3KG1A

Crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
ADEVTFVNRFTVHGAPAEFESVFARTAAFFARQPGFVRHTLLRERDKDNSYVAIAVWTDHDAFRRALAQPGFLPHATALRALSTSEHGLFTARQTLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SnoaB
publication title Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism
pubmed doi rcsb
source organism Streptomyces nogalater
molecule tags Oxidoreductase
total genus 26
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature ec 1.13.12.22: Deoxynogalonate monooxygenase.
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kg1A00
1RJJA 1YJRA 2XMUA 5T7LB 2RSQA 2BYCA 1S6OA 1W2IA 2L3MA 1TUVA 1FE0A 3VTIA 1TL5A 5B0CA 3BN7A 1X8DA 2QIFA 2GGPB 3BM7A 1YJUA 3LGMA 3KNGA 4OJHA 3KG0A 4Y2IA 4A46A 4F67A 1FD8A 4HL9A 2KYZA 2ROPA 1Y9OA 3QMQA 2K7JA 3I9ZA 1WD6A 4NL5A 1AFJA 1S6UA 2GGPA 2K7KA 2PD1A 3E8OA 1R6YA 2ZDOA 3TRGA 2GO8A 2QLWA 1TL4A 2OD4A 2QYCA 1KQKA 2BJEA 1Y3JA 2GA7A 2HFNA 4DN9A 2OAUA 2KT3A 4HH0A 5B0DA 1SB6A 4HI1A 1Q4RA 2ROEA 2FIUA 3MZIA 1Y0HA 5B0FA 2OD6A 3WDOA 2XMKA 5B0BA 4NPOA 2BBEA 4DL0C 5KAKA 1N5TA 1K0VA 1VQSA 2BUNA 2IFXA 4Q2MA 2FB0A 2N7YA 4YDXA 3DCAA 1OPZA 2EW9A 4Y2MA 1MWYA 3BGUA 4EFAC 3K7RA 3QGPA 1V3ZA 1CC7A 2OFHX 1YRXA 5B0AA 1FVSA 5T7LA 1TZ0A 3BDEA 3HHLD 5B0GA 2VH7A 3TOQA 4A47A 1URRA 4OIXA 2OP5A 4FNHA 2RU9A 3DXSX 2XMMA 4ZOSA 2XMWA 2ACYA 2QLXA 1FVQA 2K1RB 1MWZA 3KG1A 5B09A 4HH1A 1AW0A 2LQ9A 2XMJA 3CJKB 2W4CA 2HIQA 1Y3KA 5B08A 2IYIA 2XMVA 3HHLC 5A6WA 1YJVA 2KT2A 1OQ6A 1Q8BA 4Q2LA 2RMLA 3HHLB 2CRLA 2ASYA 4YEAA 1SQEA 3CJKA 3T9NA 1TR0A 1VQYA 2JDJA 2AJ0A 2HLTA 2OKQA 2ZDPA 4ZA1A 3UDCA 1KVJA 1SI9A 4OJGA 2LDIA 4A4JA 1XBWA 1ULRA 4QOTA 3IWXA 1X0PA 5IXUA 4OJ3A 2AP6A 4HI2A 4DPOA 3BF4A 2FTRA 3HF5A 4Y2KA 1Q53A 1Q8LA 1X7VA 1CPZA 1KVIA 2GFFA 2AW0A 2W4DA 1YJTA 4A48A 1N5QA 2OMOA 1APSA 1YG0A 1FEEA 3HFKA 1P8GA 3HX9A 1AFIA 2BJDA 2AJ1A 2PGCA 2VV5A 3FGVA 3BR8A 2LXFA 4FNIA 3FMBA 3HDSA 5F0WA 1N5SA 2IYGA 3BB5A 2ROGA 3LO3A 2HQIA 2K1RA 3MCSA 5B0EA 3F44A 1FESA 1JWWA 1CC8A 2GCFA 1U7LA 1P6TA 2HFOA 2G9OA 2HLUA 2FHMA 1GXUA 2K2PA 3GZ7A 2N4CA 3LGNA 3FRYA 2GV1A 2OFGX 3TNVA 5K9FA 1GXTA 2KKHA 3KKFA 1QUPA 1N5VA 2W4PA 3HHLA 3IWLA 2XMTA 4U9RA 1FE4A 5A6PA 5F0UA 2Q3PA 1LQ9A 1OQ3A 1JK9B 1OSDA 4OJ1A 1IUJA 2N4DA 2LQBA 2RILA
chains in the Genus database with same CATH superfamily
5J1NA 2MJUA 2XMUA 5ETRA 4FZVA 3TARA 3JB9k 2H4WB 1VRUA 4UOHA 3BPDA 2HIYA 4RUAA 2FLPA 3KG0A 4LSLA 3CEDA 1KHVA 4KAIA 2ZDOA 2L41A 1G6BA 3VR1A 3IP0A 3MZIA 4NLGA 3R6LB 2F8MA 2RIJA 1LW2B 2IAJA 4FPRA 1DAXA 2VFRA 2JC1A 2O3DA 2ZHAA 1Q82T 2DGUA 1R6VA 1ZZNA 4PYDA 2BE2A 5F8GA 2IVFB 2DRAA 1O6XA 4ZA1A 3IM8A 3M2RB 3LF0A 2VG5B 2GS8A 4OJ3A 2BE9B 3I0RA 4OX6A 3FZ2A 1VQPS 3AXKA 3EICA 4X65F 4CH1A 4QPXA 3DOKA 4DR1J 2B0GA 1G1XA 5KG6A 5LT5A 2VHGA 4B17A 4FS1A 2XCPA 3PACA 1SJ4P 2A2CA 1HBOB 3D9BA 3NGSA 4FVCA 1W2IA 3HZGA 4C9DA 3MMAA 1XNRF 3PW5A 1H72C 3PEHA 2DTJA 1ZM9A 1WHVA 2HK2A 4JYAJ 3B78A 4MMOA 4ZCKA 1NSAA 4KH0B 3D6HB 2V8GA 3KYLA 3UW1A 3KK2B 5GADU 2R2TA 2E1AA 3TOQA 1I94J 4U8YA 4P7VA 2UXCJ 4J5OA 2Y0SD 1CJKA 2HFUA 3NGTA 2LU2A 3QIDA 3DRYA 3IWXA 4HI2A 1QAYA 2J7UA 1TL1B 3NBPB 3HX9A 1B7FA 2YX7A 5KFPA 1NZAA 1P27B 3R97A 2E5JA 2XNRA 4JI0F 4DS4A 1B0PA 1CULA 5CA5A 3JQMA 4TY8A 2XLJA 2RHSB 4X2BA 2R7WA 1WOPA 1RT2B 1P9QC 1KP6A 2UUAF 5IV4A 3BN7A 4ED5A 4UUWA 4LF9F 1OSCA 4IFVB 2HHXA 1HWLA 2AQ4A 3PG9A 2B8PA 4WJBA 4RW4B 3QLHB 4RNNA 3A8IA 2CPHA 4JP8A 4PG4A 5G4DA 1KD1T 1CJTA 3VAHA 3BKFA 2NXJA 3F73A 5L38A 3KMQA 3NRBA 3IG1B 2XCAA 3IAM9 3UDCA 3G6VA 4C11B 4Z2XA 3TVZA 4ICLA 4TKTA 1HBUA 1L3VA 1JKHB 1UKUA 4ECUA 3AOCA 3M32B 1C1CB 2J6UA 3ZNJ1 4WE1B 1PYSB 5F9LA 2XYGB 4GKJJ 1SV5B 5HQLA 3G82A 2CWKA 2DD8S 4OLPA 5HP1B 2FZKB 3IA0A 1KDNA 2X51A 3TYTA 3UQSA 1UJ4A 3UI3A 2YWHA 4HL9A 3KFWX 2CPIA 3L7UA 9RUBA 2R8KA 2Y9HA 3LANA 1NHUA 2D41A 3NNCA 2JLFA 1D8ZA 2G2ZA 1TMJA 3C14A 2LP4A 2EXUA 2XYHB 3D66A 2W2OP 1Z1ZA 1EKSA 1UA0A 1RTDA 2NYIA 4ER8A 4CTAA 1JXEA 4DR3J 3T1YJ 2OP5A 3HHKA 1VQKS 1RTHA 4DV5J 4CLWA 2ABYA 2VPZB 4TN2A 1RKJA 1RAJA 3IFEA 1H38A 1P9YA 5GAGI 2KYXA 4OYOA 1ULRA 3D67A 5E3PA 2IRYA 2LYVA 3VAKA 2V2QA 5E3QA 5ETLA 3LP1A 4G6VB 1WHWA 1UFKA 3Q8UA 4DR5J 4ZN3A 1S1XB 1HNWF 2YNHA 2DGXA 2QRRA 2BXJA 1S6QB 1XMBA 4RLEA 4EEYA 1S9GA 2VFSA 2OPPA 2LA6A 1JLAB 2K06A 4WZQA 1JB0C 2Y3YA 1C1BB 4DV4F 1BLUA 1WD6A 1S49A 1HARA 1TL4A 2KXFA 2Q79A 5F9NA 3DGVA 2H5EA 4RBVA 5IS2A 3NS7B 1IR2A 3UN2A 2AYGA 1UAWA 1MLAA 3H2VE 3W9IA 3R5JB 2YWKA 5A8KA 4I1TA 2D7SA 4JI6F 5K8PA 2VPXB 5KFVA 3ISND 2DNMA 1WTFA 4WIIA 2OPRB 2BM0A 2MSTA 4AD6A 2RQ4A 2CPFA 3OR1B 4ED4A 1RAHB 4OHZA 3LWLA 5A0YA 1IQTA 4MFBA 1Y5IB 1UEVA 2DNGA 1D3WA 5EX3A 3MUTP 2I6WA 3MEGB 1NH8A 4HDHA 4Z7CA 1N5VA 5AT1B 1N8RT 1GH8A 3CMQA 2DNNA 1IUJA 2HRYA 5A2QU 3OHAA 1SL2A 4CYUB 1NM2A 2SXLA 1N88A 2V6AA 1ZAWA 2OGUA 4DS5A 4DPYA 2AYEA 1M5VC 1QAXA 4NL5A 2ZH2A 2OSRA 2W2MP 5CYQB 1RTZA 3M1VB 4DN9A 3BBBA 1IBMJ 2ZM6F 1U45A 3MEDA 2FZCB 2U2FA 4IDKB 1S1WA 2BQUA 1GNKA 2HBQB 2CJQA 1FJGJ 1PBAA 2V9KA 3ENVA 4KHRA 5DJBA 3MAAA 4ALZA 5LMUF 1AUSL 5J1EB 1PCAA 3QFWA 1RWUA 4E8UA 3GIRA 3PR4A 4MJKA 3H2LA 4B9VA 1LW0A 1V3SA 2MQPA 4IQXA 5L46A 3N01A 1H74A 5HN0A 2CJAA 1OJ4A 2ZE2B 1I5OB 3RJMB 5HMXA 1IR0A 1JNRB 1Q8KA 3TQEA 2OEMA 4AXIA 3RBDA 1M90T 4RU9A 2OSQA 4I2PB 3P5TL 5J2QB 3MECB 5D0HA 4A8OA 1QY7A 3CW2C 2UUBF 3CDUA 4WP3A 5KFWA 4LRFA 2OAUA 4NLUA 3FVYA 2IMWP 1FK9A 1RK8A 4MH8A 5DLFA 1UW9A 3M6XA 4K7QA 1Q5YA 1YRXA 4NCBA 3GPAA 3S01A 5DGBA 4DFJA 2I2YA 3W2WB 3QT8A 2CQHA 5J2MB 1FNMA 3DU5A 3CJKB 5MAOA 3KLHA 1JJCB 2HBRB 1WKKA 1LFWA 4MT1A 2G13A 4KHPJ 1FO1A 2LDIA 2VG7B 2KTQA 1NSQA 1CVJA 5A76A 3VGUA 3DLEB 1S0NA 4DR7J 3RRGA 1E6YB 3R6GB 4ZLPA 2QEXS 3LO3A 1FNOA 4LSZB 2VQEJ 2UXDJ 2K2PA 4KC5A 1RKIA 5ITHA 1NKEA 4RZRA 3DGPB 2UUCJ 4U6PA 3EZ5A 1NRKA 1FRHA 2XZDB 3Q8PB 3QRPA 2UV8A 2B4PA 2RNEA 3H5YA 4ANCA 1HNIB 2F4VF 4KIAA 4PWUA 1Z2ZA 3CB4A 3H98A 2G2OA 3I6PA 2QLWA 5HVGA 4DV1J 1U1NA 4PQAA 3K5LA 3V81B 2CVIA 1OPZA 1V9OA 4LFBF 3MFIA 3PRDA 2FLLA 1N52B 2ADBA 5HBMB 3KLIA 4DV7J 2BW7A 1QUVA 3KHHA 4P2XA 1N33F 2J9DA 3HHLC 1HA1A 1RU1A 1RTJB 1BUXA 3KHGA 2AEFA 1RT7B 2IBKA 3UNGC 2MQMA 3SYZA 3CF5Q 4DCPB 5IXUA 2LEPA 1AZSA 3QFHA 1Q8LA 1S0VA 5F8HA 1UTAA 4DFMA 3UVJA 1UZHA 1IBLJ 2EBEA 1RHUB 3KKFA 3A4TA 2DO0A 2W4PA 3BGRB 1UZDA 3JAMY 1FFSB 4P10A 4KRWA 3IS9A 1RBAA 2WB1D 2JFDA 4BCAA 2BYCA 4F0HA 1FRMA 5DQHA 4V19X 3UE2A 4PQUB 1S76D 3GV8B 1NJZA 3H42A 2XQCA 2GHVC 3A3OB 3IWNC 4QYZJ 2VC1A 2IY5B 4I6WA 2MKHA 2MSSA 4USVA 2EFQA 4W4MA 1VQSA 2KFZA 4Y65A 4JI3J 2DHXA 1RA6A 1S99A 2PIIA 4NLOA 1LNQA 2CPJA 4QYZK 4QZVB 5IOLA 2ZKTA 1T9VA 3JTOA 3UR3C 1WELA 3TP2A 3K2YA 4K4WA 1N5YA 1SH2A 2QMUB 4W92B 2VOPA 3IRWP 4J9PA 4URQU 1K8AT 2CDQA 2ERRA 3OLBA 1EQ0A 1Y11A 4IH6A 3KLVA 3QAEA 4WK1A 2C2MB 1GTHA 2DKOB 3FMBA 3PHTA 2EK1A 3RB4A 3RU0A 1X4EA 2F9DA 3MGJA 4K4TA 3QO9A 4JI0J 5L9XA 2R7UA 1F1BB 4BWJA 3PO5A 2KG1A 2PA8D 4K4SA 1Q95G 3UN3A 4CM2A 1ZETA 4CCHA 3CJ5A 3RB3A 4DI6A 3E3XA 5C25A 3M8PB 1PG5B 1NK0A 2OD4A 4U96A 4PUOB 2HWTA 3VZIA 4UF4A 2DEJA 4IH5A 3DC2A 3OVAA 1OO0B 5JMNA 4P2FA 4R8UB 4PG6A 2GO9A 1HIYA 2WVBA 1DY3A 3W9JA 1SKRA 2DGWA 1RT4A 1CEZA 2W9CB 2NUHA 1BXNA 2ZZMA 4ZITA 4K4UA 2FC9A 3CD6S 3RG6A 3TX0A 2ASYA 3H4DA 3QBCA 3J7Z5 1ZZFA 4NMLA 1XTZA 2HS3A 1MN7A 2BKPA 4DMZA 2V34A 1RDRA 4QQBA 3BR8A 4RU2A 4V1Ak 1YIJS 4QR0A 5MLCV 2AZ1A 1HW8A 5CCMA 3U27A 1X60A 2H4YB 1D0EA 2ZJPQ 4KY3A 3CMES 2JNJA 5IT9Y 3MM8A 1JLBB 3CJQA 3L9ZA 4I7FA 3G86A 2FJDB 1HYSA 1WI6A 3RAQA 3PKMA 2B9XA 3RB6A 3EXYA 2R8GA 2LECA 2VICA 2MKCA 3DRRB 4O3SA 4OYZA 3KNAA 3MEEB 3UDEA 4X4TA 3IBFB 2W7PA 2VDHA 4ZJOA 1T0TV 2DNQA 4OX8A 4HH1A 1RT6B 4QU7A 4ECWA 1PAEX 1VQYA 2DNLA 2AGQA 2QSFA 2MKIA 1S0OA 1KQGB 1RTIA 5KFSA 2B7CB 3OVBA 2B43A 4YY3F 4O23A 1RACB 2B9YA 2ZD1B 2XLKA 4JUZA 4WPAA 4JI4J 5CAAA 4NYPA 2IHR1 4M5DA 3BB5A 1Y10A 4ECYA 2DGVA 2GNKA 4OI3A 1YSJA 4WFNQ 2BJ1A 1OSDA 1EIYB 4B3MJ 1H0HB 4PXBA 2VC0A 1IKVB 3C15A 5GAGU 1LXNA 3P96A 3H5UA 3U7JA 1REVB 3BM7A 1U0HA 2WVEA 4G1PA 4NXNJ 2LEBA 5SUHA 1R6YA 1N34J 2JH3A 1Y0HA 2ZBRA 2B9WA 4IR1A 4K4YA 3BGLA 2EC0A 5C2GA 1NHVA 5C2CA 2WRMA 1IKYB 5AXMA 1U2FA 2XMWA 3WQPA 1RB0A 2W7AA 2PO4A 4LR7A 3UDVA 3HO1A 2K3IA 1D09B 3C6UA 2HMIB 4WCEQ 2MB0B 3POTB 4CI0B 2HQ3A 4ES2A 3GP9A 3VGVA 5M2UA 2YPYA 4QBUA 1SUQA 4QWAA 2MEWA 1N4LA 1JX4A 3ENWA 2V0NA 3D1OA 3MTKA 3OT9A 3UFCX 1N54B 2AJ1A 3QZ8A 4CLYA 5M2PA 3SCLE 4MKVA 2BR0A 3BGOP 1KS2A 5AXLA 3FDSA 3TNVA 2IRUA 2VD3A 4DXLA 3QYYA 1TK5A 4OYXA 1HBNA 5IT4A 4DV0J 1LWEB 3T9ZA 4DR6F 2OUGA 2VL1A 3BO3A 2W7OA 4DR4J 3BQ2A 2DHAA 1SBRA 1TQLA 4W98A 4QWDA 2HSEB 3C8YA 1Z4UA 2C2KB 4I64A 4CO1A 5THWA 3R5AA 2ZOGA 1Y5LB 2Q6BA 4NLQA 2VG6B 1R0AA 4YDXA 3DOLB 5C24B 1K9MT 3ZFVA 2HZCA 5HMYA 1GFWB 1KQSR 3AQPA 1IM4A 1J5OA 1U0SA 3DM2A 1WNEA 4PZVA 4FBTA 1UVLA 4K5RA 1X9MA 4OI1A 4HT5A 3GCWP 4K50A 3W9HA 4EYIB 4Y2AA 4TXSA 4V19J 1JLQB 4ZJQA 2LVWA 2V50A 4C8KA 2GV1A 3TVKA 2P2CB 5BJRA 3LP0A 2IIHA 4B3OA 2E5GA 4LRCA 3BREA 3H8YA 1PIEA 2HFSA 3JSMA 2CQ0A 4DX5A 2B8QA 1PO6A 1J5EF 1FDNA 4GVBB 5HVFA 4FF1A 1U1MA 2FQQB 1NMEB 2M88A 4GO7X 1F6TA 5I3UB 2CZ9A 3TAPA 1URRA 1MW7A 1VK8A 1HNVB 5KT4A 5F8JA 3QGGA 2GVDB 2E29A 4LF5J 4FXWA 2DGQA 3OW2R 1F9EB 1TV6B 1O51A 2OHDA 1Q0NA 3K59A 1SQEA 1QSSA 1G2EA 4QIWD 1X9SA 1UMJA 3CCUS 3WIUA 3OTDA 1LW2A 3NMRA 3ISZA 1KOHA 1H7XA 3OJSA 3HXMA 4PWDA 1KFSA 4NRTA 2FVQA 2GCFA 3M2VB 2YQ0A 4DZ6A 1B7YB 1YWXA 3EVMA 1AA1B 1RSCA 4QW9A 2BABA 3PR5B 3M2RA 5FDLB 2ZJQQ 1QM9A 4N8NA 3SBMA 3CGIA 5GAEU 3Q24A 4DU8A 1N0VC 4G1QA 4FPIA 1E6VB 2GGPA 3TRGA 2Y1LB 1MROB 2AKWB 3R2CJ 4P2MA 2VKZG 5ETQA 3WDOA 1NO8A 3M7VA 3OL9A 5FLXY 2XO6A 1WF1A 3JQJA 3A3NB 4WKYA 5AE3A 1HBOA 2FJVA 1LXJA 2VPWB 1MU2A 2MZJA 1S6PB 2HQDA 1R43A 4GMKA 3K89A 3SFUA 2OTJS 1S7IA 1BQMA 2ZOMA 2XMVA 2J7WA 1T11A 4KQZA 4OJGA 1NUEA 2R7TA 3PV8A 3SDEB 3KK2A 2C2OB 3M8YA 5KFMA 4U7UK 1G4CA 3OFGA 3MURP 4YOEA 3OL6A 2BJ7A 3G8SA 3TANA 3LGNA 4ZKAA 4K4XA 2EC2A 4E2FB 1YGYA 3QPIA 4OYPA 3AD8C 4K2JA 1GMWD 2ZEJA 3PZPA 1H6KX 2RILA 2HWHA 1VQLS 3ILJA 3VAGA 2R7VA 4DV3F 3NBPA 3CDBA 5F3TA 1YTYA 3LGMA 2KH9A 5HMWA 4RW9B 2UUWA 4ATNA 2XGPA 2B5JB 3PRVA 1N5TA 3V4MA 4AYBD 3K5MA 1RT2A 1X4DA 2VH7A 2MZQA 4OIXA 2CQPA 4ZVUB 4CLKA 4FNHA 4FYXB 4IFVA 5KFAA 3GIJA 2BJ3A 2LQ9A 2QV6A 1MG7A 4RW4A 3DRPB 3QLHA 3ZZPA 4DX7A 1UJ5A 2UVVA 3EGVA 3OVSA 3Q0AA 2UZAA 1U09A 5SZTA 1ZAVA 1WKLA 4DUYJ 3FZBA 1GAOA 4AQYF 1LFPA 3HP6A 3MD1A 3HDSA 2VJUA 2CJKA 1RP5A 1URNA 2QFIA 4CO3A 1ZS6A 3THTA 2DHHA 3M6VA 2V8VA 1O8BA 2NXCA 4CT8A 2CQCA 4C11A 3VAFA 3NY0A 1RAGB 1RWXB 2R8JA 3TA0A 4MKYA 1JKHA 3GJTB 3FEYB 1NDPA 1U2CA 2W2NP 2AD9A 3M32A 1C1CA 2CQ4A 4WE1A 1RCXB 2COLA 4QU6A 2V4JB 3MM9B 1SV5A 3W66A 4J9VA 3W63A 1ROFA 5DDOC 4H4OB 2V8HA 2RD5C 4OYMA 5HP1A 2UVUA 2GIQA 2ZHOA 1A6LA 4EBDA 5DZ6A 1VHFA 1TFWA 4C3LA 2KT2A 4UW2A 1RQ0A 2RKIB 2L9DA 2MY7A 2FVPA 4QOTA 4KGXB 1F9FA 4O44B 1WHYA 1CBKA 3CD0A 1GT8A 3TZWA 2ZH1A 4PXDA 2PGCA 2GW8A 3CPWR 3D1QA 4DV6F 3D4JA 4X66F 1R89A 2HYIB 5K9FA 1UJ6A 4USWA 2PA3A 3K17A 3WX8A 2YH1A 2QYGA 2WB4A 3HSDA 1PILA 2XG8A 3A3PB 2CPYA 3PO4A 1RLDA 2ZOFA 2HZAA 3TUIC 4YUDA 3GYGA 5LSLA 4KYZA 2E7XA 4M5MA 2LEAA 3OUYB 1TUWA 4ZVGA 2HFNA 4LT6A 1S1XA 2OD6A 3GFZA 3TQ1A 2AIRB 1UVIA 1S6QA 4HEA9 1JLAA 5KFNA 1C1BA 5LJ5Y 4XK8C 1AW0A 3GYXB 1TTHB 4JI1F 5BYRA 3U1LA 4WFZA 2E5IA 2PDAA 2GZOA 3BF4A 1VK3A 2VUGA 1KVIA 1ZM3A 1XMQF 5I42B 2YKNB 3FC9A 4ZP9A 2HQCA 3KJFB 3KK1B 2BA9A 3AOAA 1JIHA 1ZA2B 2FGCA 5GMDA 1YI2S 2NPFA 1TKZA 5E41A 3S7RA 3N9UC 1PJ5A 2AGOA 3KK3B 4LF7F 4NXMJ 2L3MA 3OR1A 2HGLA 3UPFA 4LFCJ 3RW7A 3BR9A 2E1CA 3MR5A 4KV8B 1FNXH 5KG0A 3T5KA 5JUMA 1SJRA 1JLGB 1XR7A 4M5HA 2Z2YB 5ETTA 4CYUA 4CLZA 1A9NB 2AEMA 4ZK7M 3NGDA 3DYAA 2BVZA 3OSPA 2MY8A 2ZUAA 1RHQB 2YNIB 3BBCA 5CYQA 3MCMA 4ZN1A 3M1VA 2E44A 2AJ0A 5HAOA 2NXNA 4RW8A 5C5JA 4XPCA 4IDKA 1HD0A 2C3YA 1NKBA 1TVRB 5ADZA 2PFFB 2ZHBA 1T3OA 1IWAA 1OIAA 4FNIA 1HQ2A 3A12A 2V4QA 4ANEA 4NZ6A 3CSKA 5HQMA 2KB2A 1TFYA 2BACA 3ILOA 5J1EA 1NPRA 3SZ2A 4ZP6A 2MQ8A 2DH9A 2M8HA 3D0HE 4DQPA 3J80Y 3EJMA 5KT6A 2Z58B 3NS5A 5CXTA 2XZWA 4ZPAA 2AJ2A 4P73A 2DNHA 1RGVA 2BJEA 2KG0A 2DXFA 3ZZUA 2BUNA 3J7ZT 4RPFA 1JLCB 3HHDA 4DPUA 1VBZA 4YB7A 4I2PA 3GIIA 1W26A 4WYLA 4KSEB 5J2QA 3MECA 3PJ9A 3R5BA 2YKOA 2EFOA 5L1LA 3PW7A 2DR8A 3DNCA 2CYYA 5BR8F 4OFZA 3CJ0A 2AP6A 4Z7YA 3H90A 4P9SA 3BYRA 5HROB 2IC3B 3W2WA 2Y1IA 2VKRA 2GMHA 2RDJA 2BX6A 2DR5A 3P45B 4RX6A 2J0WA 1YZ7A 3HT0A 2VG7A 4R25A 3A8KA 2R7XA 4NX9A 1RA7A 3IN5A 3P3DA 3DLEA 3EMTA 3RRHA 1E6YA 2NXUA 5E0OA 3H40A 1NDKA 4WWSA 3NKYA 3HT3A 3RGIA 1F5BA 2PI5A 4HH0A 3D3CJ 1RWWB 4C8NA 3MR7A 2CQ3A 5B0BA 2QGFB 4F3OA 3DGPA 2DYAA 2J0SD 2XY6A 2CDRB 3D2WA 2HVHA 4DUZF 1HNIA 4NCGB 1YQHA 2NXEA 4N41A 2RS8A 1M1KT 1WG5A 2VASA 4M5GA 1QLNA 1B64A 2Z0GA 3CJTA 2JL9A 3I5BA 1T03B 2MZTA 3V81A 5HMZA 2FJAB 3TJAA 2IRXA 2OLWA 2W4DA 2M52A 3G6YA 1AT1B 5HBMA 2R2SA 1X4FA 3TAMB 2NUUG 1QSLA 4PG8A 2CVEA 1HWUA 4M63A 1RTJA 2R4FA 1F3FA 3M30B 1RT5B 1RJJA 5E3AA 3FKBA 1RHRB 1F3VA 3MWBA 1SJQA 3NMAA 4TLRA 2B56A 1NB7A 4HDGA 5B0DA 3BGRA 4ZPDA 5CH7B 2J9EA 2P9EA 5B0AA 2R8IA 2Z2ZA 5JVGQ 2H48B 1R8HA 3TUPA 5JXSA 4ZLJA 4PQUA 5H9FJ 4B3TF 4FF4A 2D74B 3EYZA 2BW2A 2KXNB 3H25A 5H9FK 4M8LA 1KVKA 2BQ3A 1FTCA 1S97A 3MTJA 1Q8IA 2BANB 1XQIA 3NGUA 3I82A 5KFLA 4P2SA 3J7YI 3V5RA 4EZ6A 1GEHA 3NAIA 2BDPA 2QN6B 2VB6A 2FVSA 2QIFA 3TEGA 4J90A 3BYPA 2DH7A 2K7KA 3E8OA 4ZCIA 2EFPA 2R8HA 1XNQJ 3MM6B 4PXEA 4N76A 3PDNA 2LDYA 1HLWA 2DB1A 5GMKa 3JS9A 3HULA 3KTQA 4NZ0A 2ZH8A 3CDAA 4MAKA 2ZC3A 4NLSA 1Y5NB 3MDFA 2EBGA 2XMMA 4ZOSA 3ZZOA 4UY85 2UXBF 2EFGA 2HRTA 4NEYA 3M8PA 2IMOA 2J9DE 4TNOA 3UD3P 4PUOA 1U2RA 4TQRA 4A4JA 4JI2F 4OI0A 3RB0A 1HKAA 4R8UA 2DRDA 2WCXA 1T3NA 1V5IB 3CJ2A 3LQVA 2DITA 2W9CA 2HURA 5AJ3F 3G4SS 1KFDA 5DGAA 4QPTA 3G6ES 5KFJA 1O0PA 2N4DA 2HZVA 3ETOA 5HI7A 3JYTB 2RF2B 3BKTA 2HBZB 2DRBA 3WZ0A 1U1QA 4I69A 4OHYA 3DLGB 3GJSB 2ZH6A 3BEGB 4LF6J 2F65A 5K5MA 3HFVA 1NK9A 3TA1A 3C16B 3ET6B 4EWTA 2R3VA 4OI4A 4UT4A 1PYTA 5RUBA 2Y1RI 2HNDB 1MMLA 3I32A 3T19A 4UOGA 2H51B 2MYFA 1WC3A 3ZZTA 5J2PA 4O0IA 1U24A 2CXEA 3KUGA 1O5JA 2BJ9A 3CNQP 5B09A 1JLBA 4ZJLA 1FT8A 4C3MA 2XMAA 4F3QA 4J9QA 1KVJA 4OYBA 4ZPBA 2H5IB 1PBUA 2JC0A 4DPOA 1SXLA 2GMJA 4DR2F 3Q23A 3B4MA 2JJ4D 4U7UD 3MEEA 4NE9C 2B3TB 4JI5F 4WTYA 1KLMB 5HLFB 2DHGA 5DM7Q 1RT6A 3H7HB 1CLFA 1M1HA 4DV2F 1YHQS 1QJHA 3AT1B 1NK6A 4P71A 2Z30B 1RWNB 2YVSA 2XSFA 3BSOA 1Q7YT 4ZVOB 1TMMA 1VBKA 1VISA 2EG2A 4AE5A 1WWHA 2ZD1A 3IBCB 4J9KA 2DEIA 4I6AA 1TL7B 5I3QA 3KLFA 1KQKA 4C2MA 4DEZA 2NR0A 1IBKF 4M5IA 5H9EJ 2IAJB 4Q43A 4ECRA 3UR0A 2PE8A 3DDKA 1IKVA 2EKNA 2VOOA 1BQNA 1N0UA 4MIWA 1YBUA 1VC0A 4FP9A 1REVA 4ECZA 1JXLA 1PC5A 1WDDA 2HIQA 4TVAB 4KBIA 2G1HA 4HACA 2RMLA 5EDWA 3I0RB 3QGIA 5GMEA 1RAOA 2BM1A 2MMYA 4NLPA 3M8SA 4ZVQB 1IJEB 1Y4ZB 5F8LA 1T95A 1TKDA 3KDNA 4FYWB 3H5XA 2BRKA 2O1PA 2Z8QA 1IKYA 3WC2A 4LFAJ 2FJEB 2NCKL 3KJNB 4N47A 4USMA 2HLUA 2DVIA 1MN9A 2HMIA 3POTA 3DRSA 1NCLA 4BLGA 3V6KA 3Q83A 2EK6A 1H2TZ 3B54A 4F4YA 2D69A 2DNOA 3PYEA 3HKWA 1BD6A 3LGHA 2KYZA 3N5FA 2OI2A 4TU7A 5E3RA 4IFYB 2RUSA 1TELA 2DBBA 2A18A 3ZTPA 1LWEA 3I55S 2MLXA 2CIMA 1N32J 3B6BA 3EGZA 3GB0A 1T02A 1SC6A 2YH0A 5HANA 3KXDA 1HR0J 4AFFA 1TKXB 3LUYA 4OHWA 3GLJA 3GYNA 2VG6A 1VQOS 1FKOA 3WIVA 5C24A 2LCWA 4LF8F 1N5QA 1DQAA 1HNXF 1JJ2R 4ED8A 3LW5C 2FDNA 7AT1B 4EGLA 2RDDA 2VPYB 3BO4A 3IR7B 4DCJB 3OSNA 4UZCA 2DR6A 2HEKA 1BGXT 1DLOB 2RJZA 3EGWB 4Q8EA 1FKPA 3FBFA 1REGX 1EETB 2O66A 4GKKJ 3KLGB 1JLQA 2JSXA 2Y8WA 1YJUA 3R27A 3D5MA 1YKWA 1SH0A 3G8QA 5HJXA 4X64J 3SXLA 1UCNA 2ZH4A 1SVDA 4QCLA 4OYAA 3T41A 4M95A 1TKTB 4ZPWR 2YTCA 1IVZA 1SL0A 2HVEA 4DFKA 5D77A 3CCMS 4QIFA 1FEHA 1U1PA 4TU9A 3KJVB 2W4CA 1KTQA 4GVBA 1U8SA 3GV5B 3OD2A 2WW4A 3T6JA 1FRXA 3N4WA 1AYEA 3I0SA 3OXFA 4ZPCA 3V6JA 3EGNA 2FY1A 4FDFA 4YHHJ 5D3GB 5EWGA 4ZPVR 4LR9A 5KT7A 1UFLA 2W9BB 5I3UA 1YG0A 1JQGA 5LJ3Y 1HNVA 1X5SA 2VFVA 2K3KA 3E51A 4ZP8A 4RWXA 3NOCA 3DKDA 3JQKA 5HSPA 1N36F 5HL7Q 5A2QY 3GIKA 4I67A 3FK4A 2RH3A 3MOJB 4F50A 1WOOA 1DQ9A 2CPEA 1XMOF 1NKCA 2Z2MA 1X4CA 3M2VA 2N3OA 4HLBA 4N56A 1HL6A 1RTDB 3ZZYA 4CTAB 1SQFA 3CT9A 5FDLA 4P7TA 1VIXA 1V3ZA 4M5LA 5D0RA 3U1MA 4F0KA 5D4PA 4G3IA 2JEIA 3RUBL 4OZ2A 2FUG9 1E6VA 2BJ8A 5FJ4A 1RHJB 2KN4A 1MROA 4ID5B 2CRLA 1X4AA 4YMEA 1RE1B 2OKQA 5I4MA 1CS4B 2HHHJ 3I4HX 2BMBA 1HNZJ 2FC8A 3LP1B 4YB6A 2CQ1A 1S6PA 4USUA 4EZ9A 3ZZZA 5K14B 2FHJA 2MKKA 1TU0B 4DL5A 2IYGA 4B3RF 2QLBB 4RNHA 3BQ1A 4W90B 3GR0A 4ETXA 5LSRA 2VQFJ 1S9GB 4OJ1A 3SDEA 1VMBA 2HNZA 3FBCA 2E5LF 3Q2SC 1S9EB 1QD1A 5LL6d 1FDBA 4OZ5A 5J2NB 3AOBA 4X4SA 5C42B 3S8SA 3I87A 5EHHA 1J2VA 4PCQA 2XMKA 4RNMA 4B3SJ 2FB0A 2WONB 3ENQA 1A7GE 3OTBA 3DMJB 2EPIA 3ELHA 2DY9A 4JI8J 2F1FA 3ZXWA 3CIMA 2W24A 2KI2A 4J9LA 3W5XA 1AB8A 1RBLA 2P5VA 1S1UB 1CJVA 3BSAA 4RUCA 2B5JA 2C28A 4WP8A 4NYZA 4K5SA 3IGVA 2OJ3A 4MFBB 1P8GA 3EE3A 4L3NA 2LXFA 5F0WA 2RT3A 1SH3A 4ECXA 3GTYX 1IKWA 2A6OA 3DRPA 1M5PC 2QA2A 1RAAB 1N6QB 2NSCA 3IBWA 3FSYA 3Q8VA 1YVFA 1ZAXA 3W2VA 4OX9F 5T7LB 3TEHB 4MK9A 2DT9A 5D4LA 1PSDA 2FLNA 4IG0B 2NYHA 5D78A 3K0JA 2HFVA 2J8SA 4K0KF 2HVDA 4AUKA 2HVZA 1T7PA 1Q86T 1KSPA 2DJWA 2QA4S 1S1WB 1RU2A 2NZCA 1XJWB 2HGNA 3RZAA 1JNZB 1S10A 1JLFA 3J7YU 3P6YC 2CNKB 3FJ2A 1S57A 3GE9A 1DRZA 2B4UA 4PXCA 2V4JA 4YQWA 3MM9A 1M5OC 4OV1A 3DLJA 1PJ7A 3NCRA 1FA0A 1R8CA 4H4OA 1Q7LB 1QE1B 4HKQA 1C0UB 3HM9A 1U25A 4JI7F 1AFIA 2UU9F 3IC1A 2ROGA 4LMZA 3NG8A 2H65B 2MQLA 1T9YA 2RKIA 3NS6A 3T1HF 1U4BA 3HKZD 3DXBA 5EWFA 1K0TA 5HVHA 1T9XA 3PFEA 4O44A 1TK8A 2AV5A 2F7VA 1H73A 4NEZA 4LJMA 2XBPA 4J7CA 3CWJA 2BV3A 1X4BA 3NNHA 3MR2A 2WBRA 2X7IA 1FFWB 2W8KA 1ZA1B 2VZ9A 3T1AA 1XEZA 4QWBA 1HQEB 3OTOJ 1DBDA 2GVZB 3K5OA 2XHWA 2NSBA 4U67Q 3N0VA 2HBYB 3KWMA 3QT6A 2FZGB 5ETPA 3SQGB 1GMWA 3OUYA 1EP4B 3LTOA 1OQ6A 1R7IA 2AYMA 3MI7X 1KC8T 1JXVA 4ZLLA 1QAIA 3HMJG 1G7CB 4DSEA 3W7BA 2YQ1A 3M8QB 1EHWA 1MSWD 6AT1B 2DGTA 1EAYC 1S12A 4JV5J 1WTBA 2O67A 2XLIA 1C4CA 2MGZB 3RRKA 1FFGB 3T3FA 4DR1F 2ZC4A 1KKHA 1KBRA 3Q8QB 3JTNA 1L3SA 5E3CA 4B9LA 1TUVA 5I42A 3TO8A 5EX0A 2ZNYA 2YKNA 2G0JA 2XS7A 3FBBA 5GADI 3J81j 3KK1A 2AJ4A 1KONA 1NAQA 3CMAS 1CSJA 5LMNJ 2C1EB 1SIWB 1OY6A 5AXNA 2N7YA 5DQIA 1S48A 4JYAF 3Q89A 3PW2A 3W65A 4L3KA 1F60B 4DLGA 2XULA 3MR3A 3J81U 3GJRB 4KV8A 1B0TA 1KWMA 4IO1A 1RCOB 1OYDA 2B4OA 1JLGA 3M8WA 1VC5A 1I94F 3GIMA 1FRKA 3DDNA 2UXCF 3VGSA 4GC6A 4Y2KA 1X7VA 1GX5A 2RE1A 2BOPA 2QT7A 3HFKA 1FEEA 3HJFA 3KG4A 4LSNB 4ERDA 2ATCB 4OMFG 1DTTB 2QZ8A 3QIPB 4DSJA 3DI6A 2J76E 2RQCA 3SCJE 4PYAA 1VLOA 4BDPA 2QG9B 1TVRA 4NWBA 3OR2B 3BSNA 4HVZA 1S59A 4NASA 4B9MA 2YKQA 3H2UB 3R7BB 2CKWA 5BXIA 4UUXA 3QMQA 3AJ1A 2XTJP 1S6UA 5IFMA 4DX6A 1HPZB 4I2QA 4K59A 2ZH7A 5KFZA 1VYAA 1H2VZ 5D6GA 3ILLA 3L3CA 2IFXA 1MWYA 1LOUA 2QL5B 4DQIA 1NHKL 4NLDA 1N5YB 2C3UA 4ZS6A 2NPIA 4CNYA 4B02A 3GR1A 4PRFA 4DN0A 1ZYQA 1TL3B 4F4ZA 1DJ0A 2MZ1A 1S79A 2ASDA 5E2QA 1JLCA 3M9NB 3H20A 3G2XA 3CIZA 1IQZA 1YJTA 3R9LA 1EB0A 4PG5A 4F3MA 2A6MA 3S6EA 3EDRB 4X62J 3C3LA 1SQGA 3KDOA 2KKHA 1LQ9A 4KGZB 1R31A 3GFHA 2PMWA 4WBFA 2C22A 3FQKA 1UVNA 3JXOA 5HROA 1LWXA 1IM6A 4GKJF 3OFEA 4CLSA 2HW3A 5C25B 2IC3A 3KNGA 2YWEA 2J9CA 3CCES 5DG7A 5F8IA 1F2GA 4RW6B 2JWNA 1Y7PA 1ZPWX 4NOHA 3C6TB 5IWAJ 1ZOTA 3QWPA 3PEJA 2XC9A 3MM7A 1WKJA 1WUUA 1F9HA 5KFEA 2WVFA 1L3TA 1QTNB 2CNOB 4DR3F 2M9KA 3T1YF 2UVRA 4ID8A 5ETSA 5KFFA 2XSJA 2DCLA 4DV5F 3MPWA 2IBOA 2HHWA 1WEZA 3BQ0A 1H3DA 2BJDA 2ZBPA 2KJWA 4NLTA 5D0GA 3RAXA 4NCGA 4NYOA 2IM0A 5DO2A 5K8MA 1K47A 4Q44A 3F41A 2QLJB 3GWCA 1S77D 1T03A 4D3HA 3VQSA 3UD4P 3TAQA 2LQBA 3CUNA 4B9NA 5KFTA 4DR5F 5B0CA 1WDTA 2M4MA 3C66A 4OZ3A 1FERA 1V5VA 2CQBA 2CQ2A 1B3TA 3TAMA 4ECSA 4E0DA 4Z37A 2F40A 3M30A 4RJVA 4NI2B 4ZVSB 1PAUB 3HHLD 2YKPA 2DY1A 2CJBA 3FUYA 2E1RA 1LWFA 4NLYA 2CZ4A 1WC1A 2UUTA 1RTIB 1S1TB 2AT1B 3MCOA 4X65J 4MKBA 2GQCA 1Q53A 3LAKA 4F2RA 4I6YA 1S1VB 1WC0A 1RYRA 2ZH9A 4WKRA 1ITPA 5KFYA 2OPSB 1XNRJ 2Z2LA 3ZTOA 1X0FA 2JZ5A 4IQMA 5IM0B 4BWMA 2HS4A 2GAHC 2BQRA 3WC0A 1VQ7S 2B6AB 1D9FA 2GX8A 2BANA 4RUBA 3FQLA 1IKXB 2B7BB 4DDFA 4P75A 3M05A 3WHIA 4ILMA 3QATA 3AFGA 1IBMF 2W8LA 1D8YA 4ZVFA 1NK7A 4HYKA 4TYBA 2J7KA 4M5JA 5KT3A 3MM6A 2ZDPA 2F63A 3GILA 2V63A 4RW7B 1FJGF 4OI2A 3FCHA 8AT1B 4RUHA 3DOMB 1GTEA 2E1PA 2C3PA 3D6FB 2EG1A 2VV5A 4LBPA 1JLEB 3S1TA 4OYWA 5CABA 3LA0A 4WF9Q 3EWGA 3UDLA 1GXTA 2UUAJ 3A1YG 4LF9J 5HQ8A 4TY9A 2Q1LA 2WOMB 3FCVA 4OZ1A 4A8FA 2YY3A 5F41A 4NLRA 1RAEB 1YJ7A 1NJIT 3A8EA 1QAJA 3TR5A 1R0AB 2F9JA 2M5YA 4DJBA 4DL0C 2IJFA 1NSKL 3GFXA 5D8HB 3VAMA 3JYTA 2RF2A 3OQ2A 2DNPA 3DLGA 4I0WA 3PX4A 3DM2B 2QLXA 3MM5B 3R2DJ 3ONQA 2APOA 3C16A 2DISA 2YWFA 3HHLB 4TU8A 3MPDA 5KG7A 2RHQB 2HNDA 4KHMA 4DHVA 2C2RA 2CNNB 2CPDA 4A8YA 4HHHA 4KHPF 3FBEA 4B3OB 4RR5A 2F4FA 2N3LA 4USHA 2MKSA 2CNLB 2XMTA 4FYDA 4YDDB 4DR7F 3D6TB 5K20B 4O3QA 3AXMA 1Q81T 3KHLA 4R0EA 2VQEF 2J0XA 2UXDF 3OFFA 4I68A 4EU0A 4CRJA 2I5JA 2O01C 2LFVA 4EO8A 3D0GE 1KLMA 2UUCF 2B4VA 5HLFA 4OQJA 1XR6A 4FKXA 2GIRA 4WYWA 4J9UE 3VVUA 2C42A 3K5PA 3O44A 2XM3A 2PEHA 1A0OB 2QLFB 1T8EA 1T9UA 4ES1A 2KZMA 4DZDA 4DV1F 4ECVA 2Z56B 4O3PA 4WP9A 4LIWA 3QRQA 1K1SA 1TL7A 3W62A 4OHXA 2G0IA 3RBEA 1X0PA 4Q0BB 3MD3A 3IGNA 4DV7F 2ASLA 1VFJA 2C2EA 2GQ2A 4PWDB 4QIEA 1HNWJ 3MCSA 2Y0BB 4AXJA 2MPUA 3DLKB 1RABB 5KG4A 4NLVA 1Y00A 4C8LA 4HR2A 2POKA 4DV4J 1NZ8A 2PEBA 4USIA 3TUJC 1UETA 4LBIA 1VC6A 1IBLF 3V2UC 4J37A 3SSQA 5DS7A 4G1QB 3V4IB 5DM6Q 4WU3A 4CO2A 2KVIA 2GGPB 1I6JA 5CD4A 3I9ZA 3W64A 1VQ9S 3HPOA 4LF2A 1V3RA 4DWIA 1X5OA 4NRUA 2L08A 2RVJA 1Q4RA 8ATCB 4JI6J 1MU2B 3DCAA 5KFQA 1XN9A 4LF4F 4WFYA 1BQMB 5CZVA 2C2DA 2UP1A 4GO5X 5DQGA 1FDDA 4P74A 3IR6B 5CYMB 4JI3F 2GC8A 1ZTWA 4IFYA 3B82A 4ES3A 3P8BB 3D0IE 2LLZA 1U1OA 3CVKA 1YK9A 1JJHA 1U6FA 2BE7D 2HPUA 4LQ9A 4DL4A 2VIHA 2AGPA 3J7AN 1XC9A 1TKXA 5T41A 5F0UA 4WFBQ 4BS2A 3GU0A 4L6V3 1FDAA 1RWMB 2VFTA 1KRPA 4O0NA 2NREA 1OY9A 2RS2A 3LP2B 4L75A 1WEXA 1CG2A 2RU3A 2ZM6J 2DK2A 1RADB 2K7JA 2R7RA 1NSPA 3G8TA 3LPEA 1SL1A 2I1RA 1NH7A 4JV1A 2DIUA 5B0FA 2MJNA 2BBEA 1SC1B 4X4QA 2ZH5A 3CCTA 2HVIA 4LR8A 4CZCA 1DLOA 2W01A 3KLEA 2AJQA 5LMUJ 3QGHA 1EETA 3KLGA 2RU9A 3V6DB 3MAHA 2YNGB 1RAIB 3IRXB 3MFHA 1RT1B 1D9AA 2JX2A 2HLTA 2EKYA 2WVCA 3ZTSA 3ZTRA 1TKTA 1ZM4A 3W8PA 3BJYA 1WC6A 3OV7A 4FF2A 4P6QA 3UCUP 4CM0A 4DQQA 1BQXA 2CWXA 3GCXP 3ETMA 1NJWA 4DFPA 4X4NA 3KJVA 4LQ3A 3UD5A 2H5JB 2MQQA 1YJWS 3NEKA 1KR4A 3I5CA 5A8RA 3QQCD 2G1DA 2UUBJ 5D3GA 5I3PA 4DPWA 2ZZNA 2YNFB 4QWCA 2DIVA 2W9BA 5DDRC 4S0MA 3F0NA 4JV2A 1S9FA 3X1LB 1K44A 3TWZA 2MKJA 4XAKA 3EM1A 1HQUB 4Y2MA 2JOQA 2KHDA 3CO0P 2QSWA 4HHJA 2AHOB 2OPQB 2DR9A 2KVQE 4YEAA 5IT0A 3NWRA 1RT3B 4RNFA 2PMHA 2D9PA 2JVRA 2VG5A 4A8KA 1GXLA 3TW0A 2XWYA 3RAMA 3FFIB 2HAIA 1U1LA 2WBMA 4H4MB 2OFGX 5BYQA 4ID5A 2ZBCA 2F4VJ 1CS4A 4JI4F 1R8BA 4XDCA 2RRNA 3R7NB 2MHEA 1ZPVA 4IR9A 5K14A 3Q8RB 2B51A 4B3MF 4LFBJ 1VJQA 2AZ3A 2PD1A 3I5AA 2E9RX 1UWAA 2IA0A 1GQEA 4DL3A 2MZSA 1N33J 4YR3A 4NXNF 2ACMA 3CXCR 2OH2A 1S9EA 5KFRA 1RAFB 1ELOA 1N34F 3Q8YA 4QJVA 4R5PB 3TUZC 2DNRA 5J2NA 1YJVA 2DCUB 1T05B 5C42A 4C3KA 4XPEA 4Y34A 2JDJA 3M2UB 2ZFHA 2DO4A 5JVHQ 1EARA 3QJLA 3N5BA 5CZXA 2WONA 3ISNC 4IRDA 4CDIA 3DMJA 2E9TA 2G4BA 3EUNA 4A48A 2GIFA 1TL1A 3A13A 4XO0A 3KUHA 2X1GA 3JSBA 1TKZB 1GXUA 2ZUGA 2M2BA 5ETVA 1S1UA 1ACMB 3AJDA 4UOFA 2Q43A 3NLCA 1OPIA 4J9RA 3U02A 2G0CA 1VCTA 2QO3A 3L95X 3RR8A 2IM3A 1OMSA 4DV0F 5KTQA 3L09A 4P52A 2GO8A 4K4VA 3Q22A 2MHNA 3ULHA 4DR4F 3QJJA 1N6QA 2F8EX 2P9GA 3VHQA 1NXIA 4KKOB 4B9TA 1NK5A 3BGUA 3DYAB 2P8IA 5T7LA 3THVA 2HG4A 2WSFC 2H1YA 4IG0A 2IYIA 4ED7A 3GJQB 1TUGB 4RW8B 3ZO7A 1HD1A 5GAHI 3D6MB 2KFYA 4EMDA 4N7TA 3IG1A 3MEKA 2K8GA 4X4VA 4CO4A 3MR6A 2GFFA 1C2PA 2FJXA 3H0PA 3VV2B 3N6NA 1EZZB 1FHTA 1YJ9S 1UPPA 2B9EA 5M2RA 2DH8A 1FJ7A 4F4XA 1U26A 4NA2A 1QE1A 3SCIE 1K1QA 1FWLA 2HNYB 1C0UA 4J9NA 2VJVA 5LXRA 2XNQA 1F5AA 4LUBA 4B08A 1Y9OA 4D3GA 1R0CB 4Y3CA 4CWBA 3ZC4A 2ALZA 4U7CA 2DHSA 5DG8A 3MMCB 3VALA 4HI1A 2ROEA 1WJ9A 5DG9A 2DGSA 1NB2A 2XY7A 1PGZA 4AL5A 2IVMA 2Q66A 4ZCLA 4LF1A 5E33A 1RYSA 3GQCA 3THPA 3T6BA 3NAHA 4ELUA 1EQMA 3MCNA 3OXLA 1TR0A 1HQEA 1RWVB 5DRKA 4JBCA 4LF5F 3BDPA 2GVZA 4J9MA 4NMXA 3SQGA 4A8QA 3F44A 1UL3A 1J27A 5GAEI 2J0QD 1EP4A 3PKYA 3E01B 1WORA 2RQKA 3DHXA 4PAAA 4OZNA 2ZJRQ 3I4PA 4CLLA 3OL8A 4DSLA 3HI9A 4ENOA 1RI7A 3M8QA 3P49B 1TP7A 1FJCA 2HHQA 4X84A 1UVKA 3EXCX 4WFAQ 2OELA 2MGZA 2ZVIA 1QDUB 2FHKA 4MK8A 3H5SA 3C2PA 2EW9A 3N6LA 3QJPA 2QE5A 2GJIA 3KMSA 3PIPQ 5KOWA 2VA2A 3LPYA 2ACYA 1MWZA 1M5KC 2FHOB 4YY3J 1HHQA 4ZPTR 5DLGA 2QA1A 4CLUA 2GJ2A 4Y6IA 2DXEA 3M8RA 2I9SA 4G1IA 1P1LA 4K2XA 1HWIA 2OPRA 3BPSP 1WG4A 3P5BP 1BWVA 3I31A 5D0EA 4GVLA 4Q45A 2CFXA 4LRAA 2GHPA 4KT0C 3LAMA 5KG5A 1UWBB 5ETKA 4EK2A 1JWWA 5G0RB 5GVQA 5T14A 1Q1KA 2WW8A 5IV3A 1QUPA 2W25A 1HWJA 3MEGA 5KG1A 1UPMB 1YBTA 2HHPA 3HVTB 4DUTA 3UN5A 4QIVA 4U8VA 4Y2IA 3F56A 4LSNA 4TQSA 1KTVA 1WEYA 4KFBB 1DTTA 3D68A 3QIPA 1NJYA 2X3GA 1U1RA 3IXQA 2QC3A 3IM9A 3GSIA 3PVXA 2XB2D 4ZVTB 4OZJA 3TJ9A 4FVMA 1ZH5A 3OR2A 4LVOP 4LF4J 2IVYA 2CZVC 3CC2S 4ZP7A 4KO0B 1FVQA 1VI7A 2V68A 2IM2A 1S5ZA 3PNIA 1HPZA 3T9NA 1SKUB 1NDCA 5JJBA 3HHEA 1FRLA 4ECQA 1FRIA 1EKRA 1Q79A 5KFGA 1DQ8A 2V67A 4ZHRB 3ADAC 5IQQA 2ZNZA 2Z4PA 4DR6J 4IRCA 3Q2TC 4DUYF 4C8ZA 2ZE2A 2E1MC 4C6AA 1TL3A 3W5ZA 1IXKA 3MMJA 3B8HA 3OPKA 4FN5A 4IG3B 3OBIA 2QFJA 1VLYA 1C0TB 2V2ZA 1F0XA 3GV7B 2PC6A 2ROPA 1VQNS 3O5TB 1AROP 1WF2A 2QYCA 2GA7A 2KT3A 2Y1JA 4ZLNA 1YRTA 1RHKB 2E5HA 2CG8A 1B0VA 3GG0A 2EEYA 5B0GA 4O4GB 2PT0A 2L9WA 4EI2A 4DLEA 1PKUA 4RO0A 4PR6A 4F0MA 3G6XA 4H4KC 4RW6A 5J2MA 3CJKA 3VZHA 2BOAA 1FWKA 2W1BA 3C6TA 3PYFA 2R2RA 3JSRA 3NGKA 1SJ3P 2F5GA 2NQPA 4X4OA 5E7OB 2AX0A 2OMOA 2OEJA 3HFZB 4O3OA 2V2VA 2XHCA 3FMWA 3MUVP 3R1HA 4EO6A 4DSKA 2FJWA 1J5EJ 2PN6A 2F3JA 1UEUA 1EX8A 3R7SB 2ZH3A 3VVTA 2ZWOA 4B9UA 1UFWA 4NLWA 4DG1B 4MYTA 2FPHX 4YFUA 3WBZA 3X3UA 4LBHA 1RWOB 5J2PB 3TJ8A 1FF2A 5KFOA 3NXZA 5AE1A 5BYSA 3HVWA 4YB1P 1LWCB 3CCLS 3P4UB 3PIOQ 4RBUA 3NNAA 2L9NA 4N8OA 5DDQC 4O3RA 3AY0A 1RT7A 1CPZA 3PM9A 1RBOB 4NI2A 3DHWC 1KLNA 4AL6A 3TX8A 3EPGA 1L3UA 1NLKL 4KH1B 1I1GA 3FEXB 1RZMA 2N4CA 2Z57B 2HHVA 1S1TA 3HSJA 3SV4A 1FXRA 1ZTTA 2LMIA 3O8WA 2ZVSA 4DSIA 2VBYA 1KOOA 3MMBB 3HHNB 3BV8A 1TL5A 2HWIA 1YBAA 2KU7A 4DF4A 1HBMB 3KLFB 1S1VA 1Q5VA 2DNZA 2QMXA 2FD2A 1AFJA 4NXMF 3VGTA 2OPSA 1SB6A 4LFCF 2DGOA 3V6HA 1FJEB 2AYBA 1BQNB 2M8DB 1M1GA 5IM0A 2CQDA 4CQ1A 4A8WA 1B99A 3SI8A 4KGMA 2CG4A 3R5GA 4PEOA 2K1RB 4HACB 3M8ZA 3K58A 2B6AA 5L1JA 4FYYB 3ITHB 1IKXA 6FDRA 1BHNA 1UA1A 1VHIA 5EN1A 4O3NA 2VF3A 5CD4H 2D3ZA 1YJNS 4NLXA 2HHTA 1YLXA 1RHMB 4YP3A 3DRSB 3L7OA 5HK4A 4WK3A 3DRXA 1U8WA 3O1LA 1UW4A 4DV3J 2KM8B 1WHXA 3T5LA 4X4RA 2A3JA 4RW7A 1FWPA 4O4RA 4OHVA 5B08A 3CULA 2CADA 1VRTB 4E98A 4J9OA 1TAUA 3C46A 3QWUA 3CCWA 3DOMA 1R3NA 3R5DA 2W2PP 3OL7A 4C8OA 1JLEA 4PKDB 1KHWA 3JSYA 3N28A 4DL7A 1DTQB 2RQMA 4CH7A 1CJUB 2LQ8A 2LA4A 3AA9A 4AL7A 2AF6A 4C7QA 5ETMA 4BHQA 4CP5A 4QYRA 2WOMA 5ETNA 5CQGA 4KPYA 3DDIA 2IDEA 4H54A 7FDRA 1SKSA 3M6WA 2FHJD 4AQYJ 3BH7B 5LXYA 1FKOB 2R9LA 2MKYA 3CJ3A 3BO2A 1HI8A 1PC4A 2FVCA 2DR7A 4NA3A 2AW0A 2X1BA 5A8WB 3RBZA 3EVOA 3OTEA 5KFXA 1GMVA 2KRRA 3CD7A 4HT7A 1NDLA 4KGVB 3MM5A 4ZVRB 2M0GB 3ZNUA 2HHSA 4DQSA 3HHLA 5KFKA 3JAMU 2XWXA 3MPYA 2EI5A 1FKPB 1M5SA 1WSRA 2D3UA 2CAJA 4AT1B 3R1LA 5GAHU 5LM7E 2CUYA 3CCZA 4JOUA 2IDLA 4KJIA 3N79A 2VBWA 4HTJA 3CCRS 1OY8A 3BS9A 2CJYB 3CCVS 1HHSA 2NLWA 4PPDA 4UQGA 1Y3JA 3ILIA 1XK8A 3UNYA 1NPPA 3O6QA 3HJVA 4NPOA 2CJXB 4EFAC 1VQ6S 3K8WA 4OZLA 7FD1A 3SSRA 1WC4A 2YKMB 3DRRA 1WOSA 6FD1A 4CLFA 3I0SB 1HMVB 3UCGA 4DL2A 3SSSA 4DV6J 4BC9A 4X66J 1HFEL 4C97A 3GSDA 4WTOB 2IM1A 2CPZA 5KFDA 1VRUB 5F3ZA 1X5TA 3QZ7A 2KFNA 4LSLB 3B4DA 5CCLA 3QRRA 5IC4B 2QX0A 4PABA 1LEOA 3D3BJ 3PRBA 4Y00A 2HK3A 2JEJA 3EDQB 2HS0A 9ATCB 1XWLA 4Q0BA 3DLHA 4CNZA 5KG2A 3TVYA 2D9OA 5KFUA 3FNNA 2KXHA 3DLKA 2BE2B 5H9EK 5D15A 4IOCQ 4F02A 1KN6A 3O3LA 2IPOB 5KAKA 2RUGA 3MF5A 4Q2MA 3M4XA 2PFDA 3MUMP 3RR7A 3SMZA 4JI1J 4DOZA 3V4IA 3LOUA 2V9WA 4DF8A 3KG1A 3DOKB 2W2QP 3PJXA 1XMQJ 1VR6A 5KG3A 2VFUA 3PYDA 4H4KA 2AU0A 1FTRA 1WI8A 5C7PA 2P9CA 2JHEA 3MMAB 1SCJB 2N7CA 1VDHA 1C4AA 2VODA 3GONA 3D28A 3IO1A 3CJ4A 4LF7J 3PHEA 5CYMA 1LK7A 1U7LA 4DU7A 4F4WA 1VIOA 3N6MA 2HKEA 2HNZB 3CCQS 4X4UA 4URSA 3PTWA 5D4OA 5IT9U 3ZZ0A 3AB4B 1YZ6A 1DARA 1LKZA 1CJKB 4BBYA 1B70B 2MXYA 4JB8B 2CPXA 3M9OB 3GFYA 1SC4B 4YB5A 3OTCA 1TZ0A 1XNQF 3LP2A 2AJFE 4QW8A 3DOLA 1CJVB 3JTPA 4L76A 5E5NA 3CJ8A 4NZ7A 1CULB 2XS2A 3ENAA 4TY8B 4N5SA 2L48A 3R8YA 1GX6A 4ZCMA 3PX0A 2M70A 2LQ5A 2KT5A 4USJC 3SIPB 1IKWB 3V6DA 2YNGA 3IRXA 5B7WA 1WF0A 2XS5A 1RT1A 3GZ7A 2JLGA 1D9DA 3KOAA 1FD2A 3W2VB 3PY8A 5IZHA 4G65A 2DNKA 1DZ5A 1CJTB 2RSQA 3RW6A 4MIAA 1X8DA 2HGMA 1HW9A 4DCOB 2XZTB 2XGQA 2IJNA 4LF6F 4ICLB 1JLFB 1HBUB 4XDDA 3TZYA 2YNFA 2BKOA 2OFHX 3D54A 1YDLA 5BR8J 3AHPA 1VQMS 3UWTA 4X4PA 4A8SA 2J8AA 3EZOA 3J81Y 3QSYB 1U47A 4EBEA 2GVDA 4Q2LA 3LH2S 5KFCA 1VQ8S 3G82B 1HQUA 2GAGC 1TV6A 3PJWA 3G71S 4ETZA 4F7VA 1BWEA 3HK2A 4PPZA 4CO0A 1BY9A 3W1YC 1W2BR 4FXDA 2HQIA 4F4KA 2OPQA 3CC4S 2LU1A 4U9RA 1XERA 5EGYA 1RT3A 3C14B 4CLPA 1M0SA 1KQFB 1TAQA 1YJRA 3NP5A 4TLQA 1UEKA 3W8GA 2KJVA 1RTHB 4CO5A 4FKYA 3KHRA 3FFIA 2JLEA 3CJRA 4H4MA 1NPKA 1I3OB 4YS2A 2PSZA 3BZQA 3W3SA 4DUZJ 2YWWA 1FRJA 3VWSA 2EWHA 2MDAA 2KO1A 3NWGA 2RDIA 1R8AA 3OJUA 3BDEA 1NK4A 1D1UA 2LKZA 3OFHA 4C0HA 1MNEA 4MTPA 1X9WA 2HAFA 8RUCA 4IOAQ 2ASJA 2JRSA 2YNHB 4WU2A 1WACA 5CHCB 3W61A 4ILRA 3HZEA 5HJYA 2OPPB 5LOQA 2E7WA 2PI4A 3NCPA 1N5SA 3VAJA 3EX7B 2J6SA 4R5PA 5K8OA 1T05A 2XI2A 2C3MA 3IWLA 4HHUA 1JMTA 3M2UA 1QTMA 4LFAF 4F4AA 3FEZA 1FX4A 4RWWA 1VBYA 1LV5A 4F36A 5A8KB 3L7PA 3VTIA 4RKUC 3NOGA 4F67A 4OJHA 1T9WA 3FSXA 4UZBA 4QR1A 4ILLA 1QSYA 4ED3A 3D7SB 4RW9A 4ANDA 1DFDA 2H3EB 4J9SA 2RRAA 4IRKA 2LQJA 1S4FA 4B3TJ 2QJ3A 1RWKB 2WHOA 1UVMA 2YPZA 1KNZA 1XR5A 3CDEA 5A0YB 3DXSX 3VCDA 4OYIA 4ELTA 1RXOB 3CDWA 3CCSS 1QVGR 5A6WA 1N32F 2CQGA 1SJ1A 1NBEB 3AD9C 3K5NA 4KKOA 3GMGA 1H2UX 2U1AA 1X5PA 2QA4G 2DPJA 4F2SA 4BC7A 1HR0F 2RB7A 4Y28C 1Q78A 2BKNA 1APSA 3SFGA 3DI6B 2D3OR 3HD1A 2G9OA 2M7SA 4PG7A 2EFVA 1T94A 4KB7A 3TZXA 1N56A 3U1NA 4CLTA 2PMZD 3MEDB 3CE8A 2YX1A 2QTWA 2V69A 3BBFA 4Y0FA 1PJ6A 2A2DA 1SPBP 2QL7B 4DL6A 2I38A 3NL0A 2A0FB 3PXGa 2BEFA 4EYHB 4A46A 1FD8A 3SQOP 1WG1A 1FI4A 2MLZA 4I2QB 1JJ4A 4QWEA 4ECTA 2I0XA 4KE5A 1M5HA 1U02A 2NS1B 3MAAB 4F26A 3MPVA 4GKKF 3IAS9 5FLXU 3AQOA 2UXBJ 1LW0B 4X64F 1CC7A 2HNYA 1Z2LA 3M9MB 4YR0A 4JI2J 1UVJA 4GRSA 2P6SA 1HWKA 4JV0A 1R0BG 3MMCA 1YRUA 3SEOA 5DDPC 3FRZA 1SI9A 2Y8YA 2FJBB 5AJ3J 2VA3A 3Q86A 2N82B 3AB2B 2DXDA 4NCAA 4K4ZA 2XYPB 2V8PA 4CIOA 1GMUA 2E7VA 3BGFA 3RTVA 4YHHF 3CO9A 2GMLA 5L39A 1VJWA 3I9V9 1W25A 2GJFA 1FK9B 3AJ2A 4FF3A 1DHMA 4ITSA 1MWQA 3AODA 3NGRA 5L9NA 3AD7C 2KM8C 3TI0A 1U1KA 3KLHB 3DLBA 4ZDNA 1WC5A 1AXQA 3C19A 3E01A 1HHTP 2DPIA 1NJXA 1K0VA 2XEXA 4C48A 2JEFA 2OIHA 3MM7B 1PYOB 1QVFR 2X1AA 3G9CA 4LRBA 4DPTA 3BSCA 1IN0A 4UTGA 5L1IA 2EVZA 2XMJA 2QL9B 4DR2J 3VQTA 4EUVA 2XSJB 1BE4A 2A10A 4JI5J 3GG1A 5IC6B 3ZZRA 1S0MA 1X31C 4C8YA 3SCKE 5HO4A 4K8RA 4DV2J 3CTRA 3UO0A 1P1TA 2Q6CA 1R27B 2HHHF 2R7SA 1HNZF 3HSZA 1DURA 2MLYA 3ZTQA 4IO9Q 5IQ6A 2P6TA 1CQMA 5K8NA 5DZ7A 2ZITA 3WX4A 3BKUA 2H9ZA 3QT7A 2VBZA 2IA6A 1NEEA 1IBKJ 3KK3A 3UCZP 1G3OA 2VQFF 1UWBA 3KLIB 4HTIA 1SJFA 5G0RA 4FBUA 1VBXA 2KZZA 5KOXA 4RL1A 1ZM2A 1W7WA 4M94A 2FYXA 2R2UA 1TK0A 3MHYA 1BMQB 2HQFA 1AZSB 2C3OA 1LWFB 2DNYA 2X3DA 4KTQA 1MMDA 3UVJB 3HVTA 2R7QA 4XIUA 3OXGA 4B3SF 2KDOA 3FCWA 4KFBA 2EFNA 4L72B 1IWGA 2ILZA 1IBCB 3CC7S 1SKWA 4R0JA 3HCXA 2ALYB 1NNDA 4GC7A 1R8PA 4JI8F 2YNIA 3IS9B 3CJSA 4DPXA 1FX2A 3LALA 5L8RC 3HF5A 4OV6A 1VQ4S 4Q8FA 3HD2A 1FXDA 2FVRA 4KO0A 3A8JA 3LWMA 5ETOA 4C4WA 3KJQB 4UY8T 4DSFA 4Y2CA 1F5CA 1YX2A 3QNWB 4C8MA 2ATLA 2A1BA 2CJ9A 2JFKA 4A8MP 4MYUA 5KFHA 3AA8A 4ZHRA 4L74A 3TA2A 4L73A 4OLOA 2M3DA 3PW0A 1SC3B 3HSGA 5H1SV 2RRBA 3T5HA 4LREA 2FIUA 4RBTA 3AAWB 3QGPA 1T9TA 1FVSA 4IG3A 3DN9A 1H7WA 3BN4A 3MAQA 4ZVEA 1C0TA 4PWWA 2KRBA 1Y3KA 4LF8J 2ILYA 1HNXJ 3QO9B 3HVAA 5KFIA 2VU5A 1OWXA 1XBWA 4ZMMA 3I56S 4IYQA 3EZUA 5J1PA 4ELVA 2KL8A 3FSIA 1X4GA 2AMCB 4KPCA 3DLLQ 4M5KA 3PYGA 1RLCL 4O4GA 5KFBA 4I4BA 2XI3A 4ED2A 3DU6A 2XO7A 2HFOA 2YKAA 2FHMA 4N77A 5F8MA 1LK5A 3K8VA 2Q3PA 2LXIA 2OEKA 1L3KA 1JK9B 2YXLA 2V4RA 4FYVB 2F8HA 4I56A 5HATA 1NU4A 1RT4B 5FD1A 1UP1A 2OO4A 1RWPB 5FIIA 4KGKA 3O2IA 2C2NA 3W60A 1I51B 3QSIA 3RYLA 4F04B 2E9ZA 2VBXA 5KT2A 2R7OA 4P72A 1U6BA 5EWEA 2VONA 3RBXA 1IR1A 1FXLA 4DQRA 2ZBQA 4A47A 1H98A 4USKA 2BZ2A 1IJFB 2AWZA 4MK7A 4U95A 3OTOF 2R42A 4DG1A 4XTTA 3OLAA 5D4NA 3MOZA 1VRQC 1ZBTA 5L1KA 2QMWA 3NCQA 4OX7A 2D1CA 4CH0S 4WXOA 1OYEA 1N36J 3MM8B 1LWCA 4I7FB 2V5HG 5B0EA 1FCAA 3US5A 5CYJA 2WZ1A 2CQIA 1HYSB 1GK8A 1S72S 1FE4A 3W5YA 4DBQA 3PX6A 1XMOJ 4J91A 4C0BA 4A8XA 4IKAA 2I5JB 4JV5F 4OZ0A 2RAQA 1S6OA 1RT5A 1VS3A 1FE0A 2GQQA 4UQTA 3J80U 3D1HA 2XY5A 5DETA 1VGYA 3BH6B 2CA9A 2YWGA 4WXWA 3HVRA 2V8DA 2C2ZB 4RNOA 1X4HA 1S4EA 4ED6A 4Q5VA 3PW4A 4ZVPB 2NZ4A 2WAQD 3PFOA 3EVWA 3R3TA 4DX8H 2WSCC 2W9AA 3VAIA 4F25A 3MMBA 3DFEA 1XIQA 5LSOA 1FKAF 5LMNF 1HBMA 4M5DB 3H59A 3ICLA 3G87A 2BRLA 3PCOB 2J5AA 2JEGA 2I8EA 3I96A 3H4BA 4LVNP 4MIBA 4B3RJ 2J6TA 2FY8A 2E66A 3VF0B 4OL8A 2LXUA 4ED0A 3C15B 5KT5A 4MKAA 2ZBIA 3Q8SB 2FLOA 3TZZA 3MXHP 1U0HB 2K1RA 2O5DA 4WZMA 2E5LJ 3ITHA 2HQGA 4LRDA 1BC6A 4IOBA 3HLUA 2AEJA 1B4SA 4F8RA 4UOCA 2AX1A 1CQNA 4FXVA 1RUSA 1U48A 4USTA 2X1FA 3C6UB 2KHCA 1OS5A 3SV3A 2HHUA 1MMNA 4WIQA 4IH7A 5AXKA 1SUQB 2VDIA 2V94A 4YN3B 3T5JA 1EJ7L 1VRTA 2HRUA 3OHBA 2HFZA 2WSEC 1U6ZA 2V2KA 1N48A 1KEKA 4ZIVA 3M6UA 4ED1A 3R5CA 1L5UA 3AH6A 1RISA 1S7HA 4C98A 1AUDA 4M5NA 1HBNB 1DTQA 1WSVA 1K73T 1CJUA 4C0OC 2GHWA 1U49A 4B9SA 2YBVA 3QAUA 2MQOA 3FGVA 2YX4A 2IJRA 4OX9J 4QIGA 1CC8A 3FRYA 1V6HA 3J7A1 5A6PA 4LIRA 1OQ3A 4Q7AA 1SIZA 4X62F 4K0KJ 2G2YA 5A8WA 2ZKUA 4URGA 4YR2A 3CD5A 2YQ3A 1J5OB 2H54B 2WVDA 2MTLA 4CT9A 3ET6A 3KLEB 3MPUB 4M1KA 4ZVHA 4QR2A 2WK4A 1ICEB 2WTFA 3K7RA 2MZRA 1NK8A 1YITS 4KR0B 4OI6A 4IUFA 2D3O1 3G96A 3CCJS 2FGOA 3IR5B 3K57A 1F2HA 5AE2A 5IWAF 3KUEA 3L4BC 2ZWPA 1Q8BA 2ZZTA 4JI7J 3E2EA 3LP0B 2ADCA 2OMLA 2UU9J 2OTLS 3EPIA 2FTRA 5F8NA 4WFXA 1HI0P 4FS2A 3JSMB 4TYAA 5U47A 3T1HJ 2YKMA 1VQ5S 4ZIWA 5EUHA 1FESA 1Q16B 1P6TA 5A8RB 2UVWA 4NA1A 1HMVA 3QT5A 2MQNA 2UV8G 1VOMA 1HI1A 4EBCA 2JVOA 3IMQJ
chains in the Genus database with same CATH topology
2VBYA 1KOOA 2R8JA 5J1NA 2MJUA 2XMUA 4BDPA 3MMBB 4FZVA 3TARA 3JB9k 3HHNB 3TA0A 1TVRA 4NWBA 1VRUA 4MKYA 1JKHA 3OR2B 3BSNA 1TL5A 3FEYB 2HWIA 1YBAA 4HVZA 2KU7A 4DF4A 1HBMB 3KLFB 4RUAA 2AD9A 1S1VA 3M32A 2FLPA 4B9MA 2YKQA 3KG0A 4LSLA 1C1CA 3H2UB 2CKWA 2CQ4A 2DNZA 4UUXA 3QMQA 4WE1A 3AJ1A 2COLA 2QMXA 3CEDA 2FD2A 1KHVA 4KAIA 1S6UA 1AFJA 5IFMA 4QU6A 2V4JB 2ZDOA 2L41A 3MM9B 1G6BA 4NXMF 3VR1A 1HPZB 2OPSA 4I2QA 1SV5A 1SB6A 4K59A 3MZIA 4NLGA 2ZH7A 5KFZA 5D6GA 1H2VZ 1ROFA 5DDOC 4LFCF 2DGOA 3L3CA 4H4OB 2IFXA 3V6HA 1FJEB 2AYBA 2V8HA 1BQNB 2M8DB 2F8MA 1MWYA 2RD5C 1LOUA 2RIJA 1LW2B 5IM0A 2CQDA 5HP1A 2IAJA 2UVUA 4CQ1A 2GIQA 4FPRA 4DQIA 2ZHOA 1A6LA 1DAXA 2VFRA 4A8WA 4EBDA 3SI8A 2JC1A 4NLDA 4KGMA 2CG4A 2O3DA 1VHFA 1N5YB 2ZHAA 2C3UA 1Q82T 2K1RB 4ZS6A 2NPIA 4CNYA 4B02A 2DGUA 3K58A 2B6AA 5L1JA 1TFWA 3GR1A 4C3LA 2KT2A 3ITHB 2BE2A 4UW2A 1ZZNA 4PRFA 5F8GA 1RQ0A 2RKIB 4DN0A 1IKXA 2IVFB 6FDRA 1ZYQA 1TL3B 2DRAA 4F4ZA 4ZA1A 2L9DA 3M2RB 1UA1A 3LF0A 1DJ0A 2VG5B 2MY7A 2MZ1A 2FVPA 1S79A 4QOTA 2ASDA 1F9FA 4OJ3A 5E2QA 1JLCA 3M9NB 5EN1A 3H20A 4O44B 3I0RA 4O3NA 1WHYA 3CIZA 4OX6A 1IQZA 1GT8A 3CD0A 2ZH1A 3FZ2A 1YJTA 4PXDA 5CD4H 1VQPS 2D3ZA 1YJNS 2PGCA 2GW8A 3CPWR 4NLXA 4X65F 2HHTA 4PG5A 4CH1A 3D1QA 4F3MA 4QPXA 4DV6F 3DOKA 3S6EA 2B0GA 4YP3A 3DRSB 4X66F 1G1XA 3L7OA 1R89A 5KG6A 5LT5A 2HYIB 4WK3A 4B17A 3C3LA 3DRXA 3O1LA 1UW4A 5K9FA 2KKHA 1UJ6A 2PA3A 2KM8B 1WHXA 4FS1A 2XCPA 1LQ9A 3PACA 3T5LA 2YH1A 4X4RA 2A3JA 4RW7A 1R31A 4O4RA 2WB4A 3GFHA 4OHVA 1SJ4P 5B08A 2A2CA 3CULA 1HBOB 1VRTB 3FQKA 2C22A 4E98A 4J9OA 1UVNA 1PILA 1TAUA 2XG8A 4FVCA 3C46A 1W2IA 3QWUA 5HROA 3CCWA 3DOMA 1R3NA 2CPYA 3R5DA 3PO4A 4GKJF 3OFEA 2ZOFA 3HZGA 4C9DA 2HW3A 3MMAA 3TUIC 3PW5A 5C25B 1XNRF 4YUDA 2IC3A 3OL7A 3KNGA 5LSLA 2YWEA 4C8OA 1JLEA 3PEHA 4PKDB 2DTJA 2E7XA 2J9CA 1ZM9A 2LEAA 3OUYB 3CCES 5DG7A 5F8IA 1F2GA 4RW6B 1WHVA 4ZVGA 2HFNA 1KHWA 3JSYA 2JWNA 3B78A 3N28A 4LT6A 1S1XA 2OD6A 4DL7A 1Y7PA 4MMOA 4ZCKA 1DTQB 1ZPWX 2RQMA 3GFZA 3TQ1A 4NOHA 1UVIA 1S6QA 3C6TB 4CH7A 2V8GA 3KYLA 2LA4A 3AA9A 3UW1A 4AL7A 3KK2B 4HEA9 2AF6A 4C7QA 5GADU 4BHQA 2E1AA 1JLAA 2R2TA 4QYRA 3TOQA 5KFNA 1ZOTA 2WOMA 3QWPA 5CQGA 1C1BA 4KPYA 3PEJA 2XC9A 5LJ5Y 4P7VA 4H54A 3MM7A 4XK8C 7FDRA 1AW0A 1SKSA 3M6WA 5KFEA 3GYXB 1L3TA 4J5OA 2FHJD 5LXYA 4JI1F 5BYRA 4DR3F 2Y0SD 2M9KA 1FKOB 3U1LA 2R9LA 3T1YF 4WFZA 2E5IA 2PDAA 2UVRA 2LU2A 3QIDA 4ID8A 5KFFA 3CJ3A 2XSJA 2DCLA 3DRYA 3IWXA 3BO2A 4DV5F 1HI8A 3MPWA 1PC4A 2FVCA 2IBOA 1QAYA 3BF4A 4HI2A 2DR7A 2HHWA 2J7UA 1WEZA 1VK3A 1TL1B 4NA3A 2VUGA 1KVIA 1ZM3A 2AW0A 2X1BA 1XMQF 5A8WB 5I42B 3BQ0A 1H3DA 3NBPB 3OTEA 5KFXA 3HX9A 1B7FA 2BJDA 2YX7A 5KFPA 2KRRA 3CD7A 2KJWA 4HT7A 2YKNB 4NLTA 1NZAA 4NCGA 3RAXA 4NYOA 4ZP9A 1P27B 3MM5A 2IM0A 2E5JA 3KK1B 2XNRA 5DO2A 4JI0F 2BA9A 5K8MA 2M0GB 1JIHA 2HHSA 4Q44A 2FGCA 4DS4A 3F41A 4DQSA 1B0PA 1YI2S 3HHLA 5CA5A 5KFKA 3GWCA 2NPFA 1S77D 1TKZA 2XWXA 1T03A 3MPYA 2EI5A 5E41A 4D3HA 3VQSA 3UD4P 1FKPB 1M5SA 4TY8A 3S7RA 3TAQA 2LQBA 3N9UC 2XLJA 2AGOA 3CUNA 2D3UA 3KK3B 4B9NA 4LF7F 4X2BA 2R7WA 3R1LA 1RT2B 1P9QC 2L3MA 5KFTA 3OR1A 5GAHU 4DR5F 2HGLA 5B0CA 2UUAF 3BN7A 2M4MA 3CCZA 3C66A 4JOUA 4UUWA 4ED5A 3UPFA 4LF9F 1OSCA 1FERA 4IFVB 2HHXA 1HWLA 3BR9A 3RW7A 2E1CA 4KJIA 2CQBA 2CQ2A 3N79A 4KV8B 3MR5A 2AQ4A 2VBWA 1FNXH 4HTJA 3CCRS 5KG0A 3BS9A 4WJBA 3TAMA 4RW4B 3CCVS 3QLHB 1HHSA 2NLWA 3T5KA 5JUMA 4ECSA 4PPDA 4RNNA 1SJRA 4UQGA 1Y3JA 1JLGB 1XK8A 2CPHA 1XR7A 3O6QA 4NPOA 4PG4A 5G4DA 4Z37A 1KD1T 4E0DA 2F40A 3M30A 4EFAC 1VQ6S 3VAHA 3HHLD 3K8WA 2YKPA 4OZLA 1A9NB 7FD1A 3SSRA 2CJBA 4ZK7M 3NGDA 3F73A 2YKMB 2E1RA 3DYAA 2BVZA 3DRRA 1LWFA 6FD1A 4NLYA 5L38A 2CZ4A 3OSPA 2UUTA 3KMQA 2MY8A 3I0SB 2YNIB 1HMVB 1RTIB 5CYQA 1S1TB 3NRBA 3UCGA 3IG1B 3M1VA 2E44A 2XCAA 3IAM9 4DL2A 3UDCA 2AJ0A 3G6VA 4C11B 4Z2XA 3TVZA 3SSSA 4RW8A 4BC9A 5C5JA 4XPCA 4IDKA 4ICLA 1HD0A 1HFEL 4MKBA 4TKTA 2C3YA 1NKBA 1HBUA 2GQCA 4C97A 3GSDA 1Q53A 1TVRB 2IM1A 2CPZA 3LAKA 1VRUB 5KFDA 1L3VA 4F2RA 1JKHB 5ADZA 2PFFB 5F3ZA 1T3OA 2ZHBA 1UKUA 1X5TA 3QZ7A 4I6YA 4ECUA 1S1VB 1OIAA 3M32B 2KFNA 4LSLB 1C1CB 4FNIA 3B4DA 5CCLA 2V4QA 2J6UA 1RYRA 4WE1B 2ZH9A 4WKRA 5KFYA 4NZ6A 3CSKA 3PRBA 5F9LA 2OPSB 4Y00A 1SV5B 2JEJA 2HS0A 2KB2A 2Z2LA 1TFYA 2BACA 5J1EA 1XWLA 3SZ2A 1X0FA 2JZ5A 4ZP6A 4Q0BA 4IQMA 5IM0B 4BWMA 2HS4A 2DD8S 4OLPA 5HP1B 3DLHA 3IA0A 4CNZA 2DH9A 2M8HA 3D0HE 4DQPA 3J80Y 5KG2A 5KT6A 2X51A 3TYTA 2D9OA 3TVYA 3UQSA 1UJ4A 5KFUA 3UI3A 2YWHA 3NS5A 5CXTA 4HL9A 2BQRA 3WC0A 2XZWA 1VQ7S 3KFWX 2CPIA 3FNNA 2B6AB 2R8KA 3LANA 4ZPAA 1NHUA 2KXHA 3DLKA 2BE2B 2D41A 1D9FA 2GX8A 3NNCA 2BANA 2DNHA 1RGVA 2JLFA 1D8ZA 3FQLA 2BJEA 2KG0A 1IKXB 4IOCQ 2B7BB 4F02A 1KN6A 3ZZUA 3O3LA 5KAKA 2RUGA 2BUNA 3MF5A 4DDFA 3J7ZT 4Q2MA 1JLCB 3HHDA 3M4XA 3MUMP 1VBZA 1Z1ZA 4YB7A 3RR7A 4I2PA 1UA0A 3GIIA 3SMZA 1RTDA 4WYLA 2NYIA 3M05A 4KSEB 4CTAA 1JXEA 4DOZA 3V4IA 5J2QA 3MECA 4ILMA 3LOUA 2V9WA 2OP5A 1IBMF 4DF8A 3HHKA 1VQKS 3R5BA 2YKOA 1RTHA 2W8LA 3KG1A 1D8YA 3DOKB 2ABYA 2VPZB 4TN2A 4ZVFA 2EFOA 5L1LA 1RKJA 1NK7A 4HYKA 4TYBA 1RAJA 2J7KA 3PW7A 3IFEA 3PJXA 1H38A 2DR8A 5GAGI 5KT3A 2KYXA 3MM6A 3DNCA 2CYYA 2ZDPA 3GILA 5BR8F 4RW7B 5KG3A 1ULRA 2VFUA 4OFZA 1FJGF 3CJ0A 4OI2A 5E3PA 2AP6A 3FCHA 4H4KA 2AU0A 2IRYA 2LYVA 1FTRA 1WI8A 5HROB 4RUHA 2P9CA 2JHEA 3VAKA 1GTEA 2C3PA 3MMAB 2EG1A 5E3QA 2IC3B 3W2WA 2N7CA 2VV5A 1C4AA 3LP1A 2Y1IA 2VODA 3D28A 4G6VB 3IO1A 1JLEB 3S1TA 1WHWA 2VKRA 3CJ4A 2GMHA 3PHEA 5CYMA 2RDJA 1LK7A 1U7LA 4WF9Q 3UDLA 4F4WA 1VIOA 1GXTA 2DR5A 3A1YG 3N6MA 4RX6A 2J0WA 1S1XB 1HNWF 2YNHA 2DGXA 2QRRA 2BXJA 2HNZB 1S6QB 5HQ8A 1XMBA 4TY9A 2VG7A 4R25A 3CCQS 4RLEA 4X4UA 2R7XA 4URSA 4NX9A 4EEYA 1RA7A 1S9GA 2VFSA 2OPPA 3IN5A 2LA6A 1JLAB 5D4OA 2Q1LA 3P3DA 2WOMB 1JB0C 4OZ1A 4A8FA 4WZQA 3DLEA 3RRHA 1C1BB 4DV4F 1E6YA 2YY3A 1BLUA 3ZZ0A 2NXUA 5E0OA 3H40A 5F41A 4NLRA 3AB4B 1WD6A 1NJIT 1S49A 1HARA 1TL4A 2KXFA 3NKYA 3HT3A 2Q79A 1DARA 3A8EA 5F9NA 1F5BA 3TR5A 1QAJA 1LKZA 1R0AB 2F9JA 2M5YA 2H5EA 4HH0A 4RBVA 4C8NA 5IS2A 4DJBA 2CQ3A 5B0BA 4BBYA 4DL0C 2MXYA 2IJFA 2AYGA 2CPXA 4F3OA 3DGPA 1UAWA 3M9OB 2J0SD 3GFYA 3GFXA 2XY6A 3H2VE 5D8HB 4YB5A 3OTCA 3JYTA 2RF2A 3OQ2A 1TZ0A 2DNPA 3VAMA 2YWKA 1XNQF 3LP2A 5A8KA 3D2WA 2HVHA 2AJFE 4QW8A 3DLGA 4I0WA 3DOLA 4I1TA 4DUZF 3PX4A 2D7SA 1HNIA 3DM2B 4NCGB 4JI6F 2QLXA 1YQHA 3MM5B 4N41A 5K8PA 2RS8A 3JTPA 1M1KT 3ONQA 2VPXB 2APOA 5E5NA 5KFVA 1WG5A 3ISND 2VASA 2DNMA 1QLNA 1B64A 1WTFA 4NZ7A 2Z0GA 2DISA 2YWFA 3HHLB 4WIIA 2JL9A 2OPRB 3I5BA 2XS2A 1T03B 2MZTA 2BM0A 4TU8A 4TY8B 5KG7A 2MSTA 2HNDA 3V81A 5HMZA 2FJAB 4N5SA 2L48A 4KHMA 2IRXA 2RQ4A 2OLWA 2CPFA 3OR1B 2W4DA 2M52A 1GX6A 4DHVA 2C2RA 4OHZA 4ZCMA 2CPDA 3LWLA 3G6YA 2M70A 2LQ5A 3PX0A 2KT5A 4A8YA 1S0VA 4USJC 4KHPF 5A0YA 1IKWB 3V6DA 2YNGA 5HBMA 1IQTA 4MFBA 2R2SA 1Y5IB 1UEVA 4B3OB 1X4FA 3IRXA 2DNGA 3TAMB 2N3LA 5B7WA 1WF0A 2XS5A 2NUUG 1D3WA 1RT1A 1QSLA 3GZ7A 5EX3A 3MUTP 4USHA 2JLGA 2MKSA 1D9DA 3KOAA 3MEGB 4PG8A 1NH8A 4HDHA 1FD2A 1N5VA 2CVEA 1HWUA 3W2VB 2XMTA 4M63A 1RTJA 3PY8A 1N8RT 4YDDB 4FYDA 5IZHA 4DR7F 1GH8A 2DNKA 2R4FA 2DNNA 1IUJA 2HRYA 3M30B 1RT5B 1DZ5A 1RJJA 5E3AA 4O3QA