3KFUG

Crystal structure of the transamidosome
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
b'ELSPELLRKLETLAKIRLSPEEEALLLQDLKRILDFVDALPRVEEGGAEEALGRLREDEPRPSLPQAEALALAPEAEDGFFRVPPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-discriminating and archaeal-type aspartyl-tRNA synthetas
publication title Crystal structure of a transfer-ribonucleoprotein particle that promotes asparagine formation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase/rna
total genus 15
structure length 86
sequence length 86
chains with identical sequence J
ec nomenclature
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02686 Glu-tRNAGln Glu-tRNAGln amidotransferase C subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.990 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kfuG02
1.10.20.60 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kfuG01
3A1KA 3H0MC 2F2AC 2G5HC 3A1IA 3H0LC 4WJ3C 2DQNC 2DF4C 2G5IC 3IP4C 3AL0C 3H0RC 3KFUG
chains in the Genus database with same CATH superfamily
3UTBC 3AZKB 4NE3A 2NQBB 1V92A 3B0DC 1DGHB 1OFIA 3FTEA 3KS4A 3REKA 1P3KA 3LQQA 4G6ZA 3MGQA 1KX4B 2DWZB 4QLCB 2KDLA 5B31D 4XZQC 3SAUA 3K92A 3SBJA 3X1TA 3E21A 1XB2B 5B2ID 1DGBA 3KVWA 3A1IA 4H9PB 1GJSA 2JY8A 2JY6B 3REJD 3W68A 3SMSA 1XNRM 4LD9C 4NFTA 5B0ZC 1P3PB 3AZNC 4RNAA 2RVQD 4LGYA 4NE6A 4CGYB 3MGRB 2FJ7A 1IBMM 3U6EA 3KXBA 1KU5A 2JY5A 5B33D 4CISA 5AV5A 2YQZA 4NRWA 3AV1D 3ZQJA 1QZEA 5ITQA 4H9RB 2E5LM 4LJ9A 3LZ0D 3UTAD 1KYIA 3D8LA 2UUCM 1Q02A 2JY7A 1F4IA 2EKFA 1GO5A 3FKEA 4KHAA 5JRGA 1Q3BA 3W99B 3CF2A 4JI1M 1KX5A 3B7NA 2Y2KA 1JQJC 3GPPA 4NSOB 3THGA 1N32M 5AV8D 4JV5M 1KSFX 2JA2A 3WTPE 2HKJA 5EXPA 1P3OA 2CV2A 4MB7A 3GO8A 5B2JA 3X1SB 2L4EA 1AOID 1ORYB 3LVWA 1EFUB 4X64M 2KEBA 3HHXA 4GKJM 3H4MA 3MGPA 1M1AC 3REID 4IBFA 1T43A 2X8AA 3AZEB 3AZMD 1J7KA 1XXHA 5DYIA 4JI0M 3AZFB 2D7HA 5EXTA 4GIPA 5CP6D 3MVDB 1IM2A 2Y0TA 4IBDA 1EE8A 4D82A 4G4NA 3X1VB 4LRSA 1F66B 4LF4M 3AZID 1TDZA 4LRTA 5B40C 3H0RC 3LVVA 5GT3A 4X23D 2ZY4A 4XUJA 3L27A 2HHHM 5KPTA 4QHSA 2AROC 1P3FB 2NZDB 1TAFA 3X1UC 5E5AB 4P17A 2C5RA 3SHFA 4FWDA 1DO0A 4DV2M 1Q39A 1P34A 3W99C 1NVMA 2C9OA 3GLIA 3J2PB 3TU4A 3WAAB 2XF3A 3ZCBB 4H9NB 3CTWB 5B1LB 5AY8D 3B6GD 2Y2OA 2QSFX 3KOXE 1MJGM 5AVCC 1P3LD 5CPIC 1U35C 3AN2A 1JB0F 1OJLA 2CUZA 5AV9C 1ID3D 1P3GB 3W98D 5EP3A 5FUGB 4KUDC 5ITUA 4Z66D 5BNXB 1BH9B 1WGLA 2ZAOA 4IBJA 3SYKA 2GNOA 3AFAB 4B3TM 2FS1A 2LXEA 2DAMA 2KHHA 4WU9A 4LF5M 3WA9B 4HGAC 1XXHE 4J8XA 3GLGB 1K3WA 1M18A 1H3OB 1M19B 2EUCA 3FE3A 5BR8M 5FLXS 3W97D 3AYWA 3D8BA 1D0LA 3AV2A 3WTPC 4DR1M 3W96D 1P3IA 3AZLA 1FJGM 2LTUA 1ZLAD 4JI7M 5FTNA 1NJGA 2UUAM 1BH8A 2DENA 4J8VD 3K2LA 3REKC 4PDGA 1IBKM 1P3KC 3TWKA 3B6FA 4ZPXA 4XZQD 4YHHM 3MGQC 1HQ3A 2QQ8A 4AWLB 3FD9A 5EQTA 2HIOD 4MGYE 2PYOA 2DZLA 5B1MD 3L26A 3TWMA 1K3XA 2X49A 2ZM6M 3J27B 3X1TC 2ZTCA 5GSUA 5CPJB 4AG5A 1G8PA 5B24D 1JFIA 3C1CB 3FUXA 5B0YA 4WU8B 5CHLB 4EIWA 4R8PD 2FJ7C 2QBYB 3KXBC 3A46A 4Z2MH 4LF7M 4KLNA 5AV5C 3LZ1D 1L2DA 2CHQA 5LMUM 4PDIA 3L25A 4CAYA 3GLFA 3PVSA 4JI6M 1EQZD 5EJCA 2XFTA 4LZJA 2KA6B 4WZSB 3QAUA 3K1JA 5JRGC 3SC3A 2R65A 2XSZD 2DWLA 2Y2MA 2UXBM 3T38A 5DNMB 1E9SA 4GC9A 2L4FA 4JN6A 4LG2A 1KX5C 3M0EA 2L2DA 5C3IB 4G4OA 1NNUC 2UXCM 3V9RB 2FH0A 3WKJB 2QZ4A 2F5SA 2XD1A 1Z5CA 4WNNA 1GKIA 1P3AB 2LVPC 4H9OB 1PZRA 1P3OC 4AI6A 5B2JC 4IBEA 2XD5A 3F6TA 3AZKD 2NQBD 5GT0B 1Q3CA 3MGSB 3MGPC 1W2EA 1KX4D 4IBCA 2RRUA 4QLCD 1QUSA 1NJFA 4II7A 2BYKA 4YM6A 1JR3A 5EXXA 3I4YA 2HUEB 4Q7JA 1P3PD 2LVQD 2JZ0A 4KT0F 5KPRA 3MGRD 1HNZM 1R4VA 2OPFA 3KFUG 3SATA 4FCWA 2JP7A 1P3BB 5EP1A 3GRYA 3Q8XA 5AV6A 4XUJC 4G4RA 5E6JA 3GLFE 2P5TA 5G49B 3MNNA 1HR0M 3LZ1A 5KDMA 2Z4SA 4H9QA 3I4VA 5GKNA 3W99D 3B6GB 1P3MB 3FYDA 3QYBA 4MGHA 3VKGA 1G4AE 2EKKA 3TU4C 1OIZA 3P5JB 1HTAA 2OQ4A 2BJVA 1SXJB 3PFIA 4AZFA 1NNJA 3R45A 4QNMA 2M60A 1TH3A 3RFWA 2J7OA 3AN2C 3X1SD 3LJAA 2X4AA 4HL4A 4DR2M 3HU2A 3J7BA 3HU3A 4LJ4A 2JWSA 4UPKA 3T1HM 2DWNA 5GT0C 2LVAA 2L6OA 3HKPA 3UT9B 3AZED 1VG5A 4LFAM 5B32A 5BNVA 1DGHA 4JXJA 2V1UA 3UTBB 2Y2PA 3AZFD 3ILKA 4J8XC 1VEKA 3C9PA 3B0DB 1M18C 3MVDD 3NQJB 5GXQA 4IBKA 3AYWC 4OVZB 3L2AA 1IXRC 3AV2C 2JXNA 2O5RA 3X1VD 3FTCA 3KWQA 1P3IC 3AZLC 4F1IA 2DHRA 2F5QA 1IY0A 4J8WA 2R44A 3U5ZA 3A45A 2Z8YM 1ZAEA 2KRUA 4EO5C 3AZHA 3B6FC 4LD9B 5B0ZB 5KO3A 1TTEA 3AZNB 1HNWM 1NY6A 1P3FD 1TZYA 4Z5TA 1PJQA 1GL7A 2NZDD 2PYOC 4J8UA 5E5AD 1EIJA 3QYEA 3C1BA 2JNHA 5GSUC 2KW0A 1UM8A 1Z59A 4BB9A 3VH6T 2ZTDA 5B0YC 5F99A 5AVBA 3E4RA 4JYAM 1UFZA 3WAAD 5B1LD 2EJSA 2NQ8C 3K8ZA 1IXSA 4UUZA 1KX3A 5BS7A 1YE9A 1P3GD 5DNNA 4CHTB 4DR4M 4OU7A 2L09A 2L7HA 1L2CA 3AFAD 3HJ8A 2DNAA 4AKGA 3WA9D 4MGZE 1J5EM 3U6QA 4YS3B 1M19D 1WGNA 1M1AB 4DBGB 2VIIA 4KGCA 1LV7A 3SARA 3RELA 1S32A 3EIHA 4LF9M 2CV5A 3NQUB 3FTDA 2XZUA 2IO5C 4MH0E 5CPKA 2OOAA 4RF0A 4DR3M 2C98A 1F66A 3A98B 3E46A 1BVSA 1E32A 1ZMWA 2FFFB 3VH5A 4IBIA 3GLHA 1N1JB 4M9XA 4YM6C 5KQ8A 5B40B 1VEJA 3AZJA 4A3VB 1QUTA 1TGUA 4DV0M 5CPJD 3C1CD 2AROB 1YLAA 2O25A 4WU8D 3FRHA 3X1UB 3O62A 3A6NC 3TE6A 1DV0A 2ZY2A 3ZC7B 1VQ1A 1YSYA 3MNNC 2Q2EB 1I4WA 4AQYM 1IN7A 3A1KA 4X62M 3SMPA 2DZNB 5AVCB 4ZUXA 5CPIB 1U35B 3RE8A 5DNMD 5AV9B 4DUZM 4JJNA 4KUDB 2G8LA 2Z7JA 3REHA 3LELA 2ZY5A 2KZSA 1PJJA 3LQRA 3WKJD 5JA4B 4YS3C 1P3AD 4GC5A 3U6OA 3KUYA 2F8NA 3U60A 4CSRB 3AZGA 4HGAB 3LJAC 3HX3A 4DR6M 2YFWA 2Y2LA 4QOSA 5GT0D 3K9PA 3MGSD 3EPJA 4G92C 2BYMB 1QDRA 5JI2E 4KO8A 3WTPB 3HJSA 4Y28F 4JI3M 5B31A 5B32C 3GLHE 4DUYM 4MGIE 5B2IA 1QQWA 2Y2NA 3REKB 5GXQC 1P3KB 1D2NA 3REJA 2K9DA 3DA1A 3MGQB 3VH6A 4Z8XA 1MX0A 3BOSA 3KWQC 2RGOA 2ZANA 2Y2QA 1R6BX 1VDLA 1K82A 3U6MA 5B33A 1D0KA 2JZ1A 2WSCF 4J8WC 3X1TB 1P3BD 3AV1A 2VQRA 4IIWA 2DF4C 3LZ0A 3UTAA 3AZHC 2KXEA 1TZYC 4Z5TC 2FJ7B 4J8UC 3KXBB 3KOYE 2F2AC 4MM3B 5AV5B 1L8QA 2G5IC 4AKIA 1P3MD 2EA0A 3NBXX 1VDDA 2CV0A 2BG1A 3HU1A 5F99C 5AVBC 4MGKE 3PNYA 1QDTA 5C18A 3E9SA 4KHAB 5AV8A 5JRGB 2H1RA 3AKZA 1SXJD 4B7GA 1ZMVA 1KX3C 2KNVA 1KX5B 4WJ3C 2CV1A 1AOIA 1DGGA 1NV9A 4UN2B 1HT1E 5DNNC 3REIA 1XHBA 2JUJA 1QAQA 3UT9D 1P3OB 1J09A 3GPUA 3U61A 3AZMA 5B2JB 3VFDA 3UTBD 4JI5M 5CP6A 3MGPB 4DRBA 3AV0A 4KGCC 2HWJA 4L8RC 3B89A 1NHGC 4FWGA 3RELC 3U6DA 1S32C 4IBBA 3U6CA 3AZIA 5IREB 2RGHA 1XXHB 2CV5C 4LJ5A 3C3DA 1IY2A 1Q9CA 2VDBB 5FTKA 5CPKC 1PJTA 3EPLA 1IQPA 4X23A 2C99A 4LD9D 5B0ZD 2Y0QA 1MN3A 3AZND 4HLQA 3LW5F 3EG5B 3AZJC 4BLCA 3HGIA 3TL4X 5GT3B 4R71A 2MJ5B 1R2YA 4LY6A 3EPHA 4XUJB 2GQFA 3K9OA 4FD2A 3A6ND 1IFYA 1TAFB 3C58A 2MH8A 3O62C 1L1TA 2DHYA 3U6LA 5AY8A 4L78A 3B6GA 3J7AS 2YNMD 2K6BA 1P3LA 2ZM5A 1P34B 1ID3A 3I51A 3W98A 3GPYA 3GRVA 4Z66A 5BO0A 5ITYA 2MROB 3GLIB 3TU4B 1TF0B 2J5YA 2Y2JA 4B3SM 1R2ZA 2DVWB 2XEPA 2J8PA 1F1EA 1N36M 4GHAA 2YFVA 3NWLA 4ZUXC 3AN2B 1B67A 1OKSA 1HT2E 4IJEA 4LFCM 1DGFA 3FRIA 1E9RA 4JJNC 4B3RM 2LVOC 2KRKA 3AOGA 4YS3D 3REHC 3LELC 3FYCA 1KFVA 3W97A 2LHCA 1M1AD 2CRUA 3W96A 2ERCA 1ZLAA 3AZGC 4WV4B 3GQ4A 4J8XB 1M18B 4BBAA 2DAKA 5IT9S 4J8VA 2CFOA 1TH4A 4CJ6A 3AYWB 4ANRA 4XZQA 3AV2B 5BT1C 2JCHA 4FVMA 1P3IB 3AZLB 2HIOA 3PXGA 5B31C 3WHLA 3V76A 3FTFA 5B1MA 4JI8M 1OQYA 1BH8B 5B40D 2DAIA 4NE5A 5B2IC 3T1YM 1AIPC 2VQFM 3U6PA 4EO5B 3REJC 3B6FB 5B24A 3LCVB 1GABA 1BFMA 1HQ3B 5GT3C 2RVQC 2AROD 1NY5A 3SFZA 4G4QA 2PYOB 3X1UD 4R8PA 1CUKA 2CE7A 1L2BA 5B33C 2F5PA 4RF1A 3UK6A 3AV1C 3VH5T 5GSUB 3LZ0C 1QAMA 3FUUA 3WHKA 3UTAC 1PJIA 4LZZA 2MGWA 2QNJA 1JFIB 3VKHA 5B0YB 1EQZA 4HEOA 1P34C 2CEAA 3M6AA 4LJAA 1QZMA 2Y2GA 2WSEF 2G5GX 2XSZA 3UGJA 5AVCD 5CPID 1U35D 1MU5A 4CAYB 4H9SA 5AV9D 3GLFB 1FNNA 4GH9A 4REZA 1PJSA 4KUDD 2XGNA 1IN4A 3SAVA 3JR4A 2CWBA 3W0LB 4GKKM 3AZKA 1AOIC 4LJ6A 4WU9C 3W0FA 2NQBA 1ZMUA 2V1CA 4K0KM 4QHTA 4GMQA 1KX4A 3REIC 4FW9A 3WTPD 4IBGA 4WNNB 3J81S 3LCUA 4QLCA 3AZMC 3AL0C 2LBCA 3FUWA 2IO5B 2M5ZA 2RIQA 2F5OA 4H9PA 3REKD 2YFQA 1R7RA 3HHZA 1P3KD 1V34A 1IN6A 3MGQD 1P3PA 4DV3M 5L8RF 4LF8M 3HJQA 3MGRA 2BYKB 3AZIC 1HQ3C 4YM6B 1T6OA 1G41A 3MHVC 3X1TD 5DFLA 1PM5A 2APLA 4H9RA 4X23C 4ITQA 2I7NA 1TDHA 3Q8GA 1IBLM 4WURA 2FJ7D 3KXBD 3A6NB 3SAWA 1W5TA 5AV5D 2V6ZM 1A5TA 3AOEA 3ZH9B 3W99A 4QNRA 3KXEC 3KOZE 1OTRA 2KZUA 3MNNB 4P16A 8CATA 3VDUA 2DAGA 3T6PA 5KDMB 1HQYE 4GHLA 5B32G 4E44A 5FSWA 5JRGD 4XK8F 4H9QB 5AY8C 2R6FA 4E45A 3VK7A 2WSFF 4LFBM 3IECA 3IHPA 1P3LC 1WXQA 2D7EA 3X1SA 4G3OA 1KX5D 3BXWA 3W98C 1ZV1A 4Z66C 1C1KA 5IZ7D 3I04M 3GPXA 4Z2MG 1WJ7A 2C96A 2Z3XA 4M0WA 2F5NA 3KS8A 3R45B 3AZEA 1P3OD 4M0DA 4IJFA 5B2JD 4JI4M 1QYRA 3LJAB 3AZFA 2OOBA 1NSFA 2Y2IA 5LMNM 3MVDA 4ZBJC 4NXMM 3IG8A 2G5HC 4G92B 3MGPD 3W97C 2JE5A 3KW6A 3FDDA 3W96C 3X1VA 4L4UA 3KSJA 5B32B 5BNVB 1ZLAC 2YR0A 1QANA 2W8SA 1IY1A 1I94M 5BT1D 4J8VC 5GXQB 3AJIB 1G3IA 3L28A 4D81A 1QAOA 3KWQB 1P3FA 2ZBKB 2NZDA 2HIOC 1N75A 1GL6A 5B1MC 5E5AA 3KSYA 5BPVA 1N78A 1WWIA 4J8WB 4L16A 3U5ZB 3MMPA 5GT3D 3AZHB 3J80S 4XUJD 5B24C 3L29A 3HHYA 1TZYB 4Z5TB 5AV6C 1N77A 2CHGA 4J8UB 4R8PC 3WAAA 1R4GA 4R7GA 4H9NA 5B1LA 3PNVA 3LZ1C 5E26A 3EPKA 3C1BB 2R46A 2L7IA 1Z2CB 1P34D 1P3GA 4G91C 5FUGA 5F99B 5AVBB 1EQZC 2HCBA 4NSRA 5BNXA 3TU4D 1BH9A 1QVRA 1H6UA 3RGPA 3AFAA 2WZJA 4CIZA 2DKLA 3WA9A 3SYLA 2F4VM 1IXSB 4UUZB 1ULYA 3AN2D 1KX3B 4H9SC 5DYGA 5DNNB 4DV4M 3GLGA 1H3OA 1N33M 1M19A 5KPZA 3I01M 1N34M 4WU9D 1Z6TA 4DRAA 4F2LA 4LJ7A 3VH5W 3AZKC 1Z5AA 4J8XD 4M6BA 2NQBC 1M18D 4FCTA 3OTOM 2DWMA 4L6V6 5C1BA 2L5AA 5EXSA 4LF6M 3AYWD 1NV8A 3AV2D 1KX4C 4KGCB 4QLCC 3RELB 3AZLD 1P3ID 1S32B 2KNAA 2C9CA 2CV5B 3GQ3A 2DI0A 3H4JA 3AFHA 1C7YA 1DO2A 5CPKB 2UXDM 5CPJA 4L15A 1XC8A 3B6FD 4M9SA 1HQ3D 3JR5A 3C1CA 1P3PC 4WU8A 2PYOD 3MGRC 1B6WA 3GLHB 5ITRA 2QBYA 3AZJB 3MJ5A 3HY5A 3H0MC 1XWIA 1Y8GA 5GSUD 1XMOM 4GITA 1NHWC 3C1BC 2DZOB 5B0YD 4YY3M 1IXZA 2F8NG 3C3EA 1G59A 3O62B 3TQSA 3B0BA 4GEWA 1OFHA 5EP2A 4NC6A 3AOEC 3SHGB 5FTLA 5DNMA 4AKHA 2OO9A 3GLGE 2R0IA 5BS7C 5B31G 3V9RA 4JI2M 3WKJA 2BJWA 4B08A 2Y2HA 2KNZA 3IG5A 1P3AA 4H9OA 4ZUXB 2R62A 2R18A 3X1SC 1GVNA 4JJNB 3RGSA 3REHB 3LELB 5GT0A 4NL4H 3MGSA 3B0CT 4I5SA 3GRUA 2QPAA 3UZUA 4DR7M 3KUYB 2BWEA 3VH6W 2F8NB 3AZEC 2EO2A 3U60B 3AZGB 2DQNC 3KP1E 3AZFC 7CATA 2YFWB 3MVDC 3U6SA 1XNQM 3X1VC 1RU3A 3LMMA 4AW4A 5B31B 1F66C 4FWHA 4YM6D 1JR3D 2LVNC 3BBZA 2B3TA 1P3BA 5B2IB 2K0BX 2JSSA 3REJB 1TH2A 1P3QQ 3DOAA 3KOWE 1P3FC 2FNAA 4B3MM 5G49A 2RKOA 2NZDC 2LHGA 4W5WA 2LY8A 2H5XA 5E5AC 4DQYB 5B33B 2FOIC 4R3DA 3AV1B 1HJPA 3NBIA 5A2QS 3LZ0B 3TWLA 3UTAB 5AV6D 3FUVA 1P3MA 3GLIE 4NXNM 3H0LC 3MNND 4AG6A 2F8NK 3B74A 1YUBA 3WAAC 3TPZA 4LJ8A 1L1ZA 1GJTA 4GRIA 5B1LC 3M7GA 2CWEA 1SXJA 3HHWA 3UMMA 2I7PA 1P3GC 2ZAMA 1TR8A 2AHMA 2D7GA 2VQEM 5AV8B 4KODA 3DZDA 3AFAC 1R5LA 3T15A 1T3TA 3VLFB 3UT9A 3WA9C 4DV7M 3LJAD 3UTBA 1AOIB 4WU9B 3KUYC 5FTJA 1M19C 3NQJA 1VEGA 2VF7A 4OVZA 3KDSE 3REIB 1NO1A 3QWLA 4TUWA 3MK6A 5IWAM 1OIPA 5F3WA 2G3QA 3U61B 3AZMB 4KHPM 5B32D 5CP6B 1W5SA 5GXQD 4LD9A 5B0ZA 4X65M 3AZNA 4I4LA 4AWLC 3KWQD 1IN5A 1OAIA 3AZIB 4XGIA 2VF8A 2W82A 4PD2A 4J8WD 2LWXA 4X23B 5CPJC 3AZHD 3B9PA 2LH0A 3B7QA 3C1CC 1E94E 1IN8A 3A6NA 1TZYD 4WU8C 4Z5TD 4X66M 4J8UD 1PRBA 4PCZA 1LTMA 2Z4RA 3C1BD 1SXJE 2UWXA 1PGYA 4OX9M 1X37A 2N35A 5F99D 5AVBD 2UUBM 1D0MA 2CP8A 2BWBA 5AY8B 4OW0A 3HZJA 4DR5M 1OAOC 5JI3E 1Z5BA 1WIVA 2QCUA 2HL7A 1P3LB 5AV8C 5ITTA 4LCBA 2R4EA 5DNMC 1KX3D 2XLJA 1ID3B 4S12A 3W98B 4NRVA 2R4JA 5DNND 4Z66B 5BO0B 3R9XB 3DFZA 5C3IC 3A42A 4YS3A 1M1AA 3WKJC 2HAKA 3F92A 2YFVB 4M9ZA 1P3AC 4I81A 1HNXM 5ITXA 3GQ5A 3NQUA 4XBOA 4ZBJB 2UU9M 1WHCA 3W97B 3MGSC 2DXIA 4B7FA 5CP6C 4KGCD 3W96B 3R8FA 3JAMS 4DV6M 4I8OA 1JR3E 3RELD 4WW0A 1S32D 1ZLAB 4NOOB 1N1JA 2CV5D 2DAEA 5B40A 4PT5A 4J8VB 5CPKD 3SASA 1WR1B 3W67A 2HUEC 4RKUF 1F66D 1S3SA 4XZQB 2F8NH 3GRRA 2AROA 2Y21A 2HIOB 3X1UA 5B1MB 1XMQM 1T3UA 1A7WA 4D80A 3AZJD 1P3BC 2BNKA 3IP4C 4LGMA 5B24B 4DV5M 4FCVA 1AUAA 2A5YB 3B0CW 3CGWA 2XFSA 5AV6B 3VK8A 2QHOB 4R8PB 3O62D 3B7ZA 2XZFA 2FE8A 4DV1M 3EIEA 3LZ1B 4WP2A 2QENA 5AVCA 1V33A 3KP0E 5CPIA 1U35A 2Y20A 3B6GC 3CF0A 5AV9A 1P3MC 4G91B 1WWSA 3KSXA 1EQZB 4KUDA 3HWSA 4QOZC 1SG9A 5EP4A 1ID3C 1GLNA 2O01F 4Z6YA 2QP9X 2MR9A 5JA4A 5FTMA 1SXJC 2K47A 3VDPA 3UJNA 4ZUXD 1G71A 4CSRA 5KQDA 5ITXE 5DNYA 3GP1A 4JJND 3REHD 3LELD 4B7HA 2J7NA 2BYMA 2R45A 2CHVA 3WTPA 1ZQ9A 2LNHC 3KUYD 5H37D 3UT9C 2F8ND 3FUTA 1HQCA 3CF6E 2FFJA 2XH9A 2ZY3A 3AZGD
chains in the Genus database with same CATH topology
3UTBC 3AZKB 4NE3A 2NQBB 3B0DC 1DGHB 1OFIA 3FTEA 3KS4A 3REKA 1P3KA 3LQQA 4G6ZA 3MGQA 1KX4B 2DWZB 4QLCB 5B31D 4XZQC 3SAUA 3K92A 3SBJA 3X1TA 5B2ID 1DGBA 3KVWA 3A1IA 4H9PB 3REJD 3SMSA 1XNRM 4LD9C 4NFTA 5B0ZC 1P3PB 3AZNC 4RNAA 2RVQD 4LGYA 4NE6A 4CGYB 3MGRB 2FJ7A 1IBMM 3U6EA 3KXBA 1KU5A 5B33D 4CISA 5AV5A 2YQZA 4NRWA 3AV1D 5ITQA 4H9RB 2E5LM 4LJ9A 3LZ0D 3UTAD 1KYIA 3D8LA 2UUCM 3FKEA 4KHAA 5JRGA 1Q3BA 3W99B 3CF2A 4JI1M 1KX5A 2Y2KA 1JQJC 3GPPA 4NSOB 3THGA 1N32M 5AV8D 4JV5M 1KSFX 2JA2A 3WTPE 2HKJA 5EXPA 1P3OA 2CV2A 4MB7A 3GO8A 5B2JA 3X1SB 1AOID 1ORYB 3LVWA 4X64M 2KEBA 3HHXA 4GKJM 3H4MA 3MGPA 1M1AC 3REID 4IBFA 2X8AA 3AZEB 3AZMD 1J7KA 1XXHA 5DYIA 4JI0M 3AZFB 2D7HA 5EXTA 4GIPA 5CP6D 3MVDB 1IM2A 2Y0TA 4IBDA 1EE8A 4D82A 4G4NA 3X1VB 4LRSA 1F66B 4LF4M 3AZID 1TDZA 4LRTA 5B40C 3H0RC 3LVVA 5GT3A 4X23D 2ZY4A 4XUJA 3L27A 2HHHM 5KPTA 4QHSA 2AROC 1P3FB 2NZDB 1TAFA 3X1UC 5E5AB 2C5RA 3SHFA 4FWDA 1DO0A 4DV2M 1Q39A 1P34A 3W99C 1NVMA 2C9OA 3GLIA 3J2PB 3TU4A 3WAAB 2XF3A 3ZCBB 4H9NB 3CTWB 5B1LB 5AY8D 3B6GD 2Y2OA 3KOXE 5AVCC 1P3LD 5CPIC 1U35C 3AN2A 1OJLA 2CUZA 5AV9C 1ID3D 1P3GB 3W98D 5EP3A 5FUGB 4KUDC 5ITUA 4Z66D 5BNXB 1BH9B 2ZAOA 4IBJA 3SYKA 3AFAB 4B3TM 2LXEA 4WU9A 4LF5M 3WA9B 4HGAC 4J8XA 3GLGB 1K3WA 1M18A 1H3OB 1M19B 2EUCA 5BR8M 5FLXS 3W97D 3AYWA 3D8BA 3AV2A 3WTPC 4DR1M 3W96D 1P3IA 3AZLA 1FJGM 1ZLAD 4JI7M 5FTNA 1NJGA 2UUAM 1BH8A 4J8VD 3K2LA 3REKC 4PDGA 1IBKM 1P3KC 3TWKA 3B6FA 4ZPXA 4XZQD 4YHHM 3MGQC 1HQ3A 4AWLB 3FD9A 5EQTA 2HIOD 4MGYE 2PYOA 5B1MD 3L26A 3TWMA 1K3XA 2X49A 2ZM6M 3J27B 3X1TC 5GSUA 5CPJB 4AG5A 1G8PA 5B24D 1JFIA 3C1CB 3FUXA 5B0YA 4WU8B 5CHLB 4EIWA 4R8PD 2FJ7C 2QBYB 3KXBC 3A46A 4Z2MH 4LF7M 4KLNA 5AV5C 3LZ1D 1L2DA 2CHQA 5LMUM 4PDIA 3L25A 4CAYA 3GLFA 3PVSA 4JI6M 1EQZD 5EJCA 2XFTA 4LZJA 2KA6B 4WZSB 3QAUA 3K1JA 5JRGC 3SC3A 2R65A 2XSZD 2DWLA 2Y2MA 2UXBM 3T38A 5DNMB 1E9SA 4GC9A 4LG2A 4JN6A 1KX5C 3M0EA 5C3IB 4G4OA 1NNUC 2UXCM 3V9RB 3WKJB 2QZ4A 2F5SA 2XD1A 1Z5CA 4WNNA 1GKIA 1P3AB 4H9OB 1PZRA 1P3OC 4AI6A 5B2JC 4IBEA 2XD5A 3F6TA 3AZKD 2NQBD 5GT0B 1Q3CA 3MGSB 3MGPC 1W2EA 1KX4D 4IBCA 4QLCD 4II7A 1NJFA 2BYKA 4YM6A 1JR3A 5EXXA 3I4YA 2HUEB 1P3PD 5KPRA 3MGRD 1HNZM 1R4VA 2OPFA 3KFUG 3SATA 4FCWA 1P3BB 5EP1A 3GRYA 3Q8XA 5AV6A 4XUJC 4G4RA 5E6JA 2P5TA 5G49B 3MNNA 1HR0M 3LZ1A 5KDMA 2Z4SA 4H9QA 3I4VA 5GKNA 3W99D 3B6GB 1P3MB 3FYDA 4MGHA 3VKGA 1G4AE 3TU4C 3P5JB 1HTAA 2OQ4A 2BJVA 1SXJB 3PFIA 4AZFA 1NNJA 3R45A 4QNMA 2M60A 1TH3A 3RFWA 2J7OA 3AN2C 3X1SD 3LJAA 2X4AA 4HL4A 4DR2M 3HU2A 3J7BA 3HU3A 4LJ4A 4UPKA 3T1HM 2DWNA 5GT0C 2L6OA 3HKPA 3UT9B 3AZED 4LFAM 5B32A 5BNVA 1DGHA 4JXJA 2V1UA 3UTBB 2Y2PA 3AZFD 3ILKA 4J8XC 3B0DB 1M18C 3MVDD 3NQJB 5GXQA 4IBKA 3AYWC 4OVZB 3L2AA 1IXRC 3AV2C 2O5RA 3X1VD 3FTCA 3KWQA 1P3IC 3AZLC 2DHRA 2F5QA 1IY0A 4J8WA 3U5ZA 3A45A 1ZAEA 2KRUA 4EO5C 3AZHA 3B6FC 4LD9B 5B0ZB 5KO3A 3AZNB 1HNWM 1NY6A 1P3FD 1TZYA 4Z5TA 1GL7A 2NZDD 2PYOC 4J8UA 5E5AD 3C1BA 5GSUC 2KW0A 1UM8A 1Z59A 4BB9A 3VH6T 5B0YC 5F99A 5AVBA 3E4RA 4JYAM 3WAAD 5B1LD 2NQ8C 3K8ZA 4UUZA 1KX3A 5BS7A 1YE9A 1P3GD 5DNNA 4CHTB 4DR4M 4OU7A 2L09A 2L7HA 1L2CA 3AFAD 3HJ8A 4AKGA 3WA9D 4MGZE 1J5EM 3U6QA 4YS3B 1M19D 1M1AB 2VIIA 4KGCA 1LV7A 3SARA 3RELA 1S32A 3EIHA 4LF9M 2CV5A 3NQUB 3FTDA 2XZUA 2IO5C 4MH0E 5CPKA 4RF0A 4DR3M 2C98A 1F66A 3A98B 1E32A 2FFFB 3VH5A 4IBIA 3GLHA 1N1JB 4M9XA 4YM6C 5KQ8A 5B40B 3AZJA 4A3VB 1TGUA 4DV0M 5CPJD 3C1CD 2AROB 4WU8D 3X1UB 3O62A 3A6NC 3TE6A 2ZY2A 3ZC7B 1YSYA 3MNNC 2Q2EB 1I4WA 4AQYM 1IN7A 3A1KA 4X62M 3SMPA 2DZNB 5AVCB 4ZUXA 5CPIB 1U35B 3RE8A 5DNMD 5AV9B 4DUZM 4JJNA 4KUDB 2G8LA 2Z7JA 3REHA 3LELA 2ZY5A 2KZSA 1PJJA 3LQRA 3WKJD 5JA4B 4YS3C 1P3AD 4GC5A 3U6OA 3KUYA 2F8NA 3U60A 4CSRB 3AZGA 4HGAB 3LJAC 4DR6M 2YFWA 2Y2LA 4QOSA 5GT0D 3MGSD 3EPJA 4G92C 2BYMB 5JI2E 4KO8A 3WTPB 3HJSA 4JI3M 5B31A 5B32C 4DUYM 4MGIE 5B2IA 1QQWA 2Y2NA 3REKB 5GXQC 1P3KB 1D2NA 3REJA 3DA1A 3MGQB 3VH6A 4Z8XA 1MX0A 3BOSA 3KWQC 2RGOA 2ZANA 2Y2QA 1R6BX 1K82A 3U6MA 5B33A 3X1TB 4J8WC 1P3BD 3AV1A 2VQRA 4IIWA 2DF4C 3LZ0A 3UTAA 3AZHC 2KXEA 1TZYC 4Z5TC 2FJ7B 4J8UC 3KXBB 3KOYE 2F2AC 4MM3B 5AV5B 1L8QA 2G5IC 4AKIA 1P3MD 2EA0A 1VDDA 2CV0A 2BG1A 3HU1A 5F99C 5AVBC 4MGKE 3PNYA 5C18A 3E9SA 4KHAB 5AV8A 5JRGB 2H1RA 3AKZA 1SXJD 4B7GA 1KX3C 1KX5B 4WJ3C 2CV1A 1AOIA 1DGGA 1HT1E 5DNNC 3REIA 1XHBA 1QAQA 3UT9D 1P3OB 1J09A 3GPUA 3U61A 3AZMA 5B2JB 3VFDA 3UTBD 4JI5M 5CP6A 3MGPB 4DRBA 3AV0A 4KGCC 4L8RC 1NHGC 4FWGA 3RELC 3U6DA 1S32C 4IBBA 3U6CA 3AZIA 5IREB 2RGHA 1XXHB 2CV5C 4LJ5A 1IY2A 1Q9CA 5FTKA 5CPKC 3EPLA 1IQPA 4X23A 2C99A 4LD9D 5B0ZD 2Y0QA 3AZND 4HLQA 3EG5B 3AZJC 4BLCA 3HGIA 3TL4X 5GT3B 1R2YA 4LY6A 3EPHA 4XUJB 4FD2A 3A6ND 1TAFB 3C58A 3O62C 1L1TA 3U6LA 5AY8A 4L78A 3B6GA 3J7AS 2YNMD 1P3LA 2ZM5A 1P34B 1ID3A 3I51A 3W98A 3GPYA 3GRVA 4Z66A 5BO0A 5ITYA 3GLIB 3TU4B 2Y2JA 4B3SM 1R2ZA 2DVWB 2XEPA 2J8PA 1F1EA 1N36M 4GHAA 2YFVA 3NWLA 4ZUXC 3AN2B 1B67A 1HT2E 4IJEA 4LFCM 1DGFA 1E9RA 4JJNC 4B3RM 3AOGA 2KRKA 3REHC 4YS3D 3LELC 3FYCA 1KFVA 3W97A 1M1AD 3W96A 2ERCA 1ZLAA 3AZGC 4WV4B 3GQ4A 4J8XB 1M18B 4BBAA 5IT9S 4J8VA 2CFOA 1TH4A 3AYWB 4XZQA 3AV2B 5BT1C 2JCHA 4FVMA 1P3IB 3AZLB 2HIOA 3PXGA 5B31C 3WHLA 3FTFA 5B1MA 4JI8M 1BH8B 5B40D 4NE5A 5B2IC 3T1YM 2VQFM 3U6PA 4EO5B 3REJC 3B6FB 5B24A 1BFMA 1HQ3B 5GT3C 2RVQC 2AROD 1NY5A 3SFZA 4G4QA 2PYOB 3X1UD 4R8PA 2CE7A 1L2BA 5B33C 2F5PA 4RF1A 3UK6A 3AV1C 3VH5T 5GSUB 3LZ0C 1QAMA 3FUUA 3WHKA 3UTAC 1PJIA 4LZZA 1JFIB 3VKHA 5B0YB 1EQZA 1P34C 2CEAA 3M6AA 4LJAA 1QZMA 2Y2GA 2G5GX 2XSZA 3UGJA 5AVCD 5CPID 1U35D 1MU5A 4CAYB 4H9SA 5AV9D 3GLFB 1FNNA 4GH9A 4REZA 4KUDD 2XGNA 1IN4A 3SAVA 3JR4A 3W0LB 4GKKM 3AZKA 1AOIC 4LJ6A 4WU9C 3W0FA 2NQBA 2V1CA 4K0KM 4QHTA 4GMQA 1KX4A 3REIC 4FW9A 3WTPD 4IBGA 4WNNB 3J81S 4QLCA 3AZMC 3AL0C 3FUWA 2IO5B 2M5ZA 2RIQA 2F5OA 4H9PA 3REKD 2YFQA 1R7RA 3HHZA 1P3KD 1IN6A 3MGQD 1P3PA 4DV3M 4LF8M 3HJQA 3MGRA 2BYKB 3AZIC 1HQ3C 4YM6B 1G41A 3MHVC 3X1TD 1PM5A 4H9RA 4X23C 4ITQA 2I7NA 1TDHA 1IBLM 4WURA 2FJ7D 3KXBD 3A6NB 3SAWA 1W5TA 5AV5D 2V6ZM 3AOEA 3ZH9B 3W99A 4QNRA 3KXEC 3KOZE 2KZUA 3MNNB 4P16A 8CATA 3VDUA 5KDMB 1HQYE 4GHLA 5B32G 4E44A 5FSWA 5JRGD 4H9QB 5AY8C 4E45A 3VK7A 4LFBM 1P3LC 1WXQA 2D7EA 3X1SA 1KX5D 3W98C 4Z66C 1C1KA 5IZ7D 4Z2MG 3GPXA 2C96A 2Z3XA 4M0WA 2F5NA 3KS8A 3R45B 3AZEA 1P3OD 4M0DA 4IJFA 5B2JD 4JI4M 1QYRA 3LJAB 3AZFA 1NSFA 2Y2IA 5LMNM 3MVDA 4ZBJC 4NXMM 3IG8A 2G5HC 4G92B 3MGPD 3W97C 2JE5A 3KW6A 3FDDA 3W96C 3X1VA 4L4UA 3KSJA 5B32B 5BNVB 1ZLAC 2YR0A 1QANA 2W8SA 1IY1A 1I94M 5BT1D 4J8VC 5GXQB 3AJIB 1G3IA 3L28A 4D81A 1QAOA 3KWQB 1P3FA 2ZBKB 2NZDA 2HIOC 1N75A 1GL6A 5B1MC 5E5AA 3KSYA 5BPVA 1N78A 1WWIA 4J8WB 4L16A 3U5ZB 5GT3D 3AZHB 3J80S 4XUJD 5B24C 3L29A 3HHYA 1TZYB 4Z5TB 5AV6C 1N77A 2CHGA 4J8UB 4R8PC 3WAAA 4R7GA 4H9NA 5B1LA 3PNVA 3LZ1C 5E26A 3EPKA 3C1BB 2R46A 2L7IA 1Z2CB 1P34D 1P3GA 4G91C 5FUGA 5F99B 5AVBB 1EQZC 2HCBA 4NSRA 5BNXA 3TU4D 1BH9A 1QVRA 1H6UA 3RGPA 3AFAA 3WA9A 3SYLA 2F4VM 1IXSB 4UUZB 1ULYA 3AN2D 1KX3B 4H9SC 5DYGA 5DNNB 4DV4M 3GLGA 1H3OA 1N33M 1M19A 5KPZA 1N34M 4WU9D 1Z6TA 4DRAA 4LJ7A 3VH5W 3AZKC 1Z5AA 4J8XD 4M6BA 2NQBC 1M18D 4FCTA 3OTOM 2DWMA 5C1BA 2L5AA 5EXSA 4LF6M 3AYWD 3AV2D 1KX4C 4KGCB 4QLCC 3RELB 3AZLD 1P3ID 1S32B 2C9CA 2CV5B 3GQ3A 3AFHA 1DO2A 5CPKB 2UXDM 5CPJA 4L15A 1XC8A 3B6FD 4M9SA 1HQ3D 3JR5A 3C1CA 1P3PC 4WU8A 2PYOD 3MGRC 1B6WA 3GLHB 5ITRA 2QBYA 3AZJB 3MJ5A 3H0MC 1XWIA 5GSUD 1XMOM 4GITA 1NHWC 3C1BC 2DZOB 5B0YD 4YY3M 1IXZA 2F8NG 1G59A 3O62B 3TQSA 3B0BA 1OFHA 5EP2A 3AOEC 3SHGB 5FTLA 5DNMA 4AKHA 5BS7C 5B31G 3V9RA 4JI2M 3WKJA 2BJWA 4B08A 2Y2HA 3IG5A 1P3AA 4H9OA 4ZUXB 2R62A 2R18A 3X1SC 1GVNA 4JJNB 3RGSA 3REHB 3LELB 5GT0A 4NL4H 3MGSA 3B0CT 4I5SA 3GRUA 2QPAA 3UZUA 4DR7M 3KUYB 3VH6W 2F8NB 3AZEC 2EO2A 3U60B 3AZGB 2DQNC 3KP1E 3AZFC 7CATA 2YFWB 3MVDC 3U6SA 1XNQM 3X1VC 3LMMA 4AW4A 5B31B 1F66C 4FWHA 4YM6D 1JR3D 1P3BA 5B2IB 2JSSA 3REJB 1TH2A 3DOAA 3KOWE 1P3FC 2FNAA 4B3MM 5G49A 2RKOA 2NZDC 4W5WA 2LY8A 5E5AC 4DQYB 5B33B 2FOIC 4R3DA 3AV1B 3LZ0B 3NBIA 5A2QS 3TWLA 3UTAB 5AV6D 3FUVA 1P3MA 4NXNM 3H0LC 3MNND 4AG6A 2F8NK 3WAAC 1YUBA 3TPZA 4LJ8A 1L1ZA 4GRIA 5B1LC 3M7GA 2CWEA 1SXJA 3HHWA 3UMMA 2I7PA 1P3GC 2ZAMA 2AHMA 2D7GA 2VQEM 5AV8B 4KODA 3DZDA 3AFAC 3T15A 1T3TA 3VLFB 3UT9A 3WA9C 4DV7M 3LJAD 3UTBA 1AOIB 4WU9B 3KUYC 5FTJA 1M19C 3NQJA 4OVZA 3KDSE 3REIB 3QWLA 4TUWA 3MK6A 5IWAM 5F3WA 3AZMB 3U61B 4KHPM 5B32D 5CP6B 1W5SA 5GXQD 4LD9A 5B0ZA 4X65M 3AZNA 4I4LA 4AWLC 3KWQD 1IN5A 3AZIB 4XGIA 2W82A 4PD2A 4J8WD 2LWXA 4X23B 5CPJC 3AZHD 3B9PA 2LH0A 3C1CC 1E94E 1IN8A 3A6NA 1TZYD 4WU8C 4Z5TD 4X66M 4J8UD 4PCZA 2Z4RA 3C1BD 1SXJE 2UWXA 4OX9M 1X37A 5F99D 5AVBD 2UUBM 5AY8B 4OW0A 4DR5M 5JI3E 1Z5BA 2QCUA 2HL7A 1P3LB 5AV8C 5ITTA 5DNMC 2R4EA 4LCBA 1KX3D 2XLJA 1ID3B 4S12A 3W98B 4NRVA 2R4JA 5DNND 4Z66B 5BO0B 3R9XB 3DFZA 5C3IC 3A42A 4YS3A 1M1AA 3WKJC 2YFVB 4M9ZA 1P3AC 4I81A 1HNXM 5ITXA 3GQ5A 3NQUA 4XBOA 4ZBJB 2UU9M 3W97B 3MGSC 2DXIA 4B7FA 5CP6C 4KGCD 3W96B 3R8FA 3JAMS 4DV6M 4I8OA 3RELD 4WW0A 1S32D 1ZLAB 4NOOB 1N1JA 2CV5D 5B40A 4PT5A 4J8VB 5CPKD 3SASA 2HUEC 1F66D 1S3SA 4XZQB 2F8NH 3GRRA 2AROA 2Y21A 2HIOB 3X1UA 5B1MB 1XMQM 1T3UA 1A7WA 4D80A 3AZJD 1P3BC 2BNKA 3IP4C 4LGMA 5B24B 4DV5M 4FCVA 2A5YB 3B0CW 2XFSA 5AV6B 3VK8A 4R8PB 3O62D 2XZFA 2FE8A 4DV1M 3EIEA 3LZ1B 2QENA 5AVCA 3KP0E 5CPIA 1U35A 2Y20A 3B6GC 3CF0A 5AV9A 1P3MC 4G91B 1WWSA 3KSXA 1EQZB 4KUDA 3HWSA 4QOZC 5EP4A 1ID3C 1GLNA 4Z6YA 2QP9X 5JA4A 5FTMA 1SXJC 2K47A 3VDPA 3UJNA 4ZUXD 4CSRA 5KQDA 5ITXE 5DNYA 3GP1A 4JJND 3REHD 3LELD 4B7HA 2J7NA 2BYMA 2R45A 2CHVA 3WTPA 1ZQ9A 2LNHC 3KUYD 5H37D 3UT9C 2F8ND 3FUTA 1HQCA 3CF6E 2FFJA 2XH9A 2ZY3A 3AZGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A1K A;  3H0M C;  2F2A C;  2G5H C;  3A1I A;  3H0L C;  4WJ3 C;  2DQN C;  2DF4 C;  2G5I C;  3IP4 C;  3AL0 C;  3H0R C;  3KFU G; 
#chains in the Genus database with same CATH topology
 3UTB C;  3AZK B;  4NE3 A;  2NQB B;  1V92 A;  3B0D C;  1DGH B;  1OFI A;  3FTE A;  3KS4 A;  3REK A;  1P3K A;  3LQQ A;  4G6Z A;  3MGQ A;  1KX4 B;  2DWZ B;  4QLC B;  2KDL A;  5B31 D;  4XZQ C;  3SAU A;  3K92 A;  3SBJ A;  3X1T A;  3E21 A;  1XB2 B;  5B2I D;  1DGB A;  3KVW A;  3A1I A;  4H9P B;  1GJS A;  2JY8 A;  2JY6 B;  3REJ D;  3W68 A;  3SMS A;  1XNR M;  4LD9 C;  4NFT A;  5B0Z C;  1P3P B;  3AZN C;  4RNA A;  2RVQ D;  4LGY A;  4NE6 A;  4CGY B;  3MGR B;  2FJ7 A;  1IBM M;  3U6E A;  3KXB A;  1KU5 A;  2JY5 A;  5B33 D;  4CIS A;  5AV5 A;  2YQZ A;  4NRW A;  3AV1 D;  3ZQJ A;  1QZE A;  5ITQ A;  4H9R B;  2E5L M;  4LJ9 A;  3LZ0 D;  3UTA D;  1KYI A;  3D8L A;  2UUC M;  1Q02 A;  2JY7 A;  1F4I A;  2EKF A;  1GO5 A;  3FKE A;  4KHA A;  5JRG A;  1Q3B A;  3W99 B;  3CF2 A;  4JI1 M;  1KX5 A;  3B7N A;  2Y2K A;  1JQJ C;  3GPP A;  4NSO B;  3THG A;  1N32 M;  5AV8 D;  4JV5 M;  1KSF X;  2JA2 A;  3WTP E;  2HKJ A;  5EXP A;  1P3O A;  2CV2 A;  4MB7 A;  3GO8 A;  5B2J A;  3X1S B;  2L4E A;  1AOI D;  1ORY B;  3LVW A;  1EFU B;  4X64 M;  2KEB A;  3HHX A;  4GKJ M;  3H4M A;  3MGP A;  1M1A C;  3REI D;  4IBF A;  1T43 A;  2X8A A;  3AZE B;  3AZM D;  1J7K A;  1XXH A;  5DYI A;  4JI0 M;  3AZF B;  2D7H A;  5EXT A;  4GIP A;  5CP6 D;  3MVD B;  1IM2 A;  2Y0T A;  4IBD A;  1EE8 A;  4D82 A;  4G4N A;  3X1V B;  4LRS A;  1F66 B;  4LF4 M;  3AZI D;  1TDZ A;  4LRT A;  5B40 C;  3H0R C;  3LVV A;  5GT3 A;  4X23 D;  2ZY4 A;  4XUJ A;  3L27 A;  2HHH M;  5KPT A;  4QHS A;  2ARO C;  1P3F B;  2NZD B;  1TAF A;  3X1U C;  5E5A B;  4P17 A;  2C5R A;  3SHF A;  4FWD A;  1DO0 A;  4DV2 M;  1Q39 A;  1P34 A;  3W99 C;  1NVM A;  2C9O A;  3GLI A;  3J2P B;  3TU4 A;  3WAA B;  2XF3 A;  3ZCB B;  4H9N B;  3CTW B;  5B1L B;  5AY8 D;  3B6G D;  2Y2O A;  2QSF X;  3KOX E;  1MJG M;  5AVC C;  1P3L D;  5CPI C;  1U35 C;  3AN2 A;  1JB0 F;  1OJL A;  2CUZ A;  5AV9 C;  1ID3 D;  1P3G B;  3W98 D;  5EP3 A;  5FUG B;  4KUD C;  5ITU A;  4Z66 D;  5BNX B;  1BH9 B;  1WGL A;  2ZAO A;  4IBJ A;  3SYK A;  2GNO A;  3AFA B;  4B3T M;  2FS1 A;  2LXE A;  2DAM A;  2KHH A;  4WU9 A;  4LF5 M;  3WA9 B;  4HGA C;  1XXH E;  4J8X A;  3GLG B;  1K3W A;  1M18 A;  1H3O B;  1M19 B;  2EUC A;  3FE3 A;  5BR8 M;  5FLX S;  3W97 D;  3AYW A;  3D8B A;  1D0L A;  3AV2 A;  3WTP C;  4DR1 M;  3W96 D;  1P3I A;  3AZL A;  1FJG M;  2LTU A;  1ZLA D;  4JI7 M;  5FTN A;  1NJG A;  2UUA M;  1BH8 A;  2DEN A;  4J8V D;  3K2L A;  3REK C;  4PDG A;  1IBK M;  1P3K C;  3TWK A;  3B6F A;  4ZPX A;  4XZQ D;  4YHH M;  3MGQ C;  1HQ3 A;  2QQ8 A;  4AWL B;  3FD9 A;  5EQT A;  2HIO D;  4MGY E;  2PYO A;  2DZL A;  5B1M D;  3L26 A;  3TWM A;  1K3X A;  2X49 A;  2ZM6 M;  3J27 B;  3X1T C;  2ZTC A;  5GSU A;  5CPJ B;  4AG5 A;  1G8P A;  5B24 D;  1JFI A;  3C1C B;  3FUX A;  5B0Y A;  4WU8 B;  5CHL B;  4EIW A;  4R8P D;  2FJ7 C;  2QBY B;  3KXB C;  3A46 A;  4Z2M H;  4LF7 M;  4KLN A;  5AV5 C;  3LZ1 D;  1L2D A;  2CHQ A;  5LMU M;  4PDI A;  3L25 A;  4CAY A;  3GLF A;  3PVS A;  4JI6 M;  1EQZ D;  5EJC A;  2XFT A;  4LZJ A;  2KA6 B;  4WZS B;  3QAU A;  3K1J A;  5JRG C;  3SC3 A;  2R65 A;  2XSZ D;  2DWL A;  2Y2M A;  2UXB M;  3T38 A;  5DNM B;  1E9S A;  4GC9 A;  2L4F A;  4JN6 A;  4LG2 A;  1KX5 C;  3M0E A;  2L2D A;  5C3I B;  4G4O A;  1NNU C;  2UXC M;  3V9R B;  2FH0 A;  3WKJ B;  2QZ4 A;  2F5S A;  2XD1 A;  1Z5C A;  4WNN A;  1GKI A;  1P3A B;  2LVP C;  4H9O B;  1PZR A;  1P3O C;  4AI6 A;  5B2J C;  4IBE A;  2XD5 A;  3F6T A;  3AZK D;  2NQB D;  5GT0 B;  1Q3C A;  3MGS B;  3MGP C;  1W2E A;  1KX4 D;  4IBC A;  2RRU A;  4QLC D;  1QUS A;  1NJF A;  4II7 A;  2BYK A;  4YM6 A;  1JR3 A;  5EXX A;  3I4Y A;  2HUE B;  4Q7J A;  1P3P D;  2LVQ D;  2JZ0 A;  4KT0 F;  5KPR A;  3MGR D;  1HNZ M;  1R4V A;  2OPF A;  3KFU G;  3SAT A;  4FCW A;  2JP7 A;  1P3B B;  5EP1 A;  3GRY A;  3Q8X A;  5AV6 A;  4XUJ C;  4G4R A;  5E6J A;  3GLF E;  2P5T A;  5G49 B;  3MNN A;  1HR0 M;  3LZ1 A;  5KDM A;  2Z4S A;  4H9Q A;  3I4V A;  5GKN A;  3W99 D;  3B6G B;  1P3M B;  3FYD A;  3QYB A;  4MGH A;  3VKG A;  1G4A E;  2EKK A;  3TU4 C;  1OIZ A;  3P5J B;  1HTA A;  2OQ4 A;  2BJV A;  1SXJ B;  3PFI A;  4AZF A;  1NNJ A;  3R45 A;  4QNM A;  2M60 A;  1TH3 A;  3RFW A;  2J7O A;  3AN2 C;  3X1S D;  3LJA A;  2X4A A;  4HL4 A;  4DR2 M;  3HU2 A;  3J7B A;  3HU3 A;  4LJ4 A;  2JWS A;  4UPK A;  3T1H M;  2DWN A;  5GT0 C;  2LVA A;  2L6O A;  3HKP A;  3UT9 B;  3AZE D;  1VG5 A;  4LFA M;  5B32 A;  5BNV A;  1DGH A;  4JXJ A;  2V1U A;  3UTB B;  2Y2P A;  3AZF D;  3ILK A;  4J8X C;  1VEK A;  3C9P A;  3B0D B;  1M18 C;  3MVD D;  3NQJ B;  5GXQ A;  4IBK A;  3AYW C;  4OVZ B;  3L2A A;  1IXR C;  3AV2 C;  2JXN A;  2O5R A;  3X1V D;  3FTC A;  3KWQ A;  1P3I C;  3AZL C;  4F1I A;  2DHR A;  2F5Q A;  1IY0 A;  4J8W A;  2R44 A;  3U5Z A;  3A45 A;  2Z8Y M;  1ZAE A;  2KRU A;  4EO5 C;  3AZH A;  3B6F C;  4LD9 B;  5B0Z B;  5KO3 A;  1TTE A;  3AZN B;  1HNW M;  1NY6 A;  1P3F D;  1TZY A;  4Z5T A;  1PJQ A;  1GL7 A;  2NZD D;  2PYO C;  4J8U A;  5E5A D;  1EIJ A;  3QYE A;  3C1B A;  2JNH A;  5GSU C;  2KW0 A;  1UM8 A;  1Z59 A;  4BB9 A;  3VH6 T;  2ZTD A;  5B0Y C;  5F99 A;  5AVB A;  3E4R A;  4JYA M;  1UFZ A;  3WAA D;  5B1L D;  2EJS A;  2NQ8 C;  3K8Z A;  1IXS A;  4UUZ A;  1KX3 A;  5BS7 A;  1YE9 A;  1P3G D;  5DNN A;  4CHT B;  4DR4 M;  4OU7 A;  2L09 A;  2L7H A;  1L2C A;  3AFA D;  3HJ8 A;  2DNA A;  4AKG A;  3WA9 D;  4MGZ E;  1J5E M;  3U6Q A;  4YS3 B;  1M19 D;  1WGN A;  1M1A B;  4DBG B;  2VII A;  4KGC A;  1LV7 A;  3SAR A;  3REL A;  1S32 A;  3EIH A;  4LF9 M;  2CV5 A;  3NQU B;  3FTD A;  2XZU A;  2IO5 C;  4MH0 E;  5CPK A;  2OOA A;  4RF0 A;  4DR3 M;  2C98 A;  1F66 A;  3A98 B;  3E46 A;  1BVS A;  1E32 A;  1ZMW A;  2FFF B;  3VH5 A;  4IBI A;  3GLH A;  1N1J B;  4M9X A;  4YM6 C;  5KQ8 A;  5B40 B;  1VEJ A;  3AZJ A;  4A3V B;  1QUT A;  1TGU A;  4DV0 M;  5CPJ D;  3C1C D;  2ARO B;  1YLA A;  2O25 A;  4WU8 D;  3FRH A;  3X1U B;  3O62 A;  3A6N C;  3TE6 A;  1DV0 A;  2ZY2 A;  3ZC7 B;  1VQ1 A;  1YSY A;  3MNN C;  2Q2E B;  1I4W A;  4AQY M;  1IN7 A;  3A1K A;  4X62 M;  3SMP A;  2DZN B;  5AVC B;  4ZUX A;  5CPI B;  1U35 B;  3RE8 A;  5DNM D;  5AV9 B;  4DUZ M;  4JJN A;  4KUD B;  2G8L A;  2Z7J A;  3REH A;  3LEL A;  2ZY5 A;  2KZS A;  1PJJ A;  3LQR A;  3WKJ D;  5JA4 B;  4YS3 C;  1P3A D;  4GC5 A;  3U6O A;  3KUY A;  2F8N A;  3U60 A;  4CSR B;  3AZG A;  4HGA B;  3LJA C;  3HX3 A;  4DR6 M;  2YFW A;  2Y2L A;  4QOS A;  5GT0 D;  3K9P A;  3MGS D;  3EPJ A;  4G92 C;  2BYM B;  1QDR A;  5JI2 E;  4KO8 A;  3WTP B;  3HJS A;  4Y28 F;  4JI3 M;  5B31 A;  5B32 C;  3GLH E;  4DUY M;  4MGI E;  5B2I A;  1QQW A;  2Y2N A;  3REK B;  5GXQ C;  1P3K B;  1D2N A;  3REJ A;  2K9D A;  3DA1 A;  3MGQ B;  3VH6 A;  4Z8X A;  1MX0 A;  3BOS A;  3KWQ C;  2RGO A;  2ZAN A;  2Y2Q A;  1R6B X;  1VDL A;  1K82 A;  3U6M A;  5B33 A;  1D0K A;  2JZ1 A;  2WSC F;  4J8W C;  3X1T B;  1P3B D;  3AV1 A;  2VQR A;  4IIW A;  2DF4 C;  3LZ0 A;  3UTA A;  3AZH C;  2KXE A;  1TZY C;  4Z5T C;  2FJ7 B;  4J8U C;  3KXB B;  3KOY E;  2F2A C;  4MM3 B;  5AV5 B;  1L8Q A;  2G5I C;  4AKI A;  1P3M D;  2EA0 A;  3NBX X;  1VDD A;  2CV0 A;  2BG1 A;  3HU1 A;  5F99 C;  5AVB C;  4MGK E;  3PNY A;  1QDT A;  5C18 A;  3E9S A;  4KHA B;  5AV8 A;  5JRG B;  2H1R A;  3AKZ A;  1SXJ D;  4B7G A;  1ZMV A;  1KX3 C;  2KNV A;  1KX5 B;  4WJ3 C;  2CV1 A;  1AOI A;  1DGG A;  1NV9 A;  4UN2 B;  1HT1 E;  5DNN C;  3REI A;  1XHB A;  2JUJ A;  1QAQ A;  3UT9 D;  1P3O B;  1J09 A;  3GPU A;  3U61 A;  3AZM A;  5B2J B;  3VFD A;  3UTB D;  4JI5 M;  5CP6 A;  3MGP B;  4DRB A;  3AV0 A;  4KGC C;  2HWJ A;  4L8R C;  3B89 A;  1NHG C;  4FWG A;  3REL C;  3U6D A;  1S32 C;  4IBB A;  3U6C A;  3AZI A;  5IRE B;  2RGH A;  1XXH B;  2CV5 C;  4LJ5 A;  3C3D A;  1IY2 A;  1Q9C A;  2VDB B;  5FTK A;  5CPK C;  1PJT A;  3EPL A;  1IQP A;  4X23 A;  2C99 A;  4LD9 D;  5B0Z D;  2Y0Q A;  1MN3 A;  3AZN D;  4HLQ A;  3LW5 F;  3EG5 B;  3AZJ C;  4BLC A;  3HGI A;  3TL4 X;  5GT3 B;  4R71 A;  2MJ5 B;  1R2Y A;  4LY6 A;  3EPH A;  4XUJ B;  2GQF A;  3K9O A;  4FD2 A;  3A6N D;  1IFY A;  1TAF B;  3C58 A;  2MH8 A;  3O62 C;  1L1T A;  2DHY A;  3U6L A;  5AY8 A;  4L78 A;  3B6G A;  3J7A S;  2YNM D;  2K6B A;  1P3L A;  2ZM5 A;  1P34 B;  1ID3 A;  3I51 A;  3W98 A;  3GPY A;  3GRV A;  4Z66 A;  5BO0 A;  5ITY A;  2MRO B;  3GLI B;  3TU4 B;  1TF0 B;  2J5Y A;  2Y2J A;  4B3S M;  1R2Z A;  2DVW B;  2XEP A;  2J8P A;  1F1E A;  1N36 M;  4GHA A;  2YFV A;  3NWL A;  4ZUX C;  3AN2 B;  1B67 A;  1OKS A;  1HT2 E;  4IJE A;  4LFC M;  1DGF A;  3FRI A;  1E9R A;  4JJN C;  4B3R M;  2LVO C;  2KRK A;  3AOG A;  4YS3 D;  3REH C;  3LEL C;  3FYC A;  1KFV A;  3W97 A;  2LHC A;  1M1A D;  2CRU A;  3W96 A;  2ERC A;  1ZLA A;  3AZG C;  4WV4 B;  3GQ4 A;  4J8X B;  1M18 B;  4BBA A;  2DAK A;  5IT9 S;  4J8V A;  2CFO A;  1TH4 A;  4CJ6 A;  3AYW B;  4ANR A;  4XZQ A;  3AV2 B;  5BT1 C;  2JCH A;  4FVM A;  1P3I B;  3AZL B;  2HIO A;  3PXG A;  5B31 C;  3WHL A;  3V76 A;  3FTF A;  5B1M A;  4JI8 M;  1OQY A;  1BH8 B;  5B40 D;  2DAI A;  4NE5 A;  5B2I C;  3T1Y M;  1AIP C;  2VQF M;  3U6P A;  4EO5 B;  3REJ C;  3B6F B;  5B24 A;  3LCV B;  1GAB A;  1BFM A;  1HQ3 B;  5GT3 C;  2RVQ C;  2ARO D;  1NY5 A;  3SFZ A;  4G4Q A;  2PYO B;  3X1U D;  4R8P A;  1CUK A;  2CE7 A;  1L2B A;  5B33 C;  2F5P A;  4RF1 A;  3UK6 A;  3AV1 C;  3VH5 T;  5GSU B;  3LZ0 C;  1QAM A;  3FUU A;  3WHK A;  3UTA C;  1PJI A;  4LZZ A;  2MGW A;  2QNJ A;  1JFI B;  3VKH A;  5B0Y B;  1EQZ A;  4HEO A;  1P34 C;  2CEA A;  3M6A A;  4LJA A;  1QZM A;  2Y2G A;  2WSE F;  2G5G X;  2XSZ A;  3UGJ A;  5AVC D;  5CPI D;  1U35 D;  1MU5 A;  4CAY B;  4H9S A;  5AV9 D;  3GLF B;  1FNN A;  4GH9 A;  4REZ A;  1PJS A;  4KUD D;  2XGN A;  1IN4 A;  3SAV A;  3JR4 A;  2CWB A;  3W0L B;  4GKK M;  3AZK A;  1AOI C;  4LJ6 A;  4WU9 C;  3W0F A;  2NQB A;  1ZMU A;  2V1C A;  4K0K M;  4QHT A;  4GMQ A;  1KX4 A;  3REI C;  4FW9 A;  3WTP D;  4IBG A;  4WNN B;  3J81 S;  3LCU A;  4QLC A;  3AZM C;  3AL0 C;  2LBC A;  3FUW A;  2IO5 B;  2M5Z A;  2RIQ A;  2F5O A;  4H9P A;  3REK D;  2YFQ A;  1R7R A;  3HHZ A;  1P3K D;  1V34 A;  1IN6 A;  3MGQ D;  1P3P A;  4DV3 M;  5L8R F;  4LF8 M;  3HJQ A;  3MGR A;  2BYK B;  3AZI C;  1HQ3 C;  4YM6 B;  1T6O A;  1G41 A;  3MHV C;  3X1T D;  5DFL A;  1PM5 A;  2APL A;  4H9R A;  4X23 C;  4ITQ A;  2I7N A;  1TDH A;  3Q8G A;  1IBL M;  4WUR A;  2FJ7 D;  3KXB D;  3A6N B;  3SAW A;  1W5T A;  5AV5 D;  2V6Z M;  1A5T A;  3AOE A;  3ZH9 B;  3W99 A;  4QNR A;  3KXE C;  3KOZ E;  1OTR A;  2KZU A;  3MNN B;  4P16 A;  8CAT A;  3VDU A;  2DAG A;  3T6P A;  5KDM B;  1HQY E;  4GHL A;  5B32 G;  4E44 A;  5FSW A;  5JRG D;  4XK8 F;  4H9Q B;  5AY8 C;  2R6F A;  4E45 A;  3VK7 A;  2WSF F;  4LFB M;  3IEC A;  3IHP A;  1P3L C;  1WXQ A;  2D7E A;  3X1S A;  4G3O A;  1KX5 D;  3BXW A;  3W98 C;  1ZV1 A;  4Z66 C;  1C1K A;  5IZ7 D;  3I04 M;  3GPX A;  4Z2M G;  1WJ7 A;  2C96 A;  2Z3X A;  4M0W A;  2F5N A;  3KS8 A;  3R45 B;  3AZE A;  1P3O D;  4M0D A;  4IJF A;  5B2J D;  4JI4 M;  1QYR A;  3LJA B;  3AZF A;  2OOB A;  1NSF A;  2Y2I A;  5LMN M;  3MVD A;  4ZBJ C;  4NXM M;  3IG8 A;  2G5H C;  4G92 B;  3MGP D;  3W97 C;  2JE5 A;  3KW6 A;  3FDD A;  3W96 C;  3X1V A;  4L4U A;  3KSJ A;  5B32 B;  5BNV B;  1ZLA C;  2YR0 A;  1QAN A;  2W8S A;  1IY1 A;  1I94 M;  5BT1 D;  4J8V C;  5GXQ B;  3AJI B;  1G3I A;  3L28 A;  4D81 A;  1QAO A;  3KWQ B;  1P3F A;  2ZBK B;  2NZD A;  2HIO C;  1N75 A;  1GL6 A;  5B1M C;  5E5A A;  3KSY A;  5BPV A;  1N78 A;  1WWI A;  4J8W B;  4L16 A;  3U5Z B;  3MMP A;  5GT3 D;  3AZH B;  3J80 S;  4XUJ D;  5B24 C;  3L29 A;  3HHY A;  1TZY B;  4Z5T B;  5AV6 C;  1N77 A;  2CHG A;  4J8U B;  4R8P C;  3WAA A;  1R4G A;  4R7G A;  4H9N A;  5B1L A;  3PNV A;  3LZ1 C;  5E26 A;  3EPK A;  3C1B B;  2R46 A;  2L7I A;  1Z2C B;  1P34 D;  1P3G A;  4G91 C;  5FUG A;  5F99 B;  5AVB B;  1EQZ C;  2HCB A;  4NSR A;  5BNX A;  3TU4 D;  1BH9 A;  1QVR A;  1H6U A;  3RGP A;  3AFA A;  2WZJ A;  4CIZ A;  2DKL A;  3WA9 A;  3SYL A;  2F4V M;  1IXS B;  4UUZ B;  1ULY A;  3AN2 D;  1KX3 B;  4H9S C;  5DYG A;  5DNN B;  4DV4 M;  3GLG A;  1H3O A;  1N33 M;  1M19 A;  5KPZ A;  3I01 M;  1N34 M;  4WU9 D;  1Z6T A;  4DRA A;  4F2L A;  4LJ7 A;  3VH5 W;  3AZK C;  1Z5A A;  4J8X D;  4M6B A;  2NQB C;  1M18 D;  4FCT A;  3OTO M;  2DWM A;  4L6V 6;  5C1B A;  2L5A A;  5EXS A;  4LF6 M;  3AYW D;  1NV8 A;  3AV2 D;  1KX4 C;  4KGC B;  4QLC C;  3REL B;  3AZL D;  1P3I D;  1S32 B;  2KNA A;  2C9C A;  2CV5 B;  3GQ3 A;  2DI0 A;  3H4J A;  3AFH A;  1C7Y A;  1DO2 A;  5CPK B;  2UXD M;  5CPJ A;  4L15 A;  1XC8 A;  3B6F D;  4M9S A;  1HQ3 D;  3JR5 A;  3C1C A;  1P3P C;  4WU8 A;  2PYO D;  3MGR C;  1B6W A;  3GLH B;  5ITR A;  2QBY A;  3AZJ B;  3MJ5 A;  3HY5 A;  3H0M C;  1XWI A;  1Y8G A;  5GSU D;  1XMO M;  4GIT A;  1NHW C;  3C1B C;  2DZO B;  5B0Y D;  4YY3 M;  1IXZ A;  2F8N G;  3C3E A;  1G59 A;  3O62 B;  3TQS A;  3B0B A;  4GEW A;  1OFH A;  5EP2 A;  4NC6 A;  3AOE C;  3SHG B;  5FTL A;  5DNM A;  4AKH A;  2OO9 A;  3GLG E;  2R0I A;  5BS7 C;  5B31 G;  3V9R A;  4JI2 M;  3WKJ A;  2BJW A;  4B08 A;  2Y2H A;  2KNZ A;  3IG5 A;  1P3A A;  4H9O A;  4ZUX B;  2R62 A;  2R18 A;  3X1S C;  1GVN A;  4JJN B;  3RGS A;  3REH B;  3LEL B;  5GT0 A;  4NL4 H;  3MGS A;  3B0C T;  4I5S A;  3GRU A;  2QPA A;  3UZU A;  4DR7 M;  3KUY B;  2BWE A;  3VH6 W;  2F8N B;  3AZE C;  2EO2 A;  3U60 B;  3AZG B;  2DQN C;  3KP1 E;  3AZF C;  7CAT A;  2YFW B;  3MVD C;  3U6S A;  1XNQ M;  3X1V C;  1RU3 A;  3LMM A;  4AW4 A;  5B31 B;  1F66 C;  4FWH A;  4YM6 D;  1JR3 D;  2LVN C;  3BBZ A;  2B3T A;  1P3B A;  5B2I B;  2K0B X;  2JSS A;  3REJ B;  1TH2 A;  1P3Q Q;  3DOA A;  3KOW E;  1P3F C;  2FNA A;  4B3M M;  5G49 A;  2RKO A;  2NZD C;  2LHG A;  4W5W A;  2LY8 A;  2H5X A;  5E5A C;  4DQY B;  5B33 B;  2FOI C;  4R3D A;  3AV1 B;  1HJP A;  3NBI A;  5A2Q S;  3LZ0 B;  3TWL A;  3UTA B;  5AV6 D;  3FUV A;  1P3M A;  3GLI E;  4NXN M;  3H0L C;  3MNN D;  4AG6 A;  2F8N K;  3B74 A;  1YUB A;  3WAA C;  3TPZ A;  4LJ8 A;  1L1Z A;  1GJT A;  4GRI A;  5B1L C;  3M7G A;  2CWE A;  1SXJ A;  3HHW A;  3UMM A;  2I7P A;  1P3G C;  2ZAM A;  1TR8 A;  2AHM A;  2D7G A;  2VQE M;  5AV8 B;  4KOD A;  3DZD A;  3AFA C;  1R5L A;  3T15 A;  1T3T A;  3VLF B;  3UT9 A;  3WA9 C;  4DV7 M;  3LJA D;  3UTB A;  1AOI B;  4WU9 B;  3KUY C;  5FTJ A;  1M19 C;  3NQJ A;  1VEG A;  2VF7 A;  4OVZ A;  3KDS E;  3REI B;  1NO1 A;  3QWL A;  4TUW A;  3MK6 A;  5IWA M;  1OIP A;  5F3W A;  2G3Q A;  3U61 B;  3AZM B;  4KHP M;  5B32 D;  5CP6 B;  1W5S A;  5GXQ D;  4LD9 A;  5B0Z A;  4X65 M;  3AZN A;  4I4L A;  4AWL C;  3KWQ D;  1IN5 A;  1OAI A;  3AZI B;  4XGI A;  2VF8 A;  2W82 A;  4PD2 A;  4J8W D;  2LWX A;  4X23 B;  5CPJ C;  3AZH D;  3B9P A;  2LH0 A;  3B7Q A;  3C1C C;  1E94 E;  1IN8 A;  3A6N A;  1TZY D;  4WU8 C;  4Z5T D;  4X66 M;  4J8U D;  1PRB A;  4PCZ A;  1LTM A;  2Z4R A;  3C1B D;  1SXJ E;  2UWX A;  1PGY A;  4OX9 M;  1X37 A;  2N35 A;  5F99 D;  5AVB D;  2UUB M;  1D0M A;  2CP8 A;  2BWB A;  5AY8 B;  4OW0 A;  3HZJ A;  4DR5 M;  1OAO C;  5JI3 E;  1Z5B A;  1WIV A;  2QCU A;  2HL7 A;  1P3L B;  5AV8 C;  5ITT A;  4LCB A;  2R4E A;  5DNM C;  1KX3 D;  2XLJ A;  1ID3 B;  4S12 A;  3W98 B;  4NRV A;  2R4J A;  5DNN D;  4Z66 B;  5BO0 B;  3R9X B;  3DFZ A;  5C3I C;  3A42 A;  4YS3 A;  1M1A A;  3WKJ C;  2HAK A;  3F92 A;  2YFV B;  4M9Z A;  1P3A C;  4I81 A;  1HNX M;  5ITX A;  3GQ5 A;  3NQU A;  4XBO A;  4ZBJ B;  2UU9 M;  1WHC A;  3W97 B;  3MGS C;  2DXI A;  4B7F A;  5CP6 C;  4KGC D;  3W96 B;  3R8F A;  3JAM S;  4DV6 M;  4I8O A;  1JR3 E;  3REL D;  4WW0 A;  1S32 D;  1ZLA B;  4NOO B;  1N1J A;  2CV5 D;  2DAE A;  5B40 A;  4PT5 A;  4J8V B;  5CPK D;  3SAS A;  1WR1 B;  3W67 A;  2HUE C;  4RKU F;  1F66 D;  1S3S A;  4XZQ B;  2F8N H;  3GRR A;  2ARO A;  2Y21 A;  2HIO B;  3X1U A;  5B1M B;  1XMQ M;  1T3U A;  1A7W A;  4D80 A;  3AZJ D;  1P3B C;  2BNK A;  3IP4 C;  4LGM A;  5B24 B;  4DV5 M;  4FCV A;  1AUA A;  2A5Y B;  3B0C W;  3CGW A;  2XFS A;  5AV6 B;  3VK8 A;  2QHO B;  4R8P B;  3O62 D;  3B7Z A;  2XZF A;  2FE8 A;  4DV1 M;  3EIE A;  3LZ1 B;  4WP2 A;  2QEN A;  5AVC A;  1V33 A;  3KP0 E;  5CPI A;  1U35 A;  2Y20 A;  3B6G C;  3CF0 A;  5AV9 A;  1P3M C;  4G91 B;  1WWS A;  3KSX A;  1EQZ B;  4KUD A;  3HWS A;  4QOZ C;  1SG9 A;  5EP4 A;  1ID3 C;  1GLN A;  2O01 F;  4Z6Y A;  2QP9 X;  2MR9 A;  5JA4 A;  5FTM A;  1SXJ C;  2K47 A;  3VDP A;  3UJN A;  4ZUX D;  1G71 A;  4CSR A;  5KQD A;  5ITX E;  5DNY A;  3GP1 A;  4JJN D;  3REH D;  3LEL D;  4B7H A;  2J7N A;  2BYM A;  2R45 A;  2CHV A;  3WTP A;  1ZQ9 A;  2LNH C;  3KUY D;  5H37 D;  3UT9 C;  2F8N D;  3FUT A;  1HQC A;  3CF6 E;  2FFJ A;  2XH9 A;  2ZY3 A;  3AZG D; 
#chains in the Genus database with same CATH homology
 3UTB C;  3AZK B;  4NE3 A;  2NQB B;  3B0D C;  1DGH B;  1OFI A;  3FTE A;  3KS4 A;  3REK A;  1P3K A;  3LQQ A;  4G6Z A;  3MGQ A;  1KX4 B;  2DWZ B;  4QLC B;  5B31 D;  4XZQ C;  3SAU A;  3K92 A;  3SBJ A;  3X1T A;  5B2I D;  1DGB A;  3KVW A;  3A1I A;  4H9P B;  3REJ D;  3SMS A;  1XNR M;  4LD9 C;  4NFT A;  5B0Z C;  1P3P B;  3AZN C;  4RNA A;  2RVQ D;  4LGY A;  4NE6 A;  4CGY B;  3MGR B;  2FJ7 A;  1IBM M;  3U6E A;  3KXB A;  1KU5 A;  5B33 D;  4CIS A;  5AV5 A;  2YQZ A;  4NRW A;  3AV1 D;  5ITQ A;  4H9R B;  2E5L M;  4LJ9 A;  3LZ0 D;  3UTA D;  1KYI A;  3D8L A;  2UUC M;  3FKE A;  4KHA A;  5JRG A;  1Q3B A;  3W99 B;  3CF2 A;  4JI1 M;  1KX5 A;  2Y2K A;  1JQJ C;  3GPP A;  4NSO B;  3THG A;  1N32 M;  5AV8 D;  4JV5 M;  1KSF X;  2JA2 A;  3WTP E;  2HKJ A;  5EXP A;  1P3O A;  2CV2 A;  4MB7 A;  3GO8 A;  5B2J A;  3X1S B;  1AOI D;  1ORY B;  3LVW A;  4X64 M;  2KEB A;  3HHX A;  4GKJ M;  3H4M A;  3MGP A;  1M1A C;  3REI D;  4IBF A;  2X8A A;  3AZE B;  3AZM D;  1J7K A;  1XXH A;  5DYI A;  4JI0 M;  3AZF B;  2D7H A;  5EXT A;  4GIP A;  5CP6 D;  3MVD B;  1IM2 A;  2Y0T A;  4IBD A;  1EE8 A;  4D82 A;  4G4N A;  3X1V B;  4LRS A;  1F66 B;  4LF4 M;  3AZI D;  1TDZ A;  4LRT A;  5B40 C;  3H0R C;  3LVV A;  5GT3 A;  4X23 D;  2ZY4 A;  4XUJ A;  3L27 A;  2HHH M;  5KPT A;  4QHS A;  2ARO C;  1P3F B;  2NZD B;  1TAF A;  3X1U C;  5E5A B;  2C5R A;  3SHF A;  4FWD A;  1DO0 A;  4DV2 M;  1Q39 A;  1P34 A;  3W99 C;  1NVM A;  2C9O A;  3GLI A;  3J2P B;  3TU4 A;  3WAA B;  2XF3 A;  3ZCB B;  4H9N B;  3CTW B;  5B1L B;  5AY8 D;  3B6G D;  2Y2O A;  3KOX E;  5AVC C;  1P3L D;  5CPI C;  1U35 C;  3AN2 A;  1OJL A;  2CUZ A;  5AV9 C;  1ID3 D;  1P3G B;  3W98 D;  5EP3 A;  5FUG B;  4KUD C;  5ITU A;  4Z66 D;  5BNX B;  1BH9 B;  2ZAO A;  4IBJ A;  3SYK A;  3AFA B;  4B3T M;  2LXE A;  4WU9 A;  4LF5 M;  3WA9 B;  4HGA C;  4J8X A;  3GLG B;  1K3W A;  1M18 A;  1H3O B;  1M19 B;  2EUC A;  5BR8 M;  5FLX S;  3W97 D;  3AYW A;  3D8B A;  3AV2 A;  3WTP C;  4DR1 M;  3W96 D;  1P3I A;  3AZL A;  1FJG M;  1ZLA D;  4JI7 M;  5FTN A;  1NJG A;  2UUA M;  1BH8 A;  4J8V D;  3K2L A;  3REK C;  4PDG A;  1IBK M;  1P3K C;  3TWK A;  3B6F A;  4ZPX A;  4XZQ D;  4YHH M;  3MGQ C;  1HQ3 A;  4AWL B;  3FD9 A;  5EQT A;  2HIO D;  4MGY E;  2PYO A;  5B1M D;  3L26 A;  3TWM A;  1K3X A;  2X49 A;  2ZM6 M;  3J27 B;  3X1T C;  5GSU A;  5CPJ B;  4AG5 A;  1G8P A;  5B24 D;  1JFI A;  3C1C B;  3FUX A;  5B0Y A;  4WU8 B;  5CHL B;  4EIW A;  4R8P D;  2FJ7 C;  2QBY B;  3KXB C;  3A46 A;  4Z2M H;  4LF7 M;  4KLN A;  5AV5 C;  3LZ1 D;  1L2D A;  2CHQ A;  5LMU M;  4PDI A;  3L25 A;  4CAY A;  3GLF A;  3PVS A;  4JI6 M;  1EQZ D;  5EJC A;  2XFT A;  4LZJ A;  2KA6 B;  4WZS B;  3QAU A;  3K1J A;  5JRG C;  3SC3 A;  2R65 A;  2XSZ D;  2DWL A;  2Y2M A;  2UXB M;  3T38 A;  5DNM B;  1E9S A;  4GC9 A;  4LG2 A;  4JN6 A;  1KX5 C;  3M0E A;  5C3I B;  4G4O A;  1NNU C;  2UXC M;  3V9R B;  3WKJ B;  2QZ4 A;  2F5S A;  2XD1 A;  1Z5C A;  4WNN A;  1GKI A;  1P3A B;  4H9O B;  1PZR A;  1P3O C;  4AI6 A;  5B2J C;  4IBE A;  2XD5 A;  3F6T A;  3AZK D;  2NQB D;  5GT0 B;  1Q3C A;  3MGS B;  3MGP C;  1W2E A;  1KX4 D;  4IBC A;  4QLC D;  4II7 A;  1NJF A;  2BYK A;  4YM6 A;  1JR3 A;  5EXX A;  3I4Y A;  2HUE B;  1P3P D;  5KPR A;  3MGR D;  1HNZ M;  1R4V A;  2OPF A;  3KFU G;  3SAT A;  4FCW A;  1P3B B;  5EP1 A;  3GRY A;  3Q8X A;  5AV6 A;  4XUJ C;  4G4R A;  5E6J A;  2P5T A;  5G49 B;  3MNN A;  1HR0 M;  3LZ1 A;  5KDM A;  2Z4S A;  4H9Q A;  3I4V A;  5GKN A;  3W99 D;  3B6G B;  1P3M B;  3FYD A;  4MGH A;  3VKG A;  1G4A E;  3TU4 C;  3P5J B;  1HTA A;  2OQ4 A;  2BJV A;  1SXJ B;  3PFI A;  4AZF A;  1NNJ A;  3R45 A;  4QNM A;  2M60 A;  1TH3 A;  3RFW A;  2J7O A;  3AN2 C;  3X1S D;  3LJA A;  2X4A A;  4HL4 A;  4DR2 M;  3HU2 A;  3J7B A;  3HU3 A;  4LJ4 A;  4UPK A;  3T1H M;  2DWN A;  5GT0 C;  2L6O A;  3HKP A;  3UT9 B;  3AZE D;  4LFA M;  5B32 A;  5BNV A;  1DGH A;  4JXJ A;  2V1U A;  3UTB B;  2Y2P A;  3AZF D;  3ILK A;  4J8X C;  3B0D B;  1M18 C;  3MVD D;  3NQJ B;  5GXQ A;  4IBK A;  3AYW C;  4OVZ B;  3L2A A;  1IXR C;  3AV2 C;  2O5R A;  3X1V D;  3FTC A;  3KWQ A;  1P3I C;  3AZL C;  2DHR A;  2F5Q A;  1IY0 A;  4J8W A;  3U5Z A;  3A45 A;  1ZAE A;  2KRU A;  4EO5 C;  3AZH A;  3B6F C;  4LD9 B;  5B0Z B;  5KO3 A;  3AZN B;  1HNW M;  1NY6 A;  1P3F D;  1TZY A;  4Z5T A;  1GL7 A;  2NZD D;  2PYO C;  4J8U A;  5E5A D;  3C1B A;  5GSU C;  2KW0 A;  1UM8 A;  1Z59 A;  4BB9 A;  3VH6 T;  5B0Y C;  5F99 A;  5AVB A;  3E4R A;  4JYA M;  3WAA D;  5B1L D;  2NQ8 C;  3K8Z A;  4UUZ A;  1KX3 A;  5BS7 A;  1YE9 A;  1P3G D;  5DNN A;  4CHT B;  4DR4 M;  4OU7 A;  2L09 A;  2L7H A;  1L2C A;  3AFA D;  3HJ8 A;  4AKG A;  3WA9 D;  4MGZ E;  1J5E M;  3U6Q A;  4YS3 B;  1M19 D;  1M1A B;  2VII A;  4KGC A;  1LV7 A;  3SAR A;  3REL A;  1S32 A;  3EIH A;  4LF9 M;  2CV5 A;  3NQU B;  3FTD A;  2XZU A;  2IO5 C;  4MH0 E;  5CPK A;  4RF0 A;  4DR3 M;  2C98 A;  1F66 A;  3A98 B;  1E32 A;  2FFF B;  3VH5 A;  4IBI A;  3GLH A;  1N1J B;  4M9X A;  4YM6 C;  5KQ8 A;  5B40 B;  3AZJ A;  4A3V B;  1TGU A;  4DV0 M;  5CPJ D;  3C1C D;  2ARO B;  4WU8 D;  3X1U B;  3O62 A;  3A6N C;  3TE6 A;  2ZY2 A;  3ZC7 B;  1YSY A;  3MNN C;  2Q2E B;  1I4W A;  4AQY M;  1IN7 A;  3A1K A;  4X62 M;  3SMP A;  2DZN B;  5AVC B;  4ZUX A;  5CPI B;  1U35 B;  3RE8 A;  5DNM D;  5AV9 B;  4DUZ M;  4JJN A;  4KUD B;  2G8L A;  2Z7J A;  3REH A;  3LEL A;  2ZY5 A;  2KZS A;  1PJJ A;  3LQR A;  3WKJ D;  5JA4 B;  4YS3 C;  1P3A D;  4GC5 A;  3U6O A;  3KUY A;  2F8N A;  3U60 A;  4CSR B;  3AZG A;  4HGA B;  3LJA C;  4DR6 M;  2YFW A;  2Y2L A;  4QOS A;  5GT0 D;  3MGS D;  3EPJ A;  4G92 C;  2BYM B;  5JI2 E;  4KO8 A;  3WTP B;  3HJS A;  4JI3 M;  5B31 A;  5B32 C;  4DUY M;  4MGI E;  5B2I A;  1QQW A;  2Y2N A;  3REK B;  5GXQ C;  1P3K B;  1D2N A;  3REJ A;  3DA1 A;  3MGQ B;  3VH6 A;  4Z8X A;  1MX0 A;  3BOS A;  3KWQ C;  2RGO A;  2ZAN A;  2Y2Q A;  1R6B X;  1K82 A;  3U6M A;  5B33 A;  3X1T B;  4J8W C;  1P3B D;  3AV1 A;  2VQR A;  4IIW A;  2DF4 C;  3LZ0 A;  3UTA A;  3AZH C;  2KXE A;  1TZY C;  4Z5T C;  2FJ7 B;  4J8U C;  3KXB B;  3KOY E;  2F2A C;  4MM3 B;  5AV5 B;  1L8Q A;  2G5I C;  4AKI A;  1P3M D;  2EA0 A;  1VDD A;  2CV0 A;  2BG1 A;  3HU1 A;  5F99 C;  5AVB C;  4MGK E;  3PNY A;  5C18 A;  3E9S A;  4KHA B;  5AV8 A;  5JRG B;  2H1R A;  3AKZ A;  1SXJ D;  4B7G A;  1KX3 C;  1KX5 B;  4WJ3 C;  2CV1 A;  1AOI A;  1DGG A;  1HT1 E;  5DNN C;  3REI A;  1XHB A;  1QAQ A;  3UT9 D;  1P3O B;  1J09 A;  3GPU A;  3U61 A;  3AZM A;  5B2J B;  3VFD A;  3UTB D;  4JI5 M;  5CP6 A;  3MGP B;  4DRB A;  3AV0 A;  4KGC C;  4L8R C;  1NHG C;  4FWG A;  3REL C;  3U6D A;  1S32 C;  4IBB A;  3U6C A;  3AZI A;  5IRE B;  2RGH A;  1XXH B;  2CV5 C;  4LJ5 A;  1IY2 A;  1Q9C A;  5FTK A;  5CPK C;  3EPL A;  1IQP A;  4X23 A;  2C99 A;  4LD9 D;  5B0Z D;  2Y0Q A;  3AZN D;  4HLQ A;  3EG5 B;  3AZJ C;  4BLC A;  3HGI A;  3TL4 X;  5GT3 B;  1R2Y A;  4LY6 A;  3EPH A;  4XUJ B;  4FD2 A;  3A6N D;  1TAF B;  3C58 A;  3O62 C;  1L1T A;  3U6L A;  5AY8 A;  4L78 A;  3B6G A;  3J7A S;  2YNM D;  1P3L A;  2ZM5 A;  1P34 B;  1ID3 A;  3I51 A;  3W98 A;  3GPY A;  3GRV A;  4Z66 A;  5BO0 A;  5ITY A;  3GLI B;  3TU4 B;  2Y2J A;  4B3S M;  1R2Z A;  2DVW B;  2XEP A;  2J8P A;  1F1E A;  1N36 M;  4GHA A;  2YFV A;  3NWL A;  4ZUX C;  3AN2 B;  1B67 A;  1HT2 E;  4IJE A;  4LFC M;  1DGF A;  1E9R A;  4JJN C;  4B3R M;  3AOG A;  2KRK A;  3REH C;  4YS3 D;  3LEL C;  3FYC A;  1KFV A;  3W97 A;  1M1A D;  3W96 A;  2ERC A;  1ZLA A;  3AZG C;  4WV4 B;  3GQ4 A;  4J8X B;  1M18 B;  4BBA A;  5IT9 S;  4J8V A;  2CFO A;  1TH4 A;  3AYW B;  4XZQ A;  3AV2 B;  5BT1 C;  2JCH A;  4FVM A;  1P3I B;  3AZL B;  2HIO A;  3PXG A;  5B31 C;  3WHL A;  3FTF A;  5B1M A;  4JI8 M;  1BH8 B;  5B40 D;  4NE5 A;  5B2I C;  3T1Y M;  2VQF M;  3U6P A;  4EO5 B;  3REJ C;  3B6F B;  5B24 A;  1BFM A;  1HQ3 B;  5GT3 C;  2RVQ C;  2ARO D;  1NY5 A;  3SFZ A;  4G4Q A;  2PYO B;  3X1U D;  4R8P A;  2CE7 A;  1L2B A;  5B33 C;  2F5P A;  4RF1 A;  3UK6 A;  3AV1 C;  3VH5 T;  5GSU B;  3LZ0 C;  1QAM A;  3FUU A;  3WHK A;  3UTA C;  1PJI A;  4LZZ A;  1JFI B;  3VKH A;  5B0Y B;  1EQZ A;  1P34 C;  2CEA A;  3M6A A;  4LJA A;  1QZM A;  2Y2G A;  2G5G X;  2XSZ A;  3UGJ A;  5AVC D;  5CPI D;  1U35 D;  1MU5 A;  4CAY B;  4H9S A;  5AV9 D;  3GLF B;  1FNN A;  4GH9 A;  4REZ A;  4KUD D;  2XGN A;  1IN4 A;  3SAV A;  3JR4 A;  3W0L B;  4GKK M;  3AZK A;  1AOI C;  4LJ6 A;  4WU9 C;  3W0F A;  2NQB A;  2V1C A;  4K0K M;  4QHT A;  4GMQ A;  1KX4 A;  3REI C;  4FW9 A;  3WTP D;  4IBG A;  4WNN B;  3J81 S;  4QLC A;  3AZM C;  3AL0 C;  3FUW A;  2IO5 B;  2M5Z A;  2RIQ A;  2F5O A;  4H9P A;  3REK D;  2YFQ A;  1R7R A;  3HHZ A;  1P3K D;  1IN6 A;  3MGQ D;  1P3P A;  4DV3 M;  4LF8 M;  3HJQ A;  3MGR A;  2BYK B;  3AZI C;  1HQ3 C;  4YM6 B;  1G41 A;  3MHV C;  3X1T D;  1PM5 A;  4H9R A;  4X23 C;  4ITQ A;  2I7N A;  1TDH A;  1IBL M;  4WUR A;  2FJ7 D;  3KXB D;  3A6N B;  3SAW A;  1W5T A;  5AV5 D;  2V6Z M;  3AOE A;  3ZH9 B;  3W99 A;  4QNR A;  3KXE C;  3KOZ E;  2KZU A;  3MNN B;  4P16 A;  8CAT A;  3VDU A;  5KDM B;  1HQY E;  4GHL A;  5B32 G;  4E44 A;  5FSW A;  5JRG D;  4H9Q B;  5AY8 C;  4E45 A;  3VK7 A;  4LFB M;  1P3L C;  1WXQ A;  2D7E A;  3X1S A;  1KX5 D;  3W98 C;  4Z66 C;  1C1K A;  5IZ7 D;  4Z2M G;  3GPX A;  2C96 A;  2Z3X A;  4M0W A;  2F5N A;  3KS8 A;  3R45 B;  3AZE A;  1P3O D;  4M0D A;  4IJF A;  5B2J D;  4JI4 M;  1QYR A;  3LJA B;  3AZF A;  1NSF A;  2Y2I A;  5LMN M;  3MVD A;  4ZBJ C;  4NXM M;  3IG8 A;  2G5H C;  4G92 B;  3MGP D;  3W97 C;  2JE5 A;  3KW6 A;  3FDD A;  3W96 C;  3X1V A;  4L4U A;  3KSJ A;  5B32 B;  5BNV B;  1ZLA C;  2YR0 A;  1QAN A;  2W8S A;  1IY1 A;  1I94 M;  5BT1 D;  4J8V C;  5GXQ B;  3AJI B;  1G3I A;  3L28 A;  4D81 A;  1QAO A;  3KWQ B;  1P3F A;  2ZBK B;  2NZD A;  2HIO C;  1N75 A;  1GL6 A;  5B1M C;  5E5A A;  3KSY A;  5BPV A;  1N78 A;  1WWI A;  4J8W B;  4L16 A;  3U5Z B;  5GT3 D;  3AZH B;  3J80 S;  4XUJ D;  5B24 C;  3L29 A;  3HHY A;  1TZY B;  4Z5T B;  5AV6 C;  1N77 A;  2CHG A;  4J8U B;  4R8P C;  3WAA A;  4R7G A;  4H9N A;  5B1L A;  3PNV A;  3LZ1 C;  5E26 A;  3EPK A;  3C1B B;  2R46 A;  2L7I A;  1Z2C B;  1P34 D;  1P3G A;  4G91 C;  5FUG A;  5F99 B;  5AVB B;  1EQZ C;  2HCB A;  4NSR A;  5BNX A;  3TU4 D;  1BH9 A;  1QVR A;  1H6U A;  3RGP A;  3AFA A;  3WA9 A;  3SYL A;  2F4V M;  1IXS B;  4UUZ B;  1ULY A;  3AN2 D;  1KX3 B;  4H9S C;  5DYG A;  5DNN B;  4DV4 M;  3GLG A;  1H3O A;  1N33 M;  1M19 A;  5KPZ A;  1N34 M;  4WU9 D;  1Z6T A;  4DRA A;  4LJ7 A;  3VH5 W;  3AZK C;  1Z5A A;  4J8X D;  4M6B A;  2NQB C;  1M18 D;  4FCT A;  3OTO M;  2DWM A;  5C1B A;  2L5A A;  5EXS A;  4LF6 M;  3AYW D;  3AV2 D;  1KX4 C;  4KGC B;  4QLC C;  3REL B;  3AZL D;  1P3I D;  1S32 B;  2C9C A;  2CV5 B;  3GQ3 A;  3AFH A;  1DO2 A;  5CPK B;  2UXD M;  5CPJ A;  4L15 A;  1XC8 A;  3B6F D;  4M9S A;  1HQ3 D;  3JR5 A;  3C1C A;  1P3P C;  4WU8 A;  2PYO D;  3MGR C;  1B6W A;  3GLH B;  5ITR A;  2QBY A;  3AZJ B;  3MJ5 A;  3H0M C;  1XWI A;  5GSU D;  1XMO M;  4GIT A;  1NHW C;  3C1B C;  2DZO B;  5B0Y D;  4YY3 M;  1IXZ A;  2F8N G;  1G59 A;  3O62 B;  3TQS A;  3B0B A;  1OFH A;  5EP2 A;  3AOE C;  3SHG B;  5FTL A;  5DNM A;  4AKH A;  5BS7 C;  5B31 G;  3V9R A;  4JI2 M;  3WKJ A;  2BJW A;  4B08 A;  2Y2H A;  3IG5 A;  1P3A A;  4H9O A;  4ZUX B;  2R62 A;  2R18 A;  3X1S C;  1GVN A;  4JJN B;  3RGS A;  3REH B;  3LEL B;  5GT0 A;  4NL4 H;  3MGS A;  3B0C T;  4I5S A;  3GRU A;  2QPA A;  3UZU A;  4DR7 M;  3KUY B;  3VH6 W;  2F8N B;  3AZE C;  2EO2 A;  3U60 B;  3AZG B;  2DQN C;  3KP1 E;  3AZF C;  7CAT A;  2YFW B;  3MVD C;  3U6S A;  1XNQ M;  3X1V C;  3LMM A;  4AW4 A;  5B31 B;  1F66 C;  4FWH A;  4YM6 D;  1JR3 D;  1P3B A;  5B2I B;  2JSS A;  3REJ B;  1TH2 A;  3DOA A;  3KOW E;  1P3F C;  2FNA A;  4B3M M;  5G49 A;  2RKO A;  2NZD C;  4W5W A;  2LY8 A;  5E5A C;  4DQY B;  5B33 B;  2FOI C;  4R3D A;  3AV1 B;  3LZ0 B;  3NBI A;  5A2Q S;  3TWL A;  3UTA B;  5AV6 D;  3FUV A;  1P3M A;  4NXN M;  3H0L C;  3MNN D;  4AG6 A;  2F8N K;  3WAA C;  1YUB A;  3TPZ A;  4LJ8 A;  1L1Z A;  4GRI A;  5B1L C;  3M7G A;  2CWE A;  1SXJ A;  3HHW A;  3UMM A;  2I7P A;  1P3G C;  2ZAM A;  2AHM A;  2D7G A;  2VQE M;  5AV8 B;  4KOD A;  3DZD A;  3AFA C;  3T15 A;  1T3T A;  3VLF B;  3UT9 A;  3WA9 C;  4DV7 M;  3LJA D;  3UTB A;  1AOI B;  4WU9 B;  3KUY C;  5FTJ A;  1M19 C;  3NQJ A;  4OVZ A;  3KDS E;  3REI B;  3QWL A;  4TUW A;  3MK6 A;  5IWA M;  5F3W A;  3AZM B;  3U61 B;  4KHP M;  5B32 D;  5CP6 B;  1W5S A;  5GXQ D;  4LD9 A;  5B0Z A;  4X65 M;  3AZN A;  4I4L A;  4AWL C;  3KWQ D;  1IN5 A;  3AZI B;  4XGI A;  2W82 A;  4PD2 A;  4J8W D;  2LWX A;  4X23 B;  5CPJ C;  3AZH D;  3B9P A;  2LH0 A;  3C1C C;  1E94 E;  1IN8 A;  3A6N A;  1TZY D;  4WU8 C;  4Z5T D;  4X66 M;  4J8U D;  4PCZ A;  2Z4R A;  3C1B D;  1SXJ E;  2UWX A;  4OX9 M;  1X37 A;  5F99 D;  5AVB D;  2UUB M;  5AY8 B;  4OW0 A;  4DR5 M;  5JI3 E;  1Z5B A;  2QCU A;  2HL7 A;  1P3L B;  5AV8 C;  5ITT A;  5DNM C;  2R4E A;  4LCB A;  1KX3 D;  2XLJ A;  1ID3 B;  4S12 A;  3W98 B;  4NRV A;  2R4J A;  5DNN D;  4Z66 B;  5BO0 B;  3R9X B;  3DFZ A;  5C3I C;  3A42 A;  4YS3 A;  1M1A A;  3WKJ C;  2YFV B;  4M9Z A;  1P3A C;  4I81 A;  1HNX M;  5ITX A;  3GQ5 A;  3NQU A;  4XBO A;  4ZBJ B;  2UU9 M;  3W97 B;  3MGS C;  2DXI A;  4B7F A;  5CP6 C;  4KGC D;  3W96 B;  3R8F A;  3JAM S;  4DV6 M;  4I8O A;  3REL D;  4WW0 A;  1S32 D;  1ZLA B;  4NOO B;  1N1J A;  2CV5 D;  5B40 A;  4PT5 A;  4J8V B;  5CPK D;  3SAS A;  2HUE C;  1F66 D;  1S3S A;  4XZQ B;  2F8N H;  3GRR A;  2ARO A;  2Y21 A;  2HIO B;  3X1U A;  5B1M B;  1XMQ M;  1T3U A;  1A7W A;  4D80 A;  3AZJ D;  1P3B C;  2BNK A;  3IP4 C;  4LGM A;  5B24 B;  4DV5 M;  4FCV A;  2A5Y B;  3B0C W;  2XFS A;  5AV6 B;  3VK8 A;  4R8P B;  3O62 D;  2XZF A;  2FE8 A;  4DV1 M;  3EIE A;  3LZ1 B;  2QEN A;  5AVC A;  3KP0 E;  5CPI A;  1U35 A;  2Y20 A;  3B6G C;  3CF0 A;  5AV9 A;  1P3M C;  4G91 B;  1WWS A;  3KSX A;  1EQZ B;  4KUD A;  3HWS A;  4QOZ C;  5EP4 A;  1ID3 C;  1GLN A;  4Z6Y A;  2QP9 X;  5JA4 A;  5FTM A;  1SXJ C;  2K47 A;  3VDP A;  3UJN A;  4ZUX D;  4CSR A;  5KQD A;  5ITX E;  5DNY A;  3GP1 A;  4JJN D;  3REH D;  3LEL D;  4B7H A;  2J7N A;  2BYM A;  2R45 A;  2CHV A;  3WTP A;  1ZQ9 A;  2LNH C;  3KUY D;  5H37 D;  3UT9 C;  2F8N D;  3FUT A;  1HQC A;  3CF6 E;  2FFJ A;  2XH9 A;  2ZY3 A;  3AZG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...