3KGZA

Crystal structure of a cupin 2 conserved barrel domain protein from rhodopseudomonas palustris
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
145
structure length
145
Chain Sequence
SLRAQTAPGRWDGVAVMPYKQTAEAPFQDVSRQLLFADPNLACEWRYFEVDEGGYSTLERHAHVHAVMIHRGHGQCLVGETISDVAQGDLVFIPPMTWHQFRANRGDCLGFLCVVNAARDRPQLPTADDLAELRKDERIADFIRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a cupin 2 conserved barrel domain protein from Rhodopseudomonas palustris
rcsb
molecule keywords Cupin 2 conserved barrel domain protein
molecule tags Structural genomics, unknown function
source organism Rhodopseudomonas palustris
total genus 34
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kgzA00
4LLOA 2OZ6A 5KHJA 2IXHA 3H1WA 5I93A 1RTVA 1GQGA 3UKVA 2C0ZA 2D40A 1ZVFA 2GC3A 5KHKA 4F7ZA 1SQ4A 2IXKA 1ZZBA 2MPFA 1NE4A 1O3TA 4YARA 5LEKA 3NL1A 4HVQA 4HN1A 3C3VA 1GQHA 3S0MA 1CGPA 5CU1A 4HVOA 1SEFA 4L2NA 4KU8A 3M70A 1VP6A 1RGSA 3CEWA 3S7IA 3ES1A 1XE7A 5FLHA 4LTAA 2XKOA 3GBFA 4KWJA 2GAUA 1UW8A 4I01A 5JSOA 5C8WA 2N7GA 2O1QA 3EBRA 1YFYA 4D7TA 3MYXA 1ZRDA 3LZZA 2IC1A 2UYBA 3MDPA 4KL1A 2V09A 4LA2A 5LRRA 3IWZA 2H0VA 1ZZ7A 4Z82A 3ST7A 4DINB 3E6CC 1FI2A 4LUMA 2GC2A 5T3NA 1YFXA 3WW4A 4E2GA 5I0RA 5FPXA 2D5HA 3U10A 1UIKA 4Q0PA 1CAWB 4IEOA 3QACA 1Y9QA 3WW3A 2K9ZA 4EWDA 4Z07A 4K8FA 4HSJA 4EWAA 2KXLA 1YFWA 3ELNA 4EWEA 4AVAA 4AXOA 5KHIA 4Q0QA 2ATFA 3DV8A 3E6BA 4WZCA 4J1XA 1OMIA 1O7FA 5JSRA 3KGLA 5E1RA 4HSLA 4IESA 3BB6A 4IEXA 3EHKA 1OI6A 4FT8A 3KCCA 3ETQA 4NVPA 4ORFA 2F4PA 4YNIA 2GC0A 4XFHA 4YSFA 2OYZA 1PM7A 3FX3A 4I09A 1QWRA 4EROA 1CAVB 1ZZCA 4AVBA 3H50A 2GC1A 4E2SA 3ZDSA 3KSCA 4XFFA 1DGRA 2D93A 3BPZA 4R52A 5BY5A 1WA4A 3PVBB 4E2QA 4HVRA 4AQ6A 1YUDA 1O3RA 5BUVA 1OD5A 1QXJA 4XF4A 5BV6A 1X82A 3IDCB 4QM8A 1CAXB 4F8AA 4JVAA 3FHIB 4R8HA 2EA7A 4ZU5A 3KGZA 2PAMA 3BCWA 5I0TA 4UBHA 1TQ5A 1QY4A 5J3UA 5F1RA 2GU9A 1H1IA 1ZNPA 4LUKA 3I59A 4MGZE 4WBBA 4B29A 4XFAA 1RL3A 3LWCA 2WFPA 4MV2A 3SMHA 2FMYA 4H7LA 3CL1A 3LA3A 4BH9A 3NJZA 1V70A 3RDIA 3H1YA 3ACLA 1CAUB 2QJVA 1ZZ9A 3TNPB 3H3UA 3OD0A 4IERA 3SHRA 1CX4A 2ZKLA 1Q43A 3GYDA 3G7DA 1RUNA 2XKPA 4QGLA 4PIZA 1X8MA 4MUVA 1CAWA 1FT9A 1J58A 2IXJA 3CLPA 4TLFA 2Q1ZB 4D7SA 2PFWA 2ET7A 2BGCA 3WW1A 1YWKA 3ES4A 3H7JA 4XF0A 3RNSA 4O9EA 4QGNA 4KWKA 2K0GA 4KWLA 5EFUA 4FAHA 4I02A 1NXMA 5I91A 3CJXA 3UKTA 1Q5OA 1JUHA 1L3JA 3I59B 4O9GA 2O8QA 3E5UA 1IPJA 1UCXA 1ZRCA 4P9GA 4QX5A 4HBNA 3M3IA 3U0ZA 1LR5A 4X6RB 3VHRA 2OA2A 3CF6E 2VPVA 2Z2SB 1ZZ8A 2CAUA 3HIFA 3FWEA 2HJIA 4MGYE 1CAVA 2D5FA 3E6DA 4KU7A 1G6NA 1Q3EA 4QMAA 1RC6A 5J48A 5FPZA 5BXXA 5FDBA 3EO6A 3I7DA 4I0BA 5I8SA 4JTOA 3LA2A 5KHHA 3LA7A 5I0UA 1J3QA 2DCTA 3LOIA 1O3QA 5J7MA 3FJSA 3DL3A 5KHGA 5I0SA 4IEQA 5FCCA 2BNMA 2CGPA 1CAXA 5K8SA 4A2UA 2HKXA 5CADA 1EYBA 2IXLA 5FQ0B 1DGWA 4PJYA 5LEJA 1O4TA 4WVZA 4XF9A 4BIFA 4ZU7A 5E16A 2Q0AA 4YRDA 4XETA 4META 2Q4SA 3USSA 3D0JA 5LRSA 3E5XA 5JCTA 2GZWA 2CAVA 3RYKA 4OFGA 1O5LA 1SFNA 3D82A 2B8MA 2EVXA 2XL9A 3HQXA 4GULA 3BU7A 3NSTA 4XF3A 2BNNA 3JZVA 1CAUA 4FAGA 3BALA 1U12A 2UY9A 3I54A 2H6CA 3EQEA 4J1WA 3E5QA 4JTNA 2VECA 3RYPA 1O5UA 2XLAA 1I5ZA 1WGPA 4IEUA 4I0AA 1YHFA 1ZX5A 4MX3A 5AVPA 4PIXA 4MH0E 1EP0A 4AVCA 3TNQA 1FXZA 4BYYA 4IEYA 3WW2A 2WC2A 3HT2A 4L11A 3RPQA 1ZREA 1J1LA 2OPKA 3H3ZA 1XE8A 2XL7A 2QVSB 3FE5A 2PAEA 2QDRA 2XLGA 1XRUA 4AQ2A 2MHFA 2ET1A 4LULA 3B02A 3OCPA 4JV4A 3R6SA 2XHKA 3KMHA 3S7EA 4UBGA 4Q0UA 2I45A 2XLFA 3QOPA 1DZRA 4OLLA 3H7YA 3HT1A 3OTFA 2B9UA 2PHLA 4FBFA 3UKNA 2CV6A 4HZFA 1UPIA 1J3RA 4MZUA 4QM9A 2P17A 4HLTA 4XF1A 3PLQA 5FQ0A 4N9HA 4PIYA 3N4MA 4ONUA 4ZU4A 3NKTA 4Q0VA 4YYOA 1PMIA 1UIJA 2PYTA 1LB2A 5JAXA 3PNAA 2PTMA 2PA7A 5JR7B 4IEZA 4BHPA 4I2OA 1J59A 1IPKA 1I6XA 4XEZA 2Q30A 2FQPA 2PAKA 4QXKA 5CVRA 1NE6A 1VR3A 3EJKA 2ZCWA 1EPZA 4XFCA 5JSPA 2OZJA 3IBMA 1Y3TA 5FLJA 5D1IA 3NW4A 3OF1A 1LKNA 2H6BA 4I3PA 2EAAA 1J3PA 5I8YA 3CO2A 4Q0SA 4HMZA 4LEJA 4X6QB 2UYAA 4QGMA 4IEWA 1VJ2A 1LRHA 3D0SA 5BPXA 1NZCA 2IXIA 2GH2A 3SCHA 3MZHA 2PHDA 3E97A 2BNOA 3DN7A 2QNKA 3H1MA 2BEOA 2QCSB 1HW5A 3L2HA 3IIAA 3MPBA 5KBFA 1QXRA 3FFQA 4HN0A 3SXWA 3SCGA 1UD1A 4MGKE 2XGXA 3O14A 2VQAA 3H9AA 4N9IA 2E9QA 3NVCA 4UXAA 4LA3A 4EV0A 3OGJA 5C6CA 4XFGA 3FZ3A 2IXCA 3IDBB 4IETA 1X7NA 2BYVE 2ETEA 3U11A 5HI0A 1WLTA 2PQQA 4CYDA 4IEPA 4MGIE 1O3SA 1X8EA 2UY8A 1EY2A 3ROUA 3RYRA 5EZWA 1NYWA 4XFBA 1YFUA 1ZRRA 3DKWA 1RUOA 2Z69A 5I8TA 3RZZA 1OFNA 1YLLA 4Q29A 1H1MA 3LAGA 3H8UA 4IEVA 2MNGA 1ZRFA 3SCFA 2B5HA 5FLIA 2Y0OA 4XFIA 4RD7A 1DZTA 1ZZ6A
chains in the Genus database with same CATH superfamily
2JG8C 1UL9A 2VCMA 3RG0A 5J1XA 3H1WA 4XXPA 5F9TA 2ZHLA 2VUJA 1RUH2 4MXVA 3KF5A 4R4XA 4XHBA 5GJ6A 5A1AA 3KHBA 1RB8G 2GC3A 4CDWB 2D6OX 4JHZA 3SISA 2V73A 1VBC2 4CCLA 1UY3A 5ACA3 4JCKA 2X5IC 5C4WB 1NE4A 1O3TA 1SBEA 1R083 4S2DA 5DQ0A 4HKOA 2RDSA 1S0EA 5GLZA 4CCOA 2CU5A 3OG2A 3S0MA 1LODA 4DEQA 2R1BA 2DU0A 1KFXL 3DXUA 4XIOA 4DQAA 3CEWA 3K77A 4XUOA 5CIRA 1OHFA 1PK6B 4H55A 4Y4RA 1JTZX 2YGMA 5FV3A 3WG2A 4ISQA 4MHRA 2VU9A 1Q8OA 1UW8A 4LHKA 4OMDA 5JSOA 4XUPA 3T0BA 4XJWA 5FZOB 1VAVA 5C8WA 3W5MA 2N7GA 4I0WB 2O1QA 5DUXA 4AGVA 4SLIA 3MYXA 4PCRA 1MACA 2VQUA 4COZA 3OGSA 3KD4A 5CYYA 3P3NA 1LOAA 1EV12 2HEYF 1HV1A 5BNOC 3MDPA 2V09A 3KQ4B 1W28A 2VOTA 3UYJA 4DXSA 3KV9A 2W2IA 1ZZ7A 3ON7A 4OI1A 5GZEA 4DRVA 2OVUA 3SH3A 1JMUB 2ZEWA 3BI3A 4DINB 4DY5A 2SBAA 4FCAA 3ZIWA 3AZVA 1HRI2 3PTYA 1N1VA 1OOPC 2DCJA 4OZXA 4LBNA 2KA3A 2NPIA 3HNMA 4UFHA 2JDZA 3WW4A 2XVKA 1W3VA 3THDA 1QDCA 1DGLA 4NRMA 3DXTA 4FI9A 3RWKX 3NV4A 3QACA 3WNPA 3OEAA 1RXGA 2XJVA 5F8PA 2VUDA 4K8FA 4FPGA 2RS33 4J6GA 4RS5C 3O12A 1LOGA 1C8M3 2QZ3A 5GLUA 4EWEA 4YZ2A 1AL21 4AVAA 4A3XA 2FD8A 3VBSC 3D6EA 1Q8SA 4AW7A 4QKBA 3MUY1 4J1XA 1OMIA 1QJX2 1F8VA 1X36A 3KGLA 1QH7A 1ENSA 1JN2P 2Y8KA 2W1WA 4IESA 4TLGA 2WN3A 4IEXA 5FO9B 4AYUA 1FX5A 1HB2A 4QXCA 1KRIA 2Y38A 1GYKA 4GQ7A 3PIJA 1I9RA 4NVPA 3WDUA 3I8TA 2GC0A 4HKWA 4Z8BA 5LATA 4YSFA 5A3NA 3AKQA 1PM7A 2ZABA 4AL9A 3URFA 4I09A 5A1FA 4CEWA 3MW2A 1BXHA 4EROA 2HWD1 1DLLA 5GZFA 1ACCA 1R1A3 1U5IA 4OVEA 1W0OA 4GMP3 4CDWA 5FIXA 5C4WA 4IGOA 3ZDSA 4XFFA 4CCEA 2X29A 1ZRIA 4SBVA 4BQ5A 3TN91 2WABA 5E6HA 1ULPA 2HEWF 2W47A 4K1YA 2CWMA 4NIGA 3HVDA 2WR9A 1IPSA 4AQ6A 1T6BX 2GALA 5DUUA 5DZEA 1GP6A 3HWJA 1PGL2 1CZSA 2WQ4A 1RMU2 5FZOA 1UX6A 2C4XA 1CAXB 3PIGA 4F8AA 5FXXA 2QFEA 3FHIB 3MW3A 4AI3A 4R8HA 2ILMA 1FNYA 3THPA 3R4DB 5E8AA 4ZU5A 5JMCA 1RHI1 2E51A 2YBSA 4K1ZA 4XHXA 5LY1A 2D3PA 5I0TA 1QY4A 4RGKA 4QPIB 3OY8B 2ZZJA 4AHZA 2B7YA 1YJKA 1UOJA 1N3OA 1MQTB 1V6MA 1GZ9A 1H8TC 5F2WA 1RUJ2 5FPBA 4B29A 2ES3A 2VOKA 1BEV3 4XBLA 1REDA 3SMHA 2VMGA 2VOXA 1XYOA 2P3YA 1H9PA 2C26A 4XAAA 4BH9A 5ANNA 3OEBA 4GJZA 1CAUB 3B00A 4CP2A 4HKLA 1D4M3 3TNPB 3OD0A 1DQ4A 4LKEA 1DQ5A 1Z7S1 1Q43A 3GYDA 3G7DA 4JKLA 2UURA 3POJA 4PIZA 1F15A 2HWC1 1WCDJ 3VDCA 1N3QA 5F7UA 2WRAA 4XDPA 5FZ9A 5JZGA 3ZFFC 1FT9A 1J58A 4GMP0 5J37A 1YQ8A 2W1QA 4H3WA 1DIWA 1CPMA 3ZFEC 4Y1YA 3WNLA 2Q1ZB 3MBWA 4QT6A 3KQRA 2ET7A 5FYSA 1LOFC 2JKXA 5FJKA 4XF0A 4QHZA 4OI2A 1BMV1 5T50A 2P3KA 1WCKA 3WG4A 1W3XA 4FAHA 3MI8A 2BRTA 2JG9B 5FZ7A 2VNGA 4IDZA 4I02A 3JB4C 4QQHA 4BIOA 2YXSA 3LEGA 1POV1 3VKLA 4B7KA 3AZXA 3LFMA 3WVJA 1MEC1 1V0AA 3E5UA 4YPJA 4DUWA 1LNSA 2VM9A 4LPLA 4AVSA 1UNBA 3RGBA 3E1F1 5A6YA 2D98A 1SMVA 4M00A 2VNVA 4W4ZA 3CJIB 1OFSA 4BQ3A 2HWB2 1W05A 5T54A 1SLLA 1LHVA 2OA2A 3CF6E 3VN4A 2A3WA 4MLOA 1NY71 2R041 1DU3D 2VPVA 2Z2SB 3INAA 5JXHA 4CEYB 2QQVA 1V9U2 2HJIA 2ZGKA 1B35C 4MGYE 1CIWA 4XABA 1W03A 1GP4A 3BU0A 2ZMLA 1Z0HA 2R49A 2VZRA 5B4XA 2G9GA 2X8KA 3K4ZA 4RR3B 5BXXA 4QDSA 2IZWA 3EO6A 3M1HA 3THTA 5FO7B 1A8MA 5I8SA 2VCAA 1VBB2 1DYPA 2YPJA 3NMBA 5I0DA 1BBT2 4E4HA 4HK8A 2DCTA 3I2HA 2ZGSA 2LTNA 4V2VA 2XUEA 2ARCA 2DV9A 3MIDA 5J7MA 1PK6C 2D3SA 5I0SA 1NG0A 3GZAA 1WD3A 1CAXA 5CFDA 4A2UA 2HKXA 3AFKA 3AB0A 1NZIA 1RUE2 2VW0A 2ZHMA 4Y1ZA 1AL23 5FY8A 4MXWB 3ZN4A 1PMJX 3UL2A 1SPPB 1S0JA 2FBEA 4NHYA 3C7FA 2PLV2 2EIDA 4XETA 4META 3OY8A 5FZ3A 3VBOA 3VZKA 3O1TA 1ENRA 3M3CA 2WYFA 1HRV2 4A6OA 1MQTA 2OXBA 2Z5WA 1O5LA 2NLRA 2VMIA 5GLVA 5JWPA 2B8MA 2EVXA 4A7YA 2XL9A 3SH4A 1AR61 2DCYA 4BLIA 4LBMA 4YW6A 5JUVA 2B46X 5LW9A 1AR81 3CKHA 1CAUA 4CUCA 1DGRN 2KR2A 3WT3A 1OUXA 2B9VA 3KV6A 5KWRA 5ISLA 3N9PA 1JHNA 2QBXA 2V5DA 2AR6A 2VMEA 1PHMA 4L92A 4CUAA 4PLOA 1MZ5A 1SCSA 4WVVA 2HWD3 1WLCA 1O5UA 1X9TA 2XLAA 1NA1B 2YROA 1YI9A 1DYOA 3VDDC 1I5ZA 1RUI1 4HONA 3JXSA 1ZX5A 4GD4A 1ENQA 1PO11 2GNDA 2P6HA 2ZEZA 1UYZA 3GJAA 4WVMB 4DXZA 5JMOA 2OQ7A 3I2GA 4GKYA 3DECA 2WBKA 4YW5A 5CG8A 1TNRA 4AVCA 3TN93 2JG9A 3QH7A 4HETA 4UOJA 2XBO3 3PJQA 2WC2A 4AFDA 1LHOA 1GFF2 2AYHA 5HXVA 3RVHA 4LMFA 2OPKA 3ZFGB 2AH2A 3H3ZA 3M8LA 4G3YC 4BLJA 4C91A 3O1OA 4KBZA 2XL7A 2QVSB 2OX0A 2YDEA 3KF3A 3WQ7A 1O6UA 3FE5A 2H0BA 2PAEA 2ZHKA 3CJIA 2E31A 2A6YA 3B01A 4GKXA 1RHI3 3WCRA 4D0QA 2XLGA 4FPLA 2R32A 4WM7C 5A3LA 1HLCA 2QZ2A 3OCPA 3L2YA 4YG6A 4OHXA 4CEYA 3ZXLA 4AI0A 3T1MA 1DCSA 5J09A 5JXIA 5LZ6A 2JB8A 3OYWB 4PDWB 5IW0A 2ZGTA 3USUA 1DZQA 1W6QB 4Z2AA 2K2SA 2LUWA 3OB8A 4A41A 4L9BA 2GNMA 2RMU1 3WF4A 1E5RA 2YB7A 5T5OA 1Z7S3 3KS7A 4Q1PA 1LHWA 1UPIA 2AEYA 1PO22 4KG0A 4GA9A 2HWC3 1APNA 2VZQA 1W6NB 3N7KA 5CKQA 1VMHA 1PIV2 4MYEA 5IAXA 2HBTA 1XJAA 1J1TA 4IV3B 5FKBA 3Q8FA 4FOVA 5K0UC 1SBFA 1AYM1 4MXWA 5F39A 1JHJA 4XPVA 3HNYM 4ONUA 3WP3A 4FSJA 3NKTA 3MFAA 4YYOA 1K5JA 3FN9A 4GXLA 4R9BA 2DFBA 1IKPA 4IV1B 1RUF1 2WO3A 1QJU1 2UWCA 1DFQA 4HXCA 2O14A 3PNAA 4LHNA 5JAXA 2JDYA 4QPIC 4CCKA 1AX1A 4Q26A 5JR7B 3VV1A 3PMSA 4MGQA 2ZGUA 1POV3 5FMOL 1IPKA 1ND3B 2LROA 4MVTA 4XEZA 2R062 1MEC3 2VH9A 1W2UA 2Q30A 5D8AC 1CWPA 4BE3A 3UGFA 4CP0A 2PAKA 2QQKA 5LA0A 2FDFA 3Q8BA 4XZPA 5CVRA 3B9IA 1DBNA 1VR3A 3EJKA 2ZCWA 3LPFA 1SFYA 1QKQA 2VO5A 2OZJA 5JSPA 3IBMA 5LWBA 1CX1A 3V56A 4LBOA 1ZBE1 3OF1A 1JZ3A 5H9PA 1F4AA 5A1LA 4ZS3A 2YBPA 4Q8KA 3WQBA 1NA1A 2D6KA 2WNVB 4XJ9A 1FPN1 4CSWA 5FZFA 5ABJB 3AP9A 4RHV1 1ULCA 3AZYA 1VJ2A 1LRHA 2WNEA 2YV8A 4WVMA 5BPXA 5JIUA 3AKRA 5EYYA 3WD5A 4CP1A 2PHDA 3IMNA 1BK1A 3E97A 4YM2A 3H42B 3NJYA 2BDRA 4P5HA 4PLNA 4FTEA 1HJGA 2BNOA 1UY4A 3VL9A 4ASLA 4OUEA 3VZNA 1WA6X 3GALA 4FP2A 3GZEA 2DWRA 5H9RA 1BHGA 4JKMA 4BMEA 3S5AA 1R093 1HW5A 3L2HA 3MPBA 4Q2FA 3ZFGA 4DUXA 1AX2A 2VGDA 3P3PA 3VBRB 1V6NA 1S0FA 1JBCA 2JWPA 1VIWB 3V64A 3QLQA 2XGXA 3AMMA 3O7OA 3TEYA 5HCBA 2VTXA 2TNFA 3N9MA 5A3MA 1PGW1 2J1VA 3WCSA 3ILNA 4DXRA 1CR7A 5F5IA 3C7OA 1WKYA 2VC9A 5C9AB 3PHMA 5DAQA 3OGJA 4EV0A 4XFGA 5K4LA 3AMPA 3CZJA 2DUPA 2WO2A 3FZ3A 2W52A 3LIHA 4PDWA 3IDBB 5DDJ2 3WDTA 3PVOA 5A6XA 3VDBA 1W8FA 3O1VA 5C8CC 2DVBA 5FZHA 1GMMA 1XC6A 4CDXC 1STMA 1W6QA 1AR63 3U11A 1Q56A 2PHRA 4IW3A 2DU1A 2ZGMA 1AR83 1HJFA 4IEPA 1W9YA 1S2KA 1S0GA 4RR3C 1MVQA 1HN0A 3BODA 2WT1A 4AHYA 1QOTA 3U1XA 1K3IA 2UY8A 3FLPA 3K48A 4CVUA 3WR0A 3J8F2 4F3JA 5CAZA 1W6NA 2R072 3W9AA 2VXJA 1WW7A 4QPWA 3W58A 2ZXQA 4QD2A 4QAWA 3RZZA 4BXSV 1RUI3 4IV3A 1OFNA 4Q29A 1N1TA 1PM4A 1QJFA 2QQOA 3O0WA 4N7UA 4Q4X2 4X8PA 3T2TA 5LK7B 3BGAA 5GLWA 3SCFA 1XU2A 2B5HA 5CKMA 2W1SA 1OQDA 2J1RA 2WFF2 4FXGB 4KG8A 2Q8OA 5ACA1 5CFCC 5FY7A 3H8RA 1OC1A 1F4HA 4IV1A 3R4SA 1D4VB 5AFEA 1OA4A 5CISA 4CCJA 4UFMA 2XDVA 1JS9A 1KFUL 3RZMA 1G8WA 5KHJA 1ND3A 4DY3A 4HK9A 5I93A 1RTVA 5IK5A 1NOVA 1GQGA 4B4PA 3UKVA 1H2KA 4BQ2A 3I2IA 5AC92 4B1MA 2JIGA 4M0NA 4CCNA 1NKGA 4Y4YA 5FZLA 1GNHA 2K46A 3ZYGA 4DEVA 5CG9A 5KHKA 5LBEA 2J42A 4R9DA 2VZPA 4YARA 2Y60A 2RHPA 1ZBA1 2WO7A 3POGA 1OD3A 1OLRA 1GQHA 5CU1A 4HVOA 3GJBA 1RXFA 1SEFA 2WNVA 1D2SA 1VP6A 1RGSA 2WT2A 4QX2A 5FKCA 3S7IA 1OLMA 1IG0A 4AGGA 3GNEA 5L9RA 2R1DA 3LF7A 2I07B 2EALA 5FXVA 4PQ9A 1N3PA 1YYNA 2VD7A 4XJAA 4N53B 1KQRA 1C57A 5FP7A 4AR2A 4BQ4A 1UX7A 2A6VA 3JBG1 1OT5A 1VMFA 2VVFA 1SLBA 2VZ1A 2WNUC 4QB6A 3ZN6B 1YQ5A 4D7TA 2WAAA 1XPWA 3IN9A 4AE2A 1SG3A 2YC2A 5LB6A 3AYCA 1ZRDA 4QQLA 3LZZA 1ND2C 2IC1A 3RFRA 2UYBA 1OA3A 2XJUA 3WNKA 3VBRA 1AYM3 2H0VA 4D6QA 1R082 4Z82A 3ST7A 2RS31 5FYVA 4CCDA 5BNPC 4CDXB 2NQYA 3T0DA 2VVDA 4PBPA 1QMJA 1RUG1 4W65A 3E6CC 1RUF3 4QQOA 1Q8QA 1QJU3 1BYHA 2GC2A 3OUJA 4Q4Y2 5T3NA 2D7FA 3WV6A 5C9AA 4UFIA 3VZMA 1YFXA 2BBAA 2Y6HA 2B4KA 2J22A 4RYDA 1S2EA 3WHUA 3C2UA 5FPXA 3AP4A 3VZJA 4UI9L 1CAWB 4OUSA 4IEOA 5DUVA 1VRBA 4EWDA 2LS6A 4Z07A 1ZYBA 4Q4W2 5T5LA 4HPKB 2KXLA 1YFWA 5JOWA 2Q8CA 1YQCA 4UF0A 3JU9A 1SDWA 3J7HA 4MHUA 1ZBE3 2VW1A 2DVFA 1GWLA 4WZCA 1XQNA 3VBUB 2VULA 1COV2 1O7FA 1US2A 1FPN3 1AF9A 4P5YA 4RHV3 1BK0A 1YI7A 4W8JA 1N1YA 1WBLA 3EHKA 4XC9A 1RVF3 4GMP1 4JDMA 4NHMA 5DZGA 4YW7A 4IV3C 3RMYA 3CMGA 2O0OA 3U07A 4LIVA 2CTVA 3KV4A 5FZ0A 1CONA 4WM8C 2JDHA 3WDVA 1X33A 4D69A 4LK7A 1NCRC 3ACGA 1GOGA 4P9JA 4P9XA 3ZLIA 3RZHA 2Y6JA 4QB1A 3HMYA 2OYZA 3FX3A 3WX5A 5HCFA 4YG3A 4GH4C 3BVCA 3K75B 5F3EA 1XOYA 1QWRA 3UESA 4CU6A 1EAH2 2YU1A 3KT7A 3KHCA 1JODA 4BXFA 1C8M2 5BNQA 2PMWB 1CAVB 4IE0A 2QQIA 2E26A 4KQ7A 1LECA 2YU2A 1TE1B 3KSCA 5EIYB 1D7PM 5IUQA 4UW3A 4ES9A 5BY5A 2WL1A 3ACHA 1VBC1 3MLLA 3MLJA 1OBNA 2XQXA 3KLSA 4K21A 3VBFB 1PGSA 1JYWA 3AXDA 4AI9A 1JOJA 1GR3A 4HVRA 4MOAA 1YUDA 4NIIA 5BUVA 1OD5A 2BFUS 2ZBJA 4D6RA 3P1IA 4CDQA 2Y0IA 3J9SA 5ABJC 3N9NA 4CUBA 3HBZA 2ZOEB 3FBMA 1QJZA 3IDCB 4XXAA 4BK4A 5FOBB 5JPMB 4AFCA 1W90A 4N43B 4N53A 4U2AA 1TMF2 1VBE3 2A5ZA 1UXZA 2WT0A 3W21A 1W6OB 3ZN6A 3POEA 3L9JT 4E27A 4NN0A 4NIDA 1K5MC 1JZ4A 1H1IA 1UOGA 4LBJA 5D21A 4LO5B 1V6IA 4CEWB 3O1PA 1D0GA 2JKBA 1UO9A 1HXS2 3FBYA 1JZ6A 4WBBA 4XFAA 2WFPA 3BPSA 3TRSB 4MV2A 3WINE 5IFPA 4QPGB 2Z4FA 4C90A 4CDXA 2GN3A 3LA3A 5IJRA 3IZOA 2PELA 1WMFA 2PHFA 4LOTA 3WXPA 5L9VA 3H3UA 1OXCA 2ZACA 4COVA 1UU5A 3U37A 1TNFA 2XR4A 5JI9A 3N7JA 4QGLA 1F5FA 4M0HA 1X8MA 3VBHC 1CAWA 4BB3A 2IXJA 2WZR2 4GJYA 2I2SA 1UU4A 4HPKA 5HCAA 3OPZA 2W87A 1XNAA 3KWVA 2BGCA 3ES4A 2A3YA 1ZBA3 1PVXA 2TBVA 5FZEA 5A7OA 3VD4A 4KWLA 5EFUA 1RIRA 4B4QA 5A3OA 3ITQA 2F17A 3OD4A 3VBUA 1W8ZA 1MZFA 3OBTA 4PLMA 2BJSA 3VKMA 1NXMA 4XBNA 3NAPB 1BEV2 3CJXA 5CB7A 3UKTA 1Q5OA 2WYSA 3O5SA 4WVWA 5FUPA 2DURA 1L3JA 2JDAA 4O9GA 2O8QA 4P9YA 4LO6B 1QJX1 1LHUA 4YFWA 1ZRCA 4A7ZA 1D4M2 2EXHA 4P08A 1UYYA 3M3IA 3JBG3 1QNYA 1C5IA 3ZO0B 1QQP2 3VHOA 2J1TA 2QQPA 4JC1A 3VHNA 4AHXA 2XPJA 4X6RB 2WA3A 2Q1FA 2RS51 2CAUA 3GDBA 1GOFA 3HIFA 1G9FA 3FWEA 5JZGB 4LORA 4ARYA 1CAVA 2D5FA 3CDZB 1G6NA 1F9KA 2X53S 3DPRC 4COYA 1JZ5A 3TAYA 1REEA 4KBBA 1KEXA 4GWMA 2EAKA 2P2KA 1JOPA 3NNJA 1E5HA 5FDBA 1RUG3 1AR92 3I7DA 2DCKA 1Y9MA 4D3WA 4GB33 4HG6B 4UWDA 3VBFA 5KHHA 1US3A 2YC4A 3NO8A 4URTA 2ZX3A 4AAXA 2DVGA 2JE7A 3LOIA 3P6BA 3T4VA 1O3QA 5IVFA 1H2MA 5AVAA 5KHGA 4YGCA 2IUWA 4YVWC 3WG3A 1VBA3 4N43A 1YNAA 3ME2A 4UYBA 3TEXA 4BMBA 5CADA 5L7OB 4A3ZA 1F31A 1LESA 1O4TA 1RUC1 1W6OA 2OS2A 5A6ZA 4CXYA 3AJZA 2D43A 5IWFA 5E16A 2Q0AA 3OUIA 4YRDA 5FMOS 4C8DA 2P3JA 3BTXA 1RMU1 1PGL1 3MF6A 3ZSJA 2XH6A 3K51A 1U0AA 4NUBA 1OKQA 5JCTA 1LGBA 4L8QA 2CAVA 3VGIA 5FZMA 1SFNA 3D82A 1AYN3 3S6PA 3ZYJB 3ZXEA 4QPGA 2R16A 3N9LA 2F6BA 4XF3A 1C8NA 1GNYA 2BNNA 4OHZA 5FPUA 1W8UA 1XXNA 3K46A 2FDJA 2UY9A 4MGSA 4Y5TA 3AFGA 4FPKA 2OT7A 4NO4A 1JYVA 2H6CA 4NWVA 1KS5A 4JZRA 5T5JA 2RS12 1F2NA 4J1WA 3E5QA 4JTNA 5JI7A 1V6KA 2HLEA 5FY1A 5FOJB 3GBGA 2VECA 5SV5A 1WWYA 2WWJA 1NLSA 2R0HA 2XBO1 4BU2A 4NHLA 2YPDA 3RRDA 2XJRA 1FATA 1GLHA 2JD4A 4I0AA 4IEUA 1IS5A 1I3HA 1SACA 1YHFA 2Z42A 4L0PA 3J26N 4YWAA 5IVJA 3SC7X 3RJ2X 1LCLA 5CFDB 3EYPA 3ZMNA 1A3KA 2ZA9A 3VKOA 4ZHNA 2VCCA 2DCZA 1H8VA 5CKNA 2VXRA 1VBC3 3ZM8A 3VBOB 3ZSLA 1LGNA 2CNAA 4Q4V1 4UW6A 3NAPA 2WS92 1FXZA 5FP9A 4BYYA 1D0HA 3SLIA 1U5XA 1X50A 4IEYA 3WW2A 1MVEA 1WD4A 5A33B 2WKKA 3HT2A 4L11A 5FO8B 5FUIA 3VD3A 1ZREA 4QX8A 1GICA 4E4SA 1J1LA 2GH8A 1W99A 1L7LA 2MEV1 1QEXA 1XRUA 4U36A 4LULA 2ET1A 4V2WA 1ASJ1 3PJYA 1OH4A 4JV4A 2ZGNA 4NHKA 3R6SA 2BGOA 1FOD1 4X8NA 4Z92B 1S4CA 1T2XA 2ZJCA 1QJY2 4UBGA 2HWB1 2WINB 1V00A 3SEPA 3S30A 5B4NA 2FDGA 1VAKA 3O0VA 4OLLA 3WF1A 3OTFA 4CXXA 3BTYA 4D94A 2WIIB 1W04A 5DXDA 2XHNA 3ZPYA 3GHMA 1IOAA 4YM1A 3WUCA 4I30A 3B93A 1CQ9A 4MZUA 5FP4A 3KV5A 3PUSA 2C9AA 1O8SA 3T3YA 3I2OA 3S5QA 4KH9A 2A75A 3A7QA 4HLTA 5G05L 3HN3A 1X9PA 3LGRA 2YGLA 3PLQA 2WZPP 5L7OA 4Y33A 1RHI2 3WP6A 5C3OA 3LEKA 3LOBA 1CJPA 1C3HA 5J98B 1YC61 4N8MA 5E89A 4ZU4A 1HKDA 1DF0A 1V6OA 1QH6A 1OH3A 4FPJA 5F37A 2HWF2 1FYUA 2ZZQA 2JDNA 2R30A 1G9CA 3GGLA 4DRRA 4FFHA 3I2DA 2ZTNA 4CP9B 1NLQA 5GZDA 3NNGA 4IEZA 4UFKA 4YW4A 4C1WA 4QPYA 4LBQB 3J7LA 3WF0A 1I6XA 5C5TA 4CEWC 5L36A 1HIXA 4NAOA 2HYKA 1GWMA 1QJX3 1HV0A 1W8TA 2WZEA 1CPNA 3LSDA 3OGRA 3USUB 4P00B 1HQNA 1MS4A 4ZY9A 1OVSA 1HRV1 1NE6A 2YYOA 4YW2A 4CDWC 1Z7S2 5C4WC 1UOFA 2J7MA 3SH5A 4Y20B 1Y3TA 1WCQA 2HWC2 2Y6LA 5FLJA 1AR72 1HDKA 3U4SA 4XUQA 1EUUA 2RS53 1TME2 1LKNA 1HB3A 3HAGA 2JX9A 1GUIA 2CY6A 4ZZ5A 1JW6A 1R091 3TOJA 1XYPA 1W6MA 1NCQA 4IEWA 3AZZA 4ZXKA 3FLRA 4Y1UA 5FP3A 1BMV2 3M3OA 1ODMA 1OF4A 1OLME 3SCHA 5GM0A 5JXJA 4C0BA 1K42A 5DPNA 3GZUC 4ES8A 3ACFA 1PVC1 2VUAA 4DB5A 5C7GA 2EXJA 5JOZA 1OF3A 2J1AA 2R0FA 1VBD2 2QNKA 4CDUB 4JGYB 1MEC2 5A33A 5L9BA 3H1MA 3SITA 5BNNB 4IE6A 1MS8A 2QCSB 1SCRA 4ZKTB 3IIAA 5KBFA 3FFZA 3AM2A 1KJRA 3SXWA 2WSVA 1G9BA 1OQEA 2GMEA 3AKPA 3GCXA 5FZGA 1LU2A 1RUC3 4MGKE 3Q8AA 4Q8LA 1UZZA 1NY72 2R042 3UETA 1AX0A 3APBA 4N9IA 1RMU3 3PTRB 3OPTA 4UT5A 4BA6A 4CPBA 2YY1A 3G6JB 5F3GA 4IGQA 5C6CA 1O8PA 2RM22 4YW3A 5A7QA 4RQPB 3KT1A 3LIGA 4YZ4A 1X7NA 2BYVE 5H9SA 5JZGC 5EJ1B 2VAUA 1EPWA 5HI0A 1WLTA 2PQQA 2A73B 2YFUA 3J7NA 1QXPA 5JR2A 2QUOA 3AC0A 3IT8A 1TEIA 2CGNA 5A3PA 1X8EA 2DTYA 1FMD2 2ERFA 1LULA 2NN8A 2Y6FA 3R4UA 1WW6A 4ISRA 1DYKA 5EZWA 1NYWA 2B39A 4XFBA 5IVVA 2G9FA 4AEDB 1HN1A 2IFWA 3ZYRA 2VQTA 1RUOA 4QXHA 1FNZA 3ATGA 1F35A 4R9AA 5FJHA 2VNOA 3WQ0A 1H30A 1PO21 3TBDA 3H8UA 3BUCA 3VL8A 4BQWA 1WW5A 2MNGA 3D5OA 3I3DA 2CWSA 5FLIA 5FYUA 3AXEA 4FPEA 2AUYA 2Q8EA 1RUD1 3QBQA 3UV9A 2X09A 2AENA 5DAWA 3LDRA 1DQ1A 3VD9A 4Q4V3 4RD7A 4CP9A 4ZXEA 3ZXGA 5A32B 3WDYA 2OZ6A 4LBQA 4V1PA 2WWUA 3PVNA 4NMIA 1C1FA 1RITA 2C0ZA 2X10A 1BLZA 4XMAA 5FXWA 1ZVFA 4D6SA 3LE0A 5JLVA 3ACIA 3UK9A 3TEWA 4YVSB 5FAXA 2DUOA 1VB4A 2MEV3 1GZTA 1SQ4A 1ZZBA 1GKBA 2IXKA 3BOPA 4Y20A 5LY2A 2PHXA 5KR7A 3V0BB 1ASJ3 1DQ6A 2VVEA 4HN1A 3AZWA 4QX3A 1A78A 1FOD3 1YIPA 2OPWA 2RVAA 1CGPA 1PO12 4KU8A 3ZSKA 3I2JA 2HWB3 2UU8A 3N9QA 2VL4A 5FLHA 4LTAA 2FZ1A 2HWE2 4IE4A 3HN1A 4PHZA 2GAUA 1HX6A 1JZ2A 3ZSEA 4CU8A 1V9U3 3ECQA 2VZSA 2JEMA 5CFDC 3FUOA 2UWAA 4L99A 4LO7A 4OQ8A 2W9XA 2ARAA 3MO4A 2Q8DA 1AZDA 3B94A 3V65A 2W0XA 4JGYA 4CDUA 4YM0A 3TYJA 4A7KA 4OMCA 5BNNA 2WA4A 3VBOC 4IL7A 4QX7A 1VBB3 2W92A 3T09A 2XJSA 1MQTC 3Q8EA 3HEIA 5FPLA 1VRH2 1CIYA 3ZPOA 3LQCA 1S1AA 1LGCA 3DF0A 1VB2A 1FI2A 4LUMA 1RUE3 2ZMKA 3B7MA 2YBKA 2Y6GA 4E2GA 4RQPA 3N7LA 3T30A 4P9WA 4YZ3A 3SKVA 2PLV3 3AMQA 3U10A 1UIKA 4Q0PA 2RMU2 5APAA 4IE5A 4LHSA 1ONAA 4QKNA 1RVF1 3WW3A 2K9ZA 4QWNA 1HRV3 3AKSA 4NRQA 2P3IA 2GP5A 4DFSA 1H0BA 3ELNA 4HOOA 5FY9A 1VE0A 3RMXA 4LR4A 1SHWB 4AXOA 3RI9A 5KHIA 2ATFA 3DV8A 3E6BA 3ILFA 2CSGA 1XNDA 2JG9C 4AEDA 4AEKA 3AX4A 2BWCA 1AVBA 5JOYA 2VG9A 3DYPA 3FC0A 4BISA 5KXEA 1ULEA 1OI6A 2A1XA 2DVDA 3J8F1 4IE7A 2XVLA 3KCCA 1R64A 2R071 4FT8A 4Y3OA 1FV3A 3LCPA 4XJ8A 3ETQA 3B3QE 4LHLA 1W0NA 1QIQA 4ORFA 1PVC3 2F4PA 2Y64A 3TWIA 3CJIC 1UMHA 4PI0A 5FBJA 5K7PA 4Q4X1 4XFHA 4AEJA 3WHTA 3H0OA 5HXMA 5A32A 2EXIA 3LSEA 2XB6C 1KXGA 2DFCA 2JG8B 2P5BA 5FZBA 4CEYC 3W5NA 5EWSA 2P6CA 4XMIA 5DN2A 3RQ0A 1K12A 4YVSA 3TEZA 3JD71 2RR11 4QX0A 1RYYA 1URXA 4IUGA 1ZZCA 1AJKA 1EUTA 2PN5A 3V0BA 4FPOB 3AKTA 4YW1A 1ZBE2 1VBE1 2BZDA 2X5IB 4JGZB 2W3JA 4XURA 3POFA 4UF0B 5LA9A 1C28A 2D93A 4LITA 3BPZA 4R52A 1WA4A 5IATA 2G19A 2VMCA 1YCIA 4K9SA 1GANA 1O3RA 4LKFA 4ZS2A 3ZN5A 4Z2WA 1M06G 1QXJA 2JECA 2BTVC 3ENRA 3MIHA 4LKSA 1X82A 4K20A 4W6YA 4YZ1A 5BV6A 1HB1A 4H2AA 3A22A 2KM2A 3AYAA 2W94A 2JDKA 1UMZA 4QM8A 5DUWA 1WW4A 3OBRA 3OPWA 1C5HA 4JVAA 4M4PA 4BPZA 3MW4A 3KGZA 1W8OA 2PAMA 4KWUA 2Y34A 4EN0A 1TQ5A 1UOBA 5J3UA 1NUKA 2PHTA 2GU9A 4CDUC 2FDKA 5BNOB 2QQUA 3ORJA 4LUKA 1JZ8A 1UKRA 1PO23 3I59A 1Q8PA 1KJLA 2EIBA 4JRAA 4FXKB 1G9AA 1PGW2 2FMYA 1UYPA 2XJPA 4H7LA 1MS0A 3CL1A 1NX9A 4OULA 2RV9A 4YGEA 1GBGA 2CHHA 1KS4A 1RUD3 1V70A 3ASIA 4PI2A 3RDIA 4AQTA 4ARXA 4GWIA 1ZZ9A 3NNLA 2IWGB 3M3QA 5EJ3A 2OIIA 4I3GA 4XW3A 1ODNA 1OOPB 4TTGA 2E63A 2ZKLA 4OQ9A 2I74A 5J48A 1WMEA 3HNBM 4COWA 1W6PB 2A7AA 2XKPA 2RDRA 4FFFA 5AFBA 2D6PA 3MV11 3FMGA 5F2SA 4Q4Y1 1NA1C 2R7EB 3BKZA 1UQXA 4CDQB 4NROA 5HV4A 4CU9A 1A6CA 2RJLA 3ZKYA 1QGLA 4RS5B 5DAXA 2PFWA 4OI4A 5FZ8A 4AEMA 2ZX2A 3U4XA 5T5PA 1PNFA 4MADA 3T08A 4EJRA 4KWKA 3VBSB 2IVIB 2JXAA 1TG7A 2LRPA 5FY0A 4Q4W1 1IG3A 1ULFA 5IVYA 1SLIA 3RS6A 4BDVB 3I49A 2KD7A 3A0NA 2BV4A 4JQTA 4AK3A 4ZZ8A 3GXUA 4JDNA 1JUHA 1GU3A 2FCUA 2QTWB 3K2OA 5GKAC 5ACA2 2TUNA 5DAPA 1O59A 1UY1A 1UCXA 3ZFGC 4AHWA 4FVVA 1COV1 2VZ3A 1W9SA 3P5BA 4KGQA 3RZJA 3FHAA 4HBNA 4QX5A 3MHZA 3U78A 3U0ZA 4XQWA 2E7AA 5FZ1A 1LR5A 1AUYA 3NQHA 5GZCA 5J96B 5FRAA 4GB31 1DGWX 2JG8A 3ABZA 1L7RA 3VHRA 2JE9A 3WY6A 2Q1MA 1PNGA 1ZZ8A 2DVAA 2AZ5A 3O1UA 2GMPA 4PDWC 4QX1A 5ERLA 4DZGA 2YMZA 4OUMA 1MS1A 2BUKA 4KU7A 1Q3EA 2VBDA 1VBA1 1A8DA 4XOGA 1ZBA2 3BTZA 4YM3A 2X5IA 4JGZA 5LASA 1V6JA 1HQLA 2ZAAA 3ZX7A 4LOSA 4DO0A 2JE8A 2FZ2A 2E7TA 3N35A 5FP8A 4O65A 3LA2A 3R0RA 4W50A 4LXLA 3ZDVA 3J7MA 3LA7A 3POWA 3SQOA 4AFAA 2JDPA 1J3QA 5FMCA 1N1SA 1W2NA 5TSWA 4K6BA 2XUMA 3H3LA 4JKKA 2EIEA 1YRZA 1AYN1 1OQ1A 3FJSA 3JBG2 5FFOC 1GZCA 4A44A 5FCCA 5K8SA 4XZUG 4IGPA 2XOMA 4Y1XA 3T0AA 1DGWA 2GMMA 3OGVA 1XNKA 4AOCA 4WVZA 2VUCA 3AMHA 4BIFA 4ZU7A 4K3UA 3EB7A 3LFIA 1WLDA 3PDQA 4AVTA 4IV1C 4OYUA 5FYHA 2Q4SA 3POIA 1DDLA 5LRSA 1JYCA 1B09A 1REFA 3E5XA 5BNOA 4AFBA 2GZWA 4RSUA 3RYKA 4EN7B 2RS32 1ND3C 3J8F3 1O4ZA 4AI8A 1H8TB 2R073 2Z79A 1RUG2 4QKDA 4RGGA 4M3CF 2VZUA 2IFRA 4GULA 1GSLA 3WNNA 1R1ZA 1RUH1 3BU7A 3NSTA 3JZVA 4EZ4A 4Q4X3 1U12A 3I54A 1OOPA 3GZTB 1DP0A 1VAMA 1W6PA 3N9OA 3T2PA 1POQA 1XSQA 2J1UA 4XCBA 3RYPA 1WMDA 2WNVC 5JVVA 3ZFFB 4NIHA 3WP5A 2QQMA 3JD73 2RR13 4H14A 4E8CA 3QD6A 3ZFEB 5AVPA 4XDOA 4MX3A 4KMQA 4RS5A 3UGGA 3T4HB 4QHOA 1J83A 4PIXA 3D8CA 3D4KA 1O91A 1IQDC 1GP5A 1S55A 3F2ZA 4MH0E 3VBSA 2QQNA 2Y26A 3AP5A 5EYXA 3V0AB 1OA2A 1UZ0A 4DOUA 1N47A 1R1A2 3OJBA 3PURA 2BW8A 1GZWB 1S0BA 5IFTA 1VMJA 5HPOA 1FAYA 4Y5SA 2W68A 4FP3A 4XUNA 3RPQA 4JDOA 3UNPA 4ASMB 2X05A 1EV11 3VBRC 3FHQA 4P9LA 4YG0A 2G1MA 2QDRA 3ZKUA 3ZXKA 3KCXA 4AQ2A 1Q8VA 2JDMA 3C7GA 1CZVA 1QNWA 2ZEYA 2PHUA 5C9AC 1H9WA 1NAEA 2WN2A 3UJOA 2XHKA 4EE2A 4EYUA 1QQP1 1QOSA 1WLWA 1HRI1 2P37A 2YZ4A 4Q0UA 1B35B 3PUQA 2W1UA 2EIGA 1Y4WA 2XLFA 3QOPA 4HANA 4EZHA 1CD3G 4NJ4A 4PF1A 1LEMA 3HT1A 2B9UA 2FDIA 3HD8B 5GLTA 2WLQA 4B4RA 1AL0G 1G86A 1GQPA 2C6SA 2PHLA 2CV6A 3AL6A 4JGZC 3UKNA 4FBFA 4HZFA 5T55A 3NRUA 4Y1VA 2WJSA 3BYWA 2FCTA 3PMEA 1J3RA 3KT4A 1AR91 1D2QA 4QM9A 1S2BA 4Q4Y3 3ZVXA 2P17A 1J84A 3R05A 4XF1A 4UFLA 4OHYA 1H2NA 1K45A 2ZAHA 5FWJA 3I97A 5F5AA 2QDNA 4GZ9A 4N9HA 4PIYA 5EPAA 4LT5A 3SEEA 5DG1A 1PMIA 1UIJA 2PYTA 2XXZA 3BIWE 4Q4W3 1LOBA 1W9FA 3PUHA 1AHSA 4M3CB 5LA1A 1W2AX 2CDOA 1MS3A 5FZ4A 2PA7A 4I2OA 1J59A 4AZZA 1H8TA 3MGUA 3DCQA 3C7EA 3VD7A 1HQWA 3A4UA 2FQPA 1COV3 2JDUA 4QDRA 3ZIXA 2E7QA 1EPZA 1UWWA 1OPOA 4PT6A 2NP0A 2LALA 2QQWA 1CZTA 3NV1A 4MSVA 5KC5A 3MFCA 4FOWA 4XBQA 2H6BA 5FR3A 1J3PA 2ZS6B 4R4ZA 3ZFFA 5I8YA 5IT6A 5C3QA 4HMZA 2UWBA 2G9ZA 4LEJA 2UYAA 4QGMA 3VDDB 3ZFEA 3M2MA 5A3UA 2C1FA 4CE8A 2RS11 2P34A 3D0SA 1NZCA 4CDQC 2IXIA 3WOGA 2DUQA 1LOFA 1EAH3 3CNAA 2ZGQA 3MV01 3NWKA 4XUTA 4N53C 3MZHA 4CRQA 4NPLA 1KD7A 4ZONA 3V0AA 4RGAA 4WV8A 1WUVA 2OW4A 1XBFA 4H7MA 4LO8A 4O7XA 2W08A 1CJDA 1GZWA 4DMIA 3DN7A 5C33A 4BJ0A 2BEOA 3RZLA 4D8MA 5FUNA 5FZCA 2QE3A 3FFQA 3POYA 3KM5A 4FTSA 3SCGA 2WS91 3WQ1A 3IM0A 3U75A 3U14A 2RS52 2VQAA 4BQ1A 3H9AA 1RUJ1 2HEVF 3PL0A 4RA0A 1UY2A 3J4UH 1E5IA 1ZA7A 3NVCA 4WM7B 2VOVA 4GIQA 3C8XA 1TMF3 1OVPA 4LA3A 1JH5A 2IXCA 5ANQA 1B35A 1JYXA 5K9YA 4A4AA 3I3EA 4IETA 1AL22 4FPCA 1W6MB 1NCQB 3RI8A 2ETEA 4OCTA 1RUH3 3AP6A 2AREA 4FQZA 2ZEXA 1HB4A 1HXS3 1QJY1 1SZBA 3LDBA 4C0HA 3NJVA 4N7IA 2ENRA 3RYRA 1TZOA 3HJRA 1SDDB 5FBZA 4JX0A 4RN5A 1AJOA 3VBUC 3DKWA 1SLCA 3F95A 1ST8A 5J36A 5A80A 1PK6A 4AWDA 2C24A 1QOOA 1RUC2 5FZAA 1H1MA 3WDWA 1DHKB 5K0UB 4IEVA 5L73A 4S2HA 1PX3A 1G9DA 5EP9A 1ZRFA 1NQDA 3GCWA 2Y0OA 4INDA 2QKDA 2WZR3 3EMRA 4XQ4A 2YUEA 4BQYA 4N90A 2HWD2 2W46A 4M3CA 3UGHA 1I1EA 1FV2A 1LJ7A 1DZTA 3I2FA 5A7SA 1W39A 1BZWA 2W39A 4LLOA 4XQDA 3KB5A 1OKOA 2IXHA 4LBKA 3A0KA 3HPNA 4NE9A 2HWF1 2D40A 2FCVA 5D8AB 1EV13 1Y7BA 1MS5A 3ETPA 5F3CA 4TZDA 1XU1A 1H6XA 2OKXA 3TN92 2XWBB 1V9U1 4F7ZA 1KDKA 2BBVA 2MPFA 4FFGA 3W59A 4BK5A 3VHPA 1WBFA 4LJHA 5LEKA 1YXWA 2XBO2 3NL1A 1OPMA 2RE9A 3VDAA 4EQVA 4HVQA 3C3VA 5C3PA 1GNZA 5LA2A 5JDBA 3VD5A 5IVCA 3PUIA 1BVVA 4M01A 3VBFC 1QQP3 3O0XA 3M70A 4L2NA 1HRI3 3RWNA 3VDDA 2OUHA 1S0IA 1AR71 1VBB1 1XE7A 3ES1A 2XKOA 3Q9OA 5FMDA 1BBT1 3GBFA 5L19A 4KWJA 1TME1 4LQRA 2FHRA 4I01A 4QU2A 3IIIA 4N43C 4Q4V2 3K4DA 1MZEA 1DQ2A 4O61A 3EBRA 1YFYA 1RUE1 3LEIA 5C3RA 3DKQA 5IK4A 2P4EA 2D3RA 1AR93 2BGPA 4JRLA 4TYSA 5EXOA 3CIHA 3QCWA 1YQ6A 4AF9A 4BOWA 2NMOA 2PLV1 4KL1A 4LA2A 4JHTA 4PBOA 3WUDA 5JXGA 5DAVA 5LRRA 2MEV2 3IWZA 1VBD1 3VB9A 4TN7A 3NV2A 4QPGC 3I3MA 2PHWA 1ASJ2 5IHRA 2GN7A 2ZKNA 1IQAA 3MIFA 3HQUA 1NXD1 4NHXA 1FOD2 4WM7A 3K3NA 1AXYA 3KVBA 5IK7A 1MR5A 1JYIA 5A7WB 2D97A 2CDPA 2J1EA 4YLZA 4WZFA 3SKJE 2ZPXA 5I0RA 3ZMOA 2D5HA 3AJYA 4IXLA 5C8CB 4LE3A 4NIAA 1XNTA 3QH6A 1Y9QA 2ZX1A 2RM21 2LM3A 2EICA 4HSJA 4PQQA 4EWAA 1H4GA 1ULGA 5F5QA 4C1XA 2WNOA 4CPBD 5FMBA 5BYNA 2BVBA 4Q0QA 2VOWA 1UZYA 1JU4A 2RJ2A 4KI5M 4NR1A 4DIQA 3K4AA 2ARXA 4B7EA 2WLPA 5JSRA 3ZXDA 3NAPC 5E1RA 5FPVA 3HR9A 1FMD1 3I2KA 4HSLA 4AAPA 3BB6A 2RS13 1Z78A 3IDAA 5K0UA 5LBBA 2E33A 1QDOA 1QHDA 1ZA4A 1XNBA 4R9CA 2XJQA 2YFZA 3LB9A 3NNFA 3LDKA 4AQSA 2NYYA 2BFUL 1ULDA 4RFT0 5CFCB 4CXWA 1IGOA 4YNIA 1BQPA 4LKDA 4QPIA 2GP3A 3KVAA 3POSA 4K40A 4CU7A 5FK8A 4ITCA 3JB8A 3ZOIA 4A6SA 4GALA 2OUJA 5D8AA 3VUOA 1P8JA 2BU9A 4S2GA 1JUIA 3OUHA 2TEPA 2WS93 5CA6A 1OURA 2E53A 3ZYPA 2VZTA 1LHNA 2CL2A 3H50A 4AVBA 4B8EA 4DNYA 1RUJ3 2GC1A 2VTFA 2RG4A 3IPVB 1O4YA 1W9TA 3DYOA 2WDBA 2JIJA 2VCBA 4NWWA 4E2SA 1DGRA 3T2QA 4CA9A 1A34A 5FZ6A 1TVGA 2RDQA 3BTAA 4HFSA 4LBQD 1Y9GA 1R092 2A6XA 5EJZB 2VMHA 1QU0A 4YGDA 1JYNA 1SFPA 2NM1A 3PVBB 1W2OA 3ZXJA 2JD9A 4E2QA 2FDHA 1ZM1A 3MIEA 5HV0A 2ZGRA 4XIKA 2ZHNA 3VLBB 4XF4A 4HL0A 2ZX4A 4LBLA 4QQ2A 1PVC2 5IYYA 1QJY3 5FXZA 2PQSA 1LU1A 1PIV1 4Y5Z0 1DG6A 5L7OC 1IZ3A 3ZYBA 4P9IA 2HWE1 3O1SA 2EA7A 4W6WA 2VBPA 2WNUB 5FZIA 1LAJA 3I4IA 2ZGPA 3BCWA 5JPNB 4UBHA 5FREA 3X29B 4E4DX 5F1RA 4XE9A 1AR62 1ZNPA 3I3QA 1ND2B 4FO9A 1AR82 2B45X 1BCXA 2ID4A 2WAOA 4MGZE 1RL3A 2RDNA 2J1SA 3LWCA 4G4FA 5HCHA 2VTXJ 3M4FA 4XILA 5BNPB 2A6WA 3WP4A 2R061 3NJZA 4XACA 5A3WA 3H1YA 3ACLA 3ZYHA 1VRH1 5CEHA 2QJVA 3B69A 4EN8B 5A7WA 4IERA 3FL7A 2QQJA 5E88A 3SHRA 1CX4A 1RUI2 2D6LX 4RL7A 4E9KA 3BN6A 3AMNA 1RUNA 4QDQA 1IS4A 3ZXAC 3CQOA 5C8CA 2HWF3 4MUVA 3O1MA 5FYBA 4BCUA 3IDEA 1WCUA 3CLPA 1NCQC 4B3NA 4TLFA 2ORZA 3N7MA 4AI2A 4RR3A 1PZ8A 1LENA 2VY0A 4D7SA 1OSGA 3ZYFA 3WW1A 5IVBA 1YWKA 3H7JA 3RNSA 4M4RA 2SLIA 3N3HA 2ORXA 4O9EA 4QGNA 5FPAA 5FK7A 2XONA 1LEDA 4ATEA 2K0GA 4Z1VA 2G4IA 3BIEA 1JXNA 5FZKA 5I91A 2DYCA 1AR73 1GWKA 1LOCA 1JOBA 3IAQA 4L97A 2ADDA 1BBT3 4LK6A 1TME3 1M4WA 3B9CA 3I59B 1RUD2 1IPJA 4P9GA 5CFCA 3D3AA 3LPGA 1AXZA 1UXXX 1SPPA 2DTWA 3OGGA 4WM8B 1OUSA 1E5SA 1LOEA 1NCRB 5F5CA 1YEWA 3ILRA 1OLQA 1BJQA 2WZ8A 4COUA 4A42A 3MLKA 4GH4B 5FY5A 1RJ7A 3MEPA 1W8NA 1YIFA 4OHWA 2BP6A 3ZR5A 1VBD3 2LW8A 1RJ8A 1SBDA 4QMAA 3E6DA 4NPMA 4Q1RA 1UAIA 1E57A 4KNCA 1U5ZA 4FOQA 2R6QA 1RC6A 2ZX0A 5DDJ1 3IPVA 2VBBA 3N36A 5FPZA 2DF7A 2D6NA 5FYMA 2XMLA 3NV3A 4G9SB 4UW5A 3OBAA 5F32A 5H9QA 5KXCA 2Q5TA 2YC0A 4I0BA 2ZGLA 4JTOA 5FWEA 4EN9B 5C71A 5FZDA 3B5LB 4Y22B 3WNOA 2R043 5I0UA 5JIAA 5FYZA 2W5FA 4BM8A 1AYM2 5F3IA 3HOBA 4NPRA 4XJZA 3THCA 4W6XA 5IK8A 4YFZA 5CNAA 2VNRA 2DBIA 3DL3A 2RM23 4IEQA 5IAVA 2BNMA 4S2FA 5FYTA 2CGPA 1RUF2 1QJU2 1EYBA 5FYYA 4BQXA 1UPSA 2IXLA 2VR4A 4PJYA 5FQ0B 4BZ4A 4DS0A 5B2GB 5LEJA 4XF9A 2WNUA 3CU7A 3K3OA 1JZ7A 4AI1A 4YGBA 2ZGOA 3EXUA 3WNMA 4OZOA 5SV8A 3ZYIB 5A3TA 4K7JA 4LO4B 1H1AA 1VALA 3WF3A 3DGTA 2BWAA 2WFF1 3OSDA 1K5MB 1ND2A 3D0JA 3USSA 4YZ5A 1FMD3 5FYCA 4OFGA 4FFIA 4DUVA 4LNVA 3AVRA 2V72A 2V5YA 3LD8A 3CZUA 5F6KA 5G04L 4UFJA 3WLUA 1XNCA 2C9KA 2VZVA 3HQXA 4QXBA 5BNPA 2WSUA 2L9LA 4PF5A 3S57A 4FAGA 4TWTA 5AC91 3BALA 3PUAA 3JUUA 1H6YA 2ADEA 1FPN2 2JB4A 3IB3A 2JENA 4RHV2 2GNBA 4DPNA 3GBWA 1MPXA 1NLRA 3EQEA 2GSYA 2FMDA 1RVF2 1UZVA 3FUQA 4HT1T 4LIUA 4XDQA 1WCSA 3MF9A 3OYWA 1POV0 3VBHB 4CZSA 3ZSMA 5F6LB 2BOIA 4F83A 1WGPA 3RJRA 2Y33A 5CZKA 3ZXFA 1G7YA 5LCWL 3MPPG 2E32A 1F5JA 2P1BA 3TB0A 4E8DA 4UAPA 3H8XA 1EP0A 2A71A 5EQUA 2GNTA 5HBAA 3TNQA 3LKJA 3GF6A 5A6QA 4URAA 2AACA 4JGYC 1T6GC 2A3XA 5BNNC 5C3SA 4Q5OA 3I3BA 4FPFA 3T2OA 1DQ0A 3POBA 2BOJA 4FQ4A 2JICA 1JI6A 3PVEA 1CESA 4Y26A 1PO13 3HBKA 2XVGA 4ASKA 1PIV3 1XE8A 3Q8CA 2VQ0A 4WM8A 2HWE3 3WNXA 4XTMA 1JYTA 1NCRA 3JCIA 2V4VA 2W95A 2MHFA 4E4ZA 4OI0A 2HH9A 1R081 2XQRA 2BPA2 1H4HA 3W20A 1ALYA 3B02A 1UY0A 4GH4A 3AVSA 2O8OA 3JD72 2RR12 1KGYA 2E6VA 3KMHA 4RQPC 3RZGA 3NKGA 2V4AA 4Q27A 3S7EA 3O1RA 1CN1A 1VBE2 2I45A 2YHJA 2XJTA 4GWJA 3ALQA 1IS6A 1DZRA 4P02B 5C5UA 1GV9A 3DPRB 3H7YA 3SNMA 2R063 4TXWA 1KDMA 2C5DA 2CGOA 1VRH3 4MGTA 5EHDA 3KZ4C 4Y22A 5DMYA 3WZ1A 4QU1A 4QB2A 1S0DA 2NZ9A 1PX4A 5LBFA 1IHMA 2VZOA 4AEDC 1YJLA 2WQ8A 2XWJB 4GAZA 1BKZA 3H8OA 3JQXA 5ABJA 2VMFA 5C70A 4ATFA 3RZKA 4YVWB 1SLAA 1PMHX 2Y6KA 5DABA 5A70A 5FQ0A 5FYIA 3RSJA 2RMU3 1DLCA 3WG1A 3CHXA 3UJQA 4AG4A 4B1LA 3N4MA 3IKWA 4Q0VA 1XSRA 4AGRA 2B42B 3C7HA 4AVVA 3AL5A 1LB2A 1KITA 1K5MA 2JJ6A 4JAAA 4CCMA 5KC6A 2PTMA 3AYEA 5GALA 1YO8A 2D6MA 1RINA 4UW4A 2XG3A 4BHPA 4M3CE 1SLTA 4MG2A 3WEZA 4AFMA 1NQJA 1UMIA 1UZWA 4XTPA 4KGGA 5CBLA 4ZPIA 3WSOA 4XJUA 4QXKA 4YVSC 4QQPA 1PZ7A 4J25A 1EAH1 4RFRB 4XFCA 3IMMA 1C8M1 3AP7A 2HYXA 2EXKA 1UKGA 4NAMA 1UYXA 5D1IA 3KCYA 3NW4A 1UN1A 4GWNA 1W0PA 5FTTC 5IVEA 1QF3A 3A21A 4I3PA 2EAAA 3VBHA 1I5PA 3CO2A 1BVP1 2A70A 4Q0SA 4X6QB 4CCCA 3ZR6A 2VJXA 3DUIA 5DDJ3 3LEMA 5LK5A 1NT0A 2GH2A 4XVHA 1CVNA 5T52A 5KXBA 5M0TA 3BOWA 1GOHA 4FPYA 1U5YA 2WWSA 4A45A 1XE0A 5FY4A 3FLTA 1UU6A 1TMF1 1V6LA 5GZGA 5JOXA 1WMXA 3MICA 1ENXA 4K8RB 2W91A 3DEMA 2BERA 1QXRA 3DYMA 4HN0A 2CYFA 3A23A 3GHNA 1R1A1 5DZFA 5EV7A 5A7PA 1VLNA 2AC1A 4GB32 2BVVA 3VKFC 1UD1A 1HXS1 4XCAA 2ARBA 1YQ2A 2ZMNA 2EF6A 3O14A 2YG0A 3NNMA 4NOTA 1AXKA 3GM8A 2GDFA 2E9QA 2AGSA 3HQRA 3M7AA 3PU8A 4QKFA 4FPHA 5DG2A 2QQLA 2WFF3 4XYXA 4JQRA 3VZLA 4EN6B 2BQPA 4UXAA 2WUHA 3VKNA 3VZOA 1XB9A 4OHVA 3AYDA 4LLFA 1VBA2 2RJKA 1C1LA 1L7QA 1WZXA 1LTEA 2A6ZA 2VMDA 3PU3A 3WDXA 3DPRA 4TSVA 2HBUA 1VPHA 3WF2A 1Y43B 4FTBA 2AEZA 1XYNA 2D44A 4DXTA 5LBCA 4FOYA 4CTEA 4CYDA 2VW2A 1JU3A 2PXJA 3MIGA 5AC93 1MZ6A 4MGIE 4LE4A 2WZR1 1O3SA 3IAPA 3MIBA 4D7YA 4ET7A 5KXDA 1EY2A 4IQPA 3ROUA 4P14A 1UF2C 1AYN2 1QJEA 2F4LA 1IKQA 3AK0A 1YFUA 2WO1A 3M3EA 3NJXA 1ZRRA 3OBZA 3MUZ1 4CUGA 1W8WA 1W8HA 2Z69A 2DDUA 5I8TA 1C4RA 5D2AA 4YVWA 4Y24A 1YLLA 5A7NA 1S0CA 1W06A 4QHBA 3T1LA 3UT0A 3LAGA 1BEV1 4MO3M 4XAEA 2OQ6A 4NRPA 1W9WA 2VE1A 2IVJA 2NMNA 3CBNA 1W2TA 3OOXA 2WQZC 1PZ9A 2DBNA 1D4M1 1IS3A 4XFIA 4BWOA 1ULOA 3JQWA 1ZZ6A 1MS9A 1H2LA
chains in the Genus database with same CATH topology
2JG8C 1UL9A 3RG0A 3H1WA 4XXPA 5F9TA 2ZHLA 2VUJA 1RUH2 4MXVA 4R4XA 4XHBA 5GJ6A 1RB8G 2GC3A 4CDWB 2D6OX 3SISA 2V73A 1VBC2 5ACA3 4JCKA 2X5IC 5C4WB 1NE4A 1O3TA 1SBEA 1R083 4S2DA 4HKOA 1S0EA 5GLZA 3S0MA 1LODA 2R1BA 2DU0A 1KFXL 4XIOA 4DQAA 3CEWA 5CIRA 1OHFA 1PK6B 4H55A 1JTZX 2YGMA 3WG2A 4ISQA 2VU9A 1Q8OA 1UW8A 4LHKA 5JSOA 4XJWA 1VAVA 5C8WA 2N7GA 4I0WB 2O1QA 5DUXA 4AGVA 4SLIA 3MYXA 4PCRA 1MACA 4COZA 3KD4A 3P3NA 1LOAA 1EV12 2HEYF 1HV1A 5BNOC 3MDPA 2V09A 1ZZ7A 4OI1A 5GZEA 4DRVA 2OVUA 3SH3A 4DINB 4DY5A 2SBAA 4FCAA 3ZIWA 3AZVA 1HRI2 3PTYA 1N1VA 1OOPC 2DCJA 4OZXA 4LBNA 2KA3A 2NPIA 3WW4A 2JDZA 2XVKA 1QDCA 1DGLA 3NV4A 3QACA 2XJVA 4K8FA 4FPGA 2RS33 4J6GA 4RS5C 3O12A 1LOGA 1C8M3 2QZ3A 5GLUA 4EWEA 4YZ2A 1AL21 4AVAA 4A3XA 3VBSC 3D6EA 1Q8SA 4AW7A 4J1XA 1OMIA 1QJX2 1F8VA 1X36A 3KGLA 1QH7A 1ENSA 1JN2P 4IESA 4IEXA 5FO9B 4AYUA 1FX5A 1KRIA 2Y38A 1GYKA 4GQ7A 1I9RA 4NVPA 3WDUA 3I8TA 2GC0A 4HKWA 4Z8BA 4YSFA 3AKQA 1PM7A 2ZABA 3URFA 4I09A 4CEWA 3MW2A 1BXHA 4EROA 2HWD1 1DLLA 5GZFA 1R1A3 1U5IA 4OVEA 1W0OA 4GMP3 4CDWA 5C4WA 3ZDSA 4XFFA 2X29A 4SBVA 3TN91 4K1YA 2HEWF 2CWMA 4AQ6A 2GALA 5DUUA 5DZEA 3HWJA 1PGL2 2WQ4A 1RMU2 1UX6A 1CAXB 4F8AA 2QFEA 3FHIB 3MW3A 4AI3A 4R8HA 2ILMA 1FNYA 3THPA 3R4DB 5E8AA 4ZU5A 5JMCA 1RHI1 2E51A 4XHXA 4K1ZA 2D3PA 5I0TA 1QY4A 4QPIB 3OY8B 2ZZJA 4AHZA 2B7YA 1YJKA 1N3OA 1MQTB 1V6MA 1GZ9A 1H8TC 1RUJ2 4B29A 2ES3A 2VOKA 1BEV3 4XBLA 1REDA 3SMHA 2VMGA 2VOXA 1XYOA 1H9PA 4BH9A 1CAUB 3B00A 4CP2A 4HKLA 1D4M3 3TNPB 3OD0A 1DQ4A 1DQ5A 1Z7S1 1Q43A 3GYDA 3G7DA 2UURA 4PIZA 2HWC1 1WCDJ 1N3QA 5JZGA 3ZFFC 1FT9A 1J58A 4GMP0 5J37A 4H3WA 1DIWA 1CPMA 3ZFEC 4Y1YA 2Q1ZB 4QT6A 3KQRA 2ET7A 1LOFC 4XF0A 4OI2A 1BMV1 5T50A 2P3KA 1WCKA 3WG4A 4FAHA 3MI8A 2JG9B 2VNGA 4I02A 3JB4C 4QQHA 4BIOA 2YXSA 1POV1 3VKLA 4B7KA 3AZXA 3WVJA 1MEC1 3E5UA 4AVSA 2D98A 1SMVA 4M00A 3CJIB 1OFSA 2HWB2 5T54A 1SLLA 1LHVA 2OA2A 3CF6E 3VN4A 2A3WA 4MLOA 1NY71 2R041 1DU3D 2VPVA 2Z2SB 3INAA 4CEYB 1V9U2 2HJIA 2ZGKA 1B35C 4MGYE 1CIWA 2ZMLA 1Z0HA 2R49A 2G9GA 2X8KA 4RR3B 5BXXA 2IZWA 3EO6A 3M1HA 3THTA 5FO7B 1A8MA 5I8SA 1VBB2 1DYPA 2YPJA 1BBT2 4HK8A 2DCTA 2ZGSA 2LTNA 2DV9A 3MIDA 5J7MA 1PK6C 2D3SA 5I0SA 1NG0A 3GZAA 1WD3A 1CAXA 5CFDA 4A2UA 2HKXA 3AFKA 3AB0A 1RUE2 4Y1ZA 2VW0A 2ZHMA 1AL23 4MXWB 3ZN4A 3UL2A 1S0JA 2FBEA 2PLV2 4XETA 3VBOA 4META 3OY8A 3VZKA 1ENRA 3M3CA 1HRV2 1MQTA 2Z5WA 1O5LA 2NLRA 2VMIA 5GLVA 5JWPA 2B8MA 2EVXA 4A7YA 2XL9A 3SH4A 1AR61 2DCYA 4BLIA 4LBMA 2B46X 1AR81 1CAUA 1DGRN 3WT3A 5KWRA 1JHNA 2AR6A 1PHMA 4L92A 4PLOA 1MZ5A 1SCSA 4WVVA 2HWD3 1WLCA 1O5UA 2XLAA 1NA1B 2YROA 1YI9A 3VDDC 1I5ZA 1RUI1 1ZX5A 1ENQA 1PO11 2GNDA 4WVMB 4DXZA 4GKYA 4YW5A 5CG8A 1TNRA 4AVCA 3TN93 2JG9A 3QH7A 4HETA 2XBO3 3PJQA 2WC2A 4AFDA 1LHOA 1GFF2 2AYHA 5HXVA 2OPKA 3ZFGB 2AH2A 3H3ZA 3M8LA 4G3YC 4BLJA 4C91A 2XL7A 2QVSB 2YDEA 3WQ7A 3FE5A 2H0BA 2PAEA 2ZHKA 3CJIA 3B01A 2A6YA 4GKXA 3WCRA 1RHI3 2XLGA 4FPLA 2R32A 4WM7C 5A3LA 1HLCA 2QZ2A 3OCPA 3L2YA 4YG6A 4OHXA 4CEYA 3ZXLA 4AI0A 3T1MA 5J09A 3OYWB 4PDWB 2ZGTA 3USUA 1DZQA 1W6QB 2K2SA 2LUWA 4L9BA 2GNMA 2RMU1 5T5OA 1Z7S3 3KS7A 4Q1PA 1LHWA 1UPIA 1PO22 4KG0A 4GA9A 2HWC3 1APNA 3N7KA 1W6NB 1PIV2 4MYEA 1J1TA 4IV3B 4FOVA 5K0UC 1SBFA 1AYM1 4MXWA 4XPVA 4ONUA 3WP3A 4FSJA 3NKTA 3MFAA 4YYOA 4GXLA 4R9BA 2DFBA 1IKPA 4IV1B 1RUF1 1QJU1 2UWCA 1DFQA 4LHNA 5JAXA 3PNAA 4QPIC 1AX1A 4Q26A 5JR7B 3VV1A 3PMSA 5FMOL 2ZGUA 1POV3 1IPKA 1ND3B 4MVTA 4XEZA 2R062 1MEC3 2VH9A 1W2UA 2Q30A 5D8AC 4BE3A 4CP0A 2PAKA 4XZPA 5CVRA 3B9IA 1DBNA 1VR3A 3EJKA 2ZCWA 1SFYA 1QKQA 5JSPA 2OZJA 3IBMA 3V56A 4LBOA 1ZBE1 3OF1A 5H9PA 4Q8KA 1NA1A 2D6KA 2WNVB 4XJ9A 1FPN1 5ABJB 3AP9A 4RHV1 1ULCA 3AZYA 1VJ2A 1LRHA 2WNEA 2YV8A 4WVMA 5BPXA 5JIUA 3AKRA 5EYYA 3WD5A 4CP1A 2PHDA 3IMNA 1BK1A 3E97A 4YM2A 4FTEA 4P5HA 4PLNA 2BNOA 3VL9A 3VZNA 3GALA 4FP2A 2DWRA 5H9RA 4BMEA 1R093 1HW5A 3L2HA 3MPBA 4Q2FA 3ZFGA 1AX2A 2VGDA 3P3PA 3VBRB 1V6NA 1S0FA 1JBCA 1VIWB 3V64A 3QLQA 2XGXA 3AMMA 3O7OA 5HCBA 2TNFA 5A3MA 1PGW1 3WCSA 3ILNA 1CR7A 5C9AB 3PHMA 4EV0A 3OGJA 4XFGA 3AMPA 3FZ3A 2DUPA 4PDWA 2W52A 3IDBB 5DDJ2 3PVOA 5C8CC 2DVBA 1W6QA 1AR63 3U11A 1Q56A 2PHRA 2DU1A 2ZGMA 1AR83 4IEPA 1S2KA 1S0GA 4RR3C 1MVQA 3BODA 2WT1A 4AHYA 1QOTA 2UY8A 3FLPA 3K48A 3WR0A 3J8F2 4F3JA 5CAZA 1W6NA 2R072 3W9AA 3W58A 1WW7A 4QD2A 3RZZA 1RUI3 4IV3A 1OFNA 4Q29A 1N1TA 4N7UA 3O0WA 4X8PA 4Q4X2 5LK7B 3T2TA 5GLWA 3SCFA 1XU2A 2B5HA 1OQDA 2WFF2 4FXGB 2Q8OA 4KG8A 5ACA1 5CFCC 4IV1A 3R4SA 1D4VB 5AFEA 1OA4A 1KFUL 1G8WA 5KHJA 1ND3A 4DY3A 4HK9A 5I93A 1RTVA 5IK5A 1NOVA 1GQGA 4B4PA 3UKVA 1H2KA 5AC92 4M0NA 4Y4YA 1GNHA 3ZYGA 5CG9A 5KHKA 4R9DA 4YARA 2RHPA 1ZBA1 1OLRA 1GQHA 5CU1A 4HVOA 1SEFA 2WNVA 1D2SA 1VP6A 1RGSA 2WT2A 3S7IA 4AGGA 3GNEA 2R1DA 2I07B 2EALA 4PQ9A 1N3PA 1YYNA 4XJAA 4N53B 1KQRA 1C57A 2A6VA 3JBG1 2VVFA 1SLBA 2WNUC 3ZN6B 4D7TA 3IN9A 4AE2A 3AYCA 1ZRDA 4QQLA 3LZZA 1ND2C 2IC1A 2UYBA 1OA3A 2XJUA 3VBRA 1AYM3 2H0VA 1R082 4Z82A 3ST7A 2RS31 5BNPC 4CDXB 2NQYA 2VVDA 4PBPA 1QMJA 1RUG1 4W65A 3E6CC 1RUF3 4QQOA 1Q8QA 1QJU3 1BYHA 2GC2A 4Q4Y2 5T3NA 3WV6A 2D7FA 5C9AA 3VZMA 1YFXA 3WHUA 3C2UA 5FPXA 3AP4A 3VZJA 1CAWB 4OUSA 4IEOA 5DUVA 4EWDA 4Z07A 1ZYBA 4Q4W2 5T5LA 4HPKB 2KXLA 1YFWA 5JOWA 3JU9A 1SDWA 1ZBE3 2VW1A 2DVFA 4WZCA 1XQNA 3VBUB 2VULA 1COV2 1O7FA 1FPN3 1AF9A 4RHV3 1YI7A 1N1YA 1WBLA 3EHKA 5DZGA 1RVF3 4GMP1 4JDMA 4NHMA 4IV3C 3RMYA 2O0OA 3U07A 2CTVA 3WDVA 1CONA 4WM8C 4D69A 1X33A 1NCRC 4P9JA 4P9XA 3HMYA 2OYZA 3FX3A 3WX5A 5HCFA 4YG3A 4GH4C 1QWRA 1EAH2 3KT7A 1C8M2 5BNQA 1CAVB 4KQ7A 1LECA 1TE1B 3KSCA 5IUQA 4UW3A 4ES9A 5BY5A 2WL1A 3MLLA 1VBC1 3MLJA 4K21A 3VBFB 3KLSA 1PGSA 3AXDA 1JOJA 1GR3A 4HVRA 1YUDA 5BUVA 1OD5A 2BFUS 2ZBJA 4CDQA 2Y0IA 3J9SA 5ABJC 3HBZA 2ZOEB 3FBMA 1QJZA 3IDCB 4XXAA 5JPMB 5FOBB 4AFCA 4N43B 4N53A 4U2AA 1TMF2 1VBE3 2A5ZA 2WT0A 3ZN6A 1W6OB 3L9JT 4E27A 4NN0A 1K5MC 1H1IA 4LBJA 4LO5B 1V6IA 4CEWB 2JKBA 1D0GA 1HXS2 3FBYA 4WBBA 4XFAA 2WFPA 3TRSB 4MV2A 3WINE 4QPGB 4C90A 4CDXA 2GN3A 3LA3A 2PELA 1WMFA 2PHFA 3WXPA 3H3UA 2ZACA 4COVA 1UU5A 1TNFA 5JI9A 3N7JA 4QGLA 1F5FA 4M0HA 1X8MA 3VBHC 1CAWA 2IXJA 2WZR2 2I2SA 1UU4A 4HPKA 5HCAA 3OPZA 2BGCA 3ES4A 2A3YA 1ZBA3 1PVXA 2TBVA 4KWLA 5EFUA 1RIRA 4B4QA 3OD4A 3VBUA 1MZFA 3OBTA 4PLMA 3VKMA 1NXMA 4XBNA 3NAPB 1BEV2 3CJXA 5CB7A 3UKTA 1Q5OA 3O5SA 4WVWA 2DURA 1L3JA 4O9GA 2O8QA 4P9YA 4LO6B 1QJX1 1LHUA 4YFWA 1ZRCA 4A7ZA 1D4M2 2EXHA 3M3IA 3JBG3 1QNYA 1C5IA 3ZO0B 1QQP2 3VHOA 2QQPA 4JC1A 3VHNA 4AHXA 2XPJA 4X6RB 2WA3A 2RS51 2CAUA 3HIFA 1G9FA 3FWEA 5JZGB 1CAVA 2D5FA 1G6NA 1F9KA 2X53S 3DPRC 4COYA 3TAYA 1REEA 4KBBA 4GWMA 2EAKA 2P2KA 5FDBA 1RUG3 1AR92 3I7DA 2DCKA 4D3WA 4GB33 3VBFA 5KHHA 3NO8A 4URTA 2ZX3A 2DVGA 2JE7A 3LOIA 1O3QA 1H2MA 5AVAA 5KHGA 4YGCA 4YVWC 3WG3A 1VBA3 4N43A 1YNAA 3ME2A 5CADA 4BMBA 5L7OB 1F31A 1LESA 1O4TA 1RUC1 1W6OA 3AJZA 2D43A 5E16A 2Q0AA 4YRDA 5FMOS 1PGL1 2P3JA 1RMU1 3MF6A 3ZSJA 2XH6A 3K51A 1U0AA 1OKQA 5JCTA 1LGBA 4L8QA 2CAVA 3VGIA 1SFNA 3D82A 1AYN3 3S6PA 3ZYJB 3ZXEA 4QPGA 2R16A 2F6BA 4XF3A 1C8NA 4OHZA 2BNNA 1XXNA 2UY9A 3AFGA 4FPKA 4NO4A 2H6CA 4NWVA 1KS5A 5T5JA 2RS12 1F2NA 4J1WA 3E5QA 4JTNA 5JI7A 1V6KA 5FOJB 3GBGA 2VECA 5SV5A 1NLSA 2R0HA 2XBO1 4NHLA 3RRDA 2XJRA 1FATA 1GLHA 2JD4A 4I0AA 4IEUA 1IS5A 1I3HA 1SACA 1YHFA 2Z42A 3J26N 3RJ2X 1LCLA 5CFDB 3ZMNA 1A3KA 2ZA9A 3VKOA 2DCZA 1H8VA 2VXRA 1VBC3 3VBOB 3ZSLA 1LGNA 2CNAA 4Q4V1 4UW6A 3NAPA 2WS92 1FXZA 4BYYA 1D0HA 3SLIA 1U5XA 1X50A 4IEYA 3WW2A 1MVEA 1WD4A 5A33B 2WKKA 3HT2A 4L11A 5FO8B 1ZREA 1GICA 4E4SA 1J1LA 2GH8A 2MEV1 1XRUA 4U36A 4LULA 2ET1A 1ASJ1 3PJYA 4JV4A 2ZGNA 4NHKA 3R6SA 1FOD1 4X8NA 4Z92B 2ZJCA 1QJY2 4UBGA 2HWB1 2WINB 1V00A 3S30A 1VAKA 3O0VA 4OLLA 3OTFA 4D94A 2WIIB 5DXDA 3ZPYA 3GHMA 1IOAA 4YM1A 3WUCA 4I30A 3B93A 1CQ9A 4MZUA 2C9AA 4KH9A 2A75A 4HLTA 3LGRA 2YGLA 3PLQA 2WZPP 5L7OA 3WP6A 1RHI2 3LOBA 1CJPA 1C3HA 5J98B 5E89A 4ZU4A 1HKDA 1DF0A 1V6OA 1QH6A 4FPJA 2HWF2 1FYUA 2ZZQA 1G9CA 2R30A 4DRRA 3I2DA 2ZTNA 5GZDA 4IEZA 4YW4A 4C1WA 4QPYA 4LBQB 5L36A 1I6XA 4CEWC 1HIXA 2HYKA 1QJX3 1HV0A 3LSDA 3USUB 1CPNA 1HQNA 1MS4A 4CDWC 1HRV1 1NE6A 2YYOA 4YW2A 1Z7S2 5C4WC 3SH5A 4Y20B 1Y3TA 2HWC2 5FLJA 1AR72 1HDKA 2RS53 1TME2 1LKNA 3HAGA 2JX9A 2CY6A 1JW6A 1R091 3TOJA 1XYPA 1W6MA 1NCQA 4IEWA 3AZZA 4ZXKA 3FLRA 4Y1UA 1BMV2 3M3OA 3SCHA 5GM0A 4C0BA 3GZUC 4ES8A 1PVC1 2VUAA 4DB5A 2EXJA 5JOZA 2R0FA 1VBD2 2QNKA 4CDUB 4JGYB 1MEC2 5A33A 3SITA 3H1MA 5BNNB 1MS8A 2QCSB 1SCRA 4ZKTB 3IIAA 5KBFA 3FFZA 3AM2A 1KJRA 3SXWA 2WSVA 1G9BA 1OQEA 2GMEA 3AKPA 1LU2A 1RUC3 4MGKE 4Q8LA 1UZZA 1NY72 2R042 1AX0A 3APBA 4N9IA 1RMU3 4BA6A 2YY1A 3G6JB 5C6CA 2RM22 4YW3A 4RQPB 3KT1A 4YZ4A 1X7NA 2BYVE 5H9SA 5JZGC 1EPWA 5HI0A 1WLTA 2PQQA 2A73B 1QXPA 2QUOA 3IT8A 1TEIA 2CGNA 1X8EA 2DTYA 1FMD2 2ERFA 1LULA 2NN8A 3R4UA 1WW6A 4ISRA 1DYKA 5EZWA 1NYWA 2B39A 4XFBA 2G9FA 4AEDB 2IFWA 1RUOA 1FNZA 3ATGA 4R9AA 2VNOA 3WQ0A 1H30A 1PO21 3TBDA 3H8UA 3VL8A 1WW5A 2MNGA 3D5OA 2CWSA 5FLIA 3AXEA 4FPEA 2AUYA 3UV9A 1RUD1 3QBQA 2AENA 1DQ1A 4Q4V3 4RD7A 3ZXGA 5A32B 3WDYA 2OZ6A 4LBQA 4V1PA 3PVNA 1C1FA 1RITA 2C0ZA 4XMAA 5JLVA 1ZVFA 3UK9A 4YVSB 5FAXA 2DUOA 1VB4A 2MEV3 1SQ4A 2IXKA 1ZZBA 1GKBA 3BOPA 4Y20A 3V0BB 2PHXA 1ASJ3 1DQ6A 2VVEA 4HN1A 3AZWA 1A78A 1FOD3 1YIPA 1CGPA 1PO12 4KU8A 3ZSKA 2HWB3 2UU8A 5FLHA 4LTAA 2FZ1A 2HWE2 3HN1A 2GAUA 1HX6A 3ZSEA 1V9U3 3ECQA 2JEMA 5CFDC 3FUOA 2UWAA 4L99A 4LO7A 1AZDA 3B94A 3V65A 2W0XA 4JGYA 4CDUA 4YM0A 3TYJA 4A7KA 5BNNA 2WA4A 3VBOC 4IL7A 1VBB3 2XJSA 1MQTC 1VRH2 1S1AA 1LGCA 3DF0A 1VB2A 1FI2A 4LUMA 1RUE3 2ZMKA 3B7MA 4E2GA 4RQPA 3N7LA 4P9WA 4YZ3A 2PLV3 3AMQA 3U10A 1UIKA 4Q0PA 2RMU2 1ONAA 1RVF1 3WW3A 2K9ZA 1HRV3 3AKSA 2P3IA 4DFSA 1H0BA 3ELNA 3RMXA 4LR4A 4AXOA 3RI9A 5KHIA 2ATFA 3DV8A 3E6BA 3ILFA 1XNDA 2JG9C 4AEDA 4AEKA 3AX4A 2BWCA 1AVBA 2VG9A 3FC0A 5KXEA 1ULEA 1OI6A 2DVDA 3J8F1 2XVLA 3KCCA 4FT8A 2R071 1FV3A 3LCPA 4XJ8A 3ETQA 3B3QE 4LHLA 4ORFA 1PVC3 2F4PA 3TWIA 3CJIC 5K7PA 4Q4X1 4XFHA 4AEJA 3WHTA 3H0OA 5A32A 2EXIA 3LSEA 2XB6C 1KXGA 2DFCA 2JG8B 4CEYC 5EWSA 4XMIA 3RQ0A 4YVSA 3JD71 2RR11 1URXA 1ZZCA 1AJKA 2PN5A 3V0BA 4FPOB 3AKTA 4YW1A 1ZBE2 1VBE1 2X5IB 4JGZB 1C28A 2D93A 3BPZA 4R52A 1WA4A 1YCIA 4K9SA 1GANA 1O3RA 3ZN5A 4Z2WA 1M06G 1QXJA 2JECA 2BTVC 3ENRA 3MIHA 4W6YA 1X82A 4K20A 4YZ1A 5BV6A 2KM2A 3AYAA</