3KG0A

Crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, determined to 1.7 resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
ADEVTFVNRFTVHGAPAEFESVFARTAAFFARQPGFVRHTLLRERDKDNSYVNIAVWTDHDAFRRALAQPGFLPHATALRALSTSEHGLFTARQTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism
pubmed doi rcsb
source organism Streptomyces nogalater
molecule tags Oxidoreductase
molecule keywords SnoaB
total genus 27
structure length 97
sequence length 97
chains with identical sequence B, C
ec nomenclature ec 1.13.12.22: Deoxynogalonate monooxygenase.
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kg0A00
2HLTA 2ZDOA 2BYCA 2XMJA 4A4JA 5A6PA 2VV5A 4HH0A 1OQ3A 2KT2A 3CJKA 2AJ1A 1OSDA 3DXSX 1CPZA 2LXFA 2RU9A 1VQSA 4HL9A 2XMKA 2OFGX 2BJDA 1N5SA 3F44A 3VTIA 5F0WA 2FB0A 2FHMA 3BB5A 2GGPA 2OKQA 3BM7A 4Q2MA 1V3ZA 1APSA 1JWWA 1URRA 5A6WA 3WDOA 1FEEA 1SI9A 2HFOA 4Q2LA 4OIXA 2KKHA 2OFHX 1YJUA 1P6TA 1YJTA 2ASYA 2GFFA 2LDIA 2PD1A 2LQBA 5K9FA 1FVQA 1XBWA 1P8GA 4U9RA 2XMUA 3KG1A 4DL0C 1YJRA 1Q8LA 2GV1A 1WD6A 2OAUA 1K0VA 1YRXA 3HDSA 3BN7A 2W4PA 2QIFA 4OJHA 2W4CA 2G9OA 2OMOA 2N4DA 2N7YA 5B0GA 4HI1A 1TL4A 2HFNA 4OJ1A 2CRLA 1Q53A 3QMQA 1X7VA 1IUJA 2BJEA 4F67A 1KVJA 1FD8A 1OPZA 4FNHA 1SQEA 1S6OA 2EW9A 1LQ9A 5KAKA 2Q3PA 3KKFA 3IWLA 1CC7A 1X8DA 1TR0A 3BDEA 2K1RB 2N4CA 1MWYA 3IWXA 1KQKA 5B08A 3UDCA 1N5TA 5B0CA 2K7JA 1S6UA 2RILA 1N5VA 4Y2IA 2HLUA 2LQ9A 3FGVA 4OJ3A 2GO8A 2RMLA 1RJJA 4NPOA 2XMWA 2GGPB 3TNVA 3FMBA 2GCFA 3LGMA 4FNIA 2ACYA 1AFIA 2QYCA 2IYIA 1FE4A 2XMVA 4QOTA 1FESA 1GXUA 1Y0HA 2ROGA 2RSQA 3LGNA 1Q4RA 2K7KA 5B0AA 2BBEA 2GA7A 4YEAA 1YG0A 3MZIA 3CJKB 1AW0A 3BF4A 1VQYA 4A46A 3TOQA 5IXUA 4A48A 5B0EA 4DN9A 3HHLC 5T7LB 1U7LA 1KVIA 1YJVA 1Y3KA 3MCSA 1FVSA 4EFAC 1GXTA 2JDJA 1CC8A 2QLXA 3BGUA 3HHLA 2KYZA 3QGPA 5B0FA 4ZA1A 2HQIA 4Y2MA 1R6YA 1Y9OA 2OD6A 3HF5A 2K2PA 2L3MA 2VH7A 2AP6A 2XMMA 3KG0A 2ROEA 3KNGA 5B09A 5B0DA 2W4DA 3I9ZA 1JK9B 2OP5A 2IYGA 2XMTA 1TUVA 1OQ6A 4OJGA 2KT3A 3HHLD 3GZ7A 1ULRA 4DPOA 2AW0A 4ZOSA 5B0BA 2ZDPA 3DCAA 3LO3A 3TRGA 3HX9A 1QUPA 3K7RA 2ROPA 2IFXA 1W2IA 2FIUA 2FTRA 1TZ0A 3E8OA 4YDXA 1TL5A 1N5QA 3BR8A 3FRYA 3HHLB 3T9NA 1Y3JA 4NL5A 4Y2KA 4HH1A 4A47A 3HFKA 2HIQA 1MWZA 1Q8BA 2OD4A 1AFJA 2AJ0A 4HI2A 2BUNA 5T7LA 1FE0A 2PGCA 1SB6A 2QLWA 2K1RA 1X0PA 5F0UA
chains in the Genus database with same CATH superfamily
2XG8A 5SUHA 1WKLA 2B0GA 3EGWB 3CNQP 4NLSA 3UR0A 4PPZA 1N33J 1CJTA 5E33A 4RW8B 4XK8C 4URGA 1TKTB 2OFGX 2NXUA 2BJDA 4E8UA 4ZVRB 5CD4H 3K5PA 3M8YA 1SCJB 3SDEA 3PVXA 1NK0A 2M88A 4IO9Q 4DS4A 2P6SA 1KHVA 1LK7A 4NMLA 1DAXA 4NA1A 2DITA 4W92B 4JV5J 4ZVSB 1U4BA 3R5CA 2JEJA 1S49A 2CQ3A 2RF2A 3MPUB 3AODA 4Q8FA 1S0OA 2KDOA 1NHUA 3OUYB 3DGVA 4WU3A 1YJTA 3DRSB 3F0NA 3GFZA 4PG7A 4DEZA 5EX0A 2XGQA 4MFBA 2GHVC 3PYEA 1XERA 3EDRB 1TKDA 2IVYA 4DX6A 1R0AA 4P74A 1YRXA 3WX8A 2PMHA 4CH7A 4CLLA 4D3GA 1AUDA 3NG8A 5EN1A 3ENQA 2OO4A 2FJVA 5A2QU 3TUIC 4RZRA 2DR8A 1UJ5A 1PYOB 3R5GA 1VK8A 1TL4A 5CXTA 4B3MF 1X60A 3HHDA 2BJEA 2DIUA 2G2ZA 5L39A 2A0FB 2QFIA 2CQCA 3W7BA 2EW9A 4OX7A 4QR2A 2D3O1 1VQ9S 4M5LA 1HBOA 2JFDA 2GNKA 1H7WA 3EZ5A 4M5DA 4ZLPA 2K1RB 4L76A 4K4WA 3UDCA 3IR6B 1TK8A 1KHWA 2RILA 4ZPAA 2ILZA 4ZPWR 3EYZA 3I5AA 4B3TF 1TK0A 2VPWB 1SL0A 4AD6A 1TL1B 4HACB 2ZH1A 3PXGa 5M2PA 2ILYA 4ICLB 4FF1A 1JLQB 3O3LA 4W98A 2XO6A 2HHXA 2VIHA 2XMWA 4Y28C 2CPZA 2ZBRA 4LF7F 2ALZA 1XMOJ 1R8PA 5L38A 5KG3A 2GMHA 3HD2A 4HHJA 4R8UA 2IAJB 3C6UB 1FEHA 3OLBA 2ZH4A 3T1YJ 2PA8D 3S6EA 4CCHA 3W61A 2WBMA 3A8IA 4XPEA 2BBEA 1J5EF 1DZ5A 4CM0A 4NLWA 3BF4A 4ZN1A 5HP1A 2GAHC 1NJYA 2DRBA 2R7QA 5E0OA 1HNIA 3MEDA 2C2KB 2BKOA 3I82A 4KRWA 5LMUF 4JI5J 3THPA 3P49B 4K0KJ 3W66A 1LWFB 2Y1RI 3SCLE 1AXQA 3Q8VA 4J9VA 1RHUB 2YKOA 5I42B 2QYGA 2PEHA 1HQ2A 1REVA 3JTOA 4CLUA 3KK1A 1ZYQA 2BM0A 2CPHA 3SMZA 5T41A 3UD5A 1ZBTA 2QLXA 1Z2ZA 2BKPA 2B4UA 2HFSA 2DR5A 1XMOF 3DLHA 4OHYA 1XNQJ 3BGOP 3LPEA 2AP6A 2CNNB 2VASA 3HK2A 2ZNZA 4C7QA 3K2YA 1QSYA 1FFSB 3Q8QB 1N56A 4M63A 4OZ1A 5DM6Q 2YKMB 2GVDB 2RQKA 2XSJB 3TX0A 3W63A 3EZUA 4DU8A 3KDOA 1U48A 4OI0A 2NPFA 2XULA 1YBAA 5HL7Q 4RUAA 2V8DA 4R8UB 1X0FA 1X4CA 3HX9A 3CJ3A 3NWRA 2W8KA 3DHWC 2IFXA 2FQQB 3FCVA 4V1Ak 3DRPA 4YDXA 1Q81T 3T9NA 2R7TA 2MJUA 1DBDA 5U47A 5F8NA 2DGSA 1RHJB 4TY9A 4ICLA 3RW6A 4B3OB 4G65A 2IM1A 4EUVA 5A76A 4U7CA 1VQOS 1ZM4A 4IH7A 1IVZA 1RT5A 1FXDA 1A7GE 2GJFA 2K1RA 4ED1A 3EE3A 4DUZJ 2DO0A 2YKNB 4ECTA 1FJEB 2BOPA 1HBOB 1UWAA 1WKKA 4A4JA 3PZPA 1PCAA 3ZZZA 1OQ3A 1KS2A 2NSCA 4HL9A 4DX7A 3A1YG 2JLFA 2VC0A 2VU5A 4YB7A 2DHAA 3MMJA 3J7Z5 1FT8A 2DGVA 1SC6A 1V5IB 4IOBA 3QT5A 4NEZA 4ATNA 1BGXT 1XN9A 2WW8A 5KG1A 3UW1A 2L9WA 2XI3A 3OV7A 5JUMA 3OTOJ 2BX6A 5HROA 1MROA 2RQMA 3JB9k 1NJZA 2KRBA 3CJSA 1SBRA 1MW7A 2YWKA 2YVSA 2GZOA 3CF5Q 2LFVA 3GILA 3R27A 3UDEA 1FVQA 1Q8IA 3EVMA 4ZPDA 1S0NA 4YDDB 3QO9B 1BQMA 5LJ3Y 2YKAA 3O44A 2VDIA 2DNQA 4KH1B 1JLCB 1RBOB 1N34F 2C42A 3T19A 3CULA 5D77A 2VA3A 1UEKA 1TVRA 3NGKA 4OJHA 2JEGA 2N4DA 3LF0A 2BE7D 5EHHA 3R97A 3QZ7A 4RL1A 4OJ1A 4AXIA 2AKWB 4Q43A 2E5LF 2WSCC 1WOSA 5KFMA 1IBKF 4WJBA 3B6BA 5I3UB 1YX2A 3PFEA 3HVAA 4ECXA 3KKFA 2H1YA 4EYIB 2FVSA 2WVBA 3M2UB 4C3MA 3EWGA 4HHUA 3N5FA 2W9BB 2VQEJ 2GVZB 2YH1A 3GV7B 3ZZYA 1NB7A 4C3LA 1NMEB 3B8HA 2R42A 3LOUA 3HCXA 2WRMA 3QFWA 4CRJA 2DISA 1SKWA 3CCJS 4EZ9A 2DGUA 5KG4A 3MCOA 1HD1A 2BJ8A 2W24A 4TU9A 4LSNB 4O4GA 4R5PB 4ZS6A 1SXLA 2EBGA 4BLGA 4HDGA 1D9FA 5LMNF 2B8QA 7FDRA 3OVSA 4FF4A 2IM2A 5D4OA 3G6VA 3EGZA 2MQMA 5ETRA 2OPQA 2BRLA 2Z56B 1EZZB 3LGNA 4CLZA 1NK6A 2NYHA 1RABB 4X4SA 2R7OA 1KTVA 5E3QA 2XLIA 2VQFF 2QSWA 3C15B 2HVHA 2X3DA 1S7IA 1VQYA 1S1WA 1T9UA 2DR7A 1K47A 3OQ2A 3HP6A 1NKCA 4NXNF 3QIPB 3TWZA 2E5IA 4DI6A 4E2FB 5DM7Q 1R31A 4FF3A 2OTJS 1RT7A 2J76E 3BH6B 1P9QC 1U6FA 3BPDA 3ITHB 4UTGA 1BD6A 3C6TA 4I0WA 5CH7B 2ZZTA 4LRCA 3C46A 6FD1A 5H1SV 3J7YI 2DKOB 3BGUA 4HEA9 4MIAA 1S76D 1X4DA 3PW4A 2NXJA 1XC9A 2DHGA 2UUCJ 1IM4A 3P96A 2HNDA 2K2PA 1QAXA 1LWEB 3ADAC 4EGLA 3WIVA 4ED6A 1NZAA 4RNFA 1DRZA 2HHWA 4TLRA 1HLWA 2MLYA 1TKZB 5D0EA 3M9NB 2OPPB 2DNGA 2M3DA 1PILA 1VC6A 4AL7A 4XO0A 2ASJA 1RHRB 2V8VA 3BBFA 3QYYA 1X5TA 3MM9B 4R0JA 4EYHB 3K7RA 2ZOFA 5CQGA 1N36F 2Q66A 1RT1B 2KHDA 2J7WA 5K8PA 2DEIA 2IRXA 2VFSA 2LXIA 4KFBA 4OYOA 3VGTA 2WVFA 4N41A 3J7AN 3SEOA 3CSKA 1HI1A 4OZNA 1S97A 3IO1A 1RU1A 3RB0A 3DMJB 4OQJA 2OMLA 2DNNA 4TLQA 4WYWA 3HPOA 4C8YA 4J37A 2YNIB 3F73A 1HMVB 3P5TL 3U7JA 3SV4A 2HHTA 3AFGA 2A3JA 3M2RA 2BYCA 3O8WA 4WFYA 4ZCKA 1U47A 2KZMA 2ZD1A 4CLKA 1UZHA 2KT2A 1ELOA 2H5IB 3ET6B 5AE2A 1TKXA 4RLEA 1N32F 1P1LA 3VTIA 4QPXA 5IWAJ 4DV6J 2V4QA 4N47A 1DTTA 5J2PA 2P5VA 5J2QA 4LVNP 3V81A 4O0IA 1JB0C 3CO9A 1JWWA 4RWWA 1KLNA 4DV0J 4F3OA 2CQDA 2F9JA 1VIXA 1XMQF 1KONA 1X31C 2XHWA 1N0UA 4RW4B 3W2WB 1PKUA 3TVKA 2R4FA 2D9OA 3OJUA 1M0SA 3Q2SC 3JSMB 4ZIWA 4ED0A 3OHAA 1XNQF 3LP1B 3LP2B 4KYZA 4J9SA 1MMLA 3BSNA 3T5HA 3MUTP 3VZIA 5KFUA 1FFGB 2RHQB 3HM9A 2J7KA 1X4HA 2MSTA 1U24A 1URNA 2KHCA 3NAHA 1IKXB 2IM0A 4TY8A 3OL8A 2FJAB 1U8SA 4ZP6A 3BQ1A 4I2QA 2CRLA 4MAKA 3OVAA 1EARA 3FQLA 2CZVC 4F3QA 3RR7A 3THTA 1NKEA 1HNZF 3CC2S 4J7CA 3R9LA 4LRBA 2I6WA 3MPWA 2R2RA 2KI2A 2KU7A 3M6VA 4QW8A 1MU2B 1VJQA 2B56A 2EFPA 4X4TA 1S1WB 3H7HB 4GVBB 3GCXP 5AE3A 4YFUA 3IG1B 3PW2A 3E2EA 3U1NA 1D1UA 2ZBPA 5BYRA 5CCLA 4P7TA 2OPQB 3CJRA 4AL5A 2BJ1A 5KT7A 2CIMA 1M5KC 3KUGA 1YVFA 4M5IA 4DPXA 3BO3A 1C1CB 1T03B 4O4GB 4OHWA 1PC4A 2ZH9A 2UXDJ 1EJ7L 1C1BA 4MIBA 1FE4A 1IR2A 1ZS6A 1FESA 4P72A 2RSQA 3QFHA 4PXCA 4UOHA 5B09A 5F8HA 1LOUA 3MM8A 4U6PA 2GA7A 4ES1A 2A1BA 3ZNJ1 2Y8YA 3C3LA 3VR1A 1SIZA 2FPHX 3KLEA 3E3XA 1W2BR 4GKKF 3HSJA 1PIEA 4MKVA 4UUXA 1V3SA 2BJ9A 1AUSL 3MMBB 1TV6A 5AXLA 2KFYA 4OI1A 3K5LA 2ZH3A 2V0NA 1HW8A 4IOAQ 5F8JA 3ZZUA 1JKHA 2UVWA 1LEOA 2XCPA 3KLFA 1T94A 4H4MA 2V2QA 1R43A 1RI7A 1YGYA 2FZGB 3HHKA 2BANB 2A2CA 2JJ4D 3M8PA 4YY3J 1LXJA 1SV5B 2WSEC 1VQNS 2X1FA 2ACMA 1BQMB 3QO9A 4I1TA 3ENVA 3KK2B 1F9FA 1TUVA 1HWLA 2XYPB 2J0XA 1M5SA 1NLKL 2KT3A 4YR3A 4PKDB 4R0EA 5M2UA 2AT1B 5HJYA 3EPIA 1Q5VA 2VG6A 3PKMA 2MPUA 3LO3A 4PAAA 3FBFA 3M8RA 2B43A 2G0CA 3MEGA 2ZHAA 1UL3A 1DURA 3OJSA 4ZCMA 3RAMA 4DX5A 2AYGA 1WDDA 3BN4A 1N5QA 2ZHBA 4DUTA 5FLXY 1Q1KA 3QRQA 1U1PA 3NGRA 3LW5C 4Z2XA 5HO4A 2D3UA 4C3KA 5E3CA 2LVWA 1U49A 4JV1A 5KFSA 1F5CA 2DR6A 2N82B 2G2OA 2MHNA 5EDWA 2HZCA 1RT3A 3W1YC 4A8QA 1CLFA 3M8WA 2ZDOA 4OL8A 1RP5A 1S79A 1HBUA 1WF1A 1WF2A 4DN0A 2C3PA 1MMDA 2UXCJ 1T9TA 3GYNA 3QRPA 2VG7A 3DXSX 1O5JA 2QX0A 2JC0A 2X3GA 2LLZA 5DJBA 3RYLA 1TFYA 3G8QA 1HNWJ 3KYLA 2HFZA 3MFHA 1RKIA 1X9MA 2CXEA 1N5YA 4NXNJ 1ZH5A 2XY6A 1CS4A 2B4VA 2OKQA 3B82A 4WXWA 4ZPCA 5GMKa 1V3ZA 4NA3A 1H38A 3P3DA 2Z57B 3QAUA 1PC5A 3PFOA 4TXSA 4P10A 3W5XA 2HZVA 3PKYA 3P6YC 2KKHA 2E7XA 2RDDA 4FKYA 3NBPB 4DR4F 2YWWA 2YBVA 4LT6A 4FXDA 2J7UA 2YKPA 1GT8A 1KR4A 2HS0A 3QJJA 1S4FA 4DR1J 4U7UK 1P8GA 2FD2A 2RS8A 4NLYA 1SJRA 1JLFB 4HT5A 5E2QA 1F6TA 5KT6A 4K5SA 4C8KA 2C2ZB 1KLMB 1UFWA 2W4PA 2YH0A 3UI3A 2QIFA 3D7SB 3V6HA 2YWFA 4K2XA 3N28A 4YOEA 2ZWOA 2M52A 2F9DA 2HRUA 4DR6F 5IT9U 3R3TA 3TQ1A 1X7VA 1ZAWA 3MM6A 1WACA 1TU0B 1FD8A 2AV5A 2Z4PA 3CD0A 1VGYA 1YKWA 3CO0P 4WP3A 3TAPA 2M2BA 1WC6A 4QIEA 5C5JA 1N6QB 1JXVA 4DQIA 4W90B 1YZ7A 1CC7A 3L9ZA 2WOMA 1SH2A 3ZTOA 2YXLA 4LQ9A 2J5AA 3T5LA 4GVLA 4DX8H 1QD1A 3DGPB 2QFJA 1DTQB 3DI6A 4LRFA 2DGOA 1UETA 2HBQB 1XR5A 4LRDA 4DSEA 3CMQA 3C6UA 5KFOA 3CJ2A 4GMKA 5HBMB 1VQ7S 1FWPA 4DR7J 4AYBD 3FGVA 2GO8A 3HXMA 1N4LA 3DRRA 4KV8B 3GFYA 1RSCA 4U96A 5AXKA 2ZM6F 3CCZA 5CD4A 2C2OB 4RUHA 5DLGA 4B3RF 3GLJA 2VBXA 3OFEA 3PTWA 4RW6B 3OR2B 2OTLS 2A6OA 2GMLA 3M8QA 2OPSB 4LUBA 2K7KA 4DR6J 2GQ2A 4LF4F 2P9GA 3DI6B 2UU9F 1IBCB 4KGMA 5LMUJ 4JI3J 5CABA 3PW7A 4MKYA 2JOQA 1FDNA 3L4BC 4M5DB 3VAMA 3H40A 3VAKA 3TOQA 2POKA 4F36A 4X64F 2EK1A 3TAMA 3GR0A 5FDLB 2JL9A 2QSFA 5K14A 3V4IA 2C3YA 5T7LB 3G2XA 2Y3YA 2ZJPQ 1SKSA 4OYMA 5KFKA 2LEBA 1BMQB 1R7IA 2ZNYA 1JLGA 2ZUGA 1TELA 3ENAA 1R8BA 3VWSA 2PA3A 4DR3F 3SI8A 3HVWA 2OH2A 2BQUA 1NKBA 1B7YB 2G2YA 4WP9A 3MOJB 3MTJA 2HQGA 2OPRB 3NMAA 3LQVA 4N8OA 1WC5A 2MQPA 1R0AB 1QSSA 2OSQA 3KNGA 5H9EJ 2OP5A 1OS5A 5GAGU 4M94A 4WIQA 4J91A 3NBPA 2FJDB 2YX1A 1RKJA 2LKZA 1IWAA 3BBBA 2EVZA 3FCWA 2XNQA 3LP0B 2WK4A 1H74A 4QYZJ 4X4UA 2BQ3A 2DEJA 3R5BA 1JLEA 1TL5A 2EFNA 2XZWA 3F56A 2F1FA 1HL6A 3FQKA 3JXOA 1PAEX 4A47A 1QUVA 3RRHA 4ZVTB 4LFCF 1TKTA 1JLGB 2CPEA 2GIRA 2OD4A 2VG7B 2HG4A 3MTKA 1CG2A 4ZLNA 2DO4A 2KH9A 2R7VA 5T7LA 3DLGB 1KFDA 5FDLA 2WVCA 3IFEA 3A3OB 3ELHA 3R7NB 5HMZA 4WXOA 3HSZA 3CCLS 3KJQB 3VGVA 3BJYA 1KNZA 1LW0B 5F9LA 4Q8EA 3FVYA 1X4AA 1QDUB 3N5BA 4HH0A 3RZAA 5A6PA 1GX5A 2H5JB 5L1KA 4OZ2A 1FNOA 2HWIA 2OPSA 2XMKA 1SKUB 2CNKB 3A4TA 4DFJA 1N5SA 1P27B 2DGQA 5HQ8A 4DL6A 2MKIA 4OYWA 4YB1P 2MZTA 4M5GA 4ZPTR 4CO2A 5B7WA 3PHTA 2QT7A 5HJXA 2C2EA 4TVAB 4A8KA 1W7WA 2JWNA 1K1QA 2PIIA 4I2PA 3Q86A 1B0TA 5KT3A 1Q16B 4Q45A 3SFGA 1IJEB 3VF0B 3GU0A 1M1GA 3DGPA 2HFVA 2O01C 2IJRA 2XMUA 1Q8KA 5D4LA 4YHHJ 2OLWA 2RQ4A 2W9CB 4DV7J 3K5MA 3CC4S 3MEEA 4CLYA 3THVA 4C11B 4OX8A 5BR8J 1CEZA 2W4CA 2GO9A 2OMOA 2KL8A 3W9JA 2HYIB 5KFZA 3NCRA 3W5ZA 1KP6A 1Q78A 2VKRA 4EZ6A 1UA1A 4RW7A 2NXEA 1VRQC 4J9MA 3G86A 5BYQA 4KHMA 4YB5A 4GC6A 2C2DA 3HFZB 3M6XA 3QNWB 3DLBA 1EP4B 1TV6B 1OPZA 1X5PA 2HNZB 3PM9A 4ED3A 2VQEF 2ZOMA 3D3BJ 2OEMA 1VCTA 1FRMA 3AB2B 4WK1A 4F0HA 1H0HB 4C98A 2K7JA 3EGVA 2D74B 2I9SA 3Q89A 4KPYA 4FP9A 2LDYA 3TZYA 5JVHQ 4B9MA 4CLWA 1F1BB 2J6SA 4HKQA 3D0IE 3OTCA 5LXYA 3C66A 1M5OC 1C1CA 2DNHA 1U25A 1VC5A 1RBAA 1RAFB 3IBCB 3KXDA 2BJ3A 2GCFA 2WAQD 4KGZB 4PABA 1R0CB 2MKKA 2FZCB 1IXKA 2RKIA 4X4VA 2DH9A 5C2GA 2B9EA 3CWJA 1P1TA 4FYVB 1N8RT 4LMZA 1AW0A 4GVBA 3GIIA 2G13A 4A46A 2C3OA 2AU0A 2YNGB 1H72C 1NK8A 2HQ3A 4PG5A 3NRBA 2RNEA 2B3TB 8AT1B 3DU6A 5DDOC 2GMJA 3Q83A 3H20A 1YJVA 3OFGA 5KFRA 1FVSA 3UN5A 2G1DA 3BREA 3AOCA 4EFAC 3JAMU 5A2QY 2ZH2A 5AJ3J 1HNXJ 4X4QA 4ED5A 3KUHA 3AD9C 2HK3A 2V34A 2ZWPA 3UFCX 2DXDA 2KYXA 2KXFA 4QIVA 3T6BA 3RAQA 2FVQA 2XO7A 3LWLA 2Y9HA 1IKYA 2RB7A 4LSLA 4CI0B 1Y4ZB 4XPCA 3QLHA 2W4DA 1U2CA 4KKOA 3LP1A 4OV1A 2B6AB 4OI6A 2E1AA 3FK4A 2D9PA 3GQCA 2QMWA 1HNWF 3PY8A 3I0RB 4WK3A 4C2MA 1T3OA 2KM8B 2H54B 1DHMA 2ZC4A 3MAAB 3D0GE 4RBTA 2H9ZA 1SV5A 2EK6A 1IBLF 2M0GB 2FYXA 1MLAA 4NOHA 1RYSA 1WSRA 3DYAA 3HFKA 1YQHA 1HNXF 3G6ES 3K5NA 1CVJA 4KHPF 4IKAA 3NS7B 4P2FA 1UEUA 2G0IA 4X4PA 4F50A 5GAGI 4IYQA 5DQGA 3H5YA 4J9PA 4JI7F 3OVBA 1NM2A 3C8YA 4ZVHA 1YITS 2V67A 2HRYA 4PXBA 4ITSA 1C0TB 4TKTA 1DFDA 1GH8A 3QGHA 1OSDA 2YKQA 2JC1A 3MM8B 3MM5B 4UOFA 2N3OA 3T5KA 4IR9A 1UP1A 1XTZA 3C14A 1FJ7A 1HHTP 4KBIA 4OLOA 4ZVUB 2E1RA 4DDFA 2HKEA 4K4ZA 1S6QB 3BB5A 3JSBA 5JVGQ 3KHRA 1RT1A 4DV0F 4X2BA 1Q86T 1T03A 7FD1A 1URRA 2F63A 3DOLA 3OBIA 1NJIT 4NZ6A 2I0XA 4B3TJ 1EETB 3BYPA 3UNYA 1NB2A 2MZQA 3K5OA 1OSCA 1VI7A 3DC2A 4DFMA 2OGUA 3QIDA 2UZAA 2V4JB 3IG1A 2ZKTA 4DR2J 1AZSA 2VD3A 5HAOA 1T9YA 2FHKA 1JJ4A 1RB0A 4FYWB 3FRZA 1RWKB 3AB4B 4AFFA 3GIMA 2C3MA 1MWQA 2WVDA 1LV5A 2ZEJA 3TZXA 3SCIE 5KT2A 3CJ5A 3GWCA 1M5VC 4F4YA 3PO5A 2VPYB 4BC7A 2CQHA 2IHR1 3BS9A 3I5BA 1HR0J 1U1KA 4FYXB 2ZBCA 3PR5B 1S9GA 1IKXA 4F25A 4ZJOA 4X65J 4QWDA 1U2RA 2W7OA 3MMCB 2YQ0A 3KMQA 5A0YB 1ZZNA 2RRNA 3CJ0A 3UVJA 3T41A 1YBUA 1X8DA 2B7CB 4IQMA 3MMCA 3TEHB 3I32A 3C15A 4GKJJ 1S6UA 4AL6A 1H2UX 1NPRA 3JSMA 1RWOB 3BQ0A 1N5VA 5BYSA 3J81Y 4WFZA 1MN7A 1UA0A 4KT0C 2R7RA 5IC4B 4JV0A 3Q2TC 4NASA 2RQCA 2IBKA 4WTOB 2JNJA 4M5NA 4LF7J 1BE4A 2E5JA 4Q44A 1HIYA 1FI4A 1ZTWA 2BQRA 2DTJA 2GVZA 3NEKA 4FYDA 1LK5A 1BWVA 1C0TA 4C8OA 5KG5A 4B02A 4YR0A 2QJ3A 1FJGF 3IXQA 4BWJA 2AX0A 2MZ1A 1M1HA 3HHEA 1H6KX 2IMOA 3DXBA 3HHLC 4URQU 4WTYA 3DMJA 4F4XA 5HVGA 4LFCJ 1S6QA 2DNMA 3L7UA 5I3QA 3V6JA 1Y3KA 1YRTA 2UUWA 3QWPA 1Z2LA 1Y5IB 3DOKB 4LFAF 4M5MA 3VCDA 3JTNA 4O3RA 1OWXA 2CDQA 3IR5B 5L1LA 3W5YA 4C8MA 3IAS9 3WQPA 3AAWB 3TO8A 2NXNA 3KG0A 3MM9A 4K4TA 3OSPA 2EBEA 1QE1B 1KD1T 2PSZA 4FS1A 4ES2A 4ZP9A 2EG1A 2WSFC 1PAUB 1RWWB 3EUNA 3QATA 1W25A 5CYMB 5D15A 1Y11A 1RACB 5HK4A 1I3OB 5F3ZA 3HZGA 1LFWA 5THWA 2I5JA 5IT4A 4ECQA 5G4DA 4CO3A 2NPIA 1HNZJ 4ZLJA 1RAEB 1T11A 1V3RA 4Y65A 4NCGB 1UZDA 1NSKL 3H59A 3BYRA 1JIHA 1RT7B 3D6MB 1ZZFA 2CQ1A 4L3KA 2J6TA 2HPUA 2Z2MA 3M30B 2CVEA 2IA0A 2B6AA 3HFVA 2YKNA 3FEYB 3D1OA 3JQJA 1VQMS 4GC7A 1U02A 3GSIA 1N34J 4DFPA 3H90A 1WSVA 3CIZA 2VV5A 3N6LA 2BRKA 3A12A 4GO7X 3CB4A 2CG4A 1SUQB 3HVTA 1CQMA 3ETMA 3IBWA 1H73A 4EWTA 5KOXA 3DLKB 5H9EK 1L3SA 1YZ6A 3GIKA 4DR5F 1VBKA 4JYAJ 3BKFA 5CZVA 4H4KA 3BM7A 4B9VA 5KFXA 2V8GA 4GO5X 1EQMA 4DJBA 4R5PA 3BSOA 3FSXA 1WI6A 2HGMA 4U8YA 1ITPA 3RU0A 2CADA 2M4MA 3D67A 2RT3A 3OT9A 4Q7AA 4X62F 1B0PA 4MYTA 3A8EA 5KT4A 4QYZK 2WHOA 2P2CB 1PBUA 2GFFA 3DLEB 2QV6A 4M5KA 5GAHU 4QWEA 2IM3A 4ZPVR 5DG7A 2CPDA 2HMIA 5F3TA 3PHEA 5LMNJ 1WOOA 1ZETA 3BN7A 1HYSA 1F2GA 1NO8A 4XIUA 1KVJA 4H4OA 2OEKA 1CJVB 1RK8A 5D0GA 2HQFA 3HULA 1ZPVA 1BUXA 1XR6A 1KTQA 4RW7B 5BR8F 4ZVEA 1NK4A 4J9KA 3BKTA 3QMQA 3MPVA 2KM8C 3CCSS 2JSXA 5E3AA 3PW0A 3AJ1A 2QEXS 4P71A 1SQEA 3BPSP 3CTRA 4PQAA 3MEEB 4UQGA 5CHCB 3RJMB 3HVRA 2BXJA 1T05B 5HSPA 4ECWA 1X9WA 4O3QA 2DXEA 2FGCA 3V2UC 3IWXA 2OELA 2DH8A 2W01A 3T9ZA 2R8HA 2HVDA 1VQ5S 2O67A 4C9DA 2W2PP 4DG1A 3G6YA 3SZ2A 3OFFA 2ADCA 2HIYA 3VAIA 1FDBA 2DNYA 4NLOA 5DGBA 5GAEU 3CC7S 2UUCF 3G82A 2AWZA 1Q79A 4UQTA 1GX6A 4Y0FA 5HROB 3CGIA 1VBYA 2CDRB 3MWBA 3HHNB 2RH3A 1NK5A 3MD3A 3POTA 4G1PA 3UQSA 5LT5A 1UEVA 4F4AA 3I55S 1L3UA 2F4VF 1WELA 1GXUA 3MHYA 1RXOB 1L3VA 1FA0A 1W26A 2HS3A 4X4NA 4R25A 4C8ZA 3A3PB 1RWMB 1ZA2B 1RLDA 4NLTA 3M1VA 5D0RA 2L08A 3HKZD 3K0JA 1RT5B 1N36J 5DGAA 1UVIA 1I94J 2VJVA 2HHVA 1NPKA 1U7LA 4KR0B 4DR2F 3GJRB 2DRDA 3O1LA 4IFYB 5FJ4A 1IQZA 3LANA 4RJVA 4DV3J 1FKOA 5L9XA 4CO1A 4MYUA 3FZBA 5HQLA 5ETTA 1SJ4P 1TL7B 3D28A 1WEYA 1R6YA 2BEFA 4AXJA 4QU7A 1DLOA 3LAMA 2VH7A 5B0DA 3R6GB 5LSRA 1EQ0A 3LAKA 5GAEI 1HHQA 3PX4A 1KFSA 2LA4A 5IM0A 4KH0B 4ELVA 1HQUB 4Q5VA 1OQ6A 3NAIA 3J7YU 3KMSA 3M05A 3VAJA 2YPYA 2AW0A 2YNHB 2FZKB 2NYIA 4RX6A 3QRRA 2AIRB 2ZH6A 2V9WA 2WTFA 4WFAQ 4B3MJ 2XEXA 3ZNUA 2LQ5A 3IR7B 5L8RC 2XC9A 2DHHA 1RDRA 1TZ0A 1J27A 5D4NA 4K4SA 1Y3JA 3H5UA 4DR3J 1FDAA 1LNQA 1XIQA 1RAJA 4OI3A 4OX9F 3RBZA 2YNFA 4C0BA 3KLHB 4QBUA 1VQ6S 4K4VA 2VA2A 1JJCB 4RW8A 4EK2A 4EBCA 4RNNA 4YMEA 3VALA 2AEMA 3CCRS 1MNEA 2G4BA 1LWFA 3RTVA 4J9UE 4ZN3A 1NHKL 1S6PB 2EFQA 1AB8A 4L74A 4LSZB 2L48A 4CIOA 2C22A 2B5JB 4LQ3A 1U6BA 3N01A 4K7QA 1D09B 5KFFA 3F41A 3H25A 2J0WA 3I5CA 3GG0A 1CPZA 4YUDA 1D3WA 2R3VA 1RWVB 4NRUA 4O3SA 1UVJA 3TR5A 4P7VA 1T9XA 1R6VA 2WONA 3G87A 4I6YA 2EG2A 4OZJA 4TYAA 4ILRA 2BW2A 5HATA 4PR6A 5KFAA 1XJWB 4NZ7A 3MM7B 2BA9A 3AD8C 3OLAA 3SBMA 3N6MA 3CJ8A 3SXLA 2HWTA 1HKAA 1F60B 1F9EB 1KVKA 1EIYB 2HAIA 4B9UA 3UR3C 3I96A 4P52A 1QTMA 3M8QB 2FVRA 1T7PA 3OR2A 1YJRA 1EAYC 4RW6A 2CQ2A 1WD6A 2GV1A 4WFNQ 2EFGA 2WBRA 3CD5A 5K8NA 1XNRF 2R7UA 5J1EA 2ZKUA 3BR9A 3QSYB 3ZZRA 4L3NA 3MM6B 4C6AA 2EEYA 3MUVP 4LF9J 1X5OA 5B0GA 2VC1A 4CLFA 2ZH8A 1RGVA 5HBMA 3GIRA 1U1QA 2AJQA 3V6DA 1VHIA 2VDHA 2HHHF 1IUJA 3DRYA 3SSSA 1FJGJ 1HR0F 4NA2A 1F3FA 2PN6A 4M5JA 2Y0BB 2DGTA 1YRUA 2WOMB 4N5SA 4RNMA 1U26A 1SC4B 4USIA 1T05A 5F9NA 3PR4A 1UCNA 2F4FA 2NSBA 4OHZA 3QAEA 3WC0A 3D54A 3DRSA 2E5GA 3S1TA 4ELUA 3OUYA 4O3OA 4J9OA 2QO3A 4ENOA 4WBFA 3KLIB 3K17A 3IGVA 4GKJF 1R8AA 1NUEA 2AJ2A 1CJUB 2RMLA 2K06A 4Y00A 4G1QB 4I64A 1RJJA 1GTHA 1FKPA 4NEYA 4H4OB 2KG0A 2O1PA 4OI4A 4FNIA 4P2MA 2ZE2A 1UMJA 1JXLA 5LOQA 2QYCA 4ZPBA 3SSQA 5J2NA 1VLOA 3FCHA 4IRDA 1SH3A 4ZVOB 5JXSA 1OY9A 2DB1A 4LBIA 3ZO7A 4LF5F 3UCUP 2CAJA 4NLVA 3GTYX 4DCOB 4NI2A 3PJXA 1HQUA 3BKUA 2W7PA 2U2FA 3P8BB 1U1RA 1RADB 3MGJA 4WU2A 2QL5B 4CTAA 5KG0A 1UVKA 3TUPA 1Y5LB 4LIWA 1RWNB 4JBCA 4X4OA 1J5OB 1TL7A 4YP3A 4F3MA 3JYTB 4IFVA 4ILMA 3GJTB 3Q8RB 2DPIA 1CULA 3MI7X 1FKOB 1SUQA 3QGPA 4WPAA 4IFYA 1LKZA 3MUMP 2R7XA 2D41A 3EXYA 1RHQB 2HQIA 2MJNA 2BV3A 3JSRA 3Q8PB 3NGDA 4DWIA 1FRIA 2VG5A 2ROEA 1RT3B 3A3NB 3GB0A 4FF2A 2UXCF 2VG6B 3O6QA 4I4BA 5AXNA 3ENWA 3M30A 1RT4B 2XMTA 3MEKA 4ZP8A 4BS2A 4DLEA 2E66A 5K20B 4ID5A 4OI2A 2CJKA 2Z2ZA 4JUZA 5CAAA 4FBTA 1PO6A 4ETZA 2VQFJ 3JQMA 3NOCA 4RW9A 2UXBJ 1H98A 2UUBF 2IJFA 3CEDA 2XGPA 1CBKA 2N3LA 3NS5A 2W2OP 4FKXA 5E41A 3BV8A 1U0HA 3D6HB 4DV2J 5CYQA 4PRFA 1HHSA 3BEGB 3TUJC 4NL5A 2NR0A 2RIJA 2KO1A 4OYXA 3Q0AA 1LWCB 4KJIA 1KSPA 2MKCA 3AQPA 3FMWA 3TJ9A 4USKA 5F8IA 3CIMA 4DLGA 5CYMA 2LU1A 5AJ3F 1YK9A 3I31A 4DG1B 4B3RJ 1RE1B 4PQUA 4QCLA 1SB6A 4G1IA 3KJVA 2UVUA 1R3NA 2O3DA 5AT1B 4IR1A 3TA0A 3KLEB 1RTZA 1S9EB 3K89A 4NYPA 5HANA 4C0OC 5DDPC 4B17A 5KFHA 2MDAA 3TVYA 3PIOQ 1VQSA 3V6KA 4H4MB 4K8RA 2CPIA 4D3HA 2AYBA 3R2DJ 4KC5A 1PBAA 3SQGB 5E3PA 1TP7A 1EB0A 3PRVA 3ONQA 4Q2MA 1CJVA 1RT2A 4WE1A 4ZVFA 4ANDA 3R1LA 1YJ9S 2FLPA 3Q23A 1FEEA 1RLCL 1RTHB 4DPYA 2HFOA 4YS2A 3BGLA 4Q2LA 4OIXA 1G1XA 6AT1B 2FJXA 1YJUA 4WYLA 3MURP 3OW2R 2EC0A 2NZ4A 2PD1A 2I2YA 1MMNA 2ZJRQ 4KHPJ 4O3PA 3RW7A 4ZIVA 1CJKA 4U9RA 3KG1A 3PIPQ 3NNAA 3MPYA 1MU2A 2XWYA 3FNNA 1BQXA 4PWWA 2VF3A 3BSAA 4FN5A 2FJWA 4ZITA 1FRJA 2MQ8A 2AGQA 2DYAA 1UKUA 2HQCA 3I56S 5GMEA 4J9NA 3P45B 5C42B 2YQ3A 4LF4J 1GMWD 1R27B 2LP4A 2XYHB 4RR5A 4JI3F 4F67A 2RD5C 1D0EA 1JJ2R 2V2KA 4FNHA 3ILOA 4YQWA 1TTHB 4FBUA 1D8YA 4NCAA 1NDCA 3CCUS 3IS9B 1HBNA 2JVOA 2E1MC 3LP2A 3FEZA 1KQKA 4PUOA 3AT1B 2WCXA 5B0CA 2AD9A 1XMQJ 1S9GB 2AZ3A 2C2NA 1Y00A 2PDAA 4ECRA 3R5JB 1HI0P 1WF0A 4I2QB 5J1NA 1RISA 1V6HA 2HLUA 2J8AA 2NUHA 1FX2A 1U8WA 5FIIA 4QU6A 2EFVA 3EXCX 4NPOA 4WKYA 4ES3A 3EPGA 3OSNA 4DR7F 2DD8S 2CWKA 2MMYA 4LR9A 3LGMA 3GR1A 4LF2A 5J2PB 1UJ4A 3PYGA 4U95A 1KBRA 4OYZA 4XTTA 1C0UA 3RBXA 4O44A 1O8BA 3QJLA 1FDDA 3CDUA 3TVZA 4GKKJ 1TAQA 3DDNA 3FJ2A 3N9UC 1BC6A 2W25A 1S5ZA 2ZD1B 3HO1A 3OL6A 1EETA 2LYVA 1GFWB 3M2RB 3W9HA 2CQGA 2W2MP 3KTQA 3K57A 2CJ9A 1JQGA 2YNIA 3AH6A 4U8VA 4DV6F 5HLFB 4N76A 5DETA 5KFIA 2FJBB 3BQ2A 2K3KA 4CH1A 1HARA 1EHWA 3AD7C 3UNGC 3KNAA 2F3JA 1FERA 3D6TB 3BH7B 1SIWB 3HJVA 3E51A 3KUEA 1I94F 2KFZA 3PYFA 1L3TA 4M95A 3IRXB 3DOKA 4WZMA 2V6AA 2AMCB 2CVIA 3BBCA 3MM5A 4QYRA 4EEYA 1ICEB 4P6QA 1X9SA 5B0FA 4MTPA 4TNOA 1J2VA 1PJ6A 3KHLA 2HHQA 4MK8A 2MKHA 1GQEA 1QY7A 2KB2A 2Z2LA 1H3DA 5ITHA 4PWDB 2WZ1A 1VQ4S 2DY9A 1C2PA 3LH2S 3FFIB 1T9WA 1ZM3A 3MR3A 3MR5A 2QC3A 4DPOA 1V5VA 1C0UB 2MQOA 1JLAA 2FGOA 5D8HB 4KFBB 2DHSA 1VRTB 1WG4A 1Y10A 2NXCA 1E6YB 4PXDA 4NCBA 1F3VA 2FIUA 3HD1A 2XS7A 1SL1A 4CWBA 3NL0A 4DV5J 3HHLB 2E9TA 1GXLA 4DL3A 2PI5A 3L95X 3H4BA 3IBFB 3KHHA 1WEZA 4NZ0A 2GIFA 2K3IA 3QSIA 4ED8A 2BJ7A 3NGSA 3I0RA 3W2VB 3CMES 2PC6A 1FRKA 2HBZB 1UWBA 4FPRA 2HNYB 3OTEA 2W7AA 2VFTA 5IZHA 1LWEA 1FWKA 2LCWA 3IS9A 4YY3F 2MZRA 4O23A 5A0YA 5L1IA 4J90A 2R2TA 3J80Y 5DZ6A 1VISA 1A0OB 2ZZNA 1GEHA 2W1BA 4C4WA 3TI0A 2PFDA 2LXFA 3SQOP 4CT9A 5KOWA 3QPIA 5EGYA 2NREA 1C4CA 4QW9A 3RG6A 5ETSA 4K50A 2KVIA 3ITHA 1KQGB 2FHJA 1WJ9A 2HBRB 2KFNA 2MQNA 2BW7A 3AHPA 3QIPA 3SCKE 5DQHA 3TA2A 2GHWA 2AGOA 4K2JA 4L72B 2XSFA 2A18A 4WCEQ 3TA1A 2R8GA 5GVQA 1CJKB 4ED2A 5DRKA 4CDIA 1UTAA 1VQPS 4KB7A 3EZOA 5EWFA 3GIJA 2XBPA 1Q8LA 4OZ0A 2OAUA 1VQKS 3DOLB 4OLPA 1FRHA 3FZ2A 2H48B 3US5A 4KTQA 4DUYF 1YHQS 3T1HF 2F40A 5ETOA 4J9QA 2IDEA 3OD2A 3QJPA 5I3PA 3SQGA 1LFPA 1UW9A 4HI1A 5ETVA 4LVOP 2JHEA 3IN5A 3G71S 1FK9A 2MGZA 2DCLA 2FLLA 4DQRA 4W4MA 3Q8YA 5HN0A 3A8KA 2L41A 5E7OB 3KK3A 4KAIA 4ZDNA 4DCPB 1ZM2A 1JLCA 4KY3A 4ZVQB 2E29A 3PO4A 1QTNB 1RAAB 3MR7A 1NK7A 2PMZD 3DLLQ 5IQ6A 2JFKA 2B8PA 3LALA 1RAIB 1X4BA 2ZHOA 4QZVB 2MY8A 2I38A 2MQQA 3KLGA 3Q24A 1OJ4A 3QQCD 4CLTA 1LWCA 1WHVA 2FC9A 3MMAA 4OJ3A 1MROB 1SL2A 4DSKA 4EO6A 2IRUA 1TL3B 4C11A 2M8HA 1B7FA 4PG4A 2QMUB 1VS3A 3FMBA 4DSIA 3G9CA 3PV8A 3HT0A 4C0HA 2XY5A 3TARA 4C97A 1EX8A 1FKAF 3A8JA 4NE9C 4RW9B 1EKSA 2ROGA 2E5LJ 3N79A 4UZCA 5KFDA 4WFBQ 3RAXA 4IG3B 2CZ9A 1NSPA 2IIHA 3TP2A 5IXUA 3D66A 1O6XA 1IWGA 3M2VB 2V9KA 2UUTA 4RKUC 4DN9A 1IBLJ 2XZTB 3EDQB 3CCVS 4LRAA 1BQNA 3JS9A 4URSA 5AE1A 4KGKA 4EBEA 4JI1J 1FD2A 5A8RB 1CULB 5IOLA 2B9WA 1FRXA 2KYZA 3JYTA 2U1AA 3IM8A 3N6NA 4M5HA 3AXKA 3M6WA 3FDSA 2XMMA 3I87A 1RBLA 4BCAA 3W9IA 3C19A 4HT7A 2ABYA 4RWXA 3G6XA 4ECUA 3ICLA 2CUYA 2IYGA 2I8EA 5KG6A 3HHLD 1WHYA 4C8NA 4J9RA 4DV1J 2E7VA 2JVRA 1TMMA 1NDKA 4FDFA 5J2NB 3K8WA 3NXZA 2FY8A 4MKAA 4PCQA 1VYAA 4MMOA 4QWBA 4F04B 4AQYJ 2HHUA 1NCLA 2ZE2B 2ROPA 1A9NB 3U1MA 2FTRA 5F8MA 3OL7A 2DHXA 1ZTTA 2UUBJ 4DFKA 3LP0A 5DO2A 2GJIA 4LREA 1WC1A 2HIQA 5L1JA 5LM7E 1HI8A 2AJ0A 1B99A 2PEBA 3QGGA 2EPIA 2H51B 3TANA 2ZITA 1SC1B 3PRDA 3TEGA 3MEDB 1HQEA 1X4GA 3I6PA 2HLTA 3L09A 4I6AA 3FSYA 3U27A 3KHGA 4Q0BB 1X4FA 2H4WB 3M8ZA 5HP1B 2JLEA 2HNZA 3P4UB 2FHOB 2UUAF 1EP4A 3G8SA 4A8MP 5HMYA 2X7IA 3CE8A 3OHBA 3V6DB 3NCPA 2XB2D 3IM9A 2RRBA 4FXWA 1RZMA 5KFEA 4IUFA 2R9LA 1VBXA 2QL7B 5I42A 2DGWA 3VAFA 3QGIA 1UFKA 4FVCA 5K14B 4NLXA 5DLFA 3V4IB 1S72S 3H5XA 2JZ5A 3PDNA 2UP1A 4B3SJ 4DHVA 4F4WA 1HNIB 1TL1A 2E9RX 2OFHX 2K8GA 1T3NA 1DQAA 3H8YA 1PG5B 3CT9A 3R1HA 1VMBA 1FNMA 5DS7A 2H3EB 3D6FB 3JSYA 1K9MT 1QVFR 2MQLA 2EKYA 2GC8A 2IAJA 5ETKA 3H0PA 2RDIA 1NU4A 2E44A 2EI5A 1DQ8A 3VZHA 5DG9A 1RAOA 3N0VA 3RBEA 5L9NA 3DRRB 1HA1A 3FBEA 3HLUA 3NGUA 1JLQA 1C4AA 4KV8A 4A8OA 2WONB 4BC9A 4ELTA 4HACA 1J5EJ 5A8RA 1RTDB 4I68A 2F8HA 2ZOGA 4NLPA 2RE1A 3QT8A 3DDKA 3GV5B 2V2ZA 1DTQA 2DNRA 4PXEA 2Y0SD 4CNZA 4QWCA 4DV5F 4EBDA 2Q3PA 3M2VA 1S7HA 1XEZA 2B5JA 2QA4S 1S10A 1DY3A 2HVEA 4LR7A 2N4CA 1FXLA 1S48A 2M9KA 2VKZG 2C28A 1VHFA 2WVEA 3DLGA 2IC3B 4P2XA 5LL6d 3J81U 2PE8A 3P5BP 2L9NA 4CO4A 2LQ9A 1K8AT 3KLHA 4OYAA 3G4SS 1JXEA 3HZEA 3GFXA 5E5NA 4YHHF 3C16A 3J81j 1JLEB 4DV7F 3CD7A 1KLMA 4QR1A 1S1TB 4DCJB 5FLXU 1FCAA 2FHJD 3MMAB 3NLCA 4ZLLA 5IV3A 5MAOA 1K44A 4LF8J 2AZ1A 4QOTA 1WI8A 2D3ZA 4MFBB 4QIWD 4LFBF 2YNHA 3WHIA 1REGX 3EVWA 5IM0B 3VVUA 4I7FB 2RF2B 2P9CA 1KKHA 2VFRA 1LWXA 4DL5A 1RTJB 1X4EA 1VQ8S 2E9ZA 2F65A 3MECA 2OPRA 5HMWA 4IRKA 3MR2A 1LW2B 3T3FA 1SJFA 5D0HA 3R2CJ 3SDEB 3S8SA 3N4WA 5HQMA 3TYTA 1N5YB 3K8VA 2R8KA 2B9XA 4USVA 4ZK7M 4V19J 4E0DA 1GTEA 3OXFA 3CCES 3FBBA 4JV2A 2AHOB 1EKRA 4N7TA 4PYDA 3OL9A 1ZOTA 4CO0A 4WKRA 4HLBA 4ZCLA 2ZBIA 1S12A 2PI4A 2BABA 5F8GA 4IG0B 4MIWA 1JMTA 8RUCA 5KFBA 1PGZA 1QAJA 4LF5J 1IM6A 3HT3A 2YWGA 3K58A 4OYPA 1B4SA 2QRRA 2ATLA 4DPUA 2ZDPA 4HTJA 2CPXA 1WORA 2Q6CA 2E1PA 3R6LB 4DR5J 3POTB 5DDRC 1IBMJ 4JYAF 1UPMB 2O5DA 3T5JA 4WZQA 4X66J 1K0VA 4OZ3A 5IQQA 3BR8A 2HVIA 1IKVB 2CNLB 2ZJQQ 3EM1A 3CUNA 1UW4A 2ZBQA 1IKWA 3JQKA 1MWZA 2BDPA 4KHRA 2QA2A 4HI2A 4Y2CA 5J2MB 2QA4G 2RU3A 1NEEA 1YWXA 2QLWA 3LTOA 2VOOA 2V4RA 2HNYA 1HWUA 4KQZA 2R8JA 2DNPA 4Z7CA 4IOCQ 1N6QA 2X1GA 3AQOA 3WBZA 1LXNA 1ZM9A 2BANA 2AJ1A 2HGNA 4MK9A 2XS2A 4ZVGA 3SV3A 1U45A 1JKHB 4N8NA 2QMXA 5F0WA 2YX7A 1S1XB 2FB0A 2FHMA 3ISNC 2V68A 5LSOA 4KGVB 1IBMF 2UXBF 1APSA 1RAHB 3DFEA 3MMBA 1VRTA 4NLQA 1U2FA 1WWHA 1JLAB 5A6WA 4USWA 5RUBA 2EXUA 2VUGA 2HMIB 1SI9A 3CCQS 2IBOA 4DL7A 4NMXA 1QAIA 4JI8J 4FXVA 1SC3B 2ASYA 1QM9A 2PMWA 4ZP7A 1XBWA 1WHWA 4WP8A 1S1UB 1YTYA 4KE5A 4X4RA 4UUWA 4K5RA 1XQIA 2XHCA 2X1AA 2JEFA 2J9DA 3KOAA 4WF9Q 3BGRA 3VGUA 2KZZA 3DKDA 1I6JA 1Z4UA 2DT9A 2IY5B 3LUYA 1L5UA 3L7PA 1SH0A 2DVIA 1CS4B 1S99A 2N7YA 4J5OA 1QAYA 2OJ3A 2R7SA 3U1LA 2B4OA 1HWJA 3IRWP 3UDVA 3B4DA 3VVTA 2HFNA 4L73A 5GAHI 4DUYJ 1GMWA 1NHVA 1OMSA 3ZTRA 5C24A 3GE9A 3GP9A 1Y5NB 2V50A 3KFWX 4HVZA 1HBUB 3IP0A 5D78A 4ANEA 5H9FK 1PJ5A 2HURA 1FF2A 1RHMB 4C48A 4ECSA 1TR0A 2CJQA 2L9DA 3UCGA 4IH6A 5GADI 2F7VA 1FWLA 2MY7A 5D3GB 4UF4A 2Z8QA 4UY85 5A8KA 4DPTA 3M6UA 4PZVA 1T8EA 1OY8A 4Y2IA 1VRUA 2DNOA 3FSIA 2RS2A 2W2NP 1IR0A 2COLA 4K4XA 2FDNA 1TUGB 3T1YF 1N48A 3TNVA 3HKWA 1AROP 3J7ZT 1OIAA 1FO1A 1WG5A 2BM1A 5K8MA 4OYIA 2XZDB 3GYXB 3OR1B 5D3GA 4CNYA 3CJKB 2ZVIA 4RW4A 3W2WA 1RCXB 1HBNB 2GAGC 2OUGA 1QE1A 2MKJA 5DZ7A 5LXRA 5IS2A 2EKNA 3GV8B 1B0VA 4LR8A 2UVVA 2OIHA 4O4RA 2HEKA 3M8PB 1RAGB 5KFGA 4JOUA 3NNHA 4JV5F 1H2VZ 2M7SA 4X84A 2BE2A 2DRAA 3KLVA 4NX9A 5EWEA 1SJ3P 2AF6A 5C42A 3ET6A 9RUBA 3SYZA 5M2RA 4F7VA 3MAQA 3MXHP 2HS4A 2LEAA 1WDTA 1RQ0A 1Y9OA 2OD6A 3HF5A 3TUZC 4I69A 2A2DA 3ILJA 4OZ5A 4DMZA 1VK3A 2XLJA 5C25A 2VJUA 2FLNA 1L3KA 3NNCA 1FXRA 5E3RA 2QTWA 1JLBB 1WHXA 1F2HA 1RUSA 1WC4A 1YJWS 5GADU 1QSLA 1RTHA 5B0BA 5EWGA 2JH3A 1R89A 1XK8A 2OHDA 1MSWD 2XI2A 4DZ6A 1KDNA 2HWHA 1ZA1B 3MD1A 4DQSA 1S1XA 7AT1B 4AQYF 3ZFVA 5KFYA 4HH1A 3HJFA 3BO2A 2AQ4A 1TK5A 4DF4A 1X5SA 2BE2B 2MKSA 2CFXA 2BMBA 4IO1A 4DUZF 3EGNA 4P75A 1S9EA 4LF6F 4FPIA 1XNRJ 5HI7A 2KRRA 3UN2A 2AEJA 3UVJB 2XMJA 1U0SA 2F8EX 4DBQA 4F4ZA 3UD3P 1ZAVA 2HZAA 3CJKA 4M8LA 3OR1A 4DL4A 4JI6J 3R5DA 2HAFA 2D7SA 2NS1B 4B9SA 4O3NA 3KJFB 3C6TB 2A10A 2MTLA 4TY8B 4DU7A 2KVQE 2AEFA 4ALZA 1VLYA 2MZJA 1VJWA 3PG9A 4QR0A 3WDOA 4BHQA 1RTIB 1UFLA 1VC0A 1FJCA 3NKYA 2C3UA 3DRXA 1Q5YA 4EI2A 4V19X 1AZSB 5A8KB 2V4JA 5IT0A 3NGTA 5K9FA 1R8HA 4H54A 2VOPA 1T0TV 1KN6A 4IH5A 2EWHA 4OZLA 4ANCA 2MZSA 2KXHA 3UO0A 2VG5B 1TMJA 3VV2B 3HDSA 5IFMA 3MPDA 2N7CA 2UXDF 2QLBB 4EO8A 3FC9A 1G4CA 5C24B 4LSNA 4QWAA 5J2QB 3V81B 1DTTB 1I1GA 4JI6F 4CT8A 2KN4A 3Q22A 2FUG9 1SPBP 2VPZB 4OV6A 1F0XA 5G0RB 1G3OA 3TAQA 2GQQA 1Q53A 2QA1A 5KFNA 4LF9F 4CLSA 3MECB 2W9BA 1RTJA 3IGNA 1SQGA 2W8LA 1WEXA 1FFWB 4CTAB 1NDPA 4LBPA 3LPYA 1G2EA 1FX4A 1PYSB 1XWLA 2RJZA 3BDEA 3DOMA 1HMVA 4L75A 1MWYA 1O51A 3LGHA 3O2IA 1U1LA 3D1QA 5I3UA 3GJSB 1RA6A 2EC2A 3FBCA 3TJ8A 3ZTPA 3RBDA 1RYRA 2D69A 5KFCA 1HNVB 3IMQJ 2IVFB 1G6BA 3NS6A 3M32B 3CW2C 5LSLA 2G0JA 1NNDA 2ZVSA 8ATCB 4JB8B 3MFIA 5J1PA 4HR2A 3C16B 4FYYB 1TVRB 4HDHA 5ETQA 4G1QA 1MG7A 2SXLA 3AJDA 3T1HJ 2DH7A 1CJUA 4QJVA 4TN2A 4NRTA 2ACYA 3ZTSA 3KLIA 1Y0HA 2B7BB 3PEJA 5B0AA 4A8WA 4TU7A 3Q8SB 1R8CA 1WUUA 4ED4A 2Y1JA 5KFTA 3IWNC 5ETMA 2J9CA 1HPZA 3EX7B 2OPPA 4OYBA 4OX6A 3SIPB 2UVRA 1NAQA 3PYDA 2VBWA 4KKOB 4DV2F 1Q7YT 4F0KA 5MLCV 5KG7A 1GMUA 1WC0A 4KPCA 1AT1B 1ZPWX 4HTIA 5J2MA 3MCSA 4C8LA 1G7CB 2NQPA 2NLWA 1U1NA 2MEWA 4NLUA 2JDJA 4QQBA 4DV4J 3C2PA 2D3OR 4WFXA 3GONA 4TYBA 2J0QD 4HHHA 1BY9A 1NZ8A 4Y2MA 2UV8G 1OPIA 3X1LB 5DG8A 2JRSA 1KEKA 2CJYB 4DOZA 1U1OA 2YNGA 1S0MA 2LU2A 1JK9B 3I9ZA 3PACA 2XNRA 3D68A 2ZFHA 2F4VJ 2P6TA 4OJGA 1ULRA 4B3OA 4F02A 2WB1D 4ZOSA 3DCAA 3MM7A 4JI2J 1QUPA 1XMBA 1VDHA 4AT1B 4LIRA 5KFPA 2P8IA 1NH8A 2V69A 2IVMA 2YWHA 5KG2A 3E8OA 2ASDA 3R5AA 2XM3A 3FRYA 1BHNA 1IR1A 4PEOA 3AOAA 4DL2A 4Y2KA 4UW2A 4Z7YA 4WWSA 5T14A 2C2MB 4DV4F 2DY1A 4QIGA 1KQFB 1KOHA 1RU2A 2VICA 3CD6S 3QT6A 4RO0A 1BLUA 1LW2A 1SVDA 1WTFA 2HQDA 2BUNA 2GVDA 2KJVA 2XSJA 1N54B 1FE0A 2VBYA 2YKMA 2DBBA 4GRSA 1HQEB 2KG1A 4OHVA 3M2UA 1S6PA 4USTA 3DM2B 3D9BA 4DS5A 3D2WA 4I7FA 2MLXA 4RUCA 4BBYA 3W60A 2ZH5A 4NXMJ 2XY7A 2QN6B 2M70A 4CM2A 3EJMA 1N32J 3PNIA 5LJ5Y 5ETNA 5CCMA 4RNOA 2QGFB 2YNFB 4PWDA 1RT6B 1N33F 4USHA 3CCMS 3D4JA 3WX4A 1S1TA 1VFJA 2CQBA 2GGPA 5EUHA 3W8PA 2IJNA 4LF1A 1UVMA 3DDIA 2ATCB 2F5GA 3CXCR 2RRAA 4RU9A 4EU0A 2IC3A 3MAHA 2LQ8A 3ZZOA 4P9SA 1PYTA 3CPWR 3ETOA 3UN3A 3QZ8A 3H4DA 1HD0A 2DK2A 4JI1F 2MLZA 4F8RA 1S1VB 1HBMB 1PJ7A 1T02A 2C1EB 3OTBA 4JI7J 1DLOB 2D1CA 1WOPA 4RPFA 1QJHA 1RHKB 4B9NA 1TAUA 4QIFA 4E98A 4Y34A 5L46A 2Z30B 1FRLA 2V5HG 2AJ4A 3MDFA 1RTDA 2BKNA 2WB4A 1R0BG 2QLJB 3AY0A 3T6JA 1BXNA 2HRTA 2PO4A 3EMTA 2VONA 2XWXA 2AJFE 3KDNA 4X64J 4UY8T 5HVFA 4F0MA 2AYMA 5F41A 1PSDA 1S6OA 1LQ9A 5KAKA 2QE5A 3M1VB 2J0SD 1TFWA 4CZCA 1UVNA 1CSJA 2HBYB 3NCQA 2CQ4A 1WTBA 2YX4A 4I56A 3R7SB 3NOGA 1N5TA 3AXMA 3I4PA 2XQCA 1IJFB 4LFAJ 4JI0J 3BDPA 1N88A 1SQFA 3FEXB 2FY1A 3L3CA 4MKBA 3ZZTA 1TL3A 1NPPA 3DRPB 3IAM9 4XDDA 2GGPB 2DGXA 3FUYA 3ILLA 3G82B 3JTPA 2HK2A 4Z37A 3AA8A 1F5BA 1HBMA 1S1VA 1YDLA 3KWMA 2HHSA 2IYIA 2IMWP 3KLGB 2Z58B 1F5AA 1Q4RA 4NLRA 4PG8A 4AUKA 3EVOA 2VZ9A 2UV8A 4YEAA 2IA6A 1I51B 1OYDA 4CP5A 3TQEA 1YSJA 5IV4A 1SKRA 4ED7A 3W3SA 3IC1A 2JX2A 4Q0BA 2VHGA 3WIUA 2Z2YB 4A48A 3NP5A 4USUA 5B0EA 5K8OA 3VAHA 3PRBA 4DF8A 4YN3B 2CA9A 3I4HX 4Y2AA 5C2CA 4H4KC 2MGZB 1FK9B 3B54A 3G96A 2ALYB 1WNEA 3S7RA 1TQLA 2YQ1A 5H9FJ 1RT6A 1S57A 1T95A 1GXTA 2MYFA 4LBHA 1CC8A 4N56A 2AX1A 1YJNS 4CQ1A 1REVB 3Q8UA 3KK1B 4U7UD 4ZA1A 2BACA 2CG8A 1WG1A 2BOAA 3GJQB 3MR6A 4LF8F 1UVLA 4TU8A 3TAMB 3DM2A 4RUBA 4IQXA 3MCNA 2DR9A 4ECVA 3LWMA 2OI2A 4LFBJ 2IRYA 2X51A 3DLEA 3ISZA 4NYZA 4M1KA 2MKYA 2R2SA 1TUWA 3DLJA 3JAMY 3KJNB 2DJWA 1GNKA 4PPDA 5DQIA 2ERRA 4K4UA 3TRGA 2GX8A 3AOBA 1A6LA 1NRKA 3LA0A 4HYKA 2KJWA 3NMRA 1HW9A 4IDKB 1RCOB 4KIAA 9ATCB 2VPXB 1Y7PA 1JNZB 1YIJS 4IRCA 2GW8A 2V8PA 3DLKA 1OO0B 3CJ4A 3HVTB 4Y6IA 1KWMA 1BQNB 2Q1LA 2IPOB 1DARA 5HMXA 1KOOA 1GK8A 4OFZA 4QPTA 3W8GA 3M9MB 2Y1IA 3RB4A 2HW3A 2M8DB 2JEIA 3H5SA 3PX6A 2C2RA 3TX8A 4F2SA 4IG3A 1KC8T 4BDPA 4ID8A 3I0SB 1S59A 1N0VC 3CDEA 5D6GA 1IBKJ 1NH7A 4NCGA 4J9LA 1SJQA 2FVCA 3FKBA 3F44A 3PX0A 3G8TA 3M9OB 1E6VA 3V4MA 3D1HA 1E6YA 3RR8A 3OXGA 1BWEA 4RBUA 2I5JB 3H2LA 4U67Q 2ZH7A 1JX4A 1YBTA 2VL1A 1JLFA 3SFUA 1ROFA 3R8YA 3M32A 4S0MA 3CDBA 3UDLA 1S4EA 1HNVA 3GG1A 1RWPB 1HPZB 4F4KA 3X3UA 2KTQA 3FFIA 3W64A 1JNRB 3U02A 5C7PA 2LQBA 3E01B 4KSEB 1UPPA 2Q6BA 2RAQA 3AA9A 3CVKA 1U09A 3DOMB 4NLDA 3PJ9A 4KGXB 1B70B 3M8SA 4P2SA 2PT0A 3KK3B 4I6WA 3M7VA 4ETXA 2G9OA 2KT5A 1K1SA 2RVJA 3UPFA 3RUBL 3A13A 3IRXA 2VFUA 3CDWA 2AYEA 2FVPA 2CJBA 3VQSA 5KFJA 1VOMA 2F8MA 4AE5A 2H65B 3GCWP 1Q95G 1CJTB 5EX3A 3J7A1 5A8WA 3ZXWA 2J9DE 5ETPA 4PG6A 5DDQC 2J9EA 2XS5A 3CJTA 4JI8F 5B08A 1FNXH 3UD4P 2ZZMA 3OTDA 4FZVA 3TJAA 2LECA 4YB6A 2OEJA 2CNOB 4O44B 1UAWA 2V8HA 1D8ZA 2B4PA 5G0RA 2Z0GA 3DN9A 1S77D 3VGSA 1RTIA 4A8SA 3PEHA 3MOZA 2R7WA 4NXMF 4G3IA 2LMIA 2MXYA 2B9YA 3K59A 5KFWA 2CQIA 3MEGB 3HSDA 2XMVA 3MCMA 1FTRA 2LQJA 2HSEB 3L7OA 2A6MA 3RGIA 3BGFA 2RDJA 1D9DA 4B9LA 2CJXB 2H4YB 1YG0A 1YJ7A 1M5HA 2HGLA 3DU5A 3MZIA 4MJKA 2M5YA 2V2VA 2GQCA 3KK2A 5JJBA 4DQPA 1D9AA 3CCWA 1UWBB 2B51A 1QLNA 4CLPA 3BZQA 2CJAA 3W2VA 4DSLA 4K4YA 2NUUG 4MH8A 3ZC4A 2GIQA 4OX9J 5KFQA 3KLFB 3W65A 2YY3A 4ZHRB 4UZBA 1Q82T 3HHLA 3W62A 1VBZA 2BVZA 4KO0A 4NLGA 3B78A 1AFIA 4BWMA 4XDCA 4PYAA 2R8IA 4DR1F 1WKJA 4A8YA 2ZM6J 2H5EA 2FLOA 3OPKA 2E1CA 4I67A 4OMFG 4G6VB 1HFEL 2Q43A 1JLBA 3GZ7A 3HSGA 1FTCA 1N52B 2DIVA 3IA0A 2V63A 3UE2A 4ZCIA 5C25B 2UU9J 2RUGA 1C1BB 2G1HA 3H98A 3SCJE 5IWAF 1NJXA 2MB0B 1RT2B 4WE1B 1P9YA 3BSCA 2DNKA 3WZ0A 2W9AA 3GMGA 4JI5F 4JI2F 4K0KF 4ZVPB 1NJWA 1RA7A 3UCZP 4DZDA 4DV3F 1OY6A 4N77A 4MK7A 3C14B 4ZMMA 1WC3A 5HVHA 3J80U 3DHXA 1KQSR 3GYGA 1Q8BA 1AFJA 5FD1A 3PCOB 5CYJA 5JMNA 4USJC 4F26A 2YWEA 4CYUB 2PGCA 5HLFA 2QL9B 4RNHA 2JLGA 3VQTA 1X0PA 3GPAA 5KFVA 2GHPA 3TZZA 1VIOA 2PFFB 4ZKAA 3TW0A 4PQUB 3ZZ0A 1Z1ZA 5AXMA 4NWBA 2HHPA 3B4MA 1T9VA 2X1BA 1B64A 2RU9A 4XAKA 1K0TA 3V5RA 2XMAA 1GMVA 1ACMB 3DYAB 2E5HA 4P73A 5CA5A 4UT4A 4RBVA 4X65F 2UUAJ 3NWGA 1NBEB 2VFVA 3D0HE 3H2VE 5CYQB 3TZWA 5K5MA 3UWTA 4FS2A 3T1AA 3RB6A 2QZ8A 3VAGA 2J8SA 2VODA 4PWUA 3QWUA 1NSQA 1Q0NA 2MHEA 3MAAA 3S01A 4K59A 4ID5B 4Y3CA 4MT1A 1P6TA 2LDIA 4B3SF 3ILIA 4DPWA 4DSJA 1NXIA 1RT4A 4PUOB 3CCTA 2BZ2A 1IN0A 3QLHB 1AA1B 2CWXA 4DL0C 1NSAA 2XCAA 1M90T 1IKYB 3EICA 4LSLB 2KXNB 2IDLA 3OXLA 4UOGA 2YPZA 2AGPA 4ZJLA 2LEPA 4ILLA 4RU2A 5SZTA 2ASLA 1AYEA 2NCKL 1Q7LB 1VRUB 2CQPA 5BJRA 1TKXB 4ZJQA 5GMDA 2ADBA 2APOA 1NK9A 3WC2A 2VBZA 1RWXB 3CMAS 1FHTA 2E7WA 3QBCA 3I9V9 3PW5A 2FC8A 4A8XA 4USMA 3IWLA 2CQ0A 1V9OA 3H42A 1ZAXA 3OFHA 3PJWA 1S9FA 4F2RA 1S1UA 4NI2B 5A8WB 4ECZA 4EMDA 1VR6A 4CYUA 2QG9B 3ISND 2ZC3A 3QT7A 1M1KT 2DCUB 3M4XA 2P9EA 2RKIB 2ZUAA 5ETLA 4O0NA 2NZCA 3GSDA 3ULHA 3ZZPA 1KRPA 2VB6A 3D5MA 5I4MA 3MF5A 2BR0A 3HMJG 2OSRA 1FKPB 2FJEB 4JI0F 5CZXA 4LJMA 4DQQA 4WIIA 3BGRB 4LF6J 1OYEA 1HWKA 2XYGB 3O5TB 5IT9Y 2GS8A 2W2QP 2HHHJ 3E01A 3R7BB 2EFOA 4UOCA 1H7XA 4CO5A 2MSSA 1S0VA 5KTQA 1O0PA 1TKZA 2CPYA 2O66A 3VHQA 3RB3A 2Q79A 4X66F 4YR2A 3CJQA 4DXLA 1GAOA 3KJVB 4TQSA 2HNDB 4NYOA 1E6VB 1KVIA 4KO0B 3ZTQA 4ERDA 3H2UB 2I1RA 1NDLA 1UJ6A 4OHXA 3OTOF 2R2UA 1IKWB 4ZHRA 4ER8A 3AJ2A 4B9TA 4JI4F 2DNLA 4TQRA 2RHSB 2LA6A 1I5OB 3I0SA 4L6V3 1F9HA 4CH0S 5KT5A 5J1EB 1U1MA 2J6UA 1U0HB 1B3TA 2CPFA 3DNCA 1SJ1A 1QVGR 2L3MA 2YTCA 1YI2S 2HFUA 2Y1LB 2W9CA 4DSFA 2WW4A 4DV1F 1JJHA 2V94A 1CQNA 2CYYA 2CZ4A 1XR7A 1DQ9A 5BXIA 4I2PB 5IC6B 3RRGA 2XTJP 4ECYA 1HYSB 3NY0A 4FVMA 1HWIA 1IKVA 1MN9A 5F8LA 4JP8A 3BO4A 1YLXA 1W2IA 2CPJA 2GJ2A 2LXUA 4IDKA 2CKWA 5ADZA 4X62J 1K73T 1M5PC 2DPJA 2RUSA 3SSRA 1H2TZ 1U6ZA 5KFLA 4A8FA 4JI4J 1RWUA 3CDAA 3RRKA 1VQLS 4IFVB 4DR4J 4B08A 2XLKA 2HVZA 1DJ0A 2DNZA 2QLFB 1J5OA 6FDRA 3HI9A 3KG4A 1LW0A 5D4PA 2Y8WA 3D3CJ 4IG0A 2DXFA 5F0UA 2BE9B 3GFHA 1IQTA
chains in the Genus database with same CATH topology
2XG8A 5SUHA 3UR0A 2B0GA 3EGWB 4NLSA 4PPZA 5E33A 4RW8B 4XK8C 4URGA 1TKTB 2OFGX 2NXUA 2BJDA 4E8UA 5CD4H 3PVXA 3K5PA 1NK0A 3SDEA 2M88A 4IO9Q 4DS4A 2P6SA 1KHVA 1LK7A 4NMLA 1DAXA 4NA1A 2DITA 4W92B 1U4BA 2JEJA 3R5CA 1S49A 2CQ3A 2RF2A 4Q8FA 1S0OA 2KDOA 1NHUA 3OUYB 4WU3A 1YJTA 3DRSB 3GFZA 4PG7A 4DEZA 5EX0A 2XGQA 4MFBA 2GHVC 1XERA 1TKDA 2IVYA 1R0AA 1YRXA 4CH7A 2PMHA 4D3GA 1AUDA 3NG8A 5EN1A 3ENQA 2OO4A 2FJVA 3TUIC 4RZRA 2DR8A 1UJ5A 5CXTA 1VK8A 1TL4A 4B3MF 3HHDA 2BJEA 2DIUA 5L39A 2CQCA 3W7BA 2EW9A 4OX7A 4QR2A 1VQ9S 1HBOA 2JFDA 2GNKA 1H7WA 3EZ5A 4M5DA 4ZLPA 2K1RB 4K4WA 3UDCA 3IR6B 1TK8A 1KHWA 2RILA 4ZPAA 2ILZA 4ZPWR 3EYZA 3I5AA 4B3TF 1TK0A 2VPWB 1SL0A 1TL1B 2ZH1A 3PXGa 5M2PA 2ILYA 4ICLB 4FF1A 1JLQB 3O3LA 2HHXA 2XMWA 4Y28C 2CPZA 4LF7F 2ALZA 1R8PA 5L38A 5KG3A 2GMHA 4HHJA 4R8UA 2IAJB 3C6UB 1FEHA 3OLBA 2ZH4A 4CCHA 2PA8D 3S6EA 2WBMA 4XPEA 2BBEA 1J5EF 1DZ5A 4NLWA 3BF4A 5HP1A 1NJYA 2DRBA 2R7QA 5E0OA 1HNIA 3MEDA 3I82A 4KRWA 5LMUF 3P49B 3THPA 1LWFB 2Y1RI 3SCLE 1AXQA 2YKOA 5I42B 2PEHA 1REVA 3JTOA 3KK1A 1ZYQA 2BM0A 2CPHA 3SMZA 5T41A 1ZBTA 2QLXA 1Z2ZA 2B4UA 2DR5A 1XMOF 4OHYA 2AP6A 2VASA 3HK2A 2ZNZA 4C7QA 3K2YA 1QSYA 3Q8QB 1N56A 4M63A 4OZ1A 5DM6Q 2YKMB 2RQKA 2XSJB 3EZUA 1U48A 4OI0A 2NPFA 2XULA 1YBAA 5HL7Q 4RUAA 2V8DA 4R8UB 1X0FA 1X4CA 3HX9A 3CJ3A 2W8KA 3DHWC 2IFXA 3DRPA 4YDXA 1Q81T 3T9NA 2R7TA 2MJUA 1DBDA 5U47A 5F8NA 2DGSA 4TY9A 4ICLA 3RW6A 4B3OB 2IM1A 4EUVA 4U7CA 1VQOS 1ZM4A 4IH7A 1RT5A 1FXDA 1A7GE 2K1RA 4ED1A 2DO0A 2YKNB 4ECTA 2BOPA 1HBOB 4A4JA 3PZPA 3ZZZA 1OQ3A 1KS2A 2NSCA 4HL9A 3A1YG 2JLFA 2VC0A 4YB7A 2DHAA 3MMJA 3J7Z5 1FT8A 2DGVA 1SC6A 4IOBA 4ATNA 1BGXT 1XN9A 2WW8A 5KG1A 3UW1A 2L9WA 2XI3A 3OV7A 5JUMA 5HROA 1MROA 2RQMA 3JB9k 2KRBA 1SBRA 1MW7A 2YWKA 2YVSA 3CF5Q 3GILA 3R27A 1FVQA 1Q8IA 4ZPDA 1S0NA 4YDDB 3QO9B 1BQMA 5LJ3Y 2YKAA 3O44A 2DNQA 1JLCB 1N34F 2C42A 3T19A 3CULA 5D77A 2VA3A 1TVRA 3NGKA 4OJHA 2JEGA 2N4DA 3LF0A 5EHHA 3QZ7A 4OJ1A 4AXIA 4Q43A 2E5LF 2WSCC 1IBKF 5KFMA 4WJBA 5I3UB 3PFEA 3HVAA 4ECXA 3KKFA 4EYIB 2FVSA 4C3MA 3M2UB 3N5FA 2W9BB 2YH1A 3GV7B 3ZZYA 1NB7A 4C3LA 3B8HA 3LOUA 1SKWA 2WRMA 2DISA 4EZ9A 3CCJS 2DGUA 5KG4A 1HD1A 2W24A 4TU9A 4LSNB 4O4GA 4R5PB 4ZS6A 1SXLA 2EBGA 4HDGA 1D9FA 5LMNF 7FDRA 3OVSA 4FF4A 2IM2A 5D4OA 3G6VA 2MQMA 1NK6A 2OPQA 2BRLA 1HYSA 3LGNA 4X4SA 2HVHA 2R7OA 1KTVA 5E3QA 2XLIA 2VQFF 2QSWA 1VQYA 1S1WA 2DR7A 3OQ2A 3HP6A 1NKCA 4NXNF 3QIPB 2E5IA 5DM7Q 1R31A 4FF3A 2OTJS 1RT7A 2J76E 3ITHB 1P9QC 1U6FA 1BD6A 3C6TA 4I0WA 5CH7B 3C46A 6FD1A 5H1SV 3J7YI 3BGUA 4HEA9 4MIAA 1S76D 1X4DA 3PW4A 1XC9A 2DHGA 1IM4A 3P96A 2HNDA 2K2PA 1QAXA 1LWEB 4EGLA 4ED6A 2HHWA 1NZAA 4RNFA 1DRZA 4TLRA 1TKZB 3M9NB 2OPPB 2DNGA 2M3DA 1PILA 1VC6A 4AL7A 4XO0A 2ASJA 2V8VA 3QYYA 1X5TA 3MM9B 4R0JA 4EYHB 3K7RA 2ZOFA 5CQGA 1N36F 2Q66A 1RT1B 2KHDA 2J7WA 5K8PA 2IRXA 2VFSA 2LXIA 4KFBA 4N41A 3SEOA 3CSKA 1HI1A 4OZNA 1S97A 3IO1A 3RB0A 3DMJB 4OQJA 2OMLA 2DNNA 4TLQA 4WYWA 3HPOA 4C8YA 4J37A 2YNIB 3F73A 1HMVB 3P5TL 3U7JA 3SV4A 2HHTA 2A3JA 3M2RA 2BYCA 3O8WA 4WFYA 4ZCKA 1U47A 2KZMA 2ZD1A 2KT2A 1ELOA 5AE2A 1TKXA 4RLEA 1N32F 1P1LA 3VTIA 4QPXA 2V4QA 4N47A 1DTTA 5J2PA 2P5VA 5J2QA 4LVNP 3V81A 4O0IA 1JB0C 3CO9A 1JWWA 4RWWA 1KLNA 4F3OA 2CQDA 2F9JA 1VIXA 1XMQF 1KONA 2XHWA 1N0UA 4RW4B 3W2WB 3TVKA 3JSMB 2R4FA 2D9OA 3OJUA 1M0SA 3Q2SC 4ED0A 1S77D 3OHAA 1XNQF 3LP1B 3LP2B 4J9SA 1MMLA 3BSNA 3T5HA 3MUTP 3VZIA 5KFUA 3HM9A 2J7KA 1X4HA 2MSTA 1U24A 1URNA 2KHCA 3NAHA 1IKXB 2IM0A 4TY8A 3OL8A 2FJAB 1U8SA 4ZP6A 3BQ1A 4I2QA 2CRLA 4MAKA 3OVAA 3FQLA 2CZVC 4F3QA 3RR7A 3THTA 1NKEA 1HNZF 3CC2S 3MPWA 2R2RA 2KI2A 2KU7A 3M6VA 4QW8A 1MU2B 2B56A 2EFPA 4X4TA 1S1WB 5AE3A 4YFUA 3IG1B 3PW2A 3E2EA 3U1NA 1D1UA 5BYRA 5CCLA 4P7TA 2OPQB 4AL5A 5KT7A 2CIMA 1M5KC 1YVFA 3BO3A 1T03B 1C1CB 4O4GB 4OHWA 1PC4A 2ZH9A 1AFIA 1C1BA 4MIBA 1FE4A 5B09A 1YHQS 1FESA 2RSQA 4PXCA 5F8HA 1LOUA 3MM8A 4U6PA 2GA7A 4ES1A 2A1BA 3C3LA 3VR1A 1SIZA 2FPHX 3KLEA 3E3XA 1W2BR 4GKKF 4UUXA 1V3SA 2KFYA 3MMBB 2ZH3A 1TV6A 5AXLA 3K5LA 4OI1A 2V0NA 1HW8A 4IOAQ 5F8JA 3ZZUA 1JKHA 2UVWA 2XCPA 3KLFA 1T94A 4H4MA 1R43A 1RI7A 1YGYA 3HHKA 2BANB 2A2CA 2JJ4D 3M8PA 1LXJA 1SV5B 2WSEC 1VQNS 2X1FA 1BQMB 3QO9A 4I1TA 3ENVA 3KK2B 1F9FA 1TUVA 1HWLA 2J0XA 1M5SA 2KT3A 4YR3A 4PKDB 4R0EA 5M2UA 3EPIA 2VG6A 3PKMA 2MPUA 3LO3A 3M8RA 2B43A 2G0CA 3MEGA 2ZHAA 1UL3A 1DURA 3OJSA 4ZCMA 3RAMA 2AYGA 3BN4A 1N5QA 2ZHBA 5FLXY 1Q1KA 1U1PA 3LW5C 4Z2XA 5HO4A 2D3UA 4C3KA 5E3CA 2LVWA 1U49A 4JV1A 5KFSA 1F5CA 2N82B 2MHNA 5EDWA 2HZCA 1RT3A 4A8QA 1CLFA 2ZDOA 4OL8A 1RP5A 1S79A 1HBUA 1WF1A 1WF2A 4DN0A 1MMDA 2C3PA 3GYNA 2VG7A 3DXSX 1O5JA 5DJBA 2JC0A 2X3GA 2LLZA 3RYLA 1TFYA 3G8QA 3KYLA 2HFZA 3MFHA 1RKIA 1X9MA 1N5YA 1ZH5A 2XY6A 2B4VA 2OKQA 3B82A 4WXWA 4ZPCA 5GMKa 1V3ZA 4NA3A 1H38A 3P3DA 3QAUA 1PC5A 3PFOA 4TXSA 3P6YC 3PKYA 2KKHA 2E7XA 4DR4F 3NBPB 4LT6A 4FXDA 2J7UA 2YKPA 1GT8A 1KR4A 2HS0A 3QJJA 1S4FA 4U7UK 1P8GA 2FD2A 2RS8A 4NLYA 1SJRA 1JLFB 4HT5A 5E2QA 5KT6A 4C8KA 4K5SA 1KLMB 1UFWA 2W4PA 2YH0A 3UI3A 2QIFA 3V6HA 2YWFA 4K2XA 3N28A 4YOEA 2M52A 2F9DA 2HRUA 4DR6F 3R3TA 3TQ1A 1X7VA 1ZAWA 3MM6A 1WACA 2AV5A 1FD8A 3CD0A 2Z4PA 3TAPA 1VGYA 1KVJA 2M2BA 4QIEA 5C5JA 1N6QB 4DQIA 4W90B 1CC7A 2WOMA 1SH2A 4LQ9A 2J5AA 3T5LA 4DX8H 2QFJA 1DTQB 3DI6A 2DGOA 1UETA 1XR5A 4DSEA 3C6UA 5KFOA 3CJ2A 4GMKA 5HBMB 1VQ7S 4AYBD 3FGVA 2GO8A 3HXMA 1N4LA 3DRRA 4KV8B 3GFYA 5AXKA 2ZM6F 3CCZA 4RUHA 5DLGA 4B3RF 2VBXA 3OFEA 4RW6B 3OR2B 2OTLS 2GMLA 3M8QA 2OPSB 4LUBA 2K7KA 2GQ2A 4LF4F 2P9GA 3DI6B 2UU9F 4KGMA 3PW7A 4MKYA 2JOQA 1FDNA 4M5DB 3VAMA 3H40A 3VAKA 3TOQA 2POKA 4X64F 2EK1A 3TAMA 3GR0A 5FDLB 2JL9A 2QSFA 5K14A 3V4IA 2C3YA 5T7LB 2ZJPQ 1SKSA 5KFKA 2LEBA 2ZNYA 1R7IA 2ZUGA 1JLGA 4DR3F 1R8BA 3VWSA 2PA3A 3SI8A 2OH2A 3HVWA 2BQUA 1NKBA 3MOJB 3MTJA 2OPRB 3NMAA 3LQVA 4N8OA 1R0AB 2MQPA 1QSSA 2OSQA 3KNGA 5H9EJ 2OP5A 1OS5A 5GAGU 4M94A 3NBPA 2FJDB 2YX1A 1RKJA 2LKZA 2EVZA 2XNQA 3LP0B 2WK4A 4QYZJ 4X4UA 2BQ3A 3R5BA 1JLEA 1TL5A 2EFNA 2XZWA 3F56A 2F1FA 1HL6A 3FQKA 4A47A 1QUVA 3RRHA 4LFCF 1TKTA 1JLGB 2CPEA 2OD4A 2VG7B 2GIRA 2HG4A 3MTKA 1CG2A 2KH9A 2DO4A 2R7VA 5T7LA 3DLGB 1KFDA 5FDLA 5HMZA 3IFEA 3CCLS 4WXOA 3BJYA 1KNZA 1LW0B 5F9LA 4Q8EA 3FVYA 1X4AA 3N5BA 4HH0A 3RZAA 5A6PA 1GX5A 5L1KA 1FNOA 2HWIA 2OPSA 2XMKA 4DFJA 1N5SA 1P27B 2DGQA 5HQ8A 4DL6A 2MKIA 4YB1P 2MZTA 4ZPTR 4CO2A 5B7WA 2QT7A 2C2EA 4A8KA 2JWNA 1K1QA 2PIIA 4I2PA 1B0TA 5KT3A 1Q16B 4Q45A 3SFGA 1IJEB 3VF0B 3DGPA 2O01C 2XMUA 5D4LA 2W9CB 2OLWA 2RQ4A 3K5MA 3CC4S 3MEEA 3THVA 4C11B 4OX8A 1CEZA 2W4CA 2GO9A 2OMOA 4EZ6A 2HYIB 5KFZA 3NCRA 1Q78A 2VKRA 1UA1A 4RW7A 4J9MA 3G86A 5BYQA 4KHMA 4YB5A 4GC6A 2C2DA 3M6XA 3DLBA 1EP4B 1TV6B 1OPZA 1X5PA 2HNZB 3PM9A 4ED3A 2VQEF 2ZOMA 1FRMA 3AB2B 4WK1A 1H0HB 4C98A 2K7JA 2D74B 2I9SA 4KPYA 4FP9A 2LDYA 5JVHQ 4B9MA 2J6SA 4HKQA 3D0IE 3OTCA 5LXYA 3C66A 1M5OC 1C1CA 2DNHA 1U25A 2MKKA 2GCFA 2WAQD 1IXKA 2RKIA 4X4VA 2DH9A 3CWJA 1P1TA 1N8RT 1AW0A 4LMZA 3GIIA 2G13A 4A46A 2C3OA 2AU0A 2YNGB 1NK8A 2HQ3A 4PG5A 3NRBA 2RNEA 2B3TB 3DU6A 5DDOC 2GMJA 3H20A 1YJVA 3OFGA 5KFRA 1FVSA 4EFAC 2G1DA 3BREA 5A2QY 2ZH2A 4DSIA 4ED5A 4X4QA