3KFUG

Crystal structure of the transamidosome
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
ELSPELLRKLETLAKIRLSPEEEALLLQDLKRILDFVDALPRVEEGGAEEALGRLREDEPRPSLPQAEALALAPEAEDGFFRVPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a transfer-ribonucleoprotein particle that promotes asparagine formation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase/rna
molecule keywords Non-discriminating and archaeal-type aspartyl-tRNA synthetas
total genus 15
structure length 86
sequence length 86
chains with identical sequence J
ec nomenclature
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02686 Glu-tRNAGln Glu-tRNAGln amidotransferase C subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.990 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kfuG02
1.10.20.60 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kfuG01
2G5IC 3IP4C 3H0RC 3A1IA 2F2AC 2DF4C 2G5HC 2DQNC 3A1KA 3AL0C 3H0MC 3KFUG 3H0LC 4WJ3C
chains in the Genus database with same CATH superfamily
2CHQA 1L2CA 2PYOB 1S32D 3HZJA 4NE5A 3RELD 2JXNA 3B0DC 2DAKA 2QNJA 5JRGD 4OVZB 2IO5B 1WWSA 5DNNC 2LVQD 4MGHA 3MVDA 3W68A 4AKGA 4J8VB 3UJNA 4LFBM 4GEWA 4KUDB 1N77A 3I4VA 3UGJA 2K0BX 2CV2A 3HJ8A 2CEAA 3K92A 1TF0B 2FJ7D 2R4EA 2Y2NA 3VH6T 1Q3CA 3HKPA 3FUXA 2QBYA 3E4RA 3VKHA 5B31G 4D81A 2A5YB 3FTCA 1KX5B 1EQZD 2ZTDA 4MM3B 3DA1A 4MGZE 2JY7A 1P3FC 4QHTA 3KXBB 2LVAA 5GT0C 2JZ1A 1XNRM 2CWBA 1N34M 3LJAB 1IN5A 3T1YM 3AZLC 4IJEA 1ULYA 1TH2A 3CGWA 3GQ3A 2HUEB 3B6FB 3C3DA 5DNNB 4J8VC 4AG5A 2R4JA 3KXBC 2NZDC 3B0CW 3REHD 4R71A 4GHAA 3WTPC 5B40B 3AZKB 4J8UB 2HUEC 3REKA 3MHVC 2G5GX 1LV7A 1TH3A 3HU1A 5AV6D 3KS4A 5ITXE 2DZLA 5AVBD 5DNYA 4DR3M 2E5LM 4DV6M 1XB2B 2WZJA 1W5TA 2C96A 3CTWB 1EE8A 3MMPA 3J27B 4JJNC 5AV5B 3MGSA 3SMPA 3W99B 3KOWE 5EXXA 4BBAA 1HQ3C 1ID3B 3AYWD 3M7GA 5B0YD 2KEBA 4RF0A 4AW4A 3C1BB 2CV5C 1QZMA 5DNMB 2M60A 1V92A 4Z5TC 2O5RA 1GABA 2L5AA 3AN2C 1QANA 2X8AA 4LRTA 4AKIA 4H9NA 4NRVA 3D8LA 2F8NA 1F66C 2RGOA 5DNMC 4S12A 3X1TA 4W5WA 4ANRA 5ITQA 3UTBD 2Y2GA 4H9PA 4LJ5A 1KX3A 2XD5A 5B0ZD 1XHBA 3UTAC 3JAMS 5LMUM 1P3BB 5B31B 2Y2LA 1R6BX 3O62C 3UTAD 1QAQA 1QAMA 3TU4D 1NHGC 4DR7M 1ZLAD 3IP4C 2KZSA 5ITYA 3NQJB 3AZIA 3O62D 2JWSA 1E32A 4RF1A 2G5IC 1TR8A 3HWSA 2F2AC 3AZMB 2NZDA 2JUJA 1P3MD 3AN2B 1AOIC 4LZZA 3LELA 4KLNA 2F8NK 3TWKA 3SC3A 3SMSA 3AZHD 4WJ3C 4DQYB 1G41A 3KUYB 2CRUA 1EQZC 3WAAA 3AZHC 2UXCM 1PJTA 5AVCC 3PNYA 3SARA 1AIPC 2LXEA 3HHZA 2J7OA 4DR2M 2YQZA 3AZLD 4YM6D 3FRHA 1SG9A 2BNKA 3HGIA 1N1JB 1KFVA 4JI5M 3I4YA 2EKKA 5AV6A 2ZY4A 4IJFA 1R5LA 5B33A 1M18A 1V34A 2C9OA 3M6AA 1HNZM 1TZYA 1GJTA 4LF8M 2BJWA 3GRVA 1IY1A 2UUBM 4EIWA 4PDGA 3TU4A 3AZID 3WTPD 1TH4A 4WU9B 1OAOC 1UM8A 1W5SA 4KODA 3T6PA 2KRUA 1MU5A 2WSFF 5B32G 4B7GA 3A6NC 4JN6A 5KDMA 2XSZA 3A45A 5DNMA 3A6ND 1E9RA 2LHCA 4LF7M 4G3OA 1WJ7A 2CHGA 2DAMA 2HAKA 1DO2A 4WU9A 2FE8A 1X37A 1SXJE 2NQBD 5AV9B 4JYAM 4J8XC 3VH6W 2L7IA 3FTDA 2H5XA 3GLHA 3MGQA 5KQDA 3C9PA 3KSYA 2DVWB 3GRUA 1P3PC 2DNAA 3B0BA 3Q8XA 4CSRA 3AZGB 5GXQA 4DRBA 2ZY5A 3AZHA 2YFVB 3FDDA 4LD9B 3IECA 4DV3M 2UXDM 3MGRC 3X1TD 3WA9D 3BOSA 1Y8GA 3UTBA 4X23C 2O01F 1XXHB 5KDMB 1H6UA 3F92A 4GKKM 3WTPE 4DBGB 2CP8A 3QYEA 2LNHC 5CPKA 2K6BA 4KGCB 3LZ1B 2JZ0A 3GPXA 1PJQA 1ZLAA 3AZGC 1M19A 3KWQB 1OFHA 3W96C 4DV4M 2VDBB 4FW9A 5CPKD 3KXBA 1IXSA 3B6GD 2XF3A 5B0YA 2R18A 4I5SA 4IBJA 1TZYD 1VEKA 3U60A 4DR4M 5AVCD 1IXZA 3GLGA 1KX4D 4KGCC 3U6LA 3IG8A 3RELA 3KSJA 1NJGA 5CPJD 3WTPA 3GLIE 1IBKM 1TDZA 4L16A 3J7BA 4QOZC 1JFIB 4UUZB 3THGA 4IBEA 4AKHA 5BNXB 3MGSC 1Z5CA 3KUYA 1NV9A 2O25A 1Z2CB 3AZEB 5GSUB 1QZEA 5CPID 3J80S 4FVMA 1D0KA 5B24D 3C1BA 4Z5TA 1HNWM 1SXJA 3E9SA 3VDUA 3H0MC 4B7HA 2Y0TA 5C18A 5F3WA 3UT9B 3MGSB 3AV0A 1K3XA 2M5ZA 1F66A 1L1ZA 3QYBA 4FCWA 3MK6A 5AY8D 1FNNA 4OU7A 3U6PA 3A1KA 1K82A 5FLXS 2R45A 1TAFB 3FYDA 3UTAA 2QENA 1KYIA 3GLIA 1VG5A 1DGHB 3X1VA 3RGSA 4G4OA 5B2JB 1MX0A 2HIOB 4YS3D 1HQYE 1IFYA 4AWLB 4WU8D 3D8BA 1R7RA 3AZGA 5ITXA 4H9SC 5GSUC 2C5RA 2NQ8C 1P3PD 2QZ4A 2Y2MA 5B0YC 3LELC 1H3OA 3SHFA 1U35B 5AV8B 2AROC 1GO5A 3AFAD 4NE3A 5CP6D 3UK6A 5B1LD 5AVCA 4OX9M 1V33A 1GKIA 2BYMB 4K0KM 2I7PA 2XEPA 1NNJA 2Y2KA 5B33D 1M18D 2KW0A 3MGRB 2LBCA 4LFCM 3U60B 1Z5AA 5B33C 1M18C 2FH0A 2FS1A 2LWXA 5FSWA 1JR3A 1M19D 2JY8A 1Z6TA 4GC5A 3A42A 5B0ZC 3OTOM 1P3IC 5JRGA 5EP3A 3B7QA 3U6SA 3GLHE 1TZYC 3W97B 3LZ1C 5GXQB 3AZJB 5JRGB 3DZDA 4XBOA 1KX4C 3B74A 4X62M 1WR1B 1YE9A 3KOYE 4RKUF 2JE5A 2YR0A 5B1MD 2D7GA 2C98A 2DHRA 1N32M 3QWLA 5B31A 2DF4C 5A2QS 3REIB 3T1HM 3MGPB 4AZFA 2YFQA 3GLFE 3U5ZA 1OIPA 3E21A 3W67A 2RVQD 2MJ5B 3H4JA 5EXTA 4KO8A 2FFFB 2CE7A 1N1JA 3GLFA 4H9RA 5LMNM 3W0FA 2HCBA 3REIC 4I81A 4Z66D 3C58A 1KX5D 3W98B 1M1AA 4IBDA 3AZKC 4XUJD 3SATA 2WSEF 3AZEA 4LJAA 2DKLA 4XUJC 4DRAA 3LJAD 5BO0B 1JR3D 2OQ4A 3GQ4A 4KUDC 5JI3E 4P17A 4J8VA 1G4AE 3B7ZA 1P3AA 1QUSA 4PT5A 4H9QB 1XMOM 4ZBJC 1P3PA 4JJNB 2ERCA 3WKJA 5AVBA 4DV5M 2AROA 1G71A 3B6FC 1L1TA 4B7FA 3REJB 3MGRA 1P3KD 4M6BA 2DENA 2OO9A 1P3FB 5KPZA 1P3KC 4WURA 5FUGB 2HL7A 2C99A 1F1EA 5B40D 1WWIA 4J8WB 4LCBA 1T3TA 3ZQJA 3AYWC 1F4IA 4JJNA 1P3GB 1NSFA 2YFVA 5B2IC 3REJC 5C3IB 3AOEA 1AUAA 1HQ3D 3LZ1A 4AWLC 4ITQA 4E44A 3GLHB 3W99D 3HHYA 3H0LC 2DHYA 4OW0A 3AN2A 1ZMUA 3R9XB 5EQTA 4KHAB 5DYIA 4WNNA 3RELC 2XSZD 5B31C 2LTUA 5B2JA 4MGIE 5DNMD 4ZUXB 3X1VB 5AV8C 3IHPA 1P3OA 3HU3A 2VQRA 4X65M 4WV4B 3QAUA 2XZFA 3M0EA 3FUTA 4MGYE 2ZY3A 3X1TC 3GLGB 3B0DB 3WHKA 1P3OD 3GQ5A 1NVMA 3B89A 3KUYC 3REIA 3VFDA 3WKJB 3PVSA 5B40A 3AZKA 4B3TM 2PYOA 2Y21A 3C1BC 2CV5B 1R2ZA 3WAAD 2BYKA 2UUCM 4Z5TB 4DV1M 5F99D 3UTAB 2VQFM 1E9SA 3TU4B 1HR0M 1NJFA 5C1BA 2KZUA 1P3AD 1I4WA 3WA9A 4B3RM 3WKJC 3K9OA 3AFAA 4GRIA 1EQZA 4LGMA 3SYLA 1F66B 5GT0D 2YNMD 3Q8GA 3AN2D 5JA4A 2FJ7B 3U6OA 4UUZA 2FOIC 4NOOB 1IN4A 4QNRA 2L6OA 4JXJA 1P3KA 2CFOA 2YFWB 3FE3A 3AZLA 2GNOA 3KXBD 3LJAC 3MVDD 3AZLB 2JY5A 3REKB 3J7AS 4JI8M 2X49A 2Y2QA 1IM2A 2W82A 3TE6A 5CPIC 4JI2M 4Y28F 3IG5A 3LZ0B 2FJ7A 1AOIB 3TL4X 3B6FD 5DNND 2F5OA 3TU4C 1T43A 3HHWA 3KWQA 1ZMWA 2XFSA 4DV7M 3VLFB 5F99A 1NY6A 3PXGA 3LVWA 1IN7A 3REKC 3REHB 1GLNA 4Q7JA 3WTPB 2ZAOA 1D0LA 4J8XB 3TWLA 1E94E 3LZ0C 2G5HC 4J8UD 4G4RA 4B08A 4H9PB 3LQRA 4JI4M 4QLCD 1D2NA 1GL7A 2NZDB 3B7NA 1DV0A 5AVBB 3T15A 2NQBC 5B0ZA 4Z66A 2JY6B 1KX5A 3A6NB 2LVPC 2VF7A 5FTKA 3BXWA 2X4AA 1EFUB 1PGYA 5AV5D 4IBGA 1P3GC 1XC8A 2V1UA 4GITA 3CF6E 4MB7A 5FTNA 4X64M 3MNNA 5BS7A 4LJ8A 1XXHA 3W98A 2NQBB 3FYCA 4FD2A 4CISA 1T3UA 1JB0F 5B32C 2LVOC 1P3LC 3AV2D 4M9XA 5B32D 2R6FA 3A98B 1G3IA 4IBIA 2VF8A 4E45A 3EIEA 1OQYA 4L15A 3JR4A 4M9ZA 3AZGD 5BNVA 1GVNA 4GH9A 3AZFD 1KU5A 3O62A 5CPKC 4LD9C 3GLFB 4H9RB 3UT9A 4DV2M 3W96D 3NQJA 1YLAA 2DZNB 1TAFA 1P3BD 5CPJA 4DR5M 1P3AC 3LZ1D 1DGGA 2H1RA 2OOAA 2V1CA 1KX3B 2F8ND 3KWQC 3E46A 2ZM6M 1G59A 5B24A 5CPKB 3B6FA 4AQYM 3MGQD 2G8LA 2MROB 1P3LB 1HQCA 4JI0M 1PJJA 3AV1D 2LH0A 2F8NG 4RNAA 2BG1A 4FWHA 1VDDA 4NSOB 5E5AD 4I4LA 3LZ0A 2FNAA 2CWEA 3T38A 4G4QA 3AYWA 3VKGA 3L26A 5E6JA 3LCVB 3LQQA 5GT3B 5E26A 1H3OB 1U35A 4Z66C 2UUAM 3HJQA 4Z2MH 2KRKA 1P3GA 1PZRA 3NQUB 1SXJC 3MNNC 5AY8A 2JNHA 5EJCA 5B2JC 3U6DA 2QPAA 5AV8A 3FD9A 4R8PD 2L09A 3SBJA 1P3LA 1XXHE 3RGPA 1QDRA 3HX3A 4KT0F 4II7A 5IREB 4NSRA 3A6NA 2LVNC 3LVVA 4PCZA 3AL0C 3FUUA 3KXEC 3C1CA 3L2AA 1C7YA 2Y2JA 4YHHM 3LELB 1OAIA 1J5EM 4FCVA 2Y2HA 1K3WA 3L27A 1EIJA 3AZNC 1HJPA 4WU9C 1IN6A 4NC6A 1N33M 2WSCF 3AZND 3REHA 3VK8A 1N36M 4TUWA 3GPPA 4HGAB 1XMQM 3FTFA 2Z3XA 4NRWA 2AROD 3K2LA 3I01M 4YS3B 2UXBM 2ZTCA 1NO1A 3WA9C 2DZOB 3AFAC 1P3PB 1P3IB 5B24C 1W2EA 5DFLA 3U5ZB 1IY2A 2CV1A 3AJIB 1BVSA 2GQFA 4HEOA 3AZFC 5B1LB 5G49B 3VH5T 4LD9D 1P34B 1NHWC 1TTEA 4JI6M 4XZQA 2XGNA 1ID3A 1M19C 2R65A 3LW5F 2OPFA 5JA4B 1P3IA 4KGCD 5AV5A 4WU8A 3KWQD 4LF9M 1PJSA 3HJSA 4GIPA 1KX4A 3U61B 1P34C 1JR3E 4YS3C 1DGFA 2F5QA 1MJGM 4F2LA 4KGCA 1S32B 5GXQD 3K1JA 4DR6M 3AZJC 2CUZA 1BH8B 1KX4B 2VIIA 3LMMA 5BPVA 4HL4A 4QNMA 4M0WA 1IXSB 3REID 1P3QQ 3MGPD 2Z4SA 5BNVB 3NBIA 2IO5C 1QVRA 1J09A 4X23D 4J8VD 5GT3A 1ZQ9A 4BB9A 1R4VA 1KX5C 4G4NA 2DAGA 1M1AC 1SXJD 3MNND 5FTMA 3MVDC 3AZEC 1M1AD 4LFAM 4UN2B 4ZUXA 1JFIA 4XUJA 2JP7A 3KOXE 5BS7C 3W98D 1KSFX 4Z6YA 3SAWA 5GKNA 2YFWA 3AZED 3SASA 2KNZA 4M0DA 2Y2OA 3W98C 1XWIA 2B3TA 4LJ4A 1Q39A 4CHTB 5B32A 2R46A 1S32A 1A5TA 3C1CD 3AFHA 2XD1A 4JJND 2I7NA 1HNXM 4QHSA 3AV1A 3SYKA 3ZCBB 3X1UA 1QQWA 5ITRA 4IBFA 2LY8A 1VQ1A 2QP9X 4XGIA 4G92C 1B67A 3X1SD 1S3SA 2XLJA 3UT9C 4REZA 1Q02A 3X1UD 4H9SA 5GSUA 1L2DA 2Q2EB 4WU8B 5ITUA 5AV5C 1P3GD 4M9SA 2V6ZM 3W99C 3AZKD 4DUZM 2KNAA 8CATA 1OTRA 4MH0E 2EKFA 2Y20A 5AV6B 4JI1M 3UMMA 4P16A 5AV8D 4LF6M 2HIOC 3U6MA 1ZMVA 3PFIA 1R4GA 4L4UA 4NFTA 3X1VD 2OOBA 3TWMA 2XFTA 4XZQD 2ZBKB 1ID3D 3AYWB 5B0YB 5B33B 1M18B 3C1BD 1U35C 5B2IB 5KPRA 5C3IC 1P3MC 1JQJC 3EIHA 4B3SM 1M19B 2PYOC 3X1SA 2HWJA 3GPYA 3TPZA 2PYOD 3WHLA 1WHCA 1R2YA 5FUGA 3AZJD 3R8FA 3AV2A 1Q3BA 4JI3M 3RELB 2CV5D 3JR5A 3B0CT 5B1MB 2RIQA 1S32C 3GRRA 3H0RC 2DWLA 3C3EA 5B0ZB 2MH8A 2UU9M 5CP6C 4CSRB 2QCUA 3H4MA 2MR9A 4R7GA 1NNUC 5GT0B 1ZLAB 1J7KA 3O62B 3SHGB 4QOSA 1P3BA 4KUDD 2Z8YM 4CAYA 5AV9A 3U6EA 3LJAA 3REHC 2BYMA 2QQ8A 4WZSB 3AZMD 3GRYA 4QLCA 1P3MB 4A3VB 4KUDA 3NQUA 4XUJB 3KUYD 4I8OA 3MVDB 1EQZB 3K9PA 3W99A 3REKD 3V76A 5AVBC 2DI0A 4AI6A 2XZUA 5IT9S 2L4FA 1N75A 2D7HA 2J5YA 4YM6B 1UFZA 1TDHA 5EP1A 5B1MC 3LZ0D 3NBXX 4J8UC 1AOID 1MN3A 2Y2IA 5FTJA 3KP1E 4R8PC 3EPJA 4XK8F 2HIOA 2BYKB 5GT0A 2K47A 4LG2A 4CIZA 1G8PA 3REJD 3HY5A 1P3KB 4EO5B 3U6QA 3TQSA 1P3FD 3EPHA 4L6V6 4CJ6A 4GHLA 4J8XD 3KW6A 3W97A 5H37D 5EP4A 3REJA 2APLA 3AOEC 4WU9D 2NZDD 4BLCA 3KFUG 4MGKE 2HHHM 4Z8XA 4EO5C 1IQPA 1YUBA 1GJSA 4IIWA 4H9NB 3R45B 1WGNA 3AZJA 3L25A 1P3OC 1PRBA 2P5TA 3FTEA 4YM6A 4DR1M 4LF5M 2Z4RA 1QAOA 2AHMA 4L8RC 5BR8M 2Y2PA 2LHGA 5CP6A 2QSFX 3GP1A 2KA6B 4B3MM 1A7WA 5B32B 1IBMM 3B6GC 4LJ6A 1P3BC 1HQ3A 1ZAEA 3AKZA 1B6WA 1P3OB 5BT1D 5B40C 5AV9C 5E5AA 3DOAA 1I94M 4G6ZA 1BFMA 4ZUXC 3B9PA 4WP2A 4JV5M 3MJ5A 1DGHA 3WKJD 2ZANA 3W0LB 4J8XA 5CHLB 3I51A 2L2DA 4LY6A 2D7EA 2VQEM 3MGQC 3WAAB 3W96B 2L7HA 4Z5TD 5F99B 4PD2A 2G3QA 4H9OA 3UTBB 4OVZA 3X1TB 3KS8A 5EXPA 4G91C 2JCHA 1IBLM 5B1MA 1KX3D 1P3AB 5B31D 3AOGA 3AV1C 2F4VM 3GLIB 5L8RF 1KX3C 1F66D 5KO3A 4J8WA 3MGQB 2BWEA 1P3LD 3AZMC 3ZH9B 3FUVA 2DWZB 3GPUA 3VH6A 3AZIC 3B6GB 4WW0A 1ZLAC 2ZAMA 5E5AB 3AZHB 5AVCB 4JI7M 3EPLA 1DGBA 5CPIA 4H9QA 2FJ7C 1IY0A 2J7NA 3KSXA 3WAAC 3EPKA 5IWAM 5F99C 3MGPA 3KDSE 2L4EA 1PJIA 2CV0A 4HGAC 2HKJA 4GC9A 3SFZA 4FCTA 2R62A 4LGYA 5BNXA 4YM6C 1C1KA 1Z59A 3C1CC 4R8PB 1CUKA 3A1IA 5CPIB 3RFWA 1N78A 2NQBA 5ITTA 1VEJA 3K8ZA 5B24B 2ZM5A 4LF4M 3NWLA 4QLCB 1ORYB 2DAIA 1DO0A 3AZIB 1P3MA 2UWXA 4LZJA 3LELD 2RRUA 2K9DA 3VH5W 5E5AC 1YSYA 3UT9D 1OKSA 1BH9B 3V9RB 3MGSD 1VDLA 2R0IA 3SAUA 3KVWA 4FWGA 3A46A 3AV2C 3U61A 3RE8A 4F1IA 3AZNB 7CATA 2Z7JA 1NY5A 2C9CA 1FJGM 1OIZA 3UZUA 3DFZA 2ZY2A 1NV8A 4YY3M 5KPTA 3FUWA 1WXQA 4ZPXA 5B2JD 3AV2B 2HIOD 1TGUA 1P3ID 3AZFA 4FWDA 5BT1C 5AV9D 3AZMA 3R45A 1LTMA 5DYGA 4LD9A 2DAEA 3F6TA 4XZQC 5EXSA 4QLCC 4D82A 3AZFB 3LCUA 1U35D 5CPJC 1T6OA 1IN8A 4D80A 4CGYB 3PNVA 3WA9B 4X66M 2RVQC 1HT2E 2EA0A 5GXQC 4J8UA 2DXIA 4R8PA 1XNQM 3UTBC 2F8NB 4AG6A 4X23A 4NL4H 3ZC7B 5BO0A 4G91B 1QUTA 1Z5BA 4NE6A 3AV1B 3W97D 2DQNC 3W96A 1TZYB 3W97C 3VDPA 5GT3C 5JRGC 1IXRC 4GKJM 2N35A 1D0MA 5GT3D 2J8PA 2JA2A 5CPJB 2CV5A 4X23B 4GMQA 5FTLA 4R3DA 2Y0QA 4PDIA 5AY8C 4LJ9A 5B1LA 1SXJB 4G92B 3MNNB 3VK7A 3FRIA 1M1AB 2F5PA 2RGHA 2QBYB 1RU3A 3ILKA 2KXEA 3I04M 3HHXA 4ZBJB 4Z66B 1VEGA 1L8QA 3J81S 3J2PB 1Q9CA 5KQ8A 3SAVA 5GSUD 3KOZE 2KNVA 1HTAA 3X1UC 3B6GA 3C1CB 4H9OB 4KHAA 2W8SA 4WNNB 3AZNA 1OJLA 4L78A 5DNNA 5IZ7D 2JSSA 4CAYB 2BJVA 3CF2A 2CHVA 1PM5A 3GO8A 3X1SB 2R44A 4NXMM 4HLQA 5AY8B 4LJ7A 3X1UB 1AOIA 1ZV1A 4UPKA 2AROB 3L28A 4NXNM 2BWBA 4LRSA 2XH9A 4IBBA 4Z2MG 1QDTA 1BH8A 2EUCA 1QYRA 1OFIA 4J8WD 1P3FA 1WIVA 1BH9A 3V9RA 4J8WC 4DV0M 5JI2E 3P5JB 3HU2A 2QHOB 4DUYM 3X1VC 3BBZA 5AV6C 1L2BA 3CF0A 1HQ3B 1ID3C 1WGLA 2F8NH 2F5SA 2KHHA 1P34D 2KDLA 1HT1E 1GL6A 4KHPM 5B2IA 2EJSA 2MGWA 2DWNA 3AFAB 3VH5A 4XZQB 5CP6B 4WU8C 3KP0E 3U6CA 3X1SC 1P34A 4ZUXD 2EO2A 3L29A 2F5NA 5G49A 4YS3A 3FKEA 5B2ID 3EG5B 3GLGE 4IBCA 4IBKA 2DWMA 5B1LC 3MGPC 2FFJA 3MGRD 2RKOA 5EP2A
chains in the Genus database with same CATH topology
2CHQA 1L2CA 2PYOB 1S32D 4NE5A 3RELD 3B0DC 5JRGD 4OVZB 2IO5B 1WWSA 5DNNC 4MGHA 3MVDA 4AKGA 4J8VB 3UJNA 4LFBM 4KUDB 1N77A 3I4VA 3UGJA 2CV2A 3HJ8A 2CEAA 3K92A 2FJ7D 2R4EA 2Y2NA 3VH6T 1Q3CA 3HKPA 3FUXA 2QBYA 3E4RA 3VKHA 5B31G 4D81A 2A5YB 3FTCA 1KX5B 1EQZD 4MM3B 3DA1A 4MGZE 1P3FC 4QHTA 3KXBB 5GT0C 1XNRM 1N34M 3LJAB 1IN5A 3T1YM 3AZLC 4IJEA 1ULYA 1TH2A 3GQ3A 2HUEB 3B6FB 5DNNB 4J8VC 4AG5A 2R4JA 3KXBC 2NZDC 3B0CW 3REHD 4GHAA 3WTPC 5B40B 3AZKB 4J8UB 2HUEC 3REKA 3MHVC 2G5GX 1LV7A 1TH3A 3HU1A 5AV6D 3KS4A 5ITXE 5AVBD 5DNYA 4DR3M 2E5LM 4DV6M 1W5TA 2C96A 3CTWB 1EE8A 3J27B 4JJNC 5AV5B 3MGSA 3SMPA 3W99B 3KOWE 5EXXA 4BBAA 1HQ3C 1ID3B 3AYWD 3M7GA 5B0YD 2KEBA 4RF0A 4AW4A 3C1BB 2CV5C 1QZMA 5DNMB 2M60A 4Z5TC 2O5RA 2L5AA 3AN2C 1QANA 2X8AA 4LRTA 4AKIA 4H9NA 4NRVA 3D8LA 2F8NA 1F66C 2RGOA 5DNMC 4S12A 3X1TA 4W5WA 5ITQA 3UTBD 2Y2GA 4H9PA 4LJ5A 1KX3A 2XD5A 5B0ZD 1XHBA 3UTAC 3JAMS 5LMUM 1P3BB 5B31B 2Y2LA 1R6BX 3O62C 3UTAD 1QAQA 1QAMA 3TU4D 1NHGC 4DR7M 1ZLAD 3IP4C 2KZSA 5ITYA 3NQJB 3AZIA 3O62D 1E32A 4RF1A 2G5IC 3HWSA 2F2AC 3AZMB 2NZDA 1P3MD 3AN2B 1AOIC 4LZZA 3LELA 4KLNA 2F8NK 3TWKA 3SC3A 3SMSA 3AZHD 4WJ3C 4DQYB 1G41A 3KUYB 1EQZC 3WAAA 3AZHC 2UXCM 5AVCC 3PNYA 3SARA 2LXEA 3HHZA 2J7OA 4DR2M 2YQZA 3AZLD 4YM6D 2BNKA 3HGIA 1N1JB 1KFVA 4JI5M 3I4YA 5AV6A 2ZY4A 4IJFA 5B33A 1M18A 2C9OA 3M6AA 1HNZM 1TZYA 4LF8M 2BJWA 3GRVA 1IY1A 2UUBM 4EIWA 4PDGA 3TU4A 3AZID 3WTPD 1TH4A 4WU9B 1UM8A 1W5SA 4KODA 2KRUA 1MU5A 5B32G 4B7GA 3A6NC 4JN6A 5KDMA 2XSZA 3A45A 5DNMA 3A6ND 1E9RA 4LF7M 2CHGA 1DO2A 4WU9A 2FE8A 1X37A 1SXJE 2NQBD 5AV9B 4JYAM 4J8XC 3VH6W 2L7IA 3FTDA 3GLHA 3MGQA 5KQDA 3KSYA 2DVWB 3GRUA 1P3PC 3B0BA 3Q8XA 4CSRA 3AZGB 5GXQA 4DRBA 2ZY5A 3AZHA 2YFVB 3FDDA 4LD9B 2UXDM 4DV3M 3MGRC 3X1TD 3WA9D 3BOSA 3UTBA 4X23C 1XXHB 5KDMB 1H6UA 4GKKM 3WTPE 2LNHC 5CPKA 4KGCB 3LZ1B 3GPXA 1ZLAA 3AZGC 1M19A 3KWQB 1OFHA 3W96C 4DV4M 4FW9A 5CPKD 3KXBA 3B6GD 2XF3A 5B0YA 2R18A 4I5SA 4IBJA 1TZYD 3U60A 4DR4M 5AVCD 1IXZA 3GLGA 1KX4D 4KGCC 3U6LA 3IG8A 3RELA 3KSJA 1NJGA 5CPJD 3WTPA 1IBKM 1TDZA 4L16A 3J7BA 4QOZC 1JFIB 4UUZB 3THGA 4IBEA 4AKHA 5BNXB 3MGSC 1Z5CA 3KUYA 1Z2CB 3AZEB 5GSUB 5CPID 3J80S 4FVMA 5B24D 3C1BA 4Z5TA 1HNWM 1SXJA 3E9SA 3VDUA 3H0MC 4B7HA 2Y0TA 5C18A 5F3WA 3UT9B 3MGSB 3AV0A 1K3XA 2M5ZA 1F66A 1L1ZA 4FCWA 3MK6A 5AY8D 1FNNA 4OU7A 3U6PA 3A1KA 1K82A 5FLXS 2R45A 1TAFB 3FYDA 3UTAA 2QENA 1KYIA 3GLIA 1DGHB 3X1VA 3RGSA 4G4OA 5B2JB 1MX0A 2HIOB 4YS3D 1HQYE 4AWLB 4WU8D 3D8BA 1R7RA 3AZGA 5ITXA 4H9SC 5GSUC 2C5RA 2NQ8C 1P3PD 2QZ4A 2Y2MA 5B0YC 3LELC 1H3OA 3SHFA 1U35B 5AV8B 2AROC 3AFAD 4NE3A 5CP6D 3UK6A 5B1LD 5AVCA 4OX9M 1GKIA 2BYMB 4K0KM 2I7PA 2XEPA 1NNJA 2Y2KA 5B33D 1M18D 2KW0A 3MGRB 4LFCM 3U60B 1Z5AA 5B33C 1M18C 5FSWA 2LWXA 1JR3A 1M19D 1Z6TA 4GC5A 3A42A 5B0ZC 3OTOM 1P3IC 5JRGA 5EP3A 3U6SA 1TZYC 3W97B 3LZ1C 5GXQB 3AZJB 5JRGB 3DZDA 4XBOA 1KX4C 4X62M 1YE9A 3KOYE 2JE5A 2YR0A 5B1MD 2D7GA 2C98A 2DHRA 1N32M 3QWLA 5B31A 2DF4C 5A2QS 3REIB 3T1HM 3MGPB 4AZFA 2YFQA 3U5ZA 2RVQD 5EXTA 4KO8A 2FFFB 2CE7A 1N1JA 3GLFA 4H9RA 5LMNM 3W0FA 2HCBA 3REIC 4I81A 4Z66D 3C58A 1KX5D 3W98B 1M1AA 4IBDA 3AZKC 4XUJD 3SATA 3AZEA 4LJAA 4XUJC 4DRAA 3LJAD 5BO0B 1JR3D 2OQ4A 3GQ4A 4KUDC 5JI3E 4J8VA 1G4AE 1P3AA 4PT5A 4H9QB 1XMOM 4ZBJC 1P3PA 4JJNB 2ERCA 3WKJA 5AVBA 4DV5M 2AROA 3B6FC 1L1TA 4B7FA 3REJB 3MGRA 1P3KD 4M6BA 1P3FB 5KPZA 1P3KC 4WURA 5FUGB 2HL7A 2C99A 1F1EA 5B40D 1WWIA 4J8WB 4LCBA 1T3TA 3AYWC 1P3GB 4JJNA 1NSFA 2YFVA 5B2IC 3REJC 5C3IB 3AOEA 1HQ3D 3LZ1A 4AWLC 4ITQA 4E44A 3GLHB 3W99D 3HHYA 3H0LC 4OW0A 3AN2A 3R9XB 5EQTA 4KHAB 5DYIA 4WNNA 3RELC 2XSZD 5B31C 5B2JA 4MGIE 5DNMD 4ZUXB 3X1VB 5AV8C 1P3OA 3HU3A 2VQRA 4X65M 4WV4B 3QAUA 2XZFA 3M0EA 3FUTA 4MGYE 2ZY3A 3X1TC 3GLGB 3B0DB 3WHKA 1P3OD 3GQ5A 1NVMA 3KUYC 3REIA 3VFDA 3WKJB 3AZKA 3PVSA 5B40A 4B3TM 2PYOA 2Y21A 3C1BC 2CV5B 1R2ZA 3WAAD 2BYKA 2UUCM 4Z5TB 4DV1M 5F99D 3UTAB 2VQFM 1E9SA 3TU4B 1HR0M 1NJFA 5C1BA 2KZUA 1P3AD 1I4WA 3WA9A 4B3RM 3WKJC 3AFAA 4GRIA 1EQZA 4LGMA 3SYLA 1F66B 5GT0D 2YNMD 3AN2D 5JA4A 2FJ7B 3U6OA 4UUZA 2FOIC 4NOOB 1IN4A 4QNRA 2L6OA 4JXJA 1P3KA 2CFOA 2YFWB 3AZLA 3KXBD 3LJAC 3MVDD 3AZLB 3REKB 3J7AS 4JI8M 2X49A 2Y2QA 1IM2A 2W82A 3TE6A 5CPIC 4JI2M 3IG5A 3LZ0B 2FJ7A 1AOIB 3TL4X 3B6FD 5DNND 2F5OA 3TU4C 3HHWA 3KWQA 2XFSA 4DV7M 3VLFB 5F99A 1NY6A 3PXGA 3LVWA 1IN7A 3REKC 3REHB 1GLNA 3WTPB 2ZAOA 4J8XB 3TWLA 1E94E 3LZ0C 2G5HC 4J8UD 4G4RA 4B08A 4H9PB 3LQRA 4JI4M 4QLCD 1D2NA 1GL7A 2NZDB 5AVBB 3T15A 2NQBC 5B0ZA 4Z66A 1KX5A 3A6NB 5FTKA 2X4AA 4IBGA 5AV5D 1P3GC 1XC8A 2V1UA 4GITA 3CF6E 4MB7A 5FTNA 4X64M 3MNNA 5BS7A 4LJ8A 1XXHA 3W98A 2NQBB 3FYCA 4FD2A 4CISA 1T3UA 5B32C 1P3LC 3AV2D 4M9XA 5B32D 3A98B 1G3IA 4IBIA 4E45A 3EIEA 4L15A 3JR4A 4M9ZA 3AZGD 5BNVA 1GVNA 4GH9A 3AZFD 1KU5A 3O62A 5CPKC 4LD9C 3GLFB 4H9RB 3UT9A 4DV2M 3W96D 3NQJA 2DZNB 1TAFA 1P3BD 5CPJA 4DR5M 1P3AC 3LZ1D 1DGGA 2H1RA 2V1CA 1KX3B 2F8ND 3KWQC 2ZM6M 5B24A 1G59A 5CPKB 3B6FA 4AQYM 3MGQD 2G8LA 1P3LB 1HQCA 4JI0M 1PJJA 3AV1D 2LH0A 2F8NG 4RNAA 2BG1A 4FWHA 1VDDA 4NSOB 5E5AD 4I4LA 3LZ0A 2FNAA 2CWEA 3T38A 4G4QA 3AYWA 3VKGA 3L26A 5E6JA 5GT3B 3LQQA 5E26A 1H3OB 1U35A 4Z66C 2UUAM 3HJQA 4Z2MH 2KRKA 1P3GA 1PZRA 3NQUB 1SXJC 3MNNC 5AY8A 5EJCA 5B2JC 3U6DA 2QPAA 5AV8A 3FD9A 4R8PD 2L09A 3SBJA 1P3LA 3RGPA 4II7A 5IREB 4NSRA 3A6NA 3LVVA 4PCZA 3AL0C 3FUUA 3KXEC 3C1CA 3L2AA 2Y2JA 4YHHM 3LELB 1J5EM 4FCVA 2Y2HA 1K3WA 3L27A 3AZNC 4WU9C 1IN6A 1N33M 3AZND 3REHA 3VK8A 1N36M 4TUWA 3GPPA 4HGAB 1XMQM 3FTFA 2Z3XA 4NRWA 2AROD 3K2LA 4YS3B 2UXBM 3WA9C 2DZOB 3AFAC 1P3PB 1P3IB 5B24C 1W2EA 3U5ZB 1IY2A 2CV1A 3AJIB 3AZFC 5B1LB 5G49B 3VH5T 4LD9D 1P34B 1NHWC 4JI6M 4XZQA 2XGNA 1ID3A 1M19C 2R65A 2OPFA 5JA4B 1P3IA 4KGCD 5AV5A 4WU8A 3KWQD 4LF9M 3HJSA 4GIPA 1KX4A 3U61B 1P34C 4YS3C 1DGFA 2F5QA 4KGCA 1S32B 5GXQD 3K1JA 4DR6M 3AZJC 2CUZA 1BH8B 1KX4B 2VIIA 3LMMA 5BPVA 4HL4A 4QNMA 4M0WA 1IXSB 3REID 3MGPD 2Z4SA 5BNVB 3NBIA 2IO5C 1QVRA 1J09A 4X23D 4J8VD 5GT3A 1ZQ9A 4BB9A 1R4VA 1KX5C 4G4NA 1M1AC 1SXJD 3MNND 5FTMA 3MVDC 3AZEC 1M1AD 4LFAM 4ZUXA 1JFIA 4XUJA 3KOXE 5BS7C 3W98D 3AZED 1KSFX 4Z6YA 3SAWA 5GKNA 2YFWA 3SASA 4M0DA 2Y2OA 3W98C 1XWIA 4LJ4A 1Q39A 4CHTB 5B32A 2R46A 1S32A 3C1CD 3AFHA 2XD1A 4JJND 2I7NA 1HNXM 4QHSA 3AV1A 3SYKA 3ZCBB 3X1UA 1QQWA 5ITRA 4IBFA 2LY8A 2QP9X 4XGIA 4G92C 1B67A 3X1SD 1S3SA 2XLJA 3UT9C 4REZA 3X1UD 4H9SA 5GSUA 1L2DA 2Q2EB 4WU8B 5ITUA 5AV5C 1P3GD 4M9SA 2V6ZM 3W99C 3AZKD 4DUZM 8CATA 4MH0E 2Y20A 5AV6B 4JI1M 3UMMA 4P16A 5AV8D 4LF6M 2HIOC 3U6MA 3PFIA 4L4UA 4NFTA 3X1VD 3TWMA 2XFTA 4XZQD 2ZBKB 1ID3D 3AYWB 5B0YB 5B33B 1M18B 3C1BD 1U35C 5B2IB 5KPRA 5C3IC 1P3MC 1JQJC 3EIHA 4B3SM 1M19B 2PYOC 3X1SA 3GPYA 3TPZA 2PYOD 3WHLA 1R2YA 5FUGA 3AZJD 3R8FA 3AV2A 1Q3BA 4JI3M 3RELB 2CV5D 3JR5A 3B0CT 5B1MB 2RIQA 1S32C 3GRRA 3H0RC 2DWLA 5B0ZB 2UU9M 5CP6C 4CSRB 2QCUA 3H4MA 4R7GA 1NNUC 5GT0B 1ZLAB 1J7KA 3O62B 3SHGB 4QOSA 1P3BA 4KUDD 4CAYA 5AV9A 3U6EA 3LJAA 3REHC 2BYMA 4WZSB 3AZMD 3GRYA 4QLCA 1P3MB 4A3VB 4KUDA 3NQUA 4XUJB 3KUYD 4I8OA 3MVDB 1EQZB 3W99A 3REKD 5AVBC 4AI6A 2XZUA 5IT9S 1N75A 2D7HA 4YM6B 1TDHA 5EP1A 5B1MC 3LZ0D 4J8UC 1AOID 2Y2IA 5FTJA 3KP1E 4R8PC 3EPJA 2HIOA 2BYKB 5GT0A 2K47A 4LG2A 1G8PA 3REJD 1P3KB 4EO5B 3U6QA 3TQSA 1P3FD 3EPHA 4GHLA 4J8XD 3KW6A 3W97A 5H37D 5EP4A 3REJA 3AOEC 4WU9D 2NZDD 4BLCA 3KFUG 4MGKE 2HHHM 4Z8XA 4EO5C 1IQPA 1YUBA 4IIWA 4H9NB 3R45B 3AZJA 3L25A 1P3OC 2P5TA 3FTEA 4YM6A 4DR1M 4LF5M 2Z4RA 1QAOA 2AHMA 4L8RC 5BR8M 2Y2PA 5CP6A 3GP1A 2KA6B 4B3MM 1A7WA 5B32B 1IBMM 3B6GC 4LJ6A 1P3BC 1HQ3A 1ZAEA 3AKZA 1B6WA 1P3OB 5BT1D 5B40C 5AV9C 5E5AA 3DOAA 1I94M 4G6ZA 1BFMA 4ZUXC 3B9PA 4JV5M 3MJ5A 1DGHA 3WKJD 2ZANA 3W0LB 4J8XA 5CHLB 3I51A 4LY6A 2D7EA 2VQEM 3MGQC 3WAAB 3W96B 2L7HA 4Z5TD 5F99B 4PD2A 4H9OA 3X1TB 3UTBB 4OVZA 3KS8A 5EXPA 4G91C 2JCHA 1IBLM 5B1MA 1KX3D 1P3AB 5B31D 3AOGA 3AV1C 2F4VM 3GLIB 1KX3C 1F66D 5KO3A 4J8WA 3MGQB 1P3LD 3AZMC 3ZH9B 3FUVA 2DWZB 3GPUA 3VH6A 3AZIC 3B6GB 4WW0A 1ZLAC 2ZAMA 5E5AB 3AZHB 5AVCB 4JI7M 3EPLA 1DGBA 5CPIA 4H9QA 2FJ7C 1IY0A 2J7NA 3KSXA 3WAAC 3EPKA 5IWAM 5F99C 3MGPA 3KDSE 1PJIA 2CV0A 4HGAC 2HKJA 4GC9A 3SFZA 4FCTA 2R62A 4LGYA 5BNXA 4YM6C 1C1KA 1Z59A 3C1CC 4R8PB 3A1IA 5CPIB 3RFWA 1N78A 2NQBA 5ITTA 3K8ZA 5B24B 2ZM5A 4LF4M 3NWLA 1ORYB 4QLCB 3AZIB 1DO0A 1P3MA 2UWXA 4LZJA 3LELD 3VH5W 5E5AC 1YSYA 3UT9D 1BH9B 3V9RB 3MGSD 3SAUA 3KVWA 4FWGA 3A46A 3AV2C 3U61A 3RE8A 3AZNB 7CATA 2Z7JA 1NY5A 2C9CA 1FJGM 3UZUA 3DFZA 2ZY2A 4YY3M 5KPTA 3FUWA 1WXQA 4ZPXA 5B2JD 3AV2B 2HIOD 1TGUA 1P3ID 3AZFA 4FWDA 5BT1C 5AV9D 3AZMA 3R45A 5DYGA 4LD9A 3F6TA 4XZQC 5EXSA 4QLCC 4D82A 3AZFB 1U35D 5CPJC 1IN8A 4D80A 4CGYB 3PNVA 3WA9B 4X66M 2RVQC 1HT2E 2EA0A 5GXQC 4J8UA 2DXIA 4R8PA 1XNQM 3UTBC 2F8NB 4AG6A 4X23A 4NL4H 3ZC7B 5BO0A 4G91B 1Z5BA 4NE6A 3AV1B 3W97D 2DQNC 3W96A 1TZYB 3W97C 3VDPA 5GT3C 5JRGC 1IXRC 4GKJM 5GT3D 2J8PA 2JA2A 5CPJB 2CV5A 4X23B 4GMQA 5FTLA 4R3DA 2Y0QA 4PDIA 5AY8C 4LJ9A 5B1LA 1SXJB 4G92B 3MNNB 3VK7A 1M1AB 2F5PA 2RGHA 2QBYB 3ILKA 2KXEA 3HHXA 4ZBJB 4Z66B 1L8QA 3J81S 3J2PB 1Q9CA 5KQ8A 3SAVA 5GSUD 3KOZE 1HTAA 3X1UC 3B6GA 3C1CB 4H9OB 4KHAA 2W8SA 4WNNB 3AZNA 1OJLA 4L78A 5DNNA 5IZ7D 2JSSA 4CAYB 2BJVA 3CF2A 2CHVA 1PM5A 3GO8A 3X1SB 4NXMM 4HLQA 5AY8B 4LJ7A 3X1UB 1AOIA 4UPKA 2AROB 3L28A 4NXNM 4LRSA 2XH9A 4IBBA 4Z2MG 1BH8A 2EUCA 1QYRA 1OFIA 4J8WD 1P3FA 3V9RA 1BH9A 4J8WC 4DV0M 5JI2E 3P5JB 3HU2A 4DUYM 3X1VC 5AV6C 1L2BA 3CF0A 1HQ3B 1ID3C 2F8NH 2F5SA 1P34D 1HT1E 1GL6A 4KHPM 5B2IA 2DWNA 3AFAB 3VH5A 4XZQB 5CP6B 4WU8C 3KP0E 3U6CA 3X1SC 1P34A 4ZUXD 2EO2A 3L29A 2F5NA 5G49A 4YS3A 3FKEA 5B2ID 3EG5B 4IBCA 4IBKA 2DWMA 5B1LC 3MGPC 2FFJA 3MGRD 2RKOA 5EP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G5I C;  3IP4 C;  3H0R C;  3A1I A;  2F2A C;  2DF4 C;  2G5H C;  2DQN C;  3A1K A;  3AL0 C;  3H0M C;  3KFU G;  3H0L C;  4WJ3 C; 
#chains in the Genus database with same CATH topology
 2CHQ A;  1L2C A;  2PYO B;  1S32 D;  3HZJ A;  4NE5 A;  3REL D;  2JXN A;  3B0D C;  2DAK A;  2QNJ A;  5JRG D;  4OVZ B;  2IO5 B;  1WWS A;  5DNN C;  2LVQ D;  4MGH A;  3MVD A;  3W68 A;  4AKG A;  4J8V B;  3UJN A;  4LFB M;  4GEW A;  4KUD B;  1N77 A;  3I4V A;  3UGJ A;  2K0B X;  2CV2 A;  3HJ8 A;  2CEA A;  3K92 A;  1TF0 B;  2FJ7 D;  2R4E A;  2Y2N A;  3VH6 T;  1Q3C A;  3HKP A;  3FUX A;  2QBY A;  3E4R A;  3VKH A;  5B31 G;  4D81 A;  2A5Y B;  3FTC A;  1KX5 B;  1EQZ D;  2ZTD A;  4MM3 B;  3DA1 A;  4MGZ E;  2JY7 A;  1P3F C;  4QHT A;  3KXB B;  2LVA A;  5GT0 C;  2JZ1 A;  1XNR M;  2CWB A;  1N34 M;  3LJA B;  1IN5 A;  3T1Y M;  3AZL C;  4IJE A;  1ULY A;  1TH2 A;  3CGW A;  3GQ3 A;  2HUE B;  3B6F B;  3C3D A;  5DNN B;  4J8V C;  4AG5 A;  2R4J A;  3KXB C;  2NZD C;  3B0C W;  3REH D;  4R71 A;  4GHA A;  3WTP C;  5B40 B;  3AZK B;  4J8U B;  2HUE C;  3REK A;  3MHV C;  2G5G X;  1LV7 A;  1TH3 A;  3HU1 A;  5AV6 D;  3KS4 A;  5ITX E;  2DZL A;  5AVB D;  5DNY A;  4DR3 M;  2E5L M;  4DV6 M;  1XB2 B;  2WZJ A;  1W5T A;  2C96 A;  3CTW B;  1EE8 A;  3MMP A;  3J27 B;  4JJN C;  5AV5 B;  3MGS A;  3SMP A;  3W99 B;  3KOW E;  5EXX A;  4BBA A;  1HQ3 C;  1ID3 B;  3AYW D;  3M7G A;  5B0Y D;  2KEB A;  4RF0 A;  4AW4 A;  3C1B B;  2CV5 C;  1QZM A;  5DNM B;  2M60 A;  1V92 A;  4Z5T C;  2O5R A;  1GAB A;  2L5A A;  3AN2 C;  1QAN A;  2X8A A;  4LRT A;  4AKI A;  4H9N A;  4NRV A;  3D8L A;  2F8N A;  1F66 C;  2RGO A;  5DNM C;  4S12 A;  3X1T A;  4W5W A;  4ANR A;  5ITQ A;  3UTB D;  2Y2G A;  4H9P A;  4LJ5 A;  1KX3 A;  2XD5 A;  5B0Z D;  1XHB A;  3UTA C;  3JAM S;  5LMU M;  1P3B B;  5B31 B;  2Y2L A;  1R6B X;  3O62 C;  3UTA D;  1QAQ A;  1QAM A;  3TU4 D;  1NHG C;  4DR7 M;  1ZLA D;  3IP4 C;  2KZS A;  5ITY A;  3NQJ B;  3AZI A;  3O62 D;  2JWS A;  1E32 A;  4RF1 A;  2G5I C;  1TR8 A;  3HWS A;  2F2A C;  3AZM B;  2NZD A;  2JUJ A;  1P3M D;  3AN2 B;  1AOI C;  4LZZ A;  3LEL A;  4KLN A;  2F8N K;  3TWK A;  3SC3 A;  3SMS A;  3AZH D;  4WJ3 C;  4DQY B;  1G41 A;  3KUY B;  2CRU A;  1EQZ C;  3WAA A;  3AZH C;  2UXC M;  1PJT A;  5AVC C;  3PNY A;  3SAR A;  1AIP C;  2LXE A;  3HHZ A;  2J7O A;  4DR2 M;  2YQZ A;  3AZL D;  4YM6 D;  3FRH A;  1SG9 A;  2BNK A;  3HGI A;  1N1J B;  1KFV A;  4JI5 M;  3I4Y A;  2EKK A;  5AV6 A;  2ZY4 A;  4IJF A;  1R5L A;  5B33 A;  1M18 A;  1V34 A;  2C9O A;  3M6A A;  1HNZ M;  1TZY A;  1GJT A;  4LF8 M;  2BJW A;  3GRV A;  1IY1 A;  2UUB M;  4EIW A;  4PDG A;  3TU4 A;  3AZI D;  3WTP D;  1TH4 A;  4WU9 B;  1OAO C;  1UM8 A;  1W5S A;  4KOD A;  3T6P A;  2KRU A;  1MU5 A;  2WSF F;  5B32 G;  4B7G A;  3A6N C;  4JN6 A;  5KDM A;  2XSZ A;  3A45 A;  5DNM A;  3A6N D;  1E9R A;  2LHC A;  4LF7 M;  4G3O A;  1WJ7 A;  2CHG A;  2DAM A;  2HAK A;  1DO2 A;  4WU9 A;  2FE8 A;  1X37 A;  1SXJ E;  2NQB D;  5AV9 B;  4JYA M;  4J8X C;  3VH6 W;  2L7I A;  3FTD A;  2H5X A;  3GLH A;  3MGQ A;  5KQD A;  3C9P A;  3KSY A;  2DVW B;  3GRU A;  1P3P C;  2DNA A;  3B0B A;  3Q8X A;  4CSR A;  3AZG B;  5GXQ A;  4DRB A;  2ZY5 A;  3AZH A;  2YFV B;  3FDD A;  4LD9 B;  3IEC A;  4DV3 M;  2UXD M;  3MGR C;  3X1T D;  3WA9 D;  3BOS A;  1Y8G A;  3UTB A;  4X23 C;  2O01 F;  1XXH B;  5KDM B;  1H6U A;  3F92 A;  4GKK M;  3WTP E;  4DBG B;  2CP8 A;  3QYE A;  2LNH C;  5CPK A;  2K6B A;  4KGC B;  3LZ1 B;  2JZ0 A;  3GPX A;  1PJQ A;  1ZLA A;  3AZG C;  1M19 A;  3KWQ B;  1OFH A;  3W96 C;  4DV4 M;  2VDB B;  4FW9 A;  5CPK D;  3KXB A;  1IXS A;  3B6G D;  2XF3 A;  5B0Y A;  2R18 A;  4I5S A;  4IBJ A;  1TZY D;  1VEK A;  3U60 A;  4DR4 M;  5AVC D;  1IXZ A;  3GLG A;  1KX4 D;  4KGC C;  3U6L A;  3IG8 A;  3REL A;  3KSJ A;  1NJG A;  5CPJ D;  3WTP A;  3GLI E;  1IBK M;  1TDZ A;  4L16 A;  3J7B A;  4QOZ C;  1JFI B;  4UUZ B;  3THG A;  4IBE A;  4AKH A;  5BNX B;  3MGS C;  1Z5C A;  3KUY A;  1NV9 A;  2O25 A;  1Z2C B;  3AZE B;  5GSU B;  1QZE A;  5CPI D;  3J80 S;  4FVM A;  1D0K A;  5B24 D;  3C1B A;  4Z5T A;  1HNW M;  1SXJ A;  3E9S A;  3VDU A;  3H0M C;  4B7H A;  2Y0T A;  5C18 A;  5F3W A;  3UT9 B;  3MGS B;  3AV0 A;  1K3X A;  2M5Z A;  1F66 A;  1L1Z A;  3QYB A;  4FCW A;  3MK6 A;  5AY8 D;  1FNN A;  4OU7 A;  3U6P A;  3A1K A;  1K82 A;  5FLX S;  2R45 A;  1TAF B;  3FYD A;  3UTA A;  2QEN A;  1KYI A;  3GLI A;  1VG5 A;  1DGH B;  3X1V A;  3RGS A;  4G4O A;  5B2J B;  1MX0 A;  2HIO B;  4YS3 D;  1HQY E;  1IFY A;  4AWL B;  4WU8 D;  3D8B A;  1R7R A;  3AZG A;  5ITX A;  4H9S C;  5GSU C;  2C5R A;  2NQ8 C;  1P3P D;  2QZ4 A;  2Y2M A;  5B0Y C;  3LEL C;  1H3O A;  3SHF A;  1U35 B;  5AV8 B;  2ARO C;  1GO5 A;  3AFA D;  4NE3 A;  5CP6 D;  3UK6 A;  5B1L D;  5AVC A;  4OX9 M;  1V33 A;  1GKI A;  2BYM B;  4K0K M;  2I7P A;  2XEP A;  1NNJ A;  2Y2K A;  5B33 D;  1M18 D;  2KW0 A;  3MGR B;  2LBC A;  4LFC M;  3U60 B;  1Z5A A;  5B33 C;  1M18 C;  2FH0 A;  2FS1 A;  2LWX A;  5FSW A;  1JR3 A;  1M19 D;  2JY8 A;  1Z6T A;  4GC5 A;  3A42 A;  5B0Z C;  3OTO M;  1P3I C;  5JRG A;  5EP3 A;  3B7Q A;  3U6S A;  3GLH E;  1TZY C;  3W97 B;  3LZ1 C;  5GXQ B;  3AZJ B;  5JRG B;  3DZD A;  4XBO A;  1KX4 C;  3B74 A;  4X62 M;  1WR1 B;  1YE9 A;  3KOY E;  4RKU F;  2JE5 A;  2YR0 A;  5B1M D;  2D7G A;  2C98 A;  2DHR A;  1N32 M;  3QWL A;  5B31 A;  2DF4 C;  5A2Q S;  3REI B;  3T1H M;  3MGP B;  4AZF A;  2YFQ A;  3GLF E;  3U5Z A;  1OIP A;  3E21 A;  3W67 A;  2RVQ D;  2MJ5 B;  3H4J A;  5EXT A;  4KO8 A;  2FFF B;  2CE7 A;  1N1J A;  3GLF A;  4H9R A;  5LMN M;  3W0F A;  2HCB A;  3REI C;  4I81 A;  4Z66 D;  3C58 A;  1KX5 D;  3W98 B;  1M1A A;  4IBD A;  3AZK C;  4XUJ D;  3SAT A;  2WSE F;  3AZE A;  4LJA A;  2DKL A;  4XUJ C;  4DRA A;  3LJA D;  5BO0 B;  1JR3 D;  2OQ4 A;  3GQ4 A;  4KUD C;  5JI3 E;  4P17 A;  4J8V A;  1G4A E;  3B7Z A;  1P3A A;  1QUS A;  4PT5 A;  4H9Q B;  1XMO M;  4ZBJ C;  1P3P A;  4JJN B;  2ERC A;  3WKJ A;  5AVB A;  4DV5 M;  2ARO A;  1G71 A;  3B6F C;  1L1T A;  4B7F A;  3REJ B;  3MGR A;  1P3K D;  4M6B A;  2DEN A;  2OO9 A;  1P3F B;  5KPZ A;  1P3K C;  4WUR A;  5FUG B;  2HL7 A;  2C99 A;  1F1E A;  5B40 D;  1WWI A;  4J8W B;  4LCB A;  1T3T A;  3ZQJ A;  3AYW C;  1F4I A;  4JJN A;  1P3G B;  1NSF A;  2YFV A;  5B2I C;  3REJ C;  5C3I B;  3AOE A;  1AUA A;  1HQ3 D;  3LZ1 A;  4AWL C;  4ITQ A;  4E44 A;  3GLH B;  3W99 D;  3HHY A;  3H0L C;  2DHY A;  4OW0 A;  3AN2 A;  1ZMU A;  3R9X B;  5EQT A;  4KHA B;  5DYI A;  4WNN A;  3REL C;  2XSZ D;  5B31 C;  2LTU A;  5B2J A;  4MGI E;  5DNM D;  4ZUX B;  3X1V B;  5AV8 C;  3IHP A;  1P3O A;  3HU3 A;  2VQR A;  4X65 M;  4WV4 B;  3QAU A;  2XZF A;  3M0E A;  3FUT A;  4MGY E;  2ZY3 A;  3X1T C;  3GLG B;  3B0D B;  3WHK A;  1P3O D;  3GQ5 A;  1NVM A;  3B89 A;  3KUY C;  3REI A;  3VFD A;  3WKJ B;  3PVS A;  5B40 A;  3AZK A;  4B3T M;  2PYO A;  2Y21 A;  3C1B C;  2CV5 B;  1R2Z A;  3WAA D;  2BYK A;  2UUC M;  4Z5T B;  4DV1 M;  5F99 D;  3UTA B;  2VQF M;  1E9S A;  3TU4 B;  1HR0 M;  1NJF A;  5C1B A;  2KZU A;  1P3A D;  1I4W A;  3WA9 A;  4B3R M;  3WKJ C;  3K9O A;  3AFA A;  4GRI A;  1EQZ A;  4LGM A;  3SYL A;  1F66 B;  5GT0 D;  2YNM D;  3Q8G A;  3AN2 D;  5JA4 A;  2FJ7 B;  3U6O A;  4UUZ A;  2FOI C;  4NOO B;  1IN4 A;  4QNR A;  2L6O A;  4JXJ A;  1P3K A;  2CFO A;  2YFW B;  3FE3 A;  3AZL A;  2GNO A;  3KXB D;  3LJA C;  3MVD D;  3AZL B;  2JY5 A;  3REK B;  3J7A S;  4JI8 M;  2X49 A;  2Y2Q A;  1IM2 A;  2W82 A;  3TE6 A;  5CPI C;  4JI2 M;  4Y28 F;  3IG5 A;  3LZ0 B;  2FJ7 A;  1AOI B;  3TL4 X;  3B6F D;  5DNN D;  2F5O A;  3TU4 C;  1T43 A;  3HHW A;  3KWQ A;  1ZMW A;  2XFS A;  4DV7 M;  3VLF B;  5F99 A;  1NY6 A;  3PXG A;  3LVW A;  1IN7 A;  3REK C;  3REH B;  1GLN A;  4Q7J A;  3WTP B;  2ZAO A;  1D0L A;  4J8X B;  3TWL A;  1E94 E;  3LZ0 C;  2G5H C;  4J8U D;  4G4R A;  4B08 A;  4H9P B;  3LQR A;  4JI4 M;  4QLC D;  1D2N A;  1GL7 A;  2NZD B;  3B7N A;  1DV0 A;  5AVB B;  3T15 A;  2NQB C;  5B0Z A;  4Z66 A;  2JY6 B;  1KX5 A;  3A6N B;  2LVP C;  2VF7 A;  5FTK A;  3BXW A;  2X4A A;  1EFU B;  1PGY A;  5AV5 D;  4IBG A;  1P3G C;  1XC8 A;  2V1U A;  4GIT A;  3CF6 E;  4MB7 A;  5FTN A;  4X64 M;  3MNN A;  5BS7 A;  4LJ8 A;  1XXH A;  3W98 A;  2NQB B;  3FYC A;  4FD2 A;  4CIS A;  1T3U A;  1JB0 F;  5B32 C;  2LVO C;  1P3L C;  3AV2 D;  4M9X A;  5B32 D;  2R6F A;  3A98 B;  1G3I A;  4IBI A;  2VF8 A;  4E45 A;  3EIE A;  1OQY A;  4L15 A;  3JR4 A;  4M9Z A;  3AZG D;  5BNV A;  1GVN A;  4GH9 A;  3AZF D;  1KU5 A;  3O62 A;  5CPK C;  4LD9 C;  3GLF B;  4H9R B;  3UT9 A;  4DV2 M;  3W96 D;  3NQJ A;  1YLA A;  2DZN B;  1TAF A;  1P3B D;  5CPJ A;  4DR5 M;  1P3A C;  3LZ1 D;  1DGG A;  2H1R A;  2OOA A;  2V1C A;  1KX3 B;  2F8N D;  3KWQ C;  3E46 A;  2ZM6 M;  1G59 A;  5B24 A;  5CPK B;  3B6F A;  4AQY M;  3MGQ D;  2G8L A;  2MRO B;  1P3L B;  1HQC A;  4JI0 M;  1PJJ A;  3AV1 D;  2LH0 A;  2F8N G;  4RNA A;  2BG1 A;  4FWH A;  1VDD A;  4NSO B;  5E5A D;  4I4L A;  3LZ0 A;  2FNA A;  2CWE A;  3T38 A;  4G4Q A;  3AYW A;  3VKG A;  3L26 A;  5E6J A;  3LCV B;  3LQQ A;  5GT3 B;  5E26 A;  1H3O B;  1U35 A;  4Z66 C;  2UUA M;  3HJQ A;  4Z2M H;  2KRK A;  1P3G A;  1PZR A;  3NQU B;  1SXJ C;  3MNN C;  5AY8 A;  2JNH A;  5EJC A;  5B2J C;  3U6D A;  2QPA A;  5AV8 A;  3FD9 A;  4R8P D;  2L09 A;  3SBJ A;  1P3L A;  1XXH E;  3RGP A;  1QDR A;  3HX3 A;  4KT0 F;  4II7 A;  5IRE B;  4NSR A;  3A6N A;  2LVN C;  3LVV A;  4PCZ A;  3AL0 C;  3FUU A;  3KXE C;  3C1C A;  3L2A A;  1C7Y A;  2Y2J A;  4YHH M;  3LEL B;  1OAI A;  1J5E M;  4FCV A;  2Y2H A;  1K3W A;  3L27 A;  1EIJ A;  3AZN C;  1HJP A;  4WU9 C;  1IN6 A;  4NC6 A;  1N33 M;  2WSC F;  3AZN D;  3REH A;  3VK8 A;  1N36 M;  4TUW A;  3GPP A;  4HGA B;  1XMQ M;  3FTF A;  2Z3X A;  4NRW A;  2ARO D;  3K2L A;  3I01 M;  4YS3 B;  2UXB M;  2ZTC A;  1NO1 A;  3WA9 C;  2DZO B;  3AFA C;  1P3P B;  1P3I B;  5B24 C;  1W2E A;  5DFL A;  3U5Z B;  1IY2 A;  2CV1 A;  3AJI B;  1BVS A;  2GQF A;  4HEO A;  3AZF C;  5B1L B;  5G49 B;  3VH5 T;  4LD9 D;  1P34 B;  1NHW C;  1TTE A;  4JI6 M;  4XZQ A;  2XGN A;  1ID3 A;  1M19 C;  2R65 A;  3LW5 F;  2OPF A;  5JA4 B;  1P3I A;  4KGC D;  5AV5 A;  4WU8 A;  3KWQ D;  4LF9 M;  1PJS A;  3HJS A;  4GIP A;  1KX4 A;  3U61 B;  1P34 C;  1JR3 E;  4YS3 C;  1DGF A;  2F5Q A;  1MJG M;  4F2L A;  4KGC A;  1S32 B;  5GXQ D;  3K1J A;  4DR6 M;  3AZJ C;  2CUZ A;  1BH8 B;  1KX4 B;  2VII A;  3LMM A;  5BPV A;  4HL4 A;  4QNM A;  4M0W A;  1IXS B;  3REI D;  1P3Q Q;  3MGP D;  2Z4S A;  5BNV B;  3NBI A;  2IO5 C;  1QVR A;  1J09 A;  4X23 D;  4J8V D;  5GT3 A;  1ZQ9 A;  4BB9 A;  1R4V A;  1KX5 C;  4G4N A;  2DAG A;  1M1A C;  1SXJ D;  3MNN D;  5FTM A;  3MVD C;  3AZE C;  1M1A D;  4LFA M;  4UN2 B;  4ZUX A;  1JFI A;  4XUJ A;  2JP7 A;  3KOX E;  5BS7 C;  3W98 D;  1KSF X;  4Z6Y A;  3SAW A;  5GKN A;  2YFW A;  3AZE D;  3SAS A;  2KNZ A;  4M0D A;  2Y2O A;  3W98 C;  1XWI A;  2B3T A;  4LJ4 A;  1Q39 A;  4CHT B;  5B32 A;  2R46 A;  1S32 A;  1A5T A;  3C1C D;  3AFH A;  2XD1 A;  4JJN D;  2I7N A;  1HNX M;  4QHS A;  3AV1 A;  3SYK A;  3ZCB B;  3X1U A;  1QQW A;  5ITR A;  4IBF A;  2LY8 A;  1VQ1 A;  2QP9 X;  4XGI A;  4G92 C;  1B67 A;  3X1S D;  1S3S A;  2XLJ A;  3UT9 C;  4REZ A;  1Q02 A;  3X1U D;  4H9S A;  5GSU A;  1L2D A;  2Q2E B;  4WU8 B;  5ITU A;  5AV5 C;  1P3G D;  4M9S A;  2V6Z M;  3W99 C;  3AZK D;  4DUZ M;  2KNA A;  8CAT A;  1OTR A;  4MH0 E;  2EKF A;  2Y20 A;  5AV6 B;  4JI1 M;  3UMM A;  4P16 A;  5AV8 D;  4LF6 M;  2HIO C;  3U6M A;  1ZMV A;  3PFI A;  1R4G A;  4L4U A;  4NFT A;  3X1V D;  2OOB A;  3TWM A;  2XFT A;  4XZQ D;  2ZBK B;  1ID3 D;  3AYW B;  5B0Y B;  5B33 B;  1M18 B;  3C1B D;  1U35 C;  5B2I B;  5KPR A;  5C3I C;  1P3M C;  1JQJ C;  3EIH A;  4B3S M;  1M19 B;  2PYO C;  3X1S A;  2HWJ A;  3GPY A;  3TPZ A;  2PYO D;  3WHL A;  1WHC A;  1R2Y A;  5FUG A;  3AZJ D;  3R8F A;  3AV2 A;  1Q3B A;  4JI3 M;  3REL B;  2CV5 D;  3JR5 A;  3B0C T;  5B1M B;  2RIQ A;  1S32 C;  3GRR A;  3H0R C;  2DWL A;  3C3E A;  5B0Z B;  2MH8 A;  2UU9 M;  5CP6 C;  4CSR B;  2QCU A;  3H4M A;  2MR9 A;  4R7G A;  1NNU C;  5GT0 B;  1ZLA B;  1J7K A;  3O62 B;  3SHG B;  4QOS A;  1P3B A;  4KUD D;  2Z8Y M;  4CAY A;  5AV9 A;  3U6E A;  3LJA A;  3REH C;  2BYM A;  2QQ8 A;  4WZS B;  3AZM D;  3GRY A;  4QLC A;  1P3M B;  4A3V B;  4KUD A;  3NQU A;  4XUJ B;  3KUY D;  4I8O A;  3MVD B;  1EQZ B;  3K9P A;  3W99 A;  3REK D;  3V76 A;  5AVB C;  2DI0 A;  4AI6 A;  2XZU A;  5IT9 S;  2L4F A;  1N75 A;  2D7H A;  2J5Y A;  4YM6 B;  1UFZ A;  1TDH A;  5EP1 A;  5B1M C;  3LZ0 D;  3NBX X;  4J8U C;  1AOI D;  1MN3 A;  2Y2I A;  5FTJ A;  3KP1 E;  4R8P C;  3EPJ A;  4XK8 F;  2HIO A;  2BYK B;  5GT0 A;  2K47 A;  4LG2 A;  4CIZ A;  1G8P A;  3REJ D;  3HY5 A;  1P3K B;  4EO5 B;  3U6Q A;  3TQS A;  1P3F D;  3EPH A;  4L6V 6;  4CJ6 A;  4GHL A;  4J8X D;  3KW6 A;  3W97 A;  5H37 D;  5EP4 A;  3REJ A;  2APL A;  3AOE C;  4WU9 D;  2NZD D;  4BLC A;  3KFU G;  4MGK E;  2HHH M;  4Z8X A;  4EO5 C;  1IQP A;  1YUB A;  1GJS A;  4IIW A;  4H9N B;  3R45 B;  1WGN A;  3AZJ A;  3L25 A;  1P3O C;  1PRB A;  2P5T A;  3FTE A;  4YM6 A;  4DR1 M;  4LF5 M;  2Z4R A;  1QAO A;  2AHM A;  4L8R C;  5BR8 M;  2Y2P A;  2LHG A;  5CP6 A;  2QSF X;  3GP1 A;  2KA6 B;  4B3M M;  1A7W A;  5B32 B;  1IBM M;  3B6G C;  4LJ6 A;  1P3B C;  1HQ3 A;  1ZAE A;  3AKZ A;  1B6W A;  1P3O B;  5BT1 D;  5B40 C;  5AV9 C;  5E5A A;  3DOA A;  1I94 M;  4G6Z A;  1BFM A;  4ZUX C;  3B9P A;  4WP2 A;  4JV5 M;  3MJ5 A;  1DGH A;  3WKJ D;  2ZAN A;  3W0L B;  4J8X A;  5CHL B;  3I51 A;  2L2D A;  4LY6 A;  2D7E A;  2VQE M;  3MGQ C;  3WAA B;  3W96 B;  2L7H A;  4Z5T D;  5F99 B;  4PD2 A;  2G3Q A;  4H9O A;  3UTB B;  4OVZ A;  3X1T B;  3KS8 A;  5EXP A;  4G91 C;  2JCH A;  1IBL M;  5B1M A;  1KX3 D;  1P3A B;  5B31 D;  3AOG A;  3AV1 C;  2F4V M;  3GLI B;  5L8R F;  1KX3 C;  1F66 D;  5KO3 A;  4J8W A;  3MGQ B;  2BWE A;  1P3L D;  3AZM C;  3ZH9 B;  3FUV A;  2DWZ B;  3GPU A;  3VH6 A;  3AZI C;  3B6G B;  4WW0 A;  1ZLA C;  2ZAM A;  5E5A B;  3AZH B;  5AVC B;  4JI7 M;  3EPL A;  1DGB A;  5CPI A;  4H9Q A;  2FJ7 C;  1IY0 A;  2J7N A;  3KSX A;  3WAA C;  3EPK A;  5IWA M;  5F99 C;  3MGP A;  3KDS E;  2L4E A;  1PJI A;  2CV0 A;  4HGA C;  2HKJ A;  4GC9 A;  3SFZ A;  4FCT A;  2R62 A;  4LGY A;  5BNX A;  4YM6 C;  1C1K A;  1Z59 A;  3C1C C;  4R8P B;  1CUK A;  3A1I A;  5CPI B;  3RFW A;  1N78 A;  2NQB A;  5ITT A;  1VEJ A;  3K8Z A;  5B24 B;  2ZM5 A;  4LF4 M;  3NWL A;  4QLC B;  1ORY B;  2DAI A;  1DO0 A;  3AZI B;  1P3M A;  2UWX A;  4LZJ A;  3LEL D;  2RRU A;  2K9D A;  3VH5 W;  5E5A C;  1YSY A;  3UT9 D;  1OKS A;  1BH9 B;  3V9R B;  3MGS D;  1VDL A;  2R0I A;  3SAU A;  3KVW A;  4FWG A;  3A46 A;  3AV2 C;  3U61 A;  3RE8 A;  4F1I A;  3AZN B;  7CAT A;  2Z7J A;  1NY5 A;  2C9C A;  1FJG M;  1OIZ A;  3UZU A;  3DFZ A;  2ZY2 A;  1NV8 A;  4YY3 M;  5KPT A;  3FUW A;  1WXQ A;  4ZPX A;  5B2J D;  3AV2 B;  2HIO D;  1TGU A;  1P3I D;  3AZF A;  4FWD A;  5BT1 C;  5AV9 D;  3AZM A;  3R45 A;  1LTM A;  5DYG A;  4LD9 A;  2DAE A;  3F6T A;  4XZQ C;  5EXS A;  4QLC C;  4D82 A;  3AZF B;  3LCU A;  1U35 D;  5CPJ C;  1T6O A;  1IN8 A;  4D80 A;  4CGY B;  3PNV A;  3WA9 B;  4X66 M;  2RVQ C;  1HT2 E;  2EA0 A;  5GXQ C;  4J8U A;  2DXI A;  4R8P A;  1XNQ M;  3UTB C;  2F8N B;  4AG6 A;  4X23 A;  4NL4 H;  3ZC7 B;  5BO0 A;  4G91 B;  1QUT A;  1Z5B A;  4NE6 A;  3AV1 B;  3W97 D;  2DQN C;  3W96 A;  1TZY B;  3W97 C;  3VDP A;  5GT3 C;  5JRG C;  1IXR C;  4GKJ M;  2N35 A;  1D0M A;  5GT3 D;  2J8P A;  2JA2 A;  5CPJ B;  2CV5 A;  4X23 B;  4GMQ A;  5FTL A;  4R3D A;  2Y0Q A;  4PDI A;  5AY8 C;  4LJ9 A;  5B1L A;  1SXJ B;  4G92 B;  3MNN B;  3VK7 A;  3FRI A;  1M1A B;  2F5P A;  2RGH A;  2QBY B;  1RU3 A;  3ILK A;  2KXE A;  3I04 M;  3HHX A;  4ZBJ B;  4Z66 B;  1VEG A;  1L8Q A;  3J81 S;  3J2P B;  1Q9C A;  5KQ8 A;  3SAV A;  5GSU D;  3KOZ E;  2KNV A;  1HTA A;  3X1U C;  3B6G A;  3C1C B;  4H9O B;  4KHA A;  2W8S A;  4WNN B;  3AZN A;  1OJL A;  4L78 A;  5DNN A;  5IZ7 D;  2JSS A;  4CAY B;  2BJV A;  3CF2 A;  2CHV A;  1PM5 A;  3GO8 A;  3X1S B;  2R44 A;  4NXM M;  4HLQ A;  5AY8 B;  4LJ7 A;  3X1U B;  1AOI A;  1ZV1 A;  4UPK A;  2ARO B;  3L28 A;  4NXN M;  2BWB A;  4LRS A;  2XH9 A;  4IBB A;  4Z2M G;  1QDT A;  1BH8 A;  2EUC A;  1QYR A;  1OFI A;  4J8W D;  1P3F A;  1WIV A;  1BH9 A;  3V9R A;  4J8W C;  4DV0 M;  5JI2 E;  3P5J B;  3HU2 A;  2QHO B;  4DUY M;  3X1V C;  3BBZ A;  5AV6 C;  1L2B A;  3CF0 A;  1HQ3 B;  1ID3 C;  1WGL A;  2F8N H;  2F5S A;  2KHH A;  1P34 D;  2KDL A;  1HT1 E;  1GL6 A;  4KHP M;  5B2I A;  2EJS A;  2MGW A;  2DWN A;  3AFA B;  3VH5 A;  4XZQ B;  5CP6 B;  4WU8 C;  3KP0 E;  3U6C A;  3X1S C;  1P34 A;  4ZUX D;  2EO2 A;  3L29 A;  2F5N A;  5G49 A;  4YS3 A;  3FKE A;  5B2I D;  3EG5 B;  3GLG E;  4IBC A;  4IBK A;  2DWM A;  5B1L C;  3MGP C;  2FFJ A;  3MGR D;  2RKO A;  5EP2 A; 
#chains in the Genus database with same CATH homology
 2CHQ A;  1L2C A;  2PYO B;  1S32 D;  4NE5 A;  3REL D;  3B0D C;  5JRG D;  4OVZ B;  2IO5 B;  1WWS A;  5DNN C;  4MGH A;  3MVD A;  4AKG A;  4J8V B;  3UJN A;  4LFB M;  4KUD B;  1N77 A;  3I4V A;  3UGJ A;  2CV2 A;  3HJ8 A;  2CEA A;  3K92 A;  2FJ7 D;  2R4E A;  2Y2N A;  3VH6 T;  1Q3C A;  3HKP A;  3FUX A;  2QBY A;  3E4R A;  3VKH A;  5B31 G;  4D81 A;  2A5Y B;  3FTC A;  1KX5 B;  1EQZ D;  4MM3 B;  3DA1 A;  4MGZ E;  1P3F C;  4QHT A;  3KXB B;  5GT0 C;  1XNR M;  1N34 M;  3LJA B;  1IN5 A;  3T1Y M;  3AZL C;  4IJE A;  1ULY A;  1TH2 A;  3GQ3 A;  2HUE B;  3B6F B;  5DNN B;  4J8V C;  4AG5 A;  2R4J A;  3KXB C;  2NZD C;  3B0C W;  3REH D;  4GHA A;  3WTP C;  5B40 B;  3AZK B;  4J8U B;  2HUE C;  3REK A;  3MHV C;  2G5G X;  1LV7 A;  1TH3 A;  3HU1 A;  5AV6 D;  3KS4 A;  5ITX E;  5AVB D;  5DNY A;  4DR3 M;  2E5L M;  4DV6 M;  1W5T A;  2C96 A;  3CTW B;  1EE8 A;  3J27 B;  4JJN C;  5AV5 B;  3MGS A;  3SMP A;  3W99 B;  3KOW E;  5EXX A;  4BBA A;  1HQ3 C;  1ID3 B;  3AYW D;  3M7G A;  5B0Y D;  2KEB A;  4RF0 A;  4AW4 A;  3C1B B;  2CV5 C;  1QZM A;  5DNM B;  2M60 A;  4Z5T C;  2O5R A;  2L5A A;  3AN2 C;  1QAN A;  2X8A A;  4LRT A;  4AKI A;  4H9N A;  4NRV A;  3D8L A;  2F8N A;  1F66 C;  2RGO A;  5DNM C;  4S12 A;  3X1T A;  4W5W A;  5ITQ A;  3UTB D;  2Y2G A;  4H9P A;  4LJ5 A;  1KX3 A;  2XD5 A;  5B0Z D;  1XHB A;  3UTA C;  3JAM S;  5LMU M;  1P3B B;  5B31 B;  2Y2L A;  1R6B X;  3O62 C;  3UTA D;  1QAQ A;  1QAM A;  3TU4 D;  1NHG C;  4DR7 M;  1ZLA D;  3IP4 C;  2KZS A;  5ITY A;  3NQJ B;  3AZI A;  3O62 D;  1E32 A;  4RF1 A;  2G5I C;  3HWS A;  2F2A C;  3AZM B;  2NZD A;  1P3M D;  3AN2 B;  1AOI C;  4LZZ A;  3LEL A;  4KLN A;  2F8N K;  3TWK A;  3SC3 A;  3SMS A;  3AZH D;  4WJ3 C;  4DQY B;  1G41 A;  3KUY B;  1EQZ C;  3WAA A;  3AZH C;  2UXC M;  5AVC C;  3PNY A;  3SAR A;  2LXE A;  3HHZ A;  2J7O A;  4DR2 M;  2YQZ A;  3AZL D;  4YM6 D;  2BNK A;  3HGI A;  1N1J B;  1KFV A;  4JI5 M;  3I4Y A;  5AV6 A;  2ZY4 A;  4IJF A;  5B33 A;  1M18 A;  2C9O A;  3M6A A;  1HNZ M;  1TZY A;  4LF8 M;  2BJW A;  3GRV A;  1IY1 A;  2UUB M;  4EIW A;  4PDG A;  3TU4 A;  3AZI D;  3WTP D;  1TH4 A;  4WU9 B;  1UM8 A;  1W5S A;  4KOD A;  2KRU A;  1MU5 A;  5B32 G;  4B7G A;  3A6N C;  4JN6 A;  5KDM A;  2XSZ A;  3A45 A;  5DNM A;  3A6N D;  1E9R A;  4LF7 M;  2CHG A;  1DO2 A;  4WU9 A;  2FE8 A;  1X37 A;  1SXJ E;  2NQB D;  5AV9 B;  4JYA M;  4J8X C;  3VH6 W;  2L7I A;  3FTD A;  3GLH A;  3MGQ A;  5KQD A;  3KSY A;  2DVW B;  3GRU A;  1P3P C;  3B0B A;  3Q8X A;  4CSR A;  3AZG B;  5GXQ A;  4DRB A;  2ZY5 A;  3AZH A;  2YFV B;  3FDD A;  4LD9 B;  2UXD M;  4DV3 M;  3MGR C;  3X1T D;  3WA9 D;  3BOS A;  3UTB A;  4X23 C;  1XXH B;  5KDM B;  1H6U A;  4GKK M;  3WTP E;  2LNH C;  5CPK A;  4KGC B;  3LZ1 B;  3GPX A;  1ZLA A;  3AZG C;  1M19 A;  3KWQ B;  1OFH A;  3W96 C;  4DV4 M;  4FW9 A;  5CPK D;  3KXB A;  3B6G D;  2XF3 A;  5B0Y A;  2R18 A;  4I5S A;  4IBJ A;  1TZY D;  3U60 A;  4DR4 M;  5AVC D;  1IXZ A;  3GLG A;  1KX4 D;  4KGC C;  3U6L A;  3IG8 A;  3REL A;  3KSJ A;  1NJG A;  5CPJ D;  3WTP A;  1IBK M;  1TDZ A;  4L16 A;  3J7B A;  4QOZ C;  1JFI B;  4UUZ B;  3THG A;  4IBE A;  4AKH A;  5BNX B;  3MGS C;  1Z5C A;  3KUY A;  1Z2C B;  3AZE B;  5GSU B;  5CPI D;  3J80 S;  4FVM A;  5B24 D;  3C1B A;  4Z5T A;  1HNW M;  1SXJ A;  3E9S A;  3VDU A;  3H0M C;  4B7H A;  2Y0T A;  5C18 A;  5F3W A;  3UT9 B;  3MGS B;  3AV0 A;  1K3X A;  2M5Z A;  1F66 A;  1L1Z A;  4FCW A;  3MK6 A;  5AY8 D;  1FNN A;  4OU7 A;  3U6P A;  3A1K A;  1K82 A;  5FLX S;  2R45 A;  1TAF B;  3FYD A;  3UTA A;  2QEN A;  1KYI A;  3GLI A;  1DGH B;  3X1V A;  3RGS A;  4G4O A;  5B2J B;  1MX0 A;  2HIO B;  4YS3 D;  1HQY E;  4AWL B;  4WU8 D;  3D8B A;  1R7R A;  3AZG A;  5ITX A;  4H9S C;  5GSU C;  2C5R A;  2NQ8 C;  1P3P D;  2QZ4 A;  2Y2M A;  5B0Y C;  3LEL C;  1H3O A;  3SHF A;  1U35 B;  5AV8 B;  2ARO C;  3AFA D;  4NE3 A;  5CP6 D;  3UK6 A;  5B1L D;  5AVC A;  4OX9 M;  1GKI A;  2BYM B;  4K0K M;  2I7P A;  2XEP A;  1NNJ A;  2Y2K A;  5B33 D;  1M18 D;  2KW0 A;  3MGR B;  4LFC M;  3U60 B;  1Z5A A;  5B33 C;  1M18 C;  5FSW A;  2LWX A;  1JR3 A;  1M19 D;  1Z6T A;  4GC5 A;  3A42 A;  5B0Z C;  3OTO M;  1P3I C;  5JRG A;  5EP3 A;  3U6S A;  1TZY C;  3W97 B;  3LZ1 C;  5GXQ B;  3AZJ B;  5JRG B;  3DZD A;  4XBO A;  1KX4 C;  4X62 M;  1YE9 A;  3KOY E;  2JE5 A;  2YR0 A;  5B1M D;  2D7G A;  2C98 A;  2DHR A;  1N32 M;  3QWL A;  5B31 A;  2DF4 C;  5A2Q S;  3REI B;  3T1H M;  3MGP B;  4AZF A;  2YFQ A;  3U5Z A;  2RVQ D;  5EXT A;  4KO8 A;  2FFF B;  2CE7 A;  1N1J A;  3GLF A;  4H9R A;  5LMN M;  3W0F A;  2HCB A;  3REI C;  4I81 A;  4Z66 D;  3C58 A;  1KX5 D;  3W98 B;  1M1A A;  4IBD A;  3AZK C;  4XUJ D;  3SAT A;  3AZE A;  4LJA A;  4XUJ C;  4DRA A;  3LJA D;  5BO0 B;  1JR3 D;  2OQ4 A;  3GQ4 A;  4KUD C;  5JI3 E;  4J8V A;  1G4A E;  1P3A A;  4PT5 A;  4H9Q B;  1XMO M;  4ZBJ C;  1P3P A;  4JJN B;  2ERC A;  3WKJ A;  5AVB A;  4DV5 M;  2ARO A;  3B6F C;  1L1T A;  4B7F A;  3REJ B;  3MGR A;  1P3K D;  4M6B A;  1P3F B;  5KPZ A;  1P3K C;  4WUR A;  5FUG B;  2HL7 A;  2C99 A;  1F1E A;  5B40 D;  1WWI A;  4J8W B;  4LCB A;  1T3T A;  3AYW C;  1P3G B;  4JJN A;  1NSF A;  2YFV A;  5B2I C;  3REJ C;  5C3I B;  3AOE A;  1HQ3 D;  3LZ1 A;  4AWL C;  4ITQ A;  4E44 A;  3GLH B;  3W99 D;  3HHY A;  3H0L C;  4OW0 A;  3AN2 A;  3R9X B;  5EQT A;  4KHA B;  5DYI A;  4WNN A;  3REL C;  2XSZ D;  5B31 C;  5B2J A;  4MGI E;  5DNM D;  4ZUX B;  3X1V B;  5AV8 C;  1P3O A;  3HU3 A;  2VQR A;  4X65 M;  4WV4 B;  3QAU A;  2XZF A;  3M0E A;  3FUT A;  4MGY E;  2ZY3 A;  3X1T C;  3GLG B;  3B0D B;  3WHK A;  1P3O D;  3GQ5 A;  1NVM A;  3KUY C;  3REI A;  3VFD A;  3WKJ B;  3AZK A;  3PVS A;  5B40 A;  4B3T M;  2PYO A;  2Y21 A;  3C1B C;  2CV5 B;  1R2Z A;  3WAA D;  2BYK A;  2UUC M;  4Z5T B;  4DV1 M;  5F99 D;  3UTA B;  2VQF M;  1E9S A;  3TU4 B;  1HR0 M;  1NJF A;  5C1B A;  2KZU A;  1P3A D;  1I4W A;  3WA9 A;  4B3R M;  3WKJ C;  3AFA A;  4GRI A;  1EQZ A;  4LGM A;  3SYL A;  1F66 B;  5GT0 D;  2YNM D;  3AN2 D;  5JA4 A;  2FJ7 B;  3U6O A;  4UUZ A;  2FOI C;  4NOO B;  1IN4 A;  4QNR A;  2L6O A;  4JXJ A;  1P3K A;  2CFO A;  2YFW B;  3AZL A;  3KXB D;  3LJA C;  3MVD D;  3AZL B;  3REK B;  3J7A S;  4JI8 M;  2X49 A;  2Y2Q A;  1IM2 A;  2W82 A;  3TE6 A;  5CPI C;  4JI2 M;  3IG5 A;  3LZ0 B;  2FJ7 A;  1AOI B;  3TL4 X;  3B6F D;  5DNN D;  2F5O A;  3TU4 C;  3HHW A;  3KWQ A;  2XFS A;  4DV7 M;  3VLF B;  5F99 A;  1NY6 A;  3PXG A;  3LVW A;  1IN7 A;  3REK C;  3REH B;  1GLN A;  3WTP B;  2ZAO A;  4J8X B;  3TWL A;  1E94 E;  3LZ0 C;  2G5H C;  4J8U D;  4G4R A;  4B08 A;  4H9P B;  3LQR A;  4JI4 M;  4QLC D;  1D2N A;  1GL7 A;  2NZD B;  5AVB B;  3T15 A;  2NQB C;  5B0Z A;  4Z66 A;  1KX5 A;  3A6N B;  5FTK A;  2X4A A;  4IBG A;  5AV5 D;  1P3G C;  1XC8 A;  2V1U A;  4GIT A;  3CF6 E;  4MB7 A;  5FTN A;  4X64 M;  3MNN A;  5BS7 A;  4LJ8 A;  1XXH A;  3W98 A;  2NQB B;  3FYC A;  4FD2 A;  4CIS A;  1T3U A;  5B32 C;  1P3L C;  3AV2 D;  4M9X A;  5B32 D;  3A98 B;  1G3I A;  4IBI A;  4E45 A;  3EIE A;  4L15 A;  3JR4 A;  4M9Z A;  3AZG D;  5BNV A;  1GVN A;  4GH9 A;  3AZF D;  1KU5 A;  3O62 A;  5CPK C;  4LD9 C;  3GLF B;  4H9R B;  3UT9 A;  4DV2 M;  3W96 D;  3NQJ A;  2DZN B;  1TAF A;  1P3B D;  5CPJ A;  4DR5 M;  1P3A C;  3LZ1 D;  1DGG A;  2H1R A;  2V1C A;  1KX3 B;  2F8N D;  3KWQ C;  2ZM6 M;  5B24 A;  1G59 A;  5CPK B;  3B6F A;  4AQY M;  3MGQ D;  2G8L A;  1P3L B;  1HQC A;  4JI0 M;  1PJJ A;  3AV1 D;  2LH0 A;  2F8N G;  4RNA A;  2BG1 A;  4FWH A;  1VDD A;  4NSO B;  5E5A D;  4I4L A;  3LZ0 A;  2FNA A;  2CWE A;  3T38 A;  4G4Q A;  3AYW A;  3VKG A;  3L26 A;  5E6J A;  5GT3 B;  3LQQ A;  5E26 A;  1H3O B;  1U35 A;  4Z66 C;  2UUA M;  3HJQ A;  4Z2M H;  2KRK A;  1P3G A;  1PZR A;  3NQU B;  1SXJ C;  3MNN C;  5AY8 A;  5EJC A;  5B2J C;  3U6D A;  2QPA A;  5AV8 A;  3FD9 A;  4R8P D;  2L09 A;  3SBJ A;  1P3L A;  3RGP A;  4II7 A;  5IRE B;  4NSR A;  3A6N A;  3LVV A;  4PCZ A;  3AL0 C;  3FUU A;  3KXE C;  3C1C A;  3L2A A;  2Y2J A;  4YHH M;  3LEL B;  1J5E M;  4FCV A;  2Y2H A;  1K3W A;  3L27 A;  3AZN C;  4WU9 C;  1IN6 A;  1N33 M;  3AZN D;  3REH A;  3VK8 A;  1N36 M;  4TUW A;  3GPP A;  4HGA B;  1XMQ M;  3FTF A;  2Z3X A;  4NRW A;  2ARO D;  3K2L A;  4YS3 B;  2UXB M;  3WA9 C;  2DZO B;  3AFA C;  1P3P B;  1P3I B;  5B24 C;  1W2E A;  3U5Z B;  1IY2 A;  2CV1 A;  3AJI B;  3AZF C;  5B1L B;  5G49 B;  3VH5 T;  4LD9 D;  1P34 B;  1NHW C;  4JI6 M;  4XZQ A;  2XGN A;  1ID3 A;  1M19 C;  2R65 A;  2OPF A;  5JA4 B;  1P3I A;  4KGC D;  5AV5 A;  4WU8 A;  3KWQ D;  4LF9 M;  3HJS A;  4GIP A;  1KX4 A;  3U61 B;  1P34 C;  4YS3 C;  1DGF A;  2F5Q A;  4KGC A;  1S32 B;  5GXQ D;  3K1J A;  4DR6 M;  3AZJ C;  2CUZ A;  1BH8 B;  1KX4 B;  2VII A;  3LMM A;  5BPV A;  4HL4 A;  4QNM A;  4M0W A;  1IXS B;  3REI D;  3MGP D;  2Z4S A;  5BNV B;  3NBI A;  2IO5 C;  1QVR A;  1J09 A;  4X23 D;  4J8V D;  5GT3 A;  1ZQ9 A;  4BB9 A;  1R4V A;  1KX5 C;  4G4N A;  1M1A C;  1SXJ D;  3MNN D;  5FTM A;  3MVD C;  3AZE C;  1M1A D;  4LFA M;  4ZUX A;  1JFI A;  4XUJ A;  3KOX E;  5BS7 C;  3W98 D;  3AZE D;  1KSF X;  4Z6Y A;  3SAW A;  5GKN A;  2YFW A;  3SAS A;  4M0D A;  2Y2O A;  3W98 C;  1XWI A;  4LJ4 A;  1Q39 A;  4CHT B;  5B32 A;  2R46 A;  1S32 A;  3C1C D;  3AFH A;  2XD1 A;  4JJN D;  2I7N A;  1HNX M;  4QHS A;  3AV1 A;  3SYK A;  3ZCB B;  3X1U A;  1QQW A;  5ITR A;  4IBF A;  2LY8 A;  2QP9 X;  4XGI A;  4G92 C;  1B67 A;  3X1S D;  1S3S A;  2XLJ A;  3UT9 C;  4REZ A;  3X1U D;  4H9S A;  5GSU A;  1L2D A;  2Q2E B;  4WU8 B;  5ITU A;  5AV5 C;  1P3G D;  4M9S A;  2V6Z M;  3W99 C;  3AZK D;  4DUZ M;  8CAT A;  4MH0 E;  2Y20 A;  5AV6 B;  4JI1 M;  3UMM A;  4P16 A;  5AV8 D;  4LF6 M;  2HIO C;  3U6M A;  3PFI A;  4L4U A;  4NFT A;  3X1V D;  3TWM A;  2XFT A;  4XZQ D;  2ZBK B;  1ID3 D;  3AYW B;  5B0Y B;  5B33 B;  1M18 B;  3C1B D;  1U35 C;  5B2I B;  5KPR A;  5C3I C;  1P3M C;  1JQJ C;  3EIH A;  4B3S M;  1M19 B;  2PYO C;  3X1S A;  3GPY A;  3TPZ A;  2PYO D;  3WHL A;  1R2Y A;  5FUG A;  3AZJ D;  3R8F A;  3AV2 A;  1Q3B A;  4JI3 M;  3REL B;  2CV5 D;  3JR5 A;  3B0C T;  5B1M B;  2RIQ A;  1S32 C;  3GRR A;  3H0R C;  2DWL A;  5B0Z B;  2UU9 M;  5CP6 C;  4CSR B;  2QCU A;  3H4M A;  4R7G A;  1NNU C;  5GT0 B;  1ZLA B;  1J7K A;  3O62 B;  3SHG B;  4QOS A;  1P3B A;  4KUD D;  4CAY A;  5AV9 A;  3U6E A;  3LJA A;  3REH C;  2BYM A;  4WZS B;  3AZM D;  3GRY A;  4QLC A;  1P3M B;  4A3V B;  4KUD A;  3NQU A;  4XUJ B;  3KUY D;  4I8O A;  3MVD B;  1EQZ B;  3W99 A;  3REK D;  5AVB C;  4AI6 A;  2XZU A;  5IT9 S;  1N75 A;  2D7H A;  4YM6 B;  1TDH A;  5EP1 A;  5B1M C;  3LZ0 D;  4J8U C;  1AOI D;  2Y2I A;  5FTJ A;  3KP1 E;  4R8P C;  3EPJ A;  2HIO A;  2BYK B;  5GT0 A;  2K47 A;  4LG2 A;  1G8P A;  3REJ D;  1P3K B;  4EO5 B;  3U6Q A;  3TQS A;  1P3F D;  3EPH A;  4GHL A;  4J8X D;  3KW6 A;  3W97 A;  5H37 D;  5EP4 A;  3REJ A;  3AOE C;  4WU9 D;  2NZD D;  4BLC A;  3KFU G;  4MGK E;  2HHH M;  4Z8X A;  4EO5 C;  1IQP A;  1YUB A;  4IIW A;  4H9N B;  3R45 B;  3AZJ A;  3L25 A;  1P3O C;  2P5T A;  3FTE A;  4YM6 A;  4DR1 M;  4LF5 M;  2Z4R A;  1QAO A;  2AHM A;  4L8R C;  5BR8 M;  2Y2P A;  5CP6 A;  3GP1 A;  2KA6 B;  4B3M M;  1A7W A;  5B32 B;  1IBM M;  3B6G C;  4LJ6 A;  1P3B C;  1HQ3 A;  1ZAE A;  3AKZ A;  1B6W A;  1P3O B;  5BT1 D;  5B40 C;  5AV9 C;  5E5A A;  3DOA A;  1I94 M;  4G6Z A;  1BFM A;  4ZUX C;  3B9P A;  4JV5 M;  3MJ5 A;  1DGH A;  3WKJ D;  2ZAN A;  3W0L B;  4J8X A;  5CHL B;  3I51 A;  4LY6 A;  2D7E A;  2VQE M;  3MGQ C;  3WAA B;  3W96 B;  2L7H A;  4Z5T D;  5F99 B;  4PD2 A;  4H9O A;  3X1T B;  3UTB B;  4OVZ A;  3KS8 A;  5EXP A;  4G91 C;  2JCH A;  1IBL M;  5B1M A;  1KX3 D;  1P3A B;  5B31 D;  3AOG A;  3AV1 C;  2F4V M;  3GLI B;  1KX3 C;  1F66 D;  5KO3 A;  4J8W A;  3MGQ B;  1P3L D;  3AZM C;  3ZH9 B;  3FUV A;  2DWZ B;  3GPU A;  3VH6 A;  3AZI C;  3B6G B;  4WW0 A;  1ZLA C;  2ZAM A;  5E5A B;  3AZH B;  5AVC B;  4JI7 M;  3EPL A;  1DGB A;  5CPI A;  4H9Q A;  2FJ7 C;  1IY0 A;  2J7N A;  3KSX A;  3WAA C;  3EPK A;  5IWA M;  5F99 C;  3MGP A;  3KDS E;  1PJI A;  2CV0 A;  4HGA C;  2HKJ A;  4GC9 A;  3SFZ A;  4FCT A;  2R62 A;  4LGY A;  5BNX A;  4YM6 C;  1C1K A;  1Z59 A;  3C1C C;  4R8P B;  3A1I A;  5CPI B;  3RFW A;  1N78 A;  2NQB A;  5ITT A;  3K8Z A;  5B24 B;  2ZM5 A;  4LF4 M;  3NWL A;  1ORY B;  4QLC B;  3AZI B;  1DO0 A;  1P3M A;  2UWX A;  4LZJ A;  3LEL D;  3VH5 W;  5E5A C;  1YSY A;  3UT9 D;  1BH9 B;  3V9R B;  3MGS D;  3SAU A;  3KVW A;  4FWG A;  3A46 A;  3AV2 C;  3U61 A;  3RE8 A;  3AZN B;  7CAT A;  2Z7J A;  1NY5 A;  2C9C A;  1FJG M;  3UZU A;  3DFZ A;  2ZY2 A;  4YY3 M;  5KPT A;  3FUW A;  1WXQ A;  4ZPX A;  5B2J D;  3AV2 B;  2HIO D;  1TGU A;  1P3I D;  3AZF A;  4FWD A;  5BT1 C;  5AV9 D;  3AZM A;  3R45 A;  5DYG A;  4LD9 A;  3F6T A;  4XZQ C;  5EXS A;  4QLC C;  4D82 A;  3AZF B;  1U35 D;  5CPJ C;  1IN8 A;  4D80 A;  4CGY B;  3PNV A;  3WA9 B;  4X66 M;  2RVQ C;  1HT2 E;  2EA0 A;  5GXQ C;  4J8U A;  2DXI A;  4R8P A;  1XNQ M;  3UTB C;  2F8N B;  4AG6 A;  4X23 A;  4NL4 H;  3ZC7 B;  5BO0 A;  4G91 B;  1Z5B A;  4NE6 A;  3AV1 B;  3W97 D;  2DQN C;  3W96 A;  1TZY B;  3W97 C;  3VDP A;  5GT3 C;  5JRG C;  1IXR C;  4GKJ M;  5GT3 D;  2J8P A;  2JA2 A;  5CPJ B;  2CV5 A;  4X23 B;  4GMQ A;  5FTL A;  4R3D A;  2Y0Q A;  4PDI A;  5AY8 C;  4LJ9 A;  5B1L A;  1SXJ B;  4G92 B;  3MNN B;  3VK7 A;  1M1A B;  2F5P A;  2RGH A;  2QBY B;  3ILK A;  2KXE A;  3HHX A;  4ZBJ B;  4Z66 B;  1L8Q A;  3J81 S;  3J2P B;  1Q9C A;  5KQ8 A;  3SAV A;  5GSU D;  3KOZ E;  1HTA A;  3X1U C;  3B6G A;  3C1C B;  4H9O B;  4KHA A;  2W8S A;  4WNN B;  3AZN A;  1OJL A;  4L78 A;  5DNN A;  5IZ7 D;  2JSS A;  4CAY B;  2BJV A;  3CF2 A;  2CHV A;  1PM5 A;  3GO8 A;  3X1S B;  4NXM M;  4HLQ A;  5AY8 B;  4LJ7 A;  3X1U B;  1AOI A;  4UPK A;  2ARO B;  3L28 A;  4NXN M;  4LRS A;  2XH9 A;  4IBB A;  4Z2M G;  1BH8 A;  2EUC A;  1QYR A;  1OFI A;  4J8W D;  1P3F A;  3V9R A;  1BH9 A;  4J8W C;  4DV0 M;  5JI2 E;  3P5J B;  3HU2 A;  4DUY M;  3X1V C;  5AV6 C;  1L2B A;  3CF0 A;  1HQ3 B;  1ID3 C;  2F8N H;  2F5S A;  1P34 D;  1HT1 E;  1GL6 A;  4KHP M;  5B2I A;  2DWN A;  3AFA B;  3VH5 A;  4XZQ B;  5CP6 B;  4WU8 C;  3KP0 E;  3U6C A;  3X1S C;  1P34 A;  4ZUX D;  2EO2 A;  3L29 A;  2F5N A;  5G49 A;  4YS3 A;  3FKE A;  5B2I D;  3EG5 B;  4IBC A;  4IBK A;  2DWM A;  5B1L C;  3MGP C;  2FFJ A;  3MGR D;  2RKO A;  5EP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...