3KFUG

Crystal structure of the transamidosome
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
ELSPELLRKLETLAKIRLSPEEEALLLQDLKRILDFVDALPRVEEGGAEEALGRLREDEPRPSLPQAEALALAPEAEDGFFRVPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-discriminating and archaeal-type aspartyl-tRNA synthetas
publication title Crystal structure of a transfer-ribonucleoprotein particle that promotes asparagine formation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase/rna
total genus 15
structure length 86
sequence length 86
chains with identical sequence J
ec nomenclature
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02686 Glu-tRNAGln Glu-tRNAGln amidotransferase C subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.990 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kfuG02
1.10.20.60 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kfuG01
3KFUG 3A1IA 3A1KA 3IP4C 2F2AC 3H0LC 3H0RC 2DF4C 2G5HC 2DQNC 4WJ3C 3AL0C 3H0MC 2G5IC
chains in the Genus database with same CATH superfamily
3T15A 3H0RC 5F99B 4QOSA 3VLFB 3SAUA 4AKHA 1P3IB 1K3WA 3LJAA 1BFMA 2KEBA 3W0LB 2KNAA 2BYKA 2XD1A 1N78A 1S32B 3VH5W 1P3LB 3U6QA 2DAEA 4F1IA 3HWSA 5B0ZB 3U6PA 2R46A 4WU8C 4LF9M 4WJ3C 1DV0A 1HQ3C 1IN8A 3C3DA 1WR1B 4WU9A 4MGHA 4ZUXC 2BJVA 3HZJA 4QOZC 2LHCA 4KT0F 4JXJA 1GL6A 5B33A 5EXSA 3AZNA 2LH0A 3AFAC 1V34A 3WAAB 1LV7A 4I5SA 4DV6M 1M19C 3LELB 2KRUA 4QNMA 3B6GB 2VQRA 1P3AA 2UUCM 5IWAM 1PJIA 3UK6A 4X23B 2F8NG 3V76A 2MH8A 1P3GB 5GT3C 1R4VA 3WHKA 3UTBB 2F8ND 1TF0B 4R7GA 2XEPA 2JCHA 2KXEA 3MJ5A 5B40D 3AN2D 3UGJA 5BNVA 1XXHE 3KOXE 3L2AA 2HAKA 3U5ZA 3JAMS 2LY8A 5IT9S 4RF1A 5CPKC 3FE3A 2ZM6M 3WTPE 1JFIB 2ZTCA 4J8VA 3T38A 4KHAA 1ZMWA 2UUBM 2F2AC 3GP1A 3MGRA 2CEAA 2CV0A 1OFIA 1SXJB 4XZQA 1BH9A 1H3OA 3GLGA 4R71A 1P3OB 3LQRA 5JRGC 1TH2A 4P17A 5AV9B 4CISA 4B3RM 3KDSE 2L4FA 3AJIB 5JA4B 5E6JA 1W2EA 5F99A 4WU9D 4GC9A 4DR2M 2DWLA 2QNJA 1P3IA 4GHLA 4UN2B 4CIZA 4L16A 1ZLAA 2LBCA 3I4VA 3RELB 1QZMA 5BNXA 4S12A 1P3LA 5B33D 3AZND 5ITUA 3Q8XA 5B0ZA 1KX3B 1PM5A 4YHHM 4I8OA 1W5SA 4LF6M 4WU8A 1K82A 5B32C 2IO5C 1XB2B 5BO0B 2YNMD 4CSRB 1P3AD 1DO2A 3U6DA 1OQYA 1TZYB 1DGHB 4ZUXA 4DQYB 4B7FA 1C1KA 5ITYA 2HUEB 5EP3A 2ZY5A 4FCWA 3BOSA 2HCBA 3AZKB 4W5WA 3X1SB 3VH5A 3AFAA 3I4YA 4KUDB 1L2CA 4H9NB 5E5AC 3AV2C 4LJ7A 4DRBA 4L8RC 1KX5C 3UTAB 1T3UA 4J8VD 3DZDA 1IQPA 3UJNA 3F92A 4X23A 3MGRD 2LVPC 4WP2A 4DR6M 5L8RF 2C98A 4ITQA 2XD5A 2FNAA 3WKJC 1MU5A 4K0KM 2UXDM 2CFOA 1IBLM 4JN6A 4H9RA 5CPKA 4WW0A 5B2JB 2D7EA 4JI4M 1D2NA 5F99D 1P3ID 1ID3A 1SXJA 4LZJA 3SBJA 1J7KA 5CPIB 1ZLAD 1FNNA 1P3OA 3SYKA 1AIPC 1P3LD 5GXQC 3AV1B 3LZ0B 5B0ZD 1E32A 4BB9A 4ZPXA 4WU8D 5AV9A 3AZFB 2BNKA 2F5QA 4DR3M 4TUWA 5JA4A 1QDTA 4ZUXD 3GLIB 3Q8GA 1JR3A 2FJ7C 5EP4A 4IIWA 1W5TA 4J8WB 4F2LA 3MHVC 5AY8B 1DO0A 1ORYB 2GQFA 3AFAD 2VQFM 3WAAD 4IBIA 2RGHA 5DNNA 5B32A 5BO0A 4CSRA 5ITRA 3C1BB 5B31C 3LW5F 1TZYA 1DGHA 5AVBB 4J8XB 4X23D 3UTBD 2DXIA 2M60A 5C1BA 3AZKA 2LXEA 3M7GA 1N1JB 1OAIA 2DENA 4HL4A 2Y2IA 3X1SA 4M9ZA 3W96C 5E5AA 5CP6B 4KUDA 4H9NA 5C3IB 2XLJA 3WA9C 5CPKD 1EQZB 5BR8M 3UTAA 1VG5A 3HU1A 2VDBB 5FSWA 1EIJA 1Q9CA 1ID3D 1SXJD 4BBAA 1AOIB 4DV3M 2JSSA 4Z5TB 3B7NA 3LZ1C 1P34C 5GT0B 1P3OD 4FCVA 1TR8A 1F66C 3REIC 2G5HC 2Y2MA 2NZDC 4AWLB 2VIIA 5FUGB 1I4WA 5AV9D 3AZMB 2YFWA 4CAYB 5B2JA 2DAGA 3VKHA 5C18A 5A2QS 3FKEA 1MJGM 1LTMA 2Y2KA 5AVCB 3B0DC 3B0CT 1A5TA 1TH4A 1YUBA 1JR3D 5CPIA 2DZNB 4B7HA 1FJGM 3O62C 3LZ0A 1KX3D 4NE5A 2R65A 5DNND 1ZMUA 1DGGA 3REHB 5B32D 2XZFA 1M1AB 4NE3A 2MGWA 2FFJA 1PJQA 2JP7A 2DZLA 1TZYD 2L6OA 4AI6A 1P3KB 1QUTA 3VK8A 1QVRA 3I04M 2FJ7A 2R45A 3IG5A 3U6MA 4J8WA 3AZKD 4RF0A 5AY8A 3KWQB 3X1SD 1P3PB 4KUDD 4DV4M 4H9PB 4M6BA 1KU5A 3C1BA 3MNNB 3UTAD 8CATA 4GKJM 1KSFX 4WNNB 5DFLA 2Y2HA 5B0YB 1M18C 4FWGA 3FUUA 3X1TB 3AYWB 3NQJB 1XNQM 2LVNC 5FTMA 3B9PA 5FTLA 2BWEA 2Y2JA 3UT9B 3A46A 2DWZB 2JZ1A 1P3FB 3VH6T 3WA9A 2ZANA 4DRAA 5B40C 3AN2C 1WGLA 3PNVA 1F4IA 1EQZA 5B2JD 1NY5A 4GHAA 1RU3A 2QP9X 1HT2E 1PJTA 4ANRA 4PD2A 3MGPB 2X4AA 3KXEC 2XFTA 4H9OB 5CPID 4Z5TA 4Q7JA 5GT0A 1F66A 2BG1A 4Z6YA 1QQWA 3LZ0D 2Y21A 2NZDA 2CV1A 2O5RA 2NQ8C 4CAYA 5KO3A 3HHWA 4QNRA 2F5SA 4FCTA 2FJ7D 4P16A 1DGBA 3E4RA 3LMMA 4J8WD 3EG5B 3O62A 3REKB 2G5GX 3W97C 3AOGA 4LD9B 5AY8D 3A98B 4NC6A 5BT1D 4AKIA 5B33C 2F5NA 1UM8A 3B0CW 3K9OA 3C1BD 3HHYA 4AG5A 3K9PA 4J8XD 1P3KA 2A5YB 5KDMB 1P3AC 4MGZE 4JI7M 3B6FB 2Y2QA 3MGQB 3AZLC 3KXBB 3KWQA 4MGKE 4CJ6A 2HIOB 4M9XA 2H5XA 2C5RA 1TDHA 4HGAC 1P3PA 4Z66B 5CP6D 1HNXM 1Z2CB 4H9PA 2R4JA 4RNAA 4X65M 1EQZD 2E5LM 2Y2LA 3RGSA 3DFZA 3THGA 3MNNA 4KGCB 3GRVA 3GLFE 2Y0QA 1M18A 2CV2A 3SATA 4WNNA 5CPJC 4I81A 4IBEA 2QCUA 4LG2A 3GO8A 4MM3B 4WZSB 3NQJA 4LF5M 1TH3A 4Z5TD 2F8NA 5GT0D 2JY6B 3UT9A 4I4LA 1NHGC 2CHGA 2XH9A 4R8PB 1P3FA 5B40A 3AN2A 4H9QB 1GVNA 3AZMD 4J8UB 2FH0A 1KX4B 4UUZB 1HNZM 5B1LB 4AG6A 3J81S 1OKSA 3HJSA 4LZZA 1MN3A 1PRBA 3C1CB 3C58A 1G41A 2KNZA 1N36M 4ZBJB 1TAFA 5DNYA 5AVCD 2RVQD 2GNOA 4H9OA 5F99C 1P3IC 2X8AA 4NRWA 2K9DA 3O62D 3KW6A 4AW4A 1ZLAC 1S32C 1P3LC 4DR4M 3TU4B 5B1MB 3GQ4A 5B0ZC 1M1AD 1IN6A 2OPFA 4E45A 2CE7A 3R45A 3B74A 2QBYB 1P3KD 4G3OA 2W8SA 3DA1A 5AV6B 4Z2MH 2DZOB 2ERCA 3I51A 2C9OA 2JY7A 5BPVA 2LVQD 3W97A 3GPPA 4LD9A 5KPZA 3KWQD 4JI1M 1OTRA 3X1VB 1P3PD 1X37A 2FS1A 3WAAC 2R18A 2JXNA 4DV5M 3MNND 1Z5CA 3LELC 4DV2M 1BH8A 1M18D 3B6GC 1IN5A 3X1TD 5KDMA 2CV5B 3B6FA 3ZC7B 5AV8A 3AZLA 3J7BA 4X23C 3MGQA 1IY1A 3K92A 3UTBC 4IBFA 2HIOA 3UT9D 1M19B 1P3FD 3T1YM 2WSEF 4IBKA 1QAMA 2ZTDA 2YR0A 4KGCA 2PYOB 4CGYB 5CPJA 1G71A 2XF3A 3K1JA 4G91B 2H1RA 3JR5A 4YM6B 1ID3C 1SXJC 3AOEC 3KOZE 4LRSA 3L27A 4MGIE 4DV1M 1ULYA 4XUJB 4OVZB 5FTJA 1P3BB 1P3OC 4H9QA 3RE8A 5GSUB 5EXXA 1TDZA 4J8UA 4UUZA 3A6NB 4KLNA 4HLQA 5AV9C 3C1CA 1K3XA 4FW9A 4WURA 3GLHE 1R2ZA 3D8LA 1N32M 4Y28F 3AKZA 5JRGB 3W97D 4G4RA 3BXWA 4LD9D 3RELC 4LFBM 1S32A 2C9CA 5DYIA 3HGIA 3MVDB 2JY8A 3TU4A 1KX3C 3J27B 1HJPA 5DNNC 2KA6B 1WWSA 5KPRA 4G92B 2JA2A 2UXCM 2QBYA 2QSFX 3FDDA 3NBIA 2NQBB 2Q2EB 5AV6A 1TZYC 3B6FD 5AV8D 3AZLD 2HUEC 3MGQD 1G59A 2DWNA 3FUXA 3U6CA 2HIOD 4B08A 3KUYB 3JR4A 3AZKC 3X1SC 3WAAA 5IZ7D 3AZEB 4KUDC 2KZUA 4KGCD 1N33M 4JI3M 5ITTA 3LELA 5CPJD 3B6GA 4DV7M 1JB0F 2CV5A 4JYAM 3UTAC 3PXGA 1G8PA 3L29A 1P3GA 1QYRA 3FYCA 3UTBA 3AZIB 2R62A 3FD9A 1KX5B 1IBMM 3TPZA 4J8UD 1WXQA 1TGUA 3SFZA 1Z5AA 2PYOA 1Q39A 3C1CD 1JFIA 5B2JC 1QANA 4JI6M 3GPUA 5LMNM 3AZJB 3WKJB 1XHBA 3AOEA 4YM6A 3W98B 5DNMB 1L1ZA 1I94M 5CPIC 4LJAA 1IBKM 4XUJA 4GC5A 1S32D 4OVZA 1P3BA 4LGYA 2CWBA 1IFYA 5GSUA 2UWXA 3AV1C 3LZ0C 3TU4D 7CATA 2LHGA 2L09A 4Z8XA 5LMUM 3X1UB 2RGOA 5AV6D 3B7ZA 1F1EA 2KRKA 1WWIA 3W99B 3RELA 3ILKA 4J8WC 1OAOC 5AY8C 4G4OA 1KX3A 2OOBA 5BT1C 2BYMB 3LELD 4XGIA 3B6GD 1KFVA 2CV5D 5IREB 3C1BC 1ZMVA 3J2PB 3FTFA 1AUAA 3B7QA 4JJNB 2K47A 2NQBA 4AZFA 5EP1A 3KOWE 5AVBC 4IBJA 5FTKA 4J8XC 1P3GD 3SHFA 2JWSA 1T3TA 3EPHA 4NXNM 1GKIA 3FUWA 3I01M 3KSYA 3GLGE 3TE6A 4YS3B 2HKJA 4IBDA 4OW0A 3AZEA 5CP6C 3REJB 5C3IC 5EXPA 2PYOD 3HHZA 3UMMA 2YFVB 1EQZC 4PCZA 3VDPA 4B3TM 3MGSB 4NXMM 4E44A 4YM6D 3U60B 1OIZA 1AOIC 4YY3M 3AZIA 4MB7A 3KS4A 3B0BA 4Z5TC 4XUJD 4GITA 3FRIA 1P3BD 3DOAA 5GT0C 1NNJA 5GSUD 2B3TA 1WHCA 3GQ3A 3V9RB 2DWMA 4AWLC 3AZMC 2KW0A 1GJTA 3EPKA 4NRVA 1NHWC 3AZJA 3W98A 4GH9A 3VDUA 5AVCC 3A45A 3REIB 2ZY4A 2RVQC 3RELD 1VDLA 1N75A 2DHRA 4B7GA 5B2IB 3AV1A 1SG9A 2L2DA 1OJLA 2R44A 3WTPB 2DAMA 3AZFA 4QLCB 3REHC 3TQSA 2F8NH 1M1AC 1HR0M 3X1UA 3AL0C 2NQBD 3VFDA 3H0LC 3SAWA 2WSCF 1P3KC 3GLIA 2Y2PA 1TTEA 3LVVA 4OX9M 4FWDA 1NV9A 4DR7M 3T1HM 2RIQA 3KWQC 4R3DA 1VEJA 3AZED 1P3PC 1GJSA 1QAQA 3FRHA 1P3MB 2BYMA 3AZHB 1IY0A 1V92A 4IBBA 1IXRC 4CHTB 3MNNC 2HHHM 3HJ8A 4JV5M 4JJNA 3C9PA 5AVBA 4DV0M 4II7A 4J8XA 1NV8A 3E46A 1IN4A 3AYWC 3X1TC 1SXJE 3UZUA 2YQZA 3AZID 3E21A 1YE9A 3IHPA 1T43A 2I7PA 2RKOA 4IBGA 1XMOM 4B3SM 1N1JA 4XBOA 4IJFA 3UT9C 5CP6A 4M0WA 2CWEA 1P3FC 5H37D 1QDRA 2YFVA 4QHTA 2VQEM 3B89A 4EO5B 3R8FA 2DAIA 1E9RA 3KP1E 3MGSA 3AZJD 3CF0A 1AOIA 3W98D 5EQTA 2LVOC 2JY5A 2OOAA 4D80A 5DNMD 1JR3E 3AFHA 1H6UA 3K8ZA 3GRYA 5BS7A 1NY6A 3AV1D 1OIPA 4PDIA 1D0MA 3H4MA 2Y2GA 3VH5T 4G4QA 5FUGA 3AZMA 4M9SA 3AZFD 3X1UD 1XNRM 4NFTA 3WHLA 3LJAB 4D81A 2EJSA 3GRUA 2KDLA 5AVCA 1PJJA 3W99D 4H9SC 1L2BA 2Z4RA 3L26A 3LCVB 5B2IA 1JQJC 2MR9A 3REKC 4LD9C 2R0IA 2UUAM 2XSZD 1E9SA 3WTPA 3REHA 4JI0M 4QLCA 1M1AA 5AV5B 1N77A 4WU9B 3FTEA 1QAOA 4QHSA 2DHYA 5AVBD 4JJND 3QYEA 1U35B 2JNHA 3B6FC 5AV8C 3MGQC 4MH0E 1HQCA 4DR1M 3AZNB 3KXBC 2F4VM 2HIOC 4BLCA 4Z66C 1P3MA 3AZHA 1XC8A 1P3AB 1GO5A 3MGSD 4KGCC 2WSFF 5B0YA 4EIWA 3X1TA 3AYWA 4GKKM 1EE8A 3TL4X 1AOID 2Y2NA 5FLXS 5BNVB 1EFUB 3U5ZB 3VKGA 2ZBKB 4R8PC 2O01F 2Z4SA 4J8UC 1R4GA 4FD2A 4J8VB 1KX4C 1BVSA 2OO9A 4KO8A 5B1LC 3HU2A 2V1UA 3MGRB 3SARA 3H4JA 3C1CC 4XZQB 1NNUC 1BH9B 3MGPA 3HKPA 4ZBJC 3KVWA 3KS8A 3GLIE 2CHQA 2DNAA 3VH6W 2AROB 5B2ID 3AZGB 1GABA 4D82A 5B24B 1Z59A 3WTPD 3REHD 3TU4C 4QLCD 3HJQA 5B1MC 3SC3A 2VF7A 1ZLAB 2C96A 4H9SA 5AV6C 2G8LA 5BNXB 3NWLA 2J5YA 3REKA 3GRRA 3KSXA 4WU8B 3X1VC 1PGYA 4KHPM 3HU3A 1HQ3B 1P3MD 3KSJA 3AZHD 5AV5A 2F5OA 1R6BX 2Z3XA 4ZUXB 1NJFA 3U6LA 1Y8GA 5B0YD 2L7IA 1IXZA 2MROB 3AYWD 1U35A 2CV5C 4L4UA 4LY6A 1P3GC 2DKLA 3KXBA 3AFAB 2CUZA 4Z66A 1R7RA 3TWLA 2KZSA 3CTWB 2PYOC 5GT3B 4NOOB 2R6FA 3PNYA 5JI3E 3MGPD 3EIHA 1HNWM 1YLAA 2JUJA 3ZQJA 2JE5A 1D0LA 4G91C 4YM6C 3L25A 4XUJC 4R8PA 1CUKA 4H9RB 1Q02A 1P3BC 3PVSA 5CPKB 3L28A 2EA0A 5GSUC 1KX4A 5B1LA 1ZAEA 3A6NC 1HT1E 5EXTA 4X66M 1ID3B 3LJAD 5KQDA 4WV4B 3SAVA 1XWIA 2AROA 3AZGA 3REKD 5B24A 2G3QA 4NSOB 5EP2A 5B1MA 3MVDC 1DGFA 3FYDA 5AV5D 4G92C 2BJWA 4KODA 1U35D 2NQBC 2Y0TA 3R9XB 1ZQ9A 3VH6A 2EO2A 4JI8M 3KXBD 1E94E 5DNNB 3X1VA 1L2DA 4Z66D 1V33A 3KUYC 5B32B 2IO5B 2F5PA 1HQ3A 2CP8A 4LJ6A 3AZEC 1S3SA 2UXBM 3M0EA 1ZV1A 4LFAM 1VQ1A 3W0FA 4A3VB 1IN7A 3LQQA 3RFWA 4DUZM 3QAUA 5E5AB 3AV2B 3AZIC 1VEGA 1M19A 4R8PD 1KYIA 3AV0A 1L1TA 2DAKA 2DVWB 3T6PA 1KX4D 4GMQA 3F6TA 5ITQA 3LVWA 5B1LD 2KHHA 5GT3A 4REZA 2QHOB 3FTCA 4XZQD 1P3QQ 4LF7M 1IY2A 4UPKA 4LRTA 3AZJC 1R5LA 3W98C 4PT5A 2AROD 3AZGD 4NSRA 5KPTA 5DNMC 2G5IC 3A1KA 5B24D 4HEOA 2YFWB 2RRUA 1J09A 5B1MD 3GLFB 3A6NA 1VEKA 3J7AS 2L4EA 2V1CA 3C3EA 2JZ0A 3AZFC 1PJSA 3X1UC 4LJ8A 2QZ4A 2BWBA 3KP0E 3CGWA 5GXQB 5JRGA 2Y2OA 3W99C 3NBXX 3X1VD 2EKFA 4LJ5A 3P5JB 3MVDA 1HQ3D 4AQYM 3IG8A 1MX0A 4FVMA 4B3MM 3HX3A 2FJ7B 2R4EA 4JJNC 2J8PA 3J80S 3U6EA 2DQNC 3MK6A 3H0MC 3KUYA 2EUCA 4YS3C 1M19D 3A42A 1NJGA 3IP4C 5B31B 2MJ5B 3REJC 3FTDA 2V6ZM 5GT3D 1NO1A 1OFHA 2D7HA 2ZY2A 3SMSA 2HWJA 3MGSC 2APLA 1WIVA 4GEWA 1VDDA 4Z2MG 5FTNA 3W96B 1Q3CA 3AV2A 5GKNA 2DI0A 1G4AE 3WA9B 5BS7C 1KX5A 3NQUB 2QPAA 3W68A 4DUYM 3A6ND 5E26A 2LNHC 1B6WA 2W82A 3HY5A 3U6OA 4DR5M 2FFFB 3LZ1B 1P34B 2P5TA 3WKJA 1F66B 3LCUA 5JRGD 5DNMA 3PFIA 5ITXA 2NZDB 3FUTA 1XXHB 2LTUA 5B2IC 4XK8F 3RGPA 3A1IA 1PZRA 3MVDD 3GLFA 2Y20A 4G4NA 3WTPC 3B0DB 4QLCC 4JI5M 5G49B 2ZM5A 1HTAA 1A7WA 4RKUF 2I7NA 3ZCBB 1Z6TA 2F8NK 3O62B 5GXQA 3EPJA 2DF4C 1YSYA 3EIEA 3W99A 1WGNA 1D0KA 2QQ8A 1XMQM 5B32G 3KFUG 2LVAA 3KUYD 4M0DA 1J5EM 1Z5BA 2D7GA 5KQ8A 2XSZA 2VF8A 1P3MC 2Z7JA 4LJ9A 2CRUA 3GLHB 3AZHC 2ZAOA 2QENA 3GPXA 3TWMA 3ZH9B 5B0YC 2ZY3A 3OTOM 2C99A 3E9SA 3EPLA 5E5AD 3AV2D 1N34M 3CF2A 2CHVA 2WZJA 3MMPA 4PDGA 4YS3A 4GRIA 2O25A 4AKGA 1IXSB 1KX5D 1NVMA 1L8QA 5B31A 3REJA 3U6SA 1M18B 2M5ZA 5CHLB 1WJ7A 1B67A 3HHXA 4EO5C 2F8NB 3WKJD 3MGPC 3W96A 3U60A 3GPYA 1T6OA 2XGNA 5B40B 3IECA 3AN2B 1UFZA 4LJ4A 2KNVA 3FUVA 3NQUA 1QUSA 3CF6E 3U61B 4LF4M 3V9RA 1TAFB 2HL7A 3K2LA 3LZ1A 1P34A 2UU9M 3LJAC 5GXQD 3REIA 1Q3BA 2BYKB 4DBGB 3SHGB 1XXHA 4LFCM 4OU7A 3KOYE 5F3WA 2J7OA 3BBZA 4NE6A 2J7NA 3R45B 3D8BA 4JI2M 2N35A 5G49A 5AV5C 4WU9C 1C7YA 2L5AA 4MGYE 4GIPA 3W97B 1U35C 5DYGA 4NL4H 5B33B 2EKKA 4YS3D 5B31G 3AZNC 3SASA 2LWXA 2X49A 3SMPA 3QYBA 5B31D 3REJD 2L7HA 1BH8B 3GLHA 1IM2A 3GQ5A 1R2YA 4G6ZA 1HQYE 4LF8M 5AV8B 3AZLB 1NSFA 1G3IA 3W67A 5JI2E 3W96D 1QZEA 4HGAB 2XZUA 2FE8A 5ITXE 3VK7A 3WA9D 4IBCA 4FWHA 1IXSA 4X62M 4IJEA 2OQ4A 5CPJB 2K6BA 4LCBA 4X64M 1GLNA 4KHAB 2AHMA 4L78A 4J8VC 5EJCA 1GL7A 2YFQA 3MGRC 2XFSA 3LZ1D 1P34D 3SYLA 3QWLA 2ZAMA 4XZQC 2FOIC 1F66D 1H3OB 3REID 3GLGB 2K0BX 3TWKA 2NZDD 4L6V6 4LGMA 2AROC 3AZGC 3M6AA 4L15A 3U61A 5B24C 2Z8YM
chains in the Genus database with same CATH topology
3T15A 3H0RC 5F99B 4QOSA 3VLFB 3SAUA 4AKHA 1P3IB 1K3WA 3LJAA 1BFMA 2KEBA 3W0LB 2BYKA 2XD1A 1S32B 1N78A 3VH5W 1P3LB 3U6QA 3HWSA 5B0ZB 3U6PA 2R46A 4WU8C 4LF9M 4WJ3C 1HQ3C 1IN8A 4WU9A 4MGHA 4ZUXC 2BJVA 4QOZC 4JXJA 1GL6A 5B33A 5EXSA 3AZNA 2LH0A 3AFAC 3WAAB 1LV7A 4I5SA 4DV6M 1M19C 3LELB 2KRUA 4QNMA 3B6GB 2VQRA 1P3AA 2UUCM 5IWAM 1PJIA 3UK6A 4X23B 2F8NG 1P3GB 5GT3C 1R4VA 3WHKA 3UTBB 2F8ND 4R7GA 2XEPA 2JCHA 2KXEA 3MJ5A 5B40D 3AN2D 3UGJA 5BNVA 3L2AA 3KOXE 3U5ZA 3JAMS 2LY8A 5IT9S 4RF1A 5CPKC 2ZM6M 3WTPE 1JFIB 4J8VA 3T38A 4KHAA 2UUBM 2F2AC 3GP1A 3MGRA 2CEAA 2CV0A 1OFIA 1SXJB 4XZQA 1BH9A 1H3OA 3GLGA 1P3OB 3LQRA 5JRGC 1TH2A 5AV9B 4CISA 4B3RM 3KDSE 3AJIB 5JA4B 5E6JA 1W2EA 5F99A 4WU9D 4GC9A 4DR2M 2DWLA 1P3IA 4GHLA 1ZLAA 4L16A 3I4VA 3RELB 1QZMA 5BNXA 4S12A 1P3LA 5B33D 3AZND 5ITUA 3Q8XA 5B0ZA 1KX3B 1PM5A 4YHHM 4I8OA 1W5SA 4LF6M 4WU8A 1K82A 5B32C 2IO5C 5BO0B 2YNMD 4CSRB 1P3AD 1DO2A 3U6DA 1TZYB 1DGHB 4ZUXA 4DQYB 4B7FA 1C1KA 5ITYA 2HUEB 5EP3A 2ZY5A 4FCWA 3BOSA 2HCBA 3AZKB 4W5WA 3X1SB 3VH5A 3AFAA 3I4YA 4KUDB 1L2CA 4H9NB 5E5AC 3AV2C 4LJ7A 4DRBA 4L8RC 1KX5C 3UTAB 1T3UA 4J8VD 3DZDA 1IQPA 3UJNA 4X23A 3MGRD 4DR6M 2C98A 4ITQA 2XD5A 2FNAA 3WKJC 1MU5A 4K0KM 2UXDM 2CFOA 1IBLM 4JN6A 4H9RA 5CPKA 4WW0A 5B2JB 2D7EA 4JI4M 1D2NA 5F99D 1P3ID 1ID3A 1SXJA 4LZJA 3SBJA 1J7KA 5CPIB 1ZLAD 1FNNA 1P3OA 3SYKA 1P3LD 5GXQC 3AV1B 3LZ0B 5B0ZD 1E32A 4BB9A 4ZPXA 4WU8D 5AV9A 3AZFB 2BNKA 2F5QA 4DR3M 4TUWA 5JA4A 4ZUXD 3GLIB 1JR3A 2FJ7C 5EP4A 4IIWA 1W5TA 4J8WB 3MHVC 5AY8B 1DO0A 1ORYB 3AFAD 2VQFM 3WAAD 4IBIA 2RGHA 5DNNA 5B32A 5BO0A 4CSRA 5ITRA 3C1BB 5B31C 1TZYA 1DGHA 5AVBB 4J8XB 4X23D 3UTBD 2DXIA 2M60A 5C1BA 3AZKA 2LXEA 3M7GA 1N1JB 2Y2IA 4HL4A 3X1SA 4M9ZA 3W96C 5E5AA 5CP6B 4KUDA 4H9NA 5C3IB 2XLJA 3WA9C 5CPKD 1EQZB 5BR8M 3UTAA 3HU1A 5FSWA 1Q9CA 1ID3D 1SXJD 4BBAA 1AOIB 4DV3M 2JSSA 4Z5TB 3LZ1C 1P34C 5GT0B 1P3OD 4FCVA 1F66C 3REIC 2G5HC 2Y2MA 2NZDC 4AWLB 2VIIA 5FUGB 1I4WA 5AV9D 3AZMB 2YFWA 4CAYB 5B2JA 3VKHA 5C18A 5A2QS 3FKEA 2Y2KA 5AVCB 3B0DC 3B0CT 1TH4A 1YUBA 1JR3D 5CPIA 2DZNB 4B7HA 1FJGM 3O62C 3LZ0A 1KX3D 4NE5A 2R65A 5DNND 1DGGA 3REHB 5B32D 2XZFA 1M1AB 4NE3A 2FFJA 1TZYD 2L6OA 4AI6A 1P3KB 1QVRA 3VK8A 2FJ7A 2R45A 3IG5A 3U6MA 4J8WA 3AZKD 4RF0A 5AY8A 3KWQB 3X1SD 1P3PB 4KUDD 4DV4M 4H9PB 4M6BA 1KU5A 3C1BA 3MNNB 3UTAD 8CATA 4GKJM 1KSFX 4WNNB 2Y2HA 5B0YB 1M18C 4FWGA 3FUUA 3X1TB 3AYWB 3NQJB 1XNQM 5FTMA 3B9PA 5FTLA 2Y2JA 3UT9B 3A46A 2DWZB 1P3FB 3VH6T 3WA9A 2ZANA 4DRAA 5B40C 3AN2C 3PNVA 1EQZA 5B2JD 1NY5A 4GHAA 2QP9X 1HT2E 4PD2A 3MGPB 2X4AA 3KXEC 2XFTA 4H9OB 5CPID 4Z5TA 5GT0A 1F66A 2BG1A 4Z6YA 1QQWA 3LZ0D 2Y21A 2NZDA 2CV1A 2O5RA 2NQ8C 4CAYA 5KO3A 3HHWA 4QNRA 2F5SA 4FCTA 2FJ7D 4P16A 1DGBA 3E4RA 3LMMA 4J8WD 3EG5B 3O62A 3REKB 2G5GX 3W97C 3AOGA 4LD9B 5AY8D 3A98B 5BT1D 4AKIA 5B33C 2F5NA 1UM8A 3B0CW 3C1BD 3HHYA 4AG5A 4J8XD 1P3KA 2A5YB 5KDMB 1P3AC 4MGZE 4JI7M 3B6FB 2Y2QA 3MGQB 3AZLC 3KXBB 3KWQA 4MGKE 2HIOB 4M9XA 2C5RA 1TDHA 4HGAC 1P3PA 4Z66B 5CP6D 1HNXM 1Z2CB 4H9PA 2R4JA 4RNAA 4X65M 1EQZD 2E5LM 3RGSA 2Y2LA 3DFZA 3THGA 3MNNA 4KGCB 3GRVA 2Y0QA 1M18A 2CV2A 3SATA 4WNNA 5CPJC 4I81A 4IBEA 2QCUA 4LG2A 3GO8A 4MM3B 4WZSB 3NQJA 4LF5M 1TH3A 4Z5TD 2F8NA 5GT0D 3UT9A 4I4LA 1NHGC 2CHGA 2XH9A 4R8PB 1P3FA 5B40A 3AN2A 4H9QB 1GVNA 3AZMD 4J8UB 1KX4B 4UUZB 1HNZM 5B1LB 4AG6A 3J81S 3HJSA 4LZZA 3C1CB 3C58A 1G41A 1N36M 4ZBJB 1TAFA 5DNYA 5AVCD 2RVQD 4H9OA 5F99C 1P3IC 2X8AA 4NRWA 3O62D 3KW6A 4AW4A 1ZLAC 1S32C 1P3LC 4DR4M 3TU4B 5B1MB 3GQ4A 5B0ZC 1M1AD 1IN6A 2OPFA 4E45A 2CE7A 3R45A 2QBYB 1P3KD 2W8SA 3DA1A 5AV6B 4Z2MH 2DZOB 2ERCA 3I51A 2C9OA 5BPVA 3W97A 3GPPA 4LD9A 5KPZA 3KWQD 4JI1M 3X1VB 1P3PD 1X37A 3WAAC 2R18A 4DV5M 3MNND 1Z5CA 3LELC 4DV2M 1BH8A 1M18D 3B6GC 1IN5A 3X1TD 5KDMA 2CV5B 3B6FA 3ZC7B 5AV8A 3AZLA 3J7BA 4X23C 3MGQA 1IY1A 3K92A 3UTBC 4IBFA 2HIOA 3UT9D 1M19B 1P3FD 3T1YM 4IBKA 1QAMA 2YR0A 4KGCA 2PYOB 4CGYB 5CPJA 2XF3A 3K1JA 4G91B 2H1RA 3JR5A 4YM6B 1ID3C 1SXJC 3AOEC 3KOZE 4LRSA 3L27A 4MGIE 4DV1M 1ULYA 4XUJB 4OVZB 5FTJA 1P3BB 1P3OC 4H9QA 3RE8A 5GSUB 5EXXA 1TDZA 4J8UA 4UUZA 3A6NB 4KLNA 4HLQA 5AV9C 3C1CA 1K3XA 4FW9A 4WURA 1R2ZA 3D8LA 1N32M 3AKZA 5JRGB 3W97D 4G4RA 4LD9D 3RELC 4LFBM 1S32A 2C9CA 5DYIA 3HGIA 3MVDB 3TU4A 1KX3C 3J27B 5DNNC 2KA6B 1WWSA 5KPRA 4G92B 2JA2A 2UXCM 2QBYA 3FDDA 3NBIA 2NQBB 2Q2EB 5AV6A 1TZYC 3B6FD 5AV8D 3AZLD 2HUEC 3MGQD 1G59A 2DWNA 3FUXA 3U6CA 2HIOD 4B08A 3KUYB 3JR4A 3AZKC 3X1SC 3WAAA 5IZ7D 3AZEB 4KUDC 2KZUA 4KGCD 1N33M 4JI3M 5ITTA 3LELA 5CPJD 3B6GA 4DV7M 2CV5A 4JYAM 3UTAC 3PXGA 1G8PA 3L29A 1P3GA 1QYRA 3FYCA 3UTBA 3AZIB 2R62A 3FD9A 1KX5B 1IBMM 3TPZA 4J8UD 1WXQA 1TGUA 3SFZA 1Z5AA 2PYOA 1Q39A 3C1CD 1JFIA 5B2JC 1QANA 4JI6M 3GPUA 5LMNM 3AZJB 3WKJB 1XHBA 3AOEA 4YM6A 3W98B 5DNMB 1L1ZA 1I94M 5CPIC 4LJAA 4XUJA 4GC5A 1IBKM 1S32D 4OVZA 1P3BA 4LGYA 5GSUA 2UWXA 3AV1C 3LZ0C 3TU4D 7CATA 2L09A 4Z8XA 5LMUM 3X1UB 2RGOA 5AV6D 1F1EA 2KRKA 1WWIA 3W99B 3RELA 3ILKA 4J8WC 5AY8C 4G4OA 1KX3A 5BT1C 2BYMB 3LELD 4XGIA 3B6GD 1KFVA 2CV5D 5IREB 3C1BC 3J2PB 3FTFA 2NQBA 4JJNB 2K47A 4AZFA 5EP1A 3KOWE 5AVBC 4IBJA 5FTKA 4J8XC 1P3GD 3SHFA 1T3TA 3EPHA 4NXNM 1GKIA 3FUWA 3KSYA 4YS3B 3TE6A 2HKJA 4IBDA 4OW0A 3AZEA 5CP6C 3REJB 5C3IC 5EXPA 2PYOD 3HHZA 3UMMA 2YFVB 1EQZC 4PCZA 3VDPA 4B3TM 3MGSB 4NXMM 4E44A 4YM6D 3U60B 1AOIC 4YY3M 3AZIA 4MB7A 3KS4A 3B0BA 4Z5TC 4XUJD 4GITA 1P3BD 3DOAA 5GT0C 1NNJA 5GSUD 3GQ3A 3V9RB 2DWMA 4AWLC 3AZMC 2KW0A 3EPKA 4NRVA 1NHWC 3AZJA 3W98A 4GH9A 3VDUA 5AVCC 3A45A 3REIB 2ZY4A 2RVQC 3RELD 1N75A 2DHRA 4B7GA 5B2IB 3AV1A 1OJLA 3WTPB 3AZFA 4QLCB 3REHC 3TQSA 2F8NH 1M1AC 1HR0M 3X1UA 3AL0C 2NQBD 3VFDA 3H0LC 3SAWA 1P3KC 3GLIA 2Y2PA 3LVVA 4OX9M 4FWDA 4DR7M 3T1HM 2RIQA 3KWQC 4R3DA 3AZED 1P3PC 1QAQA 1P3MB 2BYMA 3AZHB 1IY0A 4IBBA 1IXRC 4CHTB 3MNNC 2HHHM 3HJ8A 4JV5M 4JJNA 5AVBA 4DV0M 4II7A 4J8XA 1IN4A 3AYWC 3X1TC 1SXJE 3UZUA 2YQZA 3AZID 1YE9A 2I7PA 2RKOA 4IBGA 1XMOM 4B3SM 1N1JA 4XBOA 4IJFA 3UT9C 5CP6A 4M0WA 2CWEA 1P3FC 5H37D 2YFVA 4QHTA 2VQEM 4EO5B 3R8FA 3KP1E 1E9RA 3MGSA 3AZJD 3CF0A 1AOIA 3W98D 5EQTA 4D80A 5DNMD 3AFHA 1H6UA 3K8ZA 3GRYA 5BS7A 1NY6A 3AV1D 4PDIA 3H4MA 2Y2GA 3VH5T 4G4QA 5FUGA 3AZMA 4M9SA 3AZFD 3X1UD 1XNRM 4NFTA 3WHLA 3LJAB 4D81A 3GRUA 5AVCA 1PJJA 3W99D 4H9SC 1L2BA 2Z4RA 3L26A 5B2IA 1JQJC 3REKC 4LD9C 2UUAM 2XSZD 1E9SA 3WTPA 3REHA 4JI0M 4QLCA 1M1AA 5AV5B 1N77A 4WU9B 3FTEA 1QAOA 4QHSA 4JJND 5AVBD 1U35B 3B6FC 5AV8C 3MGQC 4MH0E 1HQCA 4DR1M 3AZNB 3KXBC 2F4VM 2HIOC 4BLCA 4Z66C 1P3MA 3AZHA 1XC8A 1P3AB 3MGSD 4KGCC 5B0YA 4EIWA 3X1TA 3AYWA 4GKKM 1EE8A 3TL4X 1AOID 2Y2NA 5FLXS 5BNVB 3U5ZB 3VKGA 2ZBKB 4R8PC 2Z4SA 4J8UC 4FD2A 4J8VB 1KX4C 4KO8A 5B1LC 3HU2A 2V1UA 3MGRB 3SARA 3C1CC 4XZQB 1NNUC 1BH9B 3MGPA 3HKPA 4ZBJC 3KVWA 3KS8A 2CHQA 3VH6W 2AROB 5B2ID 3AZGB 4D82A 5B24B 1Z59A 3WTPD 3REHD 3TU4C 4QLCD 3HJQA 5B1MC 3SC3A 1ZLAB 2C96A 4H9SA 5AV6C 2G8LA 5BNXB 3NWLA 3REKA 3GRRA 3KSXA 4WU8B 3X1VC 4KHPM 3HU3A 1HQ3B 1P3MD 3KSJA 3AZHD 5AV5A 2F5OA 1R6BX 2Z3XA 4ZUXB 1NJFA 3U6LA 5B0YD 2L7IA 1IXZA 3AYWD 1U35A 2CV5C 4L4UA 4LY6A 1P3GC 3KXBA 3AFAB 2CUZA 4Z66A 1R7RA 3TWLA 3CTWB 2KZSA 2PYOC 5GT3B 4NOOB 3PNYA 5JI3E 3MGPD 3EIHA 1HNWM 2JE5A 4G91C 4YM6C 3L25A 4XUJC 4R8PA 4H9RB 1P3BC 3PVSA 5CPKB 3L28A 2EA0A 5GSUC 1KX4A 5B1LA 1ZAEA 3A6NC 1HT1E 5EXTA 4X66M 1ID3B 3LJAD 5KQDA 4WV4B 3SAVA 1XWIA 2AROA 3AZGA 3REKD 5B24A 4NSOB 5EP2A 5B1MA 3MVDC 1DGFA 3FYDA 5AV5D 4G92C 2BJWA 4KODA 1U35D 2NQBC 2Y0TA 3R9XB 1ZQ9A 3VH6A 2EO2A 4JI8M 3KXBD 1E94E 5DNNB 3X1VA 1L2DA 4Z66D 3KUYC 5B32B 2IO5B 2F5PA 1HQ3A 4LJ6A 3AZEC 1S3SA 2UXBM 3M0EA 4LFAM 3W0FA 4A3VB 1IN7A 3LQQA 3RFWA 4DUZM 3QAUA 5E5AB 3AV2B 3AZIC 1M19A 4R8PD 1KYIA 3AV0A 1L1TA 2DVWB 1KX4D 4GMQA 3F6TA 5ITQA 3LVWA 5B1LD 5GT3A 4REZA 3FTCA 4XZQD 4LF7M 1IY2A 4UPKA 4LRTA 3AZJC 3W98C 4PT5A 2AROD 3AZGD 4NSRA 5KPTA 5DNMC 2G5IC 3A1KA 5B24D 2YFWB 1J09A 5B1MD 3GLFB 3A6NA 3J7AS 2V1CA 3AZFC 3X1UC 4LJ8A 2QZ4A 3KP0E 5GXQB 5JRGA 2Y2OA 3W99C 3X1VD 4LJ5A 3P5JB 3MVDA 1HQ3D 4AQYM 3IG8A 1MX0A 4FVMA 4B3MM 2FJ7B 2R4EA 4JJNC 2J8PA 3J80S 3U6EA 2DQNC 3MK6A 3H0MC 3KUYA 2EUCA 4YS3C 1M19D 3A42A 1NJGA 3IP4C 5B31B 3REJC 3FTDA 2V6ZM 5GT3D 1OFHA 2D7HA 2ZY2A 3SMSA 3MGSC 1VDDA 4Z2MG 5FTNA 3W96B 1Q3CA 3AV2A 5GKNA 1G4AE 3WA9B 5BS7C 1KX5A 3NQUB 2QPAA 4DUYM 3A6ND 5E26A 2LNHC 1B6WA 2W82A 3U6OA 4DR5M 2FFFB 3LZ1B 1P34B 2P5TA 3WKJA 1F66B 5JRGD 5DNMA 3PFIA 5ITXA 2NZDB 3FUTA 1XXHB 5B2IC 3RGPA 3A1IA 1PZRA 3MVDD 3GLFA 2Y20A 4G4NA 3WTPC 3B0DB 4QLCC 4JI5M 5G49B 2ZM5A 1HTAA 1A7WA 2I7NA 3ZCBB 1Z6TA 2F8NK 3O62B 5GXQA 3EPJA 2DF4C 1YSYA 3EIEA 3W99A 1XMQM 5B32G 3KFUG 3KUYD 4M0DA 1J5EM 1Z5BA 2D7GA 5KQ8A 2XSZA 1P3MC 2Z7JA 4LJ9A 3AZHC 3GLHB 2ZAOA 2QENA 3GPXA 3TWMA 3ZH9B 5B0YC 2ZY3A 3OTOM 2C99A 3E9SA 3EPLA 5E5AD 3AV2D 1N34M 3CF2A 2CHVA 4PDGA 4YS3A 4GRIA 4AKGA 1IXSB 1KX5D 1NVMA 1L8QA 5B31A 3REJA 3U6SA 1M18B 2M5ZA 5CHLB 1B67A 3HHXA 4EO5C 2F8NB 3WKJD 3MGPC 3W96A 3U60A 3GPYA 2XGNA 5B40B 3AN2B 4LJ4A 3FUVA 3NQUA 3CF6E 3U61B 4LF4M 3V9RA 1TAFB 2HL7A 3K2LA 3LZ1A 1P34A 2UU9M 3LJAC 3REIA 5GXQD 1Q3BA 2BYKB 3SHGB 1XXHA 4LFCM 4OU7A 3KOYE 5F3WA 2J7OA 4NE6A 2J7NA 3R45B 3D8BA 4JI2M 5G49A 5AV5C 4WU9C 2L5AA 4MGYE 4GIPA 3W97B 1U35C 5DYGA 4NL4H 5B33B 4YS3D 5B31G 3AZNC 3SASA 2LWXA 2X49A 3SMPA 5B31D 3REJD 2L7HA 1BH8B 3GLHA 1IM2A 3GQ5A 1R2YA 4G6ZA 1HQYE 4LF8M 5AV8B 3AZLB 1NSFA 1G3IA 5JI2E 3W96D 4HGAB 2XZUA 2FE8A 5ITXE 3VK7A 3WA9D 4IBCA 4FWHA 4X62M 4IJEA 2OQ4A 5CPJB 4LCBA 4X64M 1GLNA 4KHAB 2AHMA 4L78A 4J8VC 5EJCA 1GL7A 2YFQA 3MGRC 2XFSA 3LZ1D 1P34D 3SYLA 3QWLA 2ZAMA 4XZQC 2FOIC 1F66D 1H3OB 3REID 3GLGB 3TWKA 2NZDD 4LGMA 2AROC 3AZGC 3M6AA 4L15A 3U61A 5B24C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KFU G;  3A1I A;  3A1K A;  3IP4 C;  2F2A C;  3H0L C;  3H0R C;  2DF4 C;  2G5H C;  2DQN C;  4WJ3 C;  3AL0 C;  3H0M C;  2G5I C; 
#chains in the Genus database with same CATH topology
 3T15 A;  3H0R C;  5F99 B;  4QOS A;  3VLF B;  3SAU A;  4AKH A;  1P3I B;  1K3W A;  3LJA A;  1BFM A;  2KEB A;  3W0L B;  2KNA A;  2BYK A;  2XD1 A;  1N78 A;  1S32 B;  3VH5 W;  1P3L B;  3U6Q A;  2DAE A;  4F1I A;  3HWS A;  5B0Z B;  3U6P A;  2R46 A;  4WU8 C;  4LF9 M;  4WJ3 C;  1DV0 A;  1HQ3 C;  1IN8 A;  3C3D A;  1WR1 B;  4WU9 A;  4MGH A;  4ZUX C;  2BJV A;  3HZJ A;  4QOZ C;  2LHC A;  4KT0 F;  4JXJ A;  1GL6 A;  5B33 A;  5EXS A;  3AZN A;  2LH0 A;  3AFA C;  1V34 A;  3WAA B;  1LV7 A;  4I5S A;  4DV6 M;  1M19 C;  3LEL B;  2KRU A;  4QNM A;  3B6G B;  2VQR A;  1P3A A;  2UUC M;  5IWA M;  1PJI A;  3UK6 A;  4X23 B;  2F8N G;  3V76 A;  2MH8 A;  1P3G B;  5GT3 C;  1R4V A;  3WHK A;  3UTB B;  2F8N D;  1TF0 B;  4R7G A;  2XEP A;  2JCH A;  2KXE A;  3MJ5 A;  5B40 D;  3AN2 D;  3UGJ A;  5BNV A;  1XXH E;  3KOX E;  3L2A A;  2HAK A;  3U5Z A;  3JAM S;  2LY8 A;  5IT9 S;  4RF1 A;  5CPK C;  3FE3 A;  2ZM6 M;  3WTP E;  1JFI B;  2ZTC A;  4J8V A;  3T38 A;  4KHA A;  1ZMW A;  2UUB M;  2F2A C;  3GP1 A;  3MGR A;  2CEA A;  2CV0 A;  1OFI A;  1SXJ B;  4XZQ A;  1BH9 A;  1H3O A;  3GLG A;  4R71 A;  1P3O B;  3LQR A;  5JRG C;  1TH2 A;  4P17 A;  5AV9 B;  4CIS A;  4B3R M;  3KDS E;  2L4F A;  3AJI B;  5JA4 B;  5E6J A;  1W2E A;  5F99 A;  4WU9 D;  4GC9 A;  4DR2 M;  2DWL A;  2QNJ A;  1P3I A;  4GHL A;  4UN2 B;  4CIZ A;  4L16 A;  1ZLA A;  2LBC A;  3I4V A;  3REL B;  1QZM A;  5BNX A;  4S12 A;  1P3L A;  5B33 D;  3AZN D;  5ITU A;  3Q8X A;  5B0Z A;  1KX3 B;  1PM5 A;  4YHH M;  4I8O A;  1W5S A;  4LF6 M;  4WU8 A;  1K82 A;  5B32 C;  2IO5 C;  1XB2 B;  5BO0 B;  2YNM D;  4CSR B;  1P3A D;  1DO2 A;  3U6D A;  1OQY A;  1TZY B;  1DGH B;  4ZUX A;  4DQY B;  4B7F A;  1C1K A;  5ITY A;  2HUE B;  5EP3 A;  2ZY5 A;  4FCW A;  3BOS A;  2HCB A;  3AZK B;  4W5W A;  3X1S B;  3VH5 A;  3AFA A;  3I4Y A;  4KUD B;  1L2C A;  4H9N B;  5E5A C;  3AV2 C;  4LJ7 A;  4DRB A;  4L8R C;  1KX5 C;  3UTA B;  1T3U A;  4J8V D;  3DZD A;  1IQP A;  3UJN A;  3F92 A;  4X23 A;  3MGR D;  2LVP C;  4WP2 A;  4DR6 M;  5L8R F;  2C98 A;  4ITQ A;  2XD5 A;  2FNA A;  3WKJ C;  1MU5 A;  4K0K M;  2UXD M;  2CFO A;  1IBL M;  4JN6 A;  4H9R A;  5CPK A;  4WW0 A;  5B2J B;  2D7E A;  4JI4 M;  1D2N A;  5F99 D;  1P3I D;  1ID3 A;  1SXJ A;  4LZJ A;  3SBJ A;  1J7K A;  5CPI B;  1ZLA D;  1FNN A;  1P3O A;  3SYK A;  1AIP C;  1P3L D;  5GXQ C;  3AV1 B;  3LZ0 B;  5B0Z D;  1E32 A;  4BB9 A;  4ZPX A;  4WU8 D;  5AV9 A;  3AZF B;  2BNK A;  2F5Q A;  4DR3 M;  4TUW A;  5JA4 A;  1QDT A;  4ZUX D;  3GLI B;  3Q8G A;  1JR3 A;  2FJ7 C;  5EP4 A;  4IIW A;  1W5T A;  4J8W B;  4F2L A;  3MHV C;  5AY8 B;  1DO0 A;  1ORY B;  2GQF A;  3AFA D;  2VQF M;  3WAA D;  4IBI A;  2RGH A;  5DNN A;  5B32 A;  5BO0 A;  4CSR A;  5ITR A;  3C1B B;  5B31 C;  3LW5 F;  1TZY A;  1DGH A;  5AVB B;  4J8X B;  4X23 D;  3UTB D;  2DXI A;  2M60 A;  5C1B A;  3AZK A;  2LXE A;  3M7G A;  1N1J B;  1OAI A;  2DEN A;  4HL4 A;  2Y2I A;  3X1S A;  4M9Z A;  3W96 C;  5E5A A;  5CP6 B;  4KUD A;  4H9N A;  5C3I B;  2XLJ A;  3WA9 C;  5CPK D;  1EQZ B;  5BR8 M;  3UTA A;  1VG5 A;  3HU1 A;  2VDB B;  5FSW A;  1EIJ A;  1Q9C A;  1ID3 D;  1SXJ D;  4BBA A;  1AOI B;  4DV3 M;  2JSS A;  4Z5T B;  3B7N A;  3LZ1 C;  1P34 C;  5GT0 B;  1P3O D;  4FCV A;  1TR8 A;  1F66 C;  3REI C;  2G5H C;  2Y2M A;  2NZD C;  4AWL B;  2VII A;  5FUG B;  1I4W A;  5AV9 D;  3AZM B;  2YFW A;  4CAY B;  5B2J A;  2DAG A;  3VKH A;  5C18 A;  5A2Q S;  3FKE A;  1MJG M;  1LTM A;  2Y2K A;  5AVC B;  3B0D C;  3B0C T;  1A5T A;  1TH4 A;  1YUB A;  1JR3 D;  5CPI A;  2DZN B;  4B7H A;  1FJG M;  3O62 C;  3LZ0 A;  1KX3 D;  4NE5 A;  2R65 A;  5DNN D;  1ZMU A;  1DGG A;  3REH B;  5B32 D;  2XZF A;  1M1A B;  4NE3 A;  2MGW A;  2FFJ A;  1PJQ A;  2JP7 A;  2DZL A;  1TZY D;  2L6O A;  4AI6 A;  1P3K B;  1QUT A;  3VK8 A;  1QVR A;  3I04 M;  2FJ7 A;  2R45 A;  3IG5 A;  3U6M A;  4J8W A;  3AZK D;  4RF0 A;  5AY8 A;  3KWQ B;  3X1S D;  1P3P B;  4KUD D;  4DV4 M;  4H9P B;  4M6B A;  1KU5 A;  3C1B A;  3MNN B;  3UTA D;  8CAT A;  4GKJ M;  1KSF X;  4WNN B;  5DFL A;  2Y2H A;  5B0Y B;  1M18 C;  4FWG A;  3FUU A;  3X1T B;  3AYW B;  3NQJ B;  1XNQ M;  2LVN C;  5FTM A;  3B9P A;  5FTL A;  2BWE A;  2Y2J A;  3UT9 B;  3A46 A;  2DWZ B;  2JZ1 A;  1P3F B;  3VH6 T;  3WA9 A;  2ZAN A;  4DRA A;  5B40 C;  3AN2 C;  1WGL A;  3PNV A;  1F4I A;  1EQZ A;  5B2J D;  1NY5 A;  4GHA A;  1RU3 A;  2QP9 X;  1HT2 E;  1PJT A;  4ANR A;  4PD2 A;  3MGP B;  2X4A A;  3KXE C;  2XFT A;  4H9O B;  5CPI D;  4Z5T A;  4Q7J A;  5GT0 A;  1F66 A;  2BG1 A;  4Z6Y A;  1QQW A;  3LZ0 D;  2Y21 A;  2NZD A;  2CV1 A;  2O5R A;  2NQ8 C;  4CAY A;  5KO3 A;  3HHW A;  4QNR A;  2F5S A;  4FCT A;  2FJ7 D;  4P16 A;  1DGB A;  3E4R A;  3LMM A;  4J8W D;  3EG5 B;  3O62 A;  3REK B;  2G5G X;  3W97 C;  3AOG A;  4LD9 B;  5AY8 D;  3A98 B;  4NC6 A;  5BT1 D;  4AKI A;  5B33 C;  2F5N A;  1UM8 A;  3B0C W;  3K9O A;  3C1B D;  3HHY A;  4AG5 A;  3K9P A;  4J8X D;  1P3K A;  2A5Y B;  5KDM B;  1P3A C;  4MGZ E;  4JI7 M;  3B6F B;  2Y2Q A;  3MGQ B;  3AZL C;  3KXB B;  3KWQ A;  4MGK E;  4CJ6 A;  2HIO B;  4M9X A;  2H5X A;  2C5R A;  1TDH A;  4HGA C;  1P3P A;  4Z66 B;  5CP6 D;  1HNX M;  1Z2C B;  4H9P A;  2R4J A;  4RNA A;  4X65 M;  1EQZ D;  2E5L M;  2Y2L A;  3RGS A;  3DFZ A;  3THG A;  3MNN A;  4KGC B;  3GRV A;  3GLF E;  2Y0Q A;  1M18 A;  2CV2 A;  3SAT A;  4WNN A;  5CPJ C;  4I81 A;  4IBE A;  2QCU A;  4LG2 A;  3GO8 A;  4MM3 B;  4WZS B;  3NQJ A;  4LF5 M;  1TH3 A;  4Z5T D;  2F8N A;  5GT0 D;  2JY6 B;  3UT9 A;  4I4L A;  1NHG C;  2CHG A;  2XH9 A;  4R8P B;  1P3F A;  5B40 A;  3AN2 A;  4H9Q B;  1GVN A;  3AZM D;  4J8U B;  2FH0 A;  1KX4 B;  4UUZ B;  1HNZ M;  5B1L B;  4AG6 A;  3J81 S;  1OKS A;  3HJS A;  4LZZ A;  1MN3 A;  1PRB A;  3C1C B;  3C58 A;  1G41 A;  2KNZ A;  1N36 M;  4ZBJ B;  1TAF A;  5DNY A;  5AVC D;  2RVQ D;  2GNO A;  4H9O A;  5F99 C;  1P3I C;  2X8A A;  4NRW A;  2K9D A;  3O62 D;  3KW6 A;  4AW4 A;  1ZLA C;  1S32 C;  1P3L C;  4DR4 M;  3TU4 B;  5B1M B;  3GQ4 A;  5B0Z C;  1M1A D;  1IN6 A;  2OPF A;  4E45 A;  2CE7 A;  3R45 A;  3B74 A;  2QBY B;  1P3K D;  4G3O A;  2W8S A;  3DA1 A;  5AV6 B;  4Z2M H;  2DZO B;  2ERC A;  3I51 A;  2C9O A;  2JY7 A;  5BPV A;  2LVQ D;  3W97 A;  3GPP A;  4LD9 A;  5KPZ A;  3KWQ D;  4JI1 M;  1OTR A;  3X1V B;  1P3P D;  1X37 A;  2FS1 A;  3WAA C;  2R18 A;  2JXN A;  4DV5 M;  3MNN D;  1Z5C A;  3LEL C;  4DV2 M;  1BH8 A;  1M18 D;  3B6G C;  1IN5 A;  3X1T D;  5KDM A;  2CV5 B;  3B6F A;  3ZC7 B;  5AV8 A;  3AZL A;  3J7B A;  4X23 C;  3MGQ A;  1IY1 A;  3K92 A;  3UTB C;  4IBF A;  2HIO A;  3UT9 D;  1M19 B;  1P3F D;  3T1Y M;  2WSE F;  4IBK A;  1QAM A;  2ZTD A;  2YR0 A;  4KGC A;  2PYO B;  4CGY B;  5CPJ A;  1G71 A;  2XF3 A;  3K1J A;  4G91 B;  2H1R A;  3JR5 A;  4YM6 B;  1ID3 C;  1SXJ C;  3AOE C;  3KOZ E;  4LRS A;  3L27 A;  4MGI E;  4DV1 M;  1ULY A;  4XUJ B;  4OVZ B;  5FTJ A;  1P3B B;  1P3O C;  4H9Q A;  3RE8 A;  5GSU B;  5EXX A;  1TDZ A;  4J8U A;  4UUZ A;  3A6N B;  4KLN A;  4HLQ A;  5AV9 C;  3C1C A;  1K3X A;  4FW9 A;  4WUR A;  3GLH E;  1R2Z A;  3D8L A;  1N32 M;  4Y28 F;  3AKZ A;  5JRG B;  3W97 D;  4G4R A;  3BXW A;  4LD9 D;  3REL C;  4LFB M;  1S32 A;  2C9C A;  5DYI A;  3HGI A;  3MVD B;  2JY8 A;  3TU4 A;  1KX3 C;  3J27 B;  1HJP A;  5DNN C;  2KA6 B;  1WWS A;  5KPR A;  4G92 B;  2JA2 A;  2UXC M;  2QBY A;  2QSF X;  3FDD A;  3NBI A;  2NQB B;  2Q2E B;  5AV6 A;  1TZY C;  3B6F D;  5AV8 D;  3AZL D;  2HUE C;  3MGQ D;  1G59 A;  2DWN A;  3FUX A;  3U6C A;  2HIO D;  4B08 A;  3KUY B;  3JR4 A;  3AZK C;  3X1S C;  3WAA A;  5IZ7 D;  3AZE B;  4KUD C;  2KZU A;  4KGC D;  1N33 M;  4JI3 M;  5ITT A;  3LEL A;  5CPJ D;  3B6G A;  4DV7 M;  1JB0 F;  2CV5 A;  4JYA M;  3UTA C;  3PXG A;  1G8P A;  3L29 A;  1P3G A;  1QYR A;  3FYC A;  3UTB A;  3AZI B;  2R62 A;  3FD9 A;  1KX5 B;  1IBM M;  3TPZ A;  4J8U D;  1WXQ A;  1TGU A;  3SFZ A;  1Z5A A;  2PYO A;  1Q39 A;  3C1C D;  1JFI A;  5B2J C;  1QAN A;  4JI6 M;  3GPU A;  5LMN M;  3AZJ B;  3WKJ B;  1XHB A;  3AOE A;  4YM6 A;  3W98 B;  5DNM B;  1L1Z A;  1I94 M;  5CPI C;  4LJA A;  1IBK M;  4XUJ A;  4GC5 A;  1S32 D;  4OVZ A;  1P3B A;  4LGY A;  2CWB A;  1IFY A;  5GSU A;  2UWX A;  3AV1 C;  3LZ0 C;  3TU4 D;  7CAT A;  2LHG A;  2L09 A;  4Z8X A;  5LMU M;  3X1U B;  2RGO A;  5AV6 D;  3B7Z A;  1F1E A;  2KRK A;  1WWI A;  3W99 B;  3REL A;  3ILK A;  4J8W C;  1OAO C;  5AY8 C;  4G4O A;  1KX3 A;  2OOB A;  5BT1 C;  2BYM B;  3LEL D;  4XGI A;  3B6G D;  1KFV A;  2CV5 D;  5IRE B;  3C1B C;  1ZMV A;  3J2P B;  3FTF A;  1AUA A;  3B7Q A;  4JJN B;  2K47 A;  2NQB A;  4AZF A;  5EP1 A;  3KOW E;  5AVB C;  4IBJ A;  5FTK A;  4J8X C;  1P3G D;  3SHF A;  2JWS A;  1T3T A;  3EPH A;  4NXN M;  1GKI A;  3FUW A;  3I01 M;  3KSY A;  3GLG E;  3TE6 A;  4YS3 B;  2HKJ A;  4IBD A;  4OW0 A;  3AZE A;  5CP6 C;  3REJ B;  5C3I C;  5EXP A;  2PYO D;  3HHZ A;  3UMM A;  2YFV B;  1EQZ C;  4PCZ A;  3VDP A;  4B3T M;  3MGS B;  4NXM M;  4E44 A;  4YM6 D;  3U60 B;  1OIZ A;  1AOI C;  4YY3 M;  3AZI A;  4MB7 A;  3KS4 A;  3B0B A;  4Z5T C;  4XUJ D;  4GIT A;  3FRI A;  1P3B D;  3DOA A;  5GT0 C;  1NNJ A;  5GSU D;  2B3T A;  1WHC A;  3GQ3 A;  3V9R B;  2DWM A;  4AWL C;  3AZM C;  2KW0 A;  1GJT A;  3EPK A;  4NRV A;  1NHW C;  3AZJ A;  3W98 A;  4GH9 A;  3VDU A;  5AVC C;  3A45 A;  3REI B;  2ZY4 A;  2RVQ C;  3REL D;  1VDL A;  1N75 A;  2DHR A;  4B7G A;  5B2I B;  3AV1 A;  1SG9 A;  2L2D A;  1OJL A;  2R44 A;  3WTP B;  2DAM A;  3AZF A;  4QLC B;  3REH C;  3TQS A;  2F8N H;  1M1A C;  1HR0 M;  3X1U A;  3AL0 C;  2NQB D;  3VFD A;  3H0L C;  3SAW A;  2WSC F;  1P3K C;  3GLI A;  2Y2P A;  1TTE A;  3LVV A;  4OX9 M;  4FWD A;  1NV9 A;  4DR7 M;  3T1H M;  2RIQ A;  3KWQ C;  4R3D A;  1VEJ A;  3AZE D;  1P3P C;  1GJS A;  1QAQ A;  3FRH A;  1P3M B;  2BYM A;  3AZH B;  1IY0 A;  1V92 A;  4IBB A;  1IXR C;  4CHT B;  3MNN C;  2HHH M;  3HJ8 A;  4JV5 M;  4JJN A;  3C9P A;  5AVB A;  4DV0 M;  4II7 A;  4J8X A;  1NV8 A;  3E46 A;  1IN4 A;  3AYW C;  3X1T C;  1SXJ E;  3UZU A;  2YQZ A;  3AZI D;  3E21 A;  1YE9 A;  3IHP A;  1T43 A;  2I7P A;  2RKO A;  4IBG A;  1XMO M;  4B3S M;  1N1J A;  4XBO A;  4IJF A;  3UT9 C;  5CP6 A;  4M0W A;  2CWE A;  1P3F C;  5H37 D;  1QDR A;  2YFV A;  4QHT A;  2VQE M;  3B89 A;  4EO5 B;  3R8F A;  2DAI A;  1E9R A;  3KP1 E;  3MGS A;  3AZJ D;  3CF0 A;  1AOI A;  3W98 D;  5EQT A;  2LVO C;  2JY5 A;  2OOA A;  4D80 A;  5DNM D;  1JR3 E;  3AFH A;  1H6U A;  3K8Z A;  3GRY A;  5BS7 A;  1NY6 A;  3AV1 D;  1OIP A;  4PDI A;  1D0M A;  3H4M A;  2Y2G A;  3VH5 T;  4G4Q A;  5FUG A;  3AZM A;  4M9S A;  3AZF D;  3X1U D;  1XNR M;  4NFT A;  3WHL A;  3LJA B;  4D81 A;  2EJS A;  3GRU A;  2KDL A;  5AVC A;  1PJJ A;  3W99 D;  4H9S C;  1L2B A;  2Z4R A;  3L26 A;  3LCV B;  5B2I A;  1JQJ C;  2MR9 A;  3REK C;  4LD9 C;  2R0I A;  2UUA M;  2XSZ D;  1E9S A;  3WTP A;  3REH A;  4JI0 M;  4QLC A;  1M1A A;  5AV5 B;  1N77 A;  4WU9 B;  3FTE A;  1QAO A;  4QHS A;  2DHY A;  5AVB D;  4JJN D;  3QYE A;  1U35 B;  2JNH A;  3B6F C;  5AV8 C;  3MGQ C;  4MH0 E;  1HQC A;  4DR1 M;  3AZN B;  3KXB C;  2F4V M;  2HIO C;  4BLC A;  4Z66 C;  1P3M A;  3AZH A;  1XC8 A;  1P3A B;  1GO5 A;  3MGS D;  4KGC C;  2WSF F;  5B0Y A;  4EIW A;  3X1T A;  3AYW A;  4GKK M;  1EE8 A;  3TL4 X;  1AOI D;  2Y2N A;  5FLX S;  5BNV B;  1EFU B;  3U5Z B;  3VKG A;  2ZBK B;  4R8P C;  2O01 F;  2Z4S A;  4J8U C;  1R4G A;  4FD2 A;  4J8V B;  1KX4 C;  1BVS A;  2OO9 A;  4KO8 A;  5B1L C;  3HU2 A;  2V1U A;  3MGR B;  3SAR A;  3H4J A;  3C1C C;  4XZQ B;  1NNU C;  1BH9 B;  3MGP A;  3HKP A;  4ZBJ C;  3KVW A;  3KS8 A;  3GLI E;  2CHQ A;  2DNA A;  3VH6 W;  2ARO B;  5B2I D;  3AZG B;  1GAB A;  4D82 A;  5B24 B;  1Z59 A;  3WTP D;  3REH D;  3TU4 C;  4QLC D;  3HJQ A;  5B1M C;  3SC3 A;  2VF7 A;  1ZLA B;  2C96 A;  4H9S A;  5AV6 C;  2G8L A;  5BNX B;  3NWL A;  2J5Y A;  3REK A;  3GRR A;  3KSX A;  4WU8 B;  3X1V C;  1PGY A;  4KHP M;  3HU3 A;  1HQ3 B;  1P3M D;  3KSJ A;  3AZH D;  5AV5 A;  2F5O A;  1R6B X;  2Z3X A;  4ZUX B;  1NJF A;  3U6L A;  1Y8G A;  5B0Y D;  2L7I A;  1IXZ A;  2MRO B;  3AYW D;  1U35 A;  2CV5 C;  4L4U A;  4LY6 A;  1P3G C;  2DKL A;  3KXB A;  3AFA B;  2CUZ A;  4Z66 A;  1R7R A;  3TWL A;  2KZS A;  3CTW B;  2PYO C;  5GT3 B;  4NOO B;  2R6F A;  3PNY A;  5JI3 E;  3MGP D;  3EIH A;  1HNW M;  1YLA A;  2JUJ A;  3ZQJ A;  2JE5 A;  1D0L A;  4G91 C;  4YM6 C;  3L25 A;  4XUJ C;  4R8P A;  1CUK A;  4H9R B;  1Q02 A;  1P3B C;  3PVS A;  5CPK B;  3L28 A;  2EA0 A;  5GSU C;  1KX4 A;  5B1L A;  1ZAE A;  3A6N C;  1HT1 E;  5EXT A;  4X66 M;  1ID3 B;  3LJA D;  5KQD A;  4WV4 B;  3SAV A;  1XWI A;  2ARO A;  3AZG A;  3REK D;  5B24 A;  2G3Q A;  4NSO B;  5EP2 A;  5B1M A;  3MVD C;  1DGF A;  3FYD A;  5AV5 D;  4G92 C;  2BJW A;  4KOD A;  1U35 D;  2NQB C;  2Y0T A;  3R9X B;  1ZQ9 A;  3VH6 A;  2EO2 A;  4JI8 M;  3KXB D;  1E94 E;  5DNN B;  3X1V A;  1L2D A;  4Z66 D;  1V33 A;  3KUY C;  5B32 B;  2IO5 B;  2F5P A;  1HQ3 A;  2CP8 A;  4LJ6 A;  3AZE C;  1S3S A;  2UXB M;  3M0E A;  1ZV1 A;  4LFA M;  1VQ1 A;  3W0F A;  4A3V B;  1IN7 A;  3LQQ A;  3RFW A;  4DUZ M;  3QAU A;  5E5A B;  3AV2 B;  3AZI C;  1VEG A;  1M19 A;  4R8P D;  1KYI A;  3AV0 A;  1L1T A;  2DAK A;  2DVW B;  3T6P A;  1KX4 D;  4GMQ A;  3F6T A;  5ITQ A;  3LVW A;  5B1L D;  2KHH A;  5GT3 A;  4REZ A;  2QHO B;  3FTC A;  4XZQ D;  1P3Q Q;  4LF7 M;  1IY2 A;  4UPK A;  4LRT A;  3AZJ C;  1R5L A;  3W98 C;  4PT5 A;  2ARO D;  3AZG D;  4NSR A;  5KPT A;  5DNM C;  2G5I C;  3A1K A;  5B24 D;  4HEO A;  2YFW B;  2RRU A;  1J09 A;  5B1M D;  3GLF B;  3A6N A;  1VEK A;  3J7A S;  2L4E A;  2V1C A;  3C3E A;  2JZ0 A;  3AZF C;  1PJS A;  3X1U C;  4LJ8 A;  2QZ4 A;  2BWB A;  3KP0 E;  3CGW A;  5GXQ B;  5JRG A;  2Y2O A;  3W99 C;  3NBX X;  3X1V D;  2EKF A;  4LJ5 A;  3P5J B;  3MVD A;  1HQ3 D;  4AQY M;  3IG8 A;  1MX0 A;  4FVM A;  4B3M M;  3HX3 A;  2FJ7 B;  2R4E A;  4JJN C;  2J8P A;  3J80 S;  3U6E A;  2DQN C;  3MK6 A;  3H0M C;  3KUY A;  2EUC A;  4YS3 C;  1M19 D;  3A42 A;  1NJG A;  3IP4 C;  5B31 B;  2MJ5 B;  3REJ C;  3FTD A;  2V6Z M;  5GT3 D;  1NO1 A;  1OFH A;  2D7H A;  2ZY2 A;  3SMS A;  2HWJ A;  3MGS C;  2APL A;  1WIV A;  4GEW A;  1VDD A;  4Z2M G;  5FTN A;  3W96 B;  1Q3C A;  3AV2 A;  5GKN A;  2DI0 A;  1G4A E;  3WA9 B;  5BS7 C;  1KX5 A;  3NQU B;  2QPA A;  3W68 A;  4DUY M;  3A6N D;  5E26 A;  2LNH C;  1B6W A;  2W82 A;  3HY5 A;  3U6O A;  4DR5 M;  2FFF B;  3LZ1 B;  1P34 B;  2P5T A;  3WKJ A;  1F66 B;  3LCU A;  5JRG D;  5DNM A;  3PFI A;  5ITX A;  2NZD B;  3FUT A;  1XXH B;  2LTU A;  5B2I C;  4XK8 F;  3RGP A;  3A1I A;  1PZR A;  3MVD D;  3GLF A;  2Y20 A;  4G4N A;  3WTP C;  3B0D B;  4QLC C;  4JI5 M;  5G49 B;  2ZM5 A;  1HTA A;  1A7W A;  4RKU F;  2I7N A;  3ZCB B;  1Z6T A;  2F8N K;  3O62 B;  5GXQ A;  3EPJ A;  2DF4 C;  1YSY A;  3EIE A;  3W99 A;  1WGN A;  1D0K A;  2QQ8 A;  1XMQ M;  5B32 G;  3KFU G;  2LVA A;  3KUY D;  4M0D A;  1J5E M;  1Z5B A;  2D7G A;  5KQ8 A;  2XSZ A;  2VF8 A;  1P3M C;  2Z7J A;  4LJ9 A;  2CRU A;  3GLH B;  3AZH C;  2ZAO A;  2QEN A;  3GPX A;  3TWM A;  3ZH9 B;  5B0Y C;  2ZY3 A;  3OTO M;  2C99 A;  3E9S A;  3EPL A;  5E5A D;  3AV2 D;  1N34 M;  3CF2 A;  2CHV A;  2WZJ A;  3MMP A;  4PDG A;  4YS3 A;  4GRI A;  2O25 A;  4AKG A;  1IXS B;  1KX5 D;  1NVM A;  1L8Q A;  5B31 A;  3REJ A;  3U6S A;  1M18 B;  2M5Z A;  5CHL B;  1WJ7 A;  1B67 A;  3HHX A;  4EO5 C;  2F8N B;  3WKJ D;  3MGP C;  3W96 A;  3U60 A;  3GPY A;  1T6O A;  2XGN A;  5B40 B;  3IEC A;  3AN2 B;  1UFZ A;  4LJ4 A;  2KNV A;  3FUV A;  3NQU A;  1QUS A;  3CF6 E;  3U61 B;  4LF4 M;  3V9R A;  1TAF B;  2HL7 A;  3K2L A;  3LZ1 A;  1P34 A;  2UU9 M;  3LJA C;  5GXQ D;  3REI A;  1Q3B A;  2BYK B;  4DBG B;  3SHG B;  1XXH A;  4LFC M;  4OU7 A;  3KOY E;  5F3W A;  2J7O A;  3BBZ A;  4NE6 A;  2J7N A;  3R45 B;  3D8B A;  4JI2 M;  2N35 A;  5G49 A;  5AV5 C;  4WU9 C;  1C7Y A;  2L5A A;  4MGY E;  4GIP A;  3W97 B;  1U35 C;  5DYG A;  4NL4 H;  5B33 B;  2EKK A;  4YS3 D;  5B31 G;  3AZN C;  3SAS A;  2LWX A;  2X49 A;  3SMP A;  3QYB A;  5B31 D;  3REJ D;  2L7H A;  1BH8 B;  3GLH A;  1IM2 A;  3GQ5 A;  1R2Y A;  4G6Z A;  1HQY E;  4LF8 M;  5AV8 B;  3AZL B;  1NSF A;  1G3I A;  3W67 A;  5JI2 E;  3W96 D;  1QZE A;  4HGA B;  2XZU A;  2FE8 A;  5ITX E;  3VK7 A;  3WA9 D;  4IBC A;  4FWH A;  1IXS A;  4X62 M;  4IJE A;  2OQ4 A;  5CPJ B;  2K6B A;  4LCB A;  4X64 M;  1GLN A;  4KHA B;  2AHM A;  4L78 A;  4J8V C;  5EJC A;  1GL7 A;  2YFQ A;  3MGR C;  2XFS A;  3LZ1 D;  1P34 D;  3SYL A;  3QWL A;  2ZAM A;  4XZQ C;  2FOI C;  1F66 D;  1H3O B;  3REI D;  3GLG B;  2K0B X;  3TWK A;  2NZD D;  4L6V 6;  4LGM A;  2ARO C;  3AZG C;  3M6A A;  4L15 A;  3U61 A;  5B24 C;  2Z8Y M; 
#chains in the Genus database with same CATH homology
 3T15 A;  3H0R C;  5F99 B;  4QOS A;  3VLF B;  3SAU A;  4AKH A;  1P3I B;  1K3W A;  3LJA A;  1BFM A;  2KEB A;  3W0L B;  2BYK A;  2XD1 A;  1S32 B;  1N78 A;  3VH5 W;  1P3L B;  3U6Q A;  3HWS A;  5B0Z B;  3U6P A;  2R46 A;  4WU8 C;  4LF9 M;  4WJ3 C;  1HQ3 C;  1IN8 A;  4WU9 A;  4MGH A;  4ZUX C;  2BJV A;  4QOZ C;  4JXJ A;  1GL6 A;  5B33 A;  5EXS A;  3AZN A;  2LH0 A;  3AFA C;  3WAA B;  1LV7 A;  4I5S A;  4DV6 M;  1M19 C;  3LEL B;  2KRU A;  4QNM A;  3B6G B;  2VQR A;  1P3A A;  2UUC M;  5IWA M;  1PJI A;  3UK6 A;  4X23 B;  2F8N G;  1P3G B;  5GT3 C;  1R4V A;  3WHK A;  3UTB B;  2F8N D;  4R7G A;  2XEP A;  2JCH A;  2KXE A;  3MJ5 A;  5B40 D;  3AN2 D;  3UGJ A;  5BNV A;  3L2A A;  3KOX E;  3U5Z A;  3JAM S;  2LY8 A;  5IT9 S;  4RF1 A;  5CPK C;  2ZM6 M;  3WTP E;  1JFI B;  4J8V A;  3T38 A;  4KHA A;  2UUB M;  2F2A C;  3GP1 A;  3MGR A;  2CEA A;  2CV0 A;  1OFI A;  1SXJ B;  4XZQ A;  1BH9 A;  1H3O A;  3GLG A;  1P3O B;  3LQR A;  5JRG C;  1TH2 A;  5AV9 B;  4CIS A;  4B3R M;  3KDS E;  3AJI B;  5JA4 B;  5E6J A;  1W2E A;  5F99 A;  4WU9 D;  4GC9 A;  4DR2 M;  2DWL A;  1P3I A;  4GHL A;  1ZLA A;  4L16 A;  3I4V A;  3REL B;  1QZM A;  5BNX A;  4S12 A;  1P3L A;  5B33 D;  3AZN D;  5ITU A;  3Q8X A;  5B0Z A;  1KX3 B;  1PM5 A;  4YHH M;  4I8O A;  1W5S A;  4LF6 M;  4WU8 A;  1K82 A;  5B32 C;  2IO5 C;  5BO0 B;  2YNM D;  4CSR B;  1P3A D;  1DO2 A;  3U6D A;  1TZY B;  1DGH B;  4ZUX A;  4DQY B;  4B7F A;  1C1K A;  5ITY A;  2HUE B;  5EP3 A;  2ZY5 A;  4FCW A;  3BOS A;  2HCB A;  3AZK B;  4W5W A;  3X1S B;  3VH5 A;  3AFA A;  3I4Y A;  4KUD B;  1L2C A;  4H9N B;  5E5A C;  3AV2 C;  4LJ7 A;  4DRB A;  4L8R C;  1KX5 C;  3UTA B;  1T3U A;  4J8V D;  3DZD A;  1IQP A;  3UJN A;  4X23 A;  3MGR D;  4DR6 M;  2C98 A;  4ITQ A;  2XD5 A;  2FNA A;  3WKJ C;  1MU5 A;  4K0K M;  2UXD M;  2CFO A;  1IBL M;  4JN6 A;  4H9R A;  5CPK A;  4WW0 A;  5B2J B;  2D7E A;  4JI4 M;  1D2N A;  5F99 D;  1P3I D;  1ID3 A;  1SXJ A;  4LZJ A;  3SBJ A;  1J7K A;  5CPI B;  1ZLA D;  1FNN A;  1P3O A;  3SYK A;  1P3L D;  5GXQ C;  3AV1 B;  3LZ0 B;  5B0Z D;  1E32 A;  4BB9 A;  4ZPX A;  4WU8 D;  5AV9 A;  3AZF B;  2BNK A;  2F5Q A;  4DR3 M;  4TUW A;  5JA4 A;  4ZUX D;  3GLI B;  1JR3 A;  2FJ7 C;  5EP4 A;  4IIW A;  1W5T A;  4J8W B;  3MHV C;  5AY8 B;  1DO0 A;  1ORY B;  3AFA D;  2VQF M;  3WAA D;  4IBI A;  2RGH A;  5DNN A;  5B32 A;  5BO0 A;  4CSR A;  5ITR A;  3C1B B;  5B31 C;  1TZY A;  1DGH A;  5AVB B;  4J8X B;  4X23 D;  3UTB D;  2DXI A;  2M60 A;  5C1B A;  3AZK A;  2LXE A;  3M7G A;  1N1J B;  2Y2I A;  4HL4 A;  3X1S A;  4M9Z A;  3W96 C;  5E5A A;  5CP6 B;  4KUD A;  4H9N A;  5C3I B;  2XLJ A;  3WA9 C;  5CPK D;  1EQZ B;  5BR8 M;  3UTA A;  3HU1 A;  5FSW A;  1Q9C A;  1ID3 D;  1SXJ D;  4BBA A;  1AOI B;  4DV3 M;  2JSS A;  4Z5T B;  3LZ1 C;  1P34 C;  5GT0 B;  1P3O D;  4FCV A;  1F66 C;  3REI C;  2G5H C;  2Y2M A;  2NZD C;  4AWL B;  2VII A;  5FUG B;  1I4W A;  5AV9 D;  3AZM B;  2YFW A;  4CAY B;  5B2J A;  3VKH A;  5C18 A;  5A2Q S;  3FKE A;  2Y2K A;  5AVC B;  3B0D C;  3B0C T;  1TH4 A;  1YUB A;  1JR3 D;  5CPI A;  2DZN B;  4B7H A;  1FJG M;  3O62 C;  3LZ0 A;  1KX3 D;  4NE5 A;  2R65 A;  5DNN D;  1DGG A;  3REH B;  5B32 D;  2XZF A;  1M1A B;  4NE3 A;  2FFJ A;  1TZY D;  2L6O A;  4AI6 A;  1P3K B;  1QVR A;  3VK8 A;  2FJ7 A;  2R45 A;  3IG5 A;  3U6M A;  4J8W A;  3AZK D;  4RF0 A;  5AY8 A;  3KWQ B;  3X1S D;  1P3P B;  4KUD D;  4DV4 M;  4H9P B;  4M6B A;  1KU5 A;  3C1B A;  3MNN B;  3UTA D;  8CAT A;  4GKJ M;  1KSF X;  4WNN B;  2Y2H A;  5B0Y B;  1M18 C;  4FWG A;  3FUU A;  3X1T B;  3AYW B;  3NQJ B;  1XNQ M;  5FTM A;  3B9P A;  5FTL A;  2Y2J A;  3UT9 B;  3A46 A;  2DWZ B;  1P3F B;  3VH6 T;  3WA9 A;  2ZAN A;  4DRA A;  5B40 C;  3AN2 C;  3PNV A;  1EQZ A;  5B2J D;  1NY5 A;  4GHA A;  2QP9 X;  1HT2 E;  4PD2 A;  3MGP B;  2X4A A;  3KXE C;  2XFT A;  4H9O B;  5CPI D;  4Z5T A;  5GT0 A;  1F66 A;  2BG1 A;  4Z6Y A;  1QQW A;  3LZ0 D;  2Y21 A;  2NZD A;  2CV1 A;  2O5R A;  2NQ8 C;  4CAY A;  5KO3 A;  3HHW A;  4QNR A;  2F5S A;  4FCT A;  2FJ7 D;  4P16 A;  1DGB A;  3E4R A;  3LMM A;  4J8W D;  3EG5 B;  3O62 A;  3REK B;  2G5G X;  3W97 C;  3AOG A;  4LD9 B;  5AY8 D;  3A98 B;  5BT1 D;  4AKI A;  5B33 C;  2F5N A;  1UM8 A;  3B0C W;  3C1B D;  3HHY A;  4AG5 A;  4J8X D;  1P3K A;  2A5Y B;  5KDM B;  1P3A C;  4MGZ E;  4JI7 M;  3B6F B;  2Y2Q A;  3MGQ B;  3AZL C;  3KXB B;  3KWQ A;  4MGK E;  2HIO B;  4M9X A;  2C5R A;  1TDH A;  4HGA C;  1P3P A;  4Z66 B;  5CP6 D;  1HNX M;  1Z2C B;  4H9P A;  2R4J A;  4RNA A;  4X65 M;  1EQZ D;  2E5L M;  3RGS A;  2Y2L A;  3DFZ A;  3THG A;  3MNN A;  4KGC B;  3GRV A;  2Y0Q A;  1M18 A;  2CV2 A;  3SAT A;  4WNN A;  5CPJ C;  4I81 A;  4IBE A;  2QCU A;  4LG2 A;  3GO8 A;  4MM3 B;  4WZS B;  3NQJ A;  4LF5 M;  1TH3 A;  4Z5T D;  2F8N A;  5GT0 D;  3UT9 A;  4I4L A;  1NHG C;  2CHG A;  2XH9 A;  4R8P B;  1P3F A;  5B40 A;  3AN2 A;  4H9Q B;  1GVN A;  3AZM D;  4J8U B;  1KX4 B;  4UUZ B;  1HNZ M;  5B1L B;  4AG6 A;  3J81 S;  3HJS A;  4LZZ A;  3C1C B;  3C58 A;  1G41 A;  1N36 M;  4ZBJ B;  1TAF A;  5DNY A;  5AVC D;  2RVQ D;  4H9O A;  5F99 C;  1P3I C;  2X8A A;  4NRW A;  3O62 D;  3KW6 A;  4AW4 A;  1ZLA C;  1S32 C;  1P3L C;  4DR4 M;  3TU4 B;  5B1M B;  3GQ4 A;  5B0Z C;  1M1A D;  1IN6 A;  2OPF A;  4E45 A;  2CE7 A;  3R45 A;  2QBY B;  1P3K D;  2W8S A;  3DA1 A;  5AV6 B;  4Z2M H;  2DZO B;  2ERC A;  3I51 A;  2C9O A;  5BPV A;  3W97 A;  3GPP A;  4LD9 A;  5KPZ A;  3KWQ D;  4JI1 M;  3X1V B;  1P3P D;  1X37 A;  3WAA C;  2R18 A;  4DV5 M;  3MNN D;  1Z5C A;  3LEL C;  4DV2 M;  1BH8 A;  1M18 D;  3B6G C;  1IN5 A;  3X1T D;  5KDM A;  2CV5 B;  3B6F A;  3ZC7 B;  5AV8 A;  3AZL A;  3J7B A;  4X23 C;  3MGQ A;  1IY1 A;  3K92 A;  3UTB C;  4IBF A;  2HIO A;  3UT9 D;  1M19 B;  1P3F D;  3T1Y M;  4IBK A;  1QAM A;  2YR0 A;  4KGC A;  2PYO B;  4CGY B;  5CPJ A;  2XF3 A;  3K1J A;  4G91 B;  2H1R A;  3JR5 A;  4YM6 B;  1ID3 C;  1SXJ C;  3AOE C;  3KOZ E;  4LRS A;  3L27 A;  4MGI E;  4DV1 M;  1ULY A;  4XUJ B;  4OVZ B;  5FTJ A;  1P3B B;  1P3O C;  4H9Q A;  3RE8 A;  5GSU B;  5EXX A;  1TDZ A;  4J8U A;  4UUZ A;  3A6N B;  4KLN A;  4HLQ A;  5AV9 C;  3C1C A;  1K3X A;  4FW9 A;  4WUR A;  1R2Z A;  3D8L A;  1N32 M;  3AKZ A;  5JRG B;  3W97 D;  4G4R A;  4LD9 D;  3REL C;  4LFB M;  1S32 A;  2C9C A;  5DYI A;  3HGI A;  3MVD B;  3TU4 A;  1KX3 C;  3J27 B;  5DNN C;  2KA6 B;  1WWS A;  5KPR A;  4G92 B;  2JA2 A;  2UXC M;  2QBY A;  3FDD A;  3NBI A;  2NQB B;  2Q2E B;  5AV6 A;  1TZY C;  3B6F D;  5AV8 D;  3AZL D;  2HUE C;  3MGQ D;  1G59 A;  2DWN A;  3FUX A;  3U6C A;  2HIO D;  4B08 A;  3KUY B;  3JR4 A;  3AZK C;  3X1S C;  3WAA A;  5IZ7 D;  3AZE B;  4KUD C;  2KZU A;  4KGC D;  1N33 M;  4JI3 M;  5ITT A;  3LEL A;  5CPJ D;  3B6G A;  4DV7 M;  2CV5 A;  4JYA M;  3UTA C;  3PXG A;  1G8P A;  3L29 A;  1P3G A;  1QYR A;  3FYC A;  3UTB A;  3AZI B;  2R62 A;  3FD9 A;  1KX5 B;  1IBM M;  3TPZ A;  4J8U D;  1WXQ A;  1TGU A;  3SFZ A;  1Z5A A;  2PYO A;  1Q39 A;  3C1C D;  1JFI A;  5B2J C;  1QAN A;  4JI6 M;  3GPU A;  5LMN M;  3AZJ B;  3WKJ B;  1XHB A;  3AOE A;  4YM6 A;  3W98 B;  5DNM B;  1L1Z A;  1I94 M;  5CPI C;  4LJA A;  4XUJ A;  4GC5 A;  1IBK M;  1S32 D;  4OVZ A;  1P3B A;  4LGY A;  5GSU A;  2UWX A;  3AV1 C;  3LZ0 C;  3TU4 D;  7CAT A;  2L09 A;  4Z8X A;  5LMU M;  3X1U B;  2RGO A;  5AV6 D;  1F1E A;  2KRK A;  1WWI A;  3W99 B;  3REL A;  3ILK A;  4J8W C;  5AY8 C;  4G4O A;  1KX3 A;  5BT1 C;  2BYM B;  3LEL D;  4XGI A;  3B6G D;  1KFV A;  2CV5 D;  5IRE B;  3C1B C;  3J2P B;  3FTF A;  2NQB A;  4JJN B;  2K47 A;  4AZF A;  5EP1 A;  3KOW E;  5AVB C;  4IBJ A;  5FTK A;  4J8X C;  1P3G D;  3SHF A;  1T3T A;  3EPH A;  4NXN M;  1GKI A;  3FUW A;  3KSY A;  4YS3 B;  3TE6 A;  2HKJ A;  4IBD A;  4OW0 A;  3AZE A;  5CP6 C;  3REJ B;  5C3I C;  5EXP A;  2PYO D;  3HHZ A;  3UMM A;  2YFV B;  1EQZ C;  4PCZ A;  3VDP A;  4B3T M;  3MGS B;  4NXM M;  4E44 A;  4YM6 D;  3U60 B;  1AOI C;  4YY3 M;  3AZI A;  4MB7 A;  3KS4 A;  3B0B A;  4Z5T C;  4XUJ D;  4GIT A;  1P3B D;  3DOA A;  5GT0 C;  1NNJ A;  5GSU D;  3GQ3 A;  3V9R B;  2DWM A;  4AWL C;  3AZM C;  2KW0 A;  3EPK A;  4NRV A;  1NHW C;  3AZJ A;  3W98 A;  4GH9 A;  3VDU A;  5AVC C;  3A45 A;  3REI B;  2ZY4 A;  2RVQ C;  3REL D;  1N75 A;  2DHR A;  4B7G A;  5B2I B;  3AV1 A;  1OJL A;  3WTP B;  3AZF A;  4QLC B;  3REH C;  3TQS A;  2F8N H;  1M1A C;  1HR0 M;  3X1U A;  3AL0 C;  2NQB D;  3VFD A;  3H0L C;  3SAW A;  1P3K C;  3GLI A;  2Y2P A;  3LVV A;  4OX9 M;  4FWD A;  4DR7 M;  3T1H M;  2RIQ A;  3KWQ C;  4R3D A;  3AZE D;  1P3P C;  1QAQ A;  1P3M B;  2BYM A;  3AZH B;  1IY0 A;  4IBB A;  1IXR C;  4CHT B;  3MNN C;  2HHH M;  3HJ8 A;  4JV5 M;  4JJN A;  5AVB A;  4DV0 M;  4II7 A;  4J8X A;  1IN4 A;  3AYW C;  3X1T C;  1SXJ E;  3UZU A;  2YQZ A;  3AZI D;  1YE9 A;  2I7P A;  2RKO A;  4IBG A;  1XMO M;  4B3S M;  1N1J A;  4XBO A;  4IJF A;  3UT9 C;  5CP6 A;  4M0W A;  2CWE A;  1P3F C;  5H37 D;  2YFV A;  4QHT A;  2VQE M;  4EO5 B;  3R8F A;  3KP1 E;  1E9R A;  3MGS A;  3AZJ D;  3CF0 A;  1AOI A;  3W98 D;  5EQT A;  4D80 A;  5DNM D;  3AFH A;  1H6U A;  3K8Z A;  3GRY A;  5BS7 A;  1NY6 A;  3AV1 D;  4PDI A;  3H4M A;  2Y2G A;  3VH5 T;  4G4Q A;  5FUG A;  3AZM A;  4M9S A;  3AZF D;  3X1U D;  1XNR M;  4NFT A;  3WHL A;  3LJA B;  4D81 A;  3GRU A;  5AVC A;  1PJJ A;  3W99 D;  4H9S C;  1L2B A;  2Z4R A;  3L26 A;  5B2I A;  1JQJ C;  3REK C;  4LD9 C;  2UUA M;  2XSZ D;  1E9S A;  3WTP A;  3REH A;  4JI0 M;  4QLC A;  1M1A A;  5AV5 B;  1N77 A;  4WU9 B;  3FTE A;  1QAO A;  4QHS A;  4JJN D;  5AVB D;  1U35 B;  3B6F C;  5AV8 C;  3MGQ C;  4MH0 E;  1HQC A;  4DR1 M;  3AZN B;  3KXB C;  2F4V M;  2HIO C;  4BLC A;  4Z66 C;  1P3M A;  3AZH A;  1XC8 A;  1P3A B;  3MGS D;  4KGC C;  5B0Y A;  4EIW A;  3X1T A;  3AYW A;  4GKK M;  1EE8 A;  3TL4 X;  1AOI D;  2Y2N A;  5FLX S;  5BNV B;  3U5Z B;  3VKG A;  2ZBK B;  4R8P C;  2Z4S A;  4J8U C;  4FD2 A;  4J8V B;  1KX4 C;  4KO8 A;  5B1L C;  3HU2 A;  2V1U A;  3MGR B;  3SAR A;  3C1C C;  4XZQ B;  1NNU C;  1BH9 B;  3MGP A;  3HKP A;  4ZBJ C;  3KVW A;  3KS8 A;  2CHQ A;  3VH6 W;  2ARO B;  5B2I D;  3AZG B;  4D82 A;  5B24 B;  1Z59 A;  3WTP D;  3REH D;  3TU4 C;  4QLC D;  3HJQ A;  5B1M C;  3SC3 A;  1ZLA B;  2C96 A;  4H9S A;  5AV6 C;  2G8L A;  5BNX B;  3NWL A;  3REK A;  3GRR A;  3KSX A;  4WU8 B;  3X1V C;  4KHP M;  3HU3 A;  1HQ3 B;  1P3M D;  3KSJ A;  3AZH D;  5AV5 A;  2F5O A;  1R6B X;  2Z3X A;  4ZUX B;  1NJF A;  3U6L A;  5B0Y D;  2L7I A;  1IXZ A;  3AYW D;  1U35 A;  2CV5 C;  4L4U A;  4LY6 A;  1P3G C;  3KXB A;  3AFA B;  2CUZ A;  4Z66 A;  1R7R A;  3TWL A;  3CTW B;  2KZS A;  2PYO C;  5GT3 B;  4NOO B;  3PNY A;  5JI3 E;  3MGP D;  3EIH A;  1HNW M;  2JE5 A;  4G91 C;  4YM6 C;  3L25 A;  4XUJ C;  4R8P A;  4H9R B;  1P3B C;  3PVS A;  5CPK B;  3L28 A;  2EA0 A;  5GSU C;  1KX4 A;  5B1L A;  1ZAE A;  3A6N C;  1HT1 E;  5EXT A;  4X66 M;  1ID3 B;  3LJA D;  5KQD A;  4WV4 B;  3SAV A;  1XWI A;  2ARO A;  3AZG A;  3REK D;  5B24 A;  4NSO B;  5EP2 A;  5B1M A;  3MVD C;  1DGF A;  3FYD A;  5AV5 D;  4G92 C;  2BJW A;  4KOD A;  1U35 D;  2NQB C;  2Y0T A;  3R9X B;  1ZQ9 A;  3VH6 A;  2EO2 A;  4JI8 M;  3KXB D;  1E94 E;  5DNN B;  3X1V A;  1L2D A;  4Z66 D;  3KUY C;  5B32 B;  2IO5 B;  2F5P A;  1HQ3 A;  4LJ6 A;  3AZE C;  1S3S A;  2UXB M;  3M0E A;  4LFA M;  3W0F A;  4A3V B;  1IN7 A;  3LQQ A;  3RFW A;  4DUZ M;  3QAU A;  5E5A B;  3AV2 B;  3AZI C;  1M19 A;  4R8P D;  1KYI A;  3AV0 A;  1L1T A;  2DVW B;  1KX4 D;  4GMQ A;  3F6T A;  5ITQ A;  3LVW A;  5B1L D;  5GT3 A;  4REZ A;  3FTC A;  4XZQ D;  4LF7 M;  1IY2 A;  4UPK A;  4LRT A;  3AZJ C;  3W98 C;  4PT5 A;  2ARO D;  3AZG D;  4NSR A;  5KPT A;  5DNM C;  2G5I C;  3A1K A;  5B24 D;  2YFW B;  1J09 A;  5B1M D;  3GLF B;  3A6N A;  3J7A S;  2V1C A;  3AZF C;  3X1U C;  4LJ8 A;  2QZ4 A;  3KP0 E;  5GXQ B;  5JRG A;  2Y2O A;  3W99 C;  3X1V D;  4LJ5 A;  3P5J B;  3MVD A;  1HQ3 D;  4AQY M;  3IG8 A;  1MX0 A;  4FVM A;  4B3M M;  2FJ7 B;  2R4E A;  4JJN C;  2J8P A;  3J80 S;  3U6E A;  2DQN C;  3MK6 A;  3H0M C;  3KUY A;  2EUC A;  4YS3 C;  1M19 D;  3A42 A;  1NJG A;  3IP4 C;  5B31 B;  3REJ C;  3FTD A;  2V6Z M;  5GT3 D;  1OFH A;  2D7H A;  2ZY2 A;  3SMS A;  3MGS C;  1VDD A;  4Z2M G;  5FTN A;  3W96 B;  1Q3C A;  3AV2 A;  5GKN A;  1G4A E;  3WA9 B;  5BS7 C;  1KX5 A;  3NQU B;  2QPA A;  4DUY M;  3A6N D;  5E26 A;  2LNH C;  1B6W A;  2W82 A;  3U6O A;  4DR5 M;  2FFF B;  3LZ1 B;  1P34 B;  2P5T A;  3WKJ A;  1F66 B;  5JRG D;  5DNM A;  3PFI A;  5ITX A;  2NZD B;  3FUT A;  1XXH B;  5B2I C;  3RGP A;  3A1I A;  1PZR A;  3MVD D;  3GLF A;  2Y20 A;  4G4N A;  3WTP C;  3B0D B;  4QLC C;  4JI5 M;  5G49 B;  2ZM5 A;  1HTA A;  1A7W A;  2I7N A;  3ZCB B;  1Z6T A;  2F8N K;  3O62 B;  5GXQ A;  3EPJ A;  2DF4 C;  1YSY A;  3EIE A;  3W99 A;  1XMQ M;  5B32 G;  3KFU G;  3KUY D;  4M0D A;  1J5E M;  1Z5B A;  2D7G A;  5KQ8 A;  2XSZ A;  1P3M C;  2Z7J A;  4LJ9 A;  3AZH C;  3GLH B;  2ZAO A;  2QEN A;  3GPX A;  3TWM A;  3ZH9 B;  5B0Y C;  2ZY3 A;  3OTO M;  2C99 A;  3E9S A;  3EPL A;  5E5A D;  3AV2 D;  1N34 M;  3CF2 A;  2CHV A;  4PDG A;  4YS3 A;  4GRI A;  4AKG A;  1IXS B;  1KX5 D;  1NVM A;  1L8Q A;  5B31 A;  3REJ A;  3U6S A;  1M18 B;  2M5Z A;  5CHL B;  1B67 A;  3HHX A;  4EO5 C;  2F8N B;  3WKJ D;  3MGP C;  3W96 A;  3U60 A;  3GPY A;  2XGN A;  5B40 B;  3AN2 B;  4LJ4 A;  3FUV A;  3NQU A;  3CF6 E;  3U61 B;  4LF4 M;  3V9R A;  1TAF B;  2HL7 A;  3K2L A;  3LZ1 A;  1P34 A;  2UU9 M;  3LJA C;  3REI A;  5GXQ D;  1Q3B A;  2BYK B;  3SHG B;  1XXH A;  4LFC M;  4OU7 A;  3KOY E;  5F3W A;  2J7O A;  4NE6 A;  2J7N A;  3R45 B;  3D8B A;  4JI2 M;  5G49 A;  5AV5 C;  4WU9 C;  2L5A A;  4MGY E;  4GIP A;  3W97 B;  1U35 C;  5DYG A;  4NL4 H;  5B33 B;  4YS3 D;  5B31 G;  3AZN C;  3SAS A;  2LWX A;  2X49 A;  3SMP A;  5B31 D;  3REJ D;  2L7H A;  1BH8 B;  3GLH A;  1IM2 A;  3GQ5 A;  1R2Y A;  4G6Z A;  1HQY E;  4LF8 M;  5AV8 B;  3AZL B;  1NSF A;  1G3I A;  5JI2 E;  3W96 D;  4HGA B;  2XZU A;  2FE8 A;  5ITX E;  3VK7 A;  3WA9 D;  4IBC A;  4FWH A;  4X62 M;  4IJE A;  2OQ4 A;  5CPJ B;  4LCB A;  4X64 M;  1GLN A;  4KHA B;  2AHM A;  4L78 A;  4J8V C;  5EJC A;  1GL7 A;  2YFQ A;  3MGR C;  2XFS A;  3LZ1 D;  1P34 D;  3SYL A;  3QWL A;  2ZAM A;  4XZQ C;  2FOI C;  1F66 D;  1H3O B;  3REI D;  3GLG B;  3TWK A;  2NZD D;  4LGM A;  2ARO C;  3AZG C;  3M6A A;  4L15 A;  3U61 A;  5B24 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...