3KFUG

Crystal structure of the transamidosome
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
ELSPELLRKLETLAKIRLSPEEEALLLQDLKRILDFVDALPRVEEGGAEEALGRLREDEPRPSLPQAEALALAPEAEDGFFRVPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-discriminating and archaeal-type aspartyl-tRNA synthetas
publication title Crystal structure of a transfer-ribonucleoprotein particle that promotes asparagine formation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase/rna
total genus 15
structure length 86
sequence length 86
chains with identical sequence J
ec nomenclature
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02686 Glu-tRNAGln Glu-tRNAGln amidotransferase C subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.990 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kfuG02
1.10.20.60 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kfuG01
3KFUG 3A1IA 2F2AC 2DQNC 2G5HC 3A1KA 3H0LC 3IP4C 2DF4C 2G5IC 3H0MC 3AL0C 4WJ3C 3H0RC
chains in the Genus database with same CATH superfamily
1NY6A 3I01M 2DAEA 3AZGB 3LZ0A 3UT9D 1Q3CA 5AVBB 3IG8A 1P3LC 2J7OA 4KO8A 3I04M 2QPAA 1P3LD 1GO5A 1OKSA 3JR4A 2VF7A 2ZY3A 2FJ7B 3KSXA 3AN2C 1YUBA 2VDBB 4DV3M 1T3TA 4ZBJC 2FFFB 5B33C 3KW6A 2RGOA 5B33D 4GHAA 2QCUA 1P3ID 4WU8C 2FFJA 4JI1M 4QOSA 2DWMA 3H0MC 2QNJA 4XUJB 1SG9A 3X1SB 5FUGA 2C5RA 2Y2HA 3HJ8A 5AV9B 4OU7A 3WA9C 1TDZA 1ZMWA 4I8OA 2KW0A 3W96C 3LZ1C 3W96D 4J8XA 3LZ1D 4B08A 4NRWA 1ZLAD 2Q2EB 4NE6A 3AFAD 3CF0A 5ITXA 3LJAA 1P3OA 1GABA 4M0WA 4X62M 5B1LB 1PJJA 4L8RC 1G3IA 3AJIB 5KQDA 2HIOD 2Y2QA 3AZLC 1IN8A 3AZLD 4H9RA 5JRGB 3AZID 3FYDA 4FCWA 4I81A 5DYIA 4B3SM 4QLCA 5AVBA 2UXBM 1QZEA 2J5YA 1HQ3C 1N34M 1HQ3D 3B74A 2FJ7A 3GLHA 3B7NA 4DR1M 3AZMC 2UUCM 2KHHA 4DV0M 1K3XA 3AZFB 2F8NK 3SAVA 4X64M 2F2AC 5KPTA 2QP9X 5AV9A 1R2ZA 5E6JA 4CGYB 3A45A 1W5SA 3UT9B 4YS3A 1V33A 3AZJC 3AZJD 1PJIA 1P3LB 4J8UC 3H0RC 3KXEC 3NWLA 1ZQ9A 5KDMA 1PM5A 3QYBA 5B1LA 1U35A 3FRIA 2AROC 4ZBJB 5B33B 3RELD 3U60B 3B89A 1P3PC 1P3IB 2V1CA 1F66D 3AYWC 4WU8B 5JI3E 4R7GA 1R4VA 3AKZA 4W5WA 4MGYE 4KGCA 1G4AE 1WR1B 2IO5C 2PYOA 2NZDC 2NZDD 3W96B 3LZ1B 5BNXB 1IQPA 3AFAB 3AFHA 4JI6M 3B0DC 1J5EM 3AZFA 2CHQA 5BPVA 2QQ8A 2D7HA 3PXGA 2C96A 3IP4C 4RF1A 4AZFA 1B6WA 3WAAC 3SFZA 3AZLB 4X23D 5C1BA 3AZIB 4JJNC 2N35A 1P3LA 3IHPA 1NJFA 3W98C 1VG5A 1VEKA 1Y8GA 3W98D 1HQ3B 1OFHA 3AN2A 1M18D 5B33A 3U60A 5H37D 1N77A 2GNOA 4WU8A 2KRUA 4BB9A 2ZANA 4B7HA 4M6BA 1EIJA 4IBDA 3AV1C 3B6FC 3WA9A 3LELD 2K6BA 4HLQA 1JB0F 4H9PB 3I4VA 3W96A 3LZ1A 2DAGA 1QAOA 2JWSA 4EO5C 3AZJB 2C99A 5CP6C 2RKOA 3TWMA 4GHLA 1ZMVA 3HKPA 3C58A 3SATA 2JP7A 2MR9A 3HHWA 3LQRA 2G5IC 3RELB 1F66B 1P3PB 2R44A 3EPKA 3AZLA 1KX3C 3W97C 1N78A 4JI0M 4FWDA 3V76A 4H9QB 3AOEC 4HGAB 2IO5B 1ZAEA 4CJ6A 5AV8C 1ULYA 2NZDB 3QWLA 4HL4A 5CPKC 3AZMA 1D0MA 2F5SA 4F1IA 3B0DB 4BBAA 3A1KA 2F5OA 5GT3C 4ZPXA 4X23B 4B7FA 3MGSC 3REJC 3MGSD 2Y2NA 3AZJA 5JI2E 3X1TC 3WKJC 5CPJC 4OW0A 3X1TD 3B7QA 4J8UA 3W98B 5ITUA 1HJPA 3VFDA 4PT5A 1P34D 2AROA 1P3PA 4G4RA 3AYWA 2ERCA 1MJGM 5BT1C 2NQBC 3UMMA 5GT0D 3REID 3GQ3A 4LJ4A 3TPZA 3LQQA 1PZRA 2Y0QA 3LELB 4OVZB 3AV1B 3U6OA 1QAMA 5AY8C 3FUXA 5AY8D 2JXNA 5CP6B 5KPRA 1HNXM 2XZFA 3KUYD 3JR5A 3FUWA 1MX0A 4HEOA 3WAAA 1QUSA 1HNZM 2RVQC 3M6AA 2RVQD 2BWBA 3KP1E 3VLFB 3VKGA 1P3MD 1SXJE 4JJNA 4X66M 3GLGE 3W98A 3HHXA 5B2JC 1JR3A 4QHSA 3V9RA 3WHLA 1ZMUA 3HJSA 5B2JD 4QOZC 1XHBA 4AG5A 3GPYA 1DV0A 1BH8B 5B31D 3NBXX 5B32D 4QNRA 3K8ZA 2DZNB 2CWEA 3K92A 4L15A 4WP2A 2F8NA 4OVZA 3AV1A 3VH5A 3B6FA 2CV5A 3SYKA 3X1VD 4LJ6A 1KX4D 5EXPA 2ZM6M 1M1AC 3MGSB 3MJ5A 4NSRA 4JI4M 5GXQC 3X1TB 5CP6A 5GXQD 2ZY5A 3EG5B 4QNMA 1TF0B 3EIHA 2YQZA 4R8PC 4R8PD 1P34B 2XH9A 1IXRC 3IECA 3TU4C 2KNVA 2EA0A 1KX3A 2JY7A 2HL7A 3W97A 2NQBB 2R65A 4FCTA 4LFCM 3VH6W 2KZUA 3REIB 4NOOB 2R4EA 2Y21A 1E9RA 3A6NC 1HQCA 3AOEA 3KS8A 5AV8A 5AY8B 4LF6M 3AV2C 4GITA 3AV2D 2CWBA 1KFVA 5CPKA 4DR6M 1BH8A 3DOAA 3W99C 2JE5A 3NBIA 4I5SA 4UUZA 3KUYB 3KFUG 5GT3A 1S3SA 2C9OA 3A46A 1TDHA 1EQZC 1NY5A 3C3DA 1QANA 5ITTA 3MGSA 1P3MB 3REJA 2R45A 1P3OD 3GPUA 4G3OA 3X1TA 3FD9A 3WKJA 5CPJA 4KUDC 2L4FA 5B2JB 1R6BX 1OFIA 4LJ9A 1C7YA 4M9XA 4DV6M 4NFTA 3DA1A 4IBBA 4QLCD 3QYEA 5AVBD 5B31B 5B0ZC 3KWQC 3MNNC 5B0ZD 3KWQD 3KXBC 5B32B 3KXBD 2FJ7D 2NQBA 2ZBKB 2F5PA 1EFUB 4IIWA 1HQYE 2J7NA 3X1VB 3HX3A 5AY8A 1KX4B 2LH0A 1VQ1A 3U6LA 1M1AB 2BNKA 4LRTA 2HHHM 4ZUXC 4ZUXD 2DF4C 4WJ3C 3J7AS 5GXQB 2VF8A 4LFBM 2DAKA 4YS3D 2FS1A 2DWNA 4R8PB 1S32C 4L4UA 3VH6T 1S32D 3THGA 3GLFA 1WWIA 4LD9C 1R5LA 4LD9D 3LCVB 3K9PA 4MM3B 1U35D 1IY1A 5B2JA 4Z6YA 3REKC 3REKD 3AV2B 1DGBA 1TAFA 4KGCD 3GLIE 2XF3A 3MVDC 5EQTA 2PYOD 5ITRA 3CF2A 3KDSE 1XXHB 4LGYA 2FE8A 1A5TA 3DZDA 2UXCM 2OQ4A 4YHHM 1PJQA 1M1AA 1P3OB 2LVAA 2C9CA 2ZY4A 4Z5TC 3J2PB 5GXQA 4KUDB 1VDLA 4H9RB 3ZH9B 4R8PA 4D81A 4QLCB 4NL4H 3GO8A 4JYAM 3LW5F 5B0ZB 3KWQB 3TU4A 3KXBB 4B7GA 1R7RA 3E21A 3GLHB 3AN2D 5DNMC 5DNMD 2CUZA 1IY2A 1P3QQ 2KNAA 3A6NA 2LHGA 2CV2A 4LF4M 1PGYA 4WU8D 4IBCA 2UUAM 3MMPA 3AV2A 3O62C 1L8QA 4ZUXB 3WA9D 3W99A 1G59A 4YS3B 3TWLA 1XXHA 2X49A 3I51A 1S32B 2LVNC 3X1UC 3X1UD 1E32A 1EQZA 2A5YB 3HY5A 2FNAA 4R71A 4G92B 5KDMB 4LD9B 3W0LB 3VK8A 1U35B 3W68A 4CHTB 2RIQA 1TZYC 3GRYA 4KUDA 3VKHA 1J09A 3REKB 3DFZA 1AUAA 1VEJA 4KGCB 4DR3M 3E46A 2BJWA 1Z6TA 5B0ZA 3KWQA 3MNNA 1PJSA 2DHYA 3KXBA 4KT0F 3MVDB 3GP1A 2PYOB 5KPZA 2CRUA 4JI7M 4LZJA 3E9SA 2FH0A 3AZMD 4FVMA 3REHC 2Z7JA 3REHD 4IBFA 3B0CW 3WHKA 4ZUXA 2O5RA 1Q02A 1K3WA 4YM6C 3K1JA 3M7GA 3B7ZA 4AKGA 5EP2A 4Z2MG 2BJVA 4RF0A 1S32A 1PRBA 4DR4M 1WJ7A 4J8UD 2DAIA 3KOWE 3AN2B 5BS7C 4LD9A 2LVOC 1FJGM 3RGPA 2Y2JA 5DNMB 3LCUA 1Z5AA 2AROD 1P3PD 2XSZD 4AWLC 3AYWD 1DGHB 1QQWA 2G5HC 5FSWA 1XMOM 3REKA 3FUTA 3J27B 5AVCC 4REZA 2JY6B 5AVCD 1XMQM 5B0YC 2MH8A 3WA9B 3J80S 5IZ7D 3MVDA 2BYKA 2E5LM 1L2DA 2LVPC 2O25A 1TH4A 4IBEA 3X1UB 4MB7A 1GKIA 1TTEA 4CIZA 4Z8XA 4NXMM 2H5XA 2F5NA 4Z5TA 1X37A 3WAAD 4L16A 3FTEA 3MHVC 2VQEM 3AZNC 3AZND 1AOIC 3W67A 4MGKE 3SAWA 4JJND 1AOID 2K47A 3F6TA 1JR3D 3AL0C 3HGIA 1WGNA 5E5AC 4DV5M 2M60A 5DNMA 2OOAA 3B0CT 3AZMB 4LJ8A 2JY8A 1DGHA 4PDIA 3EPLA 3REHB 2Y20A 5DFLA 2VQRA 2OO9A 2LNHC 2Z3XA 3O62A 3MGQC 3MGQD 2F8ND 4IBJA 3WTPE 3AV1D 2OOBA 2CV5C 3B6FD 2CV5D 1ORYB 4MH0E 4PD2A 2BWEA 4UPKA 3X1UA 2LBCA 1A7WA 3GLIA 4J8UB 5CP6D 1ID3C 5FLXS 5BR8M 3HHZA 2XFSA 1ID3D 4AKHA 1Z5CA 4G4NA 2AROB 2F4VM 1P3GC 1P3GD 3AYWB 1NV8A 3TWKA 3SMSA 1TZYA 4AWLB 4GC5A 1KX3D 3W97D 1I94M 2M5ZA 3VDPA 3GQ4A 5AVCB 4DV7M 2X4AA 5B2IC 4ANRA 4FCVA 3SAUA 1N1JA 2XD1A 5AV8D 2B3TA 4JI5M 5FTLA 5G49A 2CV1A 1IY0A 2DNAA 3UTBC 3PNVA 3U6EA 5CPKD 4JI8M 4RNAA 1N75A 3REHA 2GQFA 1JFIA 3RGSA 3NQJB 5JA4B 4CISA 1L2CA 5EXSA 2V1UA 5GT3D 1E9SA 3WAAB 4YM6A 2I7PA 5EXXA 4B3RM 2ZM5A 3REJD 3AZNB 1IN7A 4JJNB 1E94E 1AOIB 3KS4A 2JZ0A 3WKJD 5FTJA 5CPJD 4DRBA 3HJQA 3V9RB 3WTPC 3FTCA 2CV0A 2X8AA 5BS7A 5E5AB 4WNNA 3HWSA 5E26A 2XSZA 1T3UA 5BT1D 1D0KA 1IN5A 3L29A 2NQBD 3FYCA 5AVCA 3MGQB 2F8NB 5B0YA 1DO0A 3B6FB 2CV5B 4LY6A 1H3OB 4G4OA 2HUEC 2F8NH 4WZSB 3FUUA 7CATA 2ZTDA 4WW0A 4EO5B 2L6OA 2CHGA 2DVWB 2KEBA 5CPIC 5ITQA 3U6PA 2L7IA 2XD5A 1ID3B 2RRUA 3NQJA 5JA4A 1BVSA 3C1BC 1P3GB 1IFYA 1TR8A 4DV4M 1KX3B 3W97B 3BXWA 3AZNA 2UU9M 1NNUC 1P3FC 1AOIA 4B3MM 1P3FD 3EIEA 5AV8B 2YFWA 2RGHA 2R62A 3GQ5A 5E5AA 2MGWA 5L8RF 3SASA 5CPKB 1YE9A 2Z4RA 1CUKA 5FTMA 2L4EA 5C3IC 2ZTCA 4UUZB 3MGQA 4DR2M 4B3TM 5GT3B 1NVMA 1H3OA 4GEWA 1GVNA 2YFQA 5ITXE 3NQUB 2DKLA 3REJB 4LZZA 1M1AD 3ZQJA 3PVSA 3WKJB 2Y2IA 5CPJB 2ZAOA 1YSYA 5AV6C 3BBZA 5DNNC 1ID3A 1BH9B 1GLNA 2Z4SA 4NSOB 4J8VC 3T15A 4FD2A 1P3GA 1R2YA 3TU4D 2O01F 2Y2PA 1KX5C 3GLHE 2WSEF 4GIPA 3A6ND 5B2IA 5ITYA 2QZ4A 1Q39A 2R0IA 2HKJA 2Y2KA 4GKKM 4EIWA 3U6CA 5BO0A 1SXJC 4CSRA 1IXSB 1SXJD 3UTBA 4GMQA 4NE3A 3W99D 5CPIB 3CGWA 1GL6A 2DI0A 1XC8A 1P3BC 2D7GA 1EQZD 1N36M 1WWSA 3GLFB 3NQUA 3E4RA 1P3FB 3U5ZB 4KUDD 1BH9A 3WTPA 2DXIA 4A3VB 1IN6A 1TAFB 3RFWA 1G71A 2XFTA 5EP3A 3MNND 4KHAB 4XK8F 1Z2CB 5C3IB 1IBMM 3AZGC 2DHRA 3U61B 4KHPM 1W5TA 1C1KA 3FTDA 2R18A 3HZJA 2LVQD 3HU1A 3L27A 1HT1E 1OIZA 4LG2A 4BLCA 1IXSA 2HCBA 1DGGA 3KSYA 5B1MC 5CPIA 5B1MD 4LJAA 3GRRA 3UGJA 3U6SA 4I4LA 4IBIA 3C1BA 4XUJC 4F2LA 3X1SC 3TU4B 5IWAM 1HTAA 2QBYB 4NE5A 3ZCBB 1P3FA 5EP4A 1Z5BA 3U5ZA 4WU9C 2L09A 3A6NB 4DQYB 2QENA 3ILKA 3UJNA 3J7BA 4JI2M 2LHCA 4AQYM 2WSFF 3Q8GA 1SXJB 1OIPA 3F92A 4KHAA 3W99B 3GLGB 1K82A 4ITQA 2LY8A 3MVDD 1IN4A 4XGIA 1HR0M 2JY5A 1P3BB 2ZY2A 5JRGC 3U61A 1EQZB 2EKKA 2DZLA 2EO2A 4KLNA 4LF9M 2DZOB 4R3DA 4FWGA 1GJTA 1LTMA 4UN2B 5DYGA 4Z5TD 3D8LA 3SC3A 2HWJA 1XNQM 5AV6A 4DV1M 5DNNA 3KVWA 4RKUF 1TH3A 4LCBA 4J8VA 1T43A 4CAYA 5AV5C 1UM8A 5AV5D 3MNNB 2KDLA 2QBYA 5GKNA 2H1RA 3SARA 3CTWB 4NC6A 1KX5A 3SBJA 2MJ5B 3UT9C 1P3AC 1NJGA 1P3AD 1IM2A 1QAQA 3AOGA 3O62D 1KSFX 1SXJA 1IBKM 1G8PA 3GLGA 5B1MB 3SHGB 2G3QA 1OAOC 1L1ZA 4MGIE 1P3IC 2XLJA 1P3BA 3EPHA 1WXQA 1ZV1A 1UFZA 3LVWA 2YFVA 3D8BA 5KQ8A 1PJTA 3GRVA 4XBOA 3RE8A 3MGPC 4WU9B 3MGPD 1ZLAC 3GPXA 1G41A 1Q3BA 1TZYD 3AFAC 1KU5A 2G5GX 3GRUA 5EXTA 3VH5W 1RU3A 3UTAC 3UTAD 1Q9CA 4WURA 2EKFA 2BYKB 2HIOC 2L5AA 5BNVB 3AZGA 3AZIC 2FOIC 1DO2A 2CEAA 3TL4X 1IXZA 2D7EA 1BFMA 5B24C 2JCHA 1VDDA 5B24D 4NXNM 4LFAM 4Z5TB 1XB2B 5IT9S 5B1MA 4YM6D 3L28A 3R9XB 5B31G 4XZQC 4K0KM 4XZQD 5B32G 4E44A 2L7HA 4G6ZA 3CF6E 2ZAMA 5AV5B 4XUJA 2YNMD 3X1SA 3UK6A 4J8WC 5EJCA 5CHLB 4J8WD 1JR3E 3GPPA 4X65M 4WU9A 3PNYA 2R46A 1P3AB 2OPFA 3OTOM 3O62B 1N32M 5FTNA 5B0YD 4H9SC 2APLA 3RELC 5FTKA 1F66C 5BNVA 4L6V6 3K9OA 2YR0A 5JRGA 3U6DA 3GLIB 5B40C 4DR5M 5B40D 4LF5M 1Z59A 2CHVA 4HGAC 1NO1A 5IREB 3VH5T 3MGPB 1TZYB 1ZLAB 3BOSA 3VH6A 1IBLM 4DRAA 1QZMA 1MN3A 1HT2E 4JI3M 5AV5A 1M19C 3UTAB 1M19D 2EUCA 1H6UA 1N1JB 3H4JA 1XWIA 2JA2A 4MGZE 1N33M 2HIOB 5E5AD 4X23C 5G49B 1KYIA 3UT9A 4Y28F 1TGUA 1P3AA 3R45B 2CP8A 1NNJA 5B24B 1JFIB 1OJLA 2DQNC 4DV2M 1M18C 4YM6B 4XZQB 2JZ1A 1P3IA 2C98A 3C1CC 3C1CD 4LF7M 4J8WB 2KZSA 3T38A 3LELC 3EPJA 4WNNB 2DAMA 1XNRM 3MGPA 1D0LA 4M0DA 3MGRC 2BG1A 3MGRD 1ZLAA 3T1HM 2L2DA 5BNXA 3AFAA 3B9PA 4WV4B 3AZKC 3UTAA 3AZKD 5B0YB 5B2ID 3B6GC 1NV9A 3B6GD 2HIOA 4S12A 4MGHA 2KA6B 3AZIA 4DUYM 3T1YM 3UTBD 2LTUA 3ZC7B 1VEGA 3R45A 4GRIA 3SYLA 5B40B 3I4YA 2VQFM 5B24A 4AG6A 4G91C 3W0FA 1HQ3A 5LMUM 4XZQA 4II7A 4H9OB 1NSFA 4M9SA 3GLFE 4GH9A 1M19B 3AZHC 3AZHD 2G8LA 4J8WA 2YFWB 3WTPD 5C18A 3C9PA 1J7KA 4H9PA 4JXJA 2HAKA 4IBKA 2R6FA 2CFOA 4LGMA 3KSJA 1HNWM 1M18B 4H9SA 1P34C 3RELA 4KODA 4OX9M 3L25A 2Y2MA 1F66A 3HHYA 2XGNA 3C1CB 2CE7A 2K0BX 3FTFA 5GT0C 3REIC 5CPID 5B40A 4H9QA 3KOYE 3L26A 2XEPA 3A98B 3C1BD 2NZDA 1QUTA 2WZJA 4Z66C 3MGRB 4FWHA 4Z66D 1WIVA 2VIIA 2QSFX 4PDGA 4H9OA 1P3KC 1P3KD 3AZKB 1M19A 1QDTA 5B2IB 3KUYC 2EJSA 3B6GB 1I4WA 1JQJC 4X23A 1FNNA 5BO0B 3TQSA 1YLAA 4CSRB 3KP0E 2KXEA 3UTBB 1P3MC 4E45A 2DENA 2KNZA 4TUWA 1R4GA 1T6OA 2WSCF 4M9ZA 4YY3M 3IG5A 4G91B 3J81S 4LJ7A 1DGFA 4L78A 5GSUC 1XXHE 5F99C 1M18A 5GSUD 1NHGC 5F99D 3HU3A 3A1IA 5B31C 3T6PA 5B32C 1NHWC 3UZUA 2LWXA 3LMMA 3C1CA 2AHMA 3VK7A 4AKIA 3AZEC 3AZHB 3AZED 5AV6D 3FRHA 3KOXE 3QAUA 3WTPB 5DNND 4D80A 4G4QA 4FW9A 3LELA 4J8VD 3SMPA 3X1VC 5EP1A 2BYMB 1KX4C 3L2AA 2UWXA 4LF8M 3MGRA 1W2EA 1QYRA 4DR7M 1WGLA 3C3EA 1KX5D 3AZKA 3LZ0C 1D2NA 3LZ0D 3H0LC 4DBGB 4GKJM 4D82A 3B0BA 3B6GA 2KRKA 2HUEB 2UUBM 3A42A 1V34A 1WHCA 2Y0TA 3K2LA 5GT0B 2P5TA 3R8FA 4P16A 3FKEA 4QHTA 1P3BD 4GC9A 3C1BB 1TH2A 4Z66B 3AV0A 3LVVA 1F1EA 5DNYA 1AIPC 3HU2A 1P3KB 2V6ZM 1MU5A 3AZHA 1OQYA 4J8XC 3JAMS 3FE3A 5LMNM 4JV5M 4J8XD 2LXEA 3U6QA 3FUVA 2BYMA 3VDUA 3LJAC 2W8SA 3LJAD 1P3OC 4DUZM 1QVRA 2Y2GA 2JUJA 4IJEA 3AZGD 1GL7A 5GSUB 5F99B 2JSSA 4QLCC 3H4MA 3SHFA 1P34A 5AVBC 1LV7A 4Q7JA 2NQ8C 1L1TA 2FJ7C 3P5JB 1GJSA 3AZEB 1QDRA 5GT0A 3REIA 5AV6B 2Z8YM 4AW4A 5DNNB 4H9NB 4Z2MH 4J8VB 4CAYB 1F4IA 4XUJD 4JN6A 4Z66A 3X1SD 2F8NG 1B67A 4IBGA 1EE8A 4LRSA 5AV9C 2I7NA 2DWLA 5AV9D 1OAIA 3LJAB 3Q8XA 1P3KA 3MK6A 1KX5B 4YS3C 2JNHA 1OTRA 3U6MA 4WU9D 3LZ0B 4LJ5A 3KUYA 5KO3A 3M0EA 3TE6A 8CATA 3KOZE 3PFIA 4G92C 1P3MA 2Y2OA 2XZUA 4P17A 1V92A 5B1LC 1U35C 5B1LD 2K9DA 4AI6A 2QHOB 5GSUA 5JRGD 5F99A 2UXDM 2W82A 5FUGB 2YFVB 4KGCC 5B31A 2Y2LA 4NRVA 5B32A 2PYOC 2DWZB 3AZEA 4PCZA 5F3WA 4J8XB 4H9NA 2R4JA 3FDDA 3AZFC 2F5QA 3AZFD 2MROB 2J8PA 3X1VA 5A2QS 1KX4A 4IJFA 1L2BA
chains in the Genus database with same CATH topology
1NY6A 3AZGB 3LZ0A 3UT9D 1Q3CA 5AVBB 3IG8A 1P3LC 2J7OA 4KO8A 2QPAA 1P3LD 3JR4A 2ZY3A 2FJ7B 3KSXA 3AN2C 1YUBA 4DV3M 1T3TA 4ZBJC 2FFFB 5B33C 3KW6A 2RGOA 5B33D 4GHAA 2QCUA 1P3ID 4WU8C 2FFJA 4JI1M 4QOSA 2DWMA 3H0MC 4XUJB 3X1SB 5FUGA 2C5RA 2Y2HA 3HJ8A 5AV9B 4OU7A 3WA9C 1TDZA 4I8OA 2KW0A 3W96C 3LZ1C 3W96D 4J8XA 3LZ1D 4B08A 4NRWA 1ZLAD 2Q2EB 4NE6A 3AFAD 3CF0A 5ITXA 3LJAA 1P3OA 4M0WA 4X62M 5B1LB 1PJJA 4L8RC 1G3IA 3AJIB 5KQDA 2HIOD 2Y2QA 3AZLC 1IN8A 3AZLD 4H9RA 5JRGB 3AZID 3FYDA 4FCWA 4I81A 5DYIA 4B3SM 4QLCA 5AVBA 2UXBM 1HQ3C 1N34M 1HQ3D 2FJ7A 3GLHA 4DR1M 3AZMC 2UUCM 4DV0M 1K3XA 3AZFB 2F8NK 3SAVA 4X64M 2F2AC 5KPTA 2QP9X 5AV9A 1R2ZA 5E6JA 4CGYB 3A45A 1W5SA 3UT9B 4YS3A 3AZJC 3AZJD 1PJIA 1P3LB 4J8UC 3H0RC 3KXEC 3NWLA 1ZQ9A 5KDMA 1PM5A 5B1LA 1U35A 2AROC 4ZBJB 5B33B 3RELD 3U60B 1P3PC 1F66D 1P3IB 2V1CA 3AYWC 4WU8B 5JI3E 4R7GA 1R4VA 3AKZA 4W5WA 4MGYE 4KGCA 1G4AE 2IO5C 2PYOA 2NZDC 2NZDD 3W96B 3LZ1B 5BNXB 1IQPA 3AFAB 3AFHA 4JI6M 3B0DC 1J5EM 3AZFA 2CHQA 5BPVA 2D7HA 3PXGA 2C96A 3IP4C 4RF1A 4AZFA 1B6WA 3WAAC 3SFZA 3AZLB 4X23D 5C1BA 3AZIB 4JJNC 1P3LA 1NJFA 3W98C 3W98D 1HQ3B 1OFHA 3AN2A 1M18D 5B33A 3U60A 5H37D 1N77A 4WU8A 2KRUA 4BB9A 2ZANA 4B7HA 4M6BA 4IBDA 3AV1C 3B6FC 3WA9A 3LELD 4HLQA 4H9PB 3I4VA 3W96A 3LZ1A 1QAOA 4EO5C 3AZJB 2C99A 5CP6C 2RKOA 3TWMA 4GHLA 3HKPA 3C58A 3SATA 3HHWA 3LQRA 2G5IC 3RELB 1F66B 1P3PB 3EPKA 3AZLA 1KX3C 3W97C 1N78A 4JI0M 4FWDA 4H9QB 3AOEC 4HGAB 2IO5B 1ZAEA 5AV8C 1ULYA 2NZDB 3QWLA 4HL4A 5CPKC 3AZMA 2F5SA 3B0DB 4BBAA 3A1KA 2F5OA 5GT3C 4ZPXA 4X23B 4B7FA 3MGSC 3REJC 3MGSD 2Y2NA 3AZJA 5JI2E 3X1TC 3WKJC 5CPJC 4OW0A 3X1TD 4J8UA 3W98B 5ITUA 3VFDA 4PT5A 1P34D 2AROA 1P3PA 4G4RA 3AYWA 2ERCA 5BT1C 2NQBC 3UMMA 5GT0D 3REID 3GQ3A 4LJ4A 3TPZA 3LQQA 1PZRA 2Y0QA 3LELB 4OVZB 3AV1B 3U6OA 1QAMA 5AY8C 3FUXA 5AY8D 5CP6B 5KPRA 1HNXM 2XZFA 3KUYD 3JR5A 3FUWA 1MX0A 3WAAA 1HNZM 2RVQC 3M6AA 2RVQD 3KP1E 3VLFB 1P3MD 3VKGA 1SXJE 4JJNA 4X66M 3W98A 3HHXA 5B2JC 1JR3A 4QHSA 3WHLA 3V9RA 5B2JD 3HJSA 4QOZC 1XHBA 4AG5A 3GPYA 1BH8B 5B31D 5B32D 4QNRA 3K8ZA 2DZNB 2CWEA 3K92A 4L15A 2F8NA 4OVZA 3AV1A 3VH5A 3B6FA 2CV5A 3SYKA 3X1VD 4LJ6A 1KX4D 5EXPA 2ZM6M 1M1AC 3MGSB 3MJ5A 4NSRA 4JI4M 5GXQC 3X1TB 5CP6A 5GXQD 2ZY5A 3EG5B 4QNMA 3EIHA 2YQZA 4R8PC 4R8PD 1P34B 2XH9A 1IXRC 3TU4C 2EA0A 1KX3A 2HL7A 3W97A 2NQBB 2R65A 4FCTA 4LFCM 3VH6W 2KZUA 3REIB 4NOOB 2R4EA 2Y21A 1E9RA 3A6NC 1HQCA 3AOEA 3KS8A 5AV8A 5AY8B 4LF6M 3AV2C 4GITA 3AV2D 1KFVA 5CPKA 4DR6M 1BH8A 3DOAA 3W99C 2JE5A 3NBIA 4I5SA 4UUZA 3KUYB 3KFUG 5GT3A 1S3SA 2C9OA 3A46A 1TDHA 1EQZC 1NY5A 1QANA 5ITTA 3MGSA 1P3MB 3REJA 2R45A 1P3OD 3GPUA 3X1TA 3FD9A 3WKJA 5CPJA 4KUDC 5B2JB 1R6BX 1OFIA 4LJ9A 4M9XA 4DV6M 4NFTA 3DA1A 4IBBA 4QLCD 5AVBD 5B31B 5B0ZC 3KWQC 3MNNC 5B0ZD 3KWQD 3KXBC 5B32B 3KXBD 2FJ7D 2NQBA 2ZBKB 2F5PA 4IIWA 1HQYE 2J7NA 3X1VB 5AY8A 1KX4B 2LH0A 3U6LA 1M1AB 2BNKA 4LRTA 2HHHM 4ZUXC 4ZUXD 2DF4C 4WJ3C 3J7AS 5GXQB 4LFBM 4YS3D 2DWNA 4R8PB 1S32C 4L4UA 3VH6T 1S32D 3THGA 3GLFA 1WWIA 4LD9C 4LD9D 4MM3B 1U35D 1IY1A 5B2JA 4Z6YA 3REKC 3REKD 3AV2B 1DGBA 1TAFA 4KGCD 2XF3A 3MVDC 5EQTA 2PYOD 5ITRA 3CF2A 3KDSE 1XXHB 4LGYA 2FE8A 3DZDA 2UXCM 2OQ4A 4YHHM 1M1AA 1P3OB 2C9CA 2ZY4A 4Z5TC 3J2PB 5GXQA 4KUDB 4H9RB 3ZH9B 4R8PA 4D81A 4QLCB 4NL4H 3GO8A 4JYAM 5B0ZB 3KWQB 3TU4A 3KXBB 4B7GA 1R7RA 3GLHB 3AN2D 5DNMC 5DNMD 2CUZA 1IY2A 3A6NA 2CV2A 4LF4M 4WU8D 4IBCA 2UUAM 3AV2A 3O62C 1L8QA 4ZUXB 3WA9D 3W99A 1G59A 4YS3B 3TWLA 1XXHA 2X49A 3I51A 1S32B 3X1UC 3X1UD 1E32A 1EQZA 2A5YB 2FNAA 4G92B 5KDMB 4LD9B 3W0LB 3VK8A 1U35B 4CHTB 2RIQA 1TZYC 3GRYA 4KUDA 3VKHA 1J09A 3REKB 3DFZA 4KGCB 4DR3M 2BJWA 1Z6TA 5B0ZA 3KWQA 3MNNA 3KXBA 2PYOB 3MVDB 3GP1A 5KPZA 4JI7M 4LZJA 3E9SA 3AZMD 4FVMA 3REHC 2Z7JA 3REHD 4IBFA 3B0CW 3WHKA 4ZUXA 2O5RA 1K3WA 4YM6C 3K1JA 3M7GA 4AKGA 5EP2A 4Z2MG 2BJVA 4RF0A 1S32A 4DR4M 4J8UD 3KOWE 3AN2B 5BS7C 4LD9A 1FJGM 3RGPA 2Y2JA 5DNMB 1Z5AA 2AROD 1P3PD 2XSZD 4AWLC 3AYWD 1DGHB 1QQWA 2G5HC 5FSWA 1XMOM 3REKA 3FUTA 3J27B 5AVCC 4REZA 5AVCD 1XMQM 5B0YC 3WA9B 3J80S 5IZ7D 3MVDA 2BYKA 2E5LM 1L2DA 1TH4A 4IBEA 3X1UB 4MB7A 1GKIA 4Z8XA 4NXMM 2F5NA 4Z5TA 1X37A 3WAAD 4L16A 3FTEA 3MHVC 2VQEM 3AZNC 3AZND 1AOIC 3SAWA 4MGKE 4JJND 1AOID 2K47A 3F6TA 1JR3D 3AL0C 3HGIA 5E5AC 4DV5M 2M60A 5DNMA 3B0CT 3AZMB 4LJ8A 1DGHA 4PDIA 3EPLA 3REHB 2Y20A 2VQRA 2LNHC 2Z3XA 3O62A 3MGQC 3MGQD 2F8ND 4IBJA 3WTPE 3AV1D 2CV5C 3B6FD 2CV5D 1ORYB 4MH0E 4PD2A 4UPKA 3X1UA 1A7WA 3GLIA 4J8UB 5CP6D 1ID3C 5FLXS 5BR8M 3HHZA 2XFSA 1ID3D 4AKHA 1Z5CA 4G4NA 2AROB 2F4VM 1P3GC 1P3GD 3AYWB 1TZYA 3TWKA 3SMSA 4AWLB 4GC5A 1KX3D 3W97D 1I94M 2M5ZA 3VDPA 3GQ4A 5AVCB 4DV7M 2X4AA 5B2IC 4FCVA 3SAUA 1N1JA 2XD1A 5AV8D 4JI5M 5FTLA 5G49A 2CV1A 1IY0A 3UTBC 3PNVA 3U6EA 5CPKD 4JI8M 4RNAA 1N75A 3REHA 1JFIA 3RGSA 3NQJB 5JA4B 4CISA 1L2CA 5EXSA 2V1UA 5GT3D 1E9SA 3WAAB 4YM6A 2I7PA 5EXXA 4B3RM 2ZM5A 3REJD 3AZNB 1IN7A 4JJNB 1E94E 1AOIB 3KS4A 3WKJD 5FTJA 5CPJD 4DRBA 3HJQA 3V9RB 3WTPC 3FTCA 2CV0A 2X8AA 5BS7A 5E5AB 4WNNA 3HWSA 5E26A 2XSZA 1T3UA 5BT1D 1IN5A 3L29A 2NQBD 3FYCA 5AVCA 3MGQB 2F8NB 5B0YA 1DO0A 3B6FB 2CV5B 4LY6A 1H3OB 4G4OA 2HUEC 2F8NH 4WZSB 3FUUA 7CATA 4WW0A 4EO5B 2L6OA 2CHGA 2DVWB 2KEBA 5CPIC 5ITQA 3U6PA 2L7IA 2XD5A 1ID3B 3NQJA 5JA4A 3C1BC 1P3GB 4DV4M 1KX3B 3W97B 3AZNA 2UU9M 1NNUC 1P3FC 1AOIA 4B3MM 1P3FD 3EIEA 5AV8B 2YFWA 2RGHA 2R62A 3GQ5A 5E5AA 3SASA 5CPKB 1YE9A 2Z4RA 5FTMA 5C3IC 4UUZB 3MGQA 4DR2M 4B3TM 5GT3B 1NVMA 1H3OA 1GVNA 2YFQA 5ITXE 3NQUB 3REJB 4LZZA 1M1AD 3PVSA 3WKJB 2Y2IA 5CPJB 2ZAOA 1YSYA 5AV6C 5DNNC 1ID3A 1BH9B 1GLNA 2Z4SA 4NSOB 4J8VC 3T15A 4FD2A 1P3GA 1R2YA 3TU4D 2Y2PA 1KX5C 4GIPA 3A6ND 5B2IA 5ITYA 2QZ4A 1Q39A 2HKJA 2Y2KA 4GKKM 4EIWA 3U6CA 5BO0A 1SXJC 4CSRA 1IXSB 1SXJD 3UTBA 4GMQA 4NE3A 3W99D 5CPIB 1GL6A 1XC8A 1P3BC 2D7GA 1EQZD 1N36M 1WWSA 3GLFB 3NQUA 3E4RA 1P3FB 3U5ZB 4KUDD 1BH9A 3WTPA 2DXIA 4A3VB 1IN6A 1TAFB 3RFWA 2XFTA 5EP3A 3MNND 4KHAB 1Z2CB 5C3IB 1IBMM 3AZGC 2DHRA 3U61B 4KHPM 1W5TA 1C1KA 3FTDA 2R18A 3HU1A 3L27A 1HT1E 4LG2A 4BLCA 2HCBA 1DGGA 3KSYA 5B1MC 5CPIA 5B1MD 4LJAA 3GRRA 3UGJA 3U6SA 4I4LA 4IBIA 3C1BA 4XUJC 3X1SC 3TU4B 5IWAM 1HTAA 2QBYB 4NE5A 3ZCBB 1P3FA 5EP4A 1Z5BA 3U5ZA 4WU9C 2L09A 3A6NB 4DQYB 2QENA 3ILKA 3UJNA 3J7BA 4JI2M 4AQYM 1SXJB 4KHAA 3W99B 3GLGB 1K82A 4ITQA 2LY8A 3MVDD 1IN4A 4XGIA 1HR0M 1P3BB 2ZY2A 5JRGC 3U61A 1EQZB 2EO2A 4KLNA 4LF9M 2DZOB 4R3DA 4FWGA 5DYGA 4Z5TD 3D8LA 3SC3A 1XNQM 5AV6A 4DV1M 5DNNA 3KVWA 1TH3A 4LCBA 4J8VA 4CAYA 5AV5C 1UM8A 5AV5D 3MNNB 2QBYA 5GKNA 2H1RA 3SARA 3CTWB 1KX5A 3SBJA 3UT9C 1P3AC 1NJGA 1P3AD 1IM2A 1QAQA 3AOGA 3O62D 1KSFX 1SXJA 1IBKM 1G8PA 3GLGA 5B1MB 3SHGB 1L1ZA 4MGIE 1P3IC 2XLJA 1P3BA 3EPHA 1WXQA 3LVWA 2YFVA 3D8BA 5KQ8A 3GRVA 4XBOA 3RE8A 3MGPC 4WU9B 3MGPD 1ZLAC 3GPXA 1Q3BA 1G41A 1TZYD 3AFAC 1KU5A 2G5GX 3GRUA 5EXTA 3VH5W 3UTAC 3UTAD 1Q9CA 4WURA 2BYKB 2HIOC 2L5AA 5BNVB 3AZGA 3AZIC 2FOIC 1DO2A 2CEAA 3TL4X 1IXZA 2D7EA 1BFMA 5B24C 2JCHA 1VDDA 5B24D 4NXNM 4LFAM 4Z5TB 5IT9S 5B1MA 4YM6D 3L28A 3R9XB 5B31G 4XZQC 4K0KM 4XZQD 5B32G 4E44A 2L7HA 4G6ZA 3CF6E 2ZAMA 5AV5B 4XUJA 2YNMD 3X1SA 3UK6A 4J8WC 5EJCA 5CHLB 4J8WD 3GPPA 4X65M 4WU9A 3PNYA 2R46A 1P3AB 2OPFA 3OTOM 3O62B 1N32M 5FTNA 5B0YD 4H9SC 3RELC 5FTKA 1F66C 5BNVA 2YR0A 5JRGA 3U6DA 3GLIB 5B40C 4DR5M 5B40D 4LF5M 1Z59A 2CHVA 4HGAC 5IREB 3VH5T 3MGPB 1TZYB 1ZLAB 3BOSA 3VH6A 1IBLM 4DRAA 1QZMA 1HT2E 4JI3M 5AV5A 1M19C 3UTAB 1M19D 2EUCA 1H6UA 1N1JB 1XWIA 2JA2A 4MGZE 1N33M 2HIOB 5E5AD 4X23C 5G49B 1KYIA 3UT9A 1TGUA 1P3AA 3R45B 1NNJA 5B24B 1JFIB 1OJLA 2DQNC 4DV2M 1M18C 4YM6B 4XZQB 1P3IA 2C98A 3C1CC 3C1CD 4LF7M 4J8WB 2KZSA 3T38A 3LELC 3EPJA 4WNNB 1XNRM 3MGPA 4M0DA 3MGRC 2BG1A 3MGRD 1ZLAA 3T1HM 5BNXA 3AFAA 3B9PA 4WV4B 3AZKC 3UTAA 3AZKD 5B0YB 5B2ID 3B6GC 3B6GD 2HIOA 4S12A 4MGHA 2KA6B 3AZIA 4DUYM 3T1YM 3UTBD 3ZC7B 3R45A 4GRIA 3SYLA 5B40B 3I4YA 2VQFM 5B24A 4AG6A 4G91C 3W0FA 1HQ3A 5LMUM 4XZQA 4II7A 4H9OB 1NSFA 4M9SA 4GH9A 1M19B 3AZHC 3AZHD 2G8LA 4J8WA 2YFWB 3WTPD 5C18A 1J7KA 4H9PA 4JXJA 4IBKA 2CFOA 4LGMA 3KSJA 1HNWM 1M18B 4H9SA 1P34C 3RELA 4KODA 4OX9M 3L25A 2Y2MA 1F66A 3HHYA 2XGNA 3C1CB 2CE7A 3FTFA 5GT0C 3REIC 5CPID 5B40A 4H9QA 3KOYE 3L26A 2XEPA 3A98B 3C1BD 2NZDA 4Z66C 3MGRB 4FWHA 4Z66D 2VIIA 4PDGA 4H9OA 1P3KC 1P3KD 3AZKB 1M19A 5B2IB 3KUYC 3B6GB 1I4WA 1JQJC 4X23A 1FNNA 5BO0B 3TQSA 4CSRB 3KP0E 2KXEA 3UTBB 1P3MC 4E45A 4TUWA 4M9ZA 4YY3M 3IG5A 4G91B 3J81S 4LJ7A 1DGFA 4L78A 5GSUC 5F99C 1M18A 5GSUD 1NHGC 5F99D 3HU3A 3A1IA 5B31C 5B32C 1NHWC 3UZUA 2LWXA 3LMMA 3C1CA 2AHMA 3VK7A 4AKIA 3AZEC 3AZHB 3AZED 5AV6D 3KOXE 3QAUA 3WTPB 5DNND 4D80A 4G4QA 4FW9A 3LELA 4J8VD 3SMPA 3X1VC 5EP1A 2BYMB 1KX4C 3L2AA 2UWXA 4LF8M 3MGRA 1W2EA 1QYRA 4DR7M 1KX5D 3AZKA 3LZ0C 1D2NA 3LZ0D 3H0LC 4GKJM 4D82A 3B0BA 3B6GA 2KRKA 2HUEB 2UUBM 3A42A 2Y0TA 3K2LA 5GT0B 2P5TA 3R8FA 4P16A 3FKEA 4QHTA 1P3BD 4GC9A 3C1BB 1TH2A 4Z66B 3AV0A 3LVVA 1F1EA 5DNYA 3HU2A 1P3KB 2V6ZM 1MU5A 3AZHA 4J8XC 3JAMS 5LMNM 4JV5M 4J8XD 2LXEA 3U6QA 3FUVA 2BYMA 3VDUA 3LJAC 2W8SA 3LJAD 1P3OC 4DUZM 1QVRA 2Y2GA 4IJEA 3AZGD 1GL7A 5GSUB 5F99B 2JSSA 4QLCC 3H4MA 3SHFA 1P34A 5AVBC 1LV7A 2NQ8C 1L1TA 2FJ7C 3P5JB 3AZEB 5GT0A 3REIA 5AV6B 4AW4A 5DNNB 4H9NB 4Z2MH 4J8VB 4CAYB 4XUJD 4Z66A 4JN6A 3X1SD 2F8NG 1B67A 4IBGA 1EE8A 4LRSA 5AV9C 2I7NA 2DWLA 5AV9D 3Q8XA 1P3KA 3MK6A 1KX5B 4YS3C 3U6MA 3LZ0B 4WU9D 4LJ5A 3KUYA 5KO3A 3M0EA 3TE6A 8CATA 3KOZE 3PFIA 4G92C 1P3MA 2Y2OA 2XZUA 5B1LC 1U35C 5B1LD 4AI6A 5GSUA 5JRGD 5F99A 2UXDM 2W82A 5FUGB 2YFVB 4KGCC 5B31A 2Y2LA 4NRVA 5B32A 2PYOC 2DWZB 3AZEA 4PCZA 5F3WA 4J8XB 4H9NA 2R4JA 3FDDA 3AZFC 2F5QA 3AZFD 1L2BA 2J8PA 3X1VA 5A2QS 1KX4A 4IJFA 3LJAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KFU G;  3A1I A;  2F2A C;  2DQN C;  2G5H C;  3A1K A;  3H0L C;  3IP4 C;  2DF4 C;  2G5I C;  3H0M C;  3AL0 C;  4WJ3 C;  3H0R C; 
#chains in the Genus database with same CATH topology
 1NY6 A;  3I01 M;  2DAE A;  3AZG B;  3LZ0 A;  3UT9 D;  1Q3C A;  5AVB B;  3IG8 A;  1P3L C;  2J7O A;  4KO8 A;  3I04 M;  2QPA A;  1P3L D;  1GO5 A;  1OKS A;  3JR4 A;  2VF7 A;  2ZY3 A;  2FJ7 B;  3KSX A;  3AN2 C;  1YUB A;  2VDB B;  4DV3 M;  1T3T A;  4ZBJ C;  2FFF B;  5B33 C;  3KW6 A;  2RGO A;  5B33 D;  4GHA A;  2QCU A;  1P3I D;  4WU8 C;  2FFJ A;  4JI1 M;  4QOS A;  2DWM A;  3H0M C;  2QNJ A;  4XUJ B;  1SG9 A;  3X1S B;  5FUG A;  2C5R A;  2Y2H A;  3HJ8 A;  5AV9 B;  4OU7 A;  3WA9 C;  1TDZ A;  1ZMW A;  4I8O A;  2KW0 A;  3W96 C;  3LZ1 C;  3W96 D;  4J8X A;  3LZ1 D;  4B08 A;  4NRW A;  1ZLA D;  2Q2E B;  4NE6 A;  3AFA D;  3CF0 A;  5ITX A;  3LJA A;  1P3O A;  1GAB A;  4M0W A;  4X62 M;  5B1L B;  1PJJ A;  4L8R C;  1G3I A;  3AJI B;  5KQD A;  2HIO D;  2Y2Q A;  3AZL C;  1IN8 A;  3AZL D;  4H9R A;  5JRG B;  3AZI D;  3FYD A;  4FCW A;  4I81 A;  5DYI A;  4B3S M;  4QLC A;  5AVB A;  2UXB M;  1QZE A;  2J5Y A;  1HQ3 C;  1N34 M;  1HQ3 D;  3B74 A;  2FJ7 A;  3GLH A;  3B7N A;  4DR1 M;  3AZM C;  2UUC M;  2KHH A;  4DV0 M;  1K3X A;  3AZF B;  2F8N K;  3SAV A;  4X64 M;  2F2A C;  5KPT A;  2QP9 X;  5AV9 A;  1R2Z A;  5E6J A;  4CGY B;  3A45 A;  1W5S A;  3UT9 B;  4YS3 A;  1V33 A;  3AZJ C;  3AZJ D;  1PJI A;  1P3L B;  4J8U C;  3H0R C;  3KXE C;  3NWL A;  1ZQ9 A;  5KDM A;  1PM5 A;  3QYB A;  5B1L A;  1U35 A;  3FRI A;  2ARO C;  4ZBJ B;  5B33 B;  3REL D;  3U60 B;  3B89 A;  1P3P C;  1P3I B;  2V1C A;  1F66 D;  3AYW C;  4WU8 B;  5JI3 E;  4R7G A;  1R4V A;  3AKZ A;  4W5W A;  4MGY E;  4KGC A;  1G4A E;  1WR1 B;  2IO5 C;  2PYO A;  2NZD C;  2NZD D;  3W96 B;  3LZ1 B;  5BNX B;  1IQP A;  3AFA B;  3AFH A;  4JI6 M;  3B0D C;  1J5E M;  3AZF A;  2CHQ A;  5BPV A;  2QQ8 A;  2D7H A;  3PXG A;  2C96 A;  3IP4 C;  4RF1 A;  4AZF A;  1B6W A;  3WAA C;  3SFZ A;  3AZL B;  4X23 D;  5C1B A;  3AZI B;  4JJN C;  2N35 A;  1P3L A;  3IHP A;  1NJF A;  3W98 C;  1VG5 A;  1VEK A;  1Y8G A;  3W98 D;  1HQ3 B;  1OFH A;  3AN2 A;  1M18 D;  5B33 A;  3U60 A;  5H37 D;  1N77 A;  2GNO A;  4WU8 A;  2KRU A;  4BB9 A;  2ZAN A;  4B7H A;  4M6B A;  1EIJ A;  4IBD A;  3AV1 C;  3B6F C;  3WA9 A;  3LEL D;  2K6B A;  4HLQ A;  1JB0 F;  4H9P B;  3I4V A;  3W96 A;  3LZ1 A;  2DAG A;  1QAO A;  2JWS A;  4EO5 C;  3AZJ B;  2C99 A;  5CP6 C;  2RKO A;  3TWM A;  4GHL A;  1ZMV A;  3HKP A;  3C58 A;  3SAT A;  2JP7 A;  2MR9 A;  3HHW A;  3LQR A;  2G5I C;  3REL B;  1F66 B;  1P3P B;  2R44 A;  3EPK A;  3AZL A;  1KX3 C;  3W97 C;  1N78 A;  4JI0 M;  4FWD A;  3V76 A;  4H9Q B;  3AOE C;  4HGA B;  2IO5 B;  1ZAE A;  4CJ6 A;  5AV8 C;  1ULY A;  2NZD B;  3QWL A;  4HL4 A;  5CPK C;  3AZM A;  1D0M A;  2F5S A;  4F1I A;  3B0D B;  4BBA A;  3A1K A;  2F5O A;  5GT3 C;  4ZPX A;  4X23 B;  4B7F A;  3MGS C;  3REJ C;  3MGS D;  2Y2N A;  3AZJ A;  5JI2 E;  3X1T C;  3WKJ C;  5CPJ C;  4OW0 A;  3X1T D;  3B7Q A;  4J8U A;  3W98 B;  5ITU A;  1HJP A;  3VFD A;  4PT5 A;  1P34 D;  2ARO A;  1P3P A;  4G4R A;  3AYW A;  2ERC A;  1MJG M;  5BT1 C;  2NQB C;  3UMM A;  5GT0 D;  3REI D;  3GQ3 A;  4LJ4 A;  3TPZ A;  3LQQ A;  1PZR A;  2Y0Q A;  3LEL B;  4OVZ B;  3AV1 B;  3U6O A;  1QAM A;  5AY8 C;  3FUX A;  5AY8 D;  2JXN A;  5CP6 B;  5KPR A;  1HNX M;  2XZF A;  3KUY D;  3JR5 A;  3FUW A;  1MX0 A;  4HEO A;  3WAA A;  1QUS A;  1HNZ M;  2RVQ C;  3M6A A;  2RVQ D;  2BWB A;  3KP1 E;  3VLF B;  3VKG A;  1P3M D;  1SXJ E;  4JJN A;  4X66 M;  3GLG E;  3W98 A;  3HHX A;  5B2J C;  1JR3 A;  4QHS A;  3V9R A;  3WHL A;  1ZMU A;  3HJS A;  5B2J D;  4QOZ C;  1XHB A;  4AG5 A;  3GPY A;  1DV0 A;  1BH8 B;  5B31 D;  3NBX X;  5B32 D;  4QNR A;  3K8Z A;  2DZN B;  2CWE A;  3K92 A;  4L15 A;  4WP2 A;  2F8N A;  4OVZ A;  3AV1 A;  3VH5 A;  3B6F A;  2CV5 A;  3SYK A;  3X1V D;  4LJ6 A;  1KX4 D;  5EXP A;  2ZM6 M;  1M1A C;  3MGS B;  3MJ5 A;  4NSR A;  4JI4 M;  5GXQ C;  3X1T B;  5CP6 A;  5GXQ D;  2ZY5 A;  3EG5 B;  4QNM A;  1TF0 B;  3EIH A;  2YQZ A;  4R8P C;  4R8P D;  1P34 B;  2XH9 A;  1IXR C;  3IEC A;  3TU4 C;  2KNV A;  2EA0 A;  1KX3 A;  2JY7 A;  2HL7 A;  3W97 A;  2NQB B;  2R65 A;  4FCT A;  4LFC M;  3VH6 W;  2KZU A;  3REI B;  4NOO B;  2R4E A;  2Y21 A;  1E9R A;  3A6N C;  1HQC A;  3AOE A;  3KS8 A;  5AV8 A;  5AY8 B;  4LF6 M;  3AV2 C;  4GIT A;  3AV2 D;  2CWB A;  1KFV A;  5CPK A;  4DR6 M;  1BH8 A;  3DOA A;  3W99 C;  2JE5 A;  3NBI A;  4I5S A;  4UUZ A;  3KUY B;  3KFU G;  5GT3 A;  1S3S A;  2C9O A;  3A46 A;  1TDH A;  1EQZ C;  1NY5 A;  3C3D A;  1QAN A;  5ITT A;  3MGS A;  1P3M B;  3REJ A;  2R45 A;  1P3O D;  3GPU A;  4G3O A;  3X1T A;  3FD9 A;  3WKJ A;  5CPJ A;  4KUD C;  2L4F A;  5B2J B;  1R6B X;  1OFI A;  4LJ9 A;  1C7Y A;  4M9X A;  4DV6 M;  4NFT A;  3DA1 A;  4IBB A;  4QLC D;  3QYE A;  5AVB D;  5B31 B;  5B0Z C;  3KWQ C;  3MNN C;  5B0Z D;  3KWQ D;  3KXB C;  5B32 B;  3KXB D;  2FJ7 D;  2NQB A;  2ZBK B;  2F5P A;  1EFU B;  4IIW A;  1HQY E;  2J7N A;  3X1V B;  3HX3 A;  5AY8 A;  1KX4 B;  2LH0 A;  1VQ1 A;  3U6L A;  1M1A B;  2BNK A;  4LRT A;  2HHH M;  4ZUX C;  4ZUX D;  2DF4 C;  4WJ3 C;  3J7A S;  5GXQ B;  2VF8 A;  4LFB M;  2DAK A;  4YS3 D;  2FS1 A;  2DWN A;  4R8P B;  1S32 C;  4L4U A;  3VH6 T;  1S32 D;  3THG A;  3GLF A;  1WWI A;  4LD9 C;  1R5L A;  4LD9 D;  3LCV B;  3K9P A;  4MM3 B;  1U35 D;  1IY1 A;  5B2J A;  4Z6Y A;  3REK C;  3REK D;  3AV2 B;  1DGB A;  1TAF A;  4KGC D;  3GLI E;  2XF3 A;  3MVD C;  5EQT A;  2PYO D;  5ITR A;  3CF2 A;  3KDS E;  1XXH B;  4LGY A;  2FE8 A;  1A5T A;  3DZD A;  2UXC M;  2OQ4 A;  4YHH M;  1PJQ A;  1M1A A;  1P3O B;  2LVA A;  2C9C A;  2ZY4 A;  4Z5T C;  3J2P B;  5GXQ A;  4KUD B;  1VDL A;  4H9R B;  3ZH9 B;  4R8P A;  4D81 A;  4QLC B;  4NL4 H;  3GO8 A;  4JYA M;  3LW5 F;  5B0Z B;  3KWQ B;  3TU4 A;  3KXB B;  4B7G A;  1R7R A;  3E21 A;  3GLH B;  3AN2 D;  5DNM C;  5DNM D;  2CUZ A;  1IY2 A;  1P3Q Q;  2KNA A;  3A6N A;  2LHG A;  2CV2 A;  4LF4 M;  1PGY A;  4WU8 D;  4IBC A;  2UUA M;  3MMP A;  3AV2 A;  3O62 C;  1L8Q A;  4ZUX B;  3WA9 D;  3W99 A;  1G59 A;  4YS3 B;  3TWL A;  1XXH A;  2X49 A;  3I51 A;  1S32 B;  2LVN C;  3X1U C;  3X1U D;  1E32 A;  1EQZ A;  2A5Y B;  3HY5 A;  2FNA A;  4R71 A;  4G92 B;  5KDM B;  4LD9 B;  3W0L B;  3VK8 A;  1U35 B;  3W68 A;  4CHT B;  2RIQ A;  1TZY C;  3GRY A;  4KUD A;  3VKH A;  1J09 A;  3REK B;  3DFZ A;  1AUA A;  1VEJ A;  4KGC B;  4DR3 M;  3E46 A;  2BJW A;  1Z6T A;  5B0Z A;  3KWQ A;  3MNN A;  1PJS A;  2DHY A;  3KXB A;  4KT0 F;  3MVD B;  3GP1 A;  2PYO B;  5KPZ A;  2CRU A;  4JI7 M;  4LZJ A;  3E9S A;  2FH0 A;  3AZM D;  4FVM A;  3REH C;  2Z7J A;  3REH D;  4IBF A;  3B0C W;  3WHK A;  4ZUX A;  2O5R A;  1Q02 A;  1K3W A;  4YM6 C;  3K1J A;  3M7G A;  3B7Z A;  4AKG A;  5EP2 A;  4Z2M G;  2BJV A;  4RF0 A;  1S32 A;  1PRB A;  4DR4 M;  1WJ7 A;  4J8U D;  2DAI A;  3KOW E;  3AN2 B;  5BS7 C;  4LD9 A;  2LVO C;  1FJG M;  3RGP A;  2Y2J A;  5DNM B;  3LCU A;  1Z5A A;  2ARO D;  1P3P D;  2XSZ D;  4AWL C;  3AYW D;  1DGH B;  1QQW A;  2G5H C;  5FSW A;  1XMO M;  3REK A;  3FUT A;  3J27 B;  5AVC C;  4REZ A;  2JY6 B;  5AVC D;  1XMQ M;  5B0Y C;  2MH8 A;  3WA9 B;  3J80 S;  5IZ7 D;  3MVD A;  2BYK A;  2E5L M;  1L2D A;  2LVP C;  2O25 A;  1TH4 A;  4IBE A;  3X1U B;  4MB7 A;  1GKI A;  1TTE A;  4CIZ A;  4Z8X A;  4NXM M;  2H5X A;  2F5N A;  4Z5T A;  1X37 A;  3WAA D;  4L16 A;  3FTE A;  3MHV C;  2VQE M;  3AZN C;  3AZN D;  1AOI C;  3W67 A;  4MGK E;  3SAW A;  4JJN D;  1AOI D;  2K47 A;  3F6T A;  1JR3 D;  3AL0 C;  3HGI A;  1WGN A;  5E5A C;  4DV5 M;  2M60 A;  5DNM A;  2OOA A;  3B0C T;  3AZM B;  4LJ8 A;  2JY8 A;  1DGH A;  4PDI A;  3EPL A;  3REH B;  2Y20 A;  5DFL A;  2VQR A;  2OO9 A;  2LNH C;  2Z3X A;  3O62 A;  3MGQ C;  3MGQ D;  2F8N D;  4IBJ A;  3WTP E;  3AV1 D;  2OOB A;  2CV5 C;  3B6F D;  2CV5 D;  1ORY B;  4MH0 E;  4PD2 A;  2BWE A;  4UPK A;  3X1U A;  2LBC A;  1A7W A;  3GLI A;  4J8U B;  5CP6 D;  1ID3 C;  5FLX S;  5BR8 M;  3HHZ A;  2XFS A;  1ID3 D;  4AKH A;  1Z5C A;  4G4N A;  2ARO B;  2F4V M;  1P3G C;  1P3G D;  3AYW B;  1NV8 A;  3TWK A;  3SMS A;  1TZY A;  4AWL B;  4GC5 A;  1KX3 D;  3W97 D;  1I94 M;  2M5Z A;  3VDP A;  3GQ4 A;  5AVC B;  4DV7 M;  2X4A A;  5B2I C;  4ANR A;  4FCV A;  3SAU A;  1N1J A;  2XD1 A;  5AV8 D;  2B3T A;  4JI5 M;  5FTL A;  5G49 A;  2CV1 A;  1IY0 A;  2DNA A;  3UTB C;  3PNV A;  3U6E A;  5CPK D;  4JI8 M;  4RNA A;  1N75 A;  3REH A;  2GQF A;  1JFI A;  3RGS A;  3NQJ B;  5JA4 B;  4CIS A;  1L2C A;  5EXS A;  2V1U A;  5GT3 D;  1E9S A;  3WAA B;  4YM6 A;  2I7P A;  5EXX A;  4B3R M;  2ZM5 A;  3REJ D;  3AZN B;  1IN7 A;  4JJN B;  1E94 E;  1AOI B;  3KS4 A;  2JZ0 A;  3WKJ D;  5FTJ A;  5CPJ D;  4DRB A;  3HJQ A;  3V9R B;  3WTP C;  3FTC A;  2CV0 A;  2X8A A;  5BS7 A;  5E5A B;  4WNN A;  3HWS A;  5E26 A;  2XSZ A;  1T3U A;  5BT1 D;  1D0K A;  1IN5 A;  3L29 A;  2NQB D;  3FYC A;  5AVC A;  3MGQ B;  2F8N B;  5B0Y A;  1DO0 A;  3B6F B;  2CV5 B;  4LY6 A;  1H3O B;  4G4O A;  2HUE C;  2F8N H;  4WZS B;  3FUU A;  7CAT A;  2ZTD A;  4WW0 A;  4EO5 B;  2L6O A;  2CHG A;  2DVW B;  2KEB A;  5CPI C;  5ITQ A;  3U6P A;  2L7I A;  2XD5 A;  1ID3 B;  2RRU A;  3NQJ A;  5JA4 A;  1BVS A;  3C1B C;  1P3G B;  1IFY A;  1TR8 A;  4DV4 M;  1KX3 B;  3W97 B;  3BXW A;  3AZN A;  2UU9 M;  1NNU C;  1P3F C;  1AOI A;  4B3M M;  1P3F D;  3EIE A;  5AV8 B;  2YFW A;  2RGH A;  2R62 A;  3GQ5 A;  5E5A A;  2MGW A;  5L8R F;  3SAS A;  5CPK B;  1YE9 A;  2Z4R A;  1CUK A;  5FTM A;  2L4E A;  5C3I C;  2ZTC A;  4UUZ B;  3MGQ A;  4DR2 M;  4B3T M;  5GT3 B;  1NVM A;  1H3O A;  4GEW A;  1GVN A;  2YFQ A;  5ITX E;  3NQU B;  2DKL A;  3REJ B;  4LZZ A;  1M1A D;  3ZQJ A;  3PVS A;  3WKJ B;  2Y2I A;  5CPJ B;  2ZAO A;  1YSY A;  5AV6 C;  3BBZ A;  5DNN C;  1ID3 A;  1BH9 B;  1GLN A;  2Z4S A;  4NSO B;  4J8V C;  3T15 A;  4FD2 A;  1P3G A;  1R2Y A;  3TU4 D;  2O01 F;  2Y2P A;  1KX5 C;  3GLH E;  2WSE F;  4GIP A;  3A6N D;  5B2I A;  5ITY A;  2QZ4 A;  1Q39 A;  2R0I A;  2HKJ A;  2Y2K A;  4GKK M;  4EIW A;  3U6C A;  5BO0 A;  1SXJ C;  4CSR A;  1IXS B;  1SXJ D;  3UTB A;  4GMQ A;  4NE3 A;  3W99 D;  5CPI B;  3CGW A;  1GL6 A;  2DI0 A;  1XC8 A;  1P3B C;  2D7G A;  1EQZ D;  1N36 M;  1WWS A;  3GLF B;  3NQU A;  3E4R A;  1P3F B;  3U5Z B;  4KUD D;  1BH9 A;  3WTP A;  2DXI A;  4A3V B;  1IN6 A;  1TAF B;  3RFW A;  1G71 A;  2XFT A;  5EP3 A;  3MNN D;  4KHA B;  4XK8 F;  1Z2C B;  5C3I B;  1IBM M;  3AZG C;  2DHR A;  3U61 B;  4KHP M;  1W5T A;  1C1K A;  3FTD A;  2R18 A;  3HZJ A;  2LVQ D;  3HU1 A;  3L27 A;  1HT1 E;  1OIZ A;  4LG2 A;  4BLC A;  1IXS A;  2HCB A;  1DGG A;  3KSY A;  5B1M C;  5CPI A;  5B1M D;  4LJA A;  3GRR A;  3UGJ A;  3U6S A;  4I4L A;  4IBI A;  3C1B A;  4XUJ C;  4F2L A;  3X1S C;  3TU4 B;  5IWA M;  1HTA A;  2QBY B;  4NE5 A;  3ZCB B;  1P3F A;  5EP4 A;  1Z5B A;  3U5Z A;  4WU9 C;  2L09 A;  3A6N B;  4DQY B;  2QEN A;  3ILK A;  3UJN A;  3J7B A;  4JI2 M;  2LHC A;  4AQY M;  2WSF F;  3Q8G A;  1SXJ B;  1OIP A;  3F92 A;  4KHA A;  3W99 B;  3GLG B;  1K82 A;  4ITQ A;  2LY8 A;  3MVD D;  1IN4 A;  4XGI A;  1HR0 M;  2JY5 A;  1P3B B;  2ZY2 A;  5JRG C;  3U61 A;  1EQZ B;  2EKK A;  2DZL A;  2EO2 A;  4KLN A;  4LF9 M;  2DZO B;  4R3D A;  4FWG A;  1GJT A;  1LTM A;  4UN2 B;  5DYG A;  4Z5T D;  3D8L A;  3SC3 A;  2HWJ A;  1XNQ M;  5AV6 A;  4DV1 M;  5DNN A;  3KVW A;  4RKU F;  1TH3 A;  4LCB A;  4J8V A;  1T43 A;  4CAY A;  5AV5 C;  1UM8 A;  5AV5 D;  3MNN B;  2KDL A;  2QBY A;  5GKN A;  2H1R A;  3SAR A;  3CTW B;  4NC6 A;  1KX5 A;  3SBJ A;  2MJ5 B;  3UT9 C;  1P3A C;  1NJG A;  1P3A D;  1IM2 A;  1QAQ A;  3AOG A;  3O62 D;  1KSF X;  1SXJ A;  1IBK M;  1G8P A;  3GLG A;  5B1M B;  3SHG B;  2G3Q A;  1OAO C;  1L1Z A;  4MGI E;  1P3I C;  2XLJ A;  1P3B A;  3EPH A;  1WXQ A;  1ZV1 A;  1UFZ A;  3LVW A;  2YFV A;  3D8B A;  5KQ8 A;  1PJT A;  3GRV A;  4XBO A;  3RE8 A;  3MGP C;  4WU9 B;  3MGP D;  1ZLA C;  3GPX A;  1G41 A;  1Q3B A;  1TZY D;  3AFA C;  1KU5 A;  2G5G X;  3GRU A;  5EXT A;  3VH5 W;  1RU3 A;  3UTA C;  3UTA D;  1Q9C A;  4WUR A;  2EKF A;  2BYK B;  2HIO C;  2L5A A;  5BNV B;  3AZG A;  3AZI C;  2FOI C;  1DO2 A;  2CEA A;  3TL4 X;  1IXZ A;  2D7E A;  1BFM A;  5B24 C;  2JCH A;  1VDD A;  5B24 D;  4NXN M;  4LFA M;  4Z5T B;  1XB2 B;  5IT9 S;  5B1M A;  4YM6 D;  3L28 A;  3R9X B;  5B31 G;  4XZQ C;  4K0K M;  4XZQ D;  5B32 G;  4E44 A;  2L7H A;  4G6Z A;  3CF6 E;  2ZAM A;  5AV5 B;  4XUJ A;  2YNM D;  3X1S A;  3UK6 A;  4J8W C;  5EJC A;  5CHL B;  4J8W D;  1JR3 E;  3GPP A;  4X65 M;  4WU9 A;  3PNY A;  2R46 A;  1P3A B;  2OPF A;  3OTO M;  3O62 B;  1N32 M;  5FTN A;  5B0Y D;  4H9S C;  2APL A;  3REL C;  5FTK A;  1F66 C;  5BNV A;  4L6V 6;  3K9O A;  2YR0 A;  5JRG A;  3U6D A;  3GLI B;  5B40 C;  4DR5 M;  5B40 D;  4LF5 M;  1Z59 A;  2CHV A;  4HGA C;  1NO1 A;  5IRE B;  3VH5 T;  3MGP B;  1TZY B;  1ZLA B;  3BOS A;  3VH6 A;  1IBL M;  4DRA A;  1QZM A;  1MN3 A;  1HT2 E;  4JI3 M;  5AV5 A;  1M19 C;  3UTA B;  1M19 D;  2EUC A;  1H6U A;  1N1J B;  3H4J A;  1XWI A;  2JA2 A;  4MGZ E;  1N33 M;  2HIO B;  5E5A D;  4X23 C;  5G49 B;  1KYI A;  3UT9 A;  4Y28 F;  1TGU A;  1P3A A;  3R45 B;  2CP8 A;  1NNJ A;  5B24 B;  1JFI B;  1OJL A;  2DQN C;  4DV2 M;  1M18 C;  4YM6 B;  4XZQ B;  2JZ1 A;  1P3I A;  2C98 A;  3C1C C;  3C1C D;  4LF7 M;  4J8W B;  2KZS A;  3T38 A;  3LEL C;  3EPJ A;  4WNN B;  2DAM A;  1XNR M;  3MGP A;  1D0L A;  4M0D A;  3MGR C;  2BG1 A;  3MGR D;  1ZLA A;  3T1H M;  2L2D A;  5BNX A;  3AFA A;  3B9P A;  4WV4 B;  3AZK C;  3UTA A;  3AZK D;  5B0Y B;  5B2I D;  3B6G C;  1NV9 A;  3B6G D;  2HIO A;  4S12 A;  4MGH A;  2KA6 B;  3AZI A;  4DUY M;  3T1Y M;  3UTB D;  2LTU A;  3ZC7 B;  1VEG A;  3R45 A;  4GRI A;  3SYL A;  5B40 B;  3I4Y A;  2VQF M;  5B24 A;  4AG6 A;  4G91 C;  3W0F A;  1HQ3 A;  5LMU M;  4XZQ A;  4II7 A;  4H9O B;  1NSF A;  4M9S A;  3GLF E;  4GH9 A;  1M19 B;  3AZH C;  3AZH D;  2G8L A;  4J8W A;  2YFW B;  3WTP D;  5C18 A;  3C9P A;  1J7K A;  4H9P A;  4JXJ A;  2HAK A;  4IBK A;  2R6F A;  2CFO A;  4LGM A;  3KSJ A;  1HNW M;  1M18 B;  4H9S A;  1P34 C;  3REL A;  4KOD A;  4OX9 M;  3L25 A;  2Y2M A;  1F66 A;  3HHY A;  2XGN A;  3C1C B;  2CE7 A;  2K0B X;  3FTF A;  5GT0 C;  3REI C;  5CPI D;  5B40 A;  4H9Q A;  3KOY E;  3L26 A;  2XEP A;  3A98 B;  3C1B D;  2NZD A;  1QUT A;  2WZJ A;  4Z66 C;  3MGR B;  4FWH A;  4Z66 D;  1WIV A;  2VII A;  2QSF X;  4PDG A;  4H9O A;  1P3K C;  1P3K D;  3AZK B;  1M19 A;  1QDT A;  5B2I B;  3KUY C;  2EJS A;  3B6G B;  1I4W A;  1JQJ C;  4X23 A;  1FNN A;  5BO0 B;  3TQS A;  1YLA A;  4CSR B;  3KP0 E;  2KXE A;  3UTB B;  1P3M C;  4E45 A;  2DEN A;  2KNZ A;  4TUW A;  1R4G A;  1T6O A;  2WSC F;  4M9Z A;  4YY3 M;  3IG5 A;  4G91 B;  3J81 S;  4LJ7 A;  1DGF A;  4L78 A;  5GSU C;  1XXH E;  5F99 C;  1M18 A;  5GSU D;  1NHG C;  5F99 D;  3HU3 A;  3A1I A;  5B31 C;  3T6P A;  5B32 C;  1NHW C;  3UZU A;  2LWX A;  3LMM A;  3C1C A;  2AHM A;  3VK7 A;  4AKI A;  3AZE C;  3AZH B;  3AZE D;  5AV6 D;  3FRH A;  3KOX E;  3QAU A;  3WTP B;  5DNN D;  4D80 A;  4G4Q A;  4FW9 A;  3LEL A;  4J8V D;  3SMP A;  3X1V C;  5EP1 A;  2BYM B;  1KX4 C;  3L2A A;  2UWX A;  4LF8 M;  3MGR A;  1W2E A;  1QYR A;  4DR7 M;  1WGL A;  3C3E A;  1KX5 D;  3AZK A;  3LZ0 C;  1D2N A;  3LZ0 D;  3H0L C;  4DBG B;  4GKJ M;  4D82 A;  3B0B A;  3B6G A;  2KRK A;  2HUE B;  2UUB M;  3A42 A;  1V34 A;  1WHC A;  2Y0T A;  3K2L A;  5GT0 B;  2P5T A;  3R8F A;  4P16 A;  3FKE A;  4QHT A;  1P3B D;  4GC9 A;  3C1B B;  1TH2 A;  4Z66 B;  3AV0 A;  3LVV A;  1F1E A;  5DNY A;  1AIP C;  3HU2 A;  1P3K B;  2V6Z M;  1MU5 A;  3AZH A;  1OQY A;  4J8X C;  3JAM S;  3FE3 A;  5LMN M;  4JV5 M;  4J8X D;  2LXE A;  3U6Q A;  3FUV A;  2BYM A;  3VDU A;  3LJA C;  2W8S A;  3LJA D;  1P3O C;  4DUZ M;  1QVR A;  2Y2G A;  2JUJ A;  4IJE A;  3AZG D;  1GL7 A;  5GSU B;  5F99 B;  2JSS A;  4QLC C;  3H4M A;  3SHF A;  1P34 A;  5AVB C;  1LV7 A;  4Q7J A;  2NQ8 C;  1L1T A;  2FJ7 C;  3P5J B;  1GJS A;  3AZE B;  1QDR A;  5GT0 A;  3REI A;  5AV6 B;  2Z8Y M;  4AW4 A;  5DNN B;  4H9N B;  4Z2M H;  4J8V B;  4CAY B;  1F4I A;  4XUJ D;  4JN6 A;  4Z66 A;  3X1S D;  2F8N G;  1B67 A;  4IBG A;  1EE8 A;  4LRS A;  5AV9 C;  2I7N A;  2DWL A;  5AV9 D;  1OAI A;  3LJA B;  3Q8X A;  1P3K A;  3MK6 A;  1KX5 B;  4YS3 C;  2JNH A;  1OTR A;  3U6M A;  4WU9 D;  3LZ0 B;  4LJ5 A;  3KUY A;  5KO3 A;  3M0E A;  3TE6 A;  8CAT A;  3KOZ E;  3PFI A;  4G92 C;  1P3M A;  2Y2O A;  2XZU A;  4P17 A;  1V92 A;  5B1L C;  1U35 C;  5B1L D;  2K9D A;  4AI6 A;  2QHO B;  5GSU A;  5JRG D;  5F99 A;  2UXD M;  2W82 A;  5FUG B;  2YFV B;  4KGC C;  5B31 A;  2Y2L A;  4NRV A;  5B32 A;  2PYO C;  2DWZ B;  3AZE A;  4PCZ A;  5F3W A;  4J8X B;  4H9N A;  2R4J A;  3FDD A;  3AZF C;  2F5Q A;  3AZF D;  2MRO B;  2J8P A;  3X1V A;  5A2Q S;  1KX4 A;  4IJF A;  1L2B A; 
#chains in the Genus database with same CATH homology
 1NY6 A;  3AZG B;  3LZ0 A;  3UT9 D;  1Q3C A;  5AVB B;  3IG8 A;  1P3L C;  2J7O A;  4KO8 A;  2QPA A;  1P3L D;  3JR4 A;  2ZY3 A;  2FJ7 B;  3KSX A;  3AN2 C;  1YUB A;  4DV3 M;  1T3T A;  4ZBJ C;  2FFF B;  5B33 C;  3KW6 A;  2RGO A;  5B33 D;  4GHA A;  2QCU A;  1P3I D;  4WU8 C;  2FFJ A;  4JI1 M;  4QOS A;  2DWM A;  3H0M C;  4XUJ B;  3X1S B;  5FUG A;  2C5R A;  2Y2H A;  3HJ8 A;  5AV9 B;  4OU7 A;  3WA9 C;  1TDZ A;  4I8O A;  2KW0 A;  3W96 C;  3LZ1 C;  3W96 D;  4J8X A;  3LZ1 D;  4B08 A;  4NRW A;  1ZLA D;  2Q2E B;  4NE6 A;  3AFA D;  3CF0 A;  5ITX A;  3LJA A;  1P3O A;  4M0W A;  4X62 M;  5B1L B;  1PJJ A;  4L8R C;  1G3I A;  3AJI B;  5KQD A;  2HIO D;  2Y2Q A;  3AZL C;  1IN8 A;  3AZL D;  4H9R A;  5JRG B;  3AZI D;  3FYD A;  4FCW A;  4I81 A;  5DYI A;  4B3S M;  4QLC A;  5AVB A;  2UXB M;  1HQ3 C;  1N34 M;  1HQ3 D;  2FJ7 A;  3GLH A;  4DR1 M;  3AZM C;  2UUC M;  4DV0 M;  1K3X A;  3AZF B;  2F8N K;  3SAV A;  4X64 M;  2F2A C;  5KPT A;  2QP9 X;  5AV9 A;  1R2Z A;  5E6J A;  4CGY B;  3A45 A;  1W5S A;  3UT9 B;  4YS3 A;  3AZJ C;  3AZJ D;  1PJI A;  1P3L B;  4J8U C;  3H0R C;  3KXE C;  3NWL A;  1ZQ9 A;  5KDM A;  1PM5 A;  5B1L A;  1U35 A;  2ARO C;  4ZBJ B;  5B33 B;  3REL D;  3U60 B;  1P3P C;  1F66 D;  1P3I B;  2V1C A;  3AYW C;  4WU8 B;  5JI3 E;  4R7G A;  1R4V A;  3AKZ A;  4W5W A;  4MGY E;  4KGC A;  1G4A E;  2IO5 C;  2PYO A;  2NZD C;  2NZD D;  3W96 B;  3LZ1 B;  5BNX B;  1IQP A;  3AFA B;  3AFH A;  4JI6 M;  3B0D C;  1J5E M;  3AZF A;  2CHQ A;  5BPV A;  2D7H A;  3PXG A;  2C96 A;  3IP4 C;  4RF1 A;  4AZF A;  1B6W A;  3WAA C;  3SFZ A;  3AZL B;  4X23 D;  5C1B A;  3AZI B;  4JJN C;  1P3L A;  1NJF A;  3W98 C;  3W98 D;  1HQ3 B;  1OFH A;  3AN2 A;  1M18 D;  5B33 A;  3U60 A;  5H37 D;  1N77 A;  4WU8 A;  2KRU A;  4BB9 A;  2ZAN A;  4B7H A;  4M6B A;  4IBD A;  3AV1 C;  3B6F C;  3WA9 A;  3LEL D;  4HLQ A;  4H9P B;  3I4V A;  3W96 A;  3LZ1 A;  1QAO A;  4EO5 C;  3AZJ B;  2C99 A;  5CP6 C;  2RKO A;  3TWM A;  4GHL A;  3HKP A;  3C58 A;  3SAT A;  3HHW A;  3LQR A;  2G5I C;  3REL B;  1F66 B;  1P3P B;  3EPK A;  3AZL A;  1KX3 C;  3W97 C;  1N78 A;  4JI0 M;  4FWD A;  4H9Q B;  3AOE C;  4HGA B;  2IO5 B;  1ZAE A;  5AV8 C;  1ULY A;  2NZD B;  3QWL A;  4HL4 A;  5CPK C;  3AZM A;  2F5S A;  3B0D B;  4BBA A;  3A1K A;  2F5O A;  5GT3 C;  4ZPX A;  4X23 B;  4B7F A;  3MGS C;  3REJ C;  3MGS D;  2Y2N A;  3AZJ A;  5JI2 E;  3X1T C;  3WKJ C;  5CPJ C;  4OW0 A;  3X1T D;  4J8U A;  3W98 B;  5ITU A;  3VFD A;  4PT5 A;  1P34 D;  2ARO A;  1P3P A;  4G4R A;  3AYW A;  2ERC A;  5BT1 C;  2NQB C;  3UMM A;  5GT0 D;  3REI D;  3GQ3 A;  4LJ4 A;  3TPZ A;  3LQQ A;  1PZR A;  2Y0Q A;  3LEL B;  4OVZ B;  3AV1 B;  3U6O A;  1QAM A;  5AY8 C;  3FUX A;  5AY8 D;  5CP6 B;  5KPR A;  1HNX M;  2XZF A;  3KUY D;  3JR5 A;  3FUW A;  1MX0 A;  3WAA A;  1HNZ M;  2RVQ C;  3M6A A;  2RVQ D;  3KP1 E;  3VLF B;  1P3M D;  3VKG A;  1SXJ E;  4JJN A;  4X66 M;  3W98 A;  3HHX A;  5B2J C;  1JR3 A;  4QHS A;  3WHL A;  3V9R A;  5B2J D;  3HJS A;  4QOZ C;  1XHB A;  4AG5 A;  3GPY A;  1BH8 B;  5B31 D;  5B32 D;  4QNR A;  3K8Z A;  2DZN B;  2CWE A;  3K92 A;  4L15 A;  2F8N A;  4OVZ A;  3AV1 A;  3VH5 A;  3B6F A;  2CV5 A;  3SYK A;  3X1V D;  4LJ6 A;  1KX4 D;  5EXP A;  2ZM6 M;  1M1A C;  3MGS B;  3MJ5 A;  4NSR A;  4JI4 M;  5GXQ C;  3X1T B;  5CP6 A;  5GXQ D;  2ZY5 A;  3EG5 B;  4QNM A;  3EIH A;  2YQZ A;  4R8P C;  4R8P D;  1P34 B;  2XH9 A;  1IXR C;  3TU4 C;  2EA0 A;  1KX3 A;  2HL7 A;  3W97 A;  2NQB B;  2R65 A;  4FCT A;  4LFC M;  3VH6 W;  2KZU A;  3REI B;  4NOO B;  2R4E A;  2Y21 A;  1E9R A;  3A6N C;  1HQC A;  3AOE A;  3KS8 A;  5AV8 A;  5AY8 B;  4LF6 M;  3AV2 C;  4GIT A;  3AV2 D;  1KFV A;  5CPK A;  4DR6 M;  1BH8 A;  3DOA A;  3W99 C;  2JE5 A;  3NBI A;  4I5S A;  4UUZ A;  3KUY B;  3KFU G;  5GT3 A;  1S3S A;  2C9O A;  3A46 A;  1TDH A;  1EQZ C;  1NY5 A;  1QAN A;  5ITT A;  3MGS A;  1P3M B;  3REJ A;  2R45 A;  1P3O D;  3GPU A;  3X1T A;  3FD9 A;  3WKJ A;  5CPJ A;  4KUD C;  5B2J B;  1R6B X;  1OFI A;  4LJ9 A;  4M9X A;  4DV6 M;  4NFT A;  3DA1 A;  4IBB A;  4QLC D;  5AVB D;  5B31 B;  5B0Z C;  3KWQ C;  3MNN C;  5B0Z D;  3KWQ D;  3KXB C;  5B32 B;  3KXB D;  2FJ7 D;  2NQB A;  2ZBK B;  2F5P A;  4IIW A;  1HQY E;  2J7N A;  3X1V B;  5AY8 A;  1KX4 B;  2LH0 A;  3U6L A;  1M1A B;  2BNK A;  4LRT A;  2HHH M;  4ZUX C;  4ZUX D;  2DF4 C;  4WJ3 C;  3J7A S;  5GXQ B;  4LFB M;  4YS3 D;  2DWN A;  4R8P B;  1S32 C;  4L4U A;  3VH6 T;  1S32 D;  3THG A;  3GLF A;  1WWI A;  4LD9 C;  4LD9 D;  4MM3 B;  1U35 D;  1IY1 A;  5B2J A;  4Z6Y A;  3REK C;  3REK D;  3AV2 B;  1DGB A;  1TAF A;  4KGC D;  2XF3 A;  3MVD C;  5EQT A;  2PYO D;  5ITR A;  3CF2 A;  3KDS E;  1XXH B;  4LGY A;  2FE8 A;  3DZD A;  2UXC M;  2OQ4 A;  4YHH M;  1M1A A;  1P3O B;  2C9C A;  2ZY4 A;  4Z5T C;  3J2P B;  5GXQ A;  4KUD B;  4H9R B;  3ZH9 B;  4R8P A;  4D81 A;  4QLC B;  4NL4 H;  3GO8 A;  4JYA M;  5B0Z B;  3KWQ B;  3TU4 A;  3KXB B;  4B7G A;  1R7R A;  3GLH B;  3AN2 D;  5DNM C;  5DNM D;  2CUZ A;  1IY2 A;  3A6N A;  2CV2 A;  4LF4 M;  4WU8 D;  4IBC A;  2UUA M;  3AV2 A;  3O62 C;  1L8Q A;  4ZUX B;  3WA9 D;  3W99 A;  1G59 A;  4YS3 B;  3TWL A;  1XXH A;  2X49 A;  3I51 A;  1S32 B;  3X1U C;  3X1U D;  1E32 A;  1EQZ A;  2A5Y B;  2FNA A;  4G92 B;  5KDM B;  4LD9 B;  3W0L B;  3VK8 A;  1U35 B;  4CHT B;  2RIQ A;  1TZY C;  3GRY A;  4KUD A;  3VKH A;  1J09 A;  3REK B;  3DFZ A;  4KGC B;  4DR3 M;  2BJW A;  1Z6T A;  5B0Z A;  3KWQ A;  3MNN A;  3KXB A;  2PYO B;  3MVD B;  3GP1 A;  5KPZ A;  4JI7 M;  4LZJ A;  3E9S A;  3AZM D;  4FVM A;  3REH C;  2Z7J A;  3REH D;  4IBF A;  3B0C W;  3WHK A;  4ZUX A;  2O5R A;  1K3W A;  4YM6 C;  3K1J A;  3M7G A;  4AKG A;  5EP2 A;  4Z2M G;  2BJV A;  4RF0 A;  1S32 A;  4DR4 M;  4J8U D;  3KOW E;  3AN2 B;  5BS7 C;  4LD9 A;  1FJG M;  3RGP A;  2Y2J A;  5DNM B;  1Z5A A;  2ARO D;  1P3P D;  2XSZ D;  4AWL C;  3AYW D;  1DGH B;  1QQW A;  2G5H C;  5FSW A;  1XMO M;  3REK A;  3FUT A;  3J27 B;  5AVC C;  4REZ A;  5AVC D;  1XMQ M;  5B0Y C;  3WA9 B;  3J80 S;  5IZ7 D;  3MVD A;  2BYK A;  2E5L M;  1L2D A;  1TH4 A;  4IBE A;  3X1U B;  4MB7 A;  1GKI A;  4Z8X A;  4NXM M;  2F5N A;  4Z5T A;  1X37 A;  3WAA D;  4L16 A;  3FTE A;  3MHV C;  2VQE M;  3AZN C;  3AZN D;  1AOI C;  3SAW A;  4MGK E;  4JJN D;  1AOI D;  2K47 A;  3F6T A;  1JR3 D;  3AL0 C;  3HGI A;  5E5A C;  4DV5 M;  2M60 A;  5DNM A;  3B0C T;  3AZM B;  4LJ8 A;  1DGH A;  4PDI A;  3EPL A;  3REH B;  2Y20 A;  2VQR A;  2LNH C;  2Z3X A;  3O62 A;  3MGQ C;  3MGQ D;  2F8N D;  4IBJ A;  3WTP E;  3AV1 D;  2CV5 C;  3B6F D;  2CV5 D;  1ORY B;  4MH0 E;  4PD2 A;  4UPK A;  3X1U A;  1A7W A;  3GLI A;  4J8U B;  5CP6 D;  1ID3 C;  5FLX S;  5BR8 M;  3HHZ A;  2XFS A;  1ID3 D;  4AKH A;  1Z5C A;  4G4N A;  2ARO B;  2F4V M;  1P3G C;  1P3G D;  3AYW B;  1TZY A;  3TWK A;  3SMS A;  4AWL B;  4GC5 A;  1KX3 D;  3W97 D;  1I94 M;  2M5Z A;  3VDP A;  3GQ4 A;  5AVC B;  4DV7 M;  2X4A A;  5B2I C;  4FCV A;  3SAU A;  1N1J A;  2XD1 A;  5AV8 D;  4JI5 M;  5FTL A;  5G49 A;  2CV1 A;  1IY0 A;  3UTB C;  3PNV A;  3U6E A;  5CPK D;  4JI8 M;  4RNA A;  1N75 A;  3REH A;  1JFI A;  3RGS A;  3NQJ B;  5JA4 B;  4CIS A;  1L2C A;  5EXS A;  2V1U A;  5GT3 D;  1E9S A;  3WAA B;  4YM6 A;  2I7P A;  5EXX A;  4B3R M;  2ZM5 A;  3REJ D;  3AZN B;  1IN7 A;  4JJN B;  1E94 E;  1AOI B;  3KS4 A;  3WKJ D;  5FTJ A;  5CPJ D;  4DRB A;  3HJQ A;  3V9R B;  3WTP C;  3FTC A;  2CV0 A;  2X8A A;  5BS7 A;  5E5A B;  4WNN A;  3HWS A;  5E26 A;  2XSZ A;  1T3U A;  5BT1 D;  1IN5 A;  3L29 A;  2NQB D;  3FYC A;  5AVC A;  3MGQ B;  2F8N B;  5B0Y A;  1DO0 A;  3B6F B;  2CV5 B;  4LY6 A;  1H3O B;  4G4O A;  2HUE C;  2F8N H;  4WZS B;  3FUU A;  7CAT A;  4WW0 A;  4EO5 B;  2L6O A;  2CHG A;  2DVW B;  2KEB A;  5CPI C;  5ITQ A;  3U6P A;  2L7I A;  2XD5 A;  1ID3 B;  3NQJ A;  5JA4 A;  3C1B C;  1P3G B;  4DV4 M;  1KX3 B;  3W97 B;  3AZN A;  2UU9 M;  1NNU C;  1P3F C;  1AOI A;  4B3M M;  1P3F D;  3EIE A;  5AV8 B;  2YFW A;  2RGH A;  2R62 A;  3GQ5 A;  5E5A A;  3SAS A;  5CPK B;  1YE9 A;  2Z4R A;  5FTM A;  5C3I C;  4UUZ B;  3MGQ A;  4DR2 M;  4B3T M;  5GT3 B;  1NVM A;  1H3O A;  1GVN A;  2YFQ A;  5ITX E;  3NQU B;  3REJ B;  4LZZ A;  1M1A D;  3PVS A;  3WKJ B;  2Y2I A;  5CPJ B;  2ZAO A;  1YSY A;  5AV6 C;  5DNN C;  1ID3 A;  1BH9 B;  1GLN A;  2Z4S A;  4NSO B;  4J8V C;  3T15 A;  4FD2 A;  1P3G A;  1R2Y A;  3TU4 D;  2Y2P A;  1KX5 C;  4GIP A;  3A6N D;  5B2I A;  5ITY A;  2QZ4 A;  1Q39 A;  2HKJ A;  2Y2K A;  4GKK M;  4EIW A;  3U6C A;  5BO0 A;  1SXJ C;  4CSR A;  1IXS B;  1SXJ D;  3UTB A;  4GMQ A;  4NE3 A;  3W99 D;  5CPI B;  1GL6 A;  1XC8 A;  1P3B C;  2D7G A;  1EQZ D;  1N36 M;  1WWS A;  3GLF B;  3NQU A;  3E4R A;  1P3F B;  3U5Z B;  4KUD D;  1BH9 A;  3WTP A;  2DXI A;  4A3V B;  1IN6 A;  1TAF B;  3RFW A;  2XFT A;  5EP3 A;  3MNN D;  4KHA B;  1Z2C B;  5C3I B;  1IBM M;  3AZG C;  2DHR A;  3U61 B;  4KHP M;  1W5T A;  1C1K A;  3FTD A;  2R18 A;  3HU1 A;  3L27 A;  1HT1 E;  4LG2 A;  4BLC A;  2HCB A;  1DGG A;  3KSY A;  5B1M C;  5CPI A;  5B1M D;  4LJA A;  3GRR A;  3UGJ A;  3U6S A;  4I4L A;  4IBI A;  3C1B A;  4XUJ C;  3X1S C;  3TU4 B;  5IWA M;  1HTA A;  2QBY B;  4NE5 A;  3ZCB B;  1P3F A;  5EP4 A;  1Z5B A;  3U5Z A;  4WU9 C;  2L09 A;  3A6N B;  4DQY B;  2QEN A;  3ILK A;  3UJN A;  3J7B A;  4JI2 M;  4AQY M;  1SXJ B;  4KHA A;  3W99 B;  3GLG B;  1K82 A;  4ITQ A;  2LY8 A;  3MVD D;  1IN4 A;  4XGI A;  1HR0 M;  1P3B B;  2ZY2 A;  5JRG C;  3U61 A;  1EQZ B;  2EO2 A;  4KLN A;  4LF9 M;  2DZO B;  4R3D A;  4FWG A;  5DYG A;  4Z5T D;  3D8L A;  3SC3 A;  1XNQ M;  5AV6 A;  4DV1 M;  5DNN A;  3KVW A;  1TH3 A;  4LCB A;  4J8V A;  4CAY A;  5AV5 C;  1UM8 A;  5AV5 D;  3MNN B;  2QBY A;  5GKN A;  2H1R A;  3SAR A;  3CTW B;  1KX5 A;  3SBJ A;  3UT9 C;  1P3A C;  1NJG A;  1P3A D;  1IM2 A;  1QAQ A;  3AOG A;  3O62 D;  1KSF X;  1SXJ A;  1IBK M;  1G8P A;  3GLG A;  5B1M B;  3SHG B;  1L1Z A;  4MGI E;  1P3I C;  2XLJ A;  1P3B A;  3EPH A;  1WXQ A;  3LVW A;  2YFV A;  3D8B A;  5KQ8 A;  3GRV A;  4XBO A;  3RE8 A;  3MGP C;  4WU9 B;  3MGP D;  1ZLA C;  3GPX A;  1Q3B A;  1G41 A;  1TZY D;  3AFA C;  1KU5 A;  2G5G X;  3GRU A;  5EXT A;  3VH5 W;  3UTA C;  3UTA D;  1Q9C A;  4WUR A;  2BYK B;  2HIO C;  2L5A A;  5BNV B;  3AZG A;  3AZI C;  2FOI C;  1DO2 A;  2CEA A;  3TL4 X;  1IXZ A;  2D7E A;  1BFM A;  5B24 C;  2JCH A;  1VDD A;  5B24 D;  4NXN M;  4LFA M;  4Z5T B;  5IT9 S;  5B1M A;  4YM6 D;  3L28 A;  3R9X B;  5B31 G;  4XZQ C;  4K0K M;  4XZQ D;  5B32 G;  4E44 A;  2L7H A;  4G6Z A;  3CF6 E;  2ZAM A;  5AV5 B;  4XUJ A;  2YNM D;  3X1S A;  3UK6 A;  4J8W C;  5EJC A;  5CHL B;  4J8W D;  3GPP A;  4X65 M;  4WU9 A;  3PNY A;  2R46 A;  1P3A B;  2OPF A;  3OTO M;  3O62 B;  1N32 M;  5FTN A;  5B0Y D;  4H9S C;  3REL C;  5FTK A;  1F66 C;  5BNV A;  2YR0 A;  5JRG A;  3U6D A;  3GLI B;  5B40 C;  4DR5 M;  5B40 D;  4LF5 M;  1Z59 A;  2CHV A;  4HGA C;  5IRE B;  3VH5 T;  3MGP B;  1TZY B;  1ZLA B;  3BOS A;  3VH6 A;  1IBL M;  4DRA A;  1QZM A;  1HT2 E;  4JI3 M;  5AV5 A;  1M19 C;  3UTA B;  1M19 D;  2EUC A;  1H6U A;  1N1J B;  1XWI A;  2JA2 A;  4MGZ E;  1N33 M;  2HIO B;  5E5A D;  4X23 C;  5G49 B;  1KYI A;  3UT9 A;  1TGU A;  1P3A A;  3R45 B;  1NNJ A;  5B24 B;  1JFI B;  1OJL A;  2DQN C;  4DV2 M;  1M18 C;  4YM6 B;  4XZQ B;  1P3I A;  2C98 A;  3C1C C;  3C1C D;  4LF7 M;  4J8W B;  2KZS A;  3T38 A;  3LEL C;  3EPJ A;  4WNN B;  1XNR M;  3MGP A;  4M0D A;  3MGR C;  2BG1 A;  3MGR D;  1ZLA A;  3T1H M;  5BNX A;  3AFA A;  3B9P A;  4WV4 B;  3AZK C;  3UTA A;  3AZK D;  5B0Y B;  5B2I D;  3B6G C;  3B6G D;  2HIO A;  4S12 A;  4MGH A;  2KA6 B;  3AZI A;  4DUY M;  3T1Y M;  3UTB D;  3ZC7 B;  3R45 A;  4GRI A;  3SYL A;  5B40 B;  3I4Y A;  2VQF M;  5B24 A;  4AG6 A;  4G91 C;  3W0F A;  1HQ3 A;  5LMU M;  4XZQ A;  4II7 A;  4H9O B;  1NSF A;  4M9S A;  4GH9 A;  1M19 B;  3AZH C;  3AZH D;  2G8L A;  4J8W A;  2YFW B;  3WTP D;  5C18 A;  1J7K A;  4H9P A;  4JXJ A;  4IBK A;  2CFO A;  4LGM A;  3KSJ A;  1HNW M;  1M18 B;  4H9S A;  1P34 C;  3REL A;  4KOD A;  4OX9 M;  3L25 A;  2Y2M A;  1F66 A;  3HHY A;  2XGN A;  3C1C B;  2CE7 A;  3FTF A;  5GT0 C;  3REI C;  5CPI D;  5B40 A;  4H9Q A;  3KOY E;  3L26 A;  2XEP A;  3A98 B;  3C1B D;  2NZD A;  4Z66 C;  3MGR B;  4FWH A;  4Z66 D;  2VII A;  4PDG A;  4H9O A;  1P3K C;  1P3K D;  3AZK B;  1M19 A;  5B2I B;  3KUY C;  3B6G B;  1I4W A;  1JQJ C;  4X23 A;  1FNN A;  5BO0 B;  3TQS A;  4CSR B;  3KP0 E;  2KXE A;  3UTB B;  1P3M C;  4E45 A;  4TUW A;  4M9Z A;  4YY3 M;  3IG5 A;  4G91 B;  3J81 S;  4LJ7 A;  1DGF A;  4L78 A;  5GSU C;  5F99 C;  1M18 A;  5GSU D;  1NHG C;  5F99 D;  3HU3 A;  3A1I A;  5B31 C;  5B32 C;  1NHW C;  3UZU A;  2LWX A;  3LMM A;  3C1C A;  2AHM A;  3VK7 A;  4AKI A;  3AZE C;  3AZH B;  3AZE D;  5AV6 D;  3KOX E;  3QAU A;  3WTP B;  5DNN D;  4D80 A;  4G4Q A;  4FW9 A;  3LEL A;  4J8V D;  3SMP A;  3X1V C;  5EP1 A;  2BYM B;  1KX4 C;  3L2A A;  2UWX A;  4LF8 M;  3MGR A;  1W2E A;  1QYR A;  4DR7 M;  1KX5 D;  3AZK A;  3LZ0 C;  1D2N A;  3LZ0 D;  3H0L C;  4GKJ M;  4D82 A;  3B0B A;  3B6G A;  2KRK A;  2HUE B;  2UUB M;  3A42 A;  2Y0T A;  3K2L A;  5GT0 B;  2P5T A;  3R8F A;  4P16 A;  3FKE A;  4QHT A;  1P3B D;  4GC9 A;  3C1B B;  1TH2 A;  4Z66 B;  3AV0 A;  3LVV A;  1F1E A;  5DNY A;  3HU2 A;  1P3K B;  2V6Z M;  1MU5 A;  3AZH A;  4J8X C;  3JAM S;  5LMN M;  4JV5 M;  4J8X D;  2LXE A;  3U6Q A;  3FUV A;  2BYM A;  3VDU A;  3LJA C;  2W8S A;  3LJA D;  1P3O C;  4DUZ M;  1QVR A;  2Y2G A;  4IJE A;  3AZG D;  1GL7 A;  5GSU B;  5F99 B;  2JSS A;  4QLC C;  3H4M A;  3SHF A;  1P34 A;  5AVB C;  1LV7 A;  2NQ8 C;  1L1T A;  2FJ7 C;  3P5J B;  3AZE B;  5GT0 A;  3REI A;  5AV6 B;  4AW4 A;  5DNN B;  4H9N B;  4Z2M H;  4J8V B;  4CAY B;  4XUJ D;  4Z66 A;  4JN6 A;  3X1S D;  2F8N G;  1B67 A;  4IBG A;  1EE8 A;  4LRS A;  5AV9 C;  2I7N A;  2DWL A;  5AV9 D;  3Q8X A;  1P3K A;  3MK6 A;  1KX5 B;  4YS3 C;  3U6M A;  3LZ0 B;  4WU9 D;  4LJ5 A;  3KUY A;  5KO3 A;  3M0E A;  3TE6 A;  8CAT A;  3KOZ E;  3PFI A;  4G92 C;  1P3M A;  2Y2O A;  2XZU A;  5B1L C;  1U35 C;  5B1L D;  4AI6 A;  5GSU A;  5JRG D;  5F99 A;  2UXD M;  2W82 A;  5FUG B;  2YFV B;  4KGC C;  5B31 A;  2Y2L A;  4NRV A;  5B32 A;  2PYO C;  2DWZ B;  3AZE A;  4PCZ A;  5F3W A;  4J8X B;  4H9N A;  2R4J A;  3FDD A;  3AZF C;  2F5Q A;  3AZF D;  1L2B A;  2J8P A;  3X1V A;  5A2Q S;  1KX4 A;  4IJF A;  3LJA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...