3KG1A

Crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
ADEVTFVNRFTVHGAPAEFESVFARTAAFFARQPGFVRHTLLRERDKDNSYVAIAVWTDHDAFRRALAQPGFLPHATALRALSTSEHGLFTARQTLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism
pubmed doi rcsb
source organism Streptomyces nogalater
molecule tags Oxidoreductase
molecule keywords SnoaB
total genus 26
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature ec 1.13.12.22: Deoxynogalonate monooxygenase.
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kg1A00
4YDXA 5KAKA 2EW9A 1Q4RA 1URRA 2LDIA 3FMBA 2ASYA 5IXUA 1Y9OA 2HIQA 3MCSA 2FIUA 2GV1A 2KT2A 1WD6A 4Y2KA 2OP5A 4A48A 1U7LA 1K0VA 2CRLA 2QLXA 3HFKA 1Y3JA 2K1RA 2OD4A 2XMWA 2AW0A 1Y3KA 3QGPA 2BJEA 5B0DA 2N4CA 2OFGX 2KYZA 1MWYA 1LQ9A 2BJDA 4Y2MA 5A6WA 3K7RA 2FB0A 4YEAA 1AFIA 1TUVA 1VQSA 2OMOA 3T9NA 1X7VA 1QUPA 2GO8A 2XMJA 1OSDA 3BGUA 1AFJA 1OPZA 2AJ0A 4OJHA 5T7LA 1TL4A 2W4CA 1Q8LA 4A4JA 1CPZA 2GGPA 1N5VA 1X8DA 1FVSA 1X0PA 2OAUA 1GXTA 1V3ZA 4HI2A 2AP6A 4DPOA 2PD1A 2K1RB 2XMVA 3TRGA 2BYCA 2LXFA 2G9OA 3LGNA 1KQKA 1OQ6A 5B0BA 1OQ3A 4ZOSA 1ULRA 4HI1A 1YJUA 5B0FA 4A47A 3HHLA 2FTRA 4Q2LA 1YG0A 2RILA 3KG1A 3DCAA 2KKHA 4ZA1A 1FESA 4Q2MA 4OIXA 1KVIA 5F0WA 1P8GA 5B0GA 2ROGA 2GCFA 3MZIA 3LO3A 4HL9A 3FRYA 4DL0C 3HX9A 1S6UA 3DXSX 1FE0A 3KKFA 1CC7A 1SI9A 2QIFA 4HH0A 1TR0A 1Y0HA 2QLWA 1RJJA 2LQ9A 2PGCA 4A46A 3CJKB 3BR8A 1AW0A 1TL5A 1YJTA 1YJVA 1VQYA 1YRXA 2ROEA 1R6YA 2K2PA 1JK9B 3LGMA 1IUJA 3CJKA 4F67A 2GGPB 4FNIA 2IYIA 1CC8A 1TZ0A 2K7KA 2XMMA 3BF4A 4OJ3A 3GZ7A 1XBWA 1GXUA 1Q53A 1YJRA 2AJ1A 2ZDOA 3UDCA 2HLTA 2OD6A 4Y2IA 1P6TA 4NL5A 2XMTA 1SB6A 3KNGA 2ROPA 4HH1A 1S6OA 2W4PA 2VH7A 3HHLD 5B0AA 2IFXA 2JDJA 1N5TA 2RU9A 4OJ1A 2L3MA 5A6PA 3BB5A 4QOTA 4NPOA 2RMLA 4U9RA 3BM7A 2FHMA 4FNHA 1KVJA 5B0EA 2XMUA 2RSQA 2OFHX 2HFOA 2VV5A 1FE4A 1FVQA 2HLUA 5T7LB 2HFNA 3TNVA 2IYGA 3BN7A 2BBEA 3HHLB 3KG0A 1FD8A 2QYCA 2GFFA 3I9ZA 3HDSA 3WDOA 2K7JA 2XMKA 5B0CA 1APSA 1JWWA 3IWLA 3BDEA 2Q3PA 2W4DA 3F44A 1Q8BA 1W2IA 2N4DA 3FGVA 2N7YA 2ACYA 1N5QA 3E8OA 1FEEA 1MWZA 3QMQA 2LQBA 3TOQA 1N5SA 3IWXA 5B08A 5F0UA 3VTIA 5K9FA 3HF5A 1SQEA 4DN9A 4EFAC 2HQIA 2OKQA 2GA7A 4OJGA 3HHLC 5B09A 2KT3A 2ZDPA 2BUNA
chains in the Genus database with same CATH superfamily
2HGMA 2V8GA 3BBFA 3OBIA 2MY7A 1HWUA 5CABA 4XTTA 4TYBA 3J7ZT 3CGIA 2J7WA 1S48A 4ECXA 2XSFA 4TQRA 4OI3A 4C8YA 2CZ4A 5AT1B 4DV3J 2FJWA 3UD5A 4U67Q 1V5IB 4K7QA 5GVQA 2AW0A 4EWTA 3QGPA 1NDKA 2BJEA 3CCJS 4CO2A 5EDWA 4G3IA 2QT7A 3EYZA 3G2XA 1WWHA 1QY7A 2XHWA 3GYXB 4C98A 5KFWA 3R6GB 1JLBA 2DKOB 2BDPA 2A6OA 3BGUA 3P49B 5HP1A 4OYMA 2UXCF 3DYAA 2VG6A 5T7LA 3DM2A 2OPQB 2IJFA 4NLXA 4A4JA 1QSSA 2CQPA 5IFMA 2YX4A 4DPOA 2YNIB 3H98A 5L1KA 2O5DA 1S10A 2WCXA 1ZZFA 2YKPA 5KFFA 1UA1A 2JEJA 3I4HX 2F9JA 2DCUB 3L4BC 5IC4B 3H7HB 2X51A 3UN3A 1MLAA 3M8PA 3CMAS 4OHXA 1HQ2A 2RJZA 1K44A 1IBMJ 2B7BB 1EP4B 2HRUA 5KFUA 2LYVA 5L1JA 3GB0A 3FJ2A 3BDPA 5G0RB 2BOPA 1P9YA 1PSDA 1ZS6A 4ZP9A 2VQEF 3NMRA 1U26A 2XWXA 1YITS 4WFZA 3VAJA 2CUYA 1UFLA 2M7SA 3R5JB 5U47A 2W25A 3C16A 5D4NA 3W1YC 3OUYA 1S6UA 2W01A 4GO7X 3GIMA 3R5CA 2DNHA 1HIYA 2QIFA 3W5YA 2UVWA 4O3RA 2MTLA 4Q7AA 2XWYA 4AFFA 4XAKA 4QYRA 4TXSA 1NK9A 1XERA 4OI0A 4DR6F 1KOOA 1NEEA 4G6VB 4WYLA 2ADBA 5F8LA 2G2OA 3G82A 1YJTA 4QIWD 3HP6A 2ZWOA 2R7WA 2R7OA 4MIAA 1F9HA 1GNKA 4ZITA 4NA1A 3GP9A 4LT6A 1CULA 2OPRA 1FO1A 1VMBA 3NY0A 3DN9A 2EG1A 2POKA 4ECQA 2PFDA 1NJYA 2G1HA 3JXOA 4CWBA 4OHWA 1M90T 1D8YA 3GCWP 1K8AT 5C2CA 1FRMA 2MSTA 3TX8A 4HH1A 4ZN3A 3PJXA 2QMXA 4NZ0A 2VH7A 4USIA 1RWOB 4Z7CA 4PUOA 3A12A 4KGZB 2X1AA 4BS2A 5D0EA 1CJUB 3AOBA 2KFYA 2GVDB 2Z8QA 4FZVA 4XK8C 3TUJC 4P75A 3KLEB 3WIVA 1HR0F 2FHMA 3OL8A 2FC8A 3GYNA 3W2VA 2WRMA 3MDFA 5LJ3Y 1D9AA 4NLOA 5E0OA 3BN4A 1RB0A 2L9DA 2HRYA 3DYAB 3CTRA 3HLUA 5F9LA 3BBBA 4GVBA 2OHDA 4ZCKA 1ELOA 3M1VA 1UVNA 2AT1B 3U1LA 3ZFVA 4MKBA 3K0JA 2C2EA 2GFFA 2Y1LB 4NEYA 1XQIA 1WHXA 1NK4A 1EX8A 3NBPA 1WEXA 1ZPVA 3ELHA 3IM8A 4OX6A 2ZH5A 2HGLA 2YXLA 3C2PA 2DNQA 1N32J 4AQYJ 4QWDA 5E2QA 4CLTA 2OPPB 3LGHA 4WJBA 4DSJA 5L9XA 1IR2A 3PO4A 4Z37A 1KNZA 3A3OB 4I68A 4JB8B 3TOQA 1TKZB 2IBKA 2Z0GA 1UZHA 3VTIA 3HF5A 2WBMA 1VI7A 3HHDA 2M3DA 3NOGA 3OPKA 4HLBA 1NH7A 2OKQA 1ROFA 2V2KA 2YKNA 4H4OA 4NLYA 2KT5A 5FDLB 4C8KA 3W8PA 3FC9A 4NLPA 1D9FA 4LF5J 4WKYA 5CYMB 2HPUA 4OI1A 4DFMA 2EW9A 5LMNJ 3MR7A 5K8MA 4DPXA 2VB6A 4OYPA 2MQMA 4M94A 1WD6A 1MSWD 5KG1A 2GMLA 2EKYA 3W9JA 1HBMB 1WI8A 2DNPA 4MT1A 4WU3A 4CT9A 3V5RA 4DX8H 1Q81T 3NMAA 5T14A 2LA6A 3G9CA 3PW5A 1X9SA 1N36F 2E5LF 1OMSA 2PDAA 1PYTA 5BYQA 5FJ4A 5KFOA 4C11A 5RUBA 2C42A 2DD8S 3LP1A 3THPA 1HQEA 1WC0A 3M2RA 1M5VC 2IM1A 1TUVA 2C2OB 3G96A 2G0IA 3M9NB 4DDFA 4J9NA 2MXYA 2C2ZB 5KTQA 1RT4B 4I7FB 1T9XA 2IVFB 4K5SA 3MEGA 1KDNA 2V4JA 3MOJB 3P5TL 1FRXA 3IR5B 2COLA 4LSZB 4N8NA 4X4RA 2HIYA 1BE4A 1DBDA 4U96A 2BYCA 2V68A 1U0HA 3OXLA 3V6DA 2IDLA 4DN9A 5A8KB 2ZH4A 3D54A 3EDQB 1JNRB 4HTIA 4CO5A 5JMNA 1LW0A 3QT6A 2YNGA 3AQOA 2MZJA 2BJ9A 4FPRA 4KV8A 5B0FA 3GIIA 2R8HA 2VU5A 2VFRA 2JLFA 4Q2LA 5L8RC 5DDQC 2RILA 4OI6A 2LKZA 4RW8A 4YY3F 4YB1P 1UA0A 1D9DA 2IY5B 3M8WA 1GX5A 3W5ZA 4C3LA 3A4TA 1JLAB 4ZP7A 2RQCA 1IN0A 3JS9A 2VQEJ 3SCKE 1BQNA 4OZ3A 2DVIA 2FJEB 5EHHA 4X4TA 1XK8A 4RNNA 3QGHA 2DY1A 2WTFA 2A1BA 4FYXB 4TN2A 3DXBA 2DTJA 5E3CA 3FSXA 3S6EA 5IC6B 4PPZA 3P6YC 4FYWB 4LRFA 5F8JA 1AW0A 3K2YA 4M5DA 3Q0AA 2CQ1A 3QFHA 1Y11A 2R7SA 4LRBA 5FDLA 4EYHB 5KG2A 1YKWA 1IR0A 1X9MA 3LALA 1SJFA 7FDRA 2DNNA 3EXYA 1BWEA 4K4WA 2DXDA 3UCGA 2OI2A 1RCOB 5L38A 5KFHA 3TUIC 3E01A 3M8QB 3SFUA 4I2QB 3R2CJ 2UXCJ 3M1VB 2OTLS 5CYQB 2X1FA 1UAWA 2UVRA 1L3KA 2I5JB 2XMTA 1TL3A 2ROPA 4P71A 4ZP6A 1S6OA 1AROP 4H4OB 3BGOP 4U8VA 4BC7A 3ZZOA 3NGTA 3F73A 3A1YG 3FZBA 5A6PA 3EE3A 5GMDA 3RAQA 1UZDA 2FPHX 5CXTA 4CCHA 1QLNA 4C7QA 1MN9A 3D0HE 1WOSA 3RRHA 1KFSA 1Q7YT 1SKWA 3MF5A 2GO9A 4OV6A 2ZM6J 4B9LA 1CSJA 2XGQA 2HHTA 3SCIE 2MKJA 2NSCA 4ZJQA 4F4YA 5BXIA 3NAIA 1FRJA 2YNFB 3M2RB 3HT0A 3IWLA 3BH7B 2W4DA 5DG7A 1JJCB 1FK9A 2VJUA 3QO9B 3V4IA 4DSFA 2E9ZA 4O0IA 1K1QA 3AOCA 2HZCA 4LREA 4IG0A 3ZZ0A 3BR9A 4O0NA 1V5VA 4O3SA 1FDAA 3K5OA 5A8KA 4B9MA 2JNJA 2F3JA 1QM9A 1S57A 3UVJB 4GKJJ 1HQEB 3P4UB 3KUEA 1ZAWA 4FS1A 1LWXA 3ISNC 4GO5X 3QRPA 3MAQA 5L1IA 2BE2A 5CAAA 4RZRA 2QLBB 2ZOMA 4MK9A 3N28A 3T6BA 1JLQA 4DU7A 1UJ4A 4Y2KA 4E2FB 6AT1B 4MFBB 1TKXB 3IMQJ 1RKJA 1RT1A 4ILRA 3KLHB 3GCXP 4J9OA 3D1OA 3EGWB 1FEHA 5BYSA 5C25B 2N3LA 3FNNA 4P52A 4ALZA 2OGUA 3MOZA 3C66A 2WOMA 4EGLA 1NKEA 4NMXA 2VPYB 2OPSB 4MAKA 3HHEA 4JI1F 4J37A 4PXCA 1N5YA 2EK1A 3W60A 3DOKB 3QGGA 2ZZTA 4WZQA 4ZPBA 4F26A 4JI8J 1FRKA 4CQ1A 3G6XA 1N0VC 4GC7A 4WCEQ 3EXCX 3UE2A 4O44A 2CQ0A 4RW7B 5CZVA 1X0PA 3GSIA 1SL2A 1HL6A 2YKQA 3TRGA 3ADAC 3SSQA 1REGX 2O66A 4HDHA 3N79A 1X4AA 4NCGA 3DLKA 5I4MA 2HZVA 2VBYA 1WDDA 3OJUA 2UXBJ 2KZMA 3TA1A 1HHSA 2IM3A 2I2YA 3CCMS 4EK2A 3CCSS 3PEHA 4UF4A 2X1BA 3UN5A 1IR1A 3A3NB 3C14B 4B17A 4PQUB 2WSCC 3PIPQ 2D3OR 2LQ8A 1XC9A 4A8MP 2B3TB 2K3KA 4CLFA 3MPVA 3DOLA 4J9SA 2VFTA 5AXNA 4OHYA 1Y00A 4YR0A 2F5GA 4C0OC 3M8QA 5HAOA 1NHVA 4CO3A 1BD6A 1S0MA 1KLMA 2DY9A 4QIVA 1CBKA 5HLFB 2AZ1A 4WYWA 5LL6d 2MPUA 3OVSA 3CJ8A 1FWKA 3ISZA 3X1LB 3BREA 4JV0A 5MLCV 3JYTB 3M7VA 2FQQB 3EDRB 3Q24A 1H74A 4IYQA 3F0NA 2B56A 3RYLA 1BWVA 3N6MA 4NYZA 3V4IB 1TK8A 1TKDA 2V4JB 4ES1A 4UY85 2YQ0A 4K4YA 2C1EB 1KOHA 1S79A 3AXMA 5K14B 4OYIA 2BE7D 1UMJA 2RF2B 1XTZA 2IM0A 1HBUA 3K8WA 1N54B 1RWXB 3LF0A 4ZP8A 4AL7A 1XNQJ 3MPDA 4LF6J 3UD3P 1GTEA 2VQFJ 2W24A 4JI7F 2VDHA 2WW8A 5F8IA 5EX3A 2HVIA 3TR5A 2RUGA 5ETTA 5LT5A 3MM6A 4ZLPA 1HLWA 3MPWA 1I6JA 3QATA 1SBRA 1PKUA 4A8QA 3GV8B 2E7WA 4IG3A 1UEKA 2G0JA 1VQNS 1Y5LB 2PT0A 2CWXA 1JLGA 5T7LB 5K5MA 2ZH8A 2YWFA 3KOAA 2RIJA 2IYGA 1VQLS 1V3RA 2HKEA 3D0IE 2E5IA 4NZ7A 4JP8A 3T3FA 3M6XA 3TZXA 4EMDA 3GMGA 1FD8A 4KE5A 1PG5B 4KO0A 2JRSA 1YSJA 3CCWA 2ZH3A 3QQCD 4K8RA 4DF4A 2NCKL 4ZCLA 2NYHA 3M30A 4JI8F 5K8OA 2A10A 1N48A 4QR0A 4ES2A 4LR9A 2R9LA 4LF7J 4KSEB 4BBYA 2A3JA 2E7VA 1H3DA 2L08A 4J7CA 3W64A 1X4BA 2Q43A 3EPGA 1PYOB 3CCQS 2FVQA 1S1WA 3HSDA 1MMNA 4K2XA 4DZDA 3RGIA 1FEEA 5EUHA 1U47A 2HMIA 3OT9A 2D9OA 2DH8A 1ZH5A 3C15A 3IWXA 2NR0A 2G13A 4NCGB 5F0UA 2GAHC 3VZIA 4EZ6A 2PEBA 3DMJB 1RWNB 4FN5A 5THWA 1IKVA 4U7UK 4DHVA 4DS4A 1O5JA 3GE9A 2OTJS 1VQKS 7AT1B 2ZWPA 4LSLA 5KAKA 5H1SV 4DV2J 2V9WA 4GKJF 2ADCA 1T3NA 3MM8A 3AODA 1QJHA 4LIRA 4O3QA 1FXDA 1NU4A 3HD2A 2CJQA 9RUBA 1WOOA 4PKDB 2CNKB 2FZGB 1LW2B 5KFNA 1U7LA 1U25A 4NLWA 5D4OA 3JYTA 4P2XA 3D6TB 2H3EB 2VBWA 1TL7A 3KLGB 2HAFA 2UUWA 4PR6A 3DLHA 1KLMB 2UXDF 2IVMA 5HVFA 1RXOB 2KL8A 3OFGA 3OR1B 3JAMY 3GIJA 4ED8A 4C0BA 4DR7J 4ED5A 1Q95G 4QR2A 2Q66A 1HBNB 1RBOB 1QUPA 2D3ZA 3OTBA 1JNZB 4WWSA 3SIPB 1YIJS 3AJDA 2VICA 2DR9A 1O51A 2QFIA 1HD0A 3I31A 4UW2A 3L3CA 1FVSA 2V4QA 4OZLA 1S7IA 1H2TZ 1MROA 3K8VA 4IO1A 2HHQA 4G1QB 3T5HA 3C16B 3TO8A 3OUYB 4Z7YA 4F4KA 2GJFA 2KXFA 2YVSA 2DPJA 2KFZA 4ECWA 5IV4A 3BJYA 3CJ4A 1NZ8A 2UXBF 3FBCA 5J2PA 1OPIA 4HI1A 2CPDA 4WF9Q 2O67A 1Y7PA 3CO0P 2NXCA 3MUTP 4ECSA 1T05A 2DBBA 4OYAA 1QAJA 4QCLA 3EVWA 1F5AA 1IJEB 1R31A 3TUZC 3H2VE 2CVEA 4K4TA 2E5GA 3PEJA 3UDLA 2QL9B 1VC6A 1Q0NA 3DOMB 1KVIA 3CJSA 3QRQA 3QT7A 1A0OB 1VCTA 4WFNQ 3LO3A 1TP7A 3MTKA 4JI4J 2HNDB 3RJMB 2P6TA 5D77A 1DLOB 3MM7B 3LP2B 1SI9A 2MZ1A 3M6WA 4N5SA 2HVEA 1TKZA 3TQ1A 3OR2A 2IRYA 2YWHA 4EZ9A 2JZ5A 3JTOA 3LGMA 1RT7A 2LVWA 3L95X 4IQMA 4Q43A 4JV2A 3DRRB 1B0TA 1VRTA 1IUJA 4IO9Q 4X64J 1XMOJ 2IYIA 2B8QA 1WKJA 5E5NA 2MHNA 2IC3B 4OJ3A 2Y0SD 3RU0A 2HHXA 3ZC4A 3J7YI 1T02A 3TEHB 2V69A 2QA4S 2WK4A 4NL5A 5CA5A 3TJ8A 1IKVB 2MKCA 5L1LA 2NS1B 2XMAA 3BBCA 3KWMA 3M30B 1EJ7L 2DIUA 3ITHB 1FDNA 1OYDA 3M4XA 3PY8A 4DI6A 1X5PA 3DGPA 3MMJA 4RUHA 1N36J 2QEXS 2VBXA 3IBWA 1XJWB 4F36A 4DV6F 1RI7A 1KVJA 1IJFB 5D8HB 4PPDA 1QE1B 1R89A 2GMJA 4DSEA 2ABYA 4PRFA 4A8WA 4WXWA 4ZIVA 2VDIA 3VVTA 3QJJA 3KTQA 1U24A 2DGXA 1VFJA 3ZXWA 1RTHB 3EICA 2GS8A 3PRBA 5KT5A 2BV3A 1T0TV 3VAHA 1GMWD 2ZVIA 4AQYF 3G8TA 4RBUA 4KPCA 3I5CA 3NCQA 1Z4UA 2BKOA 3H20A 3OJSA 2IA0A 3KHRA 3CD0A 2DR6A 3FGVA 2FLOA 3QT8A 1KHVA 2V8HA 1T3OA 1KQFB 4UOFA 3DU5A 3J81Y 3QMQA 2KXNB 3ET6B 2XO7A 1QAIA 3PNIA 5HQ8A 2XEXA 3FBFA 4FVCA 5B08A 4Q8FA 4B3MF 1NH8A 1RAOA 3DDNA 1VQPS 1SCJB 3J7AN 2GHVC 1UVKA 1TL1A 2QL7B 2KHCA 4AXIA 3N5FA 3M8YA 3OTOJ 1TUGB 1MMLA 2BQRA 4ETZA 3NNHA 1AT1B 4H4KC 2J76E 2AYMA 2HNZB 5A76A 3PR5B 2XNRA 3VAGA 2OP5A 4YQWA 4ZVQB 4LF6F 3QGIA 4K5RA 2M52A 1X9WA 1SC1B 2KRRA 1KC8T 2XBPA 2HNDA 2VC0A 2BRKA 2AJ2A 2YWEA 1HNWJ 1HNIB 3DLEB 5KFEA 4V19X 3G6YA 3K7RA 4CRJA 3OVAA 5IM0A 1NCLA 1RDRA 4X65F 4DPTA 2ASJA 3D1QA 1OPZA 2R8KA 5MAOA 1JXLA 3FBEA 2ZJQQ 4DFJA 4D3GA 3IS9B 4PYDA 5ETMA 2XY7A 4NXNJ 2XMVA 3CDAA 2DGSA 1ZA2B 5BYRA 3I87A 4DV4F 5ETNA 2CPYA 3PRDA 5HVHA 2DIVA 4KRWA 4UY8T 1ACMB 4DL6A 1EKSA 1RTIA 3OXGA 3OFHA 4ICLB 5CCMA 1OYEA 2MSSA 2FTRA 1IWGA 3RB4A 4JI1J 4DR1J 3BQ0A 4KY3A 2CNOB 2XB2D 4KH1B 4DR5J 5IQQA 4RW4B 4DEZA 4RUCA 4TLRA 4RWWA 4LQ9A 3BYRA 4RKUC 4RR5A 1C4AA 4B9NA 2UUTA 4DL0C 3OL6A 4DV7F 3L7OA 4IDKA 1U1OA 2CPHA 2AEJA 5ETVA 1J5OB 1IKYB 2PE8A 3G82B 1ZTWA 2HVHA 1WHYA 2A2DA 1Q8KA 2LP4A 3KHLA 2UVUA 2BA9A 4CYUA 1KTVA 2IIHA 3OD2A 2Q1LA 1FJ7A 3D28A 1RAEB 3TA0A 4JI0J 4ZHRA 5DGBA 3R3TA 4FYDA 2OEKA 2H1YA 1X4GA 3AD8C 3POTB 2W7AA 4LR8A 5T41A 4CO4A 3OW2R 1FKPA 2D9PA 4FF2A 2FUG9 4Y65A 4QW9A 5J1EA 3RTVA 3KUGA 4H4KA 1H98A 4F50A 4J91A 1RAFB 1WG1A 4NI2B 2QTWA 3NNCA 1OY8A 1S6PB 3RR8A 3C6TA 2FY1A 4IQXA 1TL1B 3KNGA 4EO6A 4HYKA 4F3QA 1H38A 2G1DA 2UUAJ 3FCVA 5KT2A 2ZHBA 5A2QY 1WF1A 5C25A 1DY3A 3KK2B 2C2MB 4C48A 2N3OA 1X4CA 2JSXA 2RF2A 3KNAA 2AGPA 3H8YA 1IBKJ 1WELA 3RG6A 4DX7A 1UETA 3MGJA 3FEZA 1U6FA 4QU7A 1AZSA 1U6ZA 3IRWP 1FCAA 2F63A 5AXMA 4WBFA 2BANA 2OFHX 3DI6B 1YBTA 2JEGA 4DV6J 1K9MT 4K50A 1FFSB 4OV1A 1DLOA 1IBLJ 4ZDNA 4DUTA 3BN7A 4OL8A 1FXRA 2ATCB 1B99A 2WSFC 3TVZA 2XLIA 2WONA 5JJBA 5AE3A 2ASLA 2K7JA 3OR2B 4ED6A 1RAIB 3LPEA 2OH2A 2ILYA 1U4BA 1V3SA 2FLLA 2V4RA 2GNKA 4TY8A 3NLCA 3LUYA 5LXRA 2ZVSA 5KFPA 4YHHJ 1RQ0A 3H5SA 1TQLA 2QA1A 4HVZA 4NA3A 3N4WA 1XN9A 2ACYA 5KFVA 1RT1B 1XMBA 3KLHA 3UNGC 3BSOA 4IRDA 4NXMF 3MAAB 4X84A 1SXLA 3O5TB 5K9FA 2ZZMA 1AB8A 1SQEA 4MTPA 5IT0A 3HJFA 2HQIA 3PYGA 4DXLA 3MM5B 1VQ5S 1UP1A 4Q0BB 1RT2B 5IM0B 2DRBA 1U8SA 1AUSL 4B3SJ 2YBVA 3GWCA 2LDIA 2F65A 4OZ5A 2DCLA 3IRXB 4DR1F 4IFVA 1U02A 3M32B 3HULA 4ER8A 4NLDA 2UUCF 2QRRA 2AX1A 2B51A 6FDRA 4A48A 1T9WA 4FXDA 4O3PA 3H4BA 3DRYA 3MUVP 3BKUA 2JVOA 2JFDA 3N5BA 2RS8A 1PCAA 4I64A 3WBZA 1R6VA 2DNRA 5DETA 5B0DA 5LSOA 3V81B 1TAQA 2VA2A 1UWBA 3GONA 1U2RA 4L73A 4C6AA 4YEAA 3OSPA 2QGFB 1RSCA 4JI0F 2F9DA 4PQUA 1F9FA 2DEJA 2ZUGA 1P9QC 1KKHA 3LTOA 4OJHA 5CD4A 2P9EA 4ELVA 2F4FA 5LSLA 1FKPB 2ZJPQ 1VLYA 1REVA 2YKMA 3VWSA 4F0KA 2L41A 2R7RA 4HI2A 4A8YA 1BGXT 1J5OA 3HVRA 2CJBA 3EGNA 2V0NA 1DFDA 1TKTA 2YX7A 2L9WA 2MKYA 2V63A 2YNGB 2RHQB 3DDKA 1N88A 4DF8A 1RT6B 1YTYA 1SJ4P 1KD1T 3L7UA 4MYTA 4WPAA 1OQ3A 2CQHA 2GJIA 2QC3A 4TU8A 2RU3A 4F4WA 4DQRA 2MQQA 4ZLLA 3HT3A 4J90A 2D3O1 4LQ3A 1S0VA 3UR0A 2UXDJ 2J6SA 4USMA 3IXQA 1T03A 2DPIA 3DCAA 5J2PB 5L46A 2AMCB 1SIWB 1LXNA 2M2BA 1C2PA 4OX7A 1T9YA 3BQ2A 1ZZNA 3PHTA 1FTRA 2GCFA 3HFVA 1F1BB 3LA0A 3QPIA 4EBDA 2QL5B 3FQKA 1SQFA 4PABA 3T5KA 2IA6A 3FSYA 4LF7F 1N56A 4ZVPB 2XLJA 2QN6B 2LFVA 2WVFA 4M5DB 4U8YA 4J9QA 1U1PA 2E1CA 2NREA 2ZKUA 4NLGA 2EKNA 3AHPA 3FK4A 4A46A 4CM0A 2RT3A 1W26A 2F1FA 4HHJA 1DHMA 1VQYA 2HHPA 3W61A 1U45A 1DQAA 3T41A 1WC4A 1FF2A 3E01B 1DTQB 1QTNB 2HBQB 3EVMA 3PACA 1F9EB 1GX6A 1LKZA 1PBUA 2R7QA 2CJKA 1R8PA 1I5OB 1JLBB 1NLKL 1Q53A 3UDCA 4F0MA 3SEOA 1U1RA 2APOA 2HHWA 3KJNB 1VHFA 2WVCA 2MZQA 4DSIA 5IWAJ 4KHMA 4KH0B 3FCWA 2W4PA 4MIWA 1RTIB 3DM2B 2NPFA 4YFUA 2ZJRQ 3A8EA 4X66F 2E7XA 3AD7C 3HJVA 4KB7A 4OJ1A 3R7SB 1ZYQA 2EC0A 4ILLA 3DHXA 2AJ4A 1HI8A 2CQ4A 4E8UA 5A8WA 4LF4F 2ZITA 3JSBA 3R5DA 1FJGF 2DK2A 3SBMA 2AJQA 2YQ1A 3OV7A 4JBCA 1UFKA 3R5AA 3ITHA 2Y8YA 1OY9A 1S9EB 1XNRJ 4MK8A 2HLUA 3VV2B 1JLCB 1NKCA 1WC1A 4ZVFA 1IKYA 4D3HA 4WTYA 5CZXA 5LXYA 2BBEA 5LMUF 4DR5F 2LXIA 3O3LA 4W98A 3RAXA 1CJKA 2ASDA 3I9ZA 4LFAF 3MMAB 1CVJA 3JTPA 3T19A 1S1VB 1DARA 3VQSA 2ERRA 3U1NA 1IM6A 2KYXA 3W66A 3H2LA 3IRXA 1I3OB 4QIEA 1TV6B 4AT1B 4RW6A 5GAEI 3TJ9A 2VPZB 2E1MC 3E8OA 3FEYB 3UVJA 2XULA 5AE1A 4CH7A 4QWAA 3Q22A 1U1NA 2M88A 3NWRA 4ECTA 5KG4A 4J5OA 1JB0C 4M5NA 5D6GA 1K1SA 2ZEJA 2IVYA 2XGPA 3KK3B 5FLXY 1J2VA 1JLQB 2OSRA 2G4BA 3H5XA 4I0WA 2AX0A 4F4XA 1SL0A 3KFWX 1EAYC 2ZC3A 2MQ8A 2ZE2B 3BQ1A 3ONQA 3JSRA 4X4QA 1YJWS 1MG7A 3D5MA 5KFCA 3UFCX 2K1RA 3AAWB 3JQKA 1IBMF 3X3UA 2HZAA 3TZYA 1RWPB 4WE1B 5D4PA 4B3RJ 1R0CB 4FKYA 4M5HA 1G1XA 3WHIA 1WKKA 1IM4A 2B43A 4USWA 2CPJA 1O8BA 3HVAA 1RISA 3D3BJ 2UUBF 4L6V3 4FF4A 4X4NA 5DZ7A 3K5LA 4ZCIA 4F4ZA 4IR9A 4ZJOA 1QSLA 3M8PB 1CEZA 4OX9F 4CLYA 2YWGA 4USVA 5F8MA 5EN1A 4C4WA 2CJAA 2QA4G 2GIFA 3S8SA 2MLZA 3PX6A 1NDCA 3MXHP 3CW2C 4V1Ak 3NAHA 4B3TJ 1HMVA 1FI4A 2H51B 4K0KF 1NSKL 2PSZA 5L9NA 1RHUB 2C2DA 2Y1RI 2KRBA 2XO6A 4IRCA 4PQAA 2R3VA 5ETSA 4WTOB 2JC1A 2V2QA 3ZO7A 1VBZA 3OHAA 1CG2A 1HW9A 1S1VA 1DTQA 4NLRA 4I67A 2YWWA 4OIXA 2B5JB 5B0GA 3RBZA 1S97A 2DRAA 3CCUS 2IHR1 3SDEA 3PJ9A 3PG9A 1JLCA 2YKAA 4B9UA 4B9VA 3J81j 3M9OB 4DL4A 3CCES 1UWBB 4KHRA 2AD9A 3GILA 1ZM3A 3KK1A 2FY8A 2GC8A 4RO0A 2AZ3A 5HBMB 5M2RA 1YJ7A 5EWGA 1V9OA 4B02A 1RWKB 3Q86A 1NPRA 4M5MA 4YDDB 3M8RA 1JJHA 1HARA 1F3VA 3HCXA 4HT5A 3KDOA 3HSZA 5K14A 2D3UA 5B7WA 3FRZA 5HMXA 4EU0A 2BX6A 2XMMA 4DOZA 4L75A 4UQTA 4KKOB 4USTA 4ERDA 5IOLA 4OYXA 1GXUA 4ZVRB 2ZDOA 1YJRA 5J2NB 3M2VB 1HNZJ 1FRLA 2YKOA 2YPYA 4XIUA 1S77D 1R27B 1SB6A 3TUPA 1B7FA 5DQHA 5GAEU 3LWLA 1PJ5A 3VHQA 3P5BP 4UZBA 2F4VJ 4ZKAA 1IQZA 1N5TA 1NK0A 2K3IA 1WTBA 1HBUB 4M8LA 3D2WA 4DL2A 4DV5F 3CIZA 4NRTA 1AYEA 2BW2A 2CDRB 2FC9A 1RU1A 1G2EA 3QYYA 1FDDA 4ZN1A 3MCOA 3R97A 3I0RA 4KPYA 4IOBA 3NGKA 3V6KA 1RHRB 2BRLA 4QZVB 4OZ0A 1NDLA 3PXGa 4I6WA 2I5JA 3TW0A 5I3QA 1VBYA 3RRGA 4RW9A 1H2UX 1KEKA 1NHUA 1H72C 2J9DA 1RWVB 1RADB 4F04B 2HMIB 4DWIA 1F5BA 3GG1A 1VIXA 4DLEA 1X4FA 1Y10A 1B7YB 3KHHA 1RE1B 2XS5A 5K8NA 1LNQA 1LFPA 2YKNB 2M8DB 1BHNA 1RT5B 2H4WB 2HWHA 4MIBA 5FLXU 1NSPA 2X3GA 1JLFA 3R5BA 3DNCA 2W2MP 1B3TA 3I5BA 1IVZA 2OIHA 1HNXF 2CAJA 5B09A 2LECA 4FYVB 4URSA 3TI0A 4TVAB 5IS2A 2FLNA 2KFNA 2HBYB 1H73A 5HO4A 1L5UA 4C3KA 1Q4RA 4ZPTR 1KLNA 1J5EJ 8AT1B 2KT2A 3FKBA 3G8QA 3MEKA 5KFGA 2R7XA 3BGFA 4XPEA 3GR1A 3OR1A 3POTA 1FKOB 2OD4A 2RDJA 5J2MA 3C19A 2R8JA 3TARA 2HHSA 4A8SA 1F5CA 1UKUA 5I3PA 3NS5A 3MEDA 2LQJA 2GQ2A 2LCWA 2OLWA 4K4SA 4ED0A 1CJTB 4WIIA 2XMJA 3EZ5A 4LF9J 1TV6A 5FD1A 3UDVA 1BXNA 4ECRA 1HQUA 4B08A 3KK2A 2E66A 1CQNA 2KDOA 1GXTA 2LEPA 3CSKA 3T1YJ 4LRDA 1WOPA 2F8HA 4KKOA 1N4LA 2VOPA 3VAIA 1M1KT 1I94F 4LFBJ 3UCZP 3AJ1A 4ZVTB 2XG8A 4N8OA 3GJRB 1SV5A 2RQKA 1FK9B 3DI6A 3K59A 1VJQA 5G4DA 3I0RB 4JUZA 2ZOGA 3OTOF 3CCVS 4F3OA 4JI7J 3T9ZA 3BYPA 1XMQJ 5KG0A 3QAUA 3ENQA 3C6UB 1NBEB 3MAHA 3MECA 3TA2A 4ZLNA 2WONB 3US5A 4DX6A 3HPOA 4DR4F 3KG1A 4ZA1A 2OELA 5HROB 1M1HA 2ROGA 1NPPA 4NLTA 4EBEA 4LF8J 3SQGA 1NK5A 4Y00A 4XDCA 1HYSB 4OI2A 2E44A 3PZPA 3KJQB 2CKWA 3I55S 1YK9A 1TVRA 4JI3J 1HNWF 2O1PA 2WW4A 2DYAA 4CP5A 1RJJA 1RT5A 3F56A 4P2FA 1U1KA 5LM7E 5IT9Y 1F2GA 2CA9A 2XY5A 3DLBA 4RWXA 2ALZA 2ZOFA 3BR8A 1LV5A 2KTQA 4X65J 3C14A 1R6YA 5AXLA 3IO1A 5D0GA 3D7SB 4CZCA 3I0SB 2VL1A 2LA4A 3DLJA 1ZM2A 2HVDA 1VGYA 3TAMB 1UTAA 4TU7A 1Q86T 4E0DA 1OSCA 1VJWA 3EUNA 3QZ7A 5C24A 1HNVA 5HQLA 4DN0A 5J1NA 4TYAA 3U02A 3DLGA 3B82A 4JI5F 2GVZB 3OL7A 3LQVA 4C8ZA 2XYPB 2B9YA 2O3DA 1FT8A 3ZTPA 2B7CB 4I4BA 4I2PB 2XZTB 1HI0P 1RLDA 2YPZA 4P10A 2QYGA 3FQLA 4C0HA 4DCJB 1L3VA 4NMLA 4FDFA 3VCDA 4FNHA 4ELUA 3QJPA 3J81U 4WP8A 5B0EA 3C3LA 4U7UD 2B8PA 2C22A 3Q8PB 3L9ZA 1RLCL 1M5KC 2YNHA 4RU9A 5CD4H 2DXFA 3IM9A 3FDSA 1S1XA 2ZC4A 2B4OA 2IMWP 5G0RA 4HR2A 5SUHA 2A0FB 1RWWB 2XS2A 4C11B 3CCTA 3CO9A 4MK7A 4WFAQ 2N7CA 2R7UA 2C3OA 3QBCA 2P9CA 3KK1B 4WP3A 4F4AA 4KYZA 3TJAA 1U8WA 2KJWA 3ET6A 3AA8A 5H9EJ 4NXMJ 3BH6B 4ENOA 1HWIA 3KLEA 4N77A 2N7YA 1NJZA 4USJC 1MWQA 5KFIA 4K4VA 1XR5A 3ZZUA 4ZIWA 3KJVA 2AHOB 4EI2A 4NWBA 3FMWA 5DJBA 1O0PA 4OZ2A 5HSPA 1U0HB 5DGAA 1VK8A 4LFAJ 3WIUA 3EWGA 1OS5A 1H7XA 3BGLA 4KO0B 3Q2SC 1FJCA 3I6PA 3SQGB 3ISND 2B6AA 4CO0A 1XWLA 3Q89A 4MKAA 3I56S 2DNYA 3CDEA 1UCNA 4YDXA 2PMZD 3W2WB 1CULB 2OPRB 1N6QA 1B0PA 4GVLA 3G6ES 3NRBA 2ZBPA 2OPPA 2PEHA 2ACMA 3DLEA 2HFUA 3HFKA 1U2CA 3Q8UA 3VGUA 1X4EA 4DR3J 2KM8B 2C3PA 4ED7A 4K0KJ 2OJ3A 1S0OA 1X4DA 3TAMA 2N4CA 2KYZA 2J6TA 4F0HA 2GQCA 4U7CA 3MM9B 1CS4A 3IG1A 3W9IA 2NXJA 3CEDA 3H59A 1DURA 1AFIA 2CZVC 1GMVA 2OMOA 3KLIB 2GQQA 1X7VA 3T9NA 2UV8A 4RU2A 1HNIA 4M5KA 3IAM9 2VJVA 2B9WA 2DNZA 1S6QB 2OAUA 2WVBA 2ZNYA 5F41A 4ED3A 2J0QD 4DZ6A 2FHJD 3HHKA 5CYJA 3UQSA 3NP5A 1PJ6A 5A8WB 3ZNJ1 4ELTA 3AA9A 4PG4A 4DQIA 4A8XA 4LF4J 1QD1A 1VLOA 4DPWA 2JLEA 3ETOA 3H0PA 4YY3J 3ZZYA 5AJ3F 5D3GB 1QVFR 1LWEB 1UVMA 1YJUA 4RX6A 2BZ2A 3W7BA 5HJYA 2XI2A 3V6HA 1NSAA 2XYHB 4DV1J 1VRQC 3CD5A 4OI4A 2FHJA 2OEJA 4ZK7M 2PN6A 1I51B 1M1GA 2BJ8A 3LOUA 4RUBA 3RW7A 3CCRS 1T9VA 2EFOA 2DNGA 5EX0A 2DEIA 2CVIA 2HNYB 3DXSX 2MKHA 1FWPA 4UZCA 4JI4F 2J9DE 3R7BB 1Y0HA 1SJQA 3R7NB 3HK2A 4RBVA 4CO1A 5I42A 1RK8A 4IH6A 2XQCA 2HWTA 4XO0A 4O3NA 2K2PA 1HBMA 3ZZTA 3K58A 2FLPA 1FD2A 1YBUA 2R42A 3CWJA 3VGTA 3GFYA 1U1LA 4F2SA 1UVIA 4PWDB 2EFQA 2CQ3A 2DHHA 3VGVA 1C1CB 4JV1A 2VC1A 4LF9F 4USKA 3GFZA 4WK3A 3MD3A 4KT0C 4ZVSB 1F2HA 2OD6A 3RBDA 1P6TA 4X66J 2MKKA 1VQ7S 1SQGA 1Y5NB 4OLOA 5DQIA 1C0UA 4DFPA 1LW0B 1RT4A 1IKXA 1RTZA 1YZ7A 2IFXA 2QG9B 3HVTB 1TELA 3OTDA 4I7FA 1NUEA 1W7WA 4IG3B 2GJ2A 3PDNA 3S01A 3TX0A 2F7VA 4QOTA 4NPOA 2RMLA 4G1QA 4URGA 4B3RF 4ANCA 5E3AA 2RKIA 4RLEA 4U9RA 1GQEA 4IKAA 3WQPA 1WJ9A 3AH6A 5CH7B 2Y1JA 4YP3A 2N82B 2HFNA 1UFWA 3M8SA 3JB9k 1T11A 2MB0B 1IWAA 3AOAA 2I6WA 1RT3A 2W7OA 3GQCA 3BGRB 2RH3A 3UO0A 3W63A 3PW4A 1JWWA 1BLUA 1JLAA 4ATNA 4WIQA 2P9GA 4P73A 2MGZA 1NM2A 1U1QA 5KT4A 5HP1B 1D3WA 4RW9B 2Y3YA 1DQ8A 1HBOB 5D15A 4TLQA 4ZPAA 3PKMA 4X2BA 2R4FA 3PTWA 3CUNA 2VG7B 2DNOA 2DGTA 4QYZJ 4PYAA 2X7IA 3ENVA 4Q5VA 5AE2A 1YRUA 3VGSA 4AUKA 2X1GA 3CB4A 3CJQA 1TL3B 3FUYA 3GU0A 3RB6A 1BUXA 1NB2A 2Q79A 3HHLC 3NCPA 1LWFA 1F6TA 5KFSA 4TKTA 2E5HA 3LWMA 1DRZA 4C3MA 2M9KA 1D0EA 1N33F 1G4CA 4LUBA 5F8HA 1UVJA 5F3TA 4WFYA 3LP0B 9ATCB 4P74A 1FX2A 1TMMA 2KHDA 4ZLJA 3Q8QB 1ZA1B 1IBCB 1FNXH 2KU7A 4YUDA 1Z2LA 5KOWA 5LSRA 2BACA 4X62J 1RABB 2OFGX 2CPFA 2RQMA 2XTJP 2VQFF 4DR4J 1YJNS 1NKBA 2HSEB 3M2UA 3P45B 3ZTQA 2FB0A 1PAUB 2Q6BA 3IGNA 5ETOA 4PG7A 2YKMB 2AEFA 3M2VA 4UTGA 2QX0A 1SKSA 4C8LA 1HNXJ 1MROB 4DQSA 1FFWB 2CG4A 4ZJLA 3J80Y 2V8PA 1C0UB 4F8RA 2H54B 1JQGA 3KYLA 1X8DA 3SCJE 5DG9A 4BDPA 1EB0A 2AYEA 2MZTA 4I6AA 2HHHF 1T7PA 2F4VF 3I96A 1SH2A 4LSNB 4PG6A 4DL3A 2DO4A 5LOQA 2LXFA 2XCAA 2VBZA 1Z1ZA 3MEEB 3N6NA 5HI7A 1N34J 1REVB 3I4PA 4LBIA 5A0YA 1KQKA 3PR4A 4B3MJ 1SH3A 5B0BA 6FD1A 5JUMA 3Q8SB 4ZOSA 1WHVA 1T95A 1X60A 4R5PB 1FRIA 2HS3A 2B9XA 2CPEA 2K8GA 3DOKA 1WORA 2MYFA 3VAFA 1X31C 2DB1A 2DGUA 3NS7B 4USHA 1S5ZA 2I38A 3GFHA 4M5GA 2AV5A 5DS7A 1GT8A 1CJVB 4YR3A 3GIRA 3S1TA 4DS5A 3NBPB 5D0RA 3NGSA 2DXEA 5KT6A 1XIQA 2W2QP 4QIFA 1UJ6A 2CPXA 3FVYA 4TU9A 4V19J 2R8GA 4DUYJ 8ATCB 4CH0S 5HROA 4HH0A 5J1PA 1RACB 2VUGA 5K20B 5JXSA 2PGCA 1C0TB 3V2UC 2W9CA 1P1LA 2B9EA 1VS3A 1LFWA 3SXLA 2ROEA 1YJVA 3EGVA 2QMWA 2RDIA 1FKAF 4KJIA 2GVDA 5HMYA 4A8KA 4MJKA 1R8HA 3OL9A 2HG4A 1PJ7A 2HURA 1RTJB 2OPQA 2RQ4A 3B8HA 1ZM9A 3EMTA 2IMOA 2QSWA 3GPAA 1ZPWX 4O44B 4OX9J 1DTTB 3NGDA 1WEZA 1G6BA 5F3ZA 2AU0A 2KH9A 2ZNZA 2CQBA 3CT9A 2V5HG 1JLEA 5C7PA 1FWLA 4AD6A 1SL1A 3RW6A 4KGXB 1NB7A 1H6KX 4DUZJ 1X5OA 2ZZNA 3HHLD 3IP0A 3WC0A 3M05A 5J2MB 1RA7A 2D41A 5IT9U 2MY8A 3O2IA 1Y4ZB 4M5IA 2J0WA 5HK4A 5F8NA 3BM7A 5HN0A 1HA1A 3MR3A 3CMES 1ZBTA 3CJ5A 1LW2A 2RAQA 2LEBA 2G2ZA 2L48A 5DO2A 1U1MA 2UZAA 5KFMA 4ILMA 4ECZA 1RHQB 2HS0A 2BABA 2P6SA 4FYYB 3IGVA 1UW4A 3AXKA 4L76A 4PXDA 1SJRA 2HGNA 2WVEA 1IBLF 2Z2ZA 3HDSA 3AB4B 4IR1A 1GMUA 3THTA 4RPFA 4RW4A 3BDEA 3D6HB 2DITA 5A0YB 3V6JA 1JXEA 3SQOP 1NO8A 2R2RA 1VQ8S 1HPZA 4NCBA 2W2OP 4DV3F 4PWWA 2N4DA 4J9UE 1C1BA 1EKRA 2QMUB 3PYDA 4QWCA 5D4LA 4NEZA 3G87A 3UW1A 3W9HA 3JSMA 1VC0A 3GG0A 2QV6A 2GMHA 2IJRA 3TVYA 3UR3C 4Z2XA 1TAUA 1KHWA 1VQ6S 3C8YA 1HNZF 3BPSP 1RA6A 1DAXA 3TVKA 4EFAC 3OLAA 3M2UB 4KAIA 2VFVA 1Q78A 4DLGA 4LF8F 2ZE2A 4F25A 4M5JA 4I69A 4MKVA 3WZ0A 4X4UA 2HIQA 2MQOA 2GHWA 5HJXA 2W9CB 3G6VA 2V9KA 4NE9C 3W2VB 2ZHAA 1HWKA 4NXNF 8RUCA 3W2WA 3SCLE 2VKRA 3D6MB 5DRKA 3MR2A 3AFGA 1PC5A 3LW5C 4R0EA 3FBBA 5CQGA 5IQ6A 1LQ9A 1YLXA 4CLZA 3RB3A 2DHSA 1RAGB 4X62F 4LJMA 1NSQA 1AZSB 3LH2S 4I2QA 4KV8B 3THVA 4PAAA 4UUWA 2J8AA 1PO6A 2I9SA 3M32A 2G0CA 2W4CA 1Q8LA 4HEA9 3FCHA 3ZTOA 4A8OA 3HKZD 3KLIA 4F3MA 1HMVB 2KB2A 3HFZB 4Y0FA 3I82A 2OUGA 2UV8G 5KG7A 1S7HA 4ECYA 5DQGA 2J0SD 1HYSA 2WB4A 3TWZA 4DV0J 4ZVEA 2C28A 5EWEA 1C0TA 5E7OB 2YNHB 2J9EA 5HL7Q 2H48B 3KMQA 3E51A 4NLQA 2HS4A 4OHVA 4RL1A 1DZ5A 2I8EA 1S1XB 2E1PA 2E9TA 2SXLA 1YG0A 4OLPA 1WUUA 3HZEA 3LP0A 1UW9A 4ZVOB 3MMBB 2JLGA 1ZAVA 1TK5A 4F02A 1SH0A 2KN4A 1P8GA 2C2KB 1S4EA 3D4JA 4HDGA 4IFYB 2HFSA 4HL9A 4YR2A 1EIYB 2FJXA 4Q0BA 1YDLA 1IQTA 1R0AB 1JLEB 5J2QA 3BO4A 3A13A 3QIDA 1WTFA 2WBRA 2W2NP 3DLGB 5DM7Q 2B5JA 2UUCJ 2VG5A 4DR7F 2XZWA 1VHIA 5E41A 2ZFHA 2BKNA 1SUQB 5KFZA 4IFVB 3KJVB 1TU0B 2GZOA 3AQPA 2FZCB 3DRSB 4GKKJ 5DLFA 2JFKA 2JEFA 4QJVA 1PILA 1YVFA 3R1HA 2V67A 2DGWA 3MFIA 2VHGA 1CLFA 2F8EX 3ILIA 3V81A 2EK6A 2W2PP 1NJWA 1D8ZA 3B78A 2KVIA 4HACB 4OZJA 4JI2F 4W4MA 3UNYA 1I1GA 4ED4A 3JTNA 2V2VA 4EUVA 1E6VA 3V6DB 1HI1A 1VYAA 3PX4A 1I94J 1TKXA 3MM7A 3J80U 1C1CA 1XMQF 1Q7LB 3GSDA 2PI5A 2YWKA 2RU9A 1SC3B 2C3YA 4OYZA 1UEUA 1UJ5A 1M5SA 2L3MA 3T1AA 3M9MB 3G86A 3DRRA 2UVVA 2OEMA 1ICEB 1CS4B 1PIEA 1DQ9A 3GJQB 2Z2YB 3IG1B 3B54A 3N9UC 5FIIA 4MFBA 4IUFA 4JI6J 3K5PA 5KFBA 2Z2LA 3ENAA 3BSCA 4C8MA 2CJ9A 2NUUG 1YBAA 4DX5A 3HHLB 1MW7A 4N76A 5H9FK 2LLZA 1S9GA 1T03B 2GHPA 2OPSA 2HHVA 4TY8B 1ITPA 3VQTA 4UOGA 1NPKA 3ILOA 2C3MA 2AEMA 5A2QU 3DOMA 3W62A 1L3UA 4B9SA 1JMTA 2VFUA 3GYGA 2Q3PA 4QR1A 4GRSA 3MCNA 3K57A 1RT3B 3PW2A 1CQMA 3OVBA 3MPUB 2Y9HA 1KS2A 1SJ1A 4O3OA 2J0XA 4P72A 1R7IA 2P5VA 3V4MA 1RTDB 2A2CA 4ECVA 2XM3A 2JVRA 2BJ7A 4YB6A 3O1LA 2VODA 4Y2CA 5KFRA 4N41A 2BJ1A 3DLKB 1UL3A 4DG1B 1RCXB 3BKTA 1U48A 1VRTB 2WAQD 1CJKB 4OYBA 2XC9A 2KT3A 2ZDPA 3UWTA 5J2QB 1OQ6A 2BUNA 3G71S 3MR5A 4C8OA 1QTMA 2M4MA 2ASYA 3PFOA 2W8LA 3GFXA 1FKOA 2FIUA 2GV1A 3OTCA 3NOCA 3MMBA 2EPIA 4K2JA 1KWMA 1PBAA 1WSVA 2CFXA 2Y0BB 4LR7A 1TTHB 5E33A 4R8UB 4DL5A 2XMWA 2R8IA 2C2RA 3PYFA 3CC4S 1O6XA 1PYSB 2WB1D 2XNQA 2VG5B 4RNFA 2BJDA 4G1IA 1BC6A 4PG5A 4Y2MA 3NL0A 2NXNA 4MMOA 3CF5Q 2AKWB 4DR2F 4UOHA 2FVPA 2AJ0A 1HPZB 1S9EA 1L3TA 2J7UA 4W90B 3DOLB 1WKLA 1LXJA 1U09A 1WF2A 2EFNA 1CJTA 5GMEA 5KFLA 1CPZA 1FA0A 3P3DA 2AP6A 1E6YB 2RD5C 1OJ4A 4L3NA 4AL6A 3PIOQ 2K1RB 2E1AA 2YH0A 3SV4A 4J9MA 4ES3A 1R0AA 3ICLA 2HFVA 5AJ3J 1NZAA 1A9NB 4G1PA 3O8WA 4DV1F 5KG5A 3KLFB 4PXBA 3WC2A 1TK0A 3HHLA 5HATA 3DKDA 4ECUA 4EO8A 1MU2B 2Z2MA 2GAGC 3TAQA 4EYIB 2PA8D 4BCAA 4R5PA 4I1TA 1FESA 1KN6A 2FYXA 5F0WA 3MWBA 4HACA 3R9LA 2RRBA 1N8RT 1SKRA 4MH8A 3FRYA 4RW8B 4DUZF 4F2RA 1RHKB 1URNA 2LQ5A 3PVXA 4KFBA 2XHCA 1FE0A 3R8YA 4L74A 2HHHJ 1FFGB 1WI6A 2QLWA 3W8GA 1P27B 2HNZA 2DHXA 2RE1A 2X3DA 4O4GB 4DMZA 2DGVA 4MYUA 2KG0A 1N34F 2V50A 1QUVA 2LU1A 2LDYA 2QJ3A 3OFFA 1VISA 2BM0A 4CI0B 2KM8C 2ZH1A 2AYBA 3MM6B 2YY3A 4FXVA 1HNVB 1LWFB 1W2BR 4FF3A 1S4FA 2CDQA 2P8IA 2KI2A 2Q6CA 3NGUA 3QZ8A 3CPWR 4M63A 1SPBP 4BWJA 2ZH7A 5H9EK 2DGQA 3MM8B 5KFDA 4RNMA 2MMYA 3CXCR 2OMLA 2UUBJ 2LXUA 3I5AA 1R8AA 2ILZA 2FJAB 2A6MA 2HLTA 1Q8IA 2IM2A 2FD2A 3CMQA 4I2PA 4Y2IA 1UVLA 2ZHOA 4P2MA 3NXZA 3T1HJ 2UU9J 5C24B 3D0GE 3HM9A 4DUYF 1RZMA 1JKHB 2HK2A 2JDJA 3A8IA 3MR6A 2MGZB 4MKYA 1UEVA 1UPMB 2HFZA 4OMFG 3IFEA 3JAMU 5ETQA 2EFGA 2ZD1A 4B3TF 2KZZA 2HK3A 3PW0A 2R2TA 4UT4A 1S1WB 3QT5A 2NPIA 1GAOA 2MHEA 2MQLA 3D68A 1MMDA 5KT3A 2CZ9A 2HFOA 3MPYA 3UDEA 2KG1A 3DU6A 4DV7J 3R6LB 4JV5J 3Q83A 1HD1A 5J2NA 1S99A 2K06A 2AGOA 2AQ4A 1E6YA 3UD4P 3CJ0A 3QNWB 4WXOA 4LSNA 2EFVA 4CYUB 2VPWB 3DHWC 2XMKA 2WSEC 4RW6B 4C9DA 2RRNA 5HMWA 4LMZA 3ILLA 4X4VA 1RHMB 1ZM4A 4ZPCA 3L7PA 1Q8BA 2JWNA 4YB5A 2IPOB 1HFEL 2DISA 2M5YA 3DRXA 2EBEA 4LIWA 5L39A 1WSRA 2IAJA 2MZSA 3BZQA 3W5XA 4G65A 3VAMA 3ZZRA 3PO5A 1T05B 5ADZA 1WEYA 2Z30B 3FZ2A 3I32A 1F0XA 3AT1B 1VQMS 4ITSA 3D6FB 4DQPA 3Q2TC 1NJXA 2QA2A 4K4ZA 2DR5A 3KXDA 5KG6A 2H5JB 4B3SF 1YZ6A 3DRPB 2MQNA 3DLLQ 5C5JA 1SVDA 1RGVA 3A8JA 4FKXA 4L3KA 1URRA 2DH7A 2HEKA 5IXUA 3CC2S 1FTCA 4O4GA 2V8DA 4DV2F 4CLUA 2PC6A 2HHUA 2MQPA 2HQ3A 3HMJG 2CRLA 1K0VA 2Z58B 2E5LJ 2HQCA 1F3FA 4M5LA 5KFXA 5BR8F 1G3OA 2ALYB 2DHGA 1A6LA 4RNOA 3TQEA 3IWNC 4RNHA 1MWYA 2CQCA 2GIQA 2XS7A 3ULHA 1JXVA 1VRUA 1N52B 3BEGB 4KHPJ 4JYAF 1NNDA 2B4VA 1F60B 2CXEA 2F40A 2RRAA 1AFJA 1CJVA 3KG4A 1JKHA 1QSYA 1NHKL 1AXQA 1RTDA 4RBTA 2CPZA 2VONA 2PD1A 1QDUB 3PCOB 1PC4A 3PHEA 3QSYB 2G9OA 2RDDA 4RW7A 1VIOA 3DMJA 3LGNA 2BQUA 1FJGJ 4GKKF 1FX4A 2R2UA 1OWXA 2PI4A 1M5PC 3ZZPA 1U2FA 4QBUA 5SZTA 3IC1A 3LANA 1FNMA 2O01C 2CJYB 4FPIA 1EARA 1OY6A 2DO0A 2BE9B 3KMSA 3VR1A 1W25A 2EI5A 5ITHA 3CIMA 1YHQS 1T94A 4Y2AA 4Q2MA 2GW8A 2CQGA 2NXUA 3MZIA 4GMKA 2J7KA 2R2SA 3HX9A 2JJ4D 4X4SA 2IAJB 4JV5F 4TNOA 2U2FA 1CC7A 5D0HA 2XLKA 2IDEA 4IFYA 2VOOA 3SV3A 2ZKTA 1ZAXA 1C4CA 4IG0B 4LFCJ 2FZKB 5DDRC 4DV5J 4OQJA 3CD6S 3CNQP 2M70A 1U0SA 2NLWA 1SKUB 4W92B 2HVZA 4R0JA 2CQ2A 3ZZZA 1EETA 1WC3A 3RBXA 1LK5A 4KHPF 2EVZA 1QE1A 2MKIA 1TZ0A 2P2CB 1YX2A 3CDWA 2BE2B 2DRDA 1TKTB 5DZ6A 3NEKA 1JIHA 4ANEA 5I3UB 2J6UA 4XDDA 2IBOA 5GAGU 4CH1A 3LPYA 4QYZK 2BKPA 1YRTA 2NXEA 1RUSA 3NS6A 1IKWA 3ZTRA 5GAHU 4NA2A 5LJ5Y 1T8EA 1NRKA 2KO1A 2M8HA 3DFEA 3ILJA 1KTQA 2B4PA 4QPTA 4KC5A 4GVBB 3VVUA 2CWKA 1T9TA 1HKAA 4ZPDA 2DR8A 4ID8A 4ANDA 2RSQA 5CCLA 4I6YA 2EG2A 5GADU 2YH1A 1AA1B 4KGMA 2GIRA 2QZ8A 3BGRA 4WE1A 2RS2A 4YS2A 2CJXB 2OSQA 3U7JA 3WX8A 2HWIA 3CJ3A 3FEXB 5C2GA 1DJ0A 1VDHA 1HBOA 4KQZA 2J8SA 4UQGA 3HXMA 4BLGA 3K5NA 2VA3A 3SSRA 2VG7A 1S9FA 5A8RB 4KTQA 4H4MA 1H0HB 1P1TA 3D1HA 3GTYX 1XNQF 1W2IA 2VASA 3D66A 1RBLA 3I9V9 4NASA 2I0XA 4NLUA 4ICLA 2FVSA 3J7YU 4NYPA 3N01A 4CLKA 2EEYA 3AY0A 4FP9A 2HBZB 4C2MA 1B70B 2EWHA 2GA7A 4BWMA 3RZAA 1RWUA 4QWEA 3Q8RB 1N5YB 4FBTA 3T6JA 3K17A 1WACA 1VRUB 3M8ZA 2W9BA 2BR0A 2WHOA 3EJMA 2BJ3A 2OO4A 2GX8A 3H2UB 1XNRF 2RUSA 3PV8A 4DJBA 1Y9OA 2UP1A 1H7WA 5KFAA 3VZHA 4P9SA 1S12A 4N56A 3M6UA 1R3NA 2JC0A 4OFZA 2W7PA 2J5AA 3G4SS 4KBIA 1RP5A 2M0GB 5IV3A 5KFQA 2PFFB 3MCMA 3SDEB 1VOMA 1H2VZ 1Y3KA 2H5IB 3NGRA 4LVNP 3H4DA 1HHQA 1X0FA 5J1EB 2E1RA 4DR3F 3EPIA 3N6LA 1S0NA 3J7Z5 5A6WA 1YI2S 2DHAA 2HBRB 3PJWA 4ZHRB 3G8SA 2EXUA 3UPFA 2ZH2A 2FJVA 2F8MA 4X4PA 4EEYA 3IAS9 1EETB 4IH5A 3MEEA 1S49A 2DT9A 1N5VA 3TP2A 4O4RA 1GK8A 5EWFA 1SV5B 1HBNA 1VR6A 1B4SA 2NSBA 3CE8A 5DDOC 1KR4A 3HD1A 5E3RA 2MLXA 4HHUA 4IDKB 3H5YA 3LAMA 5I3UA 1RYRA 4CNYA 2LU2A 3MEGB 2VF3A 1HWLA 1SUQA 5HLFA 1ULRA 1GXLA 4OYOA 3MURP 3HKWA 2H4YB 3KJFB 3NG8A 3BPDA 4NOHA 4ED2A 2CG8A 3BV8A 3HVWA 1BQNB 2FDNA 4QW8A 4B3OA 4Q44A 2KKHA 2BW7A 1WHWA 3IR6B 1TVRB 5CHCB 4CLSA 1WDTA 4U95A 2C2NA 3T5LA 1E6VB 4LF2A 4DQQA 2ATLA 2FVRA 2YX1A 3C6TB 4DU8A 3BO2A 2QO3A 3H5UA 3MAAA 3C15B 3CJKB 3DDIA 3EZUA 4KFBB 4ZVUB 3S7RA 2PA3A 3A8KA 3LP2A 7FD1A 3JSYA 4DPYA 2HRTA 4JI2J 2V94A 2MDAA 3CJTA 3QWPA 1Q1KA 3CDUA 4UOCA 3H40A 3UCUP 2GGPB 3MMCB 4J9KA 4YB7A 1GMWA 1VQOS 3E2EA 3NNAA 4I56A 2K7KA 4DPUA 2NZ4A 5F9NA 4K59A 3GZ7A 3ZNUA 3ENWA 1RTJA 1BQMA 2AJ1A 1NJIT 3FFIB 4ZMMA 2Z56B 1S9GB 4DSKA 3J7A1 4YOEA 2CNNB 2IC3A 3MM5A 2VG6B 4ZVHA 5B0AA 3RAMA 2FHOB 4LF5F 4P2SA 4URQU 5GAGI 4JOUA 4U6PA 2Y1IA 1VQ4S 4K4UA 3H90A 5LMNF 3E3XA 3BB5A 2W9AA 1EQMA 5HMZA 4DV4J 2EFPA 4GC6A 1FHTA 4LBPA 3JQMA 2JOQA 1WC6A 3ETMA 4WFXA 4A8FA 2VV5A 3EX7B 1SC6A 1JJ4A 4PCQA 1R43A 3L09A 1AUDA 2NYIA 3NWGA 1FJEB 4BHQA 3Q23A 4P7VA 5KFJA 3P8BB 3MD1A 5GADI 3TYTA 5B0CA 3T1YF 3HVTA 1S72S 1KFDA 1NAQA 4LSLB 1RT6A 4AE5A 1JJ2R 2HYIB 3C46A 4PZVA 3T1HF 5DG8A 2UU9F 1S1TA 3QLHB 5F8GA 1KRPA 5BR8J 3KLFA 1LK7A 1XEZA 4H54A 3IN5A 3SSSA 3GV7B 4LFCF 4WFBQ 3CD7A 3PYEA 4RUAA 2JEIA 2L9NA 4NI2A 3R1LA 3QO9A 2LQBA 1FNOA 3IBCB 2LMIA 3CCLS 1T9UA 2VKZG 1LWCB 5EGYA 5GAHI 2JHEA 1N6QB 4OJGA 4JYAJ 3R27A 1UWAA 2E5JA 1WC5A 2IRXA 2FGCA 4L72B 3R5GA 3CJKA 4O23A 3HHNB 1KVKA 2FJDB 2XI3A 4B3OB 4M1KA 2IJNA 5AXKA 2VIHA 1S1UB 1D09B 1R0BG 1N33J 1GFWB 2Y8WA 2QLXA 2FVCA 1HWJA 1YJ9S 1M5OC 3MM9A 2DR7A 1ZETA 1IKXB 3GJTB 2V2ZA 3CJRA 4HT7A 5ETKA 4OZ1A 5KFYA 1L3SA 1BY9A 1JLFB 1Q5VA 4USUA 1QAYA 2ZBQA 3CVKA 1ZOTA 3B4MA 4Y3CA 1BMQB 2V34A 2RKIB 3TZZA 1VQSA 4NX9A 1SIZA 1WF0A 2I1RA 2ZUAA 3HO1A 5A8RA 1OSDA 2PIIA 2VPXB 4BC9A 2XSJB 4OX8A 1D1UA 2MLYA 5E3QA 1TL4A 1XR7A 1KBRA 3I0SA 2BOAA 2GGPA 3MMCA 4TQSA 4P7TA 4OZNA 1V3ZA 4B9TA 3FSIA 4Y28C 4DCPB 2WVDA 3DGPB 4Y34A 5HQMA 3MUMP 3K5MA 1LWEA 2J9CA 1BQMB 1SC4B 3DC2A 4CM2A 5IZHA 5ETRA 3OHBA 1ZTTA 2BVZA 1NMEB 4WZMA 3OLBA 1FERA 2AJFE 2D74B 5H9FJ 3T5JA 3W3SA 1R8BA 4CTAA 1X5SA 3RB0A 4N7TA 3BSNA 2MKSA 4JI6F 2QLJB 4ID5B 2BQ3A 4ZS6A 2ZBIA 3RR7A 1B0VA 2VFSA 2DGOA 2WZ1A 1OO0B 2XYGB 3A3PB 4Y6IA 4DCOB 3BO3A 3CC7S 4JI3F 2HQGA 2ZBRA 4LF1A 4X4OA 2JX2A 2PMWA 3FFIA 3DRSA 3Q8YA 3KKFA 3WX4A 1TR0A 4WKRA 4R25A 1NXIA 3EM1A 3CCZA 3SFGA 1FDBA 3MMAA 4LRAA 3B4DA 4PWUA 3QFWA 4J9RA 1HHTP 2YQ3A 3BKFA 4XPCA 4DR2J 2HW3A 4N47A 4X64F 4LRCA 1XMOF 3C6UA 3MECB 3DRPA 4J9PA 2ZD1B 2BMBA 1VC5A 2DH9A 1TFYA 4HKQA 3KK3A 3GLJA 2B0GA 4RJVA 2E29A 3SZ2A 1Q5YA 3MHYA 1J27A 4KGVB 4PUOB 2AYGA 3MEDB 4LFBF 1N0UA 1NK7A 1RTHA 4P6QA 1KSPA 4ZCMA 3CJ2A 4IRKA 4DSLA 3QRRA 1TUWA 3PFEA 5K8PA 1VQ9S 1HQUB 1X4HA 3KUHA 3B6BA 4ZPVR 4C8NA 2ZH6A 2PO4A 4WP9A 4K4XA 5DDPC 1GH8A 1WNEA 1RAHB 2AWZA 3TANA 3EGZA 2B4UA 4ZVGA 5DLGA 5KT7A 3D3CJ 1S1UA 3GIKA 5IT4A 4DFKA 4AXJA 2HAIA 1M5HA 2DNMA 3RUBL 1FVQA 4QWBA 3BS9A 4E98A 1Q16B 2E9RX 5JVHQ 2ZM6F 5E3PA 3WDOA 1IXKA 1JLGB 3TAPA 1Q79A 1K47A 1KQGB 2FHKA 2UUAF 2NUHA 4F7VA 3GJSB 4NRUA 4FF1A 3QIPA 1Z2ZA 4HTJA 1YGYA 3Q8VA 2H65B 3SMZA 4CLWA 4KGKA 4CTAB 2YNIA 5M2UA 1N5QA 5KFTA 4ZPWR 1MWZA 4H4MB 3GV5B 1IBKF 1XR6A 2RNEA 5JVGQ 1NDPA 2MEWA 1Q82T 5CYMA 4ETXA 1RYSA 1K0TA 1JX4A 2GVZA 3O44A 4JI5J 3LAKA 2C3UA 4LBHA 5D3GA 3EVOA 1DTTA 4DG1A 1KQSR 3FMBA 4CLPA 5DM6Q 2XSJA 1FRHA 3HZGA 3MCSA 2JH3A 2HQFA 2LEAA 4CIOA 1V6HA 1NK6A 4PXEA 1C1BB 5IWAF 5CYQA 2D69A 2W9BB 3IS9A 3U27A 1Y3JA 3VAKA 3NCRA 3M6VA 2NQPA 3U1MA 4DBQA 3DGVA 3OFEA 3TEGA 3PW7A 2H9ZA 3BSAA 3PM9A 1U49A 3CDBA 1EHWA 4FVMA 4HHHA 2EC2A 4R8UA 2RVJA 1TL7B 3EZOA 3F41A 4NLSA 2QLFB 4PEOA 4C97A 4CT8A 2Z4PA 3KLGA 1YWXA 2CQDA 2GO8A 2ZBCA 3TZWA 1S1TB 3QLHA 5M2PA 2W8KA 4QU6A 5LMUJ 1A7GE 1VBKA 2CNLB 3AJ2A 3JQJA 3K89A 3JSMB 1IKWB 2CADA 4WK1A 3R2DJ 2A18A 1K73T 3QWUA 4NYOA 1GEHA 2BXJA 2AF6A 4NCAA 2V6AA 1RKIA 1KONA 1LEOA 2RB7A 1LWCA 3N0VA 2BANB 1RBAA 2DNLA 3UI3A 3RBEA 2PMHA 3D67A 3OQ2A 2MZRA 2B6AB 2AGQA 2BM1A 1EQ0A 4OHZA 2W1BA 4AYBD 1EZZB 4A47A 1RWMB 2BEFA 3IA0A 3QSIA 1OIAA 3AD9C 2MJUA 1KP6A 5ETLA 5HBMA 1CJUA 5KFKA 3MFHA 3AB2B 2MJNA 1TFWA 4FS2A 1X5TA 3KHGA 4IOAQ 2VZ9A 1VK3A 5BJRA 4OYWA 3ZTSA 2NZCA 3PRVA 1MU2A 4YN3B 5C42B 1LOUA 1M0SA 4DR6J 1S6PA 1RAAB 5D78A 1N32F 4ED1A 2EBGA 2U1AA 1RT7B 2XY6A 1QVGR 1YQHA 4Q45A 2LQ9A 1EP4A 2CQIA 3UN2A 4CNZA 1G7CB 4QQBA 4KR0B 1WG5A 4YMEA 4J9LA 2DNKA 1TL5A 3HSGA 1HW8A 1YRXA 2FGOA 2CPIA 1BQXA 3H42A 1JK9B 3MI7X 5KOXA 3PKYA 1R8CA 2KXHA 3QIPB 4FBUA 1RT2A 3HSJA 2ZH9A 1PGZA 3SYZA 4F67A 1FXLA 3OTEA 3GR0A 4FNIA 2JL9A 4IH7A 4CDIA 1SJ3P 1CC8A 1UPPA 2WOMB 2XZDB 4WU2A 3BF4A 4FXWA 2R7TA 1XBWA 2HNYA 1VBXA 2QFJA 1PAEX 3P96A 3O6QA 3IBFB 1S59A 4CLLA 4AL5A 1RAJA 5I42B 1S6QA 2Z57B 5HVGA 3MTJA 4S0MA 1HR0J 2IRUA 4J9VA 5HANA 1J5EF 3IR7B 4DV0F 4LVOP 4ID5A 3CULA 3H25A 2DJWA 1Y5IB 1QAXA 4QIGA 2XMUA 3D9BA 2D1CA 3PX0A 4PWDA 4PG8A 1S76D 1FE4A 2AIRB 2KVQE 2YNFA 4IOCQ 3TNVA 3W65A 4NLVA 3KLVA 2RHSB 3KG0A 1MN7A 2YTCA 3NKYA 2QYCA 5ETPA 3LP1B 4KIAA 3HI9A 2QE5A 2FJBB 2HQDA 2XCPA 4YHHF 4M95A 2R7VA 1APSA 2CIMA 4DL7A 1WG4A 2G2YA 4TY9A 3F44A 2D7SA 1NK8A 2H5EA 2V8VA 3SI8A 2KJVA 4QPXA 3OXFA 3OSNA 2QSFA 1MNEA 1N5SA 4UUXA 1RHJB 1B64A 5KG3A 3VF0B 4NZ6A 3RRKA 3KDNA 4Q8EA 1GTHA 1TMJA 2CYYA 4EBCA 1U6BA 3QAEA 5C42A 5GMKa 3QJLA 3VALA 2VD3A 1RU2A
chains in the Genus database with same CATH topology
2HGMA 2V8GA 3OBIA 2MY7A 1HWUA 4TYBA 3J7ZT 3CGIA 2J7WA 1S48A 4ECXA 2XSFA 4TQRA 4OI3A 4C8YA 2CZ4A 2FJWA 4U67Q 5GVQA 4EWTA 2AW0A 3CCJS 3QGPA 4G3IA 2BJEA 4CO2A 5EDWA 2QT7A 3EYZA 1WWHA 1QY7A 2XHWA 3GYXB 4C98A 5KFWA 1JLBA 2BDPA 3P49B 3BGUA 5HP1A 2UXCF 3DYAA 2VG6A 5T7LA 3DM2A 2OPQB 2IJFA 4NLXA 4A4JA 1QSSA 2CQPA 5IFMA 2YX4A 4DPOA 2YNIB 3H98A 5L1KA 2O5DA 1S10A 2WCXA 1ZZFA 2YKPA 5KFFA 1UA1A 2JEJA 3I4HX 2F9JA 2DCUB 2X51A 3M8PA 3CMAS 4OHXA 2RJZA 2B7BB 1EP4B 2HRUA 5KFUA 2LYVA 5L1JA 3GB0A 3FJ2A 3BDPA 5G0RB 2BOPA 1PSDA 2VQEF 4ZP9A 3NMRA 1U26A 2XWXA 1YITS 4WFZA 3VAJA 1UFLA 2M7SA 5U47A 2W25A 5D4NA 3OUYA 1S6UA 4GO7X 3GIMA 3R5CA 2DNHA 2QIFA 4O3RA 4OL8A 2UVWA 4Q7AA 4AFFA 2XWYA 4DR6F 4XAKA 4QYRA 4TXSA 1NK9A 1XERA 4OI0A 1KOOA 1NEEA 4G6VB 4WYLA 2ADBA 5F8LA 3HP6A 1YJTA 4QIWD 2R7WA 2R7OA 4MIAA 1GNKA 4NA1A 4LT6A 2OPRA 1FO1A 1VMBA 3DN9A 2EG1A 2POKA 4ECQA 1NJYA 1D8YA 4OHWA 1M90T 1K8AT 1FRMA 2MSTA 3TX8A 4HH1A 3PJXA 2QMXA 4NZ0A 2VH7A 4USIA 4PUOA 2X1AA 4BS2A 2KFYA 2Z8QA 4FZVA 4XK8C 3TUJC 3KLEB 1HR0F 2FHMA 3OL8A 2FC8A 3GYNA 3W2VA 2WRMA 3MDFA 5LJ3Y 1D9AA 4NLOA 5E0OA 3BN4A 2L9DA 3DYAB 2HRYA 5F9LA 3CTRA 3HLUA 4ZCKA 1ELOA 3M1VA 1UVNA 3ZFVA 3U1LA 4MKBA 3K0JA 2C2EA 2GFFA 1NK4A 1WHXA 3NBPA 1WEXA 1ZPVA 4OX6A 2ZH5A 2HGLA 3C2PA 2DNQA 4QWDA 5E2QA 2OPPB 4DSJA 4WJBA 5L9XA 3PO4A 4Z37A 1KNZA 4I68A 3TOQA 1TKZB 2IBKA 2Z0GA 3VTIA 3HF5A 2WBMA 1VI7A 3HHDA 2M3DA 3OPKA 4HLBA 5CZXA 1NH7A 2OKQA 2V2KA 1ROFA 2YKNA 4H4OA 4NLYA 2KT5A 5FDLB 4C8KA 4NLPA 1D9FA 4WKYA 5CYMB 2HPUA 4OI1A 2EW9A 5K8MA 2VB6A 2MQMA 4M94A 1WD6A 1MSWD 5KG1A 2GMLA 2EKYA 1HBMB 1WI8A 2DNPA 4DX8H 4WU3A 4CT9A 3V5RA 1Q81T 3NMAA 5T14A 2LA6A 3G9CA 3PW5A 1X9SA 1N36F 2E5LF 2PDAA 5BYQA 5FJ4A 5KFOA 4C11A 2C42A 2DD8S 3LP1A 3THPA 1HQEA 3M2RA 1M5VC 2IM1A 1TUVA 3G96A 3M9NB 4DDFA 4J9NA 2MXYA 5KTQA 1RT4B 4I7FB 2IVFB 4K5SA 3MEGA 2V4JA 3MOJB 3P5TL 1FRXA 3IR5B 2COLA 4N8NA 4X4RA 1DBDA 2BYCA 3OXLA 3V6DA 4DN9A 5A8KB 2ZH4A 3D54A 1JNRB 4HTIA 4CO5A 1LW0A 2YNGA 3AQOA 2MZJA 4FPRA 5B0FA 4KV8A 3GIIA 2R8HA 4Q2LA 2VFRA 2JLFA 5L8RC 5DDQC 2RILA 4OI6A 2LKZA 4RW8A 4YY3F 4YB1P 1UA0A 1D9DA 1GX5A 4C3LA 1JLAB 4ZP7A 2RQCA 1IN0A 3SCKE 1BQNA 2DVIA 2FJEB 5EHHA 4X4TA 1XK8A 4RNNA 3QGHA 2WTFA 2A1BA 4TN2A 3DXBA 2DTJA 5E3CA 3FSXA 3S6EA 4PPZA 3P6YC 1AW0A 5F8JA 3K2YA 4M5DA 3Q0AA 2CQ1A 2R7SA 5FDLA 4EYHB 5KG2A 1IR0A 1X9MA 3LALA 1SJFA 7FDRA 2DNNA 3EXYA 1BWEA 4K4WA 3UCGA 5L38A 5KFHA 3TUIC 3E01A 3M8QB 3SFUA 4I2QB 3M1VB 2OTLS 5CYQB 2X1FA 1UAWA 2UVRA 2XMTA 1L3KA 2I5JB 1TL3A 2ROPA 4ZP6A 4BC7A 1S6OA 1AROP 4H4OB 3ZZOA 3F73A 3A1YG 3FZBA 5A6PA 3RAQA 4CCHA 1QLNA 2FPHX 5CXTA 4C7QA 3D0HE 3RRHA 1KFSA 1Q7YT 1SKWA 3MF5A 2GO9A 4B9LA 1CSJA 2XGQA 2HHTA 3SCIE 2MKJA 2NSCA 4F4YA 3NAIA 1FRJA 2YNFB 3M2RB 3IWLA 2W4DA 5DG7A 1FK9A 3QO9B 3V4IA 4DSFA 2E9ZA 4O0IA 1K1QA 2HZCA 3ZZ0A 4IG0A 3BR9A 4O3SA 1FDAA 3K5OA 5A8KA 4B9MA 2F3JA 1QM9A 1HQEB 1ZAWA 4FS1A 3ISNC 4GO5X 3MAQA 5L1IA 2BE2A 4RZRA 2ZOMA 4MK9A 3N28A 3T6BA 1JLQA 3EX7B 1UJ4A 4Y2KA 4MFBB 1TKXB 1RKJA 1RT1A 4ILRA 3KLHB 4J9OA 3D1OA 3EGWB 1FEHA 5BYSA 5C25B 2N3LA 3FNNA 4ALZA 3MOZA 4EGLA 3C66A 2WOMA 1NKEA 2VPYB 2OPSB 4MAKA 3HHEA 4JI1F 4J37A 4PXCA 1N5YA 2EK1A 3DOKB 3QGGA 4WZQA 4ZPBA 4F26A 1FRKA 4CQ1A 3G6XA 1N0VC 4GC7A 4WCEQ 3EXCX 3UE2A 4O44A 2CQ0A 4RW7B 5CZVA 1X0PA 1SL2A 1HL6A 2YKQA 3TRGA 3SSQA 2O66A 4HDHA 3N79A 1X4AA 4NCGA 3DLKA 5I4MA 2VBYA 3OJUA 2KZMA 3TA1A 1HHSA 2IM3A 2I2YA 3CCMS 3CCSS 3PEHA 2X1BA 4B17A 4PQUB 2WSCC 3PIPQ 2D3OR 1XC9A 4A8MP 2B3TB 2K3KA 3MPVA 3DOLA 4J9SA 2VFTA 5AXNA 4OHYA 1Y00A 4YR0A 4C0OC 3M8QA 1NHVA 4CO3A 1BD6A 1S0MA 1KLMA 4QIVA 5HLFB 4WYWA 2MPUA 3OVSA 3ISZA 3X1LB 3BREA 4JV0A 5MLCV 3JYTB 3Q24A 1NK0A 4IYQA 3RYLA 1TK8A 2B56A 1TKDA 3N6MA 4NYZA 3V4IB 2V4JB 4ES1A 4UY85 4K4YA 1KOHA 1S79A 5K14B 1UMJA 2RF2B 1XTZA 2IM0A 1HBUA 3K8WA 1N54B 3LF0A 4ZP8A 4AL7A 3UD3P 1GTEA 4JI7F 2W24A 2WW8A 5F8IA 5EX3A 2HVIA 3TR5A 2RUGA 5LT5A 3MM6A 4ZLPA 1I6JA 3MPWA 1SBRA 4A8QA 3GV8B 2E7WA 4IG3A 1VQNS 1Y5LB 2PT0A 1JLGA 5T7LB 5K5MA 2ZH8A 2YWFA 3KOAA 2RIJA 2IYGA 1VQLS 1V3RA 3D0IE 2E5IA 4NZ7A 4DFMA 3T3FA 3M6XA 3GMGA 1FD8A 4KE5A 4KO0A 2JRSA 1YSJA 3CCWA 2ZH3A 4DF4A 1N48A 5K8OA 4ZCLA 4JI8F 3M30A 2A10A 4QR0A 4ES2A 2R9LA 4KSEB 4BBYA 2A3JA 1H3DA 2L08A 3EPGA 3CCQS 2FVQA 1X4BA 2Q43A 1S1WA 1MMNA 4K2XA 2HMIA 1U47A 1FEEA 5EUHA 1ZH5A 2D9OA 2DH8A 3IWXA 2NR0A 2G13A 4NCGB 5F0UA 3VZIA 4EZ6A 3DMJB 4FN5A 5THWA 4U7UK 4DHVA 1IKVA 4DS4A 2OTJS 1O5JA 3GE9A 1VQKS 5H1SV 4LSLA 5KAKA 2V9WA 4GKJF 2ADCA 3MM8A 1QJHA 4LIRA 4O3QA 1FXDA 1NU4A 2CJQA 4PKDB 1LW2B 5KFNA 1U7LA 1U25A 4NLWA 5D4OA 3JYTA 2VBWA 3KLGB 2UUWA 4PR6A 3DLHA 1KLMB 2UXDF 2IVMA 3OFGA 3JAMY 3OR1B 3GIJA 4ED8A 4C0BA 4QR2A 2Q66A 1HBNB 2D3ZA 1QUPA 1YIJS 3OTBA 1JNZB 2DR9A 1O51A 3I31A 1HD0A 4UW2A 3L3CA 2V4QA 1FVSA 4OZLA 1H2TZ 1MROA 3K8VA 4IO1A 2HHQA 4G1QB 3T5HA 3OUYB 3TO8A 4F4KA 2KXFA 2YVSA 2DPJA 2KFZA 4ECWA 3BJYA 3CJ4A 2UXBF 5J2PA 1OPIA 4HI1A 2CPDA 4WF9Q 2O67A 1Y7PA 3MUTP 4ECSA 1T05A 1QAJA 2DBBA 4QCLA 1F5AA 1IJEB 1R31A 3TUZC 3H2VE 2CVEA 4K4TA 2E5GA 3PEJA 3UDLA 1VC6A 1KVIA 4WFNQ 3LO3A 1TP7A 3MTKA 2HNDB 2P6TA 5D77A 1DLOB 3MM7B 3LP2B 1SI9A 2MZ1A 3M6WA 1TKZA 3TQ1A 3OR2A 2IRYA 2YWHA 4EZ9A 2JZ5A 3JTOA 3LGMA 1RT7A 2LVWA 3L95X 4IQMA 4Q43A 4JV2A 3DRRB 1B0TA 1VRTA 1IUJA 4IO9Q 2IYIA 5E5NA 2MHNA 2IC3B 4OJ3A 2Y0SD 3RU0A 2HHXA 3ZC4A 3J7YI 1T02A 2QA4S 2WK4A 4NL5A 5CA5A 1IKVB 2MKCA 5L1LA 2NS1B 3KWMA 3M30B 2DIUA 3ITHB 1FDNA 3M4XA 3PY8A 1X5PA 3DGPA 3MMJA 4RUHA 2QEXS 2VBXA 3IBWA 4DV6F 1KVJA 1RI7A 1IJFB 5D8HB 4PPDA 1QE1B 1R89A 2GMJA 4DSEA 2ABYA 4PRFA 4A8WA 4WXWA 3QJJA 3KTQA 1U24A 2DGXA 1VFJA 1RTHB 3PRBA 5KT5A 2BV3A 3VAHA 4AQYF 3G8TA 4RBUA 3I5CA 3NCQA 1Z4UA 3H20A 3OJSA 2IA0A 3KHRA 3CD0A 3FGVA 2FLOA 1KHVA 2V8HA 1T3OA 1KQFB 2KXNB 3DU5A 3J81Y 3QMQA 2XO7A 1QAIA 3PNIA 5HQ8A 2XEXA 4FVCA 5B08A 4Q8FA 4B3MF 1NH8A 3DDNA 1VQPS 2GHVC 1UVKA 1TL1A 4AXIA 2KHCA 3N5FA 1MMLA 2BQRA 4ETZA 3NNHA 4H4KC 2J76E 2AYMA 2HNZB 3PR5B 2XNRA 3VAGA 2OP5A 4YQWA 4LF6F 3QGIA 4K5RA 2M52A 1X9WA 2KRRA 1KC8T 2XBPA 2HNDA 2VC0A 2BRKA 2YWEA 1HNIB 3DLEB 5KFEA 4V19X 3G6YA 3K7RA 3OVAA 5IM0A 1RDRA 4X65F 2ASJA 3D1QA 1OPZA 2R8KA 5MAOA 1JXLA 2ZJQQ 4DFJA 4D3GA 3IS9B 2XY7A 2XMVA 3CDAA 2DGSA 5BYRA 3I87A 4DV4F 2CPYA 3PRDA 2DIVA 4KRWA 4UY8T 4DL6A 1RTIA 3OXGA 3OFHA 4ICLB 5CCMA 2MSSA 2FTRA 3RB4A 3BQ0A 2XB2D 5IQQA 4RW4B 4DEZA 4RUCA 4TLRA 4RWWA 4LQ9A 4RKUC 4B9NA 4ILLA 1C4AA 2UUTA 4DL0C 3OL6A 4DV7F 3L7OA 4IDKA 1U1OA 2CPHA 1J5OB 1IKYB 2PE8A 2HVHA 1ZTWA 1WHYA 2A2DA 3KHLA 2UVUA 2BA9A 1KTVA 2Q1LA 1FJ7A 3D28A 3TA0A 4ZHRA 5DGBA 3R3TA 4FYDA 1X4GA 3POTB 3OW2R 2W7AA 5T41A 4CO4A 4FF2A 1FKPA 2D9PA 2FUG9 4Y65A 4QW9A 5J1EA 3RTVA 4H4KA 1H98A 4F50A 1WG1A 3NNCA 3RR8A 1S6PB 3C6TA 2FY1A 4IQXA 1TL1B 3KNGA 4EO6A 4HYKA 4F3QA 2G1DA 5KT2A 2ZHBA 5A2QY 1WF1A 5C25A 3KK2B 2N3OA 1X4CA 2JSXA 2RF2A 3KNAA 2AGPA 3H8YA 1WELA 1UETA 3MGJA 3FEZA 1U6FA 4QU7A 1U6ZA 3IRWP 1FCAA 5AXMA 2BANA 2OFHX 3DI6B 2JEGA 1K9MT 4K50A 4OV1A 1DLOA 4ZDNA 3BN7A 1FXRA 2WSFC 3TVZA 2XLIA 2WONA 5JJBA 5AE3A 2ASLA 2K7JA 3OR2B 4ED6A 2OH2A 2ILYA 1U4BA 1V3SA 2FLLA 2V4RA 2GNKA 4TY8A 3NLCA