3KG1A

Crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
ADEVTFVNRFTVHGAPAEFESVFARTAAFFARQPGFVRHTLLRERDKDNSYVAIAVWTDHDAFRRALAQPGFLPHATALRALSTSEHGLFTARQTLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SnoaB
publication title Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism
pubmed doi rcsb
source organism Streptomyces nogalater
molecule tags Oxidoreductase
total genus 26
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature ec 1.13.12.22: Deoxynogalonate monooxygenase.
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kg1A00
2LQ9A 2AJ0A 1TL5A 2PGCA 2XMMA 3FMBA 1U7LA 2GCFA 2W4DA 1KVIA 2KT3A 1YJTA 3GZ7A 1N5SA 1YG0A 1YJRA 2GV1A 3LGNA 4Y2KA 3UDCA 1MWYA 2N4CA 3HX9A 3FRYA 1ULRA 2W4PA 3WDOA 2VV5A 3KNGA 2AJ1A 3KKFA 3CJKB 3E8OA 3HHLD 2ROPA 1QUPA 1GXTA 1X0PA 2GFFA 1VQSA 2BUNA 2RU9A 1YRXA 3BM7A 3BR8A 3HHLA 4YDXA 3HHLB 1Y0HA 2OAUA 2Q3PA 2XMVA 2OMOA 3HFKA 1FEEA 5B0BA 4EFAC 2GGPB 4Y2MA 2HIQA 1FE4A 4DPOA 4YEAA 5B0GA 1Q53A 2EW9A 4NL5A 2FIUA 1AW0A 1GXUA 4A47A 4HI2A 3FGVA 5A6PA 1URRA 4QOTA 4ZA1A 2BJDA 5KAKA 3IWXA 1RJJA 2ACYA 2JDJA 1Y3KA 2W4CA 2XMKA 1X7VA 2BJEA 2OFHX 5B0DA 3K7RA 1IUJA 2LXFA 1S6OA 2K1RA 5B0FA 1YJVA 4ZOSA 2HLTA 4FNHA 2QLWA 1Y9OA 4OJGA 4Y2IA 1AFIA 2XMWA 1TUVA 5F0WA 2GA7A 1Q4RA 4A48A 1CC7A 1WD6A 2ASYA 1Q8BA 1Y3JA 2KKHA 3LGMA 3QMQA 5B0EA 3DCAA 4OJHA 1XBWA 1OPZA 3T9NA 2QIFA 1JK9B 1FVQA 4OJ1A 2HFOA 1LQ9A 1N5VA 2KYZA 2ZDOA 4U9RA 5A6WA 2OKQA 2IFXA 3BGUA 3KG0A 1K0VA 1P8GA 1TL4A 1JWWA 3TRGA 4F67A 2N7YA 5B0AA 4A4JA 1W2IA 1N5QA 1MWZA 3BN7A 2ROGA 2FTRA 2XMTA 3HF5A 4A46A 4DN9A 2IYGA 1APSA 4HL9A 3TOQA 3I9ZA 3HDSA 5T7LA 1SB6A 1OQ3A 2OFGX 5T7LB 1VQYA 2K1RB 2FHMA 1P6TA 2XMJA 4HI1A 2KT2A 2N4DA 1FE0A 1SQEA 5B0CA 2PD1A 1YJUA 1FD8A 1V3ZA 3KG1A 4HH0A 1CPZA 2HLUA 3F44A 1S6UA 4HH1A 5F0UA 4Q2LA 2QLXA 2RMLA 4NPOA 1AFJA 1X8DA 1FVSA 3QGPA 2QYCA 1CC8A 2GO8A 5B09A 2K2PA 2LQBA 1TZ0A 2FB0A 2BBEA 4FNIA 1Q8LA 2HFNA 5K9FA 1FESA 3BB5A 2L3MA 1TR0A 2LDIA 2IYIA 2RSQA 3CJKA 2CRLA 2K7JA 3TNVA 3HHLC 2VH7A 4Q2MA 1SI9A 2ZDPA 4OIXA 1KQKA 1OQ6A 2OP5A 2ROEA 2AW0A 2XMUA 4OJ3A 3VTIA 1KVJA 2OD6A 2K7KA 3MCSA 2BYCA 3MZIA 1OSDA 2OD4A 3BF4A 3IWLA 4DL0C 2GGPA 2AP6A 1N5TA 3LO3A 5B08A 5IXUA 2RILA 1R6YA 2G9OA 2HQIA 3BDEA 3DXSX
chains in the Genus database with same CATH superfamily
1S12A 1BMQB 1YLXA 4Y2KA 3UR0A 2LQJA 4KBIA 4DR1J 4NXNJ 1HBUB 3CO9A 2IVFB 4OHZA 3RAQA 1Y0HA 2V6AA 3R9LA 3G6XA 2V8VA 1HLWA 3AB4B 2D1CA 2R8IA 3HD2A 4B17A 3UE2A 2KB2A 5A2QY 3IWNC 2ZWPA 4U9RA 2HHUA 3BGUA 3IO1A 3QGHA 5KFNA 4R8UB 3AJDA 3PCOB 1GK8A 2C3OA 4FXDA 2IDLA 2QA4S 1LWCB 4WE1B 2NREA 1C1BB 2QLXA 2MGZA 4DR5F 4LUBA 5IT4A 1FFGB 3K8VA 4OIXA 4DL3A 2HHHF 2BM0A 2WW4A 3J7Z5 3FSXA 3GIRA 1VQKS 5SZTA 2XMMA 2XMAA 2F9DA 2KRBA 3L3CA 1SXLA 2UUBF 1SQGA 5L9XA 4YDXA 3OTBA 5GAHU 1NJYA 1EARA 1HIYA 4DV3J 2BABA 4C4WA 2F4VF 4EGLA 1NUEA 5IM0B 4QW8A 2GHWA 2OTJS 3IR6B 4DSIA 5F0WA 3OR1A 3JAMY 1OY6A 3ICLA 2CPXA 4HDHA 2IIHA 5DZ7A 1TMMA 4DV5J 3KJVA 3DGVA 4KFBA 4CDIA 1X9SA 1HARA 1KLNA 5KOXA 1CC8A 5DJBA 3OLBA 1SJFA 1IM4A 2OJ3A 3V6DB 1IBMJ 3E01A 3TNVA 1U6BA 4L72B 3L7OA 1TL7B 2ZE2A 1FKAF 3HT0A 3H5SA 1NXIA 2W2OP 5IXUA 2XULA 3RZAA 3PO4A 3GONA 4C3MA 3ZTQA 1XMQF 1TL5A 5EX0A 3KOAA 3SI8A 1CJVA 4OYBA 3GR1A 4CLLA 1TL3B 2I5JA 3KLIB 4QIEA 4OI1A 3BDPA 3AFGA 1NKCA 1D9DA 1DTTB 1H98A 5C42A 3UFCX 2EW9A 2FIUA 3GB0A 1PKUA 4YY3F 3IFEA 2M4MA 3DN9A 1C2PA 1Q8BA 5B0EA 4PG8A 2RAQA 1RXOB 3OXLA 2WZ1A 2M70A 3OSNA 3R5BA 2JOQA 4F67A 3RAXA 3I9ZA 2G13A 5HBMA 3W66A 1CJTA 1RU2A 1IR1A 2PO4A 3PEJA 1TQLA 2GVDA 2P9EA 3T41A 2P9GA 4ZP8A 5JXSA 3V6JA 4DX8H 4DCPB 1JNZB 5DQGA 1GTEA 5C5JA 1RTZA 4YB7A 1FNOA 3CCSS 4B3TJ 2H9ZA 1NSKL 1NH8A 3M8WA 4FYWB 1RBAA 4QIFA 1HR0F 2J0XA 1DHMA 2O3DA 4J91A 4TVAB 2BJ1A 3TVYA 2GV1A 1C1CA 3BGRB 1FRMA 4UOFA 3CMES 1A0OB 1RYSA 1U47A 4DSKA 2DVIA 1Q0NA 4DG1B 5D3GA 2RH3A 1Q82T 4KY3A 2JVRA 3CDEA 3K5LA 2DH9A 3JSMB 1B99A 3UW1A 4PXDA 4MJKA 4DV7J 2R7OA 3HD1A 3TAMB 4Z7CA 4F0HA 4G1QB 4DCJB 3B8HA 1NMEB 3ET6B 2NPIA 4HVZA 1Q5YA 3H4DA 3U02A 3FZ2A 1SQFA 4XTTA 3M6WA 2OPPB 2HRUA 1M5PC 3T6BA 4DPUA 5L46A 3V2UC 4FVMA 2VUGA 3PIOQ 2DGQA 3MAHA 2CPIA 4DEZA 3TEHB 4F2RA 4DPTA 1Q79A 2L9DA 2CG4A 1FTCA 3D4JA 1VQ4S 4PPZA 4RW4A 1SBRA 1WORA 1MWQA 1WWHA 5H9EJ 4GVLA 5MAOA 1F3VA 3G96A 2UUWA 1O51A 2ZM6F 1S77D 3LAKA 5J2QA 1B70B 2W4DA 1Q7YT 4NA1A 3RR7A 2HNDA 1UEVA 2OH2A 4JBCA 2XEXA 4DL7A 3JQKA 3CC7S 1BQMB 3FK4A 2QSFA 3S7RA 3R7NB 3D66A 3IWXA 4DUYF 1MROA 1KFDA 1UWAA 5GADU 1ICEB 3AD9C 3DLGA 1RT7A 1K47A 3DOMB 3HSZA 3MCNA 1RAAB 4M5HA 2Z4PA 2R7QA 3QSYB 1TL1B 4FZVA 4USIA 3K5MA 1PAEX 2E7WA 2G4BA 4LFCF 3SV3A 1WC0A 5KFCA 2CWXA 3EE3A 3ZNUA 2RUSA 2QG9B 4CO2A 4KSEB 4LFBF 3BF4A 3KLEA 3EMTA 5F8LA 3DU5A 3FMBA 5K8NA 1K8AT 3IBCB 2RQCA 3THTA 1VS3A 2CDQA 2AJ1A 2FD2A 3CDBA 1VQSA 1XNRJ 3DRRA 3G82A 4IYQA 1Q86T 4NI2A 4P7VA 3VAMA 2XYGB 1FXLA 4ATNA 4ZOSA 1MLAA 5L39A 2YBVA 2XHCA 1WKLA 2RS8A 1NU4A 4U7CA 4NRTA 4NMLA 3V5RA 2EC0A 4QR2A 1SL2A 2NSBA 2DR7A 3W62A 3DRSB 3MURP 3GG0A 3ZZPA 4LQ3A 5CYQB 1NJXA 2AT1B 1R31A 1V5IB 4MFBB 2G1HA 4JV5F 4B08A 5HAOA 4GKJJ 3D6FB 5HQLA 3G86A 4QWEA 2AYGA 1EIYB 1JLQA 1QJHA 4QIVA 3HHKA 1WC3A 4K4UA 1RTHB 2NR0A 2KL8A 3J7A1 3J80Y 5AXLA 2M9KA 2QMXA 2DIVA 3PEHA 3TARA 2JX2A 3I0RB 3HFKA 1FEEA 3NOGA 1SC6A 4DF4A 2IPOB 1RT4B 2R8GA 1RHKB 1NHVA 1HQEA 3BBFA 4HR2A 4QW9A 4IOBA 3U1NA 5KT4A 4TY9A 2QEXS 1ZPVA 1N56A 1TAQA 2DNHA 1U8WA 4RW8B 4DZDA 4K4VA 3K2YA 1ZA2B 2WONB 2HFOA 1WOOA 4K4WA 4L76A 1HWLA 2FY1A 1RT2A 1JLFB 4CO3A 5CD4H 3CMQA 4QIWD 2YNHB 1N8RT 4PUOB 2UUAF 2IBOA 4UT4A 2JEGA 3BPSP 3OFEA 3N4WA 5EWFA 1N54B 4L73A 3FBCA 2UUTA 3DLLQ 1S1UB 3WQPA 2OD4A 3D9BA 1XN9A 5KG6A 1BQXA 1N0VC 4KV8A 1FWPA 4ZHRA 2HBQB 3DXBA 1U1QA 1FDNA 1VQ5S 3U1MA 1FKPB 4UQGA 4GKKF 2FZKB 2GMHA 5ADZA 4CWBA 4LF8J 2BE9B 1X4FA 2WCXA 3KHRA 3TX8A 2DTJA 2V68A 3MUMP 3I0SA 1Z4UA 2ZBQA 3TO8A 4ZLLA 3M2RB 2KI2A 5G0RB 1SC1B 1UETA 2A6OA 2R42A 3ITHA 3NBPB 3GFZA 3NCRA 2LA6A 4KO0A 1JKHA 4OI0A 2G0CA 3LP2B 3DYAB 1RE1B 2VFRA 5HJXA 1RAFB 2DHHA 1EQMA 1EZZB 1XNQJ 1BUXA 2W9BB 4MIBA 1SIWB 3QLHB 3CJQA 2ZJPQ 1VC5A 2E5IA 3UWTA 3QZ7A 1MNEA 3ENQA 5E7OB 3I56S 3UN3A 2HHVA 4FBTA 1NJZA 2V8PA 2BQRA 3BR9A 3QAUA 3HCXA 2MKKA 1PCAA 3H7HB 4DXLA 2B4VA 2DNZA 1LW2B 2Z2ZA 1T05A 4LREA 4X4PA 4OYWA 2ATCB 3P4UB 4LBIA 4KKOB 1XR6A 4V19X 3KK2A 3G71S 2HHQA 1ZAVA 4KT0C 4IG0B 1KONA 4X4SA 3IRWP 4ZCIA 4CYUA 3MOJB 1VMBA 1UKUA 3W1YC 1U49A 1DBDA 3H5UA 3W7BA 2KM8B 4ZVSB 1T9YA 3MMCA 3QT5A 1AB8A 5KT7A 2GZOA 2MKHA 3HLUA 4KGVB 3TVZA 4HHUA 3MOZA 3CCJS 1VI7A 3KWMA 2LXIA 2YWHA 3UCGA 2XMJA 2NZ4A 3FFIA 9ATCB 4WBFA 3VGUA 4Z7YA 1C0TB 3LAMA 4H4KC 3FSYA 1JJHA 3S6EA 2AYMA 2Z2LA 2MQOA 2HQCA 5F8GA 3MUTP 2RDDA 1JLCB 2K7JA 4DN0A 5LMNJ 4C11B 4MYTA 2BR0A 1N4LA 4IRDA 5L8RC 4AQYJ 1UEUA 2DBBA 1YG0A 4K2JA 4TYAA 4ZVTB 5HVGA 3H98A 1Y11A 5KFOA 1S7IA 4ZLNA 4UOGA 4Q8EA 2VBWA 1WDDA 3IXQA 4LSNB 1PBUA 5D0HA 2GX8A 5KFBA 2BJDA 3BQ1A 3P49B 3KJNB 5D78A 5LMUJ 5AT1B 4JI8J 4PKDB 4OX9J 2R2UA 1R0CB 2V4QA 1CULA 2DR6A 3N9UC 2A0FB 3VF0B 2PA8D 1IBLJ 2BZ2A 1WC5A 4LSLA 5IQ6A 1FX4A 1CQMA 5J1NA 3D54A 3SV4A 2W24A 4A8FA 2H1YA 4CH1A 2VQEF 3HFZB 2OPQA 3W2WA 2DPJA 4OV1A 5KFKA 4TY8B 3MM6A 4N77A 4KJIA 1OWXA 2LDYA 3BKTA 2YX1A 4Q2MA 4YHHJ 1JLBA 1OQ6A 4IR9A 2YWFA 3LP1A 2IRYA 1JX4A 4X2BA 3R6GB 1NSPA 3BSAA 5CD4A 1RZMA 2L41A 1YJTA 5KFYA 1EX8A 1S1XB 2V5HG 1RI7A 1J5EF 3TUJC 2R8JA 3IA0A 5E41A 3J81Y 1RTIB 2ALZA 1Z2ZA 5GMEA 1U2RA 3M30B 2MXYA 4HTJA 4OL8A 1E6VB 1U0SA 2XM3A 4DPYA 4J90A 5I3UA 2AYEA 4HACA 2GIFA 4KHPJ 2YNFB 4ZMMA 4XK8C 3W5XA 2NZCA 3RB0A 8ATCB 1RB0A 1VQ8S 3MM8A 2BOAA 1REVB 4DV6F 1XMOJ 3PYFA 2VG5B 4ZVGA 2MKSA 3CC2S 1HNXF 3ZO7A 2DGXA 2P8IA 3KJFB 4LR9A 3M9OB 3SFUA 4Q2LA 2GJFA 3MM5A 5KFHA 4I2PA 4IRKA 1PJ7A 3KLFB 3CCES 3TW0A 2ROEA 3P6YC 2VBZA 2Q6BA 1RHQB 2D3ZA 5J1PA 2C2RA 3KK1A 5JVGQ 2HHXA 1U6FA 4N8NA 1UJ6A 4NCGA 1UVIA 4PPDA 1R8HA 1VISA 3HHLA 4FS1A 4ZS6A 4EMDA 4DSFA 2ZHAA 1M5SA 2L9WA 1NBEB 5IT9U 5HLFB 1ZBTA 3HI9A 1KRPA 2CXEA 2ZVSA 4EYHB 4NXMF 4DV4F 2QGFB 3WC2A 1UW9A 2XB2D 2OSQA 2FTRA 1LV5A 2DISA 2UUCF 2OPSA 1DQAA 1GTHA 4C2MA 1DAXA 5F41A 1CPZA 3F44A 2BACA 2COLA 4OYPA 1IJEB 3SQOP 2C2EA 3TZZA 3DRXA 4N41A 2NXUA 2GAGC 2L9NA 2POKA 3LA0A 3C6UB 3NS6A 4ITSA 1CG2A 2YKQA 2CUYA 3HFVA 3GSDA 2WSEC 3CUNA 2ZHBA 3TX0A 2J9DA 2C2ZB 2HS0A 1IR2A 3C6TA 1RJJA 3DOKA 4MK8A 3P3DA 1YZ6A 2OFHX 1RWMB 4U7UK 1NPKA 4JYAJ 2DO4A 2GIQA 3OR2A 3GV5B 3THVA 4U8VA 1Y3JA 4ALZA 3OTCA 4DUZJ 1N6QB 4DX7A 5GMDA 1K1QA 1IKYB 4ZPTR 1D8YA 2YVSA 2AKWB 3MEEA 1K1SA 3CEDA 4LFAF 2GC8A 2NUUG 1NPPA 4ZPDA 3CE8A 3POTB 2RQKA 4WJBA 4J9KA 1FJGJ 4AL5A 2D74B 2R3VA 1UA1A 3NGUA 1S10A 3UVJA 3AOAA 3FQLA 4OYXA 4GVBA 4C8ZA 3HVTA 1I94F 5E3PA 2YWGA 1HQ2A 3GJQB 2DHXA 3R5GA 1IWGA 3GR0A 4P75A 3ZZUA 2DNLA 1VQOS 3NAHA 2DB1A 4PXBA 2OEMA 4Y0FA 4D3GA 3FEZA 5J2MA 3IMQJ 2BKOA 1IKVA 3QMQA 3T1HJ 3TJ8A 2QLJB 3A3NB 1T9XA 5K14A 3I55S 3DLHA 3KG0A 1TUGB 2WSCC 2LA4A 4KR0B 4JI6F 2BJ8A 2KHDA 2OFGX 5K8OA 5J2NA 3D2WA 2XZDB 1YJ9S 1EP4A 2ZC3A 1NK4A 1ROFA 2B5JA 2IY5B 3GSIA 4QZVB 2DNYA 4FKYA 3R7SB 2LDIA 3PW5A 1UVKA 4YDDB 2Y0BB 4TYBA 1QLNA 4YMEA 2IHR1 2OELA 4DQRA 1NHUA 1BWEA 1RA6A 4ED7A 2MGZB 2RT3A 2HURA 1M5VC 4HKQA 3TUIC 4XDDA 2K3IA 1I5OB 4X4QA 4L74A 1J2VA 2IM2A 3KLHA 3OJUA 3J7YI 4O0IA 1URRA 4ES1A 2J6UA 5DDPC 2XGQA 1UL3A 2OEKA 2W7AA 3OVAA 2NXEA 3CCTA 4KTQA 3W9HA 1P8GA 2ROGA 2DNKA 2XMTA 1VLYA 3MMAA 2N7CA 2Q43A 1FJ7A 3OL8A 5F9LA 4LF6F 2WVEA 3OR1B 3C2PA 4KIAA 3PR5B 3M9NB 4IUFA 4E2FB 5THWA 2YNIA 2HKEA 2MDAA 3BBBA 4DS4A 1ZH5A 2J9CA 2YX4A 3KJVB 1U1PA 2QJ3A 4KFBB 4DFMA 3OT9A 3TA2A 4DUTA 5AJ3J 4C48A 1B7YB 1WKKA 2G9OA 4B3SF 1C4CA 3QGGA 3M8RA 1HNZF 1RYRA 5SUHA 2ZFHA 3O1LA 3KNGA 1LWFA 1JLGB 3E01B 1RHRB 4K0KJ 1X0PA 1X9WA 2ZE2B 1L3KA 3NMAA 4DR6J 4XIUA 4ECUA 3CCUS 4P7TA 1CJVB 4A8YA 2ZH2A 2ZH6A 3QSIA 2I5JB 1XEZA 2V4JA 5L9NA 1AYEA 1WELA 2F63A 3W64A 4ECQA 5C42B 1LQ9A 2DO0A 1K0VA 2GHPA 1EKSA 3GJSB 2GQQA 3SXLA 4B3MF 2LECA 2N4DA 4G6VB 1KOOA 4FF2A 1IQTA 2QYCA 4ZVUB 4RPFA 1TKDA 4AD6A 1HWJA 3LOUA 2BMBA 2XZTB 2M3DA 1HD1A 1HA1A 3AH6A 5HBMB 1FRJA 1CJTB 2DIUA 4AL7A 2DGUA 4YFUA 1VQ7S 4B02A 4NRUA 5HANA 4ICLA 1QAJA 2GMJA 4QBUA 2Y1IA 4ID5A 4B9VA 5KFFA 4KC5A 3SDEA 3MAQA 2HVIA 5EX3A 4CI0B 2IDEA 3IGNA 3OJSA 1RK8A 2Z30B 1TK0A 1FD2A 4LJMA 4WWSA 4TKTA 5D8HB 2PN6A 1C1CB 2FDNA 3DOLA 3UCZP 3WZ0A 1UWBA 3CJSA 5D3GB 4KGZB 2IRXA 5L1KA 3QO9A 3JQJA 1T94A 2NXCA 1AUSL 4IFVA 4CQ1A 1DTQA 1QD1A 1YITS 2CQIA 1VOMA 2HGNA 3R1LA 2ILYA 1IBCB 3M8QA 1R8PA 1V3ZA 2PA3A 3AODA 2HK3A 2RUGA 2IM3A 4LF1A 5F8HA 3NGRA 1WF0A 3OL9A 2DGOA 2DNQA 3J81j 2NXNA 2BRKA 2MLYA 1DZ5A 2ZH9A 1T95A 3GFYA 2WAQD 2CJ9A 4JI2F 2GGPA 3MPVA 3Q8YA 3RYLA 3ZZZA 5E3QA 1XC9A 2HG4A 4RW4B 4PWUA 1DARA 4DPWA 2C3UA 4MK7A 1S6QB 2J9EA 1B7FA 2M5YA 1VR6A 1R6VA 2LQ8A 1AROP 2YKAA 1S9GA 3C15A 6FDRA 2XMKA 2HNDB 4AUKA 1XIQA 4X66F 2CDRB 2VODA 3R27A 1F5AA 1T03A 4I64A 3BPDA 1GQEA 1JXVA 2XBPA 1JWWA 4EYIB 3MDFA 1ZZFA 2FVPA 5C7PA 2C3PA 2KFNA 1BXNA 1FK9A 2F1FA 3R3TA 4UQTA 1F9FA 1SIZA 4UW2A 3ILLA 1N88A 3BO2A 3DLGB 1RT7B 4I6WA 4BHQA 4A8WA 4ECYA 1UVNA 3BKFA 4F7VA 3NLCA 3G8QA 1GMWA 2ZDPA 3W3SA 1XR7A 4QYRA 1IBKF 1N36F 3D7SB 2VF3A 1O6XA 1WOSA 1TKXA 4K2XA 2GCFA 1YJRA 3VAFA 1RWKB 1RWWB 2JWNA 4Q45A 2PFFB 2R2TA 2XO7A 4NWBA 3LH2S 3RB6A 4DL6A 4LBHA 4DI6A 2JHEA 3KLEB 2EBEA 2UXDJ 4FXVA 3B78A 4V19J 3E51A 4MMOA 1LEOA 2ASJA 2XLKA 4PAAA 3NEKA 5A8KA 4NLWA 5ETQA 3G82B 4NI2B 4OI6A 2DRAA 5H9FJ 2BDPA 4RR5A 1QE1A 4NLRA 5IS2A 1TKZA 3NS7B 4ANCA 4CLZA 5KFRA 2ZH4A 5KFVA 1TMJA 4WKRA 4I1TA 1XMQJ 2QMUB 3Q2TC 4IKAA 2DJWA 5LM7E 3TUPA 1VBKA 4JP8A 2HQIA 3EWGA 3BDEA 2BW7A 2XNQA 3N0VA 3CIMA 3MPDA 2QSWA 3Q8QB 1ZM9A 4FKXA 3DLBA 1EETA 3EXCX 1YRUA 3GIKA 1KEKA 3MECA 4YY3J 3Q83A 4JI4F 2HZVA 3AOBA 3GYGA 2MMYA 1JLQB 4DR3F 3US5A 2JLGA 2AV5A 3MAAB 4WFAQ 4QJVA 2GJIA 4Z2XA 1JK9B 1YDLA 2Q66A 4WPAA 1S0MA 2HQGA 3HSJA 1T9TA 2NXJA 1HQEB 3G6VA 5KFUA 5E33A 4DZ6A 3AHPA 1XQIA 3AJ1A 3GU0A 4LRBA 4NPOA 4OHXA 2O5DA 3AD7C 1LNQA 3AXMA 1X4DA 5BYQA 4IG3A 3KFWX 1RT2B 3K0JA 2NYIA 2K7KA 2VOPA 1YHQS 2YKNA 2YKOA 2KFYA 1R8AA 4ZKAA 3PO5A 2E66A 1HI1A 1VQLS 2KM8C 4UUWA 2X1BA 4J9LA 3KUEA 1NCLA 4C98A 3Q86A 5KG3A 4UUXA 1JMTA 3ETOA 3CMAS 1RTDA 1HWKA 4ZHRB 3NXZA 3MR5A 4ZPAA 1TUWA 1U25A 3Q23A 2UXCF 2K1RA 1FRHA 2LLZA 3EYZA 2QN6B 2HK2A 3CCMS 4PRFA 2KT5A 1RWNB 3DLEA 1U09A 4ED5A 3M8PA 3O2IA 1U2CA 3HHDA 3ITHB 2HNZA 2D7SA 5FLXY 4KO0B 1JKHB 4C8OA 2C2KB 4KGKA 4CH0S 5KFQA 1E6YA 2YX7A 4Q43A 3RGIA 4OZ5A 3QAEA 2FC9A 3VTIA 2KZZA 3S1TA 3WX4A 2KFZA 5ETMA 2MSTA 4BC9A 2XS5A 3QJLA 3RRGA 4H4KA 1P1LA 2VFVA 2AX1A 1T0TV 4CIOA 4O44A 3ISND 2G2ZA 1QTMA 1TFWA 1NO8A 5GAHI 4F50A 4DUYJ 5KG4A 1T05B 2ZOGA 1NJIT 2FVSA 2MKYA 1GXUA 4A47A 2W01A 4FN5A 2QTWA 1BY9A 3I31A 3KK2B 3CJ8A 4DV1J 4FDFA 4X4UA 1VJWA 1RADB 1EHWA 2XGPA 2JZ5A 4F3QA 1CLFA 2IFXA 1WNEA 4CYUB 3OTEA 4DV3F 1KQFB 1CBKA 3I5BA 4AT1B 2VBYA 3DM2A 4XDCA 2V9WA 3MM7A 1FD8A 4RZRA 3MMCB 5ETOA 4ES3A 2CNOB 2LP4A 3ILOA 5CZXA 4DV5F 3FFIB 1N5TA 1S9EA 4DV2J 3H0PA 3I4HX 1N5SA 5RUBA 4X4RA 3ISNC 4PWDA 4EEYA 4BDPA 1NSAA 3DKDA 1IBMF 4M63A 2IMWP 5HMWA 2UVUA 3UI3A 3CCZA 2EG1A 4NLVA 4DLGA 5HI7A 3KJQB 4JI3J 3JTPA 4DV0J 4OJGA 5BXIA 1S0OA 2OO4A 5T41A 2VZ9A 3CC4S 3IAS9 1OYDA 3SYZA 2MTLA 5F8IA 3P96A 4NX9A 5T7LA 1WSRA 1URNA 3H90A 2X1FA 1RT6B 5H1SV 1N32J 3CGIA 4RJVA 2F8HA 3AQPA 3P5BP 3RU0A 3KHGA 1W2BR 3BB5A 3DGPA 4LF5J 1S97A 1KTVA 2CQBA 1F9HA 3TZYA 2OPQB 3W2WB 1ZTWA 2DHSA 3M2UA 3MM6B 3IRXB 3U1LA 2F3JA 4GRSA 3LQVA 1TKTA 4NCBA 4K4TA 4H4MA 4CLKA 5DG7A 1GXTA 2E5GA 1JLBB 3CNQP 1RWPB 4W98A 1IR0A 5GVQA 4EFAC 4B3TF 4M5DA 1Y3KA 3CD6S 5F3ZA 3PYGA 1P9YA 2VG6A 4YB6A 4Y2IA 3VHQA 2RJZA 3PFOA 1TK8A 2UVWA 5ETKA 4M95A 4P2SA 1CJKA 4C8NA 2XSJB 4RW6A 3BYRA 4UZCA 3MR3A 5I3UB 1F6TA 1CEZA 4HACB 4ZJOA 4C6AA 4N7TA 1HQUA 4DV7F 5CXTA 1I6JA 2EFNA 1TK5A 5J1EA 4BS2A 4QYZJ 1N33F 3MM8B 2L3MA 3PDNA 2ZHOA 3OSPA 2YQ3A 4OHVA 4JV1A 2RIJA 1X60A 1HWUA 1FT8A 3MM5B 4LT6A 2RHSB 3CB4A 3BZQA 3D6HB 1H7XA 5LOQA 1S4FA 2RU9A 4ETZA 5K20B 4NOHA 2ERRA 2B3TB 1AW0A 4NZ7A 2VQFJ 3KK1B 3R8YA 4NCGB 1RWOB 3H25A 1CC7A 2HVDA 2B7BB 1QDUB 1R8BA 2DNGA 3LPYA 4WIQA 3GILA 3DFEA 1FRXA 4B3OA 2VL1A 5FIIA 3BN7A 1IKXA 3KMQA 3RUBL 1JB0C 4DSLA 2HSEB 3JTOA 5FDLA 3IG1A 2GAHC 2GMLA 2CPZA 3ELHA 4MKYA 1WHYA 4DHVA 4WP3A 1KKHA 4UOHA 2XZWA 3S8SA 2FJEB 1VRUA 4M5IA 5C25A 4K5RA 3D6TB 2UV8A 3SCLE 5DGBA 1HD0A 4MK9A 1SH2A 1M1GA 2R7VA 4UZBA 2VC0A 4PG5A 3R5AA 2BJEA 5IM0A 1XTZA 3Q8VA 4NMXA 4W92B 5LSOA 5HK4A 4IOAQ 4K4ZA 1L3SA 2QA1A 2BEFA 1S1VA 4RBTA 1LXJA 4A8KA 3AXKA 2MY8A 2BA9A 3MTJA 3RBXA 3C6TB 1FJEB 2VFSA 3DOKB 4FYVB 2OGUA 5E0OA 1HHSA 1S5ZA 1XJWB 3OR2B 3SZ2A 1TU0B 3GTYX 5IWAJ 3Q8UA 2H3EB 4P74A 2AHOB 2HZAA 1AFJA 3LP0A 4I7FB 1XERA 1DQ9A 4EU0A 2MQNA 2DH8A 3T19A 3RBEA 4F02A 1DURA 3TWZA 2GNKA 3MEEB 1WHXA 4JB8B 1QUVA 3D3BJ 5BR8F 4YR0A 2EFVA 4BBYA 2MJUA 4DDFA 3ZZ0A 1MMNA 3TA1A 3QT6A 1U1RA 3G87A 4USUA 1JXLA 4F4WA 1WC4A 3N5BA 4CM2A 1YRXA 2VFTA 4YS2A 2IJNA 3KLVA 2B56A 4CRJA 5KFIA 3DRYA 3UVJB 5EDWA 2QYGA 3MD3A 1FCAA 4ZN1A 3HVTB 2HWIA 1R7IA 3NGKA 1V6HA 2KYZA 3UQSA 1FTRA 1TL4A 3J81U 3I6PA 1HHTP 2GW8A 3HF5A 2NSCA 4RNMA 3MFHA 3FEYB 5CHCB 1WEXA 2JVOA 1XMBA 5J2MB 3RBDA 4NLPA 4CLPA 2FHJA 3RR8A 3CCRS 5K14B 3QNWB 2CPYA 4Y28C 2IC3A 5HATA 4ECXA 1EP4B 4W90B 1VJQA 1J5EJ 1RSCA 4QR1A 1OSCA 2KU7A 1KVIA 3QT8A 2QRRA 4CLUA 1Q16B 2FGOA 4DG1A 2J6TA 4NLSA 2CNKB 2J7WA 2W8KA 2MLXA 2K3KA 3JSMA 3GYNA 2ZH5A 2HRTA 3ENAA 3BV8A 2CQ4A 2B4PA 5LL6d 3GCXP 3J7AN 2O01C 3QT7A 2WVFA 3DLKA 2CQ1A 2LEAA 2CZ4A 3SMZA 2EVZA 3TJAA 3IS9A 5EWEA 1H3DA 2G0IA 4X4NA 5KFJA 2XLIA 2CWKA 1RISA 4D3HA 4RLEA 1F0XA 1G1XA 3T1YJ 1RAIB 2H4YB 2QA2A 2VPYB 2F9JA 1YJUA 4HH0A 1WG5A 3HJVA 1X8DA 4OYOA 4WYWA 1DY3A 5EUHA 1UFKA 4TQRA 1Z1ZA 4RKUC 2DITA 4C8MA 1BE4A 3NGDA 2B4UA 3BSNA 1RT1A 1UVLA 2FJBB 2Z8QA 1KVKA 4OZ2A 5HJYA 5HSPA 2A10A 3PJXA 3VAKA 2IAJA 3CCVS 4FP9A 2HPUA 3U27A 4FYYB 1LWFB 3D0IE 3LTOA 1B0TA 1B4SA 1FO1A 1HPZB 3ENWA 2UUCJ 3M6UA 3BH7B 1HL6A 2JLEA 3KK3A 3DMJB 2DGWA 3J7ZT 3HK2A 2VDIA 1T8EA 3T5KA 1FDAA 4DFKA 2W2NP 2P6SA 2WTFA 2RQMA 1NDKA 2QFIA 2OPRA 2V4JB 4X84A 2ADBA 1FRIA 1S72S 4OHWA 5GAEI 3GE9A 1S49A 1SCJB 4B9LA 3CO0P 2CRLA 4CH7A 2Y1JA 4YB5A 3BEGB 5KFZA 3UN5A 3OVSA 1U1MA 4DX5A 4CTAA 1FX2A 1NHKL 1IJFB 5F3TA 5IV3A 1U1LA 2W4PA 3LGHA 3VGTA 1Y5IB 3OHAA 2OTLS 2H5EA 3S01A 2LXUA 5GMKa 2CPHA 4JI0F 1T11A 5LMNF 1WHWA 2ZJQQ 2ASDA 3D1QA 2B9EA 1FWLA 1G6BA 2V2ZA 2FLOA 1Y9OA 3UCUP 1OS5A 1VC6A 2OEJA 3SDEB 1Y10A 3V81A 3EJMA 3CD7A 5ITHA 3IGVA 3SBMA 3CWJA 3O5TB 4LFAJ 5IT0A 2C3YA 2HIYA 4I2QB 3OXGA 2FHMA 3DOLB 3Q8RB 1HWIA 3KG1A 4JI8F 5LMUF 2HRYA 4OX9F 3HSDA 1UWBB 2AEFA 7FD1A 3QO9B 4IOCQ 3MGJA 3QPIA 2WVBA 2HNYA 4IFVB 3ZTPA 2KZMA 3PW4A 1DTQB 3SSRA 1VDHA 4LMZA 4X64J 3M8SA 3M8QB 1QVFR 3LO3A 5DETA 4NLYA 4ECWA 3BGLA 2VB6A 3NGTA 2I9SA 4IFYA 3FRYA 1ULRA 1BD6A 4PXCA 4DS5A 2VFUA 4RUBA 2ZD1A 2OMOA 2GGPB 2C42A 2RDIA 3CSKA 2M7SA 2CA9A 1U45A 2ILZA 2IA6A 2RRBA 1UP1A 2R7XA 2LU1A 2QLWA 5HQMA 1TP7A 4RW8A 5CAAA 1P27B 5CA5A 1YWXA 2W9AA 2LEPA 2YY3A 2WONA 2UVRA 4JI6J 2RQ4A 1Q7LB 2PMZD 3SEOA 2CJBA 2CQPA 1A6LA 1JLFA 3BQ0A 1S9GB 3C15B 1PC5A 1LFPA 2BANA 1F5CA 5B0CA 3PX6A 2ZBCA 4DFPA 4KE5A 1T03B 2X1AA 4YQWA 3ULHA 2EFPA 1TZ0A 4CZCA 2DR8A 1FERA 1WTFA 1WKJA 4M5MA 1FK9B 5KT5A 2VJUA 4HTIA 1MN7A 2E1AA 4DOZA 2LQ9A 2MZRA 2M2BA 3BSOA 4DSJA 1AZSA 3SCJE 2EK1A 5KFTA 3RJMB 1GMVA 3MF5A 3W61A 5B7WA 2HFVA 3A13A 3MR2A 4RU9A 1R43A 2FPHX 4TQSA 4M5NA 1YJNS 3MEDA 1IVZA 4HI2A 1TKXB 3K7RA 3NBPA 4ZIWA 3A1YG 3OVBA 3ZTOA 2I1RA 1Q4RA 4ELUA 5J2PA 3DYAA 3A12A 3J7YU 3UD3P 4B9TA 1JNRB 1F60B 4LF6J 4LSZB 3FEXB 4ID8A 5CCLA 1KFSA 3D68A 1WUUA 2W9BA 4ZCKA 4WFBQ 1OQ3A 3MHYA 1FFWB 5E3RA 1RLDA 4LF7J 1GXLA 1OY9A 3V6HA 1M5KC 3EGNA 5A8KB 3NCQA 3PYEA 1M90T 4P9SA 2E5JA 2AEJA 5H9EK 2CFXA 2ALYB 2GQCA 4G3IA 4QWBA 1QE1B 2VOOA 4QQBA 3OUYA 1TKZB 2EI5A 2QL7B 1MU2A 2FJDB 3JYTA 1NM2A 3VGVA 1HBOA 2RKIA 2EFGA 5KG1A 3D0GE 2CQGA 4ZPBA 4Q8FA 3Q0AA 5HMYA 5IT9Y 2NLWA 4OI4A 1AXQA 1K9MT 2H4WB 3TAQA 2YWWA 1KWMA 2JDJA 2MJNA 2YNGA 5DM7Q 2BKNA 4KHMA 3PXGa 1L5UA 2E1CA 4M5GA 5DG9A 1WHVA 3EUNA 4C97A 3MECB 2OLWA 2VG7A 2EC2A 1N34J 2YKMA 3RBZA 3FDSA 2JC1A 5BYSA 3M1VA 2LEBA 2DYAA 4TLRA 3QJJA 1WTBA 1X4EA 4BWMA 1H72C 3ZTRA 1FKOA 4JYAF 3M7VA 4Q0BA 4ED4A 3I82A 3MXHP 5B09A 1V9OA 2J0QD 4DUZF 2J7KA 2C28A 3DDIA 4I0WA 1SI9A 5E2QA 1D8ZA 5HMXA 3BQ2A 3SQGA 2Z2MA 4FBUA 1G2EA 1JJ4A 1FFSB 3FBFA 3PRDA 1W7WA 4FPIA 4IG3B 3AQOA 2WK4A 3R1HA 1VYAA 4C3KA 1ZETA 4O4GA 3ADAC 4K4SA 2BJ9A 3M2VA 2YKNB 3G8TA 3DU6A 3LALA 2A2CA 1FJGF 2UXBJ 4OLPA 1EKRA 4ZCLA 4PZVA 3NL0A 4Y6IA 5AXNA 1JLEA 4I68A 3H8YA 3JXOA 1XBWA 1QSLA 2JLFA 1NAQA 2AX0A 2LKZA 4KB7A 1RTDB 1MWZA 1SJQA 3GFHA 3V4IB 1RHJB 2K1RB 3N28A 2M8HA 3AD8C 2PMHA 1L3UA 3W65A 1G3OA 2Y1LB 4QWDA 4TY8A 5C24A 1BGXT 3EX7B 2W2PP 2DPIA 3DLEB 4ZP6A 5L1LA 3T1HF 3HKWA 3UO0A 2JH3A 3M8PB 3PJ9A 3MM9A 4CO0A 4RW7A 2HNZB 2ZC4A 2DR9A 3OLAA 1X4GA 1LW0A 3FZBA 1JIHA 1WJ9A 3PFEA 4KQZA 1E6YB 3T5HA 4B9MA 5EN1A 1CJUA 2BUNA 1B0VA 4DR4J 1BQNA 3M30A 4R0EA 2CJKA 1NDPA 4G1IA 2BE2A 1BC6A 1RLCL 1Q8IA 2V4RA 1W26A 4X66J 2FGCA 1FWKA 1Q95G 5KFGA 3GPAA 1MW7A 2W2QP 2XMWA 1VIOA 5CYMA 3QZ8A 2MQMA 1KHVA 2MQ8A 5DQIA 3EZ5A 3T5LA 1FVQA 1YQHA 1AT1B 2O67A 1NK5A 2F40A 2MYFA 2QX0A 1IWAA 3VAGA 2V2KA 2X51A 1REVA 4LR7A 2H54B 3L9ZA 2AGQA 1H2TZ 5F0UA 2EK6A 3PX4A 3Q8SB 4DR2J 4J9MA 2VC1A 2BQUA 2DGTA 3QJPA 3QRPA 3CXCR 4ZDNA 1A7GE 3DM2B 2E1RA 1IN0A 2DNPA 2XS2A 1VBXA 3MCMA 3QGIA 3MI7X 1R8CA 1KLMA 2IMOA 4UTGA 3WDOA 1NZ8A 3HHLD 1X4HA 4K5SA 3FC9A 3GIJA 5F8MA 4WP9A 2HS4A 1PAUB 2ZJRQ 2WB1D 1S9EB 3VQSA 4HDGA 2GHVC 2AEMA 5HLFA 3LF0A 2P9CA 5AJ3F 2AQ4A 1MMLA 4P6QA 3CCQS 4NEYA 1J5OA 3SSSA 1HNWJ 4PWDB 2HFSA 2KXNB 1RWXB 5BJRA 3THPA 1C0UA 4K0KF 4DL4A 1VQNS 4USJC 4RW9A 2IVYA 4ZIVA 1KQGB 3H20A 1VQYA 4IH7A 4DR6F 2W8LA 3D5MA 2DXEA 4EZ9A 2XTJP 4PQUA 3TZXA 2BX6A 4WTOB 3UD4P 1LOUA 2HS3A 2ZUGA 5M2PA 4QIGA 3EPGA 1ACMB 4O23A 4RNOA 1CQNA 3C6UA 2XQCA 3CT9A 3OTDA 3M4XA 3EGVA 4LVOP 2MQPA 2R7UA 5LT5A 4B3RF 3DGPB 2ZBIA 3NMRA 1VRTA 2LYVA 3EVWA 2F65A 4Q7AA 3KUGA 2DNRA 2BJ3A 5CCMA 1JXEA 5L38A 2R8KA 3BS9A 5B0DA 3DHXA 1LWXA 2N3OA 2HHWA 1TKTB 4H4MB 2MZ1A 2GA7A 2BVZA 2AD9A 4ILRA 4ZVOB 5LJ3Y 1T3NA 4ZVQB 2MZSA 3B82A 4DQPA 3BO3A 3OPKA 2HHPA 3QATA 4M5DB 3CDUA 2VG6B 5HP1A 4ZPWR 1TVRA 3QGPA 5ETSA 2VBXA 2HFZA 2LQBA 2WOMA 3NS5A 2HW3A 1CJKB 1QSSA 2V0NA 1V3SA 2BV3A 3MZIA 4RW6B 3UDLA 3IWLA 3UNYA 4L75A 2XY7A 3N6LA 3TUZC 4EBDA 1HQUB 4NA3A 2RB7A 3K59A 2AWZA 1S4EA 2HMIA 2FHKA 3MPWA 5KFLA 4WXWA 3KLGA 4FYDA 5KT3A 4WU2A 3ISZA 4M5KA 3A3OB 4TU9A 2OSRA 4WZQA 1R27B 3H2LA 2UXCJ 1N52B 2V8DA 3VWSA 5D0EA 5KFPA 2YPYA 2XC9A 4DQQA 4OI3A 5AXMA 1NB2A 5ETNA 3CPWR 3TVKA 2ASLA 1JJCB 4A46A 2E9TA 2QE5A 2WSFC 4HEA9 1YKWA 1YK9A 2MQQA 4RWWA 3KNAA 4B3OB 5D4PA 4A8MP 3OW2R 4P2FA 3NNCA 2FLPA 1IKXB 1S6PA 3MCSA 4N5SA 1Q5VA 2AJ0A 2HHTA 5D4LA 5FDLB 1MWYA 2J76E 3IG1B 5KG7A 3H2VE 4CNYA 2HAIA 1ITPA 3R97A 4WP8A 2DR5A 3C19A 5HL7Q 3PJWA 2QFJA 3PG9A 4QR0A 1RHUB 1KBRA 3FVYA 2CZVC 1S59A 1VRUB 4TU7A 5C25B 4PG6A 4Y00A 2SXLA 4RU2A 4J7CA 2W7OA 1WI6A 2J8SA 1UTAA 4USMA 4NE9C 2MHEA 2B6AB 1TFYA 2UXDF 4ZPCA 1WC1A 2OHDA 4C8LA 1U0HA 4WFYA 2AYBA 3QBCA 4TNOA 5EHHA 1S1VB 3FNNA 4J9UE 3MTKA 2RMLA 1IKWA 5DDOC 3NWRA 1F1BB 3NY0A 3OQ2A 4LF4J 5KFMA 2EEYA 2EBGA 3LUYA 4BCAA 2D9OA 4WXOA 4ZVFA 2XYHB 5KG2A 3LP0B 4B9NA 1K44A 5D0RA 1QVGR 5CH7B 4J9SA 1JLGA 2ZITA 1K0TA 4EO6A 4NEZA 4ZVHA 1BWVA 1HI0P 2UU9F 1CS4B 5B0BA 3GV8B 3E2EA 1ZOTA 4URGA 4ZPVR 4F4KA 3VGSA 4JI7F 2KXFA 3T3FA 4C0HA 2ACYA 2QMWA 2PIIA 5IV4A 3ILJA 4EZ6A 3IN5A 2V63A 3MD1A 5CQGA 4KH0B 1S57A 5F8JA 4NLOA 2DK2A 3OL6A 2CJYB 1NK6A 2KJVA 3F0NA 4USVA 4Y2AA 1X9MA 3VALA 3NAIA 3HULA 4JI1F 1S48A 3MCOA 2N3LA 4NYOA 2HBZB 4OHYA 3HVWA 4MT1A 1U2FA 3D6MB 2FB0A 4YR3A 4OX6A 2G2YA 1TV6B 2RVJA 2CQ3A 1UFLA 1K73T 2NCKL 4C9DA 2CJAA 3HKZD 5DZ6A 1X0FA 5HVHA 3R2CJ 1UVJA 4C0OC 4J37A 5I42B 3P8BB 4USKA 3CJ4A 1OY8A 4F26A 4NLGA 4OQJA 3C14A 3KKFA 1UJ5A 2IC3B 2YXLA 4A8OA 1RQ0A 2XY6A 1VGYA 3PY8A 1HBNA 3IBFB 4O3NA 2WRMA 4YEAA 3KXDA 3FBEA 2W9CA 3ILIA 5KOWA 2DXFA 4PQAA 2V2QA 1SUQA 4ZCMA 1BLUA 4OFZA 4DMZA 1VK3A 2RD5C 5HMZA 2VKZG 4OYIA 2J7UA 2CVEA 2PFDA 3DLKB 4CO1A 1N33J 3IS9B 4DF8A 4NASA 1ZAWA 2BBEA 1DQ8A 4GO5X 3QRQA 1HW9A 1S1TA 1TR0A 4YR2A 3EM1A 4OLOA 1JLAA 1B64A 1TTHB 3BSCA 2X7IA 5DDRC 3OFHA 3CJ5A 1T02A 2ZWOA 4C3LA 1HYSA 4PEOA 3MPUB 4E98A 1S6QA 4C8YA 4K59A 1UFWA 2MB0B 2UV8G 1SJRA 4J9NA 1RT1B 2XCAA 1RWUA 2HLTA 3M8YA 3A8JA 3LPEA 3TAPA 3EXYA 4PR6A 2KKHA 3DCAA 3HMJG 3K5NA 3BBCA 3G8SA 1YBAA 5KTQA 3H5YA 2IAJB 2AU0A 4I6YA 2KDOA 2UVVA 1SL1A 4FS2A 4TU8A 4F36A 4O4RA 5D4OA 1NKBA 4LIWA 4LF9J 4OZLA 2X3GA 1YZ7A 4DV1F 4ZVPB 2E1MC 2E5LJ 3KK3B 5F8NA 2QO3A 1GMWD 4RNHA 2R7SA 4QPTA 4KRWA 2ZH8A 4ED0A 2AP6A 2RILA 2OPRB 2KN4A 4R25A 2WHOA 2XO6A 4PXEA 2VONA 3IR5B 2ZBRA 3L7PA 2GVZA 3BR8A 2ZZTA 4ZP7A 3DI6A 2CQCA 1N48A 2CVIA 3CJ2A 1SJ1A 9RUBA 4CTAB 2MQLA 2O66A 1UZDA 4RNFA 3QQCD 3Q2SC 4DV2F 2LU2A 4ED8A 2PSZA 3C8YA 1EAYC 1L3VA 2LMIA 1S0VA 4X65J 2QIFA 2DXDA 5IZHA 4XAKA 2QL9B 3PKYA 5M2UA 5L1IA 3M6XA 2C3MA 2N7YA 1CSJA 3IM9A 2PEBA 1IQZA 3M9MB 3GWCA 2ZBPA 2E7XA 3B6BA 5D6GA 3ONQA 2GVDB 4JI3F 3V81B 2I38A 4NLQA 4DV0F 1FDDA 1GEHA 3Q22A 2DRDA 2ZEJA 2RHQB 2U1AA 4CO4A 5BR8J 1SKRA 3PW7A 2R2RA 1TELA 3O44A 3V4MA 2OP5A 4ELVA 2OMLA 4X62J 3ETMA 3QRRA 1VLOA 1EQ0A 4CLWA 5BYRA 3TR5A 3I96A 2MEWA 5A0YA 3M05A 1WSVA 1WG4A 3B54A 4JI5F 5A76A 1N32F 1FI4A 2HNYB 1SJ4P 4WF9Q 2C2DA 2ROPA 4L3NA 1U1KA 3KHHA 2DHGA 4OV6A 3GG1A 2IVMA 4LF5F 1ZZNA 2Y0SD 1VRQC 1P9QC 4F04B 2RF2A 3MAAA 3JSBA 4IFYB 3AJ2A 1TUVA 1GMUA 3FBBA 1UPPA 4F0KA 4ER8A 2ZD1B 1QY7A 2XLJA 1SV5A 5A2QU 4A4JA 3MR7A 4DN9A 2FJWA 2HAFA 3SIPB 1HKAA 3QIDA 4TLQA 2DGVA 4O3OA 3I87A 4LRCA 2OIHA 3GCWP 1RDRA 4Y2CA 2GO8A 1DLOA 4ZVRB 3PNIA 1D1UA 4H4OA 4PCQA 4P2MA 3QFHA 3CJKA 1ZAXA 4OJ3A 1O5JA 2BANB 1Q78A 5J2QB 5KFWA 4AE5A 3FQKA 1NZAA 1H38A 1PILA 1ZS6A 2L08A 3ZZTA 4OX7A 3LANA 1KR4A 2EFOA 3HXMA 5B0GA 3CW2C 3GFXA 2AGPA 1T9WA 1YGYA 2MKCA 3D0HE 1MROB 2C1EB 1AZSB 3GMGA 2V8GA 4DR5J 3CCWA 2Y8WA 2CPFA 4K4XA 3QWUA 3SFGA 3MEDB 3JAMU 2MY7A 2HHHJ 3CJRA 4GC6A 5ETPA 2A1BA 3NOCA 2RRNA 1FHTA 3EZUA 1WC6A 4EK2A 3BGFA 1SPBP 1YIJS 1FJCA 2J0SD 4GC7A 3DNCA 4I4BA 2YTCA 2VQFF 5J2PB 2UUBJ 1SH3A 8AT1B 1R0AA 4PG7A 2J6SA 1M5HA 1RT3A 3P5TL 2HQDA 4K50A 3C46A 3ZZRA 1HNIA 2F4VJ 4KH1B 2DCLA 5KT2A 4CLYA 2LCWA 4NLXA 4EI2A 3WC0A 4ZK7M 2JC0A 2IJFA 2EKYA 1QM9A 5LJ5Y 2FYXA 3W60A 1SC4B 3NRBA 2DNOA 2C22A 1KOHA 2A3JA 5DQHA 3DRRB 3X1LB 3OUYB 2ZVIA 1KC8T 1MU2B 1YBUA 4QOTA 1FF2A 3JYTB 3G6ES 3O8WA 1HBOB 4A8XA 2RKIB 4ETXA 4MTPA 3HO1A 3LGMA 4WK3A 1HMVA 3T9NA 3BREA 2OKQA 1N5YA 3TRGA 2JL9A 5ETVA 1H2UX 4RBVA 2YNGB 1RKIA 3K89A 2DT9A 2I8EA 5A8WA 4Q5VA 4DWIA 1SQEA 1VCTA 4CT8A 1WACA 4U7UD 4RUAA 2IM0A 2VG7B 2E5HA 1W25A 2YKMB 2MHNA 2YWEA 4R5PA 2AMCB 2YPZA 2FLLA 3M1VB 5JVHQ 1FEHA 1VIXA 4MYUA 2FQQB 2XMUA 5ETRA 4UOCA 1SKWA 2FJVA 5AE2A 2JEFA 4DBQA 3ZNJ1 2DY9A 4LRAA 1FKOB 1NH7A 3OFGA 1REGX 1RHMB 4USTA 5GAEU 4Q0BB 5D15A 3MMJA 3PM9A 5IWAF 2N4CA 3KMSA 4JI0J 4DR7F 3LW5C 4LRDA 3SQGB 2XMVA 4XPEA 4HHJA 1I1GA 2ZH7A 4NL5A 3EZOA 3TYTA 5KAKA 5GAGI 2D3O1 2HWHA 3VVUA 1ZM2A 1YJVA 4FNHA 2C2NA 1WD6A 4O4GB 1Y00A 3GIMA 2U2FA 2Y1RI 2P5VA 1D9AA 3RRKA 2J5AA 2AJQA 3RW6A 3M2VB 3OV7A 2DKOB 5H9FK 3UDEA 3UN2A 2M52A 1HNVA 2VJVA 2VPXB 1XK8A 4OZ0A 2E29A 1HR0J 4CLTA 5HROA 4I6AA 1F9EB 1JLEB 1P6TA 1RT6A 4HYKA 3ZTSA 3TZWA 1QAIA 4YN3B 1U4BA 3G4SS 5I3QA 1MMDA 3OTOF 1H74A 2DNNA 4JOUA 2V94A 3DHWC 5C24B 3IRXA 4KV8B 3L95X 3VZHA 1RA7A 3FCWA 4FF1A 3R2DJ 3JQMA 2BW2A 4QCLA 3N01A 3R5DA 3MM9B 2ZKTA 4RW7B 2BM1A 3BYPA 3W2VA 3W5ZA 4DR1F 1FA0A 3D67A 4NXNF 1LW0B 3I0SB 1I3OB 5FJ4A 3IP0A 1WEYA 1VHIA 1S7HA 3HM9A 2IBKA 2CNNB 1PG5B 3HSGA 2Y8YA 2MKIA 4IH5A 5DLFA 3B4MA 1CJUB 4LBPA 4F4AA 2KG1A 4DJBA 1H2VZ 1ZM3A 2KO1A 1BQNB 4PYDA 2BE2B 2D3OR 5B0AA 2ZZNA 2ZM6J 4YB1P 1TAUA 2Z57B 2XSJA 4PABA 1Q81T 2HFUA 3UD5A 1Y5LB 3C16A 5CYMB 5DS7A 4LRFA 4OZ1A 3UPFA 2WBRA 4IQMA 2I6WA 3OXFA 1RT5A 2IYIA 4U95A 3TQEA 2B4OA 1GFWB 1C4AA 4K8RA 2RU3A 2BOPA 1XWLA 2HGLA 1I51B 2HQ3A 4BC7A 3T1YF 2PGCA 4YUDA 2FUG9 3HX9A 5LXYA 4RUHA 2AZ3A 5A8RA 2MLZA 3E8OA 3W8PA 3N6MA 2OAUA 4FVCA 1F2GA 4DPOA 1LWEA 1G7CB 2ADCA 1VQPS 2NQPA 1RBLA 5HVFA 3T9ZA 5E3AA 2C2MB 2VD3A 1KLMB 4LFCJ 3R6LB 2PDAA 4M5LA 1PSDA 2LXFA 1X5OA 2Q1LA 1RWVB 5D4NA 5T14A 3PACA 2GS8A 2YKPA 2W25A 4H54A 1S79A 2M88A 3FMWA 3QIPA 4LFBJ 4CT9A 2YH1A 3NCPA 3SSQA 1J5OB 2A18A 4IDKA 1B3TA 1YTYA 3OD2A 3EGZA 1C0UB 2AGOA 2BJ7A 3MEGA 3KHLA 4J9OA 2ACMA 4RW9B 3Q89A 4USWA 2KVIA 4JV2A 3OBIA 2ZOMA 1Z2LA 1S0NA 2LQ5A 3VV2B 1RTJA 1NJWA 3WIUA 4PQUB 2CIMA 3FCVA 3DRPA 2VPWB 3E3XA 2ZH1A 3VVTA 2F8MA 4P10A 1S1WA 4RBUA 3FRZA 3J80U 3AAWB 2KVQE 2B8PA 1NK7A 4P71A 5JUMA 3FGVA 3V6KA 1FRLA 2CKWA 2P6TA 2QLBB 1X7VA 4WZMA 1HFEL 2H5JB 5B0FA 1SC3B 1XR5A 1CULB 2HVHA 3M32A 1VRTB 2PI5A 1J27A 4JV5J 5I4MA 3R7BB 3GLJA 4LSLB 2V69A 3RAMA 1APSA 3ZZOA 1UA0A 5K8PA 3EVOA 2FVQA 3MMBA 5K8MA 5G4DA 1FE0A 1LK7A 3CCLS 2JFDA 1KNZA 3IM8A 4I7FA 3W8GA 2DHAA 4ED6A 1RAOA 4ENOA 3DC2A 2ZUAA 1WDTA 2ZH3A 5DM6Q 2CZ9A 2GJ2A 1F2HA 3WIVA 3LP1B 5HP1B 1RBOB 3JS9A 1TVRB 3PR4A 4NA2A 1PIEA 2WOMB 2J9DE 4ZVEA 1YJ7A 2CPJA 4URSA 1KN6A 3Q8PB 3KDOA 3CJ3A 4FYXB 4CM0A 3P45B 3ZC4A 2UUAJ 4X64F 2FJAB 1H73A 2HMIB 1MN9A 1WG1A 4R0JA 3KLGB 4QU6A 4A48A 3KTQA 4NLUA 5IOLA 2Q79A 1PC4A 3OL7A 4ZN3A 4KGMA 1NK0A 1HBMA 2E1PA 3NNAA 8RUCA 1NK9A 3DDNA 4F25A 3AB2B 3PYDA 1WF1A 4HI1A 2WVDA 2PD1A 3DLJA 4F3OA 4GKKJ 2YWKA 1X4CA 2FHJD 1FVSA 5EWGA 2LFVA 4MKAA 3AT1B 2RRAA 1GT8A 2A2DA 3LWLA 4I2PB 1HBUA 3RW7A 1H6KX 4ED3A 3CDAA 4CLSA 2BQ3A 1VQMS 4Z37A 1UMJA 4ANEA 5DO2A 2HVZA 2HBYB 2FC8A 3FUYA 1PYSB 4DX6A 1GAOA 3GZ7A 2MZQA 4OI2A 5KFDA 3I9V9 1D0EA 3PZPA 2CYYA 4I69A 5GADI 2BRLA 1S6PB 3HHLB 2QC3A 3PV8A 3CVKA 4PYAA 2VPZB 2W2MP 4R8UA 4DCOB 1U8SA 2W4CA 3GJTB 4ECVA 2CAJA 4MKBA 3B4DA 1LWCA 3F56A 4WE1A 1C1BA 2ASYA 1P1TA 4HLBA 4J9QA 2MKJA 3TA0A 4DFJA 4RX6A 5KT6A 1S9FA 2OPSB 2VA3A 4ZP9A 2FHOB 5DRKA 3H4BA 4HH1A 4M1KA 3W63A 3IBWA 4QYZK 5IC6B 2NS1B 4U96A 2HYIB 2B9XA 3EDQB 2R7WA 3BN4A 3JB9k 4ECTA 1R0BG 1S99A 1NSQA 1M0SA 3CD5A 1OSDA 1U0HB 5AE1A 4L6V3 2MZTA 2Z2YB 3L09A 4F4XA 2DEJA 1IKWB 1U7LA 1GX5A 2KT3A 4LF7F 5IFMA 2R2SA 2DD8S 2JSXA 2V34A 2FLNA 3IAM9 3TEGA 2NPFA 2MZJA 1FE4A 1ZM4A 2W1BA 5C2GA 1FNXH 1XNRF 2D3UA 4FF3A 1U24A 2XHWA 2FVCA 5CYJA 5CABA 4F0MA 2EXUA 3VAIA 2QL5B 1WOPA 2YQ0A 2V50A 1KS2A 1OPZA 1HPZA 4CLFA 1GX6A 3DMJA 1X4AA 5AE3A 3V6DA 1FXRA 3AA9A 2KHCA 3MWBA 3NG8A 3C66A 5HQ8A 3HDSA 1TL7A 3C3LA 4M94A 4Q44A 2N82B 4I67A 2AZ1A 2HLUA 4F4ZA 4ZITA 2CJQA 1X5SA 4IH6A 3WX8A 3AY0A 2JEIA 1TL3A 1OYEA 1SJ3P 3KLIA 3GP9A 2FVRA 1NKEA 1N34F 2YH0A 1KP6A 1DTTA 1R6YA 1VK8A 3GIIA 2QA4G 4B3RJ 4KYZA 5K5MA 2WB4A 4GKJF 3MEKA 2DNMA 2NYHA 4GVBB 1SKUB 3H59A 4RWXA 4X4VA 4WYLA 5EGYA 2PE8A 1DJ0A 2VQEJ 3F73A 3G6YA 2ZKUA 2H48B 4N47A 4ECRA 3GQCA 3C14B 1EJ7L 2CQ0A 2JEJA 4G1PA 2LVWA 1IKVB 1HBNB 5A6WA 3OHBA 2I2YA 2XY5A 2W9CB 1AA1B 4I2QA 3I5CA 4BWJA 2UXBF 3VAHA 5J2NB 1SUQB 2ATLA 2QLFB 2WVCA 3AA8A 5FD1A 1RAHB 2B5JB 2I0XA 1SH0A 4ED2A 4FNIA 3BGRA 2F7VA 4DLEA 3KYLA 1ZA1B 1KVJA 4KHRA 4U6PA 4EO8A 2KRRA 1VBYA 5KFXA 6AT1B 5JMNA 3X3UA 2AF6A 4USHA 1S1TB 2VV5A 2VIHA 7AT1B 3TAMA 4G1QA 2ZOFA 2D41A 3WBZA 3W9IA 1JLAB 5U47A 1F3FA 3ET6A 3KLHB 4LF8F 4DV6J 3MUVP 5E3CA 1HNXJ 1YJWS 4MH8A 2OPPA 2RE1A 1SKSA 1HYSB 5I3PA 1YX2A 2Z58B 2HBRB 4P73A 4AXIA 3VCDA 2BE7D 2F8EX 4QWAA 5CZVA 4ILLA 2EKNA 2OUGA 2KJWA 1W2IA 3EDRB 4DR4F 2VDHA 4C7QA 4DU8A 4DSEA 3MMAB 4WFXA 2Z0GA 2F4FA 4OX8A 1XNQF 3R5CA 2XSFA 3BGOP 2X3DA 2HHSA 4ZLJA 5JJBA 2YNIB 1FESA 2JRSA 1DRZA 1BQMA 4RO0A 5KFAA 3K5OA 2JFKA 2XCPA 2HQFA 3SCKE 4NXMJ 3A8EA 4DV4J 2AJ2A 2V9KA 1PBAA 2XI2A 2IJRA 4DR2F 3TJ9A 4MIWA 1D09B 3DOMA 5DDQC 3FCHA 1LXNA 3TQ1A 2WBMA 2FZGB 4AFFA 1TL1A 2R4FA 3HVRA 4N8OA 2B7CB 2EPIA 4DL2A 3TANA 3HHEA 1RAEB 2FY8A 3ZZYA 1PGZA 3A8KA 4L3KA 1AFIA 3KUHA 3TI0A 2GVZB 4QPXA 1LKZA 3DI6B 4NLDA 2B0GA 1N0UA 1QTNB 2Y3YA 4K7QA 2DCUB 4YP3A 1JJ2R 4HL9A 4HT5A 3TOQA 3K17A 5C2CA 3EVMA 1WI8A 3K58A 1KDNA 1LK5A 3CTRA 3ENVA 4P2XA 3NGSA 3PHTA 2G1DA 1Q8LA 1FRKA 1HNWF 3HVAA 2D9PA 1NB7A 1VQ9S 2O1PA 3G2XA 4I56A 2VHGA 2OD6A 4X4TA 3RB4A 1V5VA 4OZNA 5B08A 3L7UA 4OYAA 1M5OC 5DG8A 4ANDA 7FDRA 1AUDA 4C8KA 2JJ4D 1RACB 2UU9J 4ICLB 1Q8KA 3N79A 2XS7A 4ID5B 4WTYA 4AQYF 1QUPA 1QAYA 3O6QA 4JI7J 1F5BA 4X4OA 4NLTA 2UZAA 5A0YB 3I5AA 3DRSA 4NYPA 2CPDA 2VASA 4ILMA 1SVDA 3JSYA 3H2UB 3EPIA 4IO1A 2R9LA 2BKPA 2GQ2A 3KG4A 4N56A 2FZCB 2CQDA 3PW2A 5CYQA 5MLCV 4JI1J 2X1GA 4F8RA 4MFBA 1IBLF 4ED1A 2RF2B 4KPYA 3KDNA 3LWMA 4HT7A 1PYOB 4CNZA 2J0WA 3HHNB 1T7PA 4CCHA 4LQ9A 1I94J 4F4YA 2HFNA 1SV5B 1RTHA 3HZGA 4FPRA 3U7JA 4OYMA 4QU7A 1UCNA 2VKRA 3I0RA 2HWTA 4ELTA 1RT4A 4YHHF 2IA0A 1DLOB 1YI2S 3D28A 1A9NB 4H4OB 1Q1KA 4DU7A 1RCOB 3CJKB 3W9JA 1HI8A 1ZPWX 1WEZA 2GFFA 3BM7A 3NNHA 1HW8A 2IM1A 3UNGC 4WKYA 4Y2MA 2HIQA 4KGXB 4OYZA 2DRBA 4O3SA 3DDKA 2CG8A 4J9RA 2VA2A 2XWYA 3PX0A 4NZ6A 2YNHA 4E8UA 4K4YA 4WFNQ 4PUOA 1V3RA 3G9CA 3K5PA 2H65B 2ZDOA 4HHHA 1O0PA 2B9WA 2R7RA 4KHPF 1D9FA 2R7TA 1NEEA 1IXKA 1S1UA 3V4IA 1OMSA 3BJYA 4WIIA 2WW8A 3K8WA 1S76D 1XMOF 2GIRA 1CVJA 3WHIA 1SL0A 2CQHA 1GH8A 2E44A 3PW0A 1FKPA 3BO4A 5K9FA 3T1AA 2HEKA 1FNMA 3T5JA 1G4CA 2VH7A 3BKUA 1KQKA 3R5JB 3UR3C 2DH7A 3BH6B 2B8QA 5KG0A 1IM6A 4DL0C 4J5OA 4CO5A 4PG4A 1KHWA 5ETLA 1T9UA 3M2RA 1R0AB 5DGAA 1RT3B 5G0RA 2VU5A 3Q24A 1Y5NB 3RTVA 1HNIB 1PJ6A 3LP2A 4GMKA 4EUVA 3CJ0A 1WF2A 5L1JA 1U26A 5KFEA 2ZNYA 4F3MA 4RL1A 1R89A 3N6NA 5HO4A 3CF5Q 3QLHA 2PC6A 1UVMA 2XNRA 2RS2A 2C2OB 1U1OA 2RDJA 3GYXB 3SCIE 2PMWA 4ES2A 3M6VA 1R3NA 4B3SJ 1LW2A 1HNZJ 1UEKA 3UDVA 2JNJA 3H40A 4ZJQA 1H7WA 4KKOA 1HMVB 3JTNA 4O3PA 1VFJA 4PWWA 5D0GA 1MG7A 1N5YB 3ZXWA 2RSQA 2D69A 4M8LA 1LFWA 3CJTA 4IG0A 4ZJLA 1PO6A 1ELOA 1QAXA 4QWCA 3L4BC 2KH9A 5A8WB 1RAGB 4EWTA 1X5TA 1Y4ZB 2M0GB 4WU3A 1MSWD 3A8IA 1VQ6S 3IC1A 4R5PB 3IR7B 2FJXA 4RUCA 1X4BA 3FJ2A 1YSJA 1EETB 4LF4F 4AYBD 4A8SA 4W4MA 1Q53A 4B3MJ 2OI2A 5HN0A 5A6PA 4S0MA 3RB3A 4O3RA 4KAIA 2F5GA 2H51B 4OMFG 1C0TA 4OJHA 1YVFA 1N5VA 4NCAA 1RKJA 3JSRA 1ZTTA 1M1KT 1PYTA 2ZNZA 1JQGA 1JLCA 1U02A 2IYGA 4UF4A 4C11A 1YRTA 3QYYA 4E0DA 5IC4B 4IR1A 4UY85 1T9VA 4KPCA 2M8DB 3HP6A 1UAWA 5DLGA 1QSYA 2V8HA 4J9VA 2PI4A 2KXHA 4OZJA 1HNVB 1NDCA 2G0JA 4EBEA 3MR6A 3H42A 3FSIA 5HROB 3A3PB 2R8HA 4MAKA 4JI5J 4LSNA 3CULA 4M5JA 3DXSX 4JV0A 3EGWB 4J9PA 3LGNA 3UDCA 4MIAA 2B9YA 4URQU 1RP5A 1NRKA 2Q3PA 1U48A 3RG6A 2L48A 4ECZA 2AIRB 4C0BA 4ZA1A 2E9ZA 3FKBA 2KG0A 1S6OA 2YQ1A 5LXRA 3NP5A 4N76A 2K8GA 2EWHA 3HZEA 3PHEA 3W2VB 3OFFA 4F2SA 4UY8T 2E7VA 3F41A 1FDBA 4JI2J 2DEIA 2XWXA 3I4PA 1S6UA 3MPYA 4LF2A 4FF4A 2DY1A 4B9SA 4LIRA 3HJFA 1FXDA 1S1XA 2MSSA 4DQIA 1UPMB 1Y7PA 3ZFVA 2KYXA 1NDLA 1RTIA 2ABYA 1HHQA 2HVEA 2Q6CA 3VR1A 2EFQA 3C16B 2RNEA 4LVNP 1D3WA 1X5PA 5F9NA 2K06A 1E6VA 4DQSA 1U1NA 1RT5B 4YOEA 4ZLPA 2Z56B 2NUHA 4O44B 2YNFA 1NPRA 1ZYQA 2J8AA 4Y3CA 2MPUA 4IRCA 4LR8A 4NYZA 1B0PA 1RABB 2APOA 5LSLA 2CPEA 2VG5A 5A8RB 5KFSA 1PJ5A 3CDWA 3D1HA 2ZZMA 1RCXB 2Y9HA 4MKVA 1LWEB 4U8YA 4NZ0A 1N5QA 4AXJA 3KLFA 1N36J 1IBKJ 1O8BA 2GO9A 3EICA 1OO0B 2CNLB 3NWGA 4DPXA 3PKMA 2XI3A 3MM7B 3H5XA 5D77A 1X31C 1M1HA 1OIAA 2K2PA 3QIPB 4V1Ak 5IQQA 4Y65A 2AW0A 1OPIA 3D3CJ 2W7PA 3D1OA 4IDKB 3I32A 3QFWA 4U67Q 4TXSA 4LF9F 3MEGB 2UP1A 3VAJA 4WK1A 4WCEQ 1U6ZA 2E5LF 2CJXB 4FXWA 2PEHA 5M2RA 1RTJB 1UW4A 4P72A 4A8QA 1T3OA 1EB0A 4P52A 5AXKA 3DRPB 4CP5A 1VHFA 2QZ8A 1S1WB 1RGVA 2B43A 4XPCA 2G2OA 3PVXA 2PT0A 2EG2A 4AL6A 2H5IB 1NK8A 3K57A 1BHNA 2B6AA 5T7LB 1RAJA 1UZHA 2KT2A 2A6MA 1KD1T 1YBTA 3M32B 2VICA 2B51A 2KTQA 3HT3A 3T6JA 2AJ4A 1KSPA 4O3QA 5ETTA 3CIZA 4X65F 3HHLC 3AOCA 3MFIA 4Y34A 4JI4J 2AJFE 3MMBB 3GV7B 4DR3J 4JUZA 3QWPA 2V2VA 4G65A 3M2UB 4DR7J 2CADA 5E5NA 4ECSA 3N5FA 3TP2A 4OZ3A 3HPOA 3VQTA 4DL5A 3CD0A 3PRVA 1CS4A 1RU1A 4WFZA 1N6QA 3VZIA 4IO9Q 1GNKA 3M8ZA 1IKYA 2XYPB 4X62F 1UJ4A 2QT7A 1IUJA 1NLKL 1NNDA 1H0HB 1KQSR 1RUSA 2IRUA 2CQ2A 1L3TA 3NKYA 2QV6A 3POTA 4OJ1A 3PRBA 1KTQA 5GAGU 4GO7X 1VC0A 1OJ4A 1SB6A 4ERDA 2BXJA 2E9RX 3GJRB 6FD1A 5LSRA 2DGSA 2HZCA 4BLGA 3OTOJ 1DFDA 1VBZA 4TN2A 4IQXA 5KG5A 5FLXU 3O3LA 4RNNA 2XG8A 1TV6A 5J1EB 1HBMB 3RRHA 2HGMA 3W5YA 2P2CB 3PIPQ 4EBCA 2BYCA 4XO0A 3PTWA 2V67A 5I42A 4B9UA 3A4TA 4O0NA
chains in the Genus database with same CATH topology
3T1YF 2PGCA 4YUDA 2FUG9 1VQ7S 4B02A 2FJDB 4NRUA 3JYTA 4Y2KA 1HBOA 4ICLA 1QAJA 2GMJA 2RKIA 3HX9A 4QBUA 5LXYA 4RUHA 2EFGA 3UR0A 2LQJA 2Y1IA 4ID5A 5A8RA 4KBIA 4B9VA 5KFFA 3E8OA 5KG1A 4KC5A 3D0GE 1HBUB 3SDEA 2CQGA 4ZPBA 3MAQA 2HVIA 4Q8FA 3CO9A 3Q0AA 2IVFB 4OHZA 3N6MA 5EX3A 4CI0B 3RAQA 1Y0HA 2OAUA 3IGNA 4FVCA 5HMYA 3OJSA 3G6XA 5IT9Y 1F2GA 2NLWA 2V8VA 4OI4A 4DPOA 1LWEA 1G7CB 1AXQA 2ADCA 1RK8A 1TK0A 1K9MT 3AB4B 1VQPS 2NQPA 1FD2A 4LJMA 2D1CA 3TAQA 2R8IA 4TKTA 5D8HB 3T9ZA 2PN6A 5E3AA 2JDJA 2VD3A 1KLMB 2MJNA 1C1CB 2PDAA 2YNGA 1PSDA 2FDNA 2LXFA 5DM7Q 1X5OA 3DOLA 2Q1LA 4KHMA 5D4NA 3PXGa 4B17A 3UE2A 5T14A 2KB2A 1L5UA 2E1CA 3PACA 5DG9A 5A2QY 1WHVA 2YKPA 2W25A 3EUNA 3UCZP 3WZ0A 3IWNC 4C97A 1UWBA 5D3GB 4H54A 3MECB 2IRXA 5L1KA 2OLWA 2VG7A 1S79A 2M88A 4U9RA 2HHUA 3FMWA 3QO9A 2YKMA 3QIPA 3BGUA 3FDSA 3IO1A 3QGHA 5KFNA 4R8UB 4CT9A 1T94A 2JC1A 5BYSA 3M1VA 4IFVA 4CQ1A 1DTQA 2LEBA 2YH1A 2C3OA 4TLRA 3NCPA 4FXDA 1YITS 3QJJA 2CQIA 1X4EA 1WTBA 1VOMA 2QA4S 3SSQA 2HGNA 3R1LA 4BWMA 2ILYA 3M8QA 1LWCB 1R8PA 1J5OB 4WE1B 1V3ZA 2PA3A 1C1BB 1FKOA 2A18A 2NREA 4IDKA 2RUGA 2IM3A 2QLXA 1YTYA 4JYAF 2MGZA 5F8HA 3EGZA 4DR5F 4Q0BA 3I82A 3MXHP 4LUBA 5B09A 5IT4A 1V9OA 1C0UB 2AGOA 1WF0A 2J0QD 3OL9A 3MEGA 3KHLA 4J9OA 2DGOA 2DNQA 4DUZF 2J7KA 4RW9B 2C28A 2BRKA 1DZ5A 3K8VA 2KVIA 4JV2A 4I0WA 1SI9A 5E2QA 4OIXA 2ZH9A 1T95A 3OBIA 1D8ZA 3GFYA 2WAQD 2ZOMA 2CJ9A 5HMXA 3SQGA 3BQ2A 1Z2LA 2Z2MA 4DL3A 2HHHF 2BM0A 4JI2F 1S0NA 2GGPA 2LQ5A 3MPVA 3J7Z5 4FBUA 3RYLA 3ZZZA 1RTJA 1NJWA 3FSXA 1VQKS 1G2EA 5SZTA 2XMMA 5E3QA 2F9DA 4PQUB 1JJ4A 2KRBA 3L3CA 1XC9A 2HG4A 1SXLA 2CIMA 3PRDA 2UUBF 3DRPA 2VPWB 3E3XA 4IG3B 4RW4B 3AQOA 2ZH1A 4PWUA 2WK4A 3R1HA 2F8MA 5L9XA 4C3KA 1ZETA 1DARA 4O4GA 2C3UA 3OTBA 4MK7A 1S1WA 4RBUA 4YDXA 5GAHU 1S6QB 1NJYA 2J9EA 3FRZA 2BABA 2M5YA 1B7FA 4K4SA 3M2VA 2YKNB 3G8TA 3AAWB 3DU6A 3LALA 2A2CA 1FJGF 1NK7A 4C4WA 4OLPA 5JUMA 2F4VF 3FGVA 4ZCLA 1AROP 3V6KA 2YKAA 1FRLA 1S9GA 2CKWA 2P6TA 4EGLA 6FDRA 2XMKA 1X7VA 4WZMA 2HNDB 4AUKA 3NL0A 5IM0B 4QW8A 2GHWA 1HFEL 4Y6IA 5B0FA 5AXNA 1JLEA 2OTJS 4I68A 3IR6B 4DSIA 1XR5A 3H8YA 2HVHA 5F0WA 3M32A 3OR1A 4X66F 1VRTB 1AFJA 3JAMY 2VODA 3R27A 1XBWA 1F5AA 1QSLA 1T03A 2PI5A 4I64A 2JLFA 1GQEA 3ICLA 1NAQA 2CPXA 4HDHA 2AX0A 5I4MA 2LKZA 2XBPA 4KB7A 1RTDB 4LSLB 1JWWA 4EYIB 3MDFA 3RAMA 1MWZA 1ZZFA 1APSA 3ZZOA 1SJQA 3KJVA 2FVPA 2C3PA 1UA0A 2KFNA 1FK9A 3GFHA 3V4IB 4KFBA 2F1FA 5K8PA 3R3TA 1X9SA 1HARA 2K1RB 4UQTA 3MMBA 1F9FA 5K8MA 3N28A 1SIZA 2M8HA 2FVQA 5G4DA 1FE0A 2PMHA 4UW2A 1N88A 1LK7A 1L3UA 3CCLS 3BO2A 1KLNA 1G3OA 3DLGB 1RT7B 2JFDA 4QWDA 4I6WA 5KOXA 1KNZA 4TY8A 5C24A 4I7FA 1BGXT 3EX7B 4BHQA 4A8WA 4ECYA 1CC8A 2DHAA 4ED6A 5DJBA 1UVNA 3OLBA 3DC2A 1SJFA 2DPIA 1IM4A 3DLEB 2OJ3A 4ZP6A 3V6DB 2ZH3A 5DM6Q 3NLCA 5L1LA 3T1HF 3E01A 3G8QA 3HKWA 3TNVA 2JH3A 3M8PB 2GJ2A 2ZDPA 3MM9A 1U6BA 4L72B 3L7OA 2ZE2A 4CO0A 4RW7A 3W3SA 1FKAF 1XR7A 2HNZB 3LP1B 4QYRA 5HP1B 2ZC4A 3H5SA 1IBKF 2DR9A 1N36F 3OLAA 1X4GA 5IXUA 2XULA 3RZAA 1LW0A 3PO4A 4C3MA 3FZBA 1JIHA 1XMQF 1TKXA 1TL5A 1TVRB 3PFEA 5EX0A 4K2XA 3PR4A 2GCFA 4KQZA 4NA2A 1YJRA 1E6YB 2WOMB 3T5HA 3KOAA 3VAFA 2J9DE 4ZVEA 2JWNA 4Q45A 3SI8A 4B9MA 2PFFB 2R2TA 2XO7A 5EN1A 3GR1A 4NWBA 1TL3B 2I5JA 2CPJA 3KLIB 3LH2S 4URSA 4QIEA 3Q8PB 3RB6A 1KN6A 4DL6A 2BUNA 4OI1A 3BDPA 1B0VA 1NKCA 1D9DA 1DTTB 3CJ3A 1H98A 5C42A 2JHEA 3UFCX 3KLEB 2EBEA 1BQNA 3M30A 2EW9A 4R0EA 2CJKA 3ZC4A 2FIUA 3GB0A 2BE2A 4G1IA 4FXVA 3B78A 4X64F 1BC6A 1Q8IA 2FJAB 2V4RA 4YY3F 3IFEA 2FGCA 4V19J 5KFGA 3E51A 4MMOA 2M4MA 2HMIB 2ASJA 1MW7A 1WG1A 3DN9A 1C2PA 4R0JA 2XMWA 1VIOA 3KLGB 2XLKA 5CYMA 4QU6A 4A48A 3QZ8A 3KTQA 1Q8BA 2MQMA 4NLUA 1KHVA 2Q79A 5B0EA 1PC4A 4PG8A 5DQIA 3OL7A 3EZ5A 5A8KA 4NLWA 3T5LA 4KGMA 1FVQA 3OXLA 1NK0A 2M70A 3OSNA 1YQHA 3R5BA 4OI6A 1HBMA 2O67A 1NK5A 2F40A 2JOQA 2MYFA 4F67A 3NNAA 2DRAA 3VAGA 2V2KA 3RAXA 2X51A 1REVA 5H9FJ 2AGQA 3I9ZA 1NK9A 2BDPA 2G13A 3DDNA 5HBMA 4F25A 1QE1A 3AB2B 1WF1A 2PO4A 3PEJA 4HI1A 4NLRA 1TQLA 2PD1A 3DLJA 4F3OA 1H2TZ 5IS2A 1TKZA 2P9EA 2YWKA 1X4CA 2FHJD 2P9GA 5F0UA 1FVSA 5EWGA 2EK6A 3PX4A 4MKAA 4ZP8A 5JXSA 3Q8SB 3V6JA 2RRAA 4DX8H 4J9MA 2VC1A 1GT8A 5KFRA 2A2DA 2ZH4A 5KFVA 3LWLA 2BQUA 4I2PB 2DGTA 3QJPA 1JNZB 4WKRA 4I1TA 5DQGA 1HBUA 3RW7A 1GTEA 5C5JA 3CXCR 1H6KX 4YB7A 4ED3A 3CDAA 4ZDNA 1FNOA 3Q2TC 1A7GE 3DM2B 2E1RA 1IN0A 4IKAA 3CCSS 2BQ3A 2H9ZA 2DJWA 1NH8A 1VQMS 4Z37A 1UMJA 2DNPA 4QIFA 2J0XA 1DHMA 5DO2A 2HQIA 2O3DA 2HVZA 1VBXA 3BDEA 1HR0F 2XS2A 2XNQA 3QGIA 2FC8A 3MI7X 1R8CA 3N0VA 3TVYA 1KLMA 1GAOA 3GZ7A 3CIMA 2GV1A 1C1CA 3BGRB 2IMOA 1FRMA 2MZQA 4OI2A 5KFDA 3WDOA 2QSWA 3CMES 3I9V9 1D0EA 3PZPA 3HHLD 1X4HA 2CYYA 1ZM9A 4I69A 3Q8QB 4K5SA 3DLBA 1EETA 5GADI 2BRLA 3EXCX 1YRUA 1RYSA 1U47A 3GIJA 4DSKA 5F8MA 1S6PB 3HHLB 3PV8A 2DVIA 3CVKA 4DG1B 3GIKA 2RH3A 1KEKA 2HS4A 1Q82T 5D3GA 3MECA 2VPZB 2ZJRQ 2JVRA 2WB1D 3CDEA 1S9EB 4JI4F 3K5LA 4R8UA 3VQSA 2DH9A 3JSMB 4HDGA 1U8SA 2GHVC 2MMYA 1JLQB 4DR3F 5HLFA 3LF0A 2W4CA 3US5A 3UW1A 2P9CA 5AJ3F 2AQ4A 4PXDA 2JLGA 1MMLA 4MJKA 4ECVA 2AV5A 4P6QA 4MKBA 3CCQS 4WFAQ 3B4DA 1LWCA 2R7OA 3F56A 1J5OA 4WE1A 3TAMB 4QJVA 4G1QB 1C1BA 3SSSA 2ASYA 4PWDB 3B8HA 2KXNB 1P1TA 2GJIA 4HLBA 4Z2XA 1JK9B 5BJRA 3THPA 1C0UA 4J9QA 2NPIA 2Q66A 4HVZA 2MKJA 1S0MA 4K0KF 4DL4A 3H4DA 1VQNS 3TA0A 3U02A 3FZ2A 4USJC 4DFJA 4RW9A 3M6WA 4RX6A 2IVYA 1HQEB 3G6VA 2OPPB 5KFUA 5E33A 2HRUA 5KT6A 1KQGB 1S9FA 2OPSB 3T6BA 1M5PC 3AHPA 3H20A 2VA3A 1VQYA 3V2UC 4ZP9A 2FHOB 3AJ1A 4FVMA 4IH7A 4DR6F 2W8LA 2VUGA 3PIOQ 3GIMA 2DGQA 5DRKA 3H4BA 3D5MA 3MAHA 4HH1A 4M1KA 2CPIA 4DEZA 4NPOA 4EZ9A 3IBWA 4OHXA 2O5DA 4F2RA 2NS1B 4PQUA 2HYIB 2B9XA 1Q79A 2L9DA 2CG4A 1FTCA 2R7WA 3BN4A 3JB9k 1VQ4S 4PPZA 1X4DA 5BYQA 4ECTA 4IG3A 3UD4P 3KFWX 4RW4A 1LOUA 2HS3A 1SBRA 2ZUGA 5M2PA 1RT2B 4QIGA 3K0JA 3EPGA 1S99A 1WWHA 1M0SA 2NYIA 4O23A 2K7KA 3CD5A 2VOPA 4RNOA 1OSDA 5H9EJ 5MAOA 1YHQS 1CQNA 3G96A 2UUWA 1O51A 2YKOA 2YKNA 2KFYA 5AE1A 4L6V3 2MZTA 3C6UA 3L09A 2ZM6F 1S77D 1R8AA 3LAKA 4ZKAA 4F4XA 5J2QA 3PO5A 2E66A 1IKWB 1U7LA 3CT9A 3OTDA 2W4DA 1HI1A 1Q7YT 1GX5A 2KT3A 4NA1A 3M4XA 1VQLS 2KM8C 4LF7F 3RR7A 2HNDA 4LVOP 2MQPA 4UUWA 5IFMA 2R7UA 5LT5A 2X1BA 2R2SA 4J9LA 4B3RF 2ZBIA 3NMRA 1UEVA 4C98A 1VRTA 2DD8S 2OH2A 2JSXA 2FLNA 4JBCA 3IAM9 2XEXA 4DL7A 2LYVA 2NPFA 5KG3A 3CC7S 4UUXA 1JMTA 2MZJA 1FE4A 4Q7AA 1BQMB 1ZM4A 3ETOA 3CMAS 2QSFA 1RTDA 1FNXH 1HWKA 2DNRA 3S7RA 1XNRF 4ZHRB 5CCMA 1JXEA 3MR5A 4ZPAA 5L38A 2R8KA 3IWXA 2D3UA 4DUYF 4FF3A 1U24A 2XHWA 1MROA 1U25A 2FVCA 5CYJA 3Q23A 1KFDA 3BS9A 5B0DA 2UXCF 3DHXA 2K1RA 3VAIA 2N3OA 2HHWA 1FRHA 1TKTB 4H4MB 2MZ1A 2LLZA 5GADU 2GA7A 3DLGA 1RT7A 1KS2A 2BVZA 2AD9A 3EYZA 4ILRA 1OPZA 1HPZA 5LJ3Y 1T3NA 2MZSA 3B82A 3CCMS 3BO3A 4DQPA 3OPKA 4PRFA 1GX6A 2KT5A 3DMJA 1X4AA 3DLEA 2HHPA 5AE3A 2Z4PA 3V6DA 1U09A 4ED5A 1FXRA 3AA9A 2KHCA 2R7QA 3M8PA 3MWBA 4M5DB 3CDUA 3NG8A 1TL1B 3O2IA 3C66A 4FZVA 5HQ8A 3HDSA 4USIA 3K5MA 3C3LA 4M94A 4Q44A 3HHDA 2E7WA 2HNZA 2VG6B 3ITHB 2G4BA 2D7SA 5HP1A 2N82B 5FLXY 4KO0B 1JKHB 4C8OA 4I67A 2HLUA 4LFCF 4F4ZA 3SV3A 4KGKA 4CH0S 2CJQA 4ZPWR 1TVRA 3QGPA 1X5SA 2HFZA 2VBXA 5KFQA