3KFQC

Unreduced cathepsin v in complex with stefin a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
b'MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin L2
publication title Unreduced cathepsin V in complex with stefin A
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 19
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3kfqC00
3QRDA 4N6NB 4CCVA 1M9GA 3KSED 1IV9A 3NX0A 1RN7A 4N6LA 1A90A 2CH9A 1N5HA 1NB3I 5ELJA 4LZIA 4EYCA 4ZM8A 1DVCA 1NB5I 1CYUA 2OCTA 5A0OB 1A67A 1STFI 3PS8A 1DVDA 1ROAA 1YVBI 4N6OB 5LC7A 2W9QA 1GD3A 3SVAA 1EQKA 1FA3A 1KWIA 4N6TA 3L0RA 5LC6A 3UL6A 3IMAB 3KFQC 1G96A 1LXEA 1MOLA 1CEWI 1IV7A 1N5PA 4N6UA 1FUWA 4N6MA 1TIJA 3GAXA 5EQLA 3PXMA 5ELUA 2KXGA 3LH4A 2BO9B 3S67A 1MNLA 4N6V0 1PFPA 1CYVA 3PYJA 3MWZA 3UL5A 1GD4A 2O9UX 1R4CA 1WNHA 2W9PA 3K9MC 4TX4A 1N9JA 4IT7A 3Q2PA
chains in the Genus database with same CATH superfamily
3URPA 4N6NB 5IENA 1BSEA 2Z77A 3NUVA 1EKMA 3FLJA 3OWYA 1OH0A 4XBYA 2GEXA 1G0TA 3CNMA 5RNTA 1AVLA 1T3BA 3I553 2W56A 1F8NA 3WDGB 4FMBA 3DGMA 2WOFA 3LTDA 1IU7A 4R9KA 1D6UA 4KT3B 1I0XA 1YJ93 3WA2X 2CX1A 3S28A 1N9EA 2OOVA 3EBYA 3B4PA 4FR9A 6GSPA 5HOHA 1N5HA 1BNSA 2RCDA 1RCLA 1W7CA 1NB3I 2YFIB 2E2UA 3Q1CA 4AKYA 1JN5A 4LZIA 1KQS2 4EYCA 1W01A 1RGEA 1B2ZA 1O7HB 3CXC2 4LEHA 1LOYA 2FGTA 1BSAA 1D6ZA 3SLUA 4LSOA 5IG3A 3FGYA 1FGRA 1BGSA 1BNGA 1RNTA 2KF5A 1B2XA 3A5EA 5M1AA 3GSPA 1GMQA 4ZM8A 2KRTA 1W4NA 4OK0A 1BRSA 1HKXA 1UI7A 3NQYA 4GSPA 3SXXA 2OCTA 5KP1A 1JBSA 4J9AA 3WA3A 3CCL3 1TRPA 1VQ93 1FW7A 1VQQA 2E2VA 1WMOA 2CK3H 1DVDA 1IYYA 3B7CA 1UUWB 2R41A 2WGOA 1FUSA 1RGKA 2QIYA 3D4AA 4RNTA 4WHAA 1IQYA 5AI1A 2MC8A 3PZWA 1U8CB 3SVAA 2H0IA 2CFGA 2J8XB 3F8HA 3CCJ3 2AADA 2XSOB 1Y4KA 4G1MB 1UCLA 5AEUB 3K5TA 2HMKB 2AAEA 3UL6A 1LXEA 4RNZA 3T8UA 5BIRA 4X2OA 1ZO2A 2F4YA 1RKYA 3CNXA 2H0HA 3F7SA 4EV5A 1VZZA 4HYZA 4FMDA 4N6UA 1LQMB 4XB5A 4J8TA 1MGWA 1IT7A 3LZAA 1W2ZA 1M904 2ZDJA 3CPW2 2F99A 2OQEC 1YI23 3CCS3 3GAXA 2BMRB 2GBWB 3ALAA 3MSOA 5CK6A 3D5GA 4R80A 3DGOA 5M19A 1K28A 5EEOA 2C11A 2KCDA 2STDA 1VQM3 1N8R4 1IQXA 2W03A 3GZYB 5G1LA 5ELUA 2KXGA 4O2HA 1DYUA 3FCSB 3SOYA 2CFKA 3DXOA 4XDWA 3IPTA 2IUKA 1EA2A 2BO9B 2KAAA 3MG3A 2P38A 1ZS7A 5D82A 3J7Yd 3RNTA 2C10A 4WWUC 4KFDA 3LT8A 3RGRA 2F5WA 3EBTA 3BB9A 1D6YA 5D83A 1YVSA 1JKGB 1RDSA 3DY5A 3F8XA 2B1XB 3HIGA 4I4KA 2W0QA 4J5GA 1YHQ3 2UUGC 1K8A4 3V99A 1AV4A 3BIRA 1BUJA 2ML6A 2K0MA 1A2VA 1GOYA 3EC9A 1JJ22 2ML5A 4FCZA 3UL5A 1EEJA 1Z1SA 3CCQ3 2O9UX 2I9WA 3K9MC 1BANA 1FGMA 4EV2A 1VQL3 3AGNA 3CMA3 2W56B 2W04A 2P09A 1OHSA 1GY6A 3X3XA 3H3HA 3ZFZA 3LMLA 2B24B 2HOHA 1UGHI 5CXOA 1GOVA 3KKGA 3NBRA 1X1UA 3EJVA 4CCVA 3N8BA 1BRJA 1TU5A 1LNHA 2XSHB 3KSPA 1M9GA 1OF5A 3OXAA 3EX9A 2F5MA 1W00A 1WQLB 3F9SA 4KFFA 1PYLA 2QA43 3VF1A 1RN7A 1C7HA 4BIRA 5AYRB 5AEWB 2CWVA 4N6LA 3V92A 4NHFA 1A90A 5DRVA 1CQSA 5IW9A 4AKZA 3X42A 4FCJA 2XR8B 1VQN3 1Q40B 1B20A 4DKIA 1ISKA 3KZTA 3RDEA 1V58A 3CC23 1RTUA 1T2IA 1X1XA 2BU4A 3X41A 4EC6A 1BNEA 1B2MA 2F86B 3FG3A 3F14A 2KF4A 1RRHA 1B2UA 5HGRA 1LOXA 3FG4A 3H51A 1T2HA 4KVHA 1NB5I 1RHLA 1O7WB 1RCKA 3S29A 1A67A 1BAOA 1LNIA 1SIHA 1FGTA 2WGQA 3BNDA 1PU4A 1MWRA 3HI7A 2HMJB 1NJI4 2OTL3 1NWWA 5DREA 5JPPA 2CX0A 1RN4A 3SX1A 1B21A 2CWTA 4BTWA 1YVBI 2Y74A 3FF0A 2BIRA 1DMMA 3I0YA 2W9QA 2PNCA 1LRAA 3HK4A 4STDA 1DETA 5IG5A 3KE7A 3E99A 4R4KA 4RBNA 1GD3A 2K3DA 1S5AA 3EN8A 1VQO3 1VQ63 3DGYA 3L0RA 2Z7AA 3BU4A 3DGNA 4HM5B 3CC43 4FCMA 4J5KA 8RNTA 3IMAB 1TTOA 3DUKA 1O7MB 1VQP3 1O7PB 1CEWI 1ZGXA 6RNTA 1N5PA 2HMOB 3GWRA 7RNTA 2GU1A 2XGNA 1N8QA 2CHCA 4MJDA 3CPOA 1W5ZA 3G8ZA 2FXTA 3STDA 1ROVA 5CF2A 1B3SA 1IT8A 1KSIA 5AIGA 5JPUA 2HMNB 1JRQA 5IG4A 1FYSA 4K61A 1BUQA 3OW22 2W6JH 3LTCA 4CPKA 4GHOA 5CF1A 2INXA 5IF6A 2XF3A 3FSDA 4HM7B 1Q42A 2CW9A 3ECFA 4BU4A 4KFEA 1VQ43 3Q90A 4R1KA 1R4YA 1IVXA 1BNJA 1RN1A 1RGGA 2L4VA 2PZVA 2CFLA 1K9M4 3X40A 2XEPA 4N6V0 3HOHA 1PFPA 4WYKA 3VSYA 1CYVA 4WFOA 3Q3FA 1BSDA 3CU3A 3JUMA 3LOYA 4AEQA 3CME3 1G02A 1SARA 3MPHA 3OX9A 1YIT3 3CD63 2HMMB 1GY5A 1TUHA 3JUOA 3B4OA 4HM6B 5KP4A 2R4IA 2RGQA 4XBXA 1AY7A 1UW1A 2XH9A 2UX0A 4HAAA 1GD4A 3K7CA 2BHMA 3AMOB 1R4CA 2W9PA 4TX4A 2IUJA 3I563 3GRDA 1N9JA 4CDLA 2GSPA 2Y73A 2WO0A 2Q07A 3EF8A 1C54A 1TP6A 3NM2A 4U13A 1MOLA 1SQWA 3QRDA 3D5IA 1YGWA 2XRXB 4HZBB 1E3VA 4OVMA 5FGOA 1RJOA 3DM8A 3OV4A 2OOVC 1JBRA 2BT3A 1LQGC 4ILFA 1QALA 4H61A 3DMCA 2CG0A 3Q2PA 1GS3A 5FW5A 1IV9A 3T8NA 8CHOA 3NV0B 5M18A 1UGIA 3ER7A 1DMQA 4O02B 2Z76A 3KN4A 2CH9A 2F56A 1DMNA 5IEPA 1L5GB 4X2HA 2SARA 3JUPA 3SYUA 1OUNA 5ELJA 3OWSA 1A2PA 1IK3A 2XFTA 3CCE3 1JB5A 1NNVA 1NO3A 3LT9A 2HMLB 1FUTA 4HJLB 1X1YA 1MWSA 1UDII 1I2EA 1UI8A 1YIJ3 1RGHA 1GSPA 3MYTA 1RSNA 1DVCA 2CFWA 3ZG5A 5AIIA 4OUQA 5A0OB 2F98A 3LXUX 3BNEA 1I3FA 1ZX2A 1JN5B 1UUGB 2LQVA 1VQ53 1RGLA 3WODG 1TJDA 2P0XA 1YGEA 3HZPA 3JVCA 4O8SA 3NXJA 1ROAA 4HM2B 3CCU3 4N6OB 1QAKA 3X3YA 3D3LA 1US1A 2XGLA 3JUNA 1NU3A 1LVNA 2XFSA 1BOXA 4K1UA 1FA3A 4N6TA 1BNFA 1BSBA 2V1LA 3EN1B 3HX8A 1EG9B 3U97A 3A76A 2BNGA 1RNBA 1OACA 2CIUA 5LC6A 2RBIA 1DE3A 3NQZA 3KFQC 1G96A 4HM4B 2A15A 3KCHA 1MWTA 1RRLA 1GY7A 5AYSC 1BRGA 2BMQB 2CKFB 4WP5A 3ZG0A 3WR2A 1EUIC 1K41A 4KZ1A 4L7KA 1ASKA 1RGFA 4MEIA 1WMNA 2IMJA 4NREA 1W6CA 3BNCA 1Q814 4RNYA 4JF8A 1ULIB 3K0ZA 1BRKA 3S27A 1BIRA 1W6GA 5D81A 1FGQA 3F40A 2UGIA 2GEYA 4I5QA 1Q824 2H0GA 3K63A 2OQEA 3G4S3 5EVHA 4LGQA 4L8PA 1NDOB 3AHSA 3O8YA 1I0VA 1TRQA 1QJGA 1VQK3 3S67A 1M1XB 5IEOA 4EW5A 1MNLA 2QGUA 3NHXA 1AVKA 2IA7A 4BL3A 1WMPA 3OWUA 1ULJB 3MKIA 5G2GA 1T5YA 1LOVA 4MMYB 3RGAA 1W02A 5KP3A 4GB5A 2M7OA 4HBRA 4QWTA 2GU3A 3NBJA 2QEX3 1W6YA 5BXQA 2Z6BA 3LYGA 4PEJA 1VQ83 1OPYA 3AHWA 4BTXA 3HIIA 1IVVA 1JZDA 1WNHA 1BRHA 1RMSA 2ZL8A 3VGNA 3N54B 2SBLA 1SIIA 1V74A 1X1WA 3GZBA 2CG1A 3EHCA 1AQZA 1UCKA 2ZA4A 3GZXB 4IPBA 3SOAA 6STDA 9RNTA 1J2BA 2IYJA 2KF3A 1GMRA 2C4BA 3NBBA 1GMPA 2ZHXB 1Q40A 1UUVB 4HM3B 1IVWA 1OHPA 3DZLA 1LOWA 1VQ73 1I3IA 3LTAA 2LYXA 3B8LA 3TDGA 4EXRA 3ROBA 3CCR3 3KSED 1JB4A 1TFKA 1HYFA 2WOHA 3EB8A 3NX0A 1BRIA 3D79A 1UCIA 1JNQA 3JUQA 2OTJ3 5JBSA 5I97A 3G16A 1YNVX 3PGBA 4N3VA 1I70A 4FMCA 1M1K4 3N9HA 3AGOA 3FH1A 2MF7A 1QVF2 1E3RA 1KD14 1Q9EA 1OF5B 1O7NB 4XBTA 2CC3A 1E97A 3V98A 4LYLB 1QVG2 2YFLB 7STDA 2YFJB 3EQQB 3GZRA 4HM8B 1QAFA 4NPBA 1BNIA 1V57A 3EE1A 3MG1A 4O3VA 7GSPA 1OGZA 1CYUA 1K734 2JQ5A 1S723 3UNLA 1HZ1A 1GYBA 1IDPA 1Q7HA 3BLZA 1STFI 1GOUA 1B27A 1JB2A 3PS8A 1CH0A 1FGOA 1I2FA 2JDIH 3D9RA 3PCSA 1JZOA 5AIHA 2OWPA 4Q53A 1HU9A 5LC7A 5BVBA 1SPUA 3G0KA 4HOHA 1A2KA 3FG1A 5IG0A 1EQKA 1BVIA 1KWIA 1OCVA 3FZWA 5AIFA 3F7XA 3FF2A 4ORLA 2RNTA 4BL2A 3NM7A 1WTHA 3CC73 3MHEA 1QMAA 1UCJA 3G713 1IVUA 3CCM3 3T0UA 1PY3A 2P05A 2KF6A 1IV7A 1IQ8A 2IY2A 5TGNA 4XDVA 4HM0B 4EBGA 4MMXB 3IJEB 4HM1B 3WHOA 3WOEB 4N6MA 4RZMA 1KC84 1FUWA 3WOFB 4LMIA 4MMZB 1OGXA 1Q7Y4 1SJWA 1JBTA 3G6E3 1BRNL 3FKAA 2D42A 3DH2A 3BNBA 2GBXB 3MG2A 2W2CA 4K90B 1TIJA 1YJN3 3LTBA 2BMOB 2CFDA 4R9LA 3M8CA 4JRFA 5EQLA 5STDA 3PXMA 2GXFA 4HVNA 1RGAA 4IIAA 2YX9A 2E2TA 1RGCA 4CJNA 2RSXA 5G1KA 4BTYA 5CLKA 3CCV3 1JV2B 2O3OA 3LH4A 4GL6A 2P0MA 2L1SA 3KIIA 4HKVB 4HZ9B 1B2SA 1YJW3 1AR0A 3AMOA 5GSPA 1MWUA 2RFRA 3SEDA 4H3UA 1STDA 3QK9A 1I8VA 4K1VA 1BNRA 1I2GA 3PYJA 3S5CA 3U1WA 3PCRA 5IERA 3DGLA 3MWZA 3UJMA 5BU4A 1MGRA 2D1WA 1FZUA 2K54A 4L8OA 1O7GB 2CWUA 2FNQA 1JKGA 4FMAA 1RLSA 1TFOA 3WMDA 4XM4A 1BSCA 3UB1A 3NV0A 4WYKB 1OHOA 3X3ZA 4IT7A 1BU4A 1Q864 1W2B2 1U5OA
chains in the Genus database with same CATH topology
4N6NB 5IENA 2Z77A 3NUVA 1EKMA 3FLJA 3OWYA 1OH0A 4XBYA 2GEXA 3CNMA 1AVLA 3I553 2W56A 1F8NA 3WDGB 4FMBA 3DGMA 2WOFA 3LTDA 1IU7A 4R9KA 1D6UA 1YJ93 3WA2X 3S28A 1N9EA 2OOVA 3EBYA 3B4PA 4FR9A 1N5HA 2RCDA 1W7CA 1NB3I 2YFIB 2E2UA 3Q1CA 4AKYA 1JN5A 4LZIA 1KQS2 4EYCA 1W01A 1O7HB 3CXC2 4LEHA 2FGTA 1D6ZA 3SLUA 4LSOA 5IG3A 3FGYA 1FGRA 4ZM8A 2KRTA 1W4NA 4OK0A 5KP1A 1HKXA 1UI7A 3NQYA 3SXXA 2OCTA 4J9AA 3WA3A 3CCL3 1VQ93 2E2VA 1WMOA 2CK3H 1DVDA 3B7CA 1UUWB 2WGOA 2QIYA 4WHAA 5AI1A 1IQYA 2MC8A 3PZWA 1U8CB 3SVAA 3F8HA 2CFGA 3CCJ3 2XSOB 1Y4KA 4G1MB 5AEUB 3K5TA 2HMKB 3UL6A 1LXEA 4RNZA 3T8UA 4X2OA 1ZO2A 1RKYA 3CNXA 3F7SA 4EV5A 1VZZA 4HYZA 4FMDA 4N6UA 4XB5A 4J8TA 1IT7A 3LZAA 1W2ZA 1M904 2ZDJA 3CPW2 2F99A 2OQEC 1YI23 3CCS3 3GAXA 2BMRB 2GBWB 3ALAA 3MSOA 5CK6A 4R80A 3DGOA 1K28A 5EEOA 2C11A 2KCDA 2STDA 1VQM3 1N8R4 1IQXA 2W03A 3GZYB 5ELUA 2KXGA 4O2HA 1DYUA 3FCSB 3SOYA 2CFKA 3DXOA 4XDWA 3IPTA 2IUKA 1EA2A 2BO9B 3MG3A 2P38A 5D82A 3J7Yd 2C10A 4WWUC 4KFDA 3LT8A 3RGRA 3EBTA 3BB9A 1D6YA 5D83A 1JKGB 3DY5A 3F8XA 2B1XB 3HIGA 4I4KA 2W0QA 1YHQ3 1K8A4 3V99A 1AV4A 2ML6A 2K0MA 1A2VA 3EC9A 1JJ22 2ML5A 4FCZA 3UL5A 1Z1SA 3CCQ3 2O9UX 2I9WA 3K9MC 1FGMA 4EV2A 1VQL3 3CMA3 2W56B 2W04A 2P09A 1OHSA 1GY6A 3X3XA 3H3HA 3LMLA 2B24B 5CXOA 3KKGA 3NBRA 3EJVA 4CCVA 3N8BA 1TU5A 1LNHA 2XSHB 3KSPA 1M9GA 1OF5A 3OXAA 3EX9A 3F9SA 1W00A 1WQLB 4KFFA 2QA43 3VF1A 1RN7A 1C7HA 5AYRB 5AEWB 2CWVA 4N6LA 3V92A 4NHFA 1A90A 5DRVA 1CQSA 5IW9A 4AKZA 3X42A 4FCJA 2XR8B 1VQN3 1Q40B 1ISKA 3KZTA 3RDEA 3CC23 4EC6A 3X41A 2F86B 3FG3A 3F14A 1RRHA 5HGRA 1LOXA 3FG4A 3H51A 4KVHA 1NB5I 1O7WB 3S29A 1A67A 2WGQA 3BNDA 1SIHA 1FGTA 1PU4A 3HI7A 2HMJB 1NJI4 2OTL3 1NWWA 5DREA 5JPPA 3SX1A 4BTWA 2CWTA 1YVBI 2Y74A 3FF0A 1DMMA 3I0YA 2W9QA 2PNCA 3HK4A 4STDA 5IG5A 3KE7A 3E99A 4R4KA 4RBNA 1GD3A 3EN8A 1S5AA 1VQO3 1VQ63 3L0RA 2Z7AA 3DGNA 4HM5B 3CC43 4FCMA 3IMAB 3DUKA 1O7MB 1VQP3 1O7PB 1CEWI 1N5PA 2HMOB 3GWRA 2GU1A 2XGNA 1N8QA 2CHCA 4MJDA 3CPOA 1W5ZA 3G8ZA 2FXTA 3STDA 1ROVA 5CF2A 1KSIA 1IT8A 5AIGA 5JPUA 2HMNB 1JRQA 5IG4A 4K61A 1BUQA 3OW22 2W6JH 3LTCA 5CF1A 2INXA 5IF6A 2XF3A 3FSDA 4HM7B 1Q42A 2CW9A 3ECFA 4KFEA 1VQ43 3Q90A 4R1KA 1IVXA 2L4VA 2PZVA 2CFLA 1K9M4 3X40A 2XEPA 4N6V0 1PFPA 4WYKA 3VSYA 1CYVA 4WFOA 3CU3A 3JUMA 3LOYA 4AEQA 3CME3 3MPHA 3OX9A 1YIT3 3CD63 2HMMB 1GY5A 1TUHA 3JUOA 3B4OA 4HM6B 5KP4A 2R4IA 2RGQA 4XBXA 1UW1A 2XH9A 2UX0A 1GD4A 3K7CA 2BHMA 3AMOB 1R4CA 2W9PA 4TX4A 2IUJA 3I563 3GRDA 1N9JA 4CDLA 2Y73A 2WO0A 2Q07A 3EF8A 1TP6A 3NM2A 4U13A 1MOLA 1SQWA 3QRDA 2XRXB 4HZBB 1E3VA 4OVMA 5FGOA 1RJOA 3DM8A 3OV4A 2OOVC 2BT3A 1QALA 4H61A 3DMCA 2CG0A 3Q2PA 1GS3A 5FW5A 1IV9A 3T8NA 8CHOA 3NV0B 3ER7A 1DMQA 4O02B 2Z76A 3KN4A 2CH9A 1DMNA 5IEPA 1L5GB 4X2HA 1IK3A 3JUPA 1OUNA 5ELJA 3OWSA 3CCE3 2XFTA 1JB5A 1NO3A 3LT9A 2HMLB 4HJLB 1UI8A 1YIJ3 3MYTA 1DVCA 2CFWA 5AIIA 4OUQA 5A0OB 2F98A 3LXUX 3BNEA 1ZX2A 1JN5B 2LQVA 1VQ53 3WODG 2P0XA 1YGEA 3HZPA 3JVCA 4O8SA 3NXJA 1ROAA 4HM2B 3CCU3 4N6OB 1QAKA 3X3YA 3D3LA 1US1A 2XGLA 3JUNA 1NU3A 1LVNA 2XFSA 4K1UA 1FA3A 4N6TA 2V1LA 3EN1B 3HX8A 1EG9B 3U97A 3A76A 2BNGA 1OACA 2CIUA 5LC6A 3NQZA 3KFQC 1G96A 4HM4B 2A15A 1RRLA 1GY7A 5AYSC 2BMQB 2CKFB 4WP5A 1K41A 4KZ1A 4L7KA 1ASKA 4MEIA 1WMNA 2IMJA 4NREA 1W6CA 3BNCA 1Q814 4RNYA 4JF8A 1ULIB 3K0ZA 3S27A 1W6GA 5D81A 1FGQA 3F40A 2GEYA 1Q824 3K63A 2OQEA 3G4S3 5EVHA 4LGQA 4L8PA 1NDOB 1VQK3 3O8YA 1QJGA 3S67A 1M1XB 5IEOA 1MNLA 2QGUA 3NHXA 1AVKA 2IA7A 1WMPA 3OWUA 1ULJB 3MKIA 5G2GA 1T5YA 3RGAA 4MMYB 1W02A 5KP3A 4GB5A 2M7OA 4HBRA 4QWTA 2GU3A 3NBJA 2QEX3 1W6YA 5BXQA 2Z6BA 3LYGA 4PEJA 1VQ83 1OPYA 4BTXA 3HIIA 1IVVA 1WNHA 2ZL8A 3VGNA 3N54B 2SBLA 1SIIA 1V74A 3GZBA 2CG1A 3EHCA 3GZXB 4IPBA 3SOAA 6STDA 1J2BA 3NBBA 1Q40A 1UUVB 4HM3B 1IVWA 1OHPA 3DZLA 1VQ73 3LTAA 2LYXA 3B8LA 3TDGA 4EXRA 3ROBA 3CCR3 3KSED 1JB4A 1TFKA 2WOHA 3EB8A 3NX0A 1JNQA 3JUQA 2OTJ3 5JBSA 5I97A 3G16A 3PGBA 4N3VA 4FMCA 1M1K4 3N9HA 3FH1A 2MF7A 1QVF2 1U5OA 1KD14 1OF5B 1O7NB 4XBTA 2CC3A 1E97A 3V98A 1QVG2 2YFLB 7STDA 2YFJB 3EQQB 3GZRA 4HM8B 1QAFA 3EE1A 4O3VA 3MG1A 1OGZA 1CYUA 1K734 2JQ5A 1S723 3UNLA 1GYBA 1IDPA 3BLZA 1STFI 1JB2A 3PS8A 1FGOA 2JDIH 3D9RA 3PCSA 5AIHA 2OWPA 4Q53A 1HU9A 5LC7A 5BVBA 1SPUA 3G0KA 1A2KA 3FG1A 5IG0A 1EQKA 1KWIA 1OCVA 3FZWA 5AIFA 3F7XA 3FF2A 4ORLA 3NM7A 1WTHA 3CC73 3MHEA 1QMAA 3G713 1IVUA 3CCM3 3T0UA 2P05A 1IV7A 1IQ8A 5TGNA 4EBGA 4XDVA 4HM0B 4MMXB 3IJEB 4HM1B 3WOEB 1KC84 4N6MA 4RZMA 1FUWA 3WOFB 4LMIA 4MMZB 1OGXA 1Q7Y4 1SJWA 3G6E3 3FKAA 2D42A 3BNBA 2GBXB 3MG2A 2W2CA 4K90B 1TIJA 1YJN3 3LTBA 2BMOB 2CFDA 4R9LA 3M8CA 4JRFA 5EQLA 5STDA 3PXMA 2GXFA 4HVNA 4IIAA 2YX9A 2E2TA 2RSXA 4BTYA 5CLKA 3CCV3 1JV2B 2O3OA 3LH4A 4GL6A 2P0MA 3KIIA 4HKVB 4HZ9B 1YJW3 1AR0A 3AMOA 2RFRA 3SEDA 4H3UA 1STDA 3QK9A 4K1VA 3PYJA 3S5CA 3U1WA 3PCRA 5IERA 3DGLA 3MWZA 3UJMA 2D1WA 2K54A 4L8OA 1O7GB 2CWUA 2FNQA 1JKGA 4FMAA 1TFOA 3WMDA 4XM4A 3UB1A 3NV0A 4WYKB 1OHOA 3X3ZA 4IT7A 1Q864 1W2B2 1E3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRD A;  4N6N B;  4CCV A;  1M9G A;  3KSE D;  1IV9 A;  3NX0 A;  1RN7 A;  4N6L A;  1A90 A;  2CH9 A;  1N5H A;  1NB3 I;  5ELJ A;  4LZI A;  4EYC A;  4ZM8 A;  1DVC A;  1NB5 I;  1CYU A;  2OCT A;  5A0O B;  1A67 A;  1STF I;  3PS8 A;  1DVD A;  1ROA A;  1YVB I;  4N6O B;  5LC7 A;  2W9Q A;  1GD3 A;  3SVA A;  1EQK A;  1FA3 A;  1KWI A;  4N6T A;  3L0R A;  5LC6 A;  3UL6 A;  3IMA B;  3KFQ C;  1G96 A;  1LXE A;  1MOL A;  1CEW I;  1IV7 A;  1N5P A;  4N6U A;  1FUW A;  4N6M A;  1TIJ A;  3GAX A;  5EQL A;  3PXM A;  5ELU A;  2KXG A;  3LH4 A;  2BO9 B;  3S67 A;  1MNL A;  4N6V 0;  1PFP A;  1CYV A;  3PYJ A;  3MWZ A;  3UL5 A;  1GD4 A;  2O9U X;  1R4C A;  1WNH A;  2W9P A;  3K9M C;  4TX4 A;  1N9J A;  4IT7 A;  3Q2P A; 
#chains in the Genus database with same CATH topology
 3URP A;  4N6N B;  5IEN A;  1BSE A;  2Z77 A;  3NUV A;  1EKM A;  3FLJ A;  3OWY A;  1OH0 A;  4XBY A;  2GEX A;  1G0T A;  3CNM A;  5RNT A;  1AVL A;  1T3B A;  3I55 3;  2W56 A;  1F8N A;  3WDG B;  4FMB A;  3DGM A;  2WOF A;  3LTD A;  1IU7 A;  4R9K A;  1D6U A;  4KT3 B;  1I0X A;  1YJ9 3;  3WA2 X;  2CX1 A;  3S28 A;  1N9E A;  2OOV A;  3EBY A;  3B4P A;  4FR9 A;  6GSP A;  5HOH A;  1N5H A;  1BNS A;  2RCD A;  1RCL A;  1W7C A;  1NB3 I;  2YFI B;  2E2U A;  3Q1C A;  4AKY A;  1JN5 A;  4LZI A;  1KQS 2;  4EYC A;  1W01 A;  1RGE A;  1B2Z A;  1O7H B;  3CXC 2;  4LEH A;  1LOY A;  2FGT A;  1BSA A;  1D6Z A;  3SLU A;  4LSO A;  5IG3 A;  3FGY A;  1FGR A;  1BGS A;  1BNG A;  1RNT A;  2KF5 A;  1B2X A;  3A5E A;  5M1A A;  3GSP A;  1GMQ A;  4ZM8 A;  2KRT A;  1W4N A;  4OK0 A;  1BRS A;  1HKX A;  1UI7 A;  3NQY A;  4GSP A;  3SXX A;  2OCT A;  5KP1 A;  1JBS A;  4J9A A;  3WA3 A;  3CCL 3;  1TRP A;  1VQ9 3;  1FW7 A;  1VQQ A;  2E2V A;  1WMO A;  2CK3 H;  1DVD A;  1IYY A;  3B7C A;  1UUW B;  2R41 A;  2WGO A;  1FUS A;  1RGK A;  2QIY A;  3D4A A;  4RNT A;  4WHA A;  1IQY A;  5AI1 A;  2MC8 A;  3PZW A;  1U8C B;  3SVA A;  2H0I A;  2CFG A;  2J8X B;  3F8H A;  3CCJ 3;  2AAD A;  2XSO B;  1Y4K A;  4G1M B;  1UCL A;  5AEU B;  3K5T A;  2HMK B;  2AAE A;  3UL6 A;  1LXE A;  4RNZ A;  3T8U A;  5BIR A;  4X2O A;  1ZO2 A;  2F4Y A;  1RKY A;  3CNX A;  2H0H A;  3F7S A;  4EV5 A;  1VZZ A;  4HYZ A;  4FMD A;  4N6U A;  1LQM B;  4XB5 A;  4J8T A;  1MGW A;  1IT7 A;  3LZA A;  1W2Z A;  1M90 4;  2ZDJ A;  3CPW 2;  2F99 A;  2OQE C;  1YI2 3;  3CCS 3;  3GAX A;  2BMR B;  2GBW B;  3ALA A;  3MSO A;  5CK6 A;  3D5G A;  4R80 A;  3DGO A;  5M19 A;  1K28 A;  5EEO A;  2C11 A;  2KCD A;  2STD A;  1VQM 3;  1N8R 4;  1IQX A;  2W03 A;  3GZY B;  5G1L A;  5ELU A;  2KXG A;  4O2H A;  1DYU A;  3FCS B;  3SOY A;  2CFK A;  3DXO A;  4XDW A;  3IPT A;  2IUK A;  1EA2 A;  2BO9 B;  2KAA A;  3MG3 A;  2P38 A;  1ZS7 A;  5D82 A;  3J7Y d;  3RNT A;  2C10 A;  4WWU C;  4KFD A;  3LT8 A;  3RGR A;  2F5W A;  3EBT A;  3BB9 A;  1D6Y A;  5D83 A;  1YVS A;  1JKG B;  1RDS A;  3DY5 A;  3F8X A;  2B1X B;  3HIG A;  4I4K A;  2W0Q A;  4J5G A;  1YHQ 3;  2UUG C;  1K8A 4;  3V99 A;  1AV4 A;  3BIR A;  1BUJ A;  2ML6 A;  2K0M A;  1A2V A;  1GOY A;  3EC9 A;  1JJ2 2;  2ML5 A;  4FCZ A;  3UL5 A;  1EEJ A;  1Z1S A;  3CCQ 3;  2O9U X;  2I9W A;  3K9M C;  1BAN A;  1FGM A;  4EV2 A;  1VQL 3;  3AGN A;  3CMA 3;  2W56 B;  2W04 A;  2P09 A;  1OHS A;  1GY6 A;  3X3X A;  3H3H A;  3ZFZ A;  3LML A;  2B24 B;  2HOH A;  1UGH I;  5CXO A;  1GOV A;  3KKG A;  3NBR A;  1X1U A;  3EJV A;  4CCV A;  3N8B A;  1BRJ A;  1TU5 A;  1LNH A;  2XSH B;  3KSP A;  1M9G A;  1OF5 A;  3OXA A;  3EX9 A;  2F5M A;  1W00 A;  1WQL B;  3F9S A;  4KFF A;  1PYL A;  2QA4 3;  3VF1 A;  1RN7 A;  1C7H A;  4BIR A;  5AYR B;  5AEW B;  2CWV A;  4N6L A;  3V92 A;  4NHF A;  1A90 A;  5DRV A;  1CQS A;  5IW9 A;  4AKZ A;  3X42 A;  4FCJ A;  2XR8 B;  1VQN 3;  1Q40 B;  1B20 A;  4DKI A;  1ISK A;  3KZT A;  3RDE A;  1V58 A;  3CC2 3;  1RTU A;  1T2I A;  1X1X A;  2BU4 A;  3X41 A;  4EC6 A;  1BNE A;  1B2M A;  2F86 B;  3FG3 A;  3F14 A;  2KF4 A;  1RRH A;  1B2U A;  5HGR A;  1LOX A;  3FG4 A;  3H51 A;  1T2H A;  4KVH A;  1NB5 I;  1RHL A;  1O7W B;  1RCK A;  3S29 A;  1A67 A;  1BAO A;  1LNI A;  1SIH A;  1FGT A;  2WGQ A;  3BND A;  1PU4 A;  1MWR A;  3HI7 A;  2HMJ B;  1NJI 4;  2OTL 3;  1NWW A;  5DRE A;  5JPP A;  2CX0 A;  1RN4 A;  3SX1 A;  1B21 A;  2CWT A;  4BTW A;  1YVB I;  2Y74 A;  3FF0 A;  2BIR A;  1DMM A;  3I0Y A;  2W9Q A;  2PNC A;  1LRA A;  3HK4 A;  4STD A;  1DET A;  5IG5 A;  3KE7 A;  3E99 A;  4R4K A;  4RBN A;  1GD3 A;  2K3D A;  1S5A A;  3EN8 A;  1VQO 3;  1VQ6 3;  3DGY A;  3L0R A;  2Z7A A;  3BU4 A;  3DGN A;  4HM5 B;  3CC4 3;  4FCM A;  4J5K A;  8RNT A;  3IMA B;  1TTO A;  3DUK A;  1O7M B;  1VQP 3;  1O7P B;  1CEW I;  1ZGX A;  6RNT A;  1N5P A;  2HMO B;  3GWR A;  7RNT A;  2GU1 A;  2XGN A;  1N8Q A;  2CHC A;  4MJD A;  3CPO A;  1W5Z A;  3G8Z A;  2FXT A;  3STD A;  1ROV A;  5CF2 A;  1B3S A;  1IT8 A;  1KSI A;  5AIG A;  5JPU A;  2HMN B;  1JRQ A;  5IG4 A;  1FYS A;  4K61 A;  1BUQ A;  3OW2 2;  2W6J H;  3LTC A;  4CPK A;  4GHO A;  5CF1 A;  2INX A;  5IF6 A;  2XF3 A;  3FSD A;  4HM7 B;  1Q42 A;  2CW9 A;  3ECF A;  4BU4 A;  4KFE A;  1VQ4 3;  3Q90 A;  4R1K A;  1R4Y A;  1IVX A;  1BNJ A;  1RN1 A;  1RGG A;  2L4V A;  2PZV A;  2CFL A;  1K9M 4;  3X40 A;  2XEP A;  4N6V 0;  3HOH A;  1PFP A;  4WYK A;  3VSY A;  1CYV A;  4WFO A;  3Q3F A;  1BSD A;  3CU3 A;  3JUM A;  3LOY A;  4AEQ A;  3CME 3;  1G02 A;  1SAR A;  3MPH A;  3OX9 A;  1YIT 3;  3CD6 3;  2HMM B;  1GY5 A;  1TUH A;  3JUO A;  3B4O A;  4HM6 B;  5KP4 A;  2R4I A;  2RGQ A;  4XBX A;  1AY7 A;  1UW1 A;  2XH9 A;  2UX0 A;  4HAA A;  1GD4 A;  3K7C A;  2BHM A;  3AMO B;  1R4C A;  2W9P A;  4TX4 A;  2IUJ A;  3I56 3;  3GRD A;  1N9J A;  4CDL A;  2GSP A;  2Y73 A;  2WO0 A;  2Q07 A;  3EF8 A;  1C54 A;  1TP6 A;  3NM2 A;  4U13 A;  1MOL A;  1SQW A;  3QRD A;  3D5I A;  1YGW A;  2XRX B;  4HZB B;  1E3V A;  4OVM A;  5FGO A;  1RJO A;  3DM8 A;  3OV4 A;  2OOV C;  1JBR A;  2BT3 A;  1LQG C;  4ILF A;  1QAL A;  4H61 A;  3DMC A;  2CG0 A;  3Q2P A;  1GS3 A;  5FW5 A;  1IV9 A;  3T8N A;  8CHO A;  3NV0 B;  5M18 A;  1UGI A;  3ER7 A;  1DMQ A;  4O02 B;  2Z76 A;  3KN4 A;  2CH9 A;  2F56 A;  1DMN A;  5IEP A;  1L5G B;  4X2H A;  2SAR A;  3JUP A;  3SYU A;  1OUN A;  5ELJ A;  3OWS A;  1A2P A;  1IK3 A;  2XFT A;  3CCE 3;  1JB5 A;  1NNV A;  1NO3 A;  3LT9 A;  2HML B;  1FUT A;  4HJL B;  1X1Y A;  1MWS A;  1UDI I;  1I2E A;  1UI8 A;  1YIJ 3;  1RGH A;  1GSP A;  3MYT A;  1RSN A;  1DVC A;  2CFW A;  3ZG5 A;  5AII A;  4OUQ A;  5A0O B;  2F98 A;  3LXU X;  3BNE A;  1I3F A;  1ZX2 A;  1JN5 B;  1UUG B;  2LQV A;  1VQ5 3;  1RGL A;  3WOD G;  1TJD A;  2P0X A;  1YGE A;  3HZP A;  3JVC A;  4O8S A;  3NXJ A;  1ROA A;  4HM2 B;  3CCU 3;  4N6O B;  1QAK A;  3X3Y A;  3D3L A;  1US1 A;  2XGL A;  3JUN A;  1NU3 A;  1LVN A;  2XFS A;  1BOX A;  4K1U A;  1FA3 A;  4N6T A;  1BNF A;  1BSB A;  2V1L A;  3EN1 B;  3HX8 A;  1EG9 B;  3U97 A;  3A76 A;  2BNG A;  1RNB A;  1OAC A;  2CIU A;  5LC6 A;  2RBI A;  1DE3 A;  3NQZ A;  3KFQ C;  1G96 A;  4HM4 B;  2A15 A;  3KCH A;  1MWT A;  1RRL A;  1GY7 A;  5AYS C;  1BRG A;  2BMQ B;  2CKF B;  4WP5 A;  3ZG0 A;  3WR2 A;  1EUI C;  1K41 A;  4KZ1 A;  4L7K A;  1ASK A;  1RGF A;  4MEI A;  1WMN A;  2IMJ A;  4NRE A;  1W6C A;  3BNC A;  1Q81 4;  4RNY A;  4JF8 A;  1ULI B;  3K0Z A;  1BRK A;  3S27 A;  1BIR A;  1W6G A;  5D81 A;  1FGQ A;  3F40 A;  2UGI A;  2GEY A;  4I5Q A;  1Q82 4;  2H0G A;  3K63 A;  2OQE A;  3G4S 3;  5EVH A;  4LGQ A;  4L8P A;  1NDO B;  3AHS A;  3O8Y A;  1I0V A;  1TRQ A;  1QJG A;  1VQK 3;  3S67 A;  1M1X B;  5IEO A;  4EW5 A;  1MNL A;  2QGU A;  3NHX A;  1AVK A;  2IA7 A;  4BL3 A;  1WMP A;  3OWU A;  1ULJ B;  3MKI A;  5G2G A;  1T5Y A;  1LOV A;  4MMY B;  3RGA A;  1W02 A;  5KP3 A;  4GB5 A;  2M7O A;  4HBR A;  4QWT A;  2GU3 A;  3NBJ A;  2QEX 3;  1W6Y A;  5BXQ A;  2Z6B A;  3LYG A;  4PEJ A;  1VQ8 3;  1OPY A;  3AHW A;  4BTX A;  3HII A;  1IVV A;  1JZD A;  1WNH A;  1BRH A;  1RMS A;  2ZL8 A;  3VGN A;  3N54 B;  2SBL A;  1SII A;  1V74 A;  1X1W A;  3GZB A;  2CG1 A;  3EHC A;  1AQZ A;  1UCK A;  2ZA4 A;  3GZX B;  4IPB A;  3SOA A;  6STD A;  9RNT A;  1J2B A;  2IYJ A;  2KF3 A;  1GMR A;  2C4B A;  3NBB A;  1GMP A;  2ZHX B;  1Q40 A;  1UUV B;  4HM3 B;  1IVW A;  1OHP A;  3DZL A;  1LOW A;  1VQ7 3;  1I3I A;  3LTA A;  2LYX A;  3B8L A;  3TDG A;  4EXR A;  3ROB A;  3CCR 3;  3KSE D;  1JB4 A;  1TFK A;  1HYF A;  2WOH A;  3EB8 A;  3NX0 A;  1BRI A;  3D79 A;  1UCI A;  1JNQ A;  3JUQ A;  2OTJ 3;  5JBS A;  5I97 A;  3G16 A;  1YNV X;  3PGB A;  4N3V A;  1I70 A;  4FMC A;  1M1K 4;  3N9H A;  3AGO A;  3FH1 A;  2MF7 A;  1QVF 2;  1E3R A;  1KD1 4;  1Q9E A;  1OF5 B;  1O7N B;  4XBT A;  2CC3 A;  1E97 A;  3V98 A;  4LYL B;  1QVG 2;  2YFL B;  7STD A;  2YFJ B;  3EQQ B;  3GZR A;  4HM8 B;  1QAF A;  4NPB A;  1BNI A;  1V57 A;  3EE1 A;  3MG1 A;  4O3V A;  7GSP A;  1OGZ A;  1CYU A;  1K73 4;  2JQ5 A;  1S72 3;  3UNL A;  1HZ1 A;  1GYB A;  1IDP A;  1Q7H A;  3BLZ A;  1STF I;  1GOU A;  1B27 A;  1JB2 A;  3PS8 A;  1CH0 A;  1FGO A;  1I2F A;  2JDI H;  3D9R A;  3PCS A;  1JZO A;  5AIH A;  2OWP A;  4Q53 A;  1HU9 A;  5LC7 A;  5BVB A;  1SPU A;  3G0K A;  4HOH A;  1A2K A;  3FG1 A;  5IG0 A;  1EQK A;  1BVI A;  1KWI A;  1OCV A;  3FZW A;  5AIF A;  3F7X A;  3FF2 A;  4ORL A;  2RNT A;  4BL2 A;  3NM7 A;  1WTH A;  3CC7 3;  3MHE A;  1QMA A;  1UCJ A;  3G71 3;  1IVU A;  3CCM 3;  3T0U A;  1PY3 A;  2P05 A;  2KF6 A;  1IV7 A;  1IQ8 A;  2IY2 A;  5TGN A;  4XDV A;  4HM0 B;  4EBG A;  4MMX B;  3IJE B;  4HM1 B;  3WHO A;  3WOE B;  4N6M A;  4RZM A;  1KC8 4;  1FUW A;  3WOF B;  4LMI A;  4MMZ B;  1OGX A;  1Q7Y 4;  1SJW A;  1JBT A;  3G6E 3;  1BRN L;  3FKA A;  2D42 A;  3DH2 A;  3BNB A;  2GBX B;  3MG2 A;  2W2C A;  4K90 B;  1TIJ A;  1YJN 3;  3LTB A;  2BMO B;  2CFD A;  4R9L A;  3M8C A;  4JRF A;  5EQL A;  5STD A;  3PXM A;  2GXF A;  4HVN A;  1RGA A;  4IIA A;  2YX9 A;  2E2T A;  1RGC A;  4CJN A;  2RSX A;  5G1K A;  4BTY A;  5CLK A;  3CCV 3;  1JV2 B;  2O3O A;  3LH4 A;  4GL6 A;  2P0M A;  2L1S A;  3KII A;  4HKV B;  4HZ9 B;  1B2S A;  1YJW 3;  1AR0 A;  3AMO A;  5GSP A;  1MWU A;  2RFR A;  3SED A;  4H3U A;  1STD A;  3QK9 A;  1I8V A;  4K1V A;  1BNR A;  1I2G A;  3PYJ A;  3S5C A;  3U1W A;  3PCR A;  5IER A;  3DGL A;  3MWZ A;  3UJM A;  5BU4 A;  1MGR A;  2D1W A;  1FZU A;  2K54 A;  4L8O A;  1O7G B;  2CWU A;  2FNQ A;  1JKG A;  4FMA A;  1RLS A;  1TFO A;  3WMD A;  4XM4 A;  1BSC A;  3UB1 A;  3NV0 A;  4WYK B;  1OHO A;  3X3Z A;  4IT7 A;  1BU4 A;  1Q86 4;  1W2B 2;  1U5O A; 
#chains in the Genus database with same CATH homology
 4N6N B;  5IEN A;  2Z77 A;  3NUV A;  1EKM A;  3FLJ A;  3OWY A;  1OH0 A;  4XBY A;  2GEX A;  3CNM A;  1AVL A;  3I55 3;  2W56 A;  1F8N A;  3WDG B;  4FMB A;  3DGM A;  2WOF A;  3LTD A;  1IU7 A;  4R9K A;  1D6U A;  1YJ9 3;  3WA2 X;  3S28 A;  1N9E A;  2OOV A;  3EBY A;  3B4P A;  4FR9 A;  1N5H A;  2RCD A;  1W7C A;  1NB3 I;  2YFI B;  2E2U A;  3Q1C A;  4AKY A;  1JN5 A;  4LZI A;  1KQS 2;  4EYC A;  1W01 A;  1O7H B;  3CXC 2;  4LEH A;  2FGT A;  1D6Z A;  3SLU A;  4LSO A;  5IG3 A;  3FGY A;  1FGR A;  4ZM8 A;  2KRT A;  1W4N A;  4OK0 A;  5KP1 A;  1HKX A;  1UI7 A;  3NQY A;  3SXX A;  2OCT A;  4J9A A;  3WA3 A;  3CCL 3;  1VQ9 3;  2E2V A;  1WMO A;  2CK3 H;  1DVD A;  3B7C A;  1UUW B;  2WGO A;  2QIY A;  4WHA A;  5AI1 A;  1IQY A;  2MC8 A;  3PZW A;  1U8C B;  3SVA A;  3F8H A;  2CFG A;  3CCJ 3;  2XSO B;  1Y4K A;  4G1M B;  5AEU B;  3K5T A;  2HMK B;  3UL6 A;  1LXE A;  4RNZ A;  3T8U A;  4X2O A;  1ZO2 A;  1RKY A;  3CNX A;  3F7S A;  4EV5 A;  1VZZ A;  4HYZ A;  4FMD A;  4N6U A;  4XB5 A;  4J8T A;  1IT7 A;  3LZA A;  1W2Z A;  1M90 4;  2ZDJ A;  3CPW 2;  2F99 A;  2OQE C;  1YI2 3;  3CCS 3;  3GAX A;  2BMR B;  2GBW B;  3ALA A;  3MSO A;  5CK6 A;  4R80 A;  3DGO A;  1K28 A;  5EEO A;  2C11 A;  2KCD A;  2STD A;  1VQM 3;  1N8R 4;  1IQX A;  2W03 A;  3GZY B;  5ELU A;  2KXG A;  4O2H A;  1DYU A;  3FCS B;  3SOY A;  2CFK A;  3DXO A;  4XDW A;  3IPT A;  2IUK A;  1EA2 A;  2BO9 B;  3MG3 A;  2P38 A;  5D82 A;  3J7Y d;  2C10 A;  4WWU C;  4KFD A;  3LT8 A;  3RGR A;  3EBT A;  3BB9 A;  1D6Y A;  5D83 A;  1JKG B;  3DY5 A;  3F8X A;  2B1X B;  3HIG A;  4I4K A;  2W0Q A;  1YHQ 3;  1K8A 4;  3V99 A;  1AV4 A;  2ML6 A;  2K0M A;  1A2V A;  3EC9 A;  1JJ2 2;  2ML5 A;  4FCZ A;  3UL5 A;  1Z1S A;  3CCQ 3;  2O9U X;  2I9W A;  3K9M C;  1FGM A;  4EV2 A;  1VQL 3;  3CMA 3;  2W56 B;  2W04 A;  2P09 A;  1OHS A;  1GY6 A;  3X3X A;  3H3H A;  3LML A;  2B24 B;  5CXO A;  3KKG A;  3NBR A;  3EJV A;  4CCV A;  3N8B A;  1TU5 A;  1LNH A;  2XSH B;  3KSP A;  1M9G A;  1OF5 A;  3OXA A;  3EX9 A;  3F9S A;  1W00 A;  1WQL B;  4KFF A;  2QA4 3;  3VF1 A;  1RN7 A;  1C7H A;  5AYR B;  5AEW B;  2CWV A;  4N6L A;  3V92 A;  4NHF A;  1A90 A;  5DRV A;  1CQS A;  5IW9 A;  4AKZ A;  3X42 A;  4FCJ A;  2XR8 B;  1VQN 3;  1Q40 B;  1ISK A;  3KZT A;  3RDE A;  3CC2 3;  4EC6 A;  3X41 A;  2F86 B;  3FG3 A;  3F14 A;  1RRH A;  5HGR A;  1LOX A;  3FG4 A;  3H51 A;  4KVH A;  1NB5 I;  1O7W B;  3S29 A;  1A67 A;  2WGQ A;  3BND A;  1SIH A;  1FGT A;  1PU4 A;  3HI7 A;  2HMJ B;  1NJI 4;  2OTL 3;  1NWW A;  5DRE A;  5JPP A;  3SX1 A;  4BTW A;  2CWT A;  1YVB I;  2Y74 A;  3FF0 A;  1DMM A;  3I0Y A;  2W9Q A;  2PNC A;  3HK4 A;  4STD A;  5IG5 A;  3KE7 A;  3E99 A;  4R4K A;  4RBN A;  1GD3 A;  3EN8 A;  1S5A A;  1VQO 3;  1VQ6 3;  3L0R A;  2Z7A A;  3DGN A;  4HM5 B;  3CC4 3;  4FCM A;  3IMA B;  3DUK A;  1O7M B;  1VQP 3;  1O7P B;  1CEW I;  1N5P A;  2HMO B;  3GWR A;  2GU1 A;  2XGN A;  1N8Q A;  2CHC A;  4MJD A;  3CPO A;  1W5Z A;  3G8Z A;  2FXT A;  3STD A;  1ROV A;  5CF2 A;  1KSI A;  1IT8 A;  5AIG A;  5JPU A;  2HMN B;  1JRQ A;  5IG4 A;  4K61 A;  1BUQ A;  3OW2 2;  2W6J H;  3LTC A;  5CF1 A;  2INX A;  5IF6 A;  2XF3 A;  3FSD A;  4HM7 B;  1Q42 A;  2CW9 A;  3ECF A;  4KFE A;  1VQ4 3;  3Q90 A;  4R1K A;  1IVX A;  2L4V A;  2PZV A;  2CFL A;  1K9M 4;  3X40 A;  2XEP A;  4N6V 0;  1PFP A;  4WYK A;  3VSY A;  1CYV A;  4WFO A;  3CU3 A;  3JUM A;  3LOY A;  4AEQ A;  3CME 3;  3MPH A;  3OX9 A;  1YIT 3;  3CD6 3;  2HMM B;  1GY5 A;  1TUH A;  3JUO A;  3B4O A;  4HM6 B;  5KP4 A;  2R4I A;  2RGQ A;  4XBX A;  1UW1 A;  2XH9 A;  2UX0 A;  1GD4 A;  3K7C A;  2BHM A;  3AMO B;  1R4C A;  2W9P A;  4TX4 A;  2IUJ A;  3I56 3;  3GRD A;  1N9J A;  4CDL A;  2Y73 A;  2WO0 A;  2Q07 A;  3EF8 A;  1TP6 A;  3NM2 A;  4U13 A;  1MOL A;  1SQW A;  3QRD A;  2XRX B;  4HZB B;  1E3V A;  4OVM A;  5FGO A;  1RJO A;  3DM8 A;  3OV4 A;  2OOV C;  2BT3 A;  1QAL A;  4H61 A;  3DMC A;  2CG0 A;  3Q2P A;  1GS3 A;  5FW5 A;  1IV9 A;  3T8N A;  8CHO A;  3NV0 B;  3ER7 A;  1DMQ A;  4O02 B;  2Z76 A;  3KN4 A;  2CH9 A;  1DMN A;  5IEP A;  1L5G B;  4X2H A;  1IK3 A;  3JUP A;  1OUN A;  5ELJ A;  3OWS A;  3CCE 3;  2XFT A;  1JB5 A;  1NO3 A;  3LT9 A;  2HML B;  4HJL B;  1UI8 A;  1YIJ 3;  3MYT A;  1DVC A;  2CFW A;  5AII A;  4OUQ A;  5A0O B;  2F98 A;  3LXU X;  3BNE A;  1ZX2 A;  1JN5 B;  2LQV A;  1VQ5 3;  3WOD G;  2P0X A;  1YGE A;  3HZP A;  3JVC A;  4O8S A;  3NXJ A;  1ROA A;  4HM2 B;  3CCU 3;  4N6O B;  1QAK A;  3X3Y A;  3D3L A;  1US1 A;  2XGL A;  3JUN A;  1NU3 A;  1LVN A;  2XFS A;  4K1U A;  1FA3 A;  4N6T A;  2V1L A;  3EN1 B;  3HX8 A;  1EG9 B;  3U97 A;  3A76 A;  2BNG A;  1OAC A;  2CIU A;  5LC6 A;  3NQZ A;  3KFQ C;  1G96 A;  4HM4 B;  2A15 A;  1RRL A;  1GY7 A;  5AYS C;  2BMQ B;  2CKF B;  4WP5 A;  1K41 A;  4KZ1 A;  4L7K A;  1ASK A;  4MEI A;  1WMN A;  2IMJ A;  4NRE A;  1W6C A;  3BNC A;  1Q81 4;  4RNY A;  4JF8 A;  1ULI B;  3K0Z A;  3S27 A;  1W6G A;  5D81 A;  1FGQ A;  3F40 A;  2GEY A;  1Q82 4;  3K63 A;  2OQE A;  3G4S 3;  5EVH A;  4LGQ A;  4L8P A;  1NDO B;  1VQK 3;  3O8Y A;  1QJG A;  3S67 A;  1M1X B;  5IEO A;  1MNL A;  2QGU A;  3NHX A;  1AVK A;  2IA7 A;  1WMP A;  3OWU A;  1ULJ B;  3MKI A;  5G2G A;  1T5Y A;  3RGA A;  4MMY B;  1W02 A;  5KP3 A;  4GB5 A;  2M7O A;  4HBR A;  4QWT A;  2GU3 A;  3NBJ A;  2QEX 3;  1W6Y A;  5BXQ A;  2Z6B A;  3LYG A;  4PEJ A;  1VQ8 3;  1OPY A;  4BTX A;  3HII A;  1IVV A;  1WNH A;  2ZL8 A;  3VGN A;  3N54 B;  2SBL A;  1SII A;  1V74 A;  3GZB A;  2CG1 A;  3EHC A;  3GZX B;  4IPB A;  3SOA A;  6STD A;  1J2B A;  3NBB A;  1Q40 A;  1UUV B;  4HM3 B;  1IVW A;  1OHP A;  3DZL A;  1VQ7 3;  3LTA A;  2LYX A;  3B8L A;  3TDG A;  4EXR A;  3ROB A;  3CCR 3;  3KSE D;  1JB4 A;  1TFK A;  2WOH A;  3EB8 A;  3NX0 A;  1JNQ A;  3JUQ A;  2OTJ 3;  5JBS A;  5I97 A;  3G16 A;  3PGB A;  4N3V A;  4FMC A;  1M1K 4;  3N9H A;  3FH1 A;  2MF7 A;  1QVF 2;  1U5O A;  1KD1 4;  1OF5 B;  1O7N B;  4XBT A;  2CC3 A;  1E97 A;  3V98 A;  1QVG 2;  2YFL B;  7STD A;  2YFJ B;  3EQQ B;  3GZR A;  4HM8 B;  1QAF A;  3EE1 A;  4O3V A;  3MG1 A;  1OGZ A;  1CYU A;  1K73 4;  2JQ5 A;  1S72 3;  3UNL A;  1GYB A;  1IDP A;  3BLZ A;  1STF I;  1JB2 A;  3PS8 A;  1FGO A;  2JDI H;  3D9R A;  3PCS A;  5AIH A;  2OWP A;  4Q53 A;  1HU9 A;  5LC7 A;  5BVB A;  1SPU A;  3G0K A;  1A2K A;  3FG1 A;  5IG0 A;  1EQK A;  1KWI A;  1OCV A;  3FZW A;  5AIF A;  3F7X A;  3FF2 A;  4ORL A;  3NM7 A;  1WTH A;  3CC7 3;  3MHE A;  1QMA A;  3G71 3;  1IVU A;  3CCM 3;  3T0U A;  2P05 A;  1IV7 A;  1IQ8 A;  5TGN A;  4EBG A;  4XDV A;  4HM0 B;  4MMX B;  3IJE B;  4HM1 B;  3WOE B;  1KC8 4;  4N6M A;  4RZM A;  1FUW A;  3WOF B;  4LMI A;  4MMZ B;  1OGX A;  1Q7Y 4;  1SJW A;  3G6E 3;  3FKA A;  2D42 A;  3BNB A;  2GBX B;  3MG2 A;  2W2C A;  4K90 B;  1TIJ A;  1YJN 3;  3LTB A;  2BMO B;  2CFD A;  4R9L A;  3M8C A;  4JRF A;  5EQL A;  5STD A;  3PXM A;  2GXF A;  4HVN A;  4IIA A;  2YX9 A;  2E2T A;  2RSX A;  4BTY A;  5CLK A;  3CCV 3;  1JV2 B;  2O3O A;  3LH4 A;  4GL6 A;  2P0M A;  3KII A;  4HKV B;  4HZ9 B;  1YJW 3;  1AR0 A;  3AMO A;  2RFR A;  3SED A;  4H3U A;  1STD A;  3QK9 A;  4K1V A;  3PYJ A;  3S5C A;  3U1W A;  3PCR A;  5IER A;  3DGL A;  3MWZ A;  3UJM A;  2D1W A;  2K54 A;  4L8O A;  1O7G B;  2CWU A;  2FNQ A;  1JKG A;  4FMA A;  1TFO A;  3WMD A;  4XM4 A;  3UB1 A;  3NV0 A;  4WYK B;  1OHO A;  3X3Z A;  4IT7 A;  1Q86 4;  1W2B 2;  1E3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...