3KG1A

Crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
ADEVTFVNRFTVHGAPAEFESVFARTAAFFARQPGFVRHTLLRERDKDNSYVAIAVWTDHDAFRRALAQPGFLPHATALRALSTSEHGLFTARQTLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism
pubmed doi rcsb
source organism Streptomyces nogalater
molecule tags Oxidoreductase
molecule keywords SnoaB
total genus 26
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature ec 1.13.12.22: Deoxynogalonate monooxygenase.
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kg1A00
2OD6A 2QLWA 1N5TA 4FNIA 2FHMA 4F67A 5F0WA 2ROEA 2RSQA 4YEAA 4DPOA 1GXTA 2RU9A 2JDJA 2ZDOA 3GZ7A 3LGMA 2GGPB 2AP6A 1X7VA 2OFGX 4OJHA 2IYIA 4HI1A 4Y2IA 1SQEA 3BM7A 2XMMA 2K1RA 5B0GA 1CPZA 4Q2LA 5B09A 2N4CA 5B0DA 4A48A 1LQ9A 4HH1A 1Y0HA 2XMKA 3DCAA 2KKHA 2AJ1A 2BBEA 1KVIA 2GCFA 1TUVA 1X8DA 2LQ9A 4YDXA 1MWZA 1Q8BA 4HL9A 1P6TA 3LGNA 5IXUA 1AFJA 4HI2A 2VV5A 1OQ6A 3MZIA 5B0EA 2BJEA 4OIXA 1APSA 1CC8A 2PD1A 1N5QA 2GO8A 2ROGA 2W4DA 3KNGA 3TRGA 4EFAC 1JWWA 2XMJA 3QGPA 4Q2MA 1OPZA 2XMVA 1Q53A 3F44A 4HH0A 2K7KA 4U9RA 4NPOA 3T9NA 1Q8LA 1S6UA 3KG1A 1YJUA 1OSDA 3K7RA 1Y3JA 1GXUA 2HFOA 1VQSA 3CJKA 1FD8A 3TOQA 2OAUA 1RJJA 3UDCA 1TL4A 1N5SA 3HHLB 2K7JA 2QIFA 1FEEA 4DN9A 2XMTA 1CC7A 2QYCA 2VH7A 3BDEA 5B0FA 1V3ZA 3FMBA 4OJ3A 5B0AA 2GV1A 2N7YA 2LDIA 5T7LB 3IWLA 1Y3KA 2HFNA 2OKQA 4FNHA 5KAKA 1W2IA 3KKFA 3FRYA 1KVJA 1P8GA 3DXSX 1OQ3A 2FTRA 1JK9B 1TR0A 2OP5A 2ZDPA 3BN7A 3IWXA 5B08A 1Q4RA 2L3MA 2RILA 2BYCA 3WDOA 4DL0C 1FVQA 1TL5A 2QLXA 2HQIA 1AW0A 3E8OA 1WD6A 2KT2A 2KYZA 2OD4A 1Y9OA 2FB0A 2BJDA 4NL5A 2IFXA 4OJGA 2HIQA 2OMOA 4ZA1A 1IUJA 3BF4A 1TZ0A 2XMUA 3MCSA 2IYGA 5F0UA 5A6WA 2ROPA 4QOTA 1R6YA 1VQYA 1URRA 3BB5A 1SI9A 5B0BA 2KT3A 2PGCA 3FGVA 3I9ZA 4A4JA 3HX9A 1FE0A 2HLTA 1XBWA 1YJTA 3BGUA 2AJ0A 3HF5A 2AW0A 2GA7A 3QMQA 2K1RB 1AFIA 2OFHX 1S6OA 1X0PA 3BR8A 2EW9A 2LXFA 1SB6A 2W4PA 2CRLA 4Y2KA 2XMWA 2GGPA 2W4CA 3HHLC 1K0VA 4OJ1A 2RMLA 4A47A 5T7LA 1QUPA 3TNVA 1FE4A 1YJRA 5A6PA 1N5VA 2ACYA 2N4DA 1FVSA 5B0CA 1FESA 2Q3PA 1MWYA 2ASYA 3HFKA 3HDSA 3VTIA 2G9OA 2BUNA 2K2PA 2LQBA 1YG0A 2HLUA 3CJKB 1KQKA 2FIUA 4Y2MA 4A46A 4ZOSA 1ULRA 5K9FA 3HHLD 2GFFA 3LO3A 1YJVA 1U7LA 1YRXA 3KG0A 3HHLA
chains in the Genus database with same CATH superfamily
2QRRA 2QLWA 2ZH3A 2G0IA 1CJVB 2RHQB 1OYDA 2WW8A 3ISZA 4ZP8A 2Z2MA 1B3TA 4WP3A 1VRUA 3DRSA 3CVKA 4OV6A 1MWQA 2ZH7A 2DXDA 1IKYA 3FZBA 4JV2A 2ZD1B 1S9EB 3LW5C 4GVLA 1OSCA 3R27A 3KLVA 4JYAF 3R9LA 4TVAB 1PBAA 4NXNF 4FF3A 1RT5B 3NWRA 1Q79A 4DL5A 5B09A 2R2RA 3KXDA 2LECA 1SUQB 2RQCA 2DNHA 3H2LA 3M1VA 4HACA 1CQNA 1OPIA 2WVBA 3RYLA 4ANCA 3CD0A 1PC4A 3GJTB 5K8OA 3QFHA 4DV4F 2AKWB 2CA9A 5F41A 4HL9A 3EVMA 5ETQA 4KTQA 2KZMA 3FBBA 2VV5A 3AA8A 4OIXA 1WI6A 2H5EA 4U8VA 1SJRA 2W4DA 4OX7A 4FBTA 1RKJA 5C42A 1OPZA 4CH1A 3Q8YA 3G6XA 2GHPA 3OTOF 1ZETA 5EHHA 2HAIA 3GCXP 4HH0A 4CYUA 1WG5A 1HMVA 3M8PB 1RAJA 5DDRC 2MKKA 2X3GA 2CJKA 2IVFB 1GX6A 2ZOGA 2HZCA 4QR2A 4QWBA 3L7PA 4G65A 2ZH9A 4DX7A 4JI1F 1YJUA 1T9WA 4TU9A 2HFOA 2Q6CA 3H8YA 3TAQA 5A2QY 5I42A 2Q6BA 5CYMA 2CQ4A 2WBMA 3M2UB 4OHXA 2CQDA 1Q16B 3GMGA 2YTCA 1PAUB 3KWMA 3N28A 3UN2A 3PKYA 1SBRA 2W2PP 3FDSA 3MEGA 1FTRA 1X5TA 4IOAQ 4RW6B 2CUYA 1HYSB 1K1SA 3O44A 3DXSX 2HPUA 2RF2A 4TY8B 1W25A 5I3PA 2LFVA 3LPEA 5ETPA 3WDOA 3M2VB 1NSPA 1LWEB 2QLXA 5HVHA 2ADBA 1TKDA 3I4PA 4LF1A 2AYBA 1OYEA 2HEKA 4YS2A 2RRAA 3EDQB 5JVHQ 2OLWA 2AWZA 4OZ5A 5CHCB 5ETRA 2XZTB 4USUA 3BBFA 4ZCMA 1WC6A 1SKRA 2LXIA 3S6EA 1EKSA 4ECYA 1XNQJ 1NHVA 1RTZA 2LCWA 2QSFA 2QMUB 1C4AA 3ISNC 5LM7E 3ZZYA 5CAAA 1MN7A 2MGZA 4CLSA 3LANA 2GVDB 4M95A 3GU0A 5HANA 3BZQA 1HBMA 1SB6A 2J9CA 4P74A 1D9DA 1KWMA 2DBBA 1T9VA 2PMHA 4KY3A 1K0VA 1KRPA 1VQ9S 5K5MA 3PO4A 1Y4ZB 5CD4A 1C0TB 2GVZA 2XZDB 1R8PA 5DO2A 1KHVA 2YKNA 1SXLA 1YRUA 2F4FA 1C1BB 2E44A 4BWJA 4DHVA 1FTCA 1QAJA 1IM4A 1ZAVA 3H5SA 1ULRA 1RHUB 4NLUA 4Y28C 5AJ3F 2C2RA 4DOZA 3L4BC 1EZZB 1U7LA 4X62F 1T05B 3SQGA 1MW7A 2IJNA 3ENQA 1OJ4A 4NEZA 3RB4A 3A8IA 5F0WA 1PSDA 1RWXB 4ZVQB 2RU9A 1NBEB 1P1LA 2NS1B 3ET6A 3W65A 4DV0J 2DRBA 3KK2B 2DXEA 2HHWA 3MDFA 5IT4A 4A8YA 1HNWJ 1U0HA 3CE8A 5A8KB 2IA6A 3RAMA 1U8WA 4DV5F 1FXLA 4RZRA 3BO3A 5AE2A 1SC3B 4OI1A 5HJYA 2FUG9 3HO1A 4DL2A 4QYZK 4WKRA 1HI8A 1S9GA 4ILMA 4K4TA 4C8LA 2ZH5A 1A7GE 3DOKA 2R7OA 5GADI 2M4MA 3T1HJ 2B4OA 1C4CA 2ZBIA 1HHSA 4P6QA 3THTA 2BBEA 1R8HA 4CO3A 5ETTA 1B7YB 3ELHA 4FS1A 4USIA 1P6TA 3KMSA 5DGBA 3H7HB 1JXLA 4WCEQ 2C2MB 3AD9C 2XGQA 1QSLA 1Q86T 1V5VA 4FS2A 3TVZA 4JI7J 2HQGA 4NEYA 5KFAA 2VJUA 4LF7F 2OUGA 3QGHA 4DL6A 4F3MA 2DJWA 5SZTA 1JXVA 3FSXA 4UQGA 1WG4A 2NCKL 2FLPA 3SQGB 2KDOA 4JV1A 2A10A 2BW7A 2FHJA 2CNOB 2WRMA 1VOMA 2KXHA 4HEA9 2QA2A 4KHPF 3JAMY 2NXEA 1ICEB 4UUWA 2VHGA 5G0RB 1NKEA 2DGUA 2NZCA 3LGHA 4DX5A 3TOQA 2BQRA 2MYFA 2RAQA 3KLIB 5J2NB 4KV8A 2OTJS 7FDRA 4ZPTR 4HT5A 4HT7A 3CIMA 3PEJA 2HHHF 2GVZB 2X1BA 4NYPA 3TJ9A 3P4UB 4OI0A 4B9LA 2CQ1A 1YRTA 1S1UA 3QGIA 2W9BA 3QRQA 1NK9A 3PNIA 4PWDB 4P73A 4IQXA 3VAFA 2Z2YB 3KG4A 3H90A 4EUVA 2CQPA 2W2MP 1WC4A 3W2WA 1WNEA 1JJHA 2W1BA 1M1HA 3MUTP 1FDNA 4LF9F 3MEEA 4Y3CA 2BE2A 2YVSA 1VIOA 3CCSS 4TXSA 1IJEB 5HMXA 2CNKB 1JLAB 2FLNA 4FF1A 3NNCA 1N33F 4RU9A 3DRRB 4ECUA 3R7NB 1UJ6A 1X4HA 3B6BA 4RW7A 1AROP 2HIQA 3V6DB 1ZPVA 4IDKB 3H0PA 4J37A 4ZPWR 3LH2S 3IAM9 4X4PA 1K47A 1NDKA 1HBUA 1T02A 5AXKA 2RNEA 5JXSA 5L1IA 2F65A 2MQNA 1S48A 5K8NA 1VK8A 3KLHB 2FLLA 3CWJA 5T41A 1MU2A 4N7TA 5BJRA 2J7KA 3FGVA 3UD4P 1CS4B 1IBKJ 2F9DA 3CJ0A 4YHHJ 3Q83A 2GMLA 4N8NA 1BQNA 4O4GA 2HKEA 3VHQA 4UY85 5J2QA 1U6BA 3DMJB 4I6AA 1X0PA 2HGNA 2M88A 4O23A 1UVNA 1I51B 2VPWB 3CJ2A 4ZP6A 1FK9B 5KT5A 1V6HA 5E2QA 3QWPA 4PG7A 2XMWA 3DM2B 1FNMA 4Y2KA 1REVB 1KONA 3DOKB 4CO1A 2GW8A 2VG6B 2C2ZB 2DH7A 3LP2B 1HARA 2HWHA 3J7YU 4FP9A 2W9AA 4ZN3A 4URGA 3BJYA 2CQGA 2ZC3A 2RDJA 4KKOB 2KO1A 2C3OA 2MJUA 2YKPA 4I6YA 3M2UA 1TL1B 1I1GA 1WTFA 4ZVRB 1PIEA 3JSMA 3KK2A 4H4KA 1VBYA 4IRDA 1R89A 3O3LA 5C25B 3TAMB 4I0WA 3J7ZT 2F63A 4FKYA 3ENAA 4CDIA 2ILYA 1RADB 3QT6A 2WVDA 3FEXB 2ZE2A 4UOFA 3OSNA 2VZ9A 4ZVOB 2MZQA 4CYUB 3T5KA 1FJEB 4YFUA 4J9OA 2XY5A 4DSLA 4YP3A 4MKYA 2QA4S 2G0CA 2XYPB 3FBEA 1JLCA 1XMBA 2F1FA 4PG8A 3PRDA 1VR6A 4ZIVA 3NEKA 3QJLA 2VL1A 2JFKA 5LMNF 2YKNB 3CJRA 3MXHP 2L08A 2R7WA 4YY3J 1DAXA 3BM7A 2K1RA 5IM0A 2R42A 1ZYQA 3EZUA 2UVUA 1XJWB 4OZLA 1Q0NA 3R5JB 2WSEC 2HK3A 1NPRA 2JWNA 3I32A 2E7VA 3ILOA 1NH7A 3MFIA 1FRKA 1GK8A 2GIFA 1UL3A 2RH3A 1DQ9A 2XEXA 5KFXA 2DNPA 2Z0GA 4D3HA 4J9KA 2EK1A 1L5UA 4CTAA 1VLOA 3AQOA 5LL6d 3ENWA 2VICA 1EARA 3H5XA 2UXBF 5SUHA 1TFYA 5L1KA 2BJ7A 3WIVA 2XI2A 1T3OA 3D68A 2E5LF 1I6JA 3WBZA 2HRTA 2QLJB 1S1WA 3QAUA 3T6BA 3HZEA 4NYOA 4ZCLA 3ENVA 3OL9A 2FJDB 2AIRB 1X9SA 2J8SA 5D4PA 5IQ6A 2C2KB 2BKPA 1TK0A 3PX0A 3EJMA 2XY7A 2HGLA 1HNIB 4ZS6A 2HS3A 2QG9B 5BYSA 5MLCV 3FC9A 2ZWOA 2J0SD 2ALYB 1WF2A 2IVYA 4K8RA 2J5AA 3EZOA 4ZVTB 4LBPA 2KL8A 3B4MA 5KOXA 2OAUA 3W2VA 1FA0A 1HWLA 5KG4A 2MKYA 1TFWA 2HQCA 2K7JA 5HI7A 4PQAA 4QIWD 2F5GA 2FGOA 4Z7YA 1MNEA 2CJBA 4F0MA 5GAGU 1JLGB 1LW0B 2VH7A 5B0FA 1L3UA 1Y10A 1MLAA 2BJ9A 2HURA 2NXUA 2W2QP 3MD3A 2GV1A 2KT5A 2N7YA 5CQGA 4EYHB 3IWLA 2AGOA 2DEJA 2OIHA 2IPOB 4OI6A 3BV8A 3UDVA 3Q8SB 1NRKA 4USVA 7AT1B 1CLFA 3TVYA 4K4YA 3M4XA 2VJVA 3RRHA 3CO9A 2HVIA 3CCMS 2V94A 1U1KA 1GMUA 2LVWA 3R1HA 2M2BA 1H7XA 4KO0A 3E8OA 2KT2A 4URSA 4J7CA 1VYAA 4IOCQ 3LA0A 9ATCB 3A3PB 4UZBA 3GP9A 1BC6A 4CCHA 3I96A 3PRVA 4WFYA 5HMWA 4WTYA 3IBWA 4LFAJ 1TV6B 4CH7A 2BACA 3MM5A 1KTQA 2VKRA 4IOBA 2LDYA 4TYAA 4WFNQ 2KZZA 3SDEB 1ZA1B 3E01B 1URRA 3GFYA 3FBCA 3S1TA 5LT5A 3EZ5A 3BO4A 2YPYA 4ED1A 2AYGA 2V6AA 2EVZA 3DNCA 1NKCA 2MY7A 5KFPA 1TMJA 4H4MB 1CULA 2DR6A 2HHUA 3ETOA 2CPHA 2OFHX 2POKA 2EFVA 1XTZA 3BSNA 4PYAA 5CA5A 4DR5J 4DPXA 1UEKA 4FXWA 4WXWA 4ZLJA 3RR8A 3NOCA 1F5AA 2XSJA 2RMLA 3AAWB 3TUIC 3H5YA 3QRRA 3IAS9 1IKVB 4DCPB 1WHWA 3PYFA 3OHBA 4E8UA 3Q23A 3TI0A 2EI5A 3B54A 3CGIA 4X4NA 1PG5B 3GCWP 1NO8A 1F3FA 5KFBA 5GAHU 3RAQA 1IKYB 1RHKB 1KLMA 4ZP7A 1FX4A 1XEZA 1IBMF 2M3DA 4WP8A 5CD4H 1G3OA 2FD2A 1RTJB 4DV2J 4Q45A 3UDEA 2A2CA 4KIAA 4L3KA 2VQFF 1YVFA 3TANA 1L3TA 3R5GA 3V5RA 3KG0A 3CC7S 1XWLA 2VG5A 1ZAXA 2W7AA 2C2OB 2CPFA 3D66A 2ROEA 4ZP9A 4F4YA 4LF5F 7FD1A 1IBCB 2UZAA 4DJBA 4DLEA 4QZVB 3HFZB 2B4PA 4OX8A 3ZZOA 4DLGA 3MD1A 4EWTA 1YJ7A 3CULA 1HNIA 1IQTA 2NPFA 1AZSB 1B99A 2DGVA 4AE5A 4B3TF 4IH5A 2YNFB 4HI1A 5KFQA 5KOWA 4LRCA 4QWDA 2XMMA 3EGNA 4KSEB 4DR3J 3ZZ0A 1R0AA 2Q1LA 4Z2XA 4TU8A 4J90A 2R7UA 1CPZA 3R2DJ 3AOCA 3PO5A 1ZH5A 1LQ9A 2QTWA 3FSYA 3SV3A 4TQSA 2ASDA 2C2DA 3QO9B 2YWHA 1R31A 2R8KA 3MEDA 2V0NA 1WEXA 3LWLA 2GCFA 3KJFB 2FZGB 4GRSA 4LREA 3M6WA 5IXUA 3KUGA 1RAGB 1TK5A 2WK4A 2GO9A 5HP1A 4Q8EA 1FHTA 4JI6J 2XB2D 1M5PC 1IBKF 2KFNA 3LP0B 2HHPA 1YBTA 2AEJA 1DJ0A 1U48A 1W7WA 3DI6B 4NCGB 3CO0P 4O3RA 2ZITA 4I69A 4YQWA 3V81A 4LFCJ 4Q2MA 3LUYA 2XWYA 2UUCJ 2FJAB 4F4WA 4NI2B 3F44A 1K8AT 5HROA 1KS2A 4OQJA 1DRZA 2X1GA 2IMWP 1YKWA 5LJ5Y 2VASA 2E29A 3CT9A 4DSJA 1HBNB 3DRPA 2R3VA 2BDPA 2B5JB 4PXBA 2EG2A 3TZZA 3K58A 3KG1A 3N01A 1NM2A 5JJBA 1P27B 5D4LA 1KVKA 1SH0A 1RZMA 4JI8J 1HHQA 4JB8B 1CJTA 1QM9A 1SVDA 2EK6A 1BWEA 4R8UB 2JH3A 2HNDB 2WB4A 3CJTA 4LR9A 3I5BA 4LQ9A 4QQBA 3D4JA 3SI8A 3V4IB 3ZFVA 1LKZA 1V3ZA 3FMBA 3PDNA 1WDTA 1KP6A 4J91A 2KM8B 2ZBQA 2LYVA 5KAKA 4XO0A 3JSMB 2OELA 2Z58B 1W2IA 4ID5A 3UN5A 1NK4A 4BCAA 2KN4A 1RAOA 3ZO7A 3CNQP 1IR2A 4F25A 2YNHA 4GVBA 1C0UB 2VDIA 3TZWA 1FO1A 4Y6IA 4B3RF 4DR1J 4B02A 2BYCA 1TKTB 3B82A 4PR6A 1UA1A 5ETVA 3KLFB 1FJGJ 2QGFB 4IH6A 1REVA 4OYOA 3FEZA 4UF4A 2HHVA 3R5CA 3A1YG 3UCZP 5HK4A 2DR8A 3EICA 4ZA1A 3C15A 2OPPA 2OPSA 2BJ3A 2UUCF 2DNMA 3BH7B 4RW4B 4MTPA 2P6TA 1TKXB 2A0FB 1CS4A 4ECTA 5B0BA 4E2FB 2EWHA 3JQMA 2A6MA 1PO6A 2GA7A 1NXIA 2LQ5A 2UVWA 1EP4A 1RWKB 4RWXA 3CF5Q 3I0SA 3IC1A 4A8FA 4LIWA 2F4VF 3OFFA 2PN6A 3ITHB 2DRDA 2N82B 2ZZTA 3S8SA 1SJ3P 3RJMB 4YMEA 1D9FA 1YK9A 1VBKA 1FE4A 2DGWA 2MPUA 2V2ZA 2RUGA 2DHGA 3R3TA 4DUTA 4ZKAA 2QL5B 1KKHA 1ZM4A 3SXLA 3KLEB 2ASYA 2WONA 3KFWX 4DN0A 3TZYA 2I6WA 5IWAF 5KTQA 1LFWA 2G9OA 3M8RA 3TEHB 2PT0A 4IFYA 1Y5IB 2VBYA 4RW8A 1S1UB 2QSWA 4ZOSA 5E3PA 4U67Q 2W9BB 3W66A 3QGGA 2B9WA 2MDAA 1XR7A 3LO3A 4IFYB 1WHVA 3BKFA 5F8LA 3A3NB 2FGCA 2ZHBA 4OJHA 3T5JA 2CG8A 2CG4A 1WOPA 2LU2A 4MAKA 3F73A 1HW8A 2R4FA 3FBFA 2V8PA 4NZ0A 1S1XA 3SSRA 4DZDA 2Z57B 4NE9C 3PFEA 4M5LA 4CLZA 1D1UA 2Q43A 3F0NA 2ZNZA 4KBIA 4WFZA 4WWSA 3W63A 4DF4A 4YUDA 1X7VA 1VBXA 4OZ0A 3SFGA 1U1MA 1NJXA 2V4JB 1EJ7L 3TQ1A 1EP4B 3M30A 3TO8A 3ZZTA 4K4VA 2A2DA 2GC8A 1F5BA 4ZVHA 1IR1A 4KGVB 2Z2LA 4UOCA 1RT7B 3DDIA 4CQ1A 3QZ8A 4B9UA 4EU0A 4G1IA 1FXRA 3RR7A 3JYTA 2AJ1A 4BS2A 3M6UA 1HQUA 2HK2A 1TUVA 3HZGA 2H51B 2RS8A 5GAEI 3D6MB 4NLPA 3OSPA 3MOJB 5ETSA 4K4UA 1HNZF 2NREA 2VBZA 2V4QA 1NKBA 4B08A 5DM7Q 3EWGA 5KFRA 3CCVS 2ROGA 4ZCIA 3GYXB 3GYGA 5KFWA 4EZ6A 3PJXA 2DTJA 3DGVA 2LP4A 1VI7A 4JV0A 4GVBB 2JEFA 5CABA 4J9UE 1U0HB 3GFXA 5GVQA 5A8KA 3KOAA 4GC7A 3T1YF 5D8HB 2W24A 3ICLA 2FY8A 1FDBA 1O51A 2RVJA 1XIQA 2OI2A 3MCNA 4PYDA 5ETLA 4DPWA 5L9NA 2XS5A 1UFLA 2J6SA 4KHRA 2O3DA 2KXNB 4LRBA 1BWVA 1M5HA 5IS2A 2O66A 1X9WA 3M32A 2MMYA 4G1PA 1ZM3A 3OL8A 3RBDA 1Q1KA 3O1LA 3Q8VA 2QYCA 2E1CA 3LQVA 4OX9J 5BYRA 3VWSA 3DOMA 2FHKA 4JP8A 1BGXT 4I2QA 2QV6A 2ADCA 2R7TA 4HTJA 2WOMB 1WEYA 5D77A 2IDLA 5DG7A 2VOOA 1TR0A 1VRTA 4NI2A 1UWBB 3K5OA 1Q4RA 2RILA 2XULA 1S10A 4PPDA 3HSGA 2G2ZA 3U1NA 3T19A 3G2XA 1HNXJ 3R5AA 2IHR1 4ECZA 5DG9A 2QLFB 4A8OA 2B8PA 2CXEA 2XZWA 4PXEA 4OHVA 4WYWA 1K9MT 1FDDA 1GT8A 1FKAF 3VVTA 1SV5A 3IM8A 1MROB 1RHJB 1U4BA 4B9TA 1RDRA 2YQ3A 4ED8A 2DGOA 2H5JB 2RQKA 2D41A 4X84A 1BHNA 2CVIA 2XHCA 1WC0A 4TQRA 2MGZB 4WE1B 2CPYA 2VQEJ 3QJJA 3KHRA 5KFOA 4LSNB 1EX8A 2EFQA 4RBVA 2ZBCA 1R0AB 2BRKA 5J2MB 3POTA 1YBUA 5KFYA 1GEHA 1DZ5A 2HQFA 3BQ1A 1EIYB 4N76A 1S99A 4LF5J 2E7WA 2XM3A 3G6VA 1VCTA 4U7UK 3TNVA 3VF0B 4NLRA 4NLVA 1Q78A 3W9IA 2HZAA 2DRAA 3C46A 3BPDA 1JQGA 4J9VA 4DX8H 4M5GA 2XCPA 2W2OP 1HYSA 4DS5A 2V34A 1JLQA 4CWBA 1NSAA 3MR6A 2AX1A 3MEGB 4DG1A 2QC3A 2OPQA 4Y2AA 2W25A 4U7UD 3J81Y 1UPMB 1QAIA 3MWBA 1KLMB 5DGAA 3RGIA 2PI5A 3NLCA 5CYMB 1JNZB 4X4TA 4ZJOA 4KGKA 1CJUA 5DJBA 1WKKA 3G96A 1U09A 1GX5A 3Q2TC 3C14A 3NBPB 5K8MA 4WFXA 1P9QC 5L1LA 1R8BA 5IV4A 3C16B 1HNWF 2YKMA 2RQ4A 1OY8A 3R1LA 3PRBA 4QIGA 1U1QA 2AT1B 5A0YA 4M1KA 5BR8J 5HLFB 2B6AA 3KHGA 2VFSA 4I64A 4IO9Q 4RW9A 1FEHA 2CQBA 3DLGA 4MFBB 5L1JA 3OL6A 3HPOA 3NS6A 4UT4A 4A8QA 2CJQA 1TP7A 2R7XA 5A8WB 1R0CB 1K73T 4LFAF 1IBLJ 3NOGA 3PW7A 3T1AA 4YB6A 3OR2B 5F8GA 2KVIA 3BR9A 4O3SA 4RW9B 3MI7X 1UEVA 4FN5A 4O3QA 3DLHA 3ETMA 4F4KA 4USTA 5U47A 3MPVA 2KB2A 3M1VB 4HACB 5KG2A 5KT3A 3DDKA 4DUYF 1N5QA 4AYBD 1MN9A 4KO0B 3TR5A 2Q79A 3NBPA 4LT6A 2YX1A 2V8VA 3NGUA 4FYWB 1RT5A 1SC1B 2IBKA 3D0GE 1CJUB 1S7IA 2U1AA 3PJ9A 3PHEA 4OL8A 4OLPA 1S9EA 5KG6A 3PKMA 1O5JA 2QMXA 3O2IA 4OX9F 4R5PA 2R2TA 2A3JA 3C6TB 3FJ2A 1VJWA 1VRUB 3DRSB 3TX0A 3NNHA 5AE3A 3K7RA 4DG1B 5C24A 2ZNYA 3CCRS 2XMAA 3I82A 4OI2A 5A8RB 5H9FK 3QQCD 3WQPA 1BD6A 1U1OA 4LIRA 3W2VB 5CXTA 3IS9B 1RAHB 2HQ3A 4PCQA 4B3TJ 2ZOFA 1RT1A 3RRKA 2GQ2A 4DL4A 2VPXB 3T3FA 2OKQA 2IC3A 1NHKL 8ATCB 1FFWB 4XK8C 2MJNA 1IBLF 2MLXA 2F9JA 3RB6A 3TQEA 3V6HA 3T41A 4AL6A 5J2MA 5H9EJ 2FPHX 2V68A 4ICLB 3TJAA 1XMOF 3AD8C 3C6TA 4R5PB 5FJ4A 1S1WB 1T11A 2E5GA 4WE1A 1N0VC 2LEAA 1HKAA 1R7IA 3GSIA 5C7PA 4DQRA 1VBZA 1IXKA 2ZWPA 5IT9Y 1S6PB 2O1PA 2G13A 4RUHA 1L3SA 3WIUA 2DR5A 3DLLQ 1R6YA 1VQYA 2J9EA 1S6QB 4PAAA 2U2FA 3MECA 4A8WA 4IUFA 4K50A 1OIAA 2ABYA 3A8JA 2DY1A 4NCAA 3EMTA 1FE0A 5J1NA 3KNAA 1G7CB 4TN2A 2MQQA 1R27B 2R9LA 3CC2S 4OZ1A 5ETOA 4ED2A 4OZ2A 1FKOA 4ZMMA 5AXNA 1VQPS 3RZAA 5F3ZA 4QR1A 3GV7B 1BMQB 4EI2A 1PGZA 2EKYA 3DOMB 1E6VB 2OEJA 3DLGB 4MFBA 2JL9A 4O4RA 1FVSA 3TUZC 1HI0P 3D2WA 2B6AB 1B0VA 2MEWA 3Q86A 3OTOJ 3R2CJ 2K2PA 2YKMB 2GIRA 1YG0A 2NPIA 1F1BB 1VQOS 4CRJA 3B78A 5C2CA 1UVJA 4RL1A 1AT1B 2I8EA 2MB0B 4K4ZA 2M5YA 3HHKA 2LEPA 3R5DA 3KTQA 2B0GA 2QZ8A 2QLBB 4WYLA 5IFMA 3RB3A 5J2PB 1B70B 3C19A 1TQLA 2L41A 4DU8A 2BR0A 4C98A 2ATLA 5H9EK 3M8QB 3I0RA 4DUZJ 2BKOA 4C8ZA 4F67A 4X4UA 1AUSL 4WK3A 4P10A 3D7SB 1F6TA 3TWZA 1U1NA 4Y2CA 3P6YC 2OFGX 4YB1P 2JEJA 3WC2A 5KFFA 1RAAB 3G86A 2KRBA 3Q0AA 1SQEA 3DMJA 1U02A 4UW2A 1BQNB 4O4GB 5B0DA 3QJPA 4A48A 2J6UA 1PC5A 3JYTB 5HL7Q 2XMKA 3DCAA 4OZ3A 4NRTA 2DNNA 1S79A 3MM6A 2WHOA 4FYVB 2KFYA 2VFVA 3K5MA 4QU6A 3JTOA 1GH8A 2VFTA 1C2PA 1SPBP 2LQ9A 4RNFA 1N56A 1XN9A 2QN6B 2COLA 1J5OB 2XC9A 1S1VB 4IRKA 3X3UA 2HBYB 2HSEB 5EWGA 4NXNJ 2D1CA 4IDKA 3EYZA 4J9SA 1CJKA 4K0KJ 3AB4B 1SIZA 2MXYA 3PYEA 4RW7B 2MSSA 2CPJA 3MM7A 5F3TA 2RQMA 2VKZG 3QGPA 4EFAC 4RJVA 2I5JA 5M2PA 5IT9U 1S57A 3DHXA 3TA2A 2ZHAA 4KGZB 1VGYA 1IWAA 3K5NA 5LJ3Y 2K7KA 4LRFA 4ED7A 1TKZA 3EGVA 4UQTA 4CLFA 1HR0J 3HSZA 3J80Y 2MLYA 2C28A 1QD1A 2HFVA 4QWAA 4I6WA 3EPIA 2ZJPQ 2YBVA 5C5JA 5EDWA 1HNVB 4OMFG 4ECVA 2V8GA 1WG1A 3CJ5A 4C6AA 1RXOB 4DCOB 2RDIA 1HD0A 1VRTB 4RPFA 3UDLA 4EEYA 4ZVUB 1RJJA 4EBEA 1N5SA 1EETA 4I2PA 1JJCB 2YWGA 4AT1B 1X0FA 1LWFA 2B9EA 2G1HA 4NOHA 3BYPA 2DHSA 1KHWA 3UO0A 3PXGa 5HN0A 1RTDB 3PZPA 4DSKA 4X65J 3MMAB 3ISND 4JI5F 3EX7B 5EUHA 1RWVB 3MM8B 1Q5YA 2H4WB 2HNYA 4ZITA 2EC0A 1KVIA 1RT2A 2CZVC 1KOOA 5HQLA 2HHXA 2FTRA 3IBCB 3N0VA 1IKXA 5CYQB 4M5NA 4JI7F 5HBMA 5B08A 4KH0B 3IP0A 2VPZB 4F2SA 4URQU 1FI4A 4MK9A 4PZVA 3FVYA 5E41A 2KYZA 1WDDA 2MKIA 1WI8A 4F7VA 5KFCA 4RUAA 3NGDA 2AEMA 1RT3A 3HM9A 3JB9k 4NX9A 2FC9A 1OMSA 3FZ2A 2HS4A 2XMUA 4RBTA 4RW4A 5RUBA 4RUCA 1N5YB 2ROPA 2L9NA 3JTPA 1VQ8S 1FKPA 4IG0A 2OPSB 2BE7D 4HKQA 4LUBA 2E7XA 2LQ8A 5IWAJ 2ZOMA 3BGOP 4RU2A 3K17A 3HX9A 3UWTA 2NUUG 2VC0A 3C8YA 2YQ1A 3NAIA 2Y1JA 1NJYA 2AJ0A 2E1RA 1SCJB 3AT1B 4CLYA 2IAJB 2EC2A 3BR8A 3J7YI 2EW9A 1C0UA 2W4PA 3CEDA 2GS8A 2PMWA 2YNHB 2Z30B 1HQUB 4WU2A 1H2UX 3MR3A 5FIIA 2GGPA 1H73A 2W4CA 4XPEA 3MURP 4X64F 1N6QB 1SL0A 4DFKA 3C2PA 3GONA 1S72S 2VPYB 2C2EA 1TELA 2GQCA 4OI4A 1RTHB 3GE9A 3PFOA 4XDCA 1U1RA 2AJQA 4IFVA 1WKLA 4GKKF 3HLUA 1U45A 2KH9A 4QWCA 4CLWA 1BY9A 3OVAA 1T03A 3NMAA 5L39A 3OPKA 1S1XB 2K3IA 4DUZF 2AJ2A 5DG8A 3G8SA 2CQ0A 5FD1A 1H0HB 3MAQA 1Q8KA 1RAEB 1NK5A 5EN1A 1UCNA 1O0PA 2R2UA 2ZBRA 2XYHB 3IBFB 4FNIA 4YR2A 1N54B 2I0XA 3N5BA 4KAIA 4C0OC 2QFJA 4IKAA 1TTHB 4YEAA 4ZPDA 3Q24A 4K59A 2JDJA 2IJFA 2W2NP 4DR5F 2DGQA 2P9GA 3G8TA 4DR2F 3J81j 1TKZB 2XTJP 5KFZA 4WJBA 2RT3A 2WONB 4M63A 3GFHA 3KLEA 4ECSA 5I3UA 1ZM9A 4DV3F 2DPIA 2ZVSA 3SCLE 3ULHA 4H54A 2Y1LB 4DF8A 4LMZA 2N4CA 3ITHA 4I7FA 5HSPA 1IVZA 4NA1A 2PMZD 3TA1A 3HHNB 2KKHA 2J7WA 1CJKB 3LP1B 3QBCA 3RBEA 5KT4A 1XR5A 4EYIB 2CNLB 1PCAA 2XG8A 1N8RT 1L3VA 2HFZA 1XERA 3BPSP 4K0KF 3K8WA 2WTFA 4OZJA 1T9UA 4PWUA 1UVMA 1WKJA 5D0GA 1S4FA 3G82A 3MZIA 2JSXA 2BJEA 3AJ2A 4O44B 4X4SA 4LF8J 1T94A 3TUJC 4F50A 3HSJA 2YNIA 3E3XA 3KNGA 1LWEA 2IRXA 1VQ5S 2KJWA 3PYGA 4F8RA 1VQ4S 4WFBQ 4X66F 3D54A 2RF2B 3J7A1 2V9KA 2GJ2A 4KRWA 3QZ7A 4DQIA 1N34F 3T9NA 3I55S 4KYZA 3DRYA 2N7CA 1X31C 3P96A 2J0QD 3IXQA 2ZM6F 5HATA 3M8ZA 1N36J 3CJKA 3M8QA 2C3YA 1LEOA 1S7HA 3QIDA 2CJYB 1NK0A 1L3KA 5GADU 4Q43A 5E3QA 5I42B 1FEEA 1X4FA 4CT9A 1TL7A 2EBGA 3OVBA 3EXCX 3NY0A 1KFSA 4DCJB 3X1LB 2UUBJ 1VK3A 3FRZA 3GG0A 1X4EA 2B7BB 3SQOP 2QEXS 4WZMA 3TVKA 3AOAA 2JLGA 1HFEL 1F9HA 3M8PA 3IN5A 4NLOA 3CIZA 1RQ0A 3GJQB 1IQZA 3HVRA 3VALA 1WWHA 3BBCA 4I1TA 2JHEA 3HI9A 3RW6A 1TU0B 1E6VA 1NZ8A 1CULB 3HVTB 4L3NA 4H4MA 4R25A 4Y65A 3MM9A 3SCIE 1FNXH 3PCOB 1WD6A 1UWAA 3D3CJ 4KPCA 2XHWA 2OSRA 1RBOB 2Y3YA 1RI7A 2EFGA 1RLDA 1TZ0A 1RACB 4LF4F 3W5ZA 2IVMA 4LR7A 1XNRF 2VD3A 3QT8A 1T9TA 3C6UB 4NWBA 4QOTA 3UPFA 1TL3B 3RW7A 3D6TB 4EBDA 2FC8A 3P3DA 5KFVA 5DRKA 2D3UA 2DR7A 3T6JA 1SUQA 3FFIA 3BGUA 4RNHA 1KVJA 5KFLA 4QR0A 1S6OA 3PM9A 2A6OA 2LXFA 3UVJA 2CDRB 3TEGA 2O67A 6AT1B 2MQOA 4MKBA 2QL9B 2DY9A 2MQ8A 3CCQS 4QU7A 3M9MB 2JVOA 1NU4A 4DR7F 2VF3A 2XY6A 2IA0A 3FCHA 4C4WA 1LV5A 1RGVA 2ILZA 1AXQA 1HR0F 2YKOA 3OR1A 1AZSA 2H54B 2HBZB 2MZTA 2J7UA 2CZ4A 3D0HE 3HDSA 4M5KA 2UU9J 4TYBA 4EMDA 2LQBA 2QE5A 4B3OA 1WF1A 1HNZJ 1HBOB 3HULA 2WW4A 4ELUA 3H4DA 4J9LA 2D3O1 1RCXB 3HXMA 1PAEX 1E6YA 3OR1B 2YH1A 4DWIA 1IJFB 4W98A 3KJVA 4JUZA 4ZVEA 1I94F 1RTJA 3BN4A 2N3LA 3HMJG 2KYXA 1RHRB 4QW8A 5F8IA 1AYEA 1PYTA 2YQ0A 3GZ7A 1NSKL 4NZ7A 2E5JA 4X4RA 4JI4J 2AP6A 4WPAA 5GMKa 2X51A 5KG1A 1T95A 5E33A 3AY0A 2VONA 3CJ8A 2IYIA 4RNMA 1UMJA 1YITS 4X2BA 4CTAB 2AZ1A 1T03B 1IKVA 4V1Ak 3I56S 3BGLA 2VUGA 3E51A 3EXYA 3FFIB 5H9FJ 3L7OA 4ZK7M 1Q81T 4HH1A 2XSJB 5HO4A 2HG4A 1WOOA 3AH6A 1KBRA 3C6UA 2RRNA 1PKUA 4N5SA 3L9ZA 3MAHA 1MMLA 4ZJLA 4B17A 3NGTA 1UFKA 1NJIT 1OQ6A 1RTIA 1SJ1A 4K2XA 1X5PA 2DITA 3D6HB 2KVQE 3AJ1A 2WVCA 4LF9J 1ZTWA 1RWPB 4FKXA 1TV6A 2V2KA 4KE5A 2WVFA 1B0PA 4CLPA 4OX6A 4HHHA 2ZEJA 4U9RA 5KFUA 2E5LJ 2X7IA 3US5A 3D67A 1VISA 2BZ2A 2FZKB 4OYZA 2DO0A 4ZPCA 3DGPB 3RAXA 1IKWA 1PYSB 5KT2A 1OSDA 3K89A 5C25A 2HMIA 1VQSA 3PEHA 4EBCA 1FD8A 2GIQA 3PX6A 2ZKTA 4WIIA 4DPYA 3T5LA 3D5MA 2I2YA 3GV5B 5LXRA 2Y1RI 2DXFA 2EFNA 2AJFE 2B51A 2OPQB 5B0AA 5IC4B 1RLCL 1S0OA 2AYMA 3MR5A 3IM9A 4QJVA 2HFNA 1KDNA 4FNHA 1UEUA 1TUGB 2AYEA 2J9DA 3VGTA 4OYWA 1M5KC 5KFMA 4Q8FA 1YHQS 2ZDPA 1HWKA 4C0BA 4NRUA 3IRWP 3BH6B 3JTNA 4NA3A 3VAJA 3CJSA 3GTYX 3OTEA 4JI2F 4UOGA 4U7CA 2J9DE 5DETA 2OMOA 3MUMP 4FVCA 4USWA 2A1BA 2FVPA 3GJRB 2VG7B 3THVA 3LAKA 3G87A 4R0JA 3TA0A 1ZOTA 4DZ6A 4ES2A 3P5TL 3S7RA 3CCUS 4K4XA 1RYRA 2FVRA 1KSPA 5C2GA 2F3JA 2KT3A 1T3NA 2KI2A 3SV4A 1ZBTA 1MSWD 4I7FB 5LXYA 4W4MA 4LVNP 4DU7A 4AXJA 3I6PA 1AFIA 2UXCF 5KG0A 3PVXA 1HQEA 2FYXA 4CI0B 1RB0A 2DGSA 5H1SV 3UCUP 2CWXA 3CJ4A 3OLBA 3HHDA 3MR2A 5F8NA 2W9CB 5D0RA 2DEIA 1YJRA 2HHTA 2K3KA 2N4DA 1HNXF 2CQHA 3CD7A 1SL1A 2WOMA 4FVMA 4E98A 1X4GA 1PJ6A 3KLIA 3M8SA 3O6QA 3BDPA 5F8MA 4OYMA 4NLDA 4AUKA 1QY7A 4L73A 2DGTA 1JLCB 1JLEA 3GJSB 4Y2MA 3ZTSA 5K9FA 3KK1A 5L38A 2P6SA 2GX8A 2APOA 4HHJA 2BM0A 3THPA 1LK5A 1FCAA 2A18A 3MOZA 3QAEA 4R0EA 4O3PA 2NXNA 2IM3A 5D15A 3CC4S 1P9YA 2ZE2B 2FHMA 1UVIA 2Z8QA 1RT6B 1UW4A 2RSQA 4GO7X 1UZHA 4AXIA 4YDDB 3H20A 2CPXA 1MMDA 3TAMA 2YWKA 1FX2A 5GMEA 1QSYA 4ZVGA 3BGFA 2DHHA 3B8HA 2J0WA 2GGPB 4NMXA 1B4SA 1LK7A 3CMAS 4DFPA 2V2VA 1TL1A 4ZHRB 3IGNA 4PXCA 1RU1A 1FJGF 4N77A 4N56A 4B3RJ 5EX0A 1W26A 2AV5A 2QJ3A 4YB7A 2HHSA 1TAQA 1FK9A 3HKZD 3GIKA 3DU6A 1N36F 3I9V9 1S59A 1WUUA 1FKPB 3M8YA 2JZ5A 1Q8BA 5J2QB 3CMES 2PFDA 5M2RA 1RU2A 2HQDA 4F4XA 1UJ4A 2BRLA 2XNRA 1FNOA 1O6XA 1MU2B 1RT3B 2DNZA 3RTVA 2ZH2A 1FDAA 2Z2ZA 2C2NA 1JWWA 3VGUA 3ET6B 1G2EA 1S5ZA 2DCUB 2XMVA 1HBUB 2KHDA 4JI0F 4YOEA 3IR6B 5A8WA 3NGRA 2KTQA 5G4DA 4FPIA 1KFDA 2B9XA 5CH7B 4JI5J 1KN6A 1QTMA 2HNYB 2BKNA 4NPOA 1I5OB 1V3SA 4BDPA 1NAQA 1S6UA 3DRRA 1S12A 3ZNJ1 1LOUA 1U8SA 2BE2B 2HAFA 3NCQA 3ONQA 4MK8A 2RKIB 3UQSA 3T1HF 1VQKS 1C1BA 4L75A 4O0IA 1YLXA 3A13A 2Y0BB 4ZVFA 2X3DA 2F8HA 4M5HA 2ZH8A 3NXZA 1F9EB 3FUYA 1FRMA 5AXLA 1RAIB 4DL7A 2QA1A 4PWDA 4OJ3A 1RABB 2W9CA 1U47A 3FMWA 2C3UA 3SYZA 5K14B 1ROFA 2B3TB 3W5XA 3C3LA 3KKFA 2UV8A 5E3CA 4IH7A 3DOLB 1NLKL 5J2NA 1M5OC 1F60B 1HQEB 1RA6A 1HBMB 5KFTA 2DKOB 2L48A 2CAJA 2GAHC 1S49A 2GVDA 1TL5A 4O3NA 4BC9A 2P8IA 1YI2S 4J9MA 1FJ7A 4N8OA 4M5JA 2NYHA 4USKA 3HD1A 1JLFA 2H3EB 3I0SB 4ZN1A 3MCSA 2R2SA 4C3KA 6FDRA 3G4SS 2KU7A 5KFKA 4OZNA 4B9SA 1U2FA 2VG7A 2D74B 3F41A 5E5NA 2ALZA 3NP5A 1CSJA 2JC0A 4EGLA 2Y8YA 1GMWA 4C2MA 3HVWA 4LF2A 1NSQA 2BMBA 2HLTA 1TKXA 1XBWA 2BJ8A 1H72C 2V8HA 4XPCA 1R8CA 4IRCA 2DNYA 1T0TV 3VZHA 2BOPA 1YIJS 1DQ8A 4MIBA 4AQYF 2FHJD 2D9OA 3J7Z5 3C15B 1Z2ZA 2LKZA 4K2JA 2XSFA 2WZ1A 1FRIA 4DUYJ 3KLFA 3CDUA 2F8EX 1S9GB 1TKTA 3ILIA 4LRAA 1ZZNA 3AOBA 2V67A 1YTYA 3I0RB 3CCES 4ZHRA 1D9AA 2LA4A 2AGPA 1UFWA 2JC1A 1EHWA 5DDPC 1YBAA 4BLGA 1XQIA 4OHZA 3D3BJ 1SJ4P 5E0OA 5DZ7A 4ZPBA 1PJ7A 1RT6A 3MAAA 4ZPAA 1YWXA 3V4IA 3HHLD 2OH2A 4U8YA 4B3MF 2M8HA 4UOHA 2D9PA 1N88A 4R8UA 5MAOA 1YRXA 1NDLA 2XQCA 3GB0A 3BQ0A 1RWMB 2P9EA 2OD6A 5GAEU 3H2VE 4USMA 3GIIA 2ZBPA 4X4VA 3W8PA 4LF6F 5DLGA 2CQ3A 3NWGA 1F2HA 1FWPA 3H40A 2HRYA 3F56A 1ZTTA 1IBMJ 4M5MA 5FLXY 3U1LA 1XR6A 2RD5C 4F0HA 2MZ1A 3CCLS 4AL5A 3IR7B 3V2UC 4P71A 1DHMA 3EVWA 5EX3A 1QLNA 2BW2A 3N4WA 5EGYA 3IWNC 4PG6A 2EKNA 2HNZB 2MQLA 4Y2IA 5AXMA 4YY3F 3V4MA 4CZCA 4JI2J 1TAUA 2YPZA 2G2YA 3V81B 1HW9A 1H2VZ 2H65B 1X4DA 1X5OA 3H98A 5HQ8A 4KPYA 3DI6A 1Y0HA 3UI3A 3LP0A 1TK8A 3RUBL 2XS7A 4MK7A 3UNGC 4WFAQ 5CYJA 3CDAA 1URNA 2OSQA 3UR0A 5JVGQ 2PA3A 4LFBF 1AFJA 3LGNA 5KFHA 1NZAA 2VIHA 4C8NA 2ZKUA 3MEKA 4OYAA 2OO4A 5E3RA 2XBPA 3DRXA 4LSLA 4PG5A 5CZVA 1ELOA 5GAGI 2RRBA 2MZSA 3V6KA 1LW2A 5KFJA 5F8JA 3NL0A 3P45B 4YN3B 4CH0S 2JLEA 4ICLA 1HWIA 2DNKA 2NXCA 3OFEA 4B9MA 2AQ4A 1N32J 1CQMA 4RNOA 1LWXA 4OI3A 2RJZA 4FF2A 2DGXA 2H9ZA 1RISA 3DKDA 4TNOA 2IC3B 5J1EA 1Q8LA 3A12A 3GIRA 3I31A 4NLTA 4DV5J 1N32F 5DLFA 2LMIA 1GXUA 1UAWA 3HJVA 3ILLA 3JSRA 3OTCA 3LTOA 4TY9A 8RUCA 4MH8A 5EWEA 2DNLA 4B3OB 3D1HA 1K0TA 1JLBB 3HHLB 4EZ9A 4GO5X 5A8RA 1DTTA 5KG3A 1RT4A 2CADA 1CC7A 3QPIA 4DSEA 5L9XA 5D4OA 1Q82T 1WC5A 2V69A 2MQPA 2UXBJ 1FRJA 3FCWA 3BGRB 4EO6A 1YZ6A 3R6GB 2H4YB 3EPGA 2C42A 3CUNA 1NNDA 3EUNA 1A6LA 2XLKA 3AD7C 3PTWA 4O3OA 3M6XA 3UVJB 2OEMA 3CPWR 4FXDA 2HW3A 3ZTPA 2L3MA 1AW0A 3MCMA 4DI6A 1FVQA 1Y11A 5E7OB 2Y0SD 3NS5A 2HVDA 2ASJA 3H5UA 3O8WA 1Y9OA 3M6VA 4F26A 2Y1IA 2IFXA 3RB0A 3L3CA 2EPIA 2FQQB 5LMNJ 2OPRA 2DVIA 1H74A 3CTRA 2IYGA 5F0UA 5A6WA 2SXLA 3M9OB 4DQQA 1GXLA 5C42B 3Q8PB 4DQPA 1UJ5A 1VRQC 4H4OB 3QT7A 5DS7A 3OUYA 2MQMA 2HWTA 3HJFA 4LF6J 3P49B 5JUMA 3BB5A 2M52A 3A8EA 2PGCA 1YJNS 3E01A 3CJQA 3QATA 1H6KX 3SDEA 2Q66A 3MM9B 1X9MA 4DDFA 2AW0A 2MKHA 1VJQA 3K59A 1U2CA 2OPRB 2HVZA 3W3SA 1DARA 4I67A 4JV5F 4W90B 2ASLA 3HHLC 1SQGA 1SKUB 3H25A 1SIWB 1BQMB 4OJ1A 3QLHB 2FLOA 4A47A 3T5HA 4PKDB 4QPXA 1NEEA 5D3GB 1SC6A 1Y5NB 4QPTA 2R8IA 3ZTOA 2FJWA 5KFSA 1A0OB 1FD2A 3CDBA 2Q3PA 1TL7B 1S0VA 2BXJA 2DISA 3JSYA 3SMZA 5IT0A 3GPAA 3BGRA 3PG9A 4CM2A 2HLUA 3D28A 3CJKB 2MY8A 3AHPA 2CIMA 4Y0FA 3OBIA 2HBQB 5DM6Q 3NGSA 2IMOA 3AODA 1JLGA 1LW0A 4NLWA 2YX4A 4BBYA 3KJVB 1FWLA 2BA9A 3PV8A 3FQKA 1JLQB 1UZDA 3EE3A 4ENOA 1JLBA 3HHLA 3DLKA 1YGYA 3W1YC 2E1PA 2YWFA 3MMBB 2FVSA 1FF2A 5JMNA 1WTBA 2CQIA 1QAYA 2MZJA 1Z4UA 4DX6A 4LFCF 2Y9HA 2B8QA 2YNIB 5A2QU 1HA1A 2DIVA 2DYAA 3QSYB 4DV7F 2QFIA 4LF4J 4NLQA 1N33J 4PUOB 2DHXA 3G82B 4DR3F 3CMQA 1Q95G 2NSBA 1VS3A 2DD8S 3N79A 3POTB 5KG7A 4AD6A 1C1CA 4Q2LA 3TAPA 5I4MA 2CPEA 3CCZA 1KD1T 4LSNA 5KFDA 4LQ3A 4A8KA 3UN3A 4XIUA 1HI1A 3LP1A 4MYUA 5M2UA 4NLXA 1WC3A 4ID8A 4CO4A 4ILLA 3K8VA 4IR9A 2YX7A 1Q7LB 2BX6A 2DCLA 1MWZA 4X4OA 2W01A 2X1AA 1DY3A 2AF6A 3NNAA 3IGVA 5THWA 3Q22A 4C9DA 1N52B 2I1RA 2GNKA 5BR8F 3UE2A 2WBRA 4DV2F 1DTQA 4MJKA 3IRXB 1TL3A 3UD5A 4ZLLA 1FJCA 2XMJA 1GQEA 2ZUAA 1PYOB 3DHWC 2G1DA 3OFGA 5BYQA 3W7BA 3UR3C 3KDNA 2HNZA 2CVEA 2ZM6J 3CDEA 4QIEA 1WJ9A 5AT1B 1D09B 2JVRA 3LAMA 3QIPA 1XMQJ 4I2QB 4I56A 3QWUA 3WZ0A 2XYGB 3DLBA 3TARA 1Z2LA 5K20B 4DQSA 5LSOA 3AXKA 1JMTA 1NDCA 1V3RA 3HT0A 1PJ5A 2YXLA 3M8WA 4OLOA 4WIQA 4YR0A 4JI0J 3CCWA 2ATCB 5CCMA 3G71S 3DFEA 2V5HG 1EKRA 1QJHA 2XMTA 3RBXA 4CLUA 4NXMJ 4RLEA 4WF9Q 5IQQA 3WC0A 1JKHB 3T1YJ 2QA4G 3IR5B 2WSCC 5T7LB 3U1MA 4FF4A 4C8KA 3L95X 4ALZA 1YZ7A 3LALA 2OMLA 3FEYB 5J1PA 2VQEF 2GJFA 4KFBA 1VHFA 3IWXA 1QE1A 1F0XA 5CCLA 1XNRJ 5T14A 2NZ4A 4B3SJ 2W8LA 2RU3A 1RAFB 1SJQA 3PACA 4QYRA 3FCVA 4C8OA 5KFEA 1RE1B 3GR0A 3LP2A 2AX0A 3IG1A 5D4NA 2BJDA 1ZZFA 2CYYA 1T8EA 1WF0A 1X5SA 3PR4A 2HRUA 1RWWB 3MPYA 4ZVPB 1UTAA 3I5AA 5HQMA 4IG0B 1Y5LB 2CQ2A 1U6ZA 1LNQA 3KJNB 4WK1A 3W62A 1M1GA 1JB0C 4DMZA 4ED6A 4RR5A 4CIOA 2H1YA 1SL2A 1QSSA 3FQLA 4FYYB 1NCLA 2FJEB 1D8YA 2E1AA 4Q5VA 1RT7A 2G0JA 1WELA 4MMOA 3PHTA 1HLWA 3QFWA 5LMUJ 3HF5A 3QMQA 4ED5A 4ELVA 4F4ZA 5D0HA 3I87A 3P8BB 4P2SA 5HBMB 3L7UA 5F9LA 4Q0BA 2DNQA 3VZIA 2HWIA 5ETMA 2DH8A 1M5VC 3CCTA 3UCGA 3A3OB 1WHXA 2LA6A 2ZH6A 3V6DA 2L9WA 1W2BR 1RHQB 3LPYA 1R8AA 3GLJA 1EQ0A 4GKKJ 2VDHA 3O5TB 3SSQA 2VC1A 3AA9A 3MEEB 3QSIA 5D78A 5A76A 4NLGA 3W2WB 1EQMA 1MWYA 2CKWA 1K44A 3DOLA 4IQMA 3HFKA 1EETB 4I2PB 1NK6A 3VTIA 3KJQB 1KC8T 4DR6J 5EWFA 1XC9A 3CD6S 2PI4A 4OHYA 1NH8A 4JI1J 2ERRA 4HTIA 4L76A 3FKBA 3S01A 1DBDA 2HFUA 3AB2B 3BSOA 2QO3A 4P2XA 2YWWA 2QL7B 4L6V3 4PWWA 2BOAA 1ZM2A 4KV8B 3W5YA 4X62J 1FRXA 2PDAA 3BBBA 4PEOA 1KQFB 3J80U 2H48B 2XI3A 2RKIA 4HLBA 1TUWA 1V9OA 5G0RA 4P75A 3ZZRA 4GKJF 1WOSA 4ECWA 2F4VJ 3H4BA 4P72A 4PRFA 1KR4A 3HVAA 1NB7A 3R8YA 4KHPJ 2P9CA 3BREA 2EG1A 1K1QA 4DPTA 4LVOP 5LMUF 1OWXA 4IFVB 3PW0A 1N0UA 2IJRA 2VA3A 2P5VA 4JYAJ 1RSCA 3OLAA 3JQJA 4V19X 4RWWA 4F02A 3NMRA 4C97A 2PSZA 1ZS6A 1G6BA 2QT7A 3PW5A 2JNJA 1GFWB 5FDLB 2LQJA 2QX0A 3VGSA 1NB2A 2JEIA 2ZFHA 2BQ3A 5D3GA 2G4BA 2CQCA 1EB0A 4HI2A 4KJIA 2K06A 4NA2A 2NLWA 2CJAA 2OPPB 5GMDA 4U6PA 3G8QA 5B7WA 2IY5B 2BE9B 2RHSB 3OXFA 4KH1B 3CSKA 1RK8A 2B43A 2GO8A 2NSCA 1N6QA 1CEZA 4DS4A 1R43A 3EDRB 3GIJA 2W8KA 4QIVA 2HYIB 1QE1B 1M0SA 4KFBB 2WVEA 4MKAA 4ZPVR 3PIOQ 2MSTA 2PIIA 4WZQA 4ID5B 4PABA 1SH2A 2JLFA 4HR2A 4MKVA 2I9SA 5E3AA 1JKHA 1F9FA 2WCXA 1IKXB 5CYQA 4ZJQA 2JX2A 2LU1A 1RT2B 1TL4A 1T05A 3K57A 2FDNA 1S1TB 3KK1B 2K8GA 2AHOB 1I3OB 1LWFB 1GTEA 5LOQA 3CCJS 5DZ6A 3NCRA 3R97A 1OY9A 4YR3A 3OJUA 4A8SA 3FNNA 3Q89A 2IBOA 3FRYA 4F3OA 3Q8UA 4UTGA 2MKJA 5HROB 1VC6A 3KK3A 3KLGB 4ED3A 3Q8RB 4FYXB 5IC6B 4ES1A 4DL0C 3H42A 1NK7A 1U0SA 4C8YA 4PQUB 2XCAA 1HWJA 2KJVA 1OS5A 3OVSA 1J5EF 2OD4A 4NL5A 4NCGA 4DSFA 2PEBA 2NQPA 4J5OA 1RYSA 3VR1A 3MECB 4C3LA 1S6QA 2CDQA 1A9NB 4KGMA 1RWOB 1OO0B 1CG2A 1HIYA 2V2QA 3QT5A 4P2FA 5ADZA 4ELTA 5ITHA 2DHAA 2NR0A 3WX8A 3MEDB 2UXCJ 2YY3A 1VQ6S 4L74A 4CP5A 4RKUC 2E1MC 2Z56B 3D6FB 2DH9A 1GNKA 4UUXA 2IM2A 4BC7A 2B9YA 3OXGA 1J5OA 4B3SF 3E2EA 4DV4J 2DO4A 2YNFA 4HVZA 1QVFR 5DDOC 1F5CA 3DLEB 2AZ3A 2CRLA 3L09A 5D0EA 4PUOA 2YNGA 1RP5A 4C48A 4CM0A 4ZLNA 1U6FA 4J9PA 4DV1J 1DQAA 1YX2A 4C8MA 1CBKA 4DR4J 1QUPA 1V5IB 2H5IB 2CWKA 3HSDA 3BKUA 2BANB 4ECRA 4M5DB 2OJ3A 2R7QA 3NGKA 3M9NB 1U2RA 4JBCA 1N34J 4LSZB 2ZZMA 4MT1A 1HHTP 2DR9A 3TX8A 4AFFA 4X66J 5LSRA 3PW4A 2L9DA 4KGXB 3K5PA 3W64A 5FLXU 3W60A 2HZVA 2MHNA 2KHCA 3OJSA 3FSIA 4CT8A 4ED4A 2DK2A 1U25A 2GFFA 2VU5A 4HDGA 1JX4A 3BO2A 4UY8T 3ILJA 2KFZA 3JSBA 4ILRA 1RBLA 3CJ3A 5J2PA 3KMQA 4QBUA 1XMOJ 3QNWB 3GWCA 5DQIA 2HMIB 1YJWS 4LF7J 3MPDA 2PFFB 1HWUA 2F7VA 3PJWA 1BQMA 2ZUGA 1FERA 3DU5A 3QLHA 4OYPA 4ZLPA 3VAHA 2FY1A 4E0DA 2MKSA 1HMVB 3DLJA 1JXEA 3C66A 1VC0A 3GG1A 2GZOA 3Q8QB 4J9QA 1IR0A 1IWGA 3KLGA 1FT8A 1TMMA 4C11A 5B0GA 2QMWA 3TW0A 3J81U 4DFMA 1R3NA 1UPPA 4W92B 4DR7J 2PE8A 4LR8A 3R7SB 2D3ZA 1X4CA 3ADAC 3IMQJ 2C3PA 3MMJA 5DQHA 1KQGB 2HS0A 2WAQD 4MIAA 3SCKE 1FKOB 4DEZA 1T9XA 4OV1A 3WX4A 2JFDA 2VFRA 3VAGA 4AQYJ 1KNZA 1X8DA 1FFGB 4ITSA 4OFZA 3MM5B 3OUYB 4L72B 3RU0A 1AA1B 2EXUA 3R5BA 1VHIA 4P7TA 3MHYA 3KDOA 4P52A 4WBFA 5F8HA 4DFJA 4M94A 2VBWA 3DYAB 5HAOA 5A0YB 5KT7A 4OYBA 1S0NA 2YKAA 3SIPB 3NS7B 5AJ3J 2B7CB 1RUSA 2HVHA 2I38A 4K4SA 3M2RB 1O8BA 1JIHA 4CLKA 2R7RA 2CPZA 3C14B 2MLZA 4I4BA 1S6PA 2YH0A 1VQ7S 3MUVP 3PX4A 1Q53A 1RWNB 4MIWA 4ETXA 1Q5VA 3KYLA 2BABA 1M90T 2UUTA 4JI6F 4RX6A 1NJWA 1KTVA 1H38A 1NUEA 3U7JA 2M9KA 2ZC4A 3SZ2A 1ITPA 3N5FA 2CJ9A 3CD5A 5HVGA 3GIMA 1U49A 1CJVA 1S4EA 4G3IA 4ERDA 1H7WA 1DTTB 3UDCA 4WKYA 1E6YB 4DXLA 5DDQC 4NASA 4K4WA 3UD3P 2E5IA 3MCOA 4IG3A 1RT1B 2DIUA 2JRSA 1Y00A 2ZHOA 4ANEA 3TZXA 3CXCR 1JJ2R 3K0JA 2EBEA 3N6LA 2QYGA 4USHA 3H59A 3NKYA 4IG3B 5HMZA 3IS9A 5J1EB 5HJXA 3SBMA 2ZJQQ 2M0GB 1VMBA 2YNGB 4OYXA 2XO6A 1GTHA 3DLEA 1JK9B 3BN7A 5C24B 2GMHA 2LLZA 4S0MA 4DSIA 2HQIA 1TVRA 2E5HA 4Q7AA 1LW2B 2FB0A 4DV6F 4C7QA 3BF4A 4LSLB 1XNQF 4F2RA 2AMCB 1S9FA 1X4AA 1PBUA 1MROA 3CDWA 3VQTA 1VQNS 3M2RA 3OT9A 1QTNB 4OYIA 2LXUA 1B7FA 1SI9A 2V50A 1SKWA 3I9ZA 3DYAA 3OFHA 4P7VA 2B4VA 1M1KT 1BXNA 1XMQF 3A4TA 1ZAWA 2JJ4D 1H3DA 4G1QA 1X60A 2K1RB 4Y34A 4A8XA 5IM0B 2CNNB 3BSCA 5IV3A 3OR2A 4HDHA 3KK3B 2W7PA 4DV1F 1RWUA 4B9NA 3SEOA 3VAIA 3NAHA 5AE1A 2ZZNA 3DC2A 2RE1A 3EGZA 2IDEA 1S1TA 3HVTA 2PO4A 1T9YA 1N5VA 2ACYA 3CW2C 1BE4A 2UV8G 4C11B 4Q44A 1D8ZA 1H2TZ 4TU7A 2AGQA 5HLFA 4D3GA 3MMCB 4B3MJ 1VLYA 3JXOA 4JOUA 2M7SA 4DR2J 5F9NA 2KXFA 3C16A 4DPUA 2ACMA 4DV0F 1VC5A 3MAAB 3HP6A 2CPDA 2ZVIA 3SFUA 3VVUA 3ZXWA 5KT6A 5CZXA 2WSFC 4ETZA 2FHOB 2R7SA 2C3MA 3W8GA 4ZVSB 4ED0A 3N6MA 3ZZZA 4USJC 3HFVA 4RNNA 3W9HA 4FDFA 1N5TA 2F40A 2D7SA 1HPZB 3HD2A 4KKOA 2VFUA 3PYDA 4P2MA 5KFGA 3HCXA 4DPOA 2ZJRQ 1QUVA 2ZDOA 2VG6A 3SCJE 4C0HA 1RCOB 3GR1A 3LGMA 1KEKA 3DM2A 2XO7A 2OTLS 3TP2A 3ZZUA 3BKTA 2HGMA 3MF5A 3J7AN 3V6JA 4DBQA 3FK4A 3NG8A 2IRYA 2HIYA 1NPPA 1J5EJ 1UA0A 4I68A 4XDDA 4M5DA 3D1OA 2BANA 1BLUA 2EFOA 3BS9A 2UXDJ 3HT3A 4LFBJ 4C3MA 2V8DA 3BEGB 3LF0A 4O44A 1YQHA 2AD9A 1P1TA 2GQQA 4CNZA 3PIPQ 3W9JA 3KLHA 1I94J 1HD1A 1RHMB 4KQZA 5HMYA 4YDXA 1AUDA 1WEZA 3PY8A 1S76D 2FJVA 3M30B 2V4JA 4F3QA 1QVGR 4PQUA 2KG1A 1JLFB 1UP1A 3HHEA 1WSVA 5LSLA 4RBUA 1S77D 2PD1A 1G4CA 1JJ4A 4DL3A 1APSA 1DFDA 2D3OR 1JLAA 2DT9A 1J2VA 2KRRA 4KT0C 4F0KA 1N48A 4NCBA 3D1QA 1FRHA 1SV5B 5I3UB 2UU9F 3EM1A 4QIFA 1NJZA 2R8JA 4IYQA 3EGWB 5BXIA 3JS9A 3DXBA 4BWMA 4F04B 1U1PA 3QRPA 4KB7A 3AXMA 5K14A 2VOPA 3GSDA 1Z1ZA 1Y3JA 4RW8B 1UKUA 1UWBA 2MZRA 1LWCB 4JI8F 2UUAF 2RDDA 4J9RA 1GMVA 4U95A 3JAMU 4PXDA 2E9TA 2VODA 2BQUA 4DN9A 1REGX 4N47A 3G9CA 4X65F 5I3QA 2MKCA 1KOHA 3H2UB 5DQGA 2FJBB 2PA8D 2LDIA 3PW2A 3A8KA 3SSSA 1QDUB 1Y3KA 2XWXA 4A8MP 4G6VB 4FXVA 3M32B 4YB5A 1RA7A 1GAOA 1OQ3A 4A4JA 4LBIA 4BHQA 2OP5A 4GKJJ 4K7QA 4RO0A 4M5IA 1NDPA 2XNQA 3KUEA 2UVVA 1RTHA 4EO8A 1R0BG 3T9ZA 4YHHF 3KHHA 4OJGA 4RUBA 3KUHA 3Q2SC 1MG7A 4GC6A 1IUJA 3UNYA 2V4RA 2JOQA 1GMWD 2BJ1A 3QYYA 4CNYA 2IAJA 2D69A 3D9BA 3UFCX 1FFSB 1M5SA 4EK2A 1SH3A 5ETKA 3VAMA 2FVQA 2VBXA 4WU3A 1BUXA 3AQPA 4DR6F 3HK2A 4ZCKA 4TKTA 4UZCA 5K8PA 1U26A 2ZH4A 4KC5A 3DN9A 4H4KC 2DNGA 1LXNA 1YJTA 3OL7A 1SC4B 1OY6A 2RIJA 3K2YA 1N5YA 2HFSA 5HVFA 1PILA 1YSJA 2CFXA 4KHMA 4DV7J 3OHAA 5FDLA 1VQMS 2VB6A 1D0EA 3U27A 3MR7A 1BQXA 4JI3J 1UW9A 2BEFA 4GMKA 4WTOB 3TUPA 5T7LA 1WORA 2GJIA 1DURA 3I5CA 4HHUA 5A6PA 5KG5A 4ER8A 1Q7YT 5B0CA 3VQSA 2HNDA 4PG4A 5ETNA 3TYTA 1KQSR 2FJXA 4JI4F 2MHEA 2BUNA 2Z4PA 3HKWA 3MM8A 4FZVA 2C22A 3MMAA 5GAHI 2V63A 4A46A 1RTDA 1B64A 8AT1B 1JLEB 1HL6A 2IIHA 5IOLA 1T7PA 1F2GA 1HBNA 3DRPB 3JQKA 2CPIA 3GYNA 2GAGC 2N3OA 4ECQA 1KLNA 2J6TA 2Y8WA 2HBRB 4CO0A 1JNRB 1LWCA 1C0TA 2X1FA 2DNRA 2NUHA 1F3VA 2J8AA 4DR1F 2O5DA 4ECXA 1HNVA 3OTBA 2O01C 3ZZPA 1AB8A 2UUAJ 1GXTA 2VA2A 3M7VA 6FD1A 1WC1A 3IRXA 3GILA 3G6YA 1YDLA 2EFPA 4JV5J 4KR0B 1HQ2A 1NPKA 4ANDA 1UVLA 3D0IE 3VV2B 1ZPWX 4NYZA 9RUBA 1VFJA 1ACMB 3I4HX 2B56A 4DV3J 2NYIA 2I5JB 3W61A 3VAKA 4NXMF 2BVZA 2B4UA 3RG6A 3MM7B 2GHWA 1MMNA 2RUSA 3ZTQA 2XGPA 3ZNUA 3OV7A 2V9WA 2OEKA 3ZTRA 2GMJA 1ZA2B 1U1LA 2UP1A 4ZIWA 4P9SA 4Q0BB 2RB7A 1S1VA 4O0NA 4QYZJ 1R6VA 4ZDNA 2R7VA 1H98A 1S0MA 4PPZA 2IRUA 3MTJA 2M8DB 4B9VA 2W7OA 1VIXA 2AJ4A 2NXJA 2IM1A 3MM6B 5B0EA 5IZHA 4NZ6A 2C1EB 2FVCA 1CC8A 3M05A 3TJ8A 5D6GA 3KHLA 1SKSA 3TRGA 3B4DA 3P5BP 4F36A 3M2VA 2UVRA 4IO1A 1VQLS 4NLYA 4TY8A 4Z37A 3MMBA 2UXDF 3OW2R 3DLKB 4FBUA 3GQCA 2FZCB 4RW6A 1NHUA 1QAXA 3IG1B 1N4LA 3UW1A 2R8GA 3R6LB 4K5SA 2IM0A 4QW9A 4X64J 4F4AA 2XS2A 1HPZA 2CJXB 3WHIA 4JI3F 4FYDA 1NMEB 1Q8IA 4WP9A 2G2OA 4X4QA 2AU0A 3G6ES 2QIFA 4AL7A 2GHVC 1S97A 1IM6A 2HHQA 2J0XA 2PC6A 1VDHA 3IA0A 3MGJA 3BDEA 3OQ2A 4LBHA 2UUBF 4FPRA 1IKWB 2UUWA 3LOUA 3DGPA 2DPJA 4QCLA 4ATNA 4ES3A 1SQFA 4J9NA 2BM1A 3R7BB 1Y7PA 2DNOA 3OD2A 2F8MA 3GV8B 5KFIA 2JEGA 3MMCA 4NMLA 1CJTB 4V19J 1P8GA 4HYKA 2RS2A 3IFEA 3VGVA 2KM8C 1LXJA 2ZH1A 4XAKA 2B5JA 4CO5A 2VQFJ 3K5LA 2LEBA 1UETA 3EVOA 3N6NA 3AJDA 3QIPB 5L8RC 4CLLA 1RTIB 3OXLA 3GFZA 1WACA 4QWEA 2HHHJ 3AFGA 4H4OA 1FWKA 4LRDA 5KFNA 3DDNA 4G1QB 2PEHA 3BSAA 4K5RA 1FRLA 1FXDA 4TLRA 3MPUB 1NK8A 2MTLA 1DTQB 2J76E 2OHDA 3OTDA 1CVJA 4U96A 1J27A 1EAYC 1WSRA 2BV3A 3VCDA 3MFHA 5HP1B 3BQ2A 2CZ9A 4IR1A 1RBAA 1WHYA 4LJMA 2E66A 1SJFA 1U24A 4MYTA 2KG0A 2E9ZA 3MTKA 3QO9A 2ZD1A 3RBZA 3LWMA 2M70A 1IN0A 1TVRB 4NLSA 2R8HA 3MPWA 4LF8F 1LFPA 1X4BA 2P2CB 3U02A 1C1CB 2XLJA 3IO1A 4DV6J 1YJ9S 3RRGA 1RKIA 5L46A 1FESA 1RT4B 4TLQA 2HVEA 1D3WA 4Y00A 4CLTA 1XK8A 4XTTA 4DR4F 3PR5B 3NRBA 4N41A 2AEFA 1B0TA 1G1XA 1DLOB 2E9RX 3BYRA 3N9UC 2YWEA 4WXOA 4OHWA 3ZC4A 1UVKA 2DB1A 1KQKA 2FIUA 4CO2A 4Z7CA 4M8LA 1HBOA 2YKQA 3NCPA 2EEYA 3CB4A 1YJVA 2VG5B 2OGUA 2WB1D 1DLOA 2XLIA
chains in the Genus database with same CATH topology
2QRRA 2QLWA 2ZH3A 2WW8A 3ISZA 4ZP8A 2Z2MA 1VRUA 3DRSA 3CVKA 2ZH7A 3FZBA 1IKYA 4JV2A 2ZD1B 1S9EB 3LW5C 1OSCA 3R27A 3KLVA 4JYAF 4NXNF 4FF3A 1RT5B 1Q79A 4DL5A 5B09A 2R2RA 2LECA 1SUQB 2RQCA 2DNHA 3H2LA 3M1VA 1CQNA 1OPIA 3RYLA 3CD0A 1PC4A 5K8OA 4DV4F 5F41A 4HL9A 4KTQA 2KZMA 2VV5A 3AA8A 4OIXA 1WI6A 2H5EA 1SJRA 2W4DA 4OX7A 4FBTA 1RKJA 5C42A 1OPZA 4CH1A 3G6XA 2GHPA 3OTOF 1ZETA 5EHHA 2HAIA 4HH0A 1WG5A 1HMVA 3M8PB 1RAJA 5DDRC 2CJKA 2X3GA 2IVFB 1GX6A 2ZOGA 2HZCA 4QR2A 4QWBA 3L7PA 2ZH9A 4JI1F 1YJUA 4TU9A 2HFOA 2Q6CA 3H8YA 3TAQA 5A2QY 5I42A 2Q6BA 5CYMA 2CQ4A 2WBMA 3M2UB 4OHXA 2CQDA 1Q16B 3GMGA 2YTCA 3KWMA 3N28A 3PKYA 1SBRA 3FDSA 3MEGA 1FTRA 1X5TA 4IOAQ 4RW6B 1HYSB 1K1SA 3O44A 3DXSX 2HPUA 2RF2A 4TY8B 1W25A 5I3PA 3WDOA 3M2VB 1LWEB 2QLXA 2ADBA 1TKDA 3I4PA 2AYBA 2RRAA 5JVHQ 2OLWA 2AWZA 4OZ5A 5CHCB 4ZCMA 1SKRA 2LXIA 3S6EA 4ECYA 1NHVA 3ISNC 2LCWA 2QSFA 2MGZA 1C4AA 3ZZYA 3LANA 3BZQA 1HBMA 1SB6A 2J9CA 1D9DA 2DBBA 2PMHA 1K0VA 1KRPA 1VQ9S 5K5MA 3PO4A 1Y4ZB 1C0TB 1R8PA 5DO2A 1KHVA 2YKNA 1SXLA 1YRUA 1C1BB 2E44A 4BWJA 4DHVA 1FTCA 1QAJA 1IM4A 1ZAVA 3H5SA 1ULRA 4Y28C 4NLUA 5AJ3F 2C2RA 4DOZA 1U7LA 4X62F 1T05B 3SQGA 1MW7A 2IJNA 3ENQA 3RB4A 5F0WA 1PSDA 2RU9A 1P1LA 2NS1B 2HHWA 2DRBA 3KK2B 3MDFA 5IT4A 4A8YA 1FXLA 5A8KB 3CE8A 2IA6A 3RAMA 4DV5F 4RZRA 3BO3A 5AE2A 4OI1A 2FUG9 3HO1A 4DL2A 4WKRA 1HI8A 1S9GA 4ILMA 4K4TA 4C8LA 2ZH5A 1A7GE 3DOKA 2R7OA 5GADI 2M4MA 2B4OA 1C4CA 2ZBIA 1HHSA 4P6QA 3THTA 2BBEA 1R8HA 4CO3A 4FS1A 4USIA 1P6TA 3KMSA 5DGBA 1JXLA 4WCEQ 2XGQA 1QSLA 1Q86T 4FS2A 3TVZA 5KFAA 4LF7F 3QGHA 4DL6A 4F3MA 2DJWA 5SZTA 3FSXA 4UQGA 1WG4A 2FLPA 3SQGB 2KDOA 4JV1A 2A10A 2WRMA 2FHJA 1VOMA 2KXHA 4HEA9 2QA2A 4KHPF 3JAMY 4UUWA 5G0RB 1NKEA 2DGUA 2BQRA 3TOQA 2MYFA 3KLIB 5J2NB 4KV8A 2OTJS 7FDRA 4ZPTR 4HT5A 4HT7A 3CIMA 3PEJA 2HHHF 2X1BA 4NYPA 4OI0A 4B9LA 2CQ1A 1YRTA 1S1UA 3QGIA 2W9BA 1NK9A 3PNIA 4PWDB 4IQXA 3VAFA 3KG4A 4EUVA 2CQPA 3W2WA 1WNEA 1JJHA 3MUTP 4LF9F 1FDNA 3MEEA 4Y3CA 2BE2A 2YVSA 1VIOA 3CCSS 4TXSA 1IJEB 5HMXA 4ELUA 1JLAB 2FLNA 4FF1A 3NNCA 4RU9A 3DRRB 4ECUA 1UJ6A 1X4HA 4RW7A 1AROP 2HIQA 3V6DB 1ZPVA 4IDKB 4J37A 4ZPWR 3LH2S 3IAM9 4X4PA 1HBUA 1T02A 5AXKA 2RNEA 5JXSA 5L1IA 2MQNA 1S48A 5K8NA 1VK8A 3KLHB 2FLLA 3CWJA 5T41A 1MU2A 5BJRA 2J7KA 3FGVA 3UD4P 3CJ0A 2F9DA 2GMLA 4N8NA 1BQNA 4O4GA 4UY85 1U6BA 5J2QA 3DMJB 4I6AA 1X0PA 2HGNA 2M88A 4O23A 1UVNA 2VPWB 3CJ2A 4ZP6A 1FK9B 5KT5A 1V6HA 5E2QA 3QWPA 4PG7A 2XMWA 3DM2B 1FNMA 4Y2KA 1REVB 1KONA 3DOKB 4CO1A 2GW8A 2VG6B 2DH7A 3LP2B 1HARA 2HWHA 3J7YU 4FP9A 2W9AA 4URGA 3BJYA 2CQGA 2ZC3A 2RDJA 4KKOB 2KO1A 2C3OA 2MJUA 2YKPA 4I6YA 3M2UA 1TL1B 1I1GA 1WTFA 4IRDA 3JSMA 3KK2A 4H4KA 1VBYA 1R89A 3O3LA 5C25B 3TAMB 4I0WA 3J7ZT 2ILYA 3FEXB 2ZE2A 3OSNA 2VZ9A 1FJEB 2MZQA 3T5KA 4YFUA 4J9OA 2XY5A 4DSLA 4YP3A 4MKYA 2QA4S 2G0CA 1JLCA 1XMBA 2F1FA 4PG8A 3PRDA 3QJLA 2VL1A 2JFKA 5LMNF 2YKNB 3MXHP 2L08A 2R7WA 1DAXA 3BM7A 2K1RA 5IM0A 1ZYQA 3EZUA 2UVUA 4OZLA 2WSEC 3I32A 2JWNA 3MFIA 1NH7A 4F3OA 1FRKA 4Q8FA 1KVIA 1UL3A 2RH3A 1DQ9A 2XEXA 5KFXA 2DNPA 2Z0GA 4D3HA 4J9KA 2EK1A 1L5UA 4CTAA 3H5XA 3AQOA 5LL6d 3ENWA 2UXBF 5SUHA 5L1KA 2E5LF 2XI2A 1T3OA 1I6JA 3WBZA 3T6BA 1S1WA 3QAUA 3HZEA 4NYOA 4ZCLA 3ENVA 3OL9A 2FJDB 1X9SA 5D4PA 5IQ6A 1TK0A 3PX0A 2XY7A 2HGLA 1HNIB 4ZS6A 2HS3A 5BYSA 5MLCV 2J0SD 1WF2A 2IVYA 2J5AA 3B4MA 5KOXA 2OAUA 3W2VA 1FA0A 1HWLA 5KG4A 1TFWA 5HI7A 2K7JA 4PQAA 4QIWD 2FGOA 5GAGU 1MNEA 2CJBA 1JLGB 1LW0B 2VH7A 5B0FA 1L3UA 2NXUA 3MD3A 4EYHB 2GV1A 2KT5A 2N7YA 5CQGA 2AGOA 3IWLA 2OIHA 1CLFA 4OI6A 3Q8SB 1NRKA 3TVYA 4K4YA 3M4XA 3RRHA 3CO9A 2HVIA 3CCMS 2V94A 1U1KA 2LVWA 3R1HA 2M2BA 1H7XA 4KO0A 3E8OA 2KT2A 4URSA 4IOCQ 1BC6A 4CCHA 3I96A 4WFYA 5HMWA 4WTYA 3IBWA 4CH7A 1TV6B 2BACA 3MM5A 2VKRA 1KTQA 4IOBA 2LDYA 4TYAA 4WFNQ 2KZZA 3SDEB 3EZ5A 3E01B 1URRA 3GFYA 2AYGA 3S1TA 5LT5A 2VA3A 3BO4A 4ED1A 2XS7A 2EVZA 3DNCA 1NKCA 2MY7A 5KFPA 4H4MB 2HHUA 3ETOA 2CPHA 2OFHX 2POKA 2EFVA 1XTZA 3BSNA 5CA5A 4FXWA 4WXWA 3RR8A 1F5AA 2XSJA 2RMLA 3AAWB 3TUIC 3H5YA 3IAS9 1IKVB 1WHWA 3OHBA 4E8UA 3Q23A 3TI0A 2EI5A 3CGIA 1NO8A 5KFBA 5GAHU 3RAQA 1IKYB 1KLMA 4ZP7A 1IBMF 1XEZA 2M3DA 5CD4H 1G3OA 2FD2A 1RTJB 4Q45A 2A2CA 4KIAA 2VQFF 3TANA 1YVFA 1L3TA 4QCLA 3V5RA 3KG0A 3CC7S 1XWLA 2VG5A 1ZAXA 2W7AA 2CPFA 2ROEA 4ZP9A 4F4YA 4LF5F 7FD1A 2UZAA 4DJBA 4DLEA 4QZVB 4OX8A 2B4PA 3ZZOA 4DLGA 3MD1A 4EWTA 3CULA 1HNIA 1IQTA 2NPFA 2DGVA 4AE5A 4B3TF 4IH5A 2YNFB 4HI1A 5KFQA 5KOWA 4QWDA 1TK5A 2XMMA 3EGNA 4KSEB 1R0AA 3ZZ0A 1CPZA 2Q1LA 4Z2XA 4TU8A 2R7UA 4X4NA 3PO5A 1ZH5A 1LQ9A 3FSYA 2ASDA 3SV3A 4TQSA 2C2DA 2R8KA 3QO9B 2YWHA 1R31A 3NMAA 3MEDA 2V0NA 1WEXA 3LWLA 2GCFA 3M6WA 5IXUA 2WK4A 2GO9A 5HP1A 4Q8EA 1FHTA 2XB2D 1M5PC 1IBKF 2KFNA 3LP0B 2HHPA 1U48A 1DJ0A 3DI6B 4NCGB 4O3RA 2ZITA 4I69A 4YQWA 3V81A 4Q2MA 3LUYA 2XWYA 2FJAB 4F4WA 1K8AT 3F44A 5HROA 1KS2A 4OQJA 1DRZA 2X1GA 2IMWP 5LJ5Y 2VASA 2E29A 3CT9A 4DSJA 1HBNB 3DRPA 2BDPA 2B5JB 4PXBA 2EG2A 3K58A 3KG1A 3N01A 5JJBA 1P27B 5D4LA 1SH0A 1QM9A 2EK6A 1BWEA 4R8UB 2JH3A 2HNDB 2WB4A 4QQBA 3I5BA 4LQ9A 3SI8A 3V4IB 3ZFVA 1LKZA 1V3ZA 3FMBA 3PDNA 2KM8B 2LYVA 5KAKA 4XO0A 3JSMB 1NK4A 1W2IA 4ID5A 4BCAA 2KN4A 4F25A 2YNHA 1C0UB 1FO1A 4Y6IA 4B3RF 4B02A 2BYCA 1TKTB 3B82A 4PR6A 1UA1A 3KLFB 4IH6A 1REVA 3FEZA 2HHVA 3R5CA 3A1YG 3UCZP 2DR8A 4ZA1A 2OPPA 2OPSA 2UUCF 2DNMA 4RW4B 4MTPA 2P6TA 1TKXB 4ECTA 5B0BA 2EWHA 1PO6A 2GA7A 2LQ5A 2UVWA 1EP4A 4RWXA 3CF5Q 3I0SA 3IC1A 4A8FA 4LIWA 2F4VF 3OFFA 2PN6A 3ITHB 1D9FA 2N82B 3S8SA 1SJ3P 4YMEA 2DGWA 1FE4A 2MPUA 3R3TA 4ZKAA 2RUGA 2DHGA 1ZM4A 3SXLA 3KLEB 2ASYA 2WONA 3KFWX 4DN0A 5IWAF 5KTQA 1LFWA 2G9OA 3M8RA 2PT0A 4IFYA 1Y5IB 2VBYA 4RW8A 1S1UB 2QSWA 4ZOSA 5E3PA 4U67Q 2W9BB 3QGGA 2B9WA 2MDAA 1XR7A 3LO3A 4IFYB 1WHVA 5F8LA 2ZHBA 2FGCA 4OJHA 3T5JA 2CG4A 2LU2A 4MAKA 3F73A 1HW8A 2R4FA 4NZ0A 1S1XA 3SSRA 1D1UA 3PFEA 2Q43A 4KBIA 2ZNZA 4WFZA 4DF4A 1VBXA 1T03B 1TFYA 4YUDA 1X7VA 5EN1A 4OZ0A 3SFGA 1U1MA 1NJXA 2V4JB 3TQ1A 1EP4B 3M30A 3TO8A 3ZZTA 4K4VA 2A2DA 2GC8A 1F5BA 4ZVHA 2Z2LA 4UOCA 1RT7B 3QZ8A 4CQ1A 4B9UA 4EU0A 4G1IA 1FXRA 3RR7A 3JYTA 2AJ1A 4BS2A 3M6UA 1HQUA 1TUVA 3HZGA 2RS8A 5GAEI 4NLPA 3OSPA 3MOJB 4K4UA 1HNZF 2NREA 2VBZA 2V4QA 1NKBA 4B08A 5DM7Q 5KFRA 3CCVS 2ROGA 4ZCIA 3GYXB 4EZ6A 5KFWA 3PJXA 2DTJA 1VI7A 4JV0A 2JEFA 3GFXA 5GVQA 5A8KA 3KOAA 4GC7A 3T1YF 5D8HB 2W24A 3ICLA 1FDBA 1O51A 2RVJA 5L9NA 2XS5A 1UFLA 4KHRA 2O3DA 2KXNB 1M5HA 5IS2A 2O66A 1X9WA 3M32A 2MMYA 4G1PA 1ZM3A 3OL8A 3RBDA 1Q1KA 3O1LA 2QYCA 2E1CA 3LQVA 5BYRA 3VWSA 3DOMA 2FHKA 1BGXT 4I2QA 2QV6A 2ADCA 2R7TA 4HTJA 2WOMB 1WEYA 5D77A 5DG7A 2VOOA 1TR0A 1VRTA 1UWBB 3K5OA 1Q4RA 2RILA 2XULA 1S10A 4PPDA 3U1NA 3T19A 3R5AA 2IHR1 4ECZA 5DG9A 4A8OA 4PXEA 4WYWA 2XZWA 4OHVA 1K9MT 1FDDA 1GT8A 1FKAF 1SV5A 1U4BA 1MROB 1RDRA 2YQ3A 4ED8A 2DGOA 4X84A 2RQKA 2D41A 2CVIA 4TQRA 2MGZB 4WE1B 2CPYA 3QJJA 3KHRA 5KFOA 4LSNB 2EFQA 4RBVA 2ZBCA 1R0AB 2BRKA 5J2MB 3POTA 5KFYA 1DZ5A 3BQ1A 4N76A 1S99A 2E7WA 3G6VA 4U7UK 3TNVA 3VF0B 4NLRA 4NLVA 1Q78A 2DRAA 3C46A 4DX8H 2XCPA 1HYSA 4DS5A 1JLQA 3MR6A 2AX1A 3MEGB 4DG1A 2OPQA 4Y2AA 2W25A 3J81Y 1QAIA 3MWBA 1KLMB 5DGAA