3KG1A

Crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
ADEVTFVNRFTVHGAPAEFESVFARTAAFFARQPGFVRHTLLRERDKDNSYVAIAVWTDHDAFRRALAQPGFLPHATALRALSTSEHGLFTARQTLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism
pubmed doi rcsb
source organism Streptomyces nogalater
molecule tags Oxidoreductase
molecule keywords SnoaB
total genus 26
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature ec 1.13.12.22: Deoxynogalonate monooxygenase.
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kg1A00
2BBEA 2K7KA 2XMMA 5B09A 1OPZA 1TR0A 2GGPA 2XMTA 1RJJA 1MWZA 1R6YA 1X8DA 1N5VA 1YJUA 2VH7A 2HLUA 3CJKB 1FVSA 1CC7A 1IUJA 4A46A 2GV1A 4Y2MA 2XMKA 3BB5A 1YG0A 3KKFA 4F67A 2BYCA 3MCSA 1CC8A 4DPOA 1JK9B 1FE4A 2QLWA 1W2IA 2XMWA 1AFIA 1VQYA 1SQEA 3HDSA 3BM7A 2ROEA 4HI1A 3WDOA 2AP6A 1X0PA 2HQIA 2GFFA 1N5TA 2LQBA 1FEEA 2XMJA 1Y3JA 3LGNA 1TUVA 3HHLB 2GO8A 3HHLC 1YJTA 3TRGA 1APSA 4YEAA 4Y2KA 4OJHA 4ZOSA 1V3ZA 3BR8A 1Q53A 1KQKA 3VTIA 1KVIA 2K7JA 3HHLD 2ZDOA 1GXUA 2EW9A 5B08A 3CJKA 2K2PA 4Y2IA 1QUPA 1YJVA 2ROGA 3K7RA 1SI9A 1K0VA 2W4DA 3HX9A 1AFJA 5IXUA 2LXFA 2AJ0A 3DCAA 1Y9OA 2IFXA 2RILA 1FE0A 2OFGX 3BDEA 1S6OA 3TNVA 1S6UA 2HLTA 1P6TA 2GGPB 2BJEA 2JDJA 1VQSA 2QIFA 1FESA 1FVQA 1OSDA 2HIQA 2OMOA 2FB0A 3KG1A 3QGPA 1Q4RA 3HHLA 4OIXA 4QOTA 4HH0A 4OJ1A 1YJRA 2FHMA 4ZA1A 1N5QA 2N7YA 2QYCA 2G9OA 2LQ9A 2ASYA 3LGMA 5F0WA 2KYZA 2W4CA 4HL9A 3I9ZA 4OJ3A 2OKQA 1YRXA 1FD8A 4Q2MA 2KT3A 2OD6A 3FMBA 4FNIA 2RSQA 3BGUA 2QLXA 1TZ0A 1Q8LA 3IWXA 3LO3A 4HI2A 5B0AA 2XMVA 4U9RA 2AJ1A 5T7LA 5T7LB 1LQ9A 3DXSX 4NL5A 4OJGA 4EFAC 3BN7A 1TL4A 2OFHX 1GXTA 2PD1A 3HF5A 3KNGA 2ZDPA 4FNHA 1P8GA 5B0CA 2GA7A 2AW0A 5KAKA 1XBWA 5B0FA 2HFOA 3IWLA 5B0EA 1CPZA 3E8OA 2PGCA 3TOQA 1KVJA 5F0UA 1U7LA 2VV5A 2BJDA 4A4JA 3MZIA 3F44A 1JWWA 5K9FA 2N4CA 4A48A 1SB6A 1URRA 2ROPA 2XMUA 2RMLA 2Q3PA 2BUNA 2GCFA 2FTRA 2K1RA 2IYGA 2K1RB 1X7VA 2ACYA 1N5SA 3T9NA 5A6PA 4HH1A 3HFKA 1TL5A 2KKHA 5B0GA 5A6WA 2OP5A 4Q2LA 4DN9A 3BF4A 3FGVA 1Y0HA 2KT2A 4DL0C 5B0BA 2W4PA 1OQ3A 2N4DA 2OD4A 3GZ7A 4NPOA 2CRLA 1ULRA 2IYIA 2LDIA 2HFNA 3KG0A 1MWYA 2FIUA 4A47A 1AW0A 3QMQA 4YDXA 5B0DA 2L3MA 3FRYA 1Q8BA 2OAUA 1OQ6A 3UDCA 1WD6A 1Y3KA 2RU9A
chains in the Genus database with same CATH superfamily
1RDRA 3SBMA 1WJ9A 3ZZOA 2OEMA 4DPXA 3NCQA 2JEGA 4ZK7M 4QIGA 4FBTA 5EX0A 1C4AA 4LFBF 2W2QP 4PKDB 3CTRA 2VQEF 4DXLA 2DHAA 1KLNA 3W63A 3TZXA 4IQXA 2P9CA 4PG4A 5BR8F 4DPOA 2XTJP 4NLPA 2RKIA 3T19A 3TYTA 3WDOA 4KT0C 2ROEA 4B9TA 3C15B 1SC6A 2GFFA 3TANA 1DZ5A 3KK1A 2Y8YA 3HI9A 4DV3F 2DNOA 3PYFA 4OI0A 2M2BA 4ITSA 1HQUB 3CJ3A 3HHLB 4TY8A 4USMA 2W2NP 2DHHA 2VB6A 5JVHQ 1HLWA 1M0SA 3DFEA 4JI3F 4ID5A 3UR3C 4ZOSA 3N9UC 1LFPA 3C6UB 1ZA2B 2EG2A 1FDAA 1MROA 2AGQA 2YNIA 3DLHA 1Q7YT 5BXIA 1JLAB 3FQKA 1HBOB 3U1NA 3J80U 2ASJA 2M70A 3BBBA 4B3OB 1RAEB 3SCIE 2LQ8A 3NWGA 4MMOA 1TV6A 2F3JA 1TL3A 1WF2A 4UOGA 3WX8A 5ETOA 5JVGQ 1TAQA 3AY0A 4K50A 2C22A 4DZ6A 2RNEA 1QVFR 3NNHA 1PBUA 4G1IA 1VQSA 1TVRA 2QIFA 4FXWA 2BRLA 1EKSA 1FVQA 5AJ3F 3K59A 3PV8A 4B3MF 5A8KB 1R0AA 5KFQA 4ECQA 5H9EK 2J6TA 1C1CA 1GTEA 2XSJB 2KXNB 3OXLA 4RJVA 1Q8IA 3MMBA 1N36F 3EDQB 4JBCA 3ZC4A 3IWNC 1QUVA 3QZ8A 2XGPA 4ZP8A 4J5OA 4WFBQ 3VGTA 2HRUA 2M9KA 2CQPA 2QYCA 1U24A 3CCZA 4LVOP 3SDEA 2JC1A 4NLUA 4YFUA 2P2CB 4I1TA 2ASYA 3D3BJ 2BE2B 4DV5J 1U02A 5KFUA 4HL9A 3ZTQA 2ZH1A 4DQSA 3Q8RB 1O51A 4B9SA 3M7VA 3FRZA 2R7QA 3SV3A 4DR6J 2POKA 1IJFB 2BJ8A 2DJWA 2QL5B 4WCEQ 2D7SA 1TQLA 1VCTA 3EGNA 2XMVA 3CB4A 5I3QA 5KFBA 2L48A 1DFDA 3KJVB 3OFEA 3CJ5A 2DRBA 2HAFA 3B54A 2BJ9A 3CCES 5DGAA 5I42A 1D09B 4F4AA 3DOLA 5F9NA 7FDRA 1B0PA 1SH3A 3MURP 1TK5A 2IA6A 1KNZA 1BE4A 3BPDA 3LP0A 2IDEA 4JYAF 2VBZA 1X4CA 2OEKA 5B0FA 2DH7A 3OLAA 3TWZA 2XULA 3ETOA 5E3CA 3TQ1A 5D6GA 1RWWB 1UP1A 3K8WA 4E8UA 4QIVA 4QWEA 4JI0J 4QJVA 5D0RA 1C0TA 2D69A 4DG1B 1RABB 2V68A 4MKAA 2VG5B 1I94F 2AJ4A 4WFXA 1HNWF 2J9DA 3C16B 2GMJA 5THWA 4ZP7A 2EFGA 2JSXA 3PJ9A 3K57A 2Z58B 2K1RA 3OTCA 2W8KA 4NLRA 3KLFB 2MLXA 4GVBA 4F2SA 1C1BA 1TUGB 4CH0S 4LQ3A 3A3NB 1J27A 2DGWA 2PDAA 3MMCB 2OP5A 3S1TA 2YNHA 3HP6A 2UZAA 1SKUB 3CCRS 3DMJB 3W9IA 1D1UA 2GHVC 3KLGB 4RR5A 1CJTB 2WVEA 1EQMA 3I87A 2MKHA 4Z7YA 2CNNB 6FD1A 2DGTA 2E1MC 2E1AA 3C14B 3W9HA 1VHIA 2L3MA 1NKBA 1RSCA 1L5UA 1MSWD 2EBGA 3LPEA 4FYDA 4USIA 3GPAA 1H2TZ 1RCOB 1YJ7A 2E5HA 2KRBA 2OPSA 4NZ7A 1MWZA 4ED2A 1ZETA 1KD1T 1QSSA 5KFZA 2MEWA 3KLIA 1UKUA 2Z8QA 5J1NA 4F3QA 1H38A 1FX2A 3FEYB 3R8YA 2XB2D 2QA1A 2AEJA 4H4MB 2M7SA 4KAIA 5LSRA 1RTDB 5I3UA 3H5SA 4DFKA 1N88A 2EEYA 3W3SA 1BWEA 3HSJA 2B4OA 3Q8UA 3UI3A 2C2KB 2KT5A 1FKPB 5L46A 3VALA 2YWWA 3C16A 4EZ9A 1FRIA 1GX5A 1MW7A 4DUYF 1HNVB 1IBMJ 3ICLA 2MKJA 4DV4J 4F4WA 3CDBA 5KG2A 3VGVA 4J91A 2C2MB 2M88A 1P9YA 3P96A 1RTIB 1O6XA 2XZTB 4OZLA 5A0YA 4DFMA 4FYXB 1F9EB 4ZCLA 3PCOB 4DUTA 4QWCA 1BQNB 4RW7A 2W9CB 3EICA 4DR2F 2R8KA 1N33F 3HKWA 4PQUA 1S6QA 3BQ0A 3BKUA 5B08A 2OELA 2IC3A 3G87A 4DLGA 2UXDJ 4C7QA 2ROGA 4MH8A 3TQEA 3MOZA 4P2MA 4HEA9 3L4BC 2DR6A 1NSPA 4NYPA 4ALZA 2E5IA 4ES2A 2AIRB 2ZUAA 4M1KA 1OY8A 3NS5A 1U1OA 1NCLA 3UCGA 1NJXA 3BBFA 3ITHB 1FXDA 1VI7A 3MMAA 2GIRA 3MM9A 5FLXY 2AWZA 3KXDA 2AHOB 3R5GA 3W5XA 2Z4PA 3M8YA 1NJIT 5G0RA 2ZWOA 3BYRA 5ETMA 4DX7A 2RDIA 3O8WA 4R0EA 3JSBA 3FJ2A 5RUBA 2N7CA 3KFWX 2DR7A 1S4FA 2ZBPA 2DHGA 1GMVA 3CMAS 5K20B 3VAGA 1H0HB 3RJMB 3TUIC 2KVIA 3M8QB 4YOEA 2XCAA 1NLKL 1FO1A 2R8IA 1U8WA 3HVWA 4X64J 3QJLA 1NNDA 3QIDA 4ZPCA 3SSQA 1YRTA 3LP2B 2B4PA 3UVJB 2FLPA 4HI2A 3BGUA 4UF4A 1Q86T 1X4HA 2BVZA 3DXBA 4JI4F 2UUTA 4MAKA 2E7VA 2L9DA 2AJ1A 2KRRA 1VIOA 2V8HA 4D3HA 3FSIA 2FVPA 3DXSX 5LMUF 2KG0A 4OJGA 4QQBA 1PYTA 5AE1A 2FJEB 4RL1A 3VWSA 2W25A 2VQFJ 2NLWA 1RT5A 1P8GA 1M1KT 1M5KC 2GA7A 1MROB 2PIIA 3V6DA 3VAKA 4F8RA 2HNYA 4NX9A 1RT3B 5T14A 4XDCA 3HM9A 1ZAVA 3IRWP 3HSZA 1S1VB 1IXKA 2VV5A 3DGPA 2VL1A 2LVWA 2M8HA 5LOQA 2YQ3A 4LRBA 1R0CB 2IAJA 3HT3A 2W7PA 1VQ7S 2V9WA 2C2ZB 1FDNA 2NQPA 1U0HA 2GO9A 1DTQA 2MKCA 2XZWA 1RHJB 3GIMA 2KU7A 2DNKA 2KHDA 4M8LA 2CZ9A 3UD4P 2IYGA 4M95A 2BQRA 1UFLA 4CNZA 5B7WA 1AUDA 4A8KA 5HMZA 5JJBA 3NG8A 3CIZA 1JLEA 1AT1B 3Q8PB 1JLQA 2APOA 2G0JA 4FVCA 1Y0HA 4WU2A 4C9DA 2UUBF 4K4TA 2J6SA 4C48A 2UXBF 4BDPA 3WIVA 4ZVFA 2ZE2A 2LKZA 1TKTA 4ZVPB 1HNVA 4CI0B 5KFCA 3J7Z5 2JOQA 5ITHA 1RU2A 3OTOJ 2GVZB 2FGCA 4ZCKA 3D54A 2N3LA 4X65F 3BO3A 1H74A 3CDWA 4Q0BB 2ZEJA 3KJQB 3MEGB 1FI4A 3D6TB 3T5LA 2BBEA 1S7HA 1VFJA 2DITA 2HZVA 3JTOA 1NHVA 3UN3A 3PG9A 4HACA 1QVGR 2DPJA 3KHLA 3M1VB 1ZPWX 1R6YA 1X8DA 4BWJA 4JI1J 1X5PA 2HVDA 3HVTA 2D3UA 3OHAA 3IXQA 2B9EA 2ZBRA 2RHQB 1TKZB 5LM7E 1RTHB 2B9YA 2MZJA 4KO0B 3X1LB 2X51A 2EFVA 4NWBA 5C5JA 2YKMB 1OY9A 2ASLA 4ECWA 1VBYA 4LF5F 2H54B 2NZCA 3D0HE 1RISA 3K0JA 3D4JA 3NGDA 3PHTA 2H65B 1N52B 1ICEB 1TUVA 2BACA 2E5JA 3H90A 2KH9A 4LF4F 2V4JB 4RW8A 4NZ6A 1IWAA 2XG8A 4WE1B 3CF5Q 4U96A 1H3DA 2B6AA 2O01C 4OHXA 4WZMA 1SC4B 4MK7A 1EETA 3CCMS 3VAFA 4OJHA 2R8JA 1NPRA 3PIPQ 4B9UA 4RW6A 1KP6A 1V3ZA 3Q2SC 4XK8C 3DLKA 1AB8A 3J81Y 4DZDA 4ER8A 4X84A 3LP1B 3L09A 1VLYA 2UP1A 3ET6B 2NZ4A 4CO0A 4E98A 5M2UA 2KFNA 2K2PA 4Y2IA 2X1AA 1IKWA 1XJWB 2AKWB 3L7PA 1X5OA 2MSTA 4YDDB 3J7ZT 1OSCA 3HX9A 1GMWD 1K0VA 1WHYA 2AX1A 1NK5A 1W2BR 3NAIA 3OBIA 4LRFA 1YZ7A 2OPSB 2QZ8A 2AGOA 2AQ4A 1KOOA 4UY8T 4H4OB 2W2OP 1M5PC 1JLFA 1IQTA 1YHQS 3I55S 1FESA 1DTTB 1RT1A 2VD3A 1WKJA 4PYDA 4P74A 3MPYA 2RVJA 4HT5A 4OIXA 4JI5F 5ETTA 4OYAA 4F3MA 1CJVA 5CZVA 4USKA 3W2WB 3KHGA 3E2EA 2O3DA 3PEHA 2DNPA 2HNDB 3WIUA 2R9LA 2VC0A 4HTJA 2W01A 2AJFE 3RUBL 5LJ5Y 2WTFA 3G8SA 1XNQJ 2HFUA 2QLBB 2HRTA 3PACA 3US5A 5CCMA 1N32F 2M0GB 1CJTA 3VF0B 4DV6J 3I0RA 1RWKB 4ELUA 2MDAA 4QIEA 3C6TA 5HP1A 2HIYA 3OT9A 5GAHI 3ENVA 3K17A 5KFIA 2VOPA 3UCUP 3QAUA 3CC4S 5T7LA 1S1UB 2MY8A 3KTQA 5AXMA 1CULA 2EG1A 2F1FA 2BOPA 1S9EB 1WEZA 4TYBA 2LA6A 1DHMA 1JMTA 4I2QA 2PC6A 4JOUA 2ZM6F 4LF9F 3BV8A 1GEHA 1ZM3A 3MAAB 2UU9F 3UD5A 3FMWA 3IR6B 2JVOA 3MR7A 4FPIA 4MTPA 3NGTA 4P2FA 4C98A 4CO1A 2D74B 2DEIA 3MI7X 1Q5YA 4DR4J 2UXDF 2JRSA 2KZMA 3SI8A 3EVMA 4ZPBA 1BQMB 4IFYA 1FKOA 3O3LA 1D9AA 2CUYA 1YLXA 3GSDA 3L95X 4NLOA 2RH3A 5L38A 1SB6A 1HMVB 4KTQA 5GMKa 4ED5A 3THVA 3CCSS 1YDLA 2LFVA 3H20A 3H98A 1J2VA 4C8NA 3T9ZA 4TLQA 1UW9A 1X7VA 4XDDA 4C0HA 5JUMA 4DS5A 2B9XA 5CXTA 4Q8EA 5KFSA 3FDSA 2HQFA 2CKWA 3M8PB 3MEEB 4P71A 1VC0A 1M5SA 3B82A 1XNRJ 2EVZA 5KFNA 1JJ4A 3PDNA 2MLZA 5E7OB 4WFAQ 3BQ2A 2IYIA 2ZH5A 2BM1A 3T5KA 1QAYA 2U1AA 1FRJA 2AYGA 3UNYA 4K4VA 2FIUA 3KMSA 4PEOA 2YPZA 4Y2CA 1N33J 1EB0A 4DOZA 3UDCA 3HXMA 1FKAF 1S4EA 2DO4A 3RB3A 4ANDA 3CCQS 3MEGA 2K7KA 3A3OB 1OPZA 3MECB 2EK6A 1EP4A 2XMTA 1RT5B 3P5BP 4X4VA 1QAIA 4JI6F 2EKYA 2V2ZA 1N5VA 1VQ4S 3CJKB 2PN6A 1FVSA 2CPHA 5HROA 3T1YF 4YUDA 4C3KA 3KKFA 2ZH9A 4OLOA 2XYPB 4HR2A 3HFVA 1TL3B 1O8BA 1WG5A 2V94A 4IG0A 4LSLB 3RW6A 4F50A 2AD9A 4HI1A 3KLGA 2HGLA 4RNFA 1NPKA 1DJ0A 4B3RF 2R2RA 1DQ8A 1MG7A 1RWPB 1SL1A 1VQLS 4ATNA 1RCXB 2KHCA 2ZWPA 2H9ZA 1KQFB 1FCAA 1KEKA 1NKEA 4KHPJ 1R43A 3OR1B 3PW7A 3BQ1A 4P7TA 3THTA 4AE5A 5C25A 2MQPA 4ELVA 1VC5A 1RTZA 2KJWA 5HN0A 1N4LA 3UW1A 2ZJPQ 4URGA 2HQDA 4DR5F 2MQOA 4C0OC 1IKYA 3EGWB 3OL7A 1REGX 2HFVA 4O3OA 4BLGA 5L9NA 3IM9A 4QU7A 1IKWB 2HHPA 1WNEA 3H0PA 5KFRA 2IFXA 1Y5IB 1X4GA 1FFSB 3RTVA 3GMGA 2G2ZA 2JDJA 3CVKA 3G86A 4KKOA 4MKBA 2E7WA 3M2UB 5EGYA 6AT1B 5DQIA 3CD5A 5KTQA 5KT7A 4H4KC 4RUAA 1FJGF 2P9GA 3MHYA 3QGPA 4OQJA 2ABYA 1U1QA 4FP9A 1CJKB 1C0UA 4IG3A 2EFNA 2J5AA 3FBFA 2BV3A 2H5IB 2WSEC 5CD4A 3W7BA 3CDEA 4O44A 2OHDA 4A8OA 5EUHA 1IM4A 3IAS9 4CYUA 3F41A 1FNOA 4DU8A 3JTPA 2HWHA 4DR1F 1A9NB 2D3O1 3KUEA 4OYIA 5CYJA 3ILIA 3V6KA 4DCOB 4DFJA 2KYZA 4U8YA 3JQJA 2MZRA 2QEXS 4E0DA 1E6YB 4B08A 4OYBA 2HFZA 3NEKA 4OYZA 4D3GA 1ZYQA 4LF8J 4TY8B 1HBNA 1F9FA 2KO1A 3N28A 4P2XA 3NGUA 1KWMA 5DZ7A 2CJKA 1RKJA 3KDNA 5T7LB 1NK9A 4HKQA 4N56A 1YJNS 1FRXA 1X9SA 3H40A 3DLKB 4JB8B 4U95A 1SH0A 1N48A 1PGZA 3KNGA 1TFWA 4DBQA 2G4BA 1S57A 3FEZA 3B6BA 3LWLA 1CJKA 4IG3B 1RB0A 2DNHA 2RS2A 4KJIA 1GH8A 4B3OA 4ZCIA 2PGCA 4QWDA 2FZKB 3GJTB 4M5GA 5E5NA 2KFYA 4F04B 3CJSA 3VGUA 2UVWA 2CVIA 2HGMA 3NNCA 2HS0A 4YY3F 4MIBA 1TKXB 3UO0A 4TQRA 1XR5A 1ZM9A 4C11B 2MKYA 4ZP6A 1RE1B 2UV8G 1G4CA 5DM6Q 2EK1A 4DEZA 4NLGA 1UMJA 1IR0A 1R6VA 1AXQA 2V34A 2IY5B 3QO9A 2Y1JA 4UUWA 3WZ0A 4DLEA 3QLHA 2VG7B 4X62F 1CQNA 3FBCA 5MAOA 2PMHA 1U1LA 5BYSA 3I0RB 5CZXA 4KGXB 4F0KA 4L75A 1CJUA 4Y00A 4CH7A 5HSPA 4ID8A 2GW8A 1NBEB 1AZSA 1P1LA 5DG7A 2F8HA 3CJQA 1SV5A 3TA1A 1KQGB 3D0GE 1R8BA 5KFHA 5C42B 1HD1A 3PW2A 5D4NA 2Q43A 3EVWA 4IO9Q 2HNZA 1UJ4A 3V4IB 5BR8J 4DWIA 3DOLB 2OLWA 3H2VE 5C24B 1EIYB 1D0EA 2HLUA 3M6XA 4GO7X 3FUYA 1YJ9S 4F2RA 2GV1A 1HWLA 2XMKA 1HWJA 5DZ6A 3R7BB 3N5BA 3J80Y 4JI7J 1RACB 5DDQC 2MZ1A 3MCSA 4PWWA 1RTHA 3K2YA 4KO0A 3MUVP 1VDHA 2G2OA 2OSRA 2HMIA 1HYSA 3HSGA 1AFIA 3VAIA 1KVKA 2AP6A 4ZVUB 3OL6A 3CD7A 3PYDA 3CJ8A 3UCZP 1FXLA 2I5JA 5G0RB 4QR0A 4P52A 2BZ2A 4L3KA 2HZAA 1YJTA 3CCWA 1GAOA 3K89A 2YNFA 4FKXA 2NXEA 3R9LA 5KFEA 5DQGA 1UEUA 4Q0BA 1S1UA 4DV3J 4EYHB 3MR6A 1QTMA 2QV6A 5ETNA 2BJ1A 2W9BA 2ZBQA 2FJVA 3GQCA 2ZDOA 4XPEA 3Q8SB 1M1GA 1HKAA 2J9EA 2MZTA 4CQ1A 5A2QU 1QUPA 2Y1LB 5EN1A 5GADI 4IDKA 2OSQA 1HQ2A 1HQEB 1PC5A 2LXFA 5DG9A 4LFAJ 4DSIA 1NKCA 3UN2A 1XNRF 4L73A 2GS8A 2R8GA 4J9RA 1HNZJ 1LKZA 2JLEA 3CW2C 4LF2A 1RUSA 4M63A 3N5FA 1Q4RA 4MJKA 4J9SA 1VIXA 2VFTA 1FA0A 4HH0A 2XGQA 1HWIA 5J1EB 1WC5A 3GG0A 3PFOA 2UVUA 2GX8A 2I38A 3DLGA 1H2VZ 2J7WA 2NS1B 1Z1ZA 3ENAA 3IS9A 1NHKL 2N7YA 5J2QA 2AEFA 1QSLA 4DG1A 2H5JB 3PFEA 3GYXB 3IG1A 2WRMA 4I69A 1U6BA 5A8WB 1YBTA 4AL5A 4P73A 1WACA 4W4MA 1TKTB 3AQPA 3U02A 3ULHA 3C6TB 4WKYA 5IV3A 2F40A 3GJQB 4R8UA 3AT1B 2YBVA 2YKNA 3MM8B 4FS1A 2J9DE 3MUMP 1V5VA 2BKPA 2B5JA 4I64A 3RBDA 2IJNA 1JLQB 1PO6A 1SKWA 1T94A 5KFGA 2W1BA 2W7OA 3TJ8A 1BMQB 1RBOB 2XZDB 4RWXA 5HQ8A 3D0IE 1U26A 4LQ9A 4YR2A 1J5OB 1NPPA 3EE3A 4F3OA 2IRXA 4ANCA 4LT6A 1N56A 2DNMA 5HVFA 3KOAA 5CYMA 2B0GA 4NLVA 5HQLA 4ZMMA 1DURA 2E1RA 5KFOA 3LGHA 2C3UA 3W2VB 4U7UK 1RWMB 2R2UA 1C2PA 4ZDNA 4QPXA 2BOAA 4NCAA 2R7UA 4ECTA 1D9DA 2F9JA 2DHSA 9ATCB 2K1RB 1RQ0A 3T9NA 2HHHF 1X4EA 4OYWA 1Y11A 1JXLA 3X3UA 4DN0A 2OEJA 4C0BA 3NMAA 4RW6B 2DO0A 1S59A 3MM7B 4DX5A 2GIFA 3VZIA 3J81j 3MM5A 3H5XA 1X4FA 1XQIA 1JLGB 4KGZB 5KFTA 3F56A 3MCOA 3T5JA 3ISND 3LP2A 3H4BA 5J2MB 1WOSA 1ELOA 1WSVA 2AEMA 3FRYA 3AXKA 4F0MA 1WD6A 1ZOTA 2PE8A 5ADZA 1SH2A 2BW2A 2RRNA 2YX7A 5FIIA 2OPQB 2XEXA 1D8YA 2RB7A 4NXNJ 4URQU 4ZJOA 1RJJA 1WDDA 4NLXA 2L9WA 1DTTA 1P1TA 2GJIA 1NM2A 1LWXA 4KE5A 3DLJA 4UW2A 4NI2B 1YG0A 4P9SA 8RUCA 1XC9A 2BYCA 2HHTA 4B9VA 1IR2A 2LDYA 1DQ9A 2IPOB 4KGKA 4LF1A 1XTZA 1S1VA 1VQYA 2EXUA 5GMDA 1HR0J 1MN9A 2RKIB 3HDSA 3UR0A 4ECZA 5HLFB 2AT1B 2WHOA 3TW0A 4WTOB 4TY9A 4U7UD 1NRKA 3KHRA 1R3NA 2PO4A 1RWOB 2XS7A 1KBRA 3FEXB 1YX2A 3MF5A 2CQDA 2CZ4A 2CXEA 3IBCB 3IGNA 3PYGA 4KH1B 3W2WA 3J7YI 3V6JA 1S1TB 4A8SA 3DLEB 3R3TA 2JWNA 3EMTA 5I3PA 4I6WA 3Q86A 3ONQA 2HAIA 2CWKA 3IC1A 2GQCA 2P8IA 1NSAA 2RQ4A 4K2JA 3CJKA 3L7OA 4ECXA 2WW4A 1W25A 2A2CA 3BGRA 5DGBA 4DQQA 1SI9A 4K4SA 3MEDB 1SIZA 1AZSB 1TKZA 3G96A 1TP7A 3AQOA 4I56A 4AT1B 1CBKA 2EKNA 2BJ7A 2VASA 4NLTA 3LQVA 5HJXA 3H5YA 1LV5A 4ILLA 2D3OR 3M1VA 3MAAA 1T9VA 2GAHC 4LFCJ 3ILJA 1RWUA 3PO5A 3MMBB 3G4SS 4EYIB 4IR9A 2L41A 3SMZA 3OUYB 5AXLA 5CYMB 4TVAB 1TELA 4CT8A 4K4XA 1BUXA 2ILZA 2KDOA 2ZC4A 3OW2R 3Q83A 4FF4A 1GXLA 2FJAB 5DO2A 2UUBJ 5KFAA 2E44A 2I6WA 3OXFA 4PG6A 5J2PB 3MXHP 1VQMS 1NH8A 1S48A 2M3DA 3UVJA 4F7VA 3NBPA 2Y8WA 3AJ1A 1RGVA 3TEHB 4Z7CA 5EWFA 4U9RA 4JV5J 2XC9A 4YQWA 3CMES 3GLJA 4M5HA 4JV5F 3TUZC 1DLOB 3C6UA 3GFHA 4EFAC 3T1HJ 5F41A 1ZAWA 4NLQA 2Z2LA 2ZDPA 3C8YA 3PRVA 4RO0A 5C2GA 4KQZA 3RRGA 4V1Ak 1R7IA 3M32B 1Q7LB 1FXRA 3NY0A 4K7QA 2FPHX 4CO4A 3A8IA 2NXCA 4ED3A 2VBWA 2V4RA 4NCGB 4C8OA 3JAMY 4DFPA 2RT3A 2B8PA 1RA6A 3QGGA 4WIQA 3V5RA 1B99A 1WTBA 1ZPVA 2E66A 5K8MA 1C0TB 4HDGA 4P7VA 3HMJG 2DISA 2GHWA 1U2CA 4Y2AA 4NLSA 4CLYA 3QJPA 2SXLA 5A8KA 1R0AB 2Q3PA 3LWMA 2XY7A 4ECSA 2FTRA 1HW9A 3NBPB 4CIOA 5H9FK 3JYTA 1TL7A 1YBUA 1Q95G 2IVMA 1EJ7L 5AXNA 1D9FA 2BM0A 2Z57B 2ZJRQ 1AROP 2JLFA 5HVGA 3PIOQ 3QAEA 1JXVA 1VS3A 1MMNA 5B0BA 2HVIA 4RBVA 2DCUB 4LSNB 5DDRC 3W5YA 2W9BB 3NL0A 2CJXB 1QE1A 1UVLA 4UOFA 3BO2A 5K8OA 4WYLA 3K5MA 1UVKA 2YPYA 2DXEA 1MWYA 1CG2A 1RKIA 2ZH3A 5HATA 3VGSA 2DH8A 2YKNB 8ATCB 4ECRA 4I6AA 5L8RC 3Q2TC 1Y3KA 1SJRA 2D9OA 3QFWA 4G65A 4FDFA 2KB2A 3TJAA 2GGPA 3ENQA 3RBZA 3GV7B 2ZOMA 3CCTA 1EAYC 3GE9A 1OWXA 3W62A 4DL6A 4ZLLA 2DCLA 3JB9k 1CVJA 3AA9A 4OMFG 1RHKB 3Q23A 2QA4G 5LMNJ 1FERA 4Q5VA 4LBPA 3SFGA 1SBRA 3OD2A 5ETRA 3IAM9 3CWJA 2M4MA 1FJGJ 1RHUB 5IV4A 2HMIB 1HYSB 2QLWA 1TAUA 3MUTP 1TL1B 2DNYA 3EZUA 3BM7A 1F3FA 3TUPA 1N5TA 2RDJA 2PT0A 4USJC 4X4UA 2YX1A 3PEJA 4ENOA 1T9UA 3UDVA 3M2VB 2DIVA 3VQTA 5IT9U 3W65A 1YZ6A 3UDLA 1FRHA 1OPIA 1VJWA 1AUSL 3ZZUA 1RTIA 3JYTB 1IBKJ 4OYPA 1APSA 2G2YA 3MWBA 2ZH4A 3KJVA 3TVKA 3SQGB 4DCPB 4LF8F 2CVEA 3MM5B 3HHLD 2RQCA 4H4KA 4WZQA 1FK9B 7AT1B 3WX4A 2YH0A 3GIJA 4AD6A 2DR8A 1MU2A 1PBAA 3PVXA 4UY85 4NA1A 2FUG9 1ZM2A 1I1GA 1T95A 2H1YA 2ATCB 3D6HB 1S1WB 3CXCR 1B0TA 2E9RX 4L76A 5ETQA 1QAXA 2HLTA 2FZGB 2Z56B 1TKXA 4TLRA 3KLIB 1FTRA 1OSDA 3QGHA 4F4YA 3NNAA 4K4UA 4C11A 2FHJD 3F0NA 3ILLA 4NMLA 1FF2A 2V8DA 2RDDA 1DRZA 2FC8A 3I31A 1UL3A 3A1YG 5L1KA 4JI1F 1U49A 4WYWA 4IOAQ 1ZA1B 1HHQA 4DV6F 1VGYA 2DY9A 2VU5A 1NB2A 3R5DA 3D6FB 2LQ9A 2F4FA 2VFSA 1Y4ZB 2XM3A 2UXCF 3EDRB 3PRDA 5IT4A 2EI5A 3I9ZA 1JLAA 1WSRA 2CPJA 5KG6A 2J6UA 4Q2MA 1RI7A 5B0AA 3DDIA 3I6PA 2B5JB 1GTHA 2WK4A 3CGIA 1IKXB 3GONA 4U7CA 3I5AA 5D3GB 3G8QA 1JJCB 1Y7PA 3OJUA 2FLLA 4JI8J 1K9MT 2DRDA 3LP1A 3CCJS 1A0OB 2YQ0A 1PSDA 3FK4A 1UVIA 1NSKL 3GIRA 2IDLA 5KAKA 2QFIA 1M5HA 2RS8A 3MTJA 2C2RA 4FS2A 3ZZRA 3MOJB 5B0EA 1FX4A 4U8VA 1VBZA 2B7BB 5L39A 1NZAA 2LCWA 4CYUB 3DYAA 4K5RA 4YHHF 1SL2A 2M52A 4JYAJ 1F60B 2F8MA 2Q1LA 3MZIA 1V3RA 1SVDA 2O5DA 1LW2B 3D68A 3HLUA 1HNIA 3WQPA 2QT7A 3PO4A 4N7TA 4LFAF 1JWWA 3AB4B 4FZVA 4MIWA 4DL5A 5DM7Q 3G6ES 1FDDA 2GCFA 1S49A 2V5HG 3BGLA 3CIMA 3DU6A 1RHQB 3FC9A 3PJXA 3KK3A 1X60A 1F3VA 2H4WB 4DV1F 1H98A 1WI8A 1FHTA 4X4NA 5A0YB 1GMUA 2LEBA 1JLEB 2VQEJ 4LBIA 2QGFB 2BE7D 3T1AA 1ZTWA 3MM7A 2DYAA 2WOMB 3LH2S 5DQHA 3OTBA 1GNKA 1XR6A 1Q0NA 1UVMA 4CTAA 2LDIA 1T9XA 2OI2A 2NPFA 3P45B 2QSFA 1ACMB 1WG4A 2MJUA 3E01B 4RW4A 4WP8A 3M2RA 5B0DA 3Q8YA 3M9MB 2I9SA 2NSBA 4Q7AA 4J9OA 1OQ6A 3D6MB 2HSEB 2WAQD 3W2VA 1FT8A 2HQ3A 4QIWD 4XO0A 2A2DA 2W9AA 4LBHA 1ZAXA 2QMXA 4ZVRB 3FZBA 1UJ6A 3LTOA 4I6YA 4K8RA 1T9YA 4EEYA 1VJQA 1X5SA 3HD2A 5ETVA 8AT1B 4JV0A 3QNWB 4UZCA 3V81B 4EU0A 2RUGA 2QMWA 3FNNA 2ZVSA 3NCRA 3R6GB 4L3NA 1TV6B 1CC8A 2XMAA 2IHR1 2R7TA 1JK9B 1ZS6A 4FKYA 5I4MA 5KT2A 2GC8A 4DR4F 4DX6A 5BJRA 4BC9A 1RAIB 3Q22A 4ZN1A 4OZ0A 1X0PA 2BDPA 1U0HB 5F8IA 1TK0A 1RLDA 5D4OA 1HMVA 3RGIA 3RW7A 4DR3J 4KV8B 3MCNA 1PCAA 1OS5A 1JKHB 3NS7B 2J8AA 4HDHA 5E41A 2FVCA 3ZZ0A 2JJ4D 3ADAC 3HHLC 2B43A 3I9V9 4RBTA 4CT9A 4X4SA 3DRXA 5KFWA 2GIQA 2I1RA 4YEAA 1FNXH 3GG1A 1L3KA 3THPA 1S9EA 1LW0B 1Q53A 1VR6A 2JL9A 4HYKA 1F0XA 3ET6A 2YNGA 5K8NA 3AHPA 1OJ4A 6FDRA 3S01A 2WB4A 4A8MP 5KFKA 3S7RA 3PKYA 3ZTOA 4DSFA 3ZTRA 4DUZJ 3I4HX 4NYOA 4OHZA 3PW0A 3CSKA 2HYIB 1IVZA 3DM2B 9RUBA 1FE0A 1X5TA 3FSXA 4GO5X 4KIAA 3OL8A 2ZJQQ 5D0GA 1KLMA 2WVCA 3GTYX 3I32A 2YWKA 2VG6B 5AXKA 3N01A 3JQKA 3KJFB 4FXDA 1FJ7A 3TX8A 4ZJQA 1T03B 5CH7B 3W8PA 3G82B 3BPSP 1I6JA 4JV2A 1RT7B 4BBYA 3OFGA 1RBLA 3OSNA 2XNRA 4OJ1A 4LF9J 3PTWA 4ED4A 1CJVB 1LOUA 1S12A 4KHRA 3K58A 2X3DA 3CE8A 2ERRA 1TL1A 2A10A 3BKTA 5E3QA 2MJNA 5H9FJ 2E5GA 1S97A 3BREA 4DX8H 2VFUA 1Q82T 4NLWA 2KT3A 4FNIA 5CHCB 2I5JB 3ENWA 1FJCA 3NXZA 1QY7A 1A6LA 4EK2A 2HHUA 1KKHA 2QYGA 1X4AA 2OPQA 2V8PA 1K73T 4LR9A 3HF5A 2J7UA 3SQGA 5KG3A 3TA0A 2OUGA 1RLCL 4RPFA 1B0VA 3KHHA 4W92B 2HWTA 1K0TA 5GAEI 1SUQA 2IVYA 1FTCA 2IJFA 2W24A 3BGRB 3I0SA 2PFDA 3MAHA 5KFMA 3IWLA 1S72S 1VC6A 1WWHA 3TOQA 2MQQA 4G1QA 1T11A 1LWFB 1JIHA 2XLJA 1S10A 1RZMA 4M5DB 1K1QA 2H4YB 5KOWA 1Q79A 2JNJA 2XHWA 1Z4UA 3G6YA 1JLFB 5K9FA 3CDUA 4QU6A 3M2UA 4CRJA 1RHMB 1URRA 4CCHA 1DTQB 2JFDA 2XMUA 3T6BA 2CQ0A 1R89A 5KG5A 1XR7A 2ACYA 3MM8A 5CYQA 4KFBA 4AQYF 3RB0A 1QM9A 5IQQA 1WEXA 4ED1A 4NXNF 4X2BA 4NXMJ 4DMZA 2CYYA 2YNHB 3A4TA 2ZVIA 3FBBA 3D7SB 4OX9F 1N54B 4XTTA 3SDEB 2H5EA 4DL0C 4ECUA 1XN9A 5LL6d 2NUHA 1U2RA 2MY7A 3V6DB 4F4XA 4CO3A 3MR2A 1TKDA 4DSKA 4IKAA 4RNNA 2WSFC 2YWGA 2MHNA 3ELHA 3NGRA 4M5LA 4OX8A 4C3LA 4OZ1A 2X1FA 2RU9A 3UNGC 1DLOA 1M5OC 4AXIA 4PAAA 4EWTA 5C2CA 2KM8B 3EZ5A 2CQCA 4DV0F 1HI0P 3V4IA 4K0KJ 2Z30B 4OFZA 3PXGa 5D8HB 4F02A 2HGNA 1OO0B 3HVAA 3QT5A 4PR6A 1G7CB 5HROB 1IKVA 4ZN3A 4J9KA 4A8XA 3T41A 2E9TA 5GMEA 2GVDB 3OFHA 5E2QA 3KNAA 4V19X 1BHNA 3IGVA 3JSMB 1RT2A 1S0MA 1SJ3P 3DYAB 1T9TA 1U6FA 3D28A 3MCMA 2AYMA 2OPRB 3LOUA 3W8GA 4NEZA 3DI6B 4ED0A 1G6BA 3UD3P 1NZ8A 2YXLA 3BBCA 4DV7F 1HNXF 3OTDA 1N0UA 2ZHBA 4XAKA 5L1JA 2GVZA 2C3MA 2J0WA 1YSJA 2DNRA 2HVEA 2LXUA 4KGVB 4OX6A 3TRGA 4AYBD 4XPCA 3M05A 2W8LA 4LF4J 2PFFB 2F65A 2I0XA 5D4LA 2HURA 3DRRA 1KQKA 2K7JA 4QR2A 2WVBA 1S6QB 4PCQA 3T6JA 2ILYA 4IH5A 1S5ZA 3VVTA 4EO8A 3LANA 5HMWA 3EJMA 1S0NA 3MDFA 3R27A 2QA2A 2AJ2A 2XS5A 1UPPA 1Y9OA 2WBRA 1EHWA 1RYRA 1DY3A 3GV5B 1VQ6S 4ES3A 3P6YC 1FKOB 2FVSA 4KKOB 3P49B 3MECA 2MXYA 1P6TA 1FD2A 2A1BA 2HNZB 3D2WA 3OR2B 3ZTPA 3TZYA 5IM0A 4ZHRB 1S0OA 3M9OB 3PW5A 2CJBA 3EPGA 3PNIA 3FSYA 2IRYA 2BX6A 3QGIA 1VRTB 2HBZB 3M30A 1VQ8S 3BSCA 5KFJA 2LQ5A 4USWA 3SXLA 4DV1J 1Q5VA 2HWIA 3A8EA 2I8EA 1SPBP 3C15A 3QLHB 4CDIA 5F8LA 2ZH2A 1QTNB 4KV8A 1VHFA 5HP1B 1J5EJ 3VV2B 2C1EB 2RSQA 3FZ2A 3IWXA 3MEDA 4WP3A 3VR1A 3KK2A 3ZZZA 5M2RA 2IJRA 3NWRA 4QR1A 1LFWA 4IUFA 3SSSA 1T9WA 2YY3A 2IBKA 3HHKA 5KFVA 2YVSA 1LNQA 2LEPA 1IBKF 1TFYA 3CD6S 1B64A 1E6VB 4WJBA 1M1HA 3K8VA 1U1RA 1FFWB 5KG7A 4FPRA 3LF0A 2UUAF 2BW7A 3LW5C 1HFEL 4KBIA 3O44A 4PXDA 4DJBA 4O0IA 3H25A 2VONA 2XO6A 2WONB 2ZZNA 5D0HA 2AYEA 3HJFA 3DM2A 5HQMA 1WF1A 5KFYA 4YR3A 4DPWA 1U6ZA 1VQKS 2AZ1A 2IAJB 1QDUB 2X7IA 3AB2B 3ITHA 4A48A 1NK4A 4M5MA 1QJHA 1FKPA 5HMYA 2XYHB 3JSYA 4RX6A 3BSAA 2DEJA 4JI4J 4USHA 1YWXA 1N5SA 3OR1A 2Y0SD 3H59A 4NI2A 4PUOA 4P6QA 3EVOA 5A6WA 2R7VA 2AJQA 1PIEA 2F4VJ 1GK8A 1R8PA 2KN4A 3BF4A 3MTKA 2ALZA 1HHTP 3TZZA 4CLKA 1U1MA 3DNCA 1NK7A 3P8BB 2OD4A 3Q0AA 1U1NA 1ULRA 1WELA 4MK9A 3T3FA 2QN6B 4I2PA 5J2PA 2B56A 4LR8A 2J7KA 1JJHA 3OVAA 2BE9B 1WHXA 2QRRA 5JMNA 1XMOF 1Q8KA 2C42A 4KHMA 4WE1A 5LMNF 2DHXA 2V2KA 3IP0A 5C42A 1MWQA 3IFEA 5B09A 2OJ3A 1NK0A 5KT5A 3ILOA 2PI4A 3RU0A 1BQXA 1SUQB 2ZBIA 1IQZA 2FHOB 1S1XB 1SJ4P 4YY3J 1BD6A 1HI1A 1WHWA 3ZO7A 4UZBA 5ETSA 4USVA 3I56S 2EC2A 2K06A 4ZVOB 4UQGA 5ETPA 1Z2ZA 5I3UB 1EX8A 1RU1A 4MIAA 5HVHA 4DF4A 1RTDA 2RU3A 5HMXA 1MLAA 1YK9A 3RAXA 3D9BA 5GAGU 4C8LA 4M5JA 3QJJA 2EWHA 1TTHB 4EBDA 3SSRA 4F4KA 3LGNA 2XY5A 3I82A 5KFPA 1X9WA 2HW3A 1I3OB 2FZCB 1U48A 2G1DA 1NJWA 2J8SA 3GYGA 2RQKA 2MGZA 4IRCA 4RWWA 4ETZA 4DV4F 2QE5A 2BANB 4N47A 2PEBA 5T41A 2VA3A 2BXJA 2CIMA 1OY6A 3SEOA 2GNKA 3V2UC 4Q44A 1BQNA 3DHWC 4LJMA 4RW7B 4PYAA 4ZVGA 4P10A 2R2SA 4DR6F 5F8NA 4B02A 4Z2XA 2HHWA 1TK8A 3JS9A 2GHPA 2IM2A 2HHXA 1N32J 2EFQA 4CM2A 1WTFA 2CA9A 3KYLA 2IM0A 3CO0P 1YGYA 1U25A 1U4BA 2XCPA 3K5OA 2HG4A 2OFGX 1PILA 2CQ4A 4OHYA 2IA0A 3JQMA 3MR3A 2VG5A 1VQNS 1WF0A 1QSYA 3ISNC 4NA2A 2D3ZA 2CJQA 2MYFA 3KG1A 3NMRA 5J1EA 4OYOA 2WONA 1WKLA 5C25B 4MFBA 3JSMA 1VRTA 3M30B 1NDLA 5GAEU 1HBUA 2JLGA 1KS2A 3CPWR 1LWCB 5DRKA 4LSLA 3DRPA 4MKYA 4RKUC 4R5PA 1YIJS 2MQ8A 2OPPB 2QSWA 2CPYA 4PZVA 4QZVB 2HVHA 4OX9J 4YB5A 4ZVSB 2DGVA 1YRXA 4KB7A 2VA2A 3C19A 4UUXA 2C3PA 3VAMA 1RADB 2PA8D 3CJ4A 2MGZB 1CQMA 4QYRA 2OMLA 1YITS 3DLBA 4LMZA 4DS4A 4NL5A 4NMXA 3IN5A 4LRAA 5AT1B 1UWBB 1RT6B 3MEKA 1WC1A 1ZZFA 3DRSB 3FKBA 3LPYA 4M5KA 1HA1A 4ZVHA 3VZHA 1N5YB 1N36J 4YMEA 4LSZB 3BR9A 1V5IB 4L6V3 2DB1A 2F8EX 4PXCA 4QYZK 2HNYB 2R7RA 3CNQP 3BJYA 4TU7A 4TU9A 1S1WA 5KFFA 2ZKTA 1L3UA 1IN0A 1KFSA 2DTJA 1J5EF 2OPRA 1S99A 5CCLA 5IM0B 4DR7J 3S8SA 3KK1B 2MKSA 4TN2A 4AL7A 3DOKA 4RW9B 2X1BA 5KFLA 4PRFA 4ZJLA 2OTJS 3TAPA 1T05B 2DY1A 5F8HA 4B9LA 3HFKA 1H73A 2ALYB 4TXSA 2YKQA 4F26A 1CS4B 4Q8FA 1W26A 4LF7J 1NU4A 1S1TA 1HWKA 2F5GA 3M8QA 1L3SA 1NB7A 1MNEA 3J7AN 3M4XA 1XIQA 3GZ7A 4W98A 4X4PA 2W9CA 4GKJF 2U2FA 3GSIA 4TU8A 2CJAA 4MT1A 3RG6A 5HJYA 2JVRA 1KOHA 3D1OA 4K2XA 4LREA 2AMCB 2ATLA 4FBUA 4NA3A 4FN5A 1RHRB 2N3OA 4J9QA 3M8SA 2P6SA 2V69A 4NEYA 2LP4A 3IM8A 3MM9B 3KLEA 3HVRA 1RBAA 3M32A 3LUYA 4ZVTB 2BMBA 1EARA 2LLZA 2ZZTA 3HSDA 4G6VB 2BQUA 2ZKUA 1RAJA 3GB0A 4TKTA 5AE3A 2DGSA 4YS2A 3FQLA 1RT4A 1XEZA 1F1BB 3N6MA 4LF6F 2BA9A 1P27B 2LEAA 3EUNA 1SQEA 1F2GA 1KTQA 2HQIA 3FVYA 3N0VA 3UFCX 4IRKA 4XIUA 4RLEA 3QQCD 2RE1A 3GR1A 2GO8A 2ZM6J 2Z2YB 4HT7A 2V4JA 4RW8B 2C28A 3VHQA 2BABA 1UVNA 2J9CA 3BH7B 4ANEA 1SV5B 1PYSB 4K5SA 3CDAA 4IR1A 5KG0A 4C2MA 1UAWA 2CNLB 3DGVA 2B7CB 3UPFA 1FJEB 2LA4A 5DLGA 3OL9A 3VTIA 2BE2A 1VISA 2C2OB 4WTYA 1HIYA 4WFYA 5ETLA 4M94A 1FRMA 2M5YA 3IA0A 4H4MA 3ZZTA 5F8GA 3GR0A 4X4TA 3R1LA 4YR0A 3OVSA 3T1YJ 1Y00A 2UUAJ 4UQTA 3M8ZA 3N6NA 3PHEA 3CEDA 1ZTTA 4DHVA 4HACB 2BJEA 4O3PA 1UWBA 3KUHA 2VODA 1TVRB 2HS4A 4QW8A 1LWEB 1XMQJ 2E5LF 3DC2A 1O5JA 1WKKA 3IR7B 4QWAA 2V4QA 3QSYB 4QOTA 2OIHA 2VICA 1HNZF 4Y65A 4IH7A 3R97A 2A18A 1NSQA 4I67A 5G4DA 2FHMA 1WC6A 1SJ1A 1DARA 2YX4A 1LEOA 1N5QA 2LU2A 2O67A 4KPCA 4M5DA 2HNDA 2VIHA 3OQ2A 4DPTA 3RR7A 3RBEA 4ZPWR 4U6PA 3KJNB 2XI3A 5F0WA 1JNZB 2FD2A 4R5PB 4DCJB 3ZTSA 3MPUB 3SFUA 3BDPA 2QLFB 4AXJA 4R8UB 4MK8A 2C3OA 2IBOA 2P9EA 4JI8F 2NCKL 5GAHU 1Q8LA 2JX2A 2QMUB 1C4CA 2UVVA 4LFCF 1GFWB 2UXCJ 2KZZA 3MMCA 3R2CJ 3G6VA 2Q6BA 4C97A 4FNHA 3PX0A 1RAHB 3R6LB 2AZ3A 1IBMF 2LYVA 2FY1A 4CTAB 4ZPTR 1H2UX 2WZ1A 1UEKA 1LXJA 1H72C 3QZ7A 3KG4A 1RT3A 2MZSA 3R5JB 3ZNJ1 4CH1A 2VBXA 1HR0F 3D1QA 2GVDA 5FDLB 1K44A 3RB4A 4NCBA 4RBUA 1RAAB 5KT4A 1SCJB 2DGUA 3PJWA 3AH6A 3UN5A 3H4DA 1P9QC 1R0BG 1X4BA 4EBCA 4P72A 1ZM4A 2CZVC 2PA3A 4ZHRA 1Q78A 2ROPA 5D0EA 3AD7C 4Y34A 1UPMB 3IR5B 5A6PA 1IWGA 3KK2B 3H42A 1TL7B 3Q24A 4C8YA 4I4BA 1T05A 2EC0A 1RAOA 1VLOA 2WBMA 3D3CJ 2W2MP 4DN9A 2O1PA 4CLSA 2QL9B 2UV8A 4B17A 3KWMA 4EZ6A 3DN9A 5GVQA 4WFNQ 2XLIA 3HHNB 4LFBJ 3WBZA 4X4OA 3A13A 3NGSA 3ETMA 4NPOA 1JLBA 1IKYB 3O2IA 2ACMA 1TU0B 2CAJA 3KG0A 4DI6A 1T7PA 2PSZA 4N77A 4RW4B 3AJDA 3QMQA 5K5MA 3KLVA 3J7A1 4CO2A 3SCJE 3SQOP 1IKXA 2AV5A 4ZCMA 4K4ZA 4DSJA 1F9HA 1UZHA 2GZOA 4GC7A 3DRSA 2ZFHA 3TZWA 3CJTA 3HCXA 2FLOA 3QATA 4KYZA 2JEIA 4WKRA 1CC7A 1WORA 5SUHA 3C66A 3BB5A 3IO1A 3W64A 4F25A 2ASDA 3A12A 5A8RB 2CPFA 5AJ3J 1KDNA 1SXLA 1FE4A 1VK3A 1U2FA 2FJXA 2C3YA 4X62J 1LWCA 2YKMA 4OZ5A 1LW2A 2Q6CA 1VBXA 4FF2A 3UWTA 4NZ0A 5JXSA 2LQJA 3OTOF 1FEEA 4OHWA 3QT8A 4Y28C 1REVA 2QA4S 4WF9Q 4PUOB 2IM1A 4HHUA 1K47A 3VAHA 4ICLA 4BCAA 1HW8A 3GFXA 2UUCF 2RF2B 3IS9B 2MB0B 3K5LA 2L9NA 4J9PA 4ECVA 4JV1A 4DPUA 3BR8A 4M5IA 1TMJA 1NDPA 1LW0A 4ERDA 5KFDA 4DDFA 1T3NA 4KPYA 5EWEA 2KXFA 1FK9A 3AD9C 5E0OA 5F9LA 5IC4B 2FY8A 4FXVA 2Z2MA 2ZHAA 1VBKA 4WP9A 3IBWA 1CLFA 3HD1A 3A3PB 3N4WA 4OLPA 5DETA 3RBXA 5IXUA 3DCAA 2JFKA 4FYVB 5L1LA 7FD1A 2FJBB 1NK6A 4FF3A 3NGKA 4PXBA 4LIRA 5A2QY 5IS2A 1E6VA 2HBQB 1HNIB 2VC1A 4AUKA 5C24A 2VG6A 5C7PA 2HIQA 1R8CA 1O0PA 1URNA 2A0FB 4KC5A 2DNZA 3AA8A 4PWUA 4DR7F 4R25A 4DL2A 2M8DB 1RWNB 4ED7A 4ZP9A 2WB1D 1F5BA 2IRUA 2QG9B 2H51B 1SQFA 2IM3A 2XWYA 4S0MA 1JXEA 2HQCA 3AOCA 4LRCA 1NMEB 1N34J 5HLFA 4DR1J 2CQIA 2W4CA 4LUBA 1KN6A 3HJVA 4OJ3A 4J9MA 2HKEA 2F4VF 2DGOA 2OD6A 1NUEA 3LA0A 5K14B 1IBCB 4Q45A 2CWXA 3B8HA 3M2RB 4J9UE 4OYXA 4C8MA 3PX4A 2OTLS 5FJ4A 1UFWA 3PZPA 1G2EA 2D41A 4X64F 1WI6A 3V4MA 3R7NB 2KTQA 2Y3YA 1GMWA 3QWUA 4C4WA 4A46A 3OR2A 2OFHX 2QLJB 4OYMA 4CLPA 4WWSA 2CQ3A 2IMWP 2AW0A 2CDRB 3DDNA 4DUZF 1XBWA 3BSOA 4OX7A 4DSEA 2XS2A 2VOOA 2CPXA 1SC3B 5CA5A 5KT6A 1XNQF 3TAQA 1LWFA 1NO8A 2CQHA 4OI3A 4PWDA 2B8QA 1U7LA 1BQMA 1WOPA 2P6TA 1RA7A 3GWCA 4IG0B 4IFYB 2B3TB 3F44A 3U1LA 1NJYA 4ILRA 1R8HA 4OV1A 4ZLNA 5LXYA 1YI2S 1UTAA 4N5SA 1JLCA 4ZVQB 5HBMA 2RRBA 3QIPA 3M8RA 1PAEX 4LRDA 2BUNA 1B7FA 4JI6J 1D8ZA 3B4MA 1RXOB 3TJ9A 2DVIA 4O4GA 5GADU 3CCUS 1T3OA 1VRQC 2DT9A 4QCLA 3WC0A 4L72B 1TL5A 5LT5A 4OZNA 2YNFB 1CULB 1F2HA 4B3RJ 3BZQA 5HK4A 2K8GA 4Q43A 2GJ2A 3NRBA 3DI6A 1XMQF 2E5LJ 1SL0A 3I5CA 4MKVA 4DV0J 1FNMA 1LK5A 3WC2A 3PRBA 2J0XA 3EZOA 4FYWB 1D3WA 4ZPVR 4A47A 1JQGA 2QL7B 1Q8BA 4PG8A 4RNOA 3J7YU 3MAQA 3MD1A 1R27B 1S9GB 2RIJA 1OYEA 1RTJB 3I96A 1GX6A 2ZNYA 3R5BA 4O3NA 3E3XA 4GKJJ 2NXJA 2VJUA 4YN3B 3JTNA 2B4VA 1J5OA 1S0VA 1YJUA 5GAGI 1WOOA 3D66A 4O4RA 4Y2MA 3W60A 3C2PA 2HRYA 4WIIA 4I7FA 4LF5J 1S9FA 2CADA 1VQ5S 3I4PA 5LSLA 2XMWA 3AODA 4IQMA 3DRPB 2Q66A 2HK2A 1V9OA 2YKPA 4AFFA 4F36A 5BYQA 2R8HA 3CD0A 4CNYA 3IG1B 3J81U 2E9ZA 2VPZB 4N76A 2Y9HA 2D1CA 3M6WA 1E6YA 2XMJA 4A8YA 2QFJA 2FLNA 2V8VA 3W66A 3H7HB 4PPDA 5CYQB 3PR5B 5J2NB 1H7XA 2RQMA 4ICLB 3CT9A 3OHBA 2DNQA 1SKSA 2KJVA 2VPYB 4DV7J 5KFXA 1HNXJ 2MMYA 3DLLQ 1RT6A 3LALA 4OL8A 1SJQA 4LSNA 1TUWA 4NRTA 3MR5A 4A8QA 2YWEA 1YRUA 1DAXA 4Z37A 1VRUA 4WFZA 5SZTA 1KONA 2UUWA 5IZHA 1HBOA 3LP0B 5CQGA 3DDKA 3D1HA 3K7RA 3RR8A 1RAGB 2FGOA 3QFHA 1HQEA 3G9CA 1IJEB 4LIWA 2CPDA 3H2UB 1KR4A 4USUA 2RILA 3GCWP 4O3SA 4N41A 2XLKA 3N79A 4CLLA 1VYAA 1XMBA 4MYTA 1B4SA 2V2VA 5EWGA 4DQIA 2OMOA 2VFVA 1IM6A 2HFSA 3JXOA 4GVLA 4R0JA 1HQUA 3HHLA 2IIHA 3K5PA 3GYNA 3NCPA 4GVBB 3W1YC 5LXRA 5EX3A 4NCGA 2W7AA 3DLGB 4JUZA 3OUYA 1RP5A 2R7OA 4WK1A 1NJZA 3LAMA 5DJBA 3DOMA 4WU3A 2WOMA 4QBUA 2GMLA 4I68A 3MD3A 5DS7A 1U1KA 4OI2A 2BKOA 4ZIVA 1YVFA 4F4ZA 4C8KA 1V3SA 2OKQA 1XMOJ 4GKKJ 2DKOB 2EFPA 1XK8A 5M2PA 4B3SF 2CNKB 4OV6A 2VKZG 4ZPDA 2VJVA 3BGOP 4OI4A 4ZPAA 3A8KA 1CSJA 1B7YB 2HBYB 3NKYA 3L9ZA 2HBRB 4QIFA 3QRPA 2HHSA 1WEYA 2V50A 3GJSB 3O1LA 4DQPA 3HFZB 5B0CA 1FWKA 3HZGA 1SC1B 3BO4A 3NAHA 3SCLE 2UUCJ 1F5CA 1HBMA 3RRHA 1XWLA 3SIPB 1HBUB 2RHSB 4H54A 3HULA 1S9GA 2VBYA 3P3DA 5EDWA 2OO4A 3DGPB 4PQAA 4A4JA 3EGVA 1PKUA 4O23A 5F3TA 3OJSA 1U1PA 4X4QA 4Y0FA 2FQQB 5IFMA 5AE2A 2ZOFA 5LMUJ 4ECYA 3KLFA 2NREA 5U47A 2G1HA 1YQHA 2KVQE 3PKMA 2K3IA 2UVRA 4JI7F 4Q2LA 3QO9B 2XBPA 5IT0A 4X65J 3KLHB 2BR0A 3H8YA 2I2YA 4JI5J 1OYDA 2KXHA 3Q89A 5CAAA 3IRXB 3R7SB 2W4PA 1Y5LB 4AL6A 1QAJA 2HK3A 3EM1A 4QYZJ 2CRLA 3IMQJ 4ZIWA 1Y5NB 2IMOA 3SYZA 2ZE2B 3BYPA 1U47A 5H1SV 3R1HA 4YDXA 2DXDA 1S6PB 3TVZA 1PYOB 1R31A 2R4FA 3BN4A 1ZZNA 3MGJA 3H5UA 4UOCA 1KSPA 1N34F 2BQ3A 2MSSA 3VCDA 1TR0A 1KLMB 1PAUB 4RUBA 2VZ9A 3TO8A 3ZZYA 3FCWA 4EO6A 4LF6J 1ITPA 3QWPA 2CQBA 4JP8A 3RYLA 2LU1A 1EKRA 1C1BB 4NRUA 2A6OA 1KRPA 1HARA 2E7XA 5IC6B 2JEJA 3CJRA 5J2QB 3S6EA 4KGMA 3MPDA 1FWPA 3MM6B 4E2FB 4K4WA 3EX7B 3P4UB 4FYYB 2K3KA 1HD0A 2LQBA 2NUUG 1JLBB 1V6HA 4WBFA 4ZVEA 4TQSA 3TR5A 1REVB 5IOLA 3OLBA 3EPIA 4DQRA 1RYSA 2G0IA 4HHJA 1C1CB 1UW4A 2XSJA 1H6KX 3M2VA 3QT6A 4DL4A 2R7SA 4HLBA 1VQOS 3ISZA 2B6AB 4O3RA 1UA0A 5IWAJ 3VVUA 4F0HA 1NAQA 2GQ2A 2DBBA 2DNNA 4RU2A 2DNLA 1AA1B 2ZC3A 3IBFB 3R5CA 2DH9A 3AD8C 2FHJA 3FCVA 2QC3A 5I42B 4QWBA 4GKKF 2RRAA 1GXUA 1A7GE 1U8SA 2EW9A 4CLTA 3NP5A 2P5VA 3I0SB 4L74A 3CMQA 4WXWA 4K0KF 3MPVA 1RK8A 2JC0A 2NSCA 3TX0A 4CP5A 2HEKA 3TAMB 2W4DA 1AFJA 1HHSA 4J9NA 3TP2A 1Q16B 2GQQA 4ES1A 5L1IA 4YP3A 3CULA 1FRLA 2ZD1B 3O6QA 1BY9A 2E1PA 2R3VA 1T0TV 2GGPB 4OZJA 4DL3A 2FJWA 2XNQA 2CNOB 3KLEB 2FVQA 2FB0A 3RAMA 1MN7A 4RUCA 1JKHA 2OH2A 2CQGA 3NS6A 3E51A 3UE2A 1IR1A 4A8WA 3MFIA 4EBEA 1F5AA 4ZA1A 3SV4A 1RWVB 3M8PA 4CM0A 2G9OA 2V0NA 4UTGA 2HHQA 4KH0B 3HT0A 4LR7A 3L7UA 2CG8A 3LGMA 3QBCA 1IBLJ 4O0NA 1WC4A 4WXOA 1QE1B 2HHVA 2GMHA 1RAFB 2MKIA 2MTLA 2AF6A 1NEEA 5E3PA 2QLXA 1TZ0A 4K59A 2CJYB 1UZDA 4M5NA 4PPZA 3U27A 3VQSA 3HHDA 2CG4A 2NPIA 4PXEA 3DRRB 3BN7A 1GXTA 1GQEA 1EP4B 4NOHA 4LVNP 1LWEA 5D4PA 3AOAA 2V6AA 3EYZA 3GCXP 3BKFA 2R2TA 2PEHA 2R42A 4O3QA 3KMQA 2J0QD 2XQCA 2BKNA 2HPUA 3FCHA 5CD4H 3GFZA 3G8TA 2Y0BB 2KYXA 2ZUGA 2WVDA 3BGFA 3D5MA 5KG1A 5K8PA 4K4YA 2V2QA 2EBEA 4NLDA 2VPWB 2N4CA 4WPAA 3OXGA 4KY3A 3Q8QB 3QIPB 4MYUA 2C2EA 2Z0GA 3DU5A 1U09A 1WG1A 3SZ2A 3P5TL 4EUVA 3G82A 2KG1A 2MQLA 1N6QA 2A3JA 4HH1A 1G1XA 2GJFA 5IT9Y 4C6AA 1BXNA 2KKHA 5B0GA 1SIWB 3MEEA 4FVMA 4OHVA 1BWVA 3PM9A 3HK2A 3O5TB 2KT2A 1U45A 4J9LA 4HHHA 2N4DA 3HO1A 2X3GA 4NE9C 1FDBA 1B70B 2YNIB 1VRUB 4I2PB 4RU9A 1KC8T 1BC6A 2FDNA 5BYRA 1AW0A 5FDLA 4NASA 2OAUA 4B9NA 1IBLF 4RNMA 2DXFA 1UJ5A 3AXMA 4RUHA 2E1CA 4ZITA 1JJ2R 2XMMA 1MMDA 4G1PA 5IWAF 4ED8A 2AX0A 1Q81T 2DR5A 1WDTA 2HHHJ 2O66A 4J7CA 2ZOGA 2A6MA 3MMAB 5FD1A 2CPZA 2ADBA 1UETA 4OZ3A 4GMKA 4J90A 1S1XA 1I94J 4KFBB 2NR0A 5DDOC 1NHUA 5HO4A 4IOCQ 1RT2B 5DG8A 3R2DJ 4EI2A 1W2IA 4N8OA 5DDPC 4FF1A 4X66J 4URSA 3FFIA 1NDKA 2LXIA 3L3CA 1WHVA 2CFXA 3GV8B 3OFFA 3CC2S 3QPIA 4DF8A 3ZFVA 4NXMF 1NK8A 3KK3B 1I5OB 5J2MA 3F73A 3C14A 1PC4A 4ILMA 1N6QB 2DD8S 3OSPA 4JI2F 2NXNA 2PMZD 2V9KA 2GAGC 2H48B 4C3MA 4IO1A 1LXNA 1Z2LA 1WC0A 2J76E 3KLHA 2ADCA 4IYQA 3EXYA 2KM8C 2UU9J 1ROFA 1VMBA 1KVIA 3W5ZA 5A8WA 4GRSA 5FLXU 2FC9A 4IFVA 4YHHJ 4KR0B 3HVTB 3GP9A 2Q79A 1MU2B 1SQGA 1YJVA 4J9VA 3E01A 5ETKA 3QT7A 3RZAA 5KT3A 4DUYJ 2EPIA 1L3VA 1W7WA 3QRRA 2HVZA 2RAQA 4CLFA 4QW9A 4BWMA 4RNHA 4PG7A 4PABA 3NOCA 2CPEA 3TARA 3K5NA 4OZ2A 3TNVA 1CEZA 5F3ZA 1BLUA 2EFOA 5HI7A 4I0WA 1B3TA 3CUNA 1WC3A 3BH6B 2DGXA 2FJDB 2PMWA 3CCLS 1C0UB 1UEVA 1RT7A 2WSCC 1YKWA 2B4UA 3HKZD 4I7FB 2YWFA 2ZNZA 5HAOA 4U67Q 2VQFF 1T8EA 1H7WA 4O44B 4Y6IA 1EETB 3LAKA 3V6HA 3WHIA 1JNRB 4PWDB 3DLEA 3W61A 2MQMA 3UQSA 4QPTA 2IVFB 2MQNA 3OTEA 2DR9A 1FRKA 2X1GA 1JLGA 1AYEA 3B4DA 3BS9A 1BGXT 1FD8A 1NXIA 5F8MA 2F63A 3FMBA 2DPIA 3JSRA 1GT8A 1S77D 3AOBA 1CJUB 2F9DA 5J2NA 2RJZA 1KHVA 1OMSA 1Y10A 4HTIA 5LJ3Y 4IOBA 5E3RA 3PX6A 4G3IA 2DNGA 2NXUA 4EGLA 1ZH5A 1QD1A 2ZITA 1TL4A 2PD1A 3TVYA 1G3OA 1L3TA 2R7XA 3PW4A 2JEFA 2HS3A 2AYBA 1F6TA 1PG5B 2W2PP 2CQ2A 2ZH6A 4ZKAA 2JH3A 1DBDA 3E8OA 3TAMA 4IRDA 1X4DA 1CPZA 4J37A 1EQ0A 2BRKA 5H9EJ 1VQ9S 3W9JA 3TA2A 5D77A 1DQAA 4A8FA 4W90B 2XWXA 1KHWA 1KFDA 4JI0F 1YJWS 2QTWA 3D67A 4Y3CA 1T03A 2RMLA 1TMMA 3GU0A 4UT4A 1XERA 1HWUA 4PG5A 4DV2J 2RD5C 4B3TF 2Y1RI 3CJ2A 3PYEA 4YB7A 2BANA 5LSOA 4DR2J 1CS4A 2KFZA 2F7VA 2YTCA 4V19J 5L9XA 2NYIA 4USTA 2CQ1A 2CJ9A 2YNGB 4ZLJA 4JI3J 4KRWA 1N0VC 4BC7A 3M8WA 4X4RA 5K14A 1PJ7A 3KUGA 3C3LA 3RAQA 2G13A 2B51A 2RF2A 5D3GA 1YBAA 4HVZA 1N5YA 1X31C 1JLCB 1S79A 5HBMB 2PI5A 3QRQA 1HI8A 5F8JA 1K1SA 2CPIA 1HPZB 1MMLA 2VH7A 2IC3B 2XI2A 3CO9A 3HPOA 1IUJA 4KSEB 1IKVB 1OIAA 3SCKE 4CWBA 3HHEA 1K8AT 3MPWA 4F67A 2HQGA 1FFGB 2B9WA 2YKOA 2YWHA 1UFKA 4AQYJ 3QYYA 3G2XA 3POTA 4ZS6A 1PJ5A 2DIUA 4CLZA 5A76A 4CLUA 2FVRA 4KHPF 3IRXA 2OPPA 1EZZB 1T02A 2AGPA 3MFHA 1UWAA 1RT1B 1Y3JA 1N8RT 3ZXWA 2OGUA 3NOGA 4DR5J 2R7WA 4ED6A 1SKRA 1JX4A 2COLA 2MLYA 2VFRA 2DRAA 3NLCA 2UXBJ 4CO5A 1LK7A 2HZCA 3A8JA 4Y2KA 2KI2A 3U1MA 3C46A 3DOMB 4TYAA 3AFGA 3UDEA 5IQ6A 1VK8A 2V8GA 4DV2F 1JB0C 3DRYA 4B3TJ 3BEGB 3EWGA 4NLYA 1YTYA 3GIKA 3GJRB 1HBMB 2V63A 1Q1KA 2AJ0A 2DK2A 2V67A 2XSFA 3G71S 3DKDA 1X0FA 3U7JA 1FEHA 3G6XA 3POTB 3PR4A 3BDEA 3VAJA 3ZNUA 1S6OA 3ZZPA 1S6UA 5MLCV 3Q8VA 4YB1P 3OVBA 2MZQA 2YH1A 2WW8A 1SJFA 3OPKA 5D15A 2YQ1A 1FWLA 3V81A 1M90T 2VPXB 1R8AA 3AJ2A 4LF7F 5E3AA 1KTVA 3TEGA 4EMDA 2Z2ZA 2JHEA 1YJRA 4MFBB 1RT4B 4UOHA 1NH7A 4ID5B 4DPYA 1WUUA 3DMJA 3CJ0A 3MM6A 3B78A 4C8ZA 2C2DA 2VG7A 3FBEA 4BHQA 2VHGA 5CABA 1UCNA 2VKRA 3EXCX 2D9PA 2VDIA 4P75A 3MMJA 3BSNA 4ZLPA 3RB6A 1X9MA 4CZCA 1M5VC 4O4GB 4GC6A 3LO3A 3TUJC 4BS2A 2MPUA 5HL7Q 3JAMU 3T1HF 1I51B 3I5BA 1HL6A 3PY8A 4DSLA 1LQ9A 2MHEA 2ZD1A 3H2LA 5HANA 5EHHA 4B3MJ 2QX0A 4RZRA 1UVJA 2XYGB 1KQSR 1NDCA 3T5HA 4PQUB 4TNOA 1PJ6A 4YB6A 2LMIA 1VOMA 2RUSA 2VDHA 2XO7A 2ZH7A 2AU0A 3R5AA 4ELTA 3GILA 2FHKA 2HFOA 4IDKB 3M6VA 3GFYA 2LECA 2XY6A 1S6PA 2C2NA 5A8RA 2ZZMA 4G1QB 5F0UA 2MKKA 1KVJA 3EGZA 5E33A 4NYZA 3RRKA 3M9NB 2BJDA 2YKAA 4B3SJ 1RTJA 4N8NA 2CDQA 2QO3A 3FFIB 4B9MA 4H4OA 1HNWJ 3TI0A 3DOKB 2VF3A 4RW9A 1U0SA 4P2SA 4OI6A 4DV5F 4X66F 1HPZA 3AAWB 4IH6A 5D78A 2JZ5A 1HBNB 5KG4A 2NYHA 4DU7A 5J1PA 1QLNA 3OV7A 1VQPS 3DHXA 3CCVS 5DLFA 3CC7S 3QSIA 3FGVA 2ZH8A 2Y1IA 1S76D 2FYXA 4I2QB 3KDOA 2BEFA 4JI2J 1OQ3A 1S7IA 2H3EB 2QJ3A 2WCXA 4ETXA 4DL7A 2HFNA 2L08A 2WVFA 2VUGA 3M6UA 2ZHOA 1ZBTA 2BJ3A 4IFVB 1UA1A 4DR3F 1RWXB 2XHCA 2ZBCA 2KL8A 2G0CA 3N6LA 5KOXA 2E29A 2N82B 4WK3A 2DGQA 4OI1A 3HZEA 3GIIA 2J0SD 4CLWA
chains in the Genus database with same CATH topology
1RDRA 3ZZOA 2JEGA 3NCQA 4ZK7M 4QIGA 4FBTA 5EX0A 1C4AA 4LFBF 4PKDB 3CTRA 2VQEF 1KLNA 2DHAA 4IQXA 2P9CA 4PG4A 5BR8F 4DPOA 4NLPA 2RKIA 3T19A 3TYTA 3WDOA 4KT0C 2ROEA 4B9TA 1SC6A 2GFFA 3TANA 1DZ5A 3KK1A 3HI9A 4DV3F 2DNOA 4OI0A 2M2BA 4ITSA 1HQUB 3CJ3A 3HHLB 4TY8A 2VB6A 5JVHQ 1M0SA 4JI3F 3DFEA 4ID5A 3UR3C 4ZOSA 3N9UC 1LFPA 3C6UB 2EG2A 1FDAA 1MROA 2AGQA 2YNIA 1Q7YT 1JLAB 3FQKA 1HBOB 3U1NA 2ASJA 2M70A 4B3OB 3SCIE 3NWGA 4MMOA 1TV6A 2F3JA 1TL3A 1WF2A 5JVGQ 1TAQA 3AY0A 4K50A 2C22A 2RNEA 1QVFR 3NNHA 4G1IA 1VQSA 1TVRA 2QIFA 4FXWA 2BRLA 1FVQA 5AJ3F 3K59A 3PV8A 4B3MF 5A8KB 1R0AA 5KFQA 4ECQA 2J6TA 1C1CA 1GTEA 2XSJB 2KXNB 3OXLA 1Q8IA 3MMBA 1N36F 3ZC4A 4JBCA 3IWNC 1QUVA 3QZ8A 2XGPA 4ZP8A 4J5OA 4WFBQ 2HRUA 2M9KA 2CQPA 2QYCA 1U24A 3CCZA 4LVOP 3SDEA 2JC1A 4NLUA 4YFUA 4I1TA 2ASYA 2BE2B 5KFUA 2ZH1A 4HL9A 4B9SA 3Q8RB 1O51A 3FRZA 2R7QA 3SV3A 2POKA 1IJFB 2DJWA 4WCEQ 2D7SA 1TQLA 3EGNA 5I3QA 2XMVA 3CB4A 5KFBA 2L48A 1DFDA 3KJVB 3OFEA 3CJ5A 2DRBA 3CCES 5DGAA 5I42A 3DOLA 5F9NA 7FDRA 1B0PA 1SH3A 3MURP 1TK5A 2IA6A 1KNZA 3LP0A 4JYAF 2VBZA 1X4CA 5B0FA 2DH7A 3OLAA 2XULA 3ETOA 5E3CA 3TQ1A 5D6GA 1UP1A 3K8WA 4E8UA 4QIVA 4QWEA 4QJVA 1C0TA 4DG1B 1HNWF 4MKAA 2VG5B 1I94F 2AJ4A 4WFXA 2J9DA 2GMJA 5THWA 4ZP7A 2EFGA 2JSXA 3K57A 1QAIA 2K1RA 3OTCA 2W8KA 4NLRA 3KLFB 4F2SA 1C1BA 4CH0S 4LQ3A 2DGWA 3MMCB 2PDAA 3S1TA 2OP5A 3HP6A 2YNHA 3CCRS 2UZAA 4DR5F 3DMJB 1D1UA 2GHVC 3KLGB 3I87A 2MKHA 6FD1A 2DGTA 2E1MC 2E1AA 2L3MA 1NKBA 1L5UA 1MSWD 2EBGA 4USIA 1H2TZ 2KRBA 2E5HA 2OPSA 1KD1T 4NZ7A 1MWZA 4ED2A 1ZETA 5KFZA 3KLIA 1UKUA 2Z8QA 5J1NA 4F3QA 1H38A 3FEYB 2XB2D 2QA1A 4H4MB 2M7SA 4KAIA 5LSRA 1RTDB 5I3UA 3H5SA 4DFKA 1N88A 3W3SA 2B4OA 3UI3A 4EZ9A 2KT5A 1FKPB 3VALA 1FRIA 1GX5A 1MW7A 4DUYF 1HNVB 3ICLA 2MKJA 4F4WA 3CDBA 5KG2A 3P96A 2M88A 1RTIB 4OZLA 4DFMA 5A0YA 4ZCLA 4QWCA 1BQNB 4RW7A 2W9CB 4DR2F 2R8KA 1N33F 3HKWA 4PQUA 1S6QA 3BQ0A 5B08A 2IC3A 4DLGA 4C7QA 2ROGA 4MH8A 3MOZA 4HEA9 4ALZA 4NYPA 2E5IA 4ES2A 4M1KA 3NS5A 1U1OA 3UCGA 1NJXA 3ITHB 1FXDA 1VI7A 3MMAA 2GIRA 3MM9A 5FLXY 2AWZA 2Z4PA 1NJIT 5G0RA 2RDIA 3O8WA 4R0EA 3JSBA 3FJ2A 2N7CA 3KFWX 2DR7A 1S4FA 2DHGA 3CMAS 3VAGA 1H0HB 3TUIC 2KVIA 3M8QB 4YOEA 1FO1A 2R8IA 3HVWA 3QJLA 1NNDA 3QIDA 4ZPCA 3SSQA 1YRTA 3LP2B 2B4PA 2FLPA 4HI2A 3BGUA 1Q86T 1X4HA 2BVZA 3DXBA 4JI4F 2UUTA 4MAKA 2L9DA 2AJ1A 2KRRA 1VIOA 2V8HA 4D3HA 3FSIA 2FVPA 3DXSX 5LMUF 2KG0A 4OJGA 4QQBA 5AE1A 2FJEB 3VWSA 2W25A 1M1KT 2NLWA 1RT5A 1P8GA 1M5KC 2GA7A 1MROB 2PIIA 3V6DA 3VAKA 4F8RA 2HNYA 4NX9A 1RT3B 5T14A 4XDCA 3HM9A 1ZAVA 3IRWP 1S1VB 1IXKA 2VV5A 3DGPA 2VL1A 2LVWA 2M8HA 2YQ3A 2IAJA 2W7PA 3HT3A 2V9WA 1FDNA 2NQPA 2GO9A 1DTQA 2MKCA 2XZWA 3GIMA 4M95A 2KU7A 2DNKA 2KHDA 4M8LA 3UD4P 2IYGA 2BQRA 1UFLA 4CNZA 5B7WA 1AUDA 4A8KA 5HMZA 5JJBA 3NG8A 3CIZA 1JLEA 3Q8PB 1JLQA 2APOA 4WU2A 4FVCA 1Y0HA 4C9DA 2UUBF 4K4TA 2J6SA 2UXBF 4BDPA 4ZVFA 2ZE2A 2LKZA 1TKTA 4CI0B 1HNVA 3J7Z5 5KFCA 2JOQA 5ITHA 3BO3A 3PW0A 2FGCA 4ZCKA 3D54A 2N3LA 4X65F 3CDWA 4Q0BB 3T5LA 3MEGB 2BBEA 1S7HA 1VFJA 2DITA 2KZZA 3JTOA 1NHVA 2DPJA 1QVGR 3KHLA 3M1VB 1ZPWX 1R6YA 1X8DA 4BWJA 1X5PA 3HVTA 2D3UA 3IXQA 1TKZB 1RTHB 2B9YA 2MZJA 4KO0B 3X1LB 2X51A 2EFVA 4NWBA 5C5JA 2YKMB 2ASLA 4LF5F 4ECWA 1VBYA 3D0HE 1RISA 3K0JA 3NGDA 1N52B 1TUVA 2BACA 4LF4F 2E5JA 2KH9A 2V4JB 4RW8A 4NZ6A 2XG8A 4WE1B 3CF5Q 1H3DA 2B6AA 2O01C 4OHXA 4WZMA 2R8JA 4MK7A 1EETA 3CCMS 3VAFA 4OJHA 4B9UA 3PIPQ 4RW6A 4XK8C 1V3ZA 3Q2SC 3DLKA 3J81Y 4X84A 3LP1B 3L09A 1VLYA 2UP1A 2NZ4A 4CO0A 4E98A 5M2UA 2KFNA 2K2PA 4Y2IA 2X1AA 1IKWA 4YDDB 1G2EA 3L7PA 1X5OA 2MSTA 3J7ZT 1K0VA 1OSCA 3HX9A 1WHYA 2AX1A 1NK5A 1W2BR 3NAIA 3OBIA 2OPSB 2QZ8A 2AGOA 2AQ4A 1KOOA 4UY8T 4H4OB 1M5PC 1JLFA 1IQTA 1YHQS 3I55S 1FESA 1DTTB 1RT1A 2VD3A 3MPYA 2RVJA 4HT5A 4OIXA 4JI5F 4F3MA 5CZVA 3E2EA 3W2WB 3KHGA 2O3DA 3PEHA 2DNPA 2HNDB 2R9LA 4DQSA 2VC0A 4HTJA 3G8SA 2AJFE 5LJ5Y 2WTFA 3US5A 5CCMA 1N32F 3PACA 2M0GB 3VF0B 3I0RA 4ELUA 2MDAA 4QIEA 3C6TA 5HP1A 5GAHI 3ENVA 5KFIA 2VOPA 3UCUP 3QAUA 3CC4S 5T7LA 1S1UB 2MY8A 3KTQA 5AXMA 2EG1A 2F1FA 2BOPA 1S9EB 1WEZA 4TYBA 2LA6A 1DHMA 1JMTA 4I2QA 2PC6A 4JOUA 2ZM6F 4LF9F 1ZM3A 2UU9F 4C98A 3FMWA 3IR6B 2JVOA 4CO1A 4MTPA 2D74B 3MI7X 2UXDF 2JRSA 2KZMA 3SI8A 4ZPBA 1BQMB 4IFYA 1FKOA 3O3LA 1D9AA 3GSDA 3L95X 4NLOA 2RH3A 5L38A 1SB6A 1HMVB 4KTQA 5GMKa 4ED5A 3THVA 3CCSS 3H20A 3H98A 1J2VA 4C8NA 3T9ZA 4TLQA 5JUMA 1X7VA 4XDDA 4C0HA 4DS5A 4Q8EA 2B9XA 5CXTA 5KFSA 3FDSA 2CKWA 3M8PB 3MEEB 1VC0A 1M5SA 3B82A 2EVZA 5KFNA 1JJ4A 3PDNA 5E7OB 3BQ2A 4WFAQ 2IYIA 2ZH5A 2BM1A 3T5KA 1QAYA 2U1AA 1FRJA 2AYGA 4K4VA 2FIUA 3KMSA 4Y2CA 4DOZA 3UDCA 3HXMA 1FKAF 2DO4A 3RB3A 3CCQS 3MEGA 2K7KA 1OPZA 3MECB 2EK6A 1EP4A 2XMTA 1RT5B 4X4VA 4JI6F 2EKYA 1N5VA 1VQ4S 3CJKB 2PN6A 1FVSA 2CPHA 5HROA 3T1YF 4YUDA 4C3KA 3KKFA 2ZH9A 4OLOA 1TL3B 1O8BA 1WG5A 2V94A 4IG0A 4LSLB 3RW6A 4F50A 2AD9A 4HI1A 3KLGA 2HGLA 4RNFA 1DJ0A 4B3RF 2R2RA 1DQ8A 1VQLS 1SL1A 4ATNA 2KHCA 2H9ZA 1KQFB 1FCAA 1KEKA 1NKEA 1R43A 3OR1B 3PW7A 3BQ1A 4P7TA 3THTA 4AE5A 5C25A 2MQPA 4ELVA 1VC5A 2KJWA 5HN0A 1N4LA 3UW1A 2ZJPQ 4URGA 2MQOA 4C0OC 1IKYA 3EGWB 3OL7A 4O3OA 5L9NA 1IKWB 2HHPA 1WNEA 5KFRA 2IFXA 1Y5IB 1X4GA 3RTVA 3GMGA 3CVKA 2JDJA 4KKOA 3G86A 4MKBA 2XCAA 2E7WA 3M2UB 5EGYA 5DQIA 5KT7A 3CD5A 5KTQA 4RUAA 4H4KC 1FJGF 2P9GA 3MHYA 3QGPA 4OQJA 2ABYA 1U1QA 4FP9A 4IG3A 1C0UA 2EFNA 2J5AA 1LV5A 2BV3A 2WSEC 3W7BA 3CDEA 4O44A 4A8OA 5EUHA 1IM4A 3IAS9 3F41A 1FNOA 3JTPA 2HWHA 4DR1F 1A9NB 5CYJA 3V6KA 4DFJA 2KYZA 4E0DA 2MZRA 2QEXS 1E6YB 4B08A 2HFZA 1ZYQA 4D3GA 4TY8B 1HBNA 1F9FA 2KO1A 3N28A 2CJKA 1RKJA 5T7LB 1NK9A 4HKQA 4N56A 1YJNS 1FRXA 1X9SA 3H40A 3DLKB 1N48A 1PGZA 1SH0A 1TFWA 3KNGA 4DBQA 2G4BA 3FEZA 3LWLA 4IG3B 2DNHA 4KJIA 2RS2A 1GH8A 4B3OA 4ZCIA 2PGCA 4QWDA 5E5NA 2KFYA 2UVWA 2CVIA 2HGMA 3NNCA 2HS0A 4YY3F 4MIBA 1TKXB 4TQRA 1XR5A 1ZM9A 4C11B 4ZP6A 2UV8G 5DM6Q 2EK1A 4DEZA 4NLGA 1UMJA 1IR0A 1AXQA 3QO9A 2Y1JA 4UUWA 3WZ0A 4DLEA 3QLHA 2VG7B 4X62F 1CQNA 5MAOA 2PMHA 1U1LA 5BYSA 3I0RB 5CZXA 4Y00A 4CH7A 4ID8A 2GW8A 1P1LA 5DG7A 2F8HA 3TA1A 1SV5A 5KFHA 3D0GE 1KQGB 1R8BA 1HD1A 5C42B 3PW2A 5D4NA 2Q43A 4IO9Q 2HNZA 1UJ4A 3V4IB 4DWIA 3DOLB 2OLWA 3H2VE 5C24B 1D0EA 2HLUA 3M6XA 4GO7X 1YJ9S 4F2RA 2GV1A 1HWLA 2XMKA 1HWJA 3N5BA 3J80Y 5DDQC 2MZ1A 3MCSA 1RTHA 3K2YA 4KO0A 3MUVP 2OSRA 2HMIA 1HYSA 1AFIA 3VAIA 2AP6A 3OL6A 3CD7A 1FXLA 3UCZP 2I5JA 5G0RB 4QR0A 2BZ2A 1YJTA 3CCWA 1GAOA 2YNFA 5KFEA 4Q0BA 5DQGA 1UEUA 1S1UA 4EYHB 3MR6A 1QTMA 2QV6A 2W9BA 2FJVA 3GQCA 2ZDOA 4XPEA 3Q8SB 2J9EA 2MZTA 4CQ1A 1QUPA 5EN1A 5GADI 4IDKA 2OSQA 1HQEB 2LXFA 1PC5A 5DG9A 4DSIA 1XNRF 1NKCA 2R8GA 4J9RA 1LKZA 2JLEA 4M63A 4MJKA 3N5FA 1Q4RA 4J9SA 1VIXA 2VFTA 1FA0A 4HH0A 2XGQA 1HWIA 5J1EB 3GG0A 3PFOA 2UVUA 2GX8A 2I38A 3DLGA 1H2VZ 2J7WA 2NS1B 1Z1ZA 3IS9A 5J2QA 1QSSA 2N7YA 1QSLA 4DG1A 3PFEA 3GYXB 3IG1A 2WRMA 4I69A 1U6BA 5A8WB 4AL5A 1WACA 3H5XA 1TKTB 3AQPA 3U02A 3ULHA 3C6TB 4WKYA 2F40A 4R8UA 4FS1A 2YKNA 3MM8B 2J9DE 3MUMP 2B5JA 4I64A 3RBDA 2IJNA 1JLQB 1PO6A 1SKWA 1T94A 5KFGA 2W7OA 4RWXA 5HQ8A 3D0IE 1U26A 4LQ9A 4YR2A 1J5OB 4F3OA 2IRXA 4LT6A 1N56A 2DNMA 3KOAA 5CYMA 2B0GA