8IA 1KQXA 1WBIA 3CR6A 2QOSC 3T1DA 1TOUA 1X8UA 1YWAA 2IZAA 1BRQA 5L8NA 3SLJA 4GU8A 5HA1A 4MIRA 3WJFA 5FQ6E 4BX6A 2RTJA 1DZKA 4ORXA 2RD7C 2X46A 3NR3A 3X00A 3WJEA 1ML7A 4WHIA 2QM9A 2X8TA 3CMPA 4U8UO 1VYGA 3NQKA 4YKOA 5BVSA 4Z27A 4OS8A 3OJYC 1NDJA 1KXOA 1SXWA 5K06A 3F6ZB 1NQMA 2YG2A 1N9MA 4CPHB 2DJFA 2Y3FA 2OFAA 5K68A 1SWCA 2NNEA 4ALBA 2IZDB 1D2UA 2MF6A 1LIBA 2GJ5A 2X45A 4U8UN 2G5LA 3B2HA 1MK5A 1N9YA 1K3BA 4O4OA 4ORSA 4QYNA 4QGXA 3OD9A 5HZ6A 1G7NA 1HMTA 2A0AA 1LCWA 1KT4A 1SWPA 4ALOA 3LV4A 5LKEA 2ACOA 4QZTA 3FIDA 4YDBA 4HWMA 5FENA 2CM9A 1IFCA 1YP6A 4AZOA 3NQ3A 3B2JA 5HCEC 1TVQA 4YFQA 3D9WA 1GX9A 1OBQA 3HWFA 1OEKA 3H3IA 3PPTA 2ZAIA 1QFVA 1P6PA 3T2WA 3ZW0A 2LBVA 1CBRA 1MX8A 3VGWA 1JIWI 4WFUA 3BU1A 3APXA 1CBSA 4A60A 4ZHFA 1SA8A 3ELZA 5HTEA 5IO6A 5B3MO 1ZNGA 1B56A 3FW5A 2OFBA 2OY1O 3BSZE 3S5XA 5C0NA 2AF5A 2AT0X 2IZIA 4YFPA 4AYHA 4I3BA 1IFBA 2L68A 4HPCA 3WBGA 3PK2A 1NP1A 2JGSA 1GT3A 3D97A 5HZ5A 2WEWA 1ERBA 1WUBA 5FQ7E 1SWKA 5CE4A 2HZQA 3LTWA 5IRAA 3NP1A 1R0UA 3SZIA 4YGGA 1BM5A 4BX6B 2JU8A 2Z4HA 2IZKA 3FIQA 3P6DA 5D4AA 2RTNB 2EU7X 1AELA 1E00A 4OEMA 2CBSA 3PP6A 4ORRA 4O3XB 3VE1A 1UZ2X 5D48A 4D6AA 4YDAA 1SWQA 1DZPA 2HNXA 2WQ9A 1UYNX 5HCCC 1RXHA 2Q4NA 1O1VA 1VWRB 2KTDA 2WWPA 3EW1A 4L1NA 2AH7X 4AZRA 1PBYA 4YMYA 1FEMA 1VWLB 2Q9SA 3AEHA 4UU2A 1ALBA 1EI5A 4I95A 2BHVA 2CZUA 1PBOA 2KT4B 3RDXA 3ZUIA 2PY1A 3F9DA 1YWBA 4EXZA 4OKAA 3BS2A 1SXYA 3HWGA 2F09A 2ANSA 4QGVA 3U0DA 3D96A 2K62A 3P6HA 2OY7A 1IIUA 1OEEA 5HBSA 3VG5A 4EQAC 4NV7A 1AVDA 3ZW0B 2RTHB 3I0AA 4CPEA 4TLJA 4YVBA 4A8ZA 4Z2PA 4FBVA 1SXXA 3WZOA 1D3SA 3N91A 2A3FX 4Y0QA 4Y0PA 4BX7A 3AKNA 2P8GA 4MVKA 3S26A 2RTLA 5F7GA 4NV8A 5FFHA 3BX7A 2IZFB 4I3DA 1S7DA 3UEXA 5K67A 4GGZA 5L3YA 2HYSA 1CJ5A 1FENA 4GETA 4QZUA 4U8UM 3O19A 4QNIA 5EPQA 5B10O 5H9LA 2GTFX 4L3RA 2CAMA 2VDFA 2QO5A 4KCAA 4ODDA 1NQNA 4WFVA 5IRWA 1LCVA 2Q39A 5HWZA 1X89A 5FQ8E 1EPBA 5BYPA 2FR3A 2A2UA 1IKJA 1JQPA 1VWFB 2IZCB 1X8OA 4GDZA 3BU9A 1N43A 1SWRA 1DF8A 3NPOA 4GNWA 4XMCA 1PMPA 3SOTA 3U03A 4YGHA 1GT1A 1OBUA 3ZW2A 2OY8A 1KT7A 1SRFA 3KFFA 4BBOA 2WQAE 4YCHA 1W6FA 3HWDA 3PQUA 4FBOA 5B11O 2UYWA 4QGWA 2OVEA 3NQ9A 3TF6A 1JYDA 2OF8A 4XMFA 4IB6A 3FA9A 1RSUB 2A13A 3BLGA 1ICNA 3S60A 1GGLA 3WOVA 3FA8A 4D6BA 1HBQA 1DV9A 1PM1X 3WZQA 3MBTA 1HN2A 3UAQA 3Q6LA 1RBPA 5CSEA 3ZW1A 2MHDA 3CWKA 4TNNA 2G79A 2RTAA 2X34A 1O1UA 1BRPA 5B5FA 2W2BA 1EPAA 4O4XA 3TGCA 4IB9A 1AVGI 3ZQ3A 1EUOA 1MOYA 2CZTA 2JN3A 1SWEA 3EC5A 4N7CA 3FR2A 1GX3A 4OMWA 4JNJA 1HQQA 5AEOA 1Y0GA 4JO6A 1HXZA 4BX7B 2AT5X 1JJUA 2WEXA 2E4JA 4XMEA 3RDQA 2W2FA 4QAEA 1VWMB 2JW1A 3RDSA 4RUUA 3VHMA 1CRBA 5DG4A 2AKQA 3HTYA 1VWGB 2RQ0A 2AMMX 5H9NA 1MVGA 2FLJA 1S2PA 3KZAA 2OFMX 5EZ2A 4TKHA 5IXGA 2DM5A 1SREA 2RTMA 2OY5O 4AZMA 4BJ8A 5LJKA 4XMDA 1XCAA 2FTBA 4DQ3A 4IBAA 1AQBA 4Z28A 1EXSA 4N7DA 4IAXA 3UEVA 2M4LA 4OELA 4ZHGA 2L67A 2CBRA 5F6ZA 2RN4A 3RBYA 3HOEA 1SLEB 4C5PA 2MJIA 1I05A 1LIDA 5LKFA 3WVMA 1W4TA 4EFGA 1GT5A 2FKGA 5KIDA 4ZJ0A 4OS3A 4MVEA 1RLBE 4COTA 2I5ZO 4O49A 1YP7A 5F58A 1JMXA 3FLLA 4TKBA 3QKGA 1LF7A 2LA7A 2RTEB 4Z2OA 1K24A 3P02A 3KFHA 4O3WA 1VWOB 4PJ2A 2XKLA 1QY0A 4FGIB 1JJXA 3RSWA 1RAVA 1KZXA 2RTIB 4O4UA 2ASNX 2R56A 1LICA 1MDCA 3APWA 3MG5A 1I9HA 2CM4A 1ADLA 4GKCA 4OS0A 3ZW1B 2KD2A 1NBXA 1TXLA 1YIVA 3K3LA 3CKFA 3NADA 3VG4A 1T0VA 3VU1A 4EDEA 4CPIA 3T6FA 3O22A 3TZSA 1SY0A 1T8VA 4K19A 4MISA 4BCSA 3RY1A 1QY1A 1NGLA 1RXKA 3CBCA 3DTQA 4IMOA 3WJDA 2Y32A 4BGFA 5HZ9A 2KW1A 3CBSA 1OPBA 4U9CA 1SLDB 1OBPA 4INNA 4I9SA 4TQ2A 1DZMA 3BRNA 3UEWA 3PH6A 4R0BA 1SWSA 2HLVA 3EMMA 4I9RA 5D8JA 4CSBA 1DZJA 4AZNA 3MVFA 4M6SA 3JS1A 4ORYA 2OVDA 3KVNA 5F2BA 4ZHCA 2BS6A 1B8EA 3PH5A 4CDDA 4GJSA 4QYPA 2FHLA 1BJ7A 1HMSA 2R74A 1SWDA 1LELA 3HK1A 4QQ1A 3WJCA 1TW4A 1Y53X 3FELA 2MM3A 5JD2A 1VWAB 3CKGA 3G7XA 3KQ0A 3WZPA 4ZH9A 2RTCB 3VG3A 1VWKB 2GC9A 3L4RA 5BVTA 1SY2A 2BSZA 4O4SA 3SLTA 2KTSA 4HFOA 4U46A 4A1HA 1DFVA 5B27A 4Y0RA 5HZ8A 4GK9A 2JMBA 1STRB 3WYPA 2NNQA 5B5GA 1X8QA 1QG5A 4ZCBA 4NNTA 3F8AA 4TJZA 2QO4A 1KZWA 1VPRA 1QQSA 2RTFB 2FT9A 4PSQA 4BQUA 5LJHA 1QWDA 1VWIB 4LQZA 4YFRA 3P6EA 5HTDA 5B2AO 1XKIA 1N0SA 2MWHA 4GJVA 1JBHA 4NNSA 3EBWA 1HQPA 2RTQB 3P6FA 3VG7A 3FA7A 3OE3A 1SMPI 5IO7A 2LKKA 2IZHB 4CDFA 3STNA 4B55A 1EQDA 1SWGA 2LBAA 5LJGA 2C4IA 1U18A 1E06A 1LNMA 4NLIA 3FEPA 5H8TA 1SXUA 1OSPO 4MVLA 4ORWA 3WXQA 2ZSCA 2BT9A 1YWDA 2HMBA 3HWEA 4O9SA 4YBUA 4FBRA 4BOEA 1KT6A 4MEEA 4O3ZA 3HOLA 2GTLO 2RCQA 5F6BA 1S44A 4IABA 1Y55X 1I4UA 2AL0X 3TGAA 3VHHA 4A1YA 4DQ4A 4CDEA 4IMNA 1SWJA 3P24A 3FW4A 1SRIA 1B0OA 1BSOA 1YWCA 2GTLN 3JQOA 3Q34A 2I5VO 3GE2A 1W5RA 5KICA 3HPEA 1LFOA 1KL3A 1EW3A 2AT6X 2RCTA 3NX2A 3P6GA 1HY2A 3P6CA 4TKJA 5H9KA 1FJ1E 4LKPA 1MM9A 1BSYA 2QMIA 4ARHA 4NP1A 5AQ6A 1ZNLA 1A18A 2C1SA 2OL7A 3JSQA 5LJBA 1RXJA 2VFCA 4I3CA 4Y5DA 3B2LA 1SWBA 2IZBA 3BY0A 1ZNKA 1GXAA 1X8NA 2A5BA 3FYFA 3SAOA 1VWEB 1DC9A 1JMZA 1SWLA 5LJEA 1ACDA 1VWHB 3MX7A 2AVIA 1STPA 4QRLA 1GKAA 2X4MA 2X8FA 3APVA 3RY2A 4O3YA 4LZVA 4EEJA 4ZHHA 3I17A 5JR8A 2A5CA 1LIEA 1Y9TA 1ZNDA 2DJGA 4CV7A 4GGTA 3ZZVA 4GD9A 1SWNA 4GH7A 5DPQA 1SWUA 4ES7A 1MX7A 4IB8A 5EDBA 1A2DA 2POAA 4ZGUA 1MEPA 1RSTB 2G8CO 2L5PA 2OVAA 2X56A 3T6LA 2HZRA 4DNEA 2RTRB 5LJDA 2Z4IA 2OL6O 1LIFA 1SRJA 2RTKA 2IFBA 4KT5A 4LZUA 5EDCA 3TGBA 3RDOA 3AKMA
chains in the Genus database with same CATH topology
3PQSA 2OVSA 1CBIA 2G7BA 3D95A 3STKA 3VE2A 1BEBA 1T68X 2AT3X 1FTPA 2RA6A 2O62A 4U3QA 1Y9LA 1QY2A 2ALLX 1Z24A 2A2GA 4ZHDA 1HMRA 1FELA 3BX8A 2BLGA 4AZQA 1X8PA 5D45A 1JYJA 5B29A 5HAEA 4I6SA 1I04A 1ZRYA 3GAQA 5EEDA 3ZWEA 3KFIA 3FR5A 1LKEA 3D4RA 3FEKA 3C77X 1KQWA 3E3CA 4ML7B 4NYRA 1EALA 1BLRA 4HPBA 1ERXA 2WR6A 4FQBB 4ID2A 4KC7A 5AJBA 1U17A 3ELXA 2G78A 1YUPA 4ZGFA 2L9CA 4MVIA 4ON1A 1QABE 1G74A 3S5VA 5HCCC 5HA0A 2OZQA 4JGLA 1GKAB 2FRSA 5D47A 2FS7A 2LFOA 4YCEA 1O8VA 3VPJE 3FENA 4XMHA 3RKGA 2GTLM 1A3YA 2MO5A 4ZFXA 1BSQA 2Q2MA 3UEXA 1ICMA 2FWVA 2ACPX 4AZPA 1VYFA 1UREA 1QFTA 5LJCA 1SY3A 2FR2A 1GX8A 4WBKA 5HZQA 5KHPA 3CQRA 5CYBA 2X8SA 2N93A 4IB7A 1DF3A 5IO5A 1KGLA 3EYCA 1EIOA 1FE3A 3NBXX 1TOWA 2BS5A 1NP4A 3C78X 4GNYA 5H9AA 3FMZA 2Q2PA 2JU3A 4AW8A 5F1EA 4NYQA 1I06A 1ZNHA 1A57A 3KFGA 3ZUOA 3WJBA 5AJCA 1GM6A 1GT4A 2XSTA 4IAWA 4LKTA 4OMXA 4BVMA 1H91A 3U9PC 4ORUA 1SY1A 2YMSA 4M7MA 1U0XA 4RUNA 3WJGA 1G5WA 2FS6A 1LPJA 1PEEA 2NNDA 4CK4A 3ZI8A 1AB0A 1B4MA 3FR4A 3STMX 2WSJA 3IFBA 2LB6A 3FA6A 3EM0A 2ZAGA 3V8UA 2R73A 4Y0SA 4GRJA 3PECA 2AT8X 1BWYA 3EBKA 4UU3A 4GE1A 4YBPA 3RWXA 3LHNA 1JV4A 1L6MA 5HCDC 2JOZA 3VG2A 1G85A 4KH8A 1FDQA 1X71A 3IA8A 2QO6A 3PEDA 4XMGA 3B2KA 4ZR2A 4GZVA 1MUPA 1HBPA 2OFRX 4YKMA 5EEEA 4KIIA 4YGZA 1KT5A 1JZUA 1IKEA 1OEJA 4NW4A 1E02A 4HPAA 2JU7A 3C76X 1KT3A 3NX1A 1BBPA 1JJJA 1ZNEA 4YH0A 3RZYA 3UEUA 3CQNA 1OPAA 2W2AA 2F73A 3APUA 1EIIA 2K23A 3B2IA 3DSZA 4NLJA 1E5PA 3BDRA 2WUTA 4ZH6A 2NP1A 3OBLA 5BVQA 5L8OA 1CBQA 1KOIA 5L8IA 5FAZA 4KC8A 4HPDA 1IW2A 3O2YA 1KQXA 3CR6A 2QOSC 3T1DA 1TOUA 1X8UA 1YWAA 5L8NA 1BRQA 5LJHA 4GU8A 5HA1A 4MIRA 3WJFA 5FQ6E 1DZKA 4ORXA 2RD7C 2X46A 3NR3A 3WJEA 1ML7A 4WHIA 2QM9A 2X8TA 3CMPA 4U8UO 1VYGA 3NQKA 4YKOA 5BVSA 4OS8A 3OJYC 1KXOA 1SXWA 5K06A 3F6ZB 2YG2A 4ALBA 2NNEA 1D2UA 1LIBA 2GJ5A 2X45A 4U8UN 3B2HA 4QYNA 5HZ6A 4O4OA 4ORSA 4QGXA 3OD9A 1G7NA 1HMTA 2A0AA 4ALOA 1KT4A 3LV4A 5LKEA 2ACOA 4QZTA 4YDBA 4HWMA 5FENA 2CM9A 1IFCA 1YP6A 4AZOA 3NQ3A 3B2JA 5HCEC 1TVQA 4YFQA 1GX9A 1OBQA 3HWFA 1OEKA 3H3IA 3PPTA 2ZAIA 1QFVA 1P6PA 3ZW0A 2LBVA 1CBRA 1MX8A 1JIWI 4WFUA 3BU1A 3APXA 1CBSA 4A60A 4ZHFA 1SA8A 3ELZA 5HTEA 5IO6A 1ZNGA 1B56A 3FW5A 3BSZE 3S5XA 5C0NA 2AT0X 4YFPA 4AYHA 4I3BA 1IFBA 2L68A 4HPCA 3WBGA 1NP1A 1GT3A 3D97A 5HZ5A 2WEWA 1ERBA 5CE4A 5FQ7E 2HZQA 3NP1A 1R0UA 4YGGA 1BM5A 2JU8A 2Z4HA 3FIQA 3P6DA 5D4AA 1AELA 2EU7X 1E00A 2CBSA 3PP6A 4ORRA 4O3XB 3VE1A 1UZ2X 5D48A 4YDAA 1DZPA 2HNXA 2WQ9A 2Q4NA 1O1VA 2KTDA 2WWPA 4L1NA 2AH7X 4AZRA 4YMYA 1FEMA 2Q9SA 4UU2A 1ALBA 1EI5A 4I95A 2BHVA 2CZUA 1PBOA 2KT4B 3ZUIA 2PY1A 3F9DA 1YWBA 4EXZA 3BS2A 1SXYA 3HWGA 2F09A 2ANSA 4QGVA 3U0DA 3D96A 2K62A 3P6HA 1IIUA 1OEEA 5HBSA 3VG5A 4EQAC 3ZW0B 3I0AA 4TLJA 4A8ZA 4FBVA 1SXXA 1D3SA 3N91A 2A3FX 4Y0QA 4Y0PA 3AKNA 2P8GA 4MVKA 3S26A 5F7GA 5FFHA 3BX7A 4I3DA 1S7DA 2HYSA 1CJ5A 1FENA 4GETA 4QZUA 4U8UM 3O19A 4QNIA 5EPQA 3VG6A 5H9LA 2GTFX 4L3RA 2QO5A 4KCAA 4ODDA 4WFVA 2Q39A 5HWZA 1X89A 5FQ8E 1EPBA 5BYPA 2FR3A 2A2UA 1IKJA 1X8OA 4GDZA 3BU9A 3NPOA 4GNWA 4XMCA 1PMPA 3SOTA 3U03A 4YGHA 1GT1A 1OBUA 3ZW2A 3KFFA 1KT7A 2WQAE 4YCHA 3HWDA 3PQUA 4FBOA 3TF6A 4QGWA 2OVEA 3NQ9A 1JYDA 4XMFA 4IB6A 3FA9A 2A13A 3BLGA 1ICNA 3S60A 1GGLA 3WOVA 3FA8A 4D6BA 1HBQA 1DV9A 1PM1X 3MBTA 1HN2A 3UAQA 3Q6LA 1RBPA 3ZW1A 2MHDA 3CWKA 4TNNA 2G79A 1O1UA 1BRPA 2W2BA 1EPAA 4O4XA 3TGCA 4IB9A 1AVGI 3ZQ3A 1EUOA 2CZTA 2JN3A 4N7CA 3FR2A 4OMWA 2AT5X 2WEXA 2E4JA 4XMEA 2W2FA 4QAEA 2JW1A 4RUUA 1CRBA 5DG4A 2AKQA 3HTYA 2RQ0A 2AMMX 5H9NA 1MVGA 2FLJA 1S2PA 3KZAA 2OFMX 5EZ2A 4TKHA 2DM5A 4AZMA 5LJKA 4XMDA 1XCAA 2FTBA 4DQ3A 4IBAA 1AQBA 3UEVA 1EXSA 4N7DA 4IAXA 2M4LA 4ZHGA 2L67A 2CBRA 5F6ZA 2RN4A 3RBYA 3HOEA 2MJIA 1I05A 1LIDA 5LKFA 3WVMA 4EFGA 5KIDA 1GT5A 4ZJ0A 4OS3A 4MVEA 1RLBE 4COTA 4O49A 5F58A 1YP7A 4TKBA 3FLLA 3QKGA 1LF7A 2LA7A 3P02A 3KFHA 4O3WA 4PJ2A 1JJXA 2XKLA 1QY0A 4FGIB 3RSWA 1KZXA 4O4UA 2ASNX 2R56A 1LICA 1MDCA 3APWA 4GKCA 2CM4A 4OS0A 1ADLA 3ZW1B 2KD2A 3K3LA 1TXLA 1YIVA 3VG4A 3VU1A 3NADA 4EDEA 1T0VA 3O22A 3TZSA 1SY0A 1T8VA 4K19A 4MISA 1QY1A 1NGLA 3DTQA 3CBCA 4IMOA 3WJDA 5HZ9A 2KW1A 3CBSA 1OPBA 4U9CA 1OBPA 4INNA 4I9SA 4TQ2A 1DZMA 3BRNA 3UEWA 3PH6A 4R0BA 5D8JA 2HLVA 3EMMA 4I9RA 4CSBA 1DZJA 4AZNA 3MVFA 4M6SA 3JS1A 4ORYA 2OVDA 4ZHCA 2BS6A 1B8EA 3PH5A 4QYPA 2R74A 1BJ7A 1HMSA 3HK1A 4QQ1A 3WJCA 1TW4A 3FELA 2MM3A 3G7XA 3KQ0A 4ZH9A 5BVTA 3VG3A 2GC9A 3L4RA 1SY2A 4O4SA 4D6AA 2KTSA 4HFOA 4A1HA 1DFVA 5B27A 4Y0RA 5HZ8A 4GK9A 2JMBA 2NNQA 1X8QA 1QG5A 4ZCBA 4NNTA 3F8AA 4TJZA 2QO4A 1KZWA 1VPRA 1QQSA 2FT9A 4PSQA 4BQUA 1QWDA 4LQZA 4YFRA 3P6EA 5HTDA 1XKIA 1N0SA 2MWHA 1JBHA 4NNSA 3EBWA 1HQPA 3P6FA 3VG7A 3FA7A 3OE3A 1SMPI 5IO7A 2LKKA 3STNA 1EQDA 2LBAA 5LJGA 1U18A 1E06A 1LNMA 4NLIA 3FEPA 5H8TA 1SXUA 4MVLA 4ORWA 3WXQA 2BT9A 1YWDA 2HMBA 3HWEA 4O9SA 4YBUA 4FBRA 1KT6A 4O3ZA 3HOLA 2GTLO 2RCQA 5F6BA 1S44A 4IABA 2AL0X 1I4UA 3TGAA 4A1YA 4DQ4A 4IMNA 3P24A 3FW4A 1B0OA 1BSOA 1YWCA 2GTLN 3JQOA 3GE2A 5KICA 1LFOA 2RCTA 1EW3A 2AT6X 3NX2A 3P6GA 3P6CA 4TKJA 5H9KA 5AEOA 4LKPA 1BSYA 2QMIA 4ARHA 4NP1A 5AQ6A 1ZNLA 1A18A 5LJBA 3JSQA 4I3CA 3B2LA 3BY0A 1ZNKA 1GXAA 1X8NA 3FYFA 3SAOA 1DC9A 5LJEA 1ACDA 3MX7A 4QRLA 4EEJA 1GKAA 3APVA 2X8FA 5JR8A 4O3YA 4LZVA 4ZHHA 3I17A 4CV7A 1LIEA 1Y9TA 1ZNDA 3ZZVA 4GH7A 5DPQA 4ES7A 1MX7A 4IB8A 5EDBA 1A2DA 2POAA 4ZGUA 2L5PA 2OVAA 2HZRA 5LJDA 2Z4IA 5EDCA 1LIFA 4KT5A 4LZUA 2IFBA 3TGBA 4BOEA 3AKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CBI A;  2G7B A;  3D95 A;  3STK A;  1BEB A;  1T68 X;  2AT3 X;  1FTP A;  2RA6 A;  2O62 A;  2ALL X;  1QY2 A;  1Z24 A;  2A2G A;  4ZHD A;  1HMR A;  1FEL A;  3BX8 A;  2BLG A;  4AZQ A;  1X8P A;  5D45 A;  1JYJ A;  5B29 A;  5HAE A;  1I04 A;  1ZRY A;  3GAQ A;  5EED A;  3KFI A;  3FR5 A;  1LKE A;  3FEK A;  1EAL A;  3C77 X;  1KQW A;  4NYR A;  1BLR A;  4HPB A;  1ERX A;  2WR6 A;  1U17 A;  3ELX A;  2G78 A;  1YUP A;  2L9C A;  4MVI A;  5HCC C;  1QAB E;  1G74 A;  5HA0 A;  2OZQ A;  1GKA B;  2FRS A;  5D47 A;  2FS7 A;  2LFO A;  4YCE A;  1O8V A;  3FEN A;  4XMH A;  1A3Y A;  2MO5 A;  4ZFX A;  1BSQ A;  2Q2M A;  3UEX A;  1ICM A;  2FWV A;  2ACP X;  4AZP A;  1VYF A;  1URE A;  1QFT A;  5LJC A;  1SY3 A;  2FR2 A;  1GX8 A;  4WBK A;  5HZQ A;  5KHP A;  3CQR A;  2N93 A;  4IB7 A;  1DF3 A;  5IO5 A;  1KGL A;  3EYC A;  1EIO A;  1FE3 A;  1TOW A;  1NP4 A;  3C78 X;  4GNY A;  5H9A A;  3FMZ A;  2Q2P A;  2JU3 A;  4AW8 A;  5F1E A;  4NYQ A;  1I06 A;  1ZNH A;  1A57 A;  3KFG A;  3ZUO A;  3WJB A;  1JJX A;  1GM6 A;  1GT4 A;  2XST A;  4IAW A;  4LKT A;  4OMX A;  4BVM A;  1H91 A;  3U9P C;  4ORU A;  1SY1 A;  4M7M A;  1U0X A;  4RUN A;  3WJG A;  1G5W A;  2FS6 A;  1LPJ A;  1PEE A;  2NND A;  4CK4 A;  1AB0 A;  1B4M A;  3FR4 A;  3STM X;  2WSJ A;  3IFB A;  2LB6 A;  3FA6 A;  3EM0 A;  2R73 A;  4Y0S A;  4GRJ A;  3PEC A;  2AT8 X;  1BWY A;  3EBK A;  4UU3 A;  4GE1 A;  4YBP A;  1JV4 A;  1L6M A;  5HCD C;  2JOZ A;  3VG2 A;  1G85 A;  1FDQ A;  1X71 A;  3IA8 A;  2QO6 A;  3PED A;  4XMG A;  3B2K A;  4ZR2 A;  1MUP A;  1HBP A;  2OFR X;  4YKM A;  5EEE A;  4KII A;  4YGZ A;  1KT5 A;  1JZU A;  1IKE A;  1OEJ A;  1E02 A;  4HPA A;  2JU7 A;  3C76 X;  1KT3 A;  3NX1 A;  1BBP A;  1JJJ A;  1ZNE A;  4YH0 A;  3RZY A;  3UEU A;  3CQN A;  1OPA A;  2W2A A;  2F73 A;  3APU A;  1EII A;  2K23 A;  3B2I A;  3DSZ A;  4NLJ A;  1E5P A;  3BDR A;  2WUT A;  4ZH6 A;  2NP1 A;  5BVQ A;  5L8O A;  1CBQ A;  1KOI A;  5L8I A;  5FAZ A;  4HPD A;  1IW2 A;  3O2Y A;  1KQX A;  3CR6 A;  2QOS C;  3T1D A;  1TOU A;  1X8U A;  1YWA A;  5L8N A;  1BRQ A;  5LJH A;  5HA1 A;  3WJF A;  1DZK A;  4ORX A;  2RD7 C;  2X46 A;  3NR3 A;  3WJE A;  1ML7 A;  2QM9 A;  3CMP A;  1VYG A;  4YKO A;  5BVS A;  4OS8 A;  3OJY C;  1KXO A;  1SXW A;  5K06 A;  2YG2 A;  4ALB A;  2NNE A;  1D2U A;  1LIB A;  2GJ5 A;  2X45 A;  3B2H A;  4QYN A;  5HZ6 A;  4ORS A;  4QGX A;  1G7N A;  1HMT A;  2A0A A;  4ALO A;  1KT4 A;  5LKE A;  2ACO A;  4QZT A;  4YDB A;  5FEN A;  2CM9 A;  1IFC A;  1YP6 A;  4AZO A;  3NQ3 A;  3B2J A;  5HCE C;  1TVQ A;  4YFQ A;  1GX9 A;  1OBQ A;  3HWF A;  1OEK A;  3PPT A;  1QFV A;  1P6P A;  2LBV A;  1CBR A;  1MX8 A;  4WFU A;  3BU1 A;  3APX A;  1CBS A;  4A60 A;  4ZHF A;  1SA8 A;  3ELZ A;  5HTE A;  5IO6 A;  1ZNG A;  1B56 A;  3FW5 A;  3BSZ E;  5C0N A;  2AT0 X;  4YFP A;  4AYH A;  4I3B A;  1IFB A;  2L68 A;  4HPC A;  3WBG A;  1NP1 A;  1GT3 A;  3D97 A;  5HZ5 A;  2WEW A;  1ERB A;  5CE4 A;  2HZQ A;  3NP1 A;  1R0U A;  4YGG A;  1BM5 A;  2JU8 A;  3FIQ A;  3P6D A;  5D4A A;  1AEL A;  2EU7 X;  1E00 A;  2CBS A;  3PP6 A;  4ORR A;  1UZ2 X;  5D48 A;  4YDA A;  1DZP A;  2HNX A;  2WQ9 A;  2Q4N A;  1O1V A;  2KTD A;  2WWP A;  2AH7 X;  4AZR A;  4YMY A;  1FEM A;  2Q9S A;  4UU2 A;  1ALB A;  3ZUI A;  2CZU A;  1PBO A;  2KT4 B;  2PY1 A;  3F9D A;  1YWB A;  4EXZ A;  3BS2 A;  1SXY A;  3HWG A;  2ANS A;  4QGV A;  3U0D A;  3D96 A;  2K62 A;  3P6H A;  1IIU A;  1OEE A;  5HBS A;  3VG5 A;  3I0A A;  4TLJ A;  4A8Z A;  1SXX A;  1D3S A;  2A3F X;  4Y0Q A;  4Y0P A;  3AKN A;  2P8G A;  4MVK A;  3S26 A;  5F7G A;  5FFH A;  3BX7 A;  4I3D A;  1S7D A;  2HYS A;  1CJ5 A;  1FEN A;  4GET A;  4QZU A;  3VG6 A;  3O19 A;  5EPQ A;  5H9L A;  2GTF X;  2QO5 A;  4ODD A;  4WFV A;  2Q39 A;  5HWZ A;  1X89 A;  1EPB A;  2FR3 A;  2A2U A;  1IKJ A;  1X8O A;  3BU9 A;  3NPO A;  4GNW A;  4XMC A;  1PMP A;  3U03 A;  4YGH A;  1GT1 A;  1OBU A;  3KFF A;  1KT7 A;  2WQA E;  4YCH A;  3HWD A;  3TF6 A;  4QGW A;  2OVE A;  3NQ9 A;  1JYD A;  4XMF A;  4IB6 A;  3FA9 A;  2A13 A;  3BLG A;  1ICN A;  1GGL A;  3FA8 A;  4D6B A;  1HBQ A;  1DV9 A;  1PM1 X;  3MBT A;  1HN2 A;  3Q6L A;  1RBP A;  3CWK A;  4TNN A;  2G79 A;  1O1U A;  1BRP A;  2W2B A;  1EPA A;  3TGC A;  4IB9 A;  1AVG I;  3ZQ3 A;  1EUO A;  2CZT A;  2JN3 A;  4N7C A;  3FR2 A;  4OMW A;  2AT5 X;  2WEX A;  2E4J A;  4XME A;  2W2F A;  4QAE A;  4RUU A;  1CRB A;  5DG4 A;  2AKQ A;  2RQ0 A;  2AMM X;  5H9N A;  1MVG A;  2FLJ A;  1S2P A;  3KZA A;  2OFM X;  5EZ2 A;  4TKH A;  2DM5 A;  4AZM A;  5LJK A;  4XMD A;  1XCA A;  2FTB A;  4DQ3 A;  4IBA A;  1AQB A;  3UEV A;  1EXS A;  4N7D A;  4IAX A;  4ZHG A;  2L67 A;  2CBR A;  5F6Z A;  2MJI A;  1I05 A;  1LID A;  5LKF A;  3WVM A;  4EFG A;  5KID A;  1GT5 A;  4ZJ0 A;  4OS3 A;  1RLB E;  5F58 A;  4TKB A;  1YP7 A;  3FLL A;  3QKG A;  1LF7 A;  3KFH A;  2XKL A;  1QY0 A;  3RSW A;  1KZX A;  2ASN X;  2R56 A;  1LIC A;  1MDC A;  3APW A;  4GKC A;  2CM4 A;  4OS0 A;  1ADL A;  3K3L A;  1TXL A;  1YIV A;  3VG4 A;  4EDE A;  3NAD A;  1T0V A;  3O22 A;  3TZS A;  1SY0 A;  1T8V A;  4K19 A;  1QY1 A;  1NGL A;  3DTQ A;  3CBC A;  4IMO A;  3WJD A;  5HZ9 A;  3CBS A;  1OPB A;  1OBP A;  4I9S A;  4TQ2 A;  1DZM A;  3BRN A;  3UEW A;  3PH6 A;  4R0B A;  5D8J A;  2HLV A;  3EMM A;  4I9R A;  1DZJ A;  4AZN A;  3MVF A;  4M6S A;  3JS1 A;  4ORY A;  2OVD A;  4ZHC A;  1B8E A;  3PH5 A;  4QYP A;  2R74 A;  1BJ7 A;  1HMS A;  3HK1 A;  3WJC A;  1TW4 A;  3FEL A;  2MM3 A;  3G7X A;  3KQ0 A;  4ZH9 A;  5BVT A;  3VG3 A;  2GC9 A;  3L4R A;  1SY2 A;  4D6A A;  4HFO A;  4A1H A;  1DFV A;  5B27 A;  4Y0R A;  5HZ8 A;  2NNQ A;  1X8Q A;  1QG5 A;  4ZCB A;  4NNT A;  3F8A A;  4TJZ A;  2QO4 A;  1KZW A;  1VPR A;  1QQS A;  2FT9 A;  4PSQ A;  4BQU A;  1QWD A;  5HTD A;  4YFR A;  3P6E A;  1XKI A;  1N0S A;  1JBH A;  4NNS A;  3EBW A;  1HQP A;  3P6F A;  3VG7 A;  3FA7 A;  5IO7 A;  2LKK A;  3STN A;  1EQD A;  2LBA A;  5LJG A;  1U18 A;  1E06 A;  1LNM A;  4NLI A;  3FEP A;  5H8T A;  1SXU A;  4MVL A;  4ORW A;  3WXQ A;  1YWD A;  2HMB A;  3HWE A;  4O9S A;  4YBU A;  1KT6 A;  2RCQ A;  5F6B A;  1S44 A;  4A1Y A;  2AL0 X;  1I4U A;  3TGA A;  4DQ4 A;  4IMN A;  3FW4 A;  1B0O A;  1BSO A;  1YWC A;  5KIC A;  1LFO A;  2RCT A;  1EW3 A;  2AT6 X;  3NX2 A;  3P6G A;  3P6C A;  4TKJ A;  5H9K A;  4LKP A;  1BSY A;  4ARH A;  4NP1 A;  5AQ6 A;  1ZNL A;  1A18 A;  5LJB A;  3JSQ A;  4I3C A;  3B2L A;  3BY0 A;  1ZNK A;  1GXA A;  1X8N A;  3SAO A;  1DC9 A;  5LJE A;  1ACD A;  4EEJ A;  1GKA A;  3APV A;  5JR8 A;  4LZV A;  4ZHH A;  3I17 A;  1LIE A;  1ZND A;  4GH7 A;  5DPQ A;  4ES7 A;  1MX7 A;  4IB8 A;  5EDB A;  1A2D A;  2POA A;  4ZGU A;  2L5P A;  2OVA A;  2HZR A;  5LJD A;  5EDC A;  1LIF A;  4LZU A;  2IFB A;  3TGB A;  4BOE A;  3AKM A; 
#chains in the Genus database with same CATH topology
 2IZL B;  3PQS A;  2OVS A;  1CBI A;  2G7B A;  1VWP B;  3D95 A;  1UYO X;  3RDU A;  3STK A;  1BEB A;  3VE2 A;  1T68 X;  1I78 A;  2AT3 X;  2OL8 O;  4Z2V A;  1FTP A;  2RA6 A;  1SWT A;  2O62 A;  4U3Q A;  1NC9 A;  1Y9L A;  1QY2 A;  2ALL X;  1Z24 A;  2A2G A;  3VG6 A;  4ZHD A;  1HMR A;  4Y59 A;  1FEL A;  3BX8 A;  1LCZ A;  2BLG A;  4AZQ A;  1X8P A;  5D45 A;  2FHN X;  1JYJ A;  2Y3E A;  5B29 A;  1VWN B;  5HAE A;  4I6S A;  4CPF A;  1I04 A;  1ZRY A;  3GAQ A;  5EED A;  3ZWE A;  3KFI A;  3FR5 A;  1LKE A;  3D4R A;  3FEK A;  2QCB A;  1KQW A;  3C77 X;  3E3C A;  4IRW A;  4ML7 B;  4NYR A;  1EAL A;  3WZN A;  1BLR A;  4HPB A;  1ERX A;  2WR6 A;  4FQB B;  3VHI A;  4ID2 A;  4KC7 A;  2UZ2 A;  5AJB A;  1U17 A;  3ELX A;  2G78 A;  1YUP A;  4ZGF A;  2L9C A;  4MVI A;  4ON1 A;  1QAB E;  1G74 A;  1SLG B;  2RTB B;  3S5V A;  2HKD A;  5HA0 A;  2OZQ A;  4JGL A;  1GKA B;  2VFB A;  1SWO A;  1VYO A;  2FRS A;  1VWQ B;  3SZJ A;  4Z6J A;  5D47 A;  2FS7 A;  2LFO A;  4YCE A;  1O8V A;  1LDO A;  3VPJ E;  1PTS A;  2WPU A;  3FEN A;  4XMH A;  3EW2 A;  3RE5 A;  2GTL M;  3RKG A;  1A3Y A;  4BX5 A;  1SWH A;  2MO5 A;  4ZFX A;  1BSQ A;  1SWF A;  2FGS A;  2Q2M A;  1ICM A;  2FWV A;  1VWC B;  2ACP X;  1VYF A;  2OF9 A;  1URE A;  1QFT A;  2IZG B;  4AZP A;  5LJC A;  3SLO A;  1SY3 A;  2FR2 A;  1GX8 A;  4WBK A;  1N7Y A;  1N4J A;  5HZQ A;  5KHP A;  2FKJ A;  3CQR A;  5CYB A;  2X8S A;  2N93 A;  4IB7 A;  1DF3 A;  2GH7 A;  5IO5 A;  1KGL A;  3EYC A;  1EIO A;  1FE3 A;  3NBX X;  1TOW A;  2X55 A;  2BS5 A;  4I60 A;  1NP4 A;  4DCB A;  3C78 X;  4GNY A;  5H9A A;  3FMZ A;  4GUZ A;  2Q2P A;  1VWD B;  2JU3 A;  4AW8 A;  5F1E A;  4NYQ A;  1I06 A;  1ZNH A;  1A57 A;  3KFG A;  3ZUO A;  3WJB A;  5AJC A;  1GM6 A;  1GT4 A;  2XST A;  4IAW A;  4LKT A;  4OMX A;  4BVM A;  1H91 A;  3U9P C;  2IZJ A;  1KL5 A;  1SY1 A;  2YMS A;  4GGR A;  1U0X A;  4M7M A;  4ORU A;  4RUN A;  2FS6 A;  1Y52 X;  1LPJ A;  3WJG A;  1G5W A;  1PEE A;  1AVE A;  2NND A;  4CK4 A;  3ZI8 A;  1SRG A;  1AB0 A;  3PDF A;  1B4M A;  3FR4 A;  3STM X;  1SRH A;  2OYB O;  4JHQ A;  2F01 A;  2WSJ A;  1KL4 A;  3IFB A;  2LB6 A;  3FA6 A;  3EM0 A;  2A8G A;  2ZAG A;  3V8U A;  4CPH A;  2R73 A;  2IZE B;  4Y0S A;  1E2T A;  2RTO B;  4GRJ A;  3PEC A;  2AT8 X;  5IRU A;  1BWY A;  2RTG B;  1LDQ A;  3EBK A;  4UU3 A;  4GE1 A;  3T2X A;  4YBP A;  3RWX A;  3LHN A;  3RDM A;  1JV4 A;  1L6M A;  1STS B;  2QOM A;  5HCD C;  2X32 A;  4GDA A;  2JOZ A;  5CHK A;  1IJ8 A;  1G85 A;  3VG2 A;  4KH8 A;  1FDQ A;  1SLF B;  3SZH A;  1X71 A;  3IA8 A;  2QO6 A;  3FDC A;  3PED A;  3B2K A;  4XMG A;  2C1Q A;  2RTD B;  3MM0 A;  4GZV A;  1MUP A;  4ZR2 A;  1HBP A;  2OFR X;  4BX5 B;  1VWB B;  4CDC A;  4YKM A;  5EEE A;  4KII A;  4YGZ A;  1KT5 A;  2PI3 O;  1JZU A;  1IKE A;  4EKV A;  1OEJ A;  4NW4 A;  1E02 A;  4HPA A;  2JU7 A;  3C76 X;  1KT3 A;  3NX1 A;  1BBP A;  1JJJ A;  2RTP B;  1ZNE A;  4YH0 A;  3RZY A;  3UEU A;  3CQN A;  1KFF A;  1OPA A;  2F73 A;  2W2A A;  3APU A;  1EII A;  2K23 A;  3B2I A;  3DSZ A;  4NLJ A;  1SWA A;  1E5P A;  3WYQ A;  3AUM O;  2WUT A;  3BDR A;  4ZH6 A;  1HXL A;  2NP1 A;  3OBL A;  5BVQ A;  1CBQ A;  5L8O A;  1LUQ A;  3RE6 A;  1KOI A;  2BC3 A;  5FAZ A;  4KC8 A;  1VWJ B;  3QQ2 A;  1IW2 A;  3O2Y A;  4HPD A;  5L8I A;  1KQX A;  1WBI A;  3CR6 A;  2QOS C;  3T1D A;  1TOU A;  1X8U A;  1YWA A;  2IZA A;  1BRQ A;  5L8N A;  3SLJ A;  4GU8 A;  5HA1 A;  4MIR A;  3WJF A;  5FQ6 E;  4BX6 A;  2RTJ A;  1DZK A;  4ORX A;  2RD7 C;  2X46 A;  3NR3 A;  3X00 A;  3WJE A;  1ML7 A;  4WHI A;  2QM9 A;  2X8T A;  3CMP A;  4U8U O;  1VYG A;  3NQK A;  4YKO A;  5BVS A;  4Z27 A;  4OS8 A;  3OJY C;  1NDJ A;  1KXO A;  1SXW A;  5K06 A;  3F6Z B;  1NQM A;  2YG2 A;  1N9M A;  4CPH B;  2DJF A;  2Y3F A;  2OFA A;  5K68 A;  1SWC A;  2NNE A;  4ALB A;  2IZD B;  1D2U A;  2MF6 A;  1LIB A;  2GJ5 A;  2X45 A;  4U8U N;  2G5L A;  3B2H A;  1MK5 A;  1N9Y A;  1K3B A;  4O4O A;  4ORS A;  4QYN A;  4QGX A;  3OD9 A;  5HZ6 A;  1G7N A;  1HMT A;  2A0A A;  1LCW A;  1KT4 A;  1SWP A;  4ALO A;  3LV4 A;  5LKE A;  2ACO A;  4QZT A;  3FID A;  4YDB A;  4HWM A;  5FEN A;  2CM9 A;  1IFC A;  1YP6 A;  4AZO A;  3NQ3 A;  3B2J A;  5HCE C;  1TVQ A;  4YFQ A;  3D9W A;  1GX9 A;  1OBQ A;  3HWF A;  1OEK A;  3H3I A;  3PPT A;  2ZAI A;  1QFV A;  1P6P A;  3T2W A;  3ZW0 A;  2LBV A;  1CBR A;  1MX8 A;  3VGW A;  1JIW I;  4WFU A;  3BU1 A;  3APX A;  1CBS A;  4A60 A;  4ZHF A;  1SA8 A;  3ELZ A;  5HTE A;  5IO6 A;  5B3M O;  1ZNG A;  1B56 A;  3FW5 A;  2OFB A;  2OY1 O;  3BSZ E;  3S5X A;  5C0N A;  2AF5 A;  2AT0 X;  2IZI A;  4YFP A;  4AYH A;  4I3B A;  1IFB A;  2L68 A;  4HPC A;  3WBG A;  3PK2 A;  1NP1 A;  2JGS A;  1GT3 A;  3D97 A;  5HZ5 A;  2WEW A;  1ERB A;  1WUB A;  5FQ7 E;  1SWK A;  5CE4 A;  2HZQ A;  3LTW A;  5IRA A;  3NP1 A;  1R0U A;  3SZI A;  4YGG A;  1BM5 A;  4BX6 B;  2JU8 A;  2Z4H A;  2IZK A;  3FIQ A;  3P6D A;  5D4A A;  2RTN B;  2EU7 X;  1AEL A;  1E00 A;  4OEM A;  2CBS A;  3PP6 A;  4ORR A;  4O3X B;  3VE1 A;  1UZ2 X;  5D48 A;  4D6A A;  4YDA A;  1SWQ A;  1DZP A;  2HNX A;  2WQ9 A;  1UYN X;  5HCC C;  1RXH A;  2Q4N A;  1O1V A;  1VWR B;  2KTD A;  2WWP A;  3EW1 A;  4L1N A;  2AH7 X;  4AZR A;  1PBY A;  4YMY A;  1FEM A;  1VWL B;  2Q9S A;  3AEH A;  4UU2 A;  1ALB A;  1EI5 A;  4I95 A;  2BHV A;  2CZU A;  1PBO A;  2KT4 B;  3RDX A;  3ZUI A;  2PY1 A;  3F9D A;  1YWB A;  4EXZ A;  4OKA A;  3BS2 A;  1SXY A;  3HWG A;  2F09 A;  2ANS A;  4QGV A;  3U0D A;  3D96 A;  2K62 A;  3P6H A;  2OY7 A;  1IIU A;  1OEE A;  5HBS A;  3VG5 A;  4EQA C;  4NV7 A;  1AVD A;  3ZW0 B;  2RTH B;  3I0A A;  4CPE A;  4TLJ A;  4YVB A;  4A8Z A;  4Z2P A;  4FBV A;  1SXX A;  3WZO A;  1D3S A;  3N91 A;  2A3F X;  4Y0Q A;  4Y0P A;  4BX7 A;  3AKN A;  2P8G A;  4MVK A;  3S26 A;  2RTL A;  5F7G A;  4NV8 A;  5FFH A;  3BX7 A;  2IZF B;  4I3D A;  1S7D A;  3UEX A;  5K67 A;  4GGZ A;  5L3Y A;  2HYS A;  1CJ5 A;  1FEN A;  4GET A;  4QZU A;  4U8U M;  3O19 A;  4QNI A;  5EPQ A;  5B10 O;  5H9L A;  2GTF X;  4L3R A;  2CAM A;  2VDF A;  2QO5 A;  4KCA A;  4ODD A;  1NQN A;  4WFV A;  5IRW A;  1LCV A;  2Q39 A;  5HWZ A;  1X89 A;  5FQ8 E;  1EPB A;  5BYP A;  2FR3 A;  2A2U A;  1IKJ A;  1JQP A;  1VWF B;  2IZC B;  1X8O A;  4GDZ A;  3BU9 A;  1N43 A;  1SWR A;  1DF8 A;  3NPO A;  4GNW A;  4XMC A;  1PMP A;  3SOT A;  3U03 A;  4YGH A;  1GT1 A;  1OBU A;  3ZW2 A;  2OY8 A;  1KT7 A;  1SRF A;  3KFF A;  4BBO A;  2WQA E;  4YCH A;  1W6F A;  3HWD A;  3PQU A;  4FBO A;  5B11 O;  2UYW A;  4QGW A;  2OVE A;  3NQ9 A;  3TF6 A;  1JYD A;  2OF8 A;  4XMF A;  4IB6 A;  3FA9 A;  1RSU B;  2A13 A;  3BLG A;  1ICN A;  3S60 A;  1GGL A;  3WOV A;  3FA8 A;  4D6B A;  1HBQ A;  1DV9 A;  1PM1 X;  3WZQ A;  3MBT A;  1HN2 A;  3UAQ A;  3Q6L A;  1RBP A;  5CSE A;  3ZW1 A;  2MHD A;  3CWK A;  4TNN A;  2G79 A;  2RTA A;  2X34 A;  1O1U A;  1BRP A;  5B5F A;  2W2B A;  1EPA A;  4O4X A;  3TGC A;  4IB9 A;  1AVG I;  3ZQ3 A;  1EUO A;  1MOY A;  2CZT A;  2JN3 A;  1SWE A;  3EC5 A;  4N7C A;  3FR2 A;  1GX3 A;  4OMW A;  4JNJ A;  1HQQ A;  5AEO A;  1Y0G A;  4JO6 A;  1HXZ A;  4BX7 B;  2AT5 X;  1JJU A;  2WEX A;  2E4J A;  4XME A;  3RDQ A;  2W2F A;  4QAE A;  1VWM B;  2JW1 A;  3RDS A;  4RUU A;  3VHM A;  1CRB A;  5DG4 A;  2AKQ A;  3HTY A;  1VWG B;  2RQ0 A;  2AMM X;  5H9N A;  1MVG A;  2FLJ A;  1S2P A;  3KZA A;  2OFM X;  5EZ2 A;  4TKH A;  5IXG A;  2DM5 A;  1SRE A;  2RTM A;  2OY5 O;  4AZM A;  4BJ8 A;  5LJK A;  4XMD A;  1XCA A;  2FTB A;  4DQ3 A;  4IBA A;  1AQB A;  4Z28 A;  1EXS A;  4N7D A;  4IAX A;  3UEV A;  2M4L A;  4OEL A;  4ZHG A;  2L67 A;  2CBR A;  5F6Z A;  2RN4 A;  3RBY A;  3HOE A;  1SLE B;  4C5P A;  2MJI A;  1I05 A;  1LID A;  5LKF A;  3WVM A;  1W4T A;  4EFG A;  1GT5 A;  2FKG A;  5KID A;  4ZJ0 A;  4OS3 A;  4MVE A;  1RLB E;  4COT A;  2I5Z O;  4O49 A;  1YP7 A;  5F58 A;  1JMX A;  3FLL A;  4TKB A;  3QKG A;  1LF7 A;  2LA7 A;  2RTE B;  4Z2O A;  1K24 A;  3P02 A;  3KFH A;  4O3W A;  1VWO B;  4PJ2 A;  2XKL A;  1QY0 A;  4FGI B;  1JJX A;  3RSW A;  1RAV A;  1KZX A;  2RTI B;  4O4U A;  2ASN X;  2R56 A;  1LIC A;  1MDC A;  3APW A;  3MG5 A;  1I9H A;  2CM4 A;  1ADL A;  4GKC A;  4OS0 A;  3ZW1 B;  2KD2 A;  1NBX A;  1TXL A;  1YIV A;  3K3L A;  3CKF A;  3NAD A;  3VG4 A;  1T0V A;  3VU1 A;  4EDE A;  4CPI A;  3T6F A;  3O22 A;  3TZS A;  1SY0 A;  1T8V A;  4K19 A;  4MIS A;  4BCS A;  3RY1 A;  1QY1 A;  1NGL A;  1RXK A;  3CBC A;  3DTQ A;  4IMO A;  3WJD A;  2Y32 A;  4BGF A;  5HZ9 A;  2KW1 A;  3CBS A;  1OPB A;  4U9C A;  1SLD B;  1OBP A;  4INN A;  4I9S A;  4TQ2 A;  1DZM A;  3BRN A;  3UEW A;  3PH6 A;  4R0B A;  1SWS A;  2HLV A;  3EMM A;  4I9R A;  5D8J A;  4CSB A;  1DZJ A;  4AZN A;  3MVF A;  4M6S A;  3JS1 A;  4ORY A;  2OVD A;  3KVN A;  5F2B A;  4ZHC A;  2BS6 A;  1B8E A;  3PH5 A;  4CDD A;  4GJS A;  4QYP A;  2FHL A;  1BJ7 A;  1HMS A;  2R74 A;  1SWD A;  1LEL A;  3HK1 A;  4QQ1 A;  3WJC A;  1TW4 A;  1Y53 X;  3FEL A;  2MM3 A;  5JD2 A;  1VWA B;  3CKG A;  3G7X A;  3KQ0 A;  3WZP A;  4ZH9 A;  2RTC B;  3VG3 A;  1VWK B;  2GC9 A;  3L4R A;  5BVT A;  1SY2 A;  2BSZ A;  4O4S A;  3SLT A;  2KTS A;  4HFO A;  4U46 A;  4A1H A;  1DFV A;  5B27 A;  4Y0R A;  5HZ8 A;  4GK9 A;  2JMB A;  1STR B;  3WYP A;  2NNQ A;  5B5G A;  1X8Q A;  1QG5 A;  4ZCB A;  4NNT A;  3F8A A;  4TJZ A;  2QO4 A;  1KZW A;  1VPR A;  1QQS A;  2RTF B;  2FT9 A;  4PSQ A;  4BQU A;  5LJH A;  1QWD A;  1VWI B;  4LQZ A;  4YFR A;  3P6E A;  5HTD A;  5B2A O;  1XKI A;  1N0S A;  2MWH A;  4GJV A;  1JBH A;  4NNS A;  3EBW A;  1HQP A;  2RTQ B;  3P6F A;  3VG7 A;  3FA7 A;  3OE3 A;  1SMP I;  5IO7 A;  2LKK A;  2IZH B;  4CDF A;  3STN A;  4B55 A;  1EQD A;  1SWG A;  2LBA A;  5LJG A;  2C4I A;  1U18 A;  1E06 A;  1LNM A;  4NLI A;  3FEP A;  5H8T A;  1SXU A;  1OSP O;  4MVL A;  4ORW A;  3WXQ A;  2ZSC A;  2BT9 A;  1YWD A;  2HMB A;  3HWE A;  4O9S A;  4YBU A;  4FBR A;  4BOE A;  1KT6 A;  4MEE A;  4O3Z A;  3HOL A;  2GTL O;  2RCQ A;  5F6B A;  1S44 A;  4IAB A;  1Y55 X;  1I4U A;  2AL0 X;  3TGA A;  3VHH A;  4A1Y A;  4DQ4 A;  4CDE A;  4IMN A;  1SWJ A;  3P24 A;  3FW4 A;  1SRI A;  1B0O A;  1BSO A;  1YWC A;  2GTL N;  3JQO A;  3Q34 A;  2I5V O;  3GE2 A;  1W5R A;  5KIC A;  3HPE A;  1LFO A;  1KL3 A;  1EW3 A;  2AT6 X;  2RCT A;  3NX2 A;  3P6G A;  1HY2 A;  3P6C A;  4TKJ A;  5H9K A;  1FJ1 E;  4LKP A;  1MM9 A;  1BSY A;  2QMI A;  4ARH A;  4NP1 A;  5AQ6 A;  1ZNL A;  1A18 A;  2C1S A;  2OL7 A;  3JSQ A;  5LJB A;  1RXJ A;  2VFC A;  4I3C A;  4Y5D A;  3B2L A;  1SWB A;  2IZB A;  3BY0 A;  1ZNK A;  1GXA A;  1X8N A;  2A5B A;  3FYF A;  3SAO A;  1VWE B;  1DC9 A;  1JMZ A;  1SWL A;  5LJE A;  1ACD A;  1VWH B;  3MX7 A;  2AVI A;  1STP A;  4QRL A;  1GKA A;  2X4M A;  2X8F A;  3APV A;  3RY2 A;  4O3Y A;  4LZV A;  4EEJ A;  4ZHH A;  3I17 A;  5JR8 A;  2A5C A;  1LIE A;  1Y9T A;  1ZND A;  2DJG A;  4CV7 A;  4GGT A;  3ZZV A;  4GD9 A;  1SWN A;  4GH7 A;  5DPQ A;  1SWU A;  4ES7 A;  1MX7 A;  4IB8 A;  5EDB A;  1A2D A;  2POA A;  4ZGU A;  1MEP A;  1RST B;  2G8C O;  2L5P A;  2OVA A;  2X56 A;  3T6L A;  2HZR A;  4DNE A;  2RTR B;  5LJD A;  2Z4I A;  2OL6 O;  1LIF A;  1SRJ A;  2RTK A;  2IFB A;  4KT5 A;  4LZU A;  5EDC A;  3TGB A;  3RDO A;  3AKM A; 
#chains in the Genus database with same CATH homology
 3PQS A;  2OVS A;  1CBI A;  2G7B A;  3D95 A;  3STK A;  3VE2 A;  1BEB A;  1T68 X;  2AT3 X;  1FTP A;  2RA6 A;  2O62 A;  4U3Q A;  1Y9L A;  1QY2 A;  2ALL X;  1Z24 A;  2A2G A;  4ZHD A;  1HMR A;  1FEL A;  3BX8 A;  2BLG A;  4AZQ A;  1X8P A;  5D45 A;  1JYJ A;  5B29 A;  5HAE A;  4I6S A;  1I04 A;  1ZRY A;  3GAQ A;  5EED A;  3ZWE A;  3KFI A;  3FR5 A;  1LKE A;  3D4R A;  3FEK A;  3C77 X;  1KQW A;  3E3C A;  4ML7 B;  4NYR A;  1EAL A;  1BLR A;  4HPB A;  1ERX A;  2WR6 A;  4FQB B;  4ID2 A;  4KC7 A;  5AJB A;  1U17 A;  3ELX A;  2G78 A;  1YUP A;  4ZGF A;  2L9C A;  4MVI A;  4ON1 A;  1QAB E;  1G74 A;  3S5V A;  5HCC C;  5HA0 A;  2OZQ A;  4JGL A;  1GKA B;  2FRS A;  5D47 A;  2FS7 A;  2LFO A;  4YCE A;  1O8V A;  3VPJ E;  3FEN A;  4XMH A;  3RKG A;  2GTL M;  1A3Y A;  2MO5 A;  4ZFX A;  1BSQ A;  2Q2M A;  3UEX A;  1ICM A;  2FWV A;  2ACP X;  4AZP A;  1VYF A;  1URE A;  1QFT A;  5LJC A;  1SY3 A;  2FR2 A;  1GX8 A;  4WBK A;  5HZQ A;  5KHP A;  3CQR A;  5CYB A;  2X8S A;  2N93 A;  4IB7 A;  1DF3 A;  5IO5 A;  1KGL A;  3EYC A;  1EIO A;  1FE3 A;  3NBX X;  1TOW A;  2BS5 A;  1NP4 A;  3C78 X;  4GNY A;  5H9A A;  3FMZ A;  2Q2P A;  2JU3 A;  4AW8 A;  5F1E A;  4NYQ A;  1I06 A;  1ZNH A;  1A57 A;  3KFG A;  3ZUO A;  3WJB A;  5AJC A;  1GM6 A;  1GT4 A;  2XST A;  4IAW A;  4LKT A;  4OMX A;  4BVM A;  1H91 A;  3U9P C;  4ORU A;  1SY1 A;  2YMS A;  4M7M A;  1U0X A;  4RUN A;  3WJG A;  1G5W A;  2FS6 A;  1LPJ A;  1PEE A;  2NND A;  4CK4 A;  3ZI8 A;  1AB0 A;  1B4M A;  3FR4 A;  3STM X;  2WSJ A;  3IFB A;  2LB6 A;  3FA6 A;  3EM0 A;  2ZAG A;  3V8U A;  2R73 A;  4Y0S A;  4GRJ A;  3PEC A;  2AT8 X;  1BWY A;  3EBK A;  4UU3 A;  4GE1 A;  4YBP A;  3RWX A;  3LHN A;  1JV4 A;  1L6M A;  5HCD C;  2JOZ A;  3VG2 A;  1G85 A;  4KH8 A;  1FDQ A;  1X71 A;  3IA8 A;  2QO6 A;  3PED A;  4XMG A;  3B2K A;  4ZR2 A;  4GZV A;  1MUP A;  1HBP A;  2OFR X;  4YKM A;  5EEE A;  4KII A;  4YGZ A;  1KT5 A;  1JZU A;  1IKE A;  1OEJ A;  4NW4 A;  1E02 A;  4HPA A;  2JU7 A;  3C76 X;  1KT3 A;  3NX1 A;  1BBP A;  1JJJ A;  1ZNE A;  4YH0 A;  3RZY A;  3UEU A;  3CQN A;  1OPA A;  2W2A A;  2F73 A;  3APU A;  1EII A;  2K23 A;  3B2I A;  3DSZ A;  4NLJ A;  1E5P A;  3BDR A;  2WUT A;  4ZH6 A;  2NP1 A;  3OBL A;  5BVQ A;  5L8O A;  1CBQ A;  1KOI A;  5L8I A;  5FAZ A;  4KC8 A;  4HPD A;  1IW2 A;  3O2Y A;  1KQX A;  3CR6 A;  2QOS C;  3T1D A;  1TOU A;  1X8U A;  1YWA A;  5L8N A;  1BRQ A;  5LJH A;  4GU8 A;  5HA1 A;  4MIR A;  3WJF A;  5FQ6 E;  1DZK A;  4ORX A;  2RD7 C;  2X46 A;  3NR3 A;  3WJE A;  1ML7 A;  4WHI A;  2QM9 A;  2X8T A;  3CMP A;  4U8U O;  1VYG A;  3NQK A;  4YKO A;  5BVS A;  4OS8 A;  3OJY C;  1KXO A;  1SXW A;  5K06 A;  3F6Z B;  2YG2 A;  4ALB A;  2NNE A;  1D2U A;  1LIB A;  2GJ5 A;  2X45 A;  4U8U N;  3B2H A;  4QYN A;  5HZ6 A;  4O4O A;  4ORS A;  4QGX A;  3OD9 A;  1G7N A;  1HMT A;  2A0A A;  4ALO A;  1KT4 A;  3LV4 A;  5LKE A;  2ACO A;  4QZT A;  4YDB A;  4HWM A;  5FEN A;  2CM9 A;  1IFC A;  1YP6 A;  4AZO A;  3NQ3 A;  3B2J A;  5HCE C;  1TVQ A;  4YFQ A;  1GX9 A;  1OBQ A;  3HWF A;  1OEK A;  3H3I A;  3PPT A;  2ZAI A;  1QFV A;  1P6P A;  3ZW0 A;  2LBV A;  1CBR A;  1MX8 A;  1JIW I;  4WFU A;  3BU1 A;  3APX A;  1CBS A;  4A60 A;  4ZHF A;  1SA8 A;  3ELZ A;  5HTE A;  5IO6 A;  1ZNG A;  1B56 A;  3FW5 A;  3BSZ E;  3S5X A;  5C0N A;  2AT0 X;  4YFP A;  4AYH A;  4I3B A;  1IFB A;  2L68 A;  4HPC A;  3WBG A;  1NP1 A;  1GT3 A;  3D97 A;  5HZ5 A;  2WEW A;  1ERB A;  5CE4 A;  5FQ7 E;  2HZQ A;  3NP1 A;  1R0U A;  4YGG A;  1BM5 A;  2JU8 A;  2Z4H A;  3FIQ A;  3P6D A;  5D4A A;  1AEL A;  2EU7 X;  1E00 A;  2CBS A;  3PP6 A;  4ORR A;  4O3X B;  3VE1 A;  1UZ2 X;  5D48 A;  4YDA A;  1DZP A;  2HNX A;  2WQ9 A;  2Q4N A;  1O1V A;  2KTD A;  2WWP A;  4L1N A;  2AH7 X;  4AZR A;  4YMY A;  1FEM A;  2Q9S A;  4UU2 A;  1ALB A;  1EI5 A;  4I95 A;  2BHV A;  2CZU A;  1PBO A;  2KT4 B;  3ZUI A;  2PY1 A;  3F9D A;  1YWB A;  4EXZ A;  3BS2 A;  1SXY A;  3HWG A;  2F09 A;  2ANS A;  4QGV A;  3U0D A;  3D96 A;  2K62 A;  3P6H A;  1IIU A;  1OEE A;  5HBS A;  3VG5 A;  4EQA C;  3ZW0 B;  3I0A A;  4TLJ A;  4A8Z A;  4FBV A;  1SXX A;  1D3S A;  3N91 A;  2A3F X;  4Y0Q A;  4Y0P A;  3AKN A;  2P8G A;  4MVK A;  3S26 A;  5F7G A;  5FFH A;  3BX7 A;  4I3D A;  1S7D A;  2HYS A;  1CJ5 A;  1FEN A;  4GET A;  4QZU A;  4U8U M;  3O19 A;  4QNI A;  5EPQ A;  3VG6 A;  5H9L A;  2GTF X;  4L3R A;  2QO5 A;  4KCA A;  4ODD A;  4WFV A;  2Q39 A;  5HWZ A;  1X89 A;  5FQ8 E;  1EPB A;  5BYP A;  2FR3 A;  2A2U A;  1IKJ A;  1X8O A;  4GDZ A;  3BU9 A;  3NPO A;  4GNW A;  4XMC A;  1PMP A;  3SOT A;  3U03 A;  4YGH A;  1GT1 A;  1OBU A;  3ZW2 A;  3KFF A;  1KT7 A;  2WQA E;  4YCH A;  3HWD A;  3PQU A;  4FBO A;  3TF6 A;  4QGW A;  2OVE A;  3NQ9 A;  1JYD A;  4XMF A;  4IB6 A;  3FA9 A;  2A13 A;  3BLG A;  1ICN A;  3S60 A;  1GGL A;  3WOV A;  3FA8 A;  4D6B A;  1HBQ A;  1DV9 A;  1PM1 X;  3MBT A;  1HN2 A;  3UAQ A;  3Q6L A;  1RBP A;  3ZW1 A;  2MHD A;  3CWK A;  4TNN A;  2G79 A;  1O1U A;  1BRP A;  2W2B A;  1EPA A;  4O4X A;  3TGC A;  4IB9 A;  1AVG I;  3ZQ3 A;  1EUO A;  2CZT A;  2JN3 A;  4N7C A;  3FR2 A;  4OMW A;  2AT5 X;  2WEX A;  2E4J A;  4XME A;  2W2F A;  4QAE A;  2JW1 A;  4RUU A;  1CRB A;  5DG4 A;  2AKQ A;  3HTY A;  2RQ0 A;  2AMM X;  5H9N A;  1MVG A;  2FLJ A;  1S2P A;  3KZA A;  2OFM X;  5EZ2 A;  4TKH A;  2DM5 A;  4AZM A;  5LJK A;  4XMD A;  1XCA A;  2FTB A;  4DQ3 A;  4IBA A;  1AQB A;  3UEV A;  1EXS A;  4N7D A;  4IAX A;  2M4L A;  4ZHG A;  2L67 A;  2CBR A;  5F6Z A;  2RN4 A;  3RBY A;  3HOE A;  2MJI A;  1I05 A;  1LID A;  5LKF A;  3WVM A;  4EFG A;  5KID A;  1GT5 A;  4ZJ0 A;  4OS3 A;  4MVE A;  1RLB E;  4COT A;  4O49 A;  5F58 A;  1YP7 A;  4TKB A;  3FLL A;  3QKG A;  1LF7 A;  2LA7 A;  3P02 A;  3KFH A;  4O3W A;  4PJ2 A;  1JJX A;  2XKL A;  1QY0 A;  4FGI B;  3RSW A;  1KZX A;  4O4U A;  2ASN X;  2R56 A;  1LIC A;  1MDC A;  3APW A;  4GKC A;  2CM4 A;  4OS0 A;  1ADL A;  3ZW1 B;  2KD2 A;  3K3L A;  1TXL A;  1YIV A;  3VG4 A;  3VU1 A;  3NAD A;  4EDE A;  1T0V A;  3O22 A;  3TZS A;  1SY0 A;  1T8V A;  4K19 A;  4MIS A;  1QY1 A;  1NGL A;  3DTQ A;  3CBC A;  4IMO A;  3WJD A;  5HZ9 A;  2KW1 A;  3CBS A;  1OPB A;  4U9C A;  1OBP A;  4INN A;  4I9S A;  4TQ2 A;  1DZM A;  3BRN A;  3UEW A;  3PH6 A;  4R0B A;  5D8J A;  2HLV A;  3EMM A;  4I9R A;  4CSB A;  1DZJ A;  4AZN A;  3MVF A;  4M6S A;  3JS1 A;  4ORY A;  2OVD A;  4ZHC A;  2BS6 A;  1B8E A;  3PH5 A;  4QYP A;  2R74 A;  1BJ7 A;  1HMS A;  3HK1 A;  4QQ1 A;  3WJC A;  1TW4 A;  3FEL A;  2MM3 A;  3G7X A;  3KQ0 A;  4ZH9 A;  5BVT A;  3VG3 A;  2GC9 A;  3L4R A;  1SY2 A;  4O4S A;  4D6A A;  2KTS A;  4HFO A;  4A1H A;  1DFV A;  5B27 A;  4Y0R A;  5HZ8 A;  4GK9 A;  2JMB A;  2NNQ A;  1X8Q A;  1QG5 A;  4ZCB A;  4NNT A;  3F8A A;  4TJZ A;  2QO4 A;  1KZW A;  1VPR A;  1QQS A;  2FT9 A;  4PSQ A;  4BQU A;  1QWD A;  4LQZ A;  4YFR A;  3P6E A;  5HTD A;  1XKI A;  1N0S A;  2MWH A;  1JBH A;  4NNS A;  3EBW A;  1HQP A;  3P6F A;  3VG7 A;  3FA7 A;  3OE3 A;  1SMP I;  5IO7 A;  2LKK A;  3STN A;  1EQD A;  2LBA A;  5LJG A;  1U18 A;  1E06 A;  1LNM A;  4NLI A;  3FEP A;  5H8T A;  1SXU A;  4MVL A;  4ORW A;  3WXQ A;  2BT9 A;  1YWD A;  2HMB A;  3HWE A;  4O9S A;  4YBU A;  4FBR A;  1KT6 A;  4O3Z A;  3HOL A;  2GTL O;  2RCQ A;  5F6B A;  1S44 A;  4IAB A;  2AL0 X;  1I4U A;  3TGA A;  4A1Y A;  4DQ4 A;  4IMN A;  3P24 A;  3FW4 A;  1B0O A;  1BSO A;  1YWC A;  2GTL N;  3JQO A;  3GE2 A;  5KIC A;  1LFO A;  2RCT A;  1EW3 A;  2AT6 X;  3NX2 A;  3P6G A;  3P6C A;  4TKJ A;  5H9K A;  5AEO A;  4LKP A;  1BSY A;  2QMI A;  4ARH A;  4NP1 A;  5AQ6 A;  1ZNL A;  1A18 A;  5LJB A;  3JSQ A;  4I3C A;  3B2L A;  3BY0 A;  1ZNK A;  1GXA A;  1X8N A;  3FYF A;  3SAO A;  1DC9 A;  5LJE A;  1ACD A;  3MX7 A;  4QRL A;  4EEJ A;  1GKA A;  3APV A;  2X8F A;  5JR8 A;  4O3Y A;  4LZV A;  4ZHH A;  3I17 A;  4CV7 A;  1LIE A;  1Y9T A;  1ZND A;  3ZZV A;  4GH7 A;  5DPQ A;  4ES7 A;  1MX7 A;  4IB8 A;  5EDB A;  1A2D A;  2POA A;  4ZGU A;  2L5P A;  2OVA A;  2HZR A;  5LJD A;  2Z4I A;  5EDC A;  1LIF A;  4KT5 A;  4LZU A;  2IFB A;  3TGB A;  4BOE A;  3AKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...