3KGZA

Crystal structure of a cupin 2 conserved barrel domain protein from rhodopseudomonas palustris
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
145
structure length
145
Chain Sequence
SLRAQTAPGRWDGVAVMPYKQTAEAPFQDVSRQLLFADPNLACEWRYFEVDEGGYSTLERHAHVHAVMIHRGHGQCLVGETISDVAQGDLVFIPPMTWHQFRANRGDCLGFLCVVNAARDRPQLPTADDLAELRKDERIADFIRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a cupin 2 conserved barrel domain protein from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
molecule keywords Cupin 2 conserved barrel domain protein
total genus 34
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kgzA00
3GYDA 4XFFA 2IXCA 5I8TA 2Q1ZB 2KXLA 3H3ZA 3CJXA 2D40A 1H1IA 4MGIE 4I0BA 1J58A 4XFBA 3BCWA 4AVBA 4ZU5A 4KWJA 3D0SA 4N9HA 1IPJA 2O8QA 1DZRA 5FLJA 1J3QA 1SQ4A 1FI2A 2XL7A 2XLFA 1O3QA 1H1MA 2ET7A 3B02A 2IXKA 4IEZA 5FLIA 3S0MA 1LR5A 3E6BA 4XFIA 1O5UA 2BNMA 5I0UA 5K8SA 4N9IA 1UIKA 1XRUA 1YUDA 2ETEA 4Q29A 4BYYA 2XHKA 3U11A 3H8UA 3DL3A 3H7JA 3NL1A 1PM7A 3U10A 3E6DA 2EA7A 5I93A 2IXHA 1RC6A 2XGXA 3EHKA 1ZZBA 2H6CA 3JZVA 3OCPA 4O9EA 3SHRA 1O4TA 4FBFA 3U0ZA 3NJZA 1CAWB 1ZZCA 4LULA 4LA2A 4HVOA 2UYAA 4JVAA 1QWRA 1J59A 2CV6A 5I91A 3IIAA 3HT1A 2CAVA 4BIFA 3G7DA 4AQ6A 1RUNA 3ROUA 3RYRA 2XKPA 4XF0A 1I5ZA 2I45A 1EYBA 3H50A 4QXKA 3DN7A 3H1MA 3I54A 3MZHA 4BH9A 5I8SA 3FJSA 2C0ZA 4EWAA 3ELNA 4MV2A 4R8HA 4HMZA 2Q0AA 4XF1A 2V09A 3I59B 3PNAA 1NE4A 3R6SA 4P9GA 3D82A 4HN0A 4QM9A 1O3TA 4XEZA 4HZFA 4IETA 4CYDA 4HBNA 3MPBA 5KHHA 5I8YA 4MX3A 3H7YA 3OF1A 3ETQA 1Q5OA 4YSFA 3NW4A 2K9ZA 5D1IA 4IEYA 4MGKE 1Y9QA 4E2SA 1X8EA 5FCCA 3RNSA 2BYVE 2OA2A 1UPIA 1LRHA 1NXMA 2Z2SB 5KBFA 3LA7A 3ES1A 3DV8A 4XFCA 1HW5A 3UKNA 2BNOA 1OMIA 2OZJA 5BY5A 4F8AA 2D5HA 1EY2A 3VHRA 4A2UA 4IEOA 4I01A 4IEWA 4IEPA 3IDBB 4PJYA 3CLPA 4WBBA 5JAXA 1VJ2A 3H1WA 4QGMA 1ZZ6A 4QGNA 4MGZE 1J3PA 4EROA 2ATFA 2PTMA 4K8FA 1XE8A 1ZVFA 2HKXA 3L2HA 4B29A 3RZZA 3QACA 1WGPA 5I0TA 3FE5A 5BPXA 1J1LA 1EPZA 1O7FA 4UBGA 1FT9A 4QM8A 2PHLA 1CGPA 3SMHA 1RL3A 2WC2A 3NKTA 3WW1A 1CAUB 5CVRA 1VR3A 3UKVA 2UY9A 3EJKA 1YFXA 4E2GA 3FFQA 4UXAA 3BALA 5FQ0A 1YLLA 2DCTA 2E9QA 3LZZA 1YWKA 1X7NA 4XFHA 3WW3A 4IESA 4OLLA 5I0RA 3E97A 1ZRCA 2GH2A 5LEJA 3N4MA 1O5LA 1DZTA 2UYBA 4KWLA 4LA3A 4AVCA 1NE6A 2PAKA 3LA2A 4QX5A 5LEKA 3RYKA 5FQ0B 3E6CC 2GAUA 3WW2A 1UIJA 3FX3A 2ZKLA 3IBMA 5KHKA 4LEJA 5FPXA 4EWEA 2B8MA 4JTOA 3O14A 3BU7A 1CAUA 3LAGA 4IERA 2CGPA 1EP0A 4BHPA 1DGRA 4YYOA 1U12A 2GU9A 2QVSB 2VPVA 3KCCA 5I0SA 2H0VA 2EVXA 4OFGA 1ZX5A 4PIYA 5FPZA 1OFNA 5J7MA 2HJIA 3MYXA 5HI0A 2PAEA 3C3VA 4JV4A 4HVQA 1QY4A 2PA7A 2XL9A 4Q0PA 3CF6E 3IWZA 4H7LA 3KMHA 1VP6A 1YHFA 3SCGA 1I6XA 5C6CA 5FDBA 2B9UA 1Y3TA 3KGZA 4EV0A 3KGLA 4LLOA 4Z82A 2XKOA 4LTAA 1GQGA 1OD5A 1UCXA 4MGYE 4EWDA 3OTFA 4I09A 4LUKA 1ZRFA 2IXIA 2IXLA 3CEWA 1GQHA 4L11A 1RUOA 1ZZ8A 2PYTA 5F1RA 2MHFA 5C8WA 1V70A 4J1WA 3HT2A 4X6QB 1ZRDA 4Q0UA 3H1YA 4ORFA 4DINB 3HIFA 2Q4SA 2Q30A 2QNKA 4ZU4A 3RPQA 4ONUA 3MDPA 4META 4X6RB 4O9GA 4R52A 3I59A 2Y0OA 2PFWA 3ES4A 1NZCA 1YFWA 4YARA 1Q43A 2GZWA 2P17A 4I0AA 2EAAA 4FAHA 4MH0E 4QMAA 2XLGA 4AQ2A 3ACLA 1X8MA 1ZZ7A 2XLAA 3BPZA 1PMIA 4HSLA 4L2NA 2QCSB 1LB2A 3TNPB 3H9AA 3NVCA 1ZZ9A 4JTNA 4TLFA 2BEOA 2FMYA 2WFPA 3M3IA 4GULA 3SCHA 1QXRA 2PHDA 4HVRA 3LWCA 1WA4A 1CAWA 1Q3EA 4KL1A 1DGWA 3I7DA 2Z69A 1OI6A 1SFNA 4KU7A 3USSA 4FT8A 1UD1A 1LKNA 2FQPA 4QGLA 2ZCWA 3CO2A 1JUHA 1X82A 1G6NA 2PQQA 2VQAA 1CAVA 4ZU7A 2CAUA 4IEVA 3DKWA 2MNGA 1WLTA 4YRDA 5KHJA 4I02A 4PIZA 5E16A 5EZWA 4F7ZA 3E5QA 1ZNPA 2GC1A 4NVPA 3OGJA 5E1RA 3ST7A 5CU1A 4FAGA 1UW8A 5KHGA 4IEQA 4PIXA 2OZ6A 3M70A 4XFGA 3FZ3A 1RTVA 2MPFA 1IPKA 3EBRA 4Q0QA 1O3SA 4LUMA 3BB6A 2QDRA 5BUVA 5KHIA 4XF9A 1XE7A 3FHIB 4HLTA 2D5FA 3WW4A 2IXJA 2GC2A 4HSJA 4MUVA 1QXJA 5EFUA 1RGSA 1CX4A 4Z07A 5LRRA 1CAXA 3SCFA 5JSRA 2H6BA 3H3UA 3UKTA 3IDCB 3KSCA 3PLQA 3RDIA 3TNQA 1L3JA 4XFAA 3LA3A 2BGCA 3RYPA 5JR7B 3PVBB 1FXZA 3EQEA 2N7GA 4XETA 3QOPA 3OD0A 4IEUA 2GC3A 3S7EA 3E5UA 4IEXA 4KU8A 4WZCA 4Q0VA 2BNNA 2PAMA 2D93A 4HN1A 2OYZA 2O1QA 4KWKA 1TQ5A 3EO6A 2IC1A 5J3UA 3CL1A 2UY8A 1NYWA 5J48A 4I2OA 1SEFA 3FWEA 5JSOA 1CAXB 2K0GA 3GBFA 4E2QA 2QJVA 5LRSA 3SXWA 3ZDSA 5BV6A 4XF4A 5JSPA 2ET1A 1O3RA 3LOIA 3E5XA 4D7SA 4D7TA 4RD7A 5FLHA 3D0JA 1J3RA 2OPKA 4UBHA 1YFUA 4I3PA 2GC0A 4Q0SA 3NSTA 5JCTA 5T3NA 1ZRRA 2B5HA 1YFYA 4MZUA 4WVZA 1ZREA 2VECA 4J1XA 3HQXA 4XF3A 5CADA 4AVAA 4AXOA 2F4PA 3S7IA 5AVPA 1CAVB 5BXXA 4YNIA
chains in the Genus database with same CATH superfamily
1X50A 2C24A 4QDRA 5DZEA 2X29A 2EXHA 4YW7A 4AOCA 4ZHNA 2KXLA 4CDXB 1SCRA 3ME2A 3WNMA 3H3ZA 4IV3B 1K5MC 3AKSA 4N53A 4MGIE 4I0BA 3SITA 3BCWA 4AVBA 4KWJA 4HFSA 1QJX2 2VULA 3DPRA 5BNNA 1C8M1 1J3QA 3VDAA 3VZLA 3WNOA 4E8DA 1G86A 3N7LA 4O61A 4SBVA 4ZXEA 2J1RA 2IFRA 1O59A 1OD3A 5FXVA 4K40A 3VBSB 2CTVA 3B02A 2WZPP 1RYYA 1HXS1 4IEZA 5FLIA 1QKQA 4FFFA 4BK5A 4BXFA 2R041 4QX8A 1OPOA 4WM7A 3SH4A 1D7PM 1KXGA 1O5UA 1QOTA 4Y20A 4AGGA 5K8SA 3AZXA 4Q4X2 1XRUA 2ETEA 5ISLA 5DDJ1 1W2UA 4BYYA 3FMGA 2DF7A 2RDRA 1BBT1 2P34A 3H7JA 3SH3A 1FMD3 1AR91 2D6MA 1KRIA 2D43A 3POJA 2EA7A 4RYDA 5L36A 2IXHA 2HWF3 1CZSA 1QJU3 2BRTA 3O1RA 1ST8A 1R081 3N35A 5FYUA 4E27A 5CB7A 2YDEA 1UU6A 2WINB 4QQPA 1H8TA 2CV6A 1BXHA 3JU9A 3ABZA 3I3EA 2BV4A 3M3EA 3VN4A 4RQPC 5JOXA 3G7DA 1CZVA 2SBAA 1RUNA 4XF0A 2SLIA 1HN1A 3O7OA 2JDHA 5ERLA 1I5ZA 4XPVA 1N47A 2AENA 4Q8LA 3W59A 3JQXA 4FVVA 1DBNA 1IHMA 4AFDA 2HWE3 4Q2FA 3MZHA 1Q8OA 3J8F1 5C33A 2RS32 2ZABA 4HONA 3FLTA 4HMZA 2QUOA 2V09A 4B7EA 4FXGB 2V4VA 4D0QA 3R6SA 3J9SA 4P9GA 2ZJCA 3D82A 3URFA 5CFDB 4QM9A 4XEZA 1W0PA 5ABJC 4AI3A 4A4AA 4MXWA 3O1VA 1FOD3 1ONAA 4IW3A 2QE3A 3RG0A 2NMOA 5KHHA 3WNPA 1FV2A 2ZEWA 4UI9L 1OPMA 3H7YA 3ZLIA 3ETQA 4KBBA 4D8MA 3PIGA 5C71A 3WF0A 2A73B 1RMU2 4AFAA 1ZA7A 4QXBA 4AWDA 1X8EA 1XYOA 5FCCA 4CCNA 4IGOA 2BYVE 4NN0A 2OA2A 3ZYHA 1JYNA 1UPIA 1NXMA 2Z2SB 3HN3A 3WCSA 5KBFA 3SKJE 3ACFA 2QBXA 4XFCA 5LB6A 1HW5A 3UGFA 3VBHA 4BISA 2OZJA 4MVTA 4QX2A 2DVFA 1XSQA 3F95A 2AZ5A 4NAOA 3ZXJA 3AVRA 1JYVA 2ARAA 4GMP1 4YG0A 5C3RA 5IVBA 2WS93 4A2UA 1UF2C 4LBMA 4MG2A 1WZXA 4P14A 4FSJA 4BQ1A 3LE0A 2D6LX 4IEWA 1XU1A 2XVKA 3IDBB 2VH9A 3VBHB 4PT6A 2A7AA 4V2VA 2YBKA 4OHXA 3ILNA 1GZ9A 2PHFA 4UFLA 4QGMA 2O8OA 1HB4A 1W2NA 4UAPA 1QEXA 4XXAA 3ZVXA 3M4FA 4NIGA 5C3OA 5IFTA 2ZMNA 2HKXA 4YZ4A 3BI3A 4B29A 5FZOA 2AR6A 3C7FA 3M7AA 4ASMB 1BVP1 3FE5A 1OHFA 1N1VA 3Q8AA 1RUJ3 1EPZA 1UU5A 5KR7A 2QQPA 2PLV3 1W90A 5EXOA 1W8UA 3ZSLA 2HBTA 4JKKA 1O7FA 1FT9A 1YJLA 4LR4A 3SMHA 1RL3A 4M3CF 4V1PA 3VL9A 1UY2A 4JC1A 4MXWB 4IE6A 2I2SA 4CU8A 5JOYA 1CAUB 1S0JA 1VR3A 5A32A 2EXKA 2ADEA 4QHBA 2QQIA 4F83A 2B39A 4QHZA 5D2AA 2JDAA 5IATA 2VUJA 2PQSA 3M2MA 1BZWA 1YFXA 3FFQA 1MS1A 4UXAA 2EICA 3OUIA 3BALA 3PURA 3VBOC 4E4HA 1KS4A 1WWYA 5FQ0A 4COUA 1AZDA 4AEKA 5EQUA 1WD4A 1MEC2 5JI9A 2IVIB 4IESA 4OLLA 4XQ4A 1ZRCA 3AX4A 2GH2A 4I30A 1EPWA 3WSOA 3PUQA 1F5FA 1NE6A 1PVC2 3HN1A 4SLIA 3O1PA 3WVJA 3RYKA 4XQDA 1VAKA 5FQ0B 4CUAA 5C8CB 3JB8A 4LIVA 2VMFA 5KHKA 2JEMA 2WNEA 2JDUA 5IJRA 1JW6A 4EWEA 4N7IA 4YW6A 5L7OA 1ENRA 2B42B 2RS12 3ZM8A 3O14A 3R4UA 4MHUA 4YFWA 3RI8A 3BKZA 1CAUA 1TMF2 4Y1VA 5LK7B 4EYUA 2BPA2 1WA6X 1EP0A 1ULCA 4M01A 4UW6A 4BHPA 1N1SA 4RHV1 1OA3A 3HOBA 1RUE3 1O4YA 1C1LA 4WM8C 1U12A 2GU9A 3NAPC 4DRRA 3GJAA 4BQ4A 2QVSB 5EJ1B 3MIDA 1UL9A 2RDNA 2IZWA 3KCCA 5EIYB 1F2NA 3BODA 4LHSA 2EVXA 4OFGA 3ZIXA 2WO3A 3H3LA 2E31A 3TYJA 5F7UA 3ZYPA 2DCKA 1OFNA 5J7MA 3ZN4A 4QQOA 1XU2A 2XJPA 5HI0A 1RUG2 4Q4Y3 4LBJA 2P1BA 1DLLA 3DYPA 1KITA 4GA9A 5A7PA 1UMIA 2UWCA 3SQOA 4RS5C 2MEV2 2XL9A 3IWZA 2WLQA 1UOFA 1NZIA 1WMFA 4CP0A 1C8M2 2WLPA 1NT0A 1S0CA 3DPRB 3SCGA 2ADDA 1PGL2 1QNYA 4NRMA 2RMU3 3AKPA 5T5OA 2VTXA 3ZSKA 4JGYB 2XWJB 1I5PA 1JZ2A 2WWJA 5FDBA 1MS8A 3BYWA 1IPSA 2JE9A 2D3SA 4XDQA 3I3MA 3D4KA 3K4DA 3LOBA 3ZR5A 4LPLA 1AYM3 3OTFA 5FZFA 3LF7A 2IXIA 4BMEA 1VLNA 1IOAA 3DECA 3KT7A 1CWPA 5K4LA 1XYNA 5A7WA 3N9PA 1GV9A 2R072 1VALA 5H9QA 1GQHA 5FKBA 2ZHKA 2HWD1 4GH4A 1AYN2 3MIFA 5SV8A 5ANNA 3C8XA 4M00A 3HT2A 5F6KA 5CZKA 1VBA2 4AF9A 3H1YA 1NXD1 2VOXA 4LBQD 2G9ZA 4Q26A 5E6HA 2VJXA 4ARXA 4CXWA 1RXGA 4YWAA 1I3HA 3MDPA 3MW2A 5ACA1 4LT5A 1K3IA 3AXDA 4O9GA 1AR71 4JX0A 4R52A 3WCRA 3LEIA 2PFWA 4Y24A 4AGVA 1QJEA 3AKRA 4EQVA 1NZCA 3D3AA 4CDWC 1MS0A 1ULDA 1YFWA 2W87A 2HEYF 4YARA 3GF6A 2GZWA 5DUVA 1UKRA 3AKQA 3N9QA 4XZPA 1MACA 5C4WC 5LZ6A 1U0AA 4FAHA 2GMMA 4K1ZA 1CD3G 4QMAA 4R9AA 4Y5TA 2DFBA 1ULFA 1HB2A 1VBB3 2HWB1 3K3NA 3BU0A 1XNBA 4IV1B 1VRH2 4NIDA 2WSUA 3BPZA 2VZVA 1PMIA 4AEDA 3WV6A 1CONA 3HPNA 3LDRA 4HG6B 3ZFGC 3RSJA 2FMYA 2X8KA 2WFPA 4A6OA 1DFQA 2WA3A 1D4M2 1D2QA 1EAH3 2R063 4HVRA 4WM8B 4DEVA 3O1OA 4CUGA 2P5BA 3ORJA 4LKFA 3WP4A 2VL4A 3VBOB 3I7DA 4KU7A 2ZZJA 3WX5A 4ZS2A 3OY8B 5A7NA 4LJHA 1UD1A 5FUNA 4YW5A 3N3HA 3TAYA 1RUI1 4QGLA 3WINE 5F6LB 4CE8A 3ZX7A 4Y1ZA 4NRPA 1VMJA 4XJ8A 1ODNA 2ZCWA 1HDKA 1FYUA 1HX6A 4Q1PA 1OF4A 2PQQA 3MF9A 4P00B 1NAEA 5DABA 5EJZB 1FX5A 1R1ZA 1U5XA 3VDDC 3KV4A 1UMZA 4ZY9A 4MHRA 1XNKA 2WFF2 2Y6GA 2YC2A 3B69A 4WM7B 3OSDA 4XIOA 4FPHA 4GKXA 4PIZA 4BPZA 1VBC3 1SLBA 1IS6A 3GZAA 4NVPA 5IVEA 3HR9A 3ST7A 4Q1RA 4FQZA 5F2SA 4DNYA 1UZYA 5LCWL 1QMJA 1LHUA 2I74A 1SACA 1UW8A 1BCXA 4PIXA 3B3QE 3M70A 4DXRA 1RTVA 1IPKA 4FI9A 4LUMA 4NPRA 5BUVA 4PDWB 2ERFA 3FHIB 1H4HA 4G9SB 2DUPA 3ZSJA 4LKDA 1NLRA 3WW4A 1YJKA 2IXJA 4LOSA 4CCJA 4HSJA 2XH6A 2W9XA 2CNAA 3UV9A 4P9LA 3M3CA 4DRVA 5FO8B 5JSRA 1W9SA 1W0OA 1AR81 3N9OA 5G04L 2B4KA 2RMU1 1JTZX 3UKTA 1PGW2 3PLQA 5BNNC 1LAJA 5ANQA 1QJU2 5EV7A 3IB3A 5JLVA 1POV3 2ZGPA 1IQAA 3RDIA 3TNQA 4CDXC 5JDBA 3AXEA 4IV3C 1T6GC 4OULA 4N53C 4XUQA 3LA3A 4W8JA 1E5SA 4L99A 3LB9A 4BWOA 4XACA 5JR7B 3PVBB 3VZJA 1UYYA 2RM23 1FXZA 1NCQC 2BGPA 4ASLA 2VR4A 3N7JA 2JENA 3AVSA 5F5IA 4Z2WA 3WF4A 1W8WA 3P3NA 3QOPA 3JXSA 1GSLA 1JS9A 1OLQA 5T50A 2JD4A 3AP7A 1LULA 4BU2A 4IEXA 4KG0A 1SPPA 1HN0A 4GJZA 5L9VA 1EV11 2BNNA 4BLIA 3MFAA 2NZ9A 1V0AA 1X9TA 5DN2A 1W8FA 5GKAC 4HN1A 1IS4A 2R1BA 1NUKA 3RI9A 5FZ3A 2ARXA 1LHOA 4KMQA 1CQ9A 3NAPA 4KWKA 4QD2A 4Y33A 3WDXA 3WG3A 1QF3A 2H0BA 2D6PA 5J3UA 2RM21 4IE5A 2D7FA 4LO5B 4PHZA 1HKDA 2WN3A 2BBVA 3FWEA 5JSOA 2JKBA 2P3YA 2B45X 1NA1C 2C5DA 1LGCA 2E7QA 5FZMA 3ZIWA 2WZR1 1WW6A 3QCWA 2QJVA 1IS5A 4Z1VA 5LRSA 3SXWA 4IE0A 4GH4C 5J1XA 4PCRA 4PLNA 5FYCA 2E26A 3BOWA 5F5CA 3ZDSA 5JSPA 4MGTA 1KFXL 2OUJA 4H2AA 4MLOA 4TSVA 4F3JA 2NN8A 2JECA 2CSGA 2WNUC 1WCQA 1BEV2 2IWGB 4C8DA 5LY1A 3BVCA 5JZGC 2A3WA 3IT8A 3ZFGB 1GZTA 2Z4FA 5SV5A 1YFUA 3PUSA 4UOJA 2GC0A 3R4DB 3OUJA 4QKDA 2WS92 1YQ5A 4A3XA 4Q0SA 1RHI1 5FWEA 2B5HA 1ZYBA 3I2GA 3T0BA 5JPMB 1YFYA 5JOZA 1D4M1 1SDDB 5FY4A 4Q4W3 2VECA 1S0DA 3W20A 5C70A 3ZR6A 4Y26A 4AXOA 2VCBA 3PUHA 5AVPA 3ZXDA 5BXXA 3LCPA 1VMFA 4YNIA 3AYDA 1KGYA 2IUWA 5FZ6A 3KCXA 3T30A 2CWSA 2R7EB 3PUIA 5LWBA 4CCDA 1OVPA 4M3CE 1ALYA 2X5IB 2YZ4A 3VKMA 3CJXA 1EUUA 2D40A 3AFGA 2V5DA 5LA1A 4CZSA 4XFBA 4WVVA 1DGRN 1HRI1 2XJTA 3OGSA 4XBQA 4ZU5A 5DMYA 3D0SA 4AVTA 2TBVA 2O8QA 1DZRA 3UESA 4XQWA 1WBLA 5CNAA 1O6UA 3VBRC 1UXXX 4DEQA 4KNCA 3O1UA 4XHXA 1Q56A 1VIWB 1OLME 1LJ7A 1RHI3 4HK8A 3WEZA 4AEDB 3W9AA 3IAQA 2JICA 4JHZA 4ARYA 3WF3A 1US3A 2XQRA 3A4UA 3RZKA 2VNVA 2HYXA 1RUH2 3UYJA 3T2QA 2KM2A 3VBFB 4AL9A 2DVDA 2J42A 2BOIA 1LR5A 1PZ7A 3A22A 4XFIA 4YW1A 1PO11 4GQ7A 3CU7A 1DQ0A 2WABA 4XZUG 4CCLA 4N9IA 1U5YA 5IHRA 2V73A 5HXVA 4Q29A 2BOJA 1TVGA 3TB0A 2ZHLA 3U11A 3POWA 3HQRA 2HH9A 5FUPA 1OBNA 1YQ6A 5FKCA 2ZPXA 2WSVA 5F5QA 1LECA 2CGOA 3K48A 3GGLA 4O9EA 5DUWA 1O4TA 5FOJB 2ZX4A 3KHBA 3RVHA 4FBFA 4LNVA 2YROA 2P2KA 5GLTA 1N3PA 4CPBA 3U0ZA 4XJ9A 1DHKB 1IQDC 1PVC1 4GH4B 4UYBA 1BQPA 4YM3A 3MV01 1IKQA 4HOOA 1QWRA 1TMF3 3RWKX 3FUQA 5A7WB 2B7YA 5JUVA 5T54A 5IWFA 3I2OA 2A70A 5CG9A 2QQWA 2Y33A 2CAVA 4BIFA 2A3XA 3CNAA 4AQ6A 4ES8A 3JBG2 2Y6HA 3RYRA 1MVQA 4Q4V2 1DF0A 4XABA 2UURA 4A41A 4R9CA 2ORZA 4EN6B 1OA4A 3I54A 1MZFA 1FPN2 1XJAA 1LENA 3J4UH 5A6ZA 1AVBA 1LTEA 4JGYA 3FJSA 2ZA9A 5I8SA 4BH9A 3H8XA 2KR2A 4R8HA 3ZXAC 4XF1A 4YZ2A 3M1HA 4TN7A 4ZKTB 1OOPB 4AHZA 2YU1A 1ULOA 1BYHA 4HN0A 4N43C 5TSWA 1O3TA 2V72A 1RIRA 2DYCA 4KBZA 4GKYA 4JDOA 1ENQA 1XE0A 1C8M3 5FZ9A 4HZFA 4C90A 3WDTA 4IETA 4HBNA 4QQHA 4LORA 4KWUA 4MX3A 2OUHA 2NYYA 3OF1A 2C6SA 2G19A 1Q5OA 4KGQA 5GALA 3NKGA 1MS5A 4YSFA 1W9TA 2YBPA 1BMV2 4PLMA 1CJPA 3DCQA 1LU2A 4E2SA 2Q8CA 3KS7A 4QT6A 3ZOIA 3LQCA 2NP0A 1W6PB 3ENRA 3CJIB 2VVFA 3T1MA 1LRHA 1NOVA 1ZBA2 3OG2A 4JRAA 4LK6A 4QKFA 3BIEA 1WW5A 3ZMNA 4CCKA 2XJQA 1X33A 2BNOA 2R073 1DYOA 1UNBA 3VV1A 4XE9A 3AMNA 4OMDA 2VM9A 2D5HA 4CCOA 1EY2A 1W3VA 5IYYA 4TTGA 3A0NA 1GKBA 2EIBA 4NHLA 4CP2A 3T4VA 1H1AA 2BW8A 1DGLA 1GNYA 1DIWA 1VBA3 2EF6A 2JKXA 3FLRA 1MQTB 4K21A 4XDOA 5C8CA 1POV1 3EXUA 3AP4A 2CU5A 4IEPA 4ATFA 4PJYA 1YIFA 4RFRB 5A3MA 1DP0A 3CLPA 5CA6A 3I3QA 3HAGA 3NNFA 5JAXA 3GBGA 3V0AA 1GBGA 3H1WA 1ZZ6A 4AGRA 4BM8A 1COV1 3NV1A 3ZYIB 1HRI2 3POIA 5IVFA 1J3PA 1R092 3JUUA 3OBZA 5DG1A 2ATFA 4YW3A 4K8FA 3WUDA 1RVF3 1PO23 1XE8A 3L2HA 4PBOA 2VUCA 3H8OA 1RUJ1 3RZZA 1N3QA 4B7KA 1K5MA 4GD4A 5A3PA 2XJUA 1GP5A 2WZEA 3Q9OA 3EYPA 1W6QB 1XOYA 2ZKNA 5GZEA 5FIXA 1UY3A 4LITA 1W9YA 3OEBA 3OOXA 2Y6JA 2VCMA 3OGVA 3VHNA 4QM8A 4XMAA 2PHLA 5A1AA 1CGPA 1XNAA 1VBE3 4PQQA 1YI7A 5FJKA 3WW1A 5C3SA 2DCZA 3B9CA 3VZNA 4LE3A 4B8EA 1LHWA 5EHDA 4QPGB 3UL2A 3QLQA 3KT4A 3VBSC 1EAH2 2DCJA 2R062 4XVHA 2A6VA 3S57A 5DAWA 3U75A 5FZ8A 3GZUC 5C7GA 3EJKA 1C5HA 3X29B 1N1TA 1QDCA 2R0HA 1ENSA 4JDMA 1A3KA 5IVYA 1GNZA 1STMA 2DCTA 4HKWA 5FZOB 1X7NA 4XFHA 1C28A 1GANA 4XUOA 1G9AA 5I0RA 3IPVB 2YFZA 3MO4A 4AG4A 5LEJA 3N4MA 4CA9A 2W95A 3S30A 3SH5A 4AVCA 3RZGA 3LA2A 1H2NA 1RMU1 4GWIA 1TZOA 2GAUA 2CGNA 3OUHA 1GYKA 1UIJA 2GALA 2WAAA 4ZONA 3AMMA 3AMHA 1BKZA 1SBEA 2ZEXA 4HT1T 3QBQA 1SLAA 2EIEA 4IGQA 2WUHA 4LEJA 5FPXA 2B8MA 1OC1A 1KJLA 1L7RA 4M3CA 2YY1A 4DUVA 3S5AA 3T4HB 1AYN1 1OQDA 2JG9C 4YG3A 1H8VA 5FO9B 4IE4A 4AHYA 2A6YA 3O0VA 3KCYA 3MF6A 1UZ0A 1W9WA 3V56A 3RZHA 1TG7A 2VPVA 4BIOA 1G9DA 1LOAA 2ZHMA 2H0VA 2E32A 2QQLA 5ACA3 5CBLA 3GJBA 4AEJA 3FLPA 5FFOC 3WHTA 2HWE2 1RITA 5K7PA 2W0XA 2YPJA 1AR61 4JGZC 2CDOA 2ZMLA 3WZ1A 5CFDC 4W6YA 1OH3A 5M0TA 1DQ5A 2HLEA 2JJ6A 2OPWA 4JV4A 4HVQA 2Z5WA 4HKLA 2BWCA 2ID4A 2PA7A 4Y3OA 2GDFA 1V9U2 4Q0PA 1QJX1 5CFDA 2RJ2A 2AACA 4H7LA 3KMHA 1FOD2 2GMPA 1GICA 1NCQA 1YHFA 1PMHX 2W39A 3HBZA 3HNMA 3MIBA 4YZ3A 1VBE1 1QJU1 4CU7A 5C6CA 2YB7A 1LOGA 4NIAA 3E1F1 1RUC3 3KGZA 5IW0A 1OT5A 2PN5A 2XKOA 3LEGA 1AHSA 1C1FA 1S0IA 2DFCA 1UCXA 2VE1A 4MGYE 1REEA 4EWDA 1A6CA 1ZRFA 1F31A 5F3IA 4LXLA 4IUGA 5FV3A 2B9VA 2IXLA 3CEWA 3OYWB 5FYVA 1GOHA 4UF0A 1COV3 2XUEA 4L11A 1RUOA 1H8TB 2PYTA 3FFZA 5F1RA 2MHFA 1GLHA 4NR1A 5FZAA 4LO7A 4AE2A 4O65A 4FPLA 1MQTC 4CEWC 4Q0UA 4UFKA 1RUF2 4DINB 5KXCA 5CKMA 1WCDJ 5FP7A 4AVSA 5FYTA 5FYHA 1H2KA 2R071 3POGA 5FMCA 1POV0 4LO8A 3RPQA 1BVVA 3ACHA 4ONUA 5HCBA 4META 4C1XA 3I59A 2E51A 2Y0OA 1F4HA 1W3XA 5BNOC 3ES4A 4R9DA 4L8QA 4NMIA 4FP3A 3N9LA 1Q43A 3ZPYA 2VZQA 4XJZA 4Y20B 1W6OA 2EALA 4TYSA 4COVA 4NHKA 2XDVA 1SBDA 1BEV1 1JHJA 1L7QA 1RUJ2 2XLGA 3VZOA 4AQ2A 3T0AA 4NIHA 2FCVA 2PLV2 3AL6A 5HBAA 3POFA 1ZZ7A 4JHTA 3VBSA 2XLAA 2WZ8A 4M0NA 4I3GA 1LNSA 3W5MA 5DUXA 2RR12 2CHHA 5FYSA 3U14A 1RUI2 2VG9A 5FY0A 1GUIA 4CXXA 1ZZ9A 2VBBA 3BOPA 4JTNA 4KQ7A 2BEOA 2RE9A 2XVGA 4E4SA 3M3IA 3U37A 3P6BA 4BA6A 2P3KA 2PHDA 3C7GA 1SFPA 1CAWA 1QHDA 2HEVF 1YXWA 2Y60A 2YHJA 3BPSA 4QHOA 5D21A 3BTYA 4Q4W2 3T09A 2VUDA 2FDIA 4IV3A 5FMBA 4FT8A 5JI7A 2FQPA 4CDXA 2HWC2 2B46X 4YZ1A 2C4XA 3HMYA 4DOUA 5A33A 2LTNA 1XC6A 3INAA 3BGAA 4UW4A 5DAXA 1JZ7A 5LBCA 4URAA 5AFBA 4YG6A 3DGTA 3USUB 4IEVA 4RGAA 4LBQA 4YGCA 3KQRA 1G9BA 5C8CC 2GNMA 2RS11 1WLTA 2XWBB 4YRDA 4RFT0 3KT1A 1YO8A 5E16A 2VNRA 3WDYA 1OSGA 2E63A 1ZNPA 2GC1A 2W91A 3E5QA 4MGQA 2A1XA 3VKFC 5A7OA 4HKOA 2EIGA 1YRZA 2C26A 4CXYA 4FAGA 2QQMA 1RHI2 3GALA 1ULEA 2E6VA 2OZ6A 4JKMA 4QPIA 2MPFA 4IQPA 1RUH3 4FPYA 4YZ5A 3U07A 2BZDA 4CEWA 1RUE2 2NPIA 2YGMA 1RUG1 3TN91 1XE7A 3WR0A 4BK4A 4XJUA 1SBFA 1ND2A 1QJZA 2D5FA 5CKQA 5FMDA 3PTRB 1R091 3AK0A 5FXXA 4C0BA 4CCCA 1QXJA 3K3OA 3ACIA 5EFUA 3O0XA 1AR73 3J7NA 4WZFA 4AHWA 5A3NA 5LRRA 2QFEA 1CAXA 4RS5B 1QH6A 2W46A 2Q8OA 2WS91 3KSCA 2Y6LA 4YFZA 2VOVA 3AZVA 1ODMA 3VB9A 1OA2A 2OXBA 5IVJA 2ZX1A 1CVNA 1FNYA 1V6KA 1V9U1 3OPWA 4XFAA 4LMFA 3RYPA 4KH9A 3IMMA 4HPKA 1A78A 2EXIA 2RMU2 4JCKA 3CBNA 3EQEA 1EAH1 1AR82 2R061 3WXPA 4YGEA 4B4RA 1LEMA 3VBRB 3A21A 4XTMA 5FY9A 5K9YA 3OB8A 4RR3C 2W94A 1Y9GA 3CMGA 3UGGA 3WQ0A 3S7EA 1FNZA 3E5UA 2HWB3 1HJGA 1PZ9A 5GZFA 3SC7X 4B4QA 5AVAA 4FOVA 4Q0VA 3D6EA 4NWWA 3RMYA 4FPKA 3R0RA 4MYEA 2PAMA 1H9PA 2Y8KA 5C4WA 2YUEA 3VDCA 3GXUA 2OYZA 2O1QA 2Y6KA 1S0EA 3KVBA 1IG0A 1AYN3 1UX6A 2DUQA 2Y6FA 4CDWA 3MFCA 5BNOA 5D8AC 2VMHA 4QPIB 2WYFA 1UU4A 2UY8A 2WO2A 1XBFA 1NYWA 5GLWA 2P3IA 2CDPA 4N43B 2WNVC 5A7SA 1UZVA 2VY0A 4OHWA 1X36A 4I2OA 5J37A 1F15A 2K0GA 3GBFA 3LGRA 1OXCA 3GZTB 2QTWB 5L7OC 2JDMA 4E2QA 4LLFA 3VDDB 4R4XA 1O8SA 3GNEA 5F9TA 4WM7C 1W2AX 3VZMA 1P8JA 5DDJ2 5FP3A 5BV6A 5JOWA 2P6HA 3ZXKA 2VQUA 2Y64A 1G9FA 1QQP1 3IKWA 3JBG1 3ON7A 2OT7A 2D3RA 1UAIA 1HJFA 2ET1A 4LHNA 3U4SA 4IV1C 1ZBA3 1RUH1 3WG2A 5C5TA 1W8HA 3LOIA 1MVEA 3ZN6A 1NCRA 4L9BA 2WNVA 3E5XA 2A6XA 4A7YA 4D7SA 2Z79A 1VRH3 4GXLA 4XAEA 5FLHA 3TN93 5C9AA 3TBDA 1R083 3J26N 1J3RA 2FBEA 2VCAA 4D6RA 5LASA 4L97A 1DYKA 5JCTA 2GN7A 1BJQA 1Y4WA 2IFWA 2ORXA 1D4M3 4BQ5A 1JZ5A 2R1DA 3BTAA 4QB6A 2VMDA 4WVZA 1PMJX 2XJVA 1DQ6A 5FZIA 3KHCA 1BK1A 5T5LA 2WQ8A 4LO4B 4OI2A 3TRSB 1OF3A 1MZEA 3ZFFA 4A6SA 4XDPA 4RR3A 2R043 3MLLA 4YW4A 5LA2A 3GYDA 2VZSA 1DDLA 2R49A 3RZJA 5H9SA 3MPPG 1RVF2 2RS53 3VBUC 4FCAA 1NY71 3CQOA 4OHVA 3ITQA 5F5AA 1W6OB 4A3ZA 3I2KA 3FL7A 1H1IA 2WFF3 3M3OA 3S6PA 2GN3A 4RHV3 3DXUA 1JOPA 1HLCA 1SQ4A 4KGGA 5CFCC 5LBEA 3WLUA 1W99A 2XLFA 4K20A 2JG9A 1NCRC 2X53S 2ET7A 1LOFC 2VCCA 2DVGA 4XC9A 5FPUA 2VZTA 3E6BA 5IK4A 5A3UA 5I0UA 1WD3A 4AFBA 3RJ2X 2XPJA 1HV1A 1O8PA 4OQ9A 1JYTA 3NJXA 1YUDA 4TWTA 2JG8A 3NQHA 2ZOEB 1E5HA 2EAKA 2VD7A 2XHKA 3H8UA 3DL3A 5FJHA 3PL0A 4CUBA 4Q5OA 4D94A 3LIGA 1PM7A 2ZGSA 4IGPA 3U10A 1I9RA 1VBD1 2J1EA 3E6DA 3LIHA 3ZYFA 4BCUA 5CKNA 1IGOA 5HV0A 2ZXQA 2XGXA 5I93A 1JXNA 1PO12 1RUD1 3JZVA 3PHMA 4JRLA 1NLQA 4P9WA 5FXWA 3U1XA 1LHVA 2CY6A 3TEZA 4CDQC 3SHRA 3GHNA 2DDUA 1LGNA 1IZ3A 1NCQB 3VDBA 2VZOA 5K0UB 1TMF1 1PM4A 4LULA 3N9MA 2WNOA 4JVAA 1NX9A 5I91A 1XNCA 4OI1A 1CX1A 3IIAA 3HT1A 3FBYA 1PGW1 4LKSA 1WMEA 2NLRA 4EN8B 5FZCA 4BXSV 2AGSA 1O91A 3RZMA 3PTYA 4LBOA 1FAYA 1HRV1 3UK9A 1BBT2 2VMGA 3N7KA 2JXAA 1X9PA 3RRDA 5A1FA 1EYBA 3MGUA 5ACA2 4QXKA 2L9LA 4UT5A 2JDNA 3VD9A 5LK5A 1UOBA 2FMDA 3ZYJB 4EWAA 2D98A 2QZ3A 4XUPA 3WOGA 4D6QA 2YGLA 4IDZA 4YM2A 3KWVA 1HXS2 2ZS6B 2VGDA 4JGZB 3IZOA 5FY1A 1NG0A 1V9U3 2YBSA 4HXCA 1JU4A 4M3CB 5FRAA 4AK3A 2VZUA 3SLIA 2ZGRA 1FPN1 3I8TA 2J1VA 4NOTA 1W8ZA 5FYZA 1EUTA 2W68A 3WNKA 5I8YA 5HPOA 4PF1A 4HK9A 3A23A 4FPJA 4CEYA 3MI8A 1SLCA 3IIIA 3MHZA 4EN9B 3WHUA 3ZXGA 3VD7A 3UGHA 3NW4A 2K9ZA 5D1IA 4IEYA 1TEIA 4MGKE 4S2FA 4CDQA 1Y7BA 1YQ2A 3LD8A 4QPWA 5KC6A 5LY2A 5LBBA 1YEWA 3JD73 3RNSA 4C0HA 1OFSA 3M8LA 3L2YA 4FFGA 1JUIA 3J7HA 1D4VB 3H42B 5CFCB 2W47A 2FD8A 2YFUA 3AYCA 5IK8A 4DZGA 2WKKA 1OMIA 4MSVA 4BLJA 5BY5A 4QX1A 3WNLA 3CDZB 4P9XA 4ZXKA 4CP9B 1LESA 4Y22B 3V0BB 5FZLA 2HYKA 3G6JB 1ENXA 3HNBM 4WVMB 2XBO3 3T2TA 1HQLA 3R05A 4IEOA 4XCAA 3V0BA 4RN5A 3POYA 4QKNA 1AF9A 3B93A 4QPGA 4I01A 2LROA 4LIUA 3PMSA 3ZN5A 5FP9A 4ZS3A 3HNYM 4QAWA 4DXTA 2WIIB 2VMCA 3ECQA 4WBBA 5CFCA 1VJ2A 4U2AA 4QGNA 2QKDA 4QQ2A 1WCKA 1GQPA 2XJRA 4EROA 5GLZA 3I3DA 3PVEA 1ZVFA 1KDKA 4DMIA 4IE7A 4QU1A 5F3GA 3AFKA 4DXZA 1K5MB 3QACA 2A71A 2R0FA 3AM2A 3LDKA 4RL7A 5I0TA 4CDQB 1E5IA 1SG3A 2ZHNA 3HEIA 3NNJA 4W50A 2JIJA 1W28A 1S55A 3OPZA 4UBGA 4Y4YA 4YM0A 4FO9A 4A42A 2G9GA 2ZX3A 1G8WA 1R1A2 2J1UA 2WN2A 3GCXA 5CYYA 5F3EA 3V0AB 2RR13 2WC2A 3NKTA 2UU8A 1W9FA 2E7AA 4RQPA 5FZDA 4NE9A 4AYUA 4RSUA 2XJSA 2JDZA 4UW5A 4JGZA 4P5YA 1WLCA 3CIHA 4PI2A 4OUEA 5J98B 3VBFC 3ZFEA 4QXHA 4A7KA 3B00A 4K9SA 1US2A 4OMCA 5BNPB 3K2OA 1S2EA 2HWC3 2A6WA 3THDA 3W58A 1ULPA 3VD3A 1QDOA 5E88A 2ZAHA 2R6QA 3QH7A 3WW3A 2C1FA 1YNAA 1Q8SA 1CPNA 2WT2A 5HXMA 5F2WA 4FQ4A 3AZYA 4Z8BA 2WO1A 1VB4A 4X8PA 5IUQA 3CJIA 4B3NA 4I0WB 5ABJB 3C2UA 2X09A 2ZAAA 1NQJA 4LA3A 1UY1A 3B01A 1B35C 1XQNA 2PAKA 3KZ4C 3A7QA 5FY7A 1S0FA 5CAZA 5LEKA 3T2OA 3E6CC 3FX3A 3IBMA 2J22A 4E4ZA 4E9KA 2EIDA 2ZGNA 5FPAA 2XOMA 4AEMA 1ACCA 1AUYA 4DUXA 3KF5A 1W06A 4O7XA 3OBTA 4JQRA 3ZFEB 2XB6C 5FY5A 4CDUB 3ZKUA 1B09A 4AI0A 2RV9A 2A5ZA 4OHYA 5J09A 2WWUA 1MS9A 3BU7A 3LAGA 1SHWB 3CJIC 4RQPB 1WBFA 4FTSA 1SZBA 5A7QA 4ES9A 3NNGA 1OLRA 2JB4A 1VRBA 1AR62 4XJWA 5A6QA 4GB33 3JBG3 5FZ0A 1HIXA 1TNFA 2AUYA 3IM0A 1WMXA 2XR4A 1MS3A 3NWKA 5L9RA 3GCWA 2BBAA 1KFUL 3ILFA 2QQUA 1JYIA 3ZYBA 3LPGA 3B94A 1J1TA 2HJIA 1V6LA 3CZUA 1AR72 3MIEA 4Y5SA 4AW7A 5J96B 2DU1A 4CP1A 2VW0A 1Y43B 2XQXA 5C3QA 4LK7A 1Q8PA 3LEKA 3C3VA 1SFYA 2KA3A 1MZ6A 3WNXA 4GALA 1W2OA 3CF6E 5L73A 3DEMA 4D6SA 1LODA 2J1SA 2Y38A 5E8AA 4MO3M 2DV9A 4WVMA 5FREA 1AR83 4AI9A 2XHNA 1AXKA 2RR11 3VHPA 4GZ9A 5A3OA 2RDQA 3PVOA 4RGKA 4YVSA 2B9UA 5B4NA 1ND3A 2ZGMA 1A34A 1NY72 3KGLA 4Q4V1 4LLOA 3Q8FA 1VMHA 4NPLA 5IT6A 2UWAA 5C9AC 1LEDA 1YI9A 1GQGA 3Q8EA 4RR3B 3RQ0A 2RJKA 2VAUA 4OCTA 1AX0A 4LUKA 1R64A 1DGWX 2XMLA 1L7LA 2EXJA 3LEMA 3WF2A 4XYXA 1PIV3 4PDWC 3AC0A 4MGSA 4HANA 1CPMA 3RGBA 1ZZ8A 5LA9A 3OEAA 1A8DA 3AYEA 4J1WA 4BQYA 2OQ7A 2BUKA 4ORFA 2LS6A 3HIFA 5A6XA 2Q30A 4C1WA 3LDBA 3RS6A 1WW4A 2QNKA 4FOQA 4FPOB 2XG3A 3UETA 4ZU4A 1UXZA 4X6RB 3TWIA 2WNVB 5FZ1A 4CSWA 3ZN6B 1G9CA 1YIPA 4YVWB 5DG2A 5D8AA 2PHXA 1HRI3 2BFUL 2GNDA 1R093 3B5LB 3LKJA 4QX3A 5T52A 1QQP2 3NMBA 2BTVC 1PO22 3ZYGA 4I0AA 4MH0E 2TEPA 3B9IA 4AI8A 1W8OA 3RWNA 2WA4A 5AC91 1WLDA 1BHGA 1NQDA 4Q4W1 3WDUA 3TN92 1UQXA 1JYCA 2W52A 2WNUB 1R082 2JE7A 2QCSB 2W1WA 1VBE2 4L2NA 4NHYA 3TNPB 3H9AA 3NVCA 2CL2A 4FXKB 5JZGB 1W6NA 2ILMA 4TLFA 2K46A 1W39A 4D7YA 3LWCA 1WA4A 2VMEA 1Q3EA 3OGGA 4KL1A 1DGWA 2BERA 1DG6A 5BNPC 2WDBA 4Q8KA 2Z69A 1OI6A 1SFNA 4XBNA 4YGDA 1RUD2 3T0DA 1UOGA 4GMP3 3WD5A 1W6MA 2RHPA 1HRV3 2MEV1 2WT0A 4NROA 3WQ1A 3ZFGA 3VL8A 2G4IA 4BB3A 4S2DA 2R042 1ZA4A 2ZX2A 3CO2A 5JMCA 2DTYA 2E7TA 3CKHA 1JUHA 4Z2AA 2ZGTA 5CIRA 2BWAA 1CZTA 2LM3A 3APBA 5DAPA 1G6NA 2VQAA 3P1IA 1CAVA 4EN0A 2ZEYA 2CAUA 3K75B 1QOOA 1N1YA 4YGBA 4TZDA 3VBUB 4PI0A 4K1YA 4AFMA 2X5IC 4OQ8A 2QQNA 5BNQA 5KHJA 4I02A 4HPKB 5JXGA 1TME2 4DB5A 5EZWA 2R30A 4CTEA 4QQLA 2W1QA 1AJKA 4RHV2 2FDFA 5F37A 3V65A 2BVVA 1VBA1 5CU1A 1RINA 1URXA 3OJBA 2AC1A 2ENRA 5FZ7A 2PXJA 2QQKA 4XFGA 3FZ3A 3EMRA 3TEYA 1H2MA 3HJRA 1O3SA 2DVBA 2IVJA 2VZRA 3BB6A 2QDRA 5FPLA 5AC92 4BDVB 1PVXA 5AFEA 5KHIA 2TNFA 3DKQA 4XF9A 3POBA 4AHXA 3P5BA 1AL0G 3NNMA 1Q8VA 2WBKA 4Q4X3 4DXSA 1F8VA 2FHRA 1PO21 2GC2A 4FPCA 2R16A 4CEWB 4CU9A 1IKPA 4BOWA 1JI6A 3SNMA 5B2GB 1FMD2 1UOJA 2OS2A 4Z07A 5FP4A 3UNPA 4XAAA 3VD5A 3SCFA 1ZRIA 2QDNA 4H3WA 3UJOA 2DVAA 3KB5A 5FK7A 4RA0A 4A45A 3P3PA 2P37A 2PHRA 3I4IA 3U4XA 1GZCA 4UFMA 3W21A 3PU8A 5T5JA 1L3JA 2BU9A 1V6OA 2W3JA 1AX1A 1XNDA 3OD4A 4WVWA 3VLBB 1VBD2 3IAPA 2VNGA 1QIQA 1VAMA 1OUXA 1EV12 2N7GA 3NV2A 5IK5A 2RVAA 1H6XA 2P3JA 3ASIA 3IDEA 4QDQA 1RUC2 5DAQA 2WFF1 3GHMA 2YPDA 5JXJA 4GMP0 1WMDA 3OD0A 2JB8A 1NCRB 2GNBA 5DZFA 1KQRA 2GC3A 4IEUA 1BBT3 4N90A 3DYMA 5FPBA 5HV4A 1MR5A 4KU8A 1T6BX 4KG8A 1ASJ2 2BGOA 3KV6A 4NAMA 4QX7A 5FY8A 4Q4X1 1H8TC 4ITCA 2D93A 5CISA 2VBPA 1COV2 4N8MA 3FC0A 2RS33 1QNWA 2CYFA 2WO7A 4YW2A 3WNNA 3BUCA 2VZPA 1HXS3 5FZHA 2D6OX 1PHMA 1PK6C 5IK7A 5B4XA 1OVSA 2DU0A 3EO6A 2IC1A 1RUF3 1OOPC 4BMBA 5A3TA 3CL1A 1VPHA 4EE2A 5J48A 4BQ3A 1D2SA 1S4CA 3IMNA 4FPFA 3POSA 3O1MA 1SEFA 4A44A 1C5IA 4QPYA 4BJ0A 4CDWB 1QJY3 2WL1A 2V5YA 2PLV1 2YG0A 3DUIA 1VRH1 2RDSA 2W1UA 2WT1A 3KVAA 3HQUA 5F3CA 5K0UC 5KXDA 3D5OA 3A0KA 3FHAA 1ZBA1 1MS4A 3JD72 1UPSA 4YM1A 2VMIA 3KLSA 5FBJA 2D6NA 5IVCA 3TOJA 2K2SA 2F4LA 3Q8CA 3MEPA 4D7TA 4RD7A 1LOEA 1PX4A 4AR2A 4COWA 2VTFA 4XUNA 3SEPA 3HBKA 3VBRA 2OPKA 3KV5A 3LSEA 1RUI3 4LKEA 2NM1A 5F39A 1W0NA 4K8RB 4YVSC 4AAPA 1FATA 2XBO2 3VBOA 1ZRRA 2BFUS 4LOTA 5C5UA 4OI0A 1E57A 1Z7S2 2GH8A 5FYYA 3POEA 1ZREA 2ZGQA 4P9YA 1GOFA 4UF0B 4XF3A 2GMEA 5CADA 2WR9A 3B7MA 3VBUA 3GBWA 1TE1B 2F4PA 4ISQA 4AVAA 4DUWA 2VOTA 1CAVB 1UN1A 2AREA 2XBO1 3KF3A 2ZGOA 5IAVA 4RS5A 3RMXA 1C8NA 3ZSMA 5FOBB 2ZGUA 3PU3A 1M06G 4XFFA 2IXCA 5G05L 2Q1ZB 5I8TA 5KC5A 1V6IA 1LCLA 5IFPA 1ZBE2 2P6CA 1W6MB 5FZKA 1AL23 1ND2B 5DUUA 2CWMA 4UFHA 1J58A 1LGBA 1DU3D 4XIKA 5JR2A 4DY5A 2Y0IA 4N9HA 1IPJA 4K6BA 2X05A 1OURA 1FOD1 3C7EA 5FLJA 1W6NB 4G4FA 3MBWA 1FI2A 2XL7A 3JQWA 2JD9A 1W03A 5JZGA 1O3QA 1H1MA 2VUAA 1G7YA 2WNUA 2ZTNA 4QPGC 1RXFA 4FFHA 1K5JA 5F8PA 5FO7B 2IXKA 1QGLA 1WKYA 2DURA 2VC9A 1QXPA 3AMQA 3GDBA 3NO8A 3F2ZA 1AJOA 2V4AA 2A75A 3MW4A 2AEZA 4OI4A 4QX0A 4WV8A 3O12A 5HCFA 3S0MA 2HBUA 2BNMA 5FXZA 5KWRA 2PMWB 3WDWA 3FBMA 1MEC3 1OUSA 3AKTA 4LBQB 1UIKA 2XXZA 3USUA 1DQ2A 3DF0A 1PX3A 3HD8B 3N36A 4QPIC 1XPWA 5D8AB 4LBKA 4YVWA 2VQ0A 3KD4A 5FUIA 1RJ7A 2BDRA 3NL1A 5A33B 3WG4A 5HCHA 4FOYA 3WQBA 1UZWA 3N9NA 1VAVA 1RC6A 3EHKA 3O0WA 4GWJA 1ZZBA 2H6CA 4B4PA 3I2FA 5L19A 1SDWA 3OCPA 2FCTA 1C57A 2BQPA 2A3YA 3BTZA 3NJZA 1QOSA 1CAWB 2RS13 5A70A 1ZZCA 5FYIA 3ZFEC 4LA2A 4HVOA 2UYAA 3AJYA 1PIV1 2GNTA 4K7JA 5GLUA 5GZGA 1J59A 2FDGA 3PDQA 2VOWA 2YYOA 4P5HA 1Z0HA 1REDA 1FV3A 1UO9A 2BP6A 3PUAA 4UFJA 3O1TA 1NKGA 1V6JA 3MLJA 4GB32 4CU6A 3IPVA 4OUSA 5FAXA 4Q4Y1 1GU3A 4QXCA 2NQYA 2XKPA 3ROUA 4CPBD 3AZZA 4NHMA 2G9FA 2I45A 1ND3B 2HWB2 5FR3A 1GP6A 1Q8QA 4LBNA 4YVSB 3H50A 5L9BA 1AXZA 1FMD1 3I2HA 3DN7A 3H1MA 1A8MA 1S2BA 2DUOA 2E53A 3WP6A 2C0ZA 4AI1A 1RUG3 3J7MA 2A6ZA 3ELNA 4MV2A 2VOKA 4PBPA 4Q4Y2 4GB31 5FZBA 2Q0AA 3C7HA 1XNTA 3I59B 3PNAA 1NE4A 3GM8A 1PGSA 4JKLA 5FYBA 1SLLA 2J7MA 3T1LA 3VHOA 1CR7A 4LHLA 1RJ8A 5IAXA 3J8F2 4UFIA 3SISA 5KXBA 1RUF1 4TLGA 3VGIA 5L7OB 1YQ8A 1ZM1A 3WP5A 4COYA 4CYDA 3MPBA 2TUNA 1D0HA 1DZQA 2RG4A 3HVDA 1WCUA 1W6QA 1CN1A 2ZACA 3OBAA 2PHWA 1YC61 1AR92 1Y9QA 1OQ1A 1KD7A 2BVBA 1K45A 2HWD2 3T08A 4CDUC 3OYWA 5DDJ3 3ZXLA 2JE8A 1ZBE1 2JWPA 4AI2A 4P9IA 3KV9A 5HCAA 2ARBA 1AYM2 4UWDA 3LA7A 3FN9A 1C3HA 3ES1A 2Q5TA 4MOAA 3DV8A 1XSRA 2PELA 2PHUA 1U5IA 3UKNA 1PIV2 5DZGA 2WZR2 5FTTC 3NRUA 4F8AA 3I2DA 1MQTA 4CDUA 3VHRA 1VB2A 5FP8A 4U36A 1S1AA 3K4AA 1WW7A 1TNRA 2VU9A 2AYHA 2OQ6A 4W6XA 4XUTA 1PZ8A 5C3PA 2FDHA 3D8CA 4XBLA 1UY4A 5A32B 2ZGKA 3BN6A 4OVEA 1VBC1 3OPTA 2OW4A 1JBCA 2WYSA 5ABJA 3NV4A 1N3OA 4OHZA 3DYOA 3O1SA 3ZO0B 2DBIA 4DO0A 1W6PA 4MGZE 3DPRC 1JYXA 3JB4C 3RFRA 1QQP3 2PTMA 1QU0A 2QQOA 4LQRA 2RS52 4NJ4A 5DAVA 1KDMA 3BTXA 5FWJA 4PLOA 1WGPA 2JIGA 1UYPA 2LUWA 5JIAA 5BPXA 4DFSA 1APNA 4FOWA 4EZHA 1J1LA 1GNHA 1UYXA 1VBB2 2D6KA 4GWNA 3MUY1 5LW9A 2Q1MA 2VNOA 2VO5A 1CIYA 1WLWA 2ZBJA 3CZJA 1QJX3 3PMEA 5FPVA 2I07B 4P08A 3M3QA 4DQAA 5EYYA 1ULGA 5CVRA 2Q8DA 1W05A 5IVVA 3UKVA 3VD4A 2UY9A 1LOCA 4AZZA 3LFMA 2ZEZA 4OUMA 4R4ZA 5EYXA 5JVVA 1JZ8A 3IN9A 2WAOA 4DPNA 1AL21 4E2GA 3ATGA 3S5QA 3AP5A 3UT0A 5FYMA 4ATEA 3AJZA 1HRV2 1YLLA 2E9QA 3AYAA 2ES3A 3LZZA 4Y1XA 1YWKA 2R32A 4P9JA 4AVVA 5A1LA 2DBNA 1GWLA 1E5RA 1IS3A 3E97A 5GZDA 1ASJ1 3LSDA 5FBZA 3VKLA 4LO6B 1C4RA 1H6YA 1O5LA 3N7MA 1SCSA 2Q1FA 4YVWC 3JD71 5KXEA 1DZTA 2UYBA 4KWLA 2FZ2A 4QX5A 1RUC1 1H2LA 2VW1A 3CHXA 1GP4A 1MEC1 2HWF2 4W6WA 5JIUA 1PO13 1TME3 3WW2A 1VBC2 2LALA 2ZKLA 1JYWA 4IL7A 4BQXA 3FHQA 4Y22A 5LA0A 4CP9A 3RZLA 3MICA 5A3LA 4JTOA 3HWJA 5GM0A 1LOFA 3EB7A 1GWMA 4IXLA 4L92A 2ZMKA 1OKOA 5JPNB 4FTEA 4FTBA 2QQVA 4IERA 4B1MA 2QZ2A 2CGPA 2GP5A 1DGRA 1LU1A 4XOGA 1DQ4A 4MXVA 4XILA 2Z42A 1MPXA 3K51A 1BLZA 3I3BA 4YYOA 5AC93 1DLCA 1ND3C 1UKGA 4EZ4A 1AYM1 3ETPA 1HB1A 4DS0A 1OQEA 5I0SA 5EPAA 1JMUB 4AFCA 2WQZC 4PIYA 1ZX5A 4CUCA 4BZ4A 5FPZA 3VBFA 5T5PA 2XONA 3WY6A 1QJY1 3MYXA 4CEYB 5GJ6A 5BYNA 2PAEA 4S2GA 3WF1A 3DXTA 1YQCA 3PIJA 4E8CA 4NPMA 2WQ4A 1O4ZA 2D44A 3O5SA 3QH6A 5H9RA 3WT3A 4C91A 3THCA 3TEWA 1PNFA 1S0GA 4Q27A 3THTA 1QY4A 1WCSA 3ZFFC 3I2IA 3MLKA 3WUCA 2GP3A 5GZCA 5DQ0A 1VP6A 3RJRA 1VBD3 1IG3A 1GOGA 1I6XA 2RM22 5T55A 3I49A 3OBRA 3ZXEA 4HETA 1REFA 2C9AA 3ZYRA 4NWVA 3KM5A 1JOBA 1EV13 1GFF2 4PF5A 4AQTA 1RMU3 2HWF1 1Y3TA 4S2HA 4DIQA 3VKOA 4EV0A 1K12A 3THPA 4QU2A 3J7LA 4Z82A 1JODA 4XJAA 1NLSA 4LTAA 2HWE1 4R9BA 5DXDA 5J36A 1OD5A 2RJLA 4H55A 5CEHA 1OH4A 4XW3A 3ZKYA 4I09A 1ASJ3 4ASKA 4BE3A 4FFIA 4P02B 5FK8A 1BMV1 1DYPA 4OYUA 3IDAA 1GR3A 2XVLA 3MIGA 1Z78A 5C8WA 4OZXA 5K0UA 1V70A 1D0GA 2D3PA 4X6QB 1ZRDA 1H30A 1JHNA 2Q4SA 3PVNA 1KJRA 1F9KA 4ISRA 4DY3A 5BNPA 3VBHC 4N7UA 3SEEA 5I0DA 1HB3A 1Z7S1 2JDPA 4CCMA 1S0BA 5BNNB 1QJY2 2WJSA 4NHXA 1OOPA 1OKQA 2VZ1A 2JG8B 4AAXA 4N53B 4NRQA 1V00A 4M4RA 4GIQA 5EWSA 2P17A 3WG1A 2F6BA 4J6GA 1JZ4A 2YC0A 2EAAA 2OVUA 3ZDVA 1JOJA 4ET7A 1H9WA 1RVF1 1SLIA 2NMNA 3ACLA 1X8MA 1BEV3 1RUE1 4JQTA 3PJQA 3ZXFA 1V6MA 2FDJA 4CRQA 4D69A 1JN2P 1R1A3 4HSLA 1LB2A 3GZEA 2G1MA 1CIWA 1UY0A 2JG9B 4TXWA 4URTA 1GMMA 3U78A 2DWRA 1LHNA 2AEYA 1QH7A 2Q8EA 2P4EA 3ALQA 3NNLA 4XURA 4GULA 5E89A 3SCHA 2WRAA 1QXRA 3K4ZA 3L9JT 1KS5A 4QB1A 2PHTA 3NAPB 5APAA 5CG8A 2VQTA 1Z7S3 4HL0A 4JAAA 2YV8A 3V64A 1DCSA 4H7MA 3KQ4B 2DCYA 3ZSEA 2LRPA 2W2IA 3USSA 3LFIA 3UJQA 1PK6B 1LKNA 1XB9A 3AZWA 2RS51 4OZOA 4JDNA 5H9PA 1CESA 4KI5M 4Y4RA 3R4SA 3BIWE 1UYZA 1F4AA 1X82A 4FP2A 1T2XA 1B35B 2C9KA 2DTWA 2XUMA 4L0PA 5FMOL 3ZFFB 4ZU7A 1NA1B 1ZBE3 1AL22 3MUZ1 3DKWA 1PVC3 1W04A 1XYPA 2HWC1 2MNGA 2VZ3A 5LBFA 1F35A 1ND2C 2VXRA 5EP9A 4F7ZA 4QKBA 1J83A 5FZ4A 3OGJA 5E1RA 4E4DX 1S2KA 4CCEA 4NUBA 3WP3A 4XMIA 1LOBA 1XXNA 5KHGA 4IEQA 5A3WA 4YPJA 5C9AB 5JMOA 5LATA 3ILRA 3PJYA 2WWSA 4Y1YA 3EBRA 4Q0QA 1AR63 1MZ5A 5FZEA 5JWPA 4BQ2A 1GWKA 2YMZA 3MW3A 2ARCA 2VTXJ 1W2TA 2VVDA 4QB2A 4NO4A 3AMPA 4HLTA 4YLZA 1H0BA 3OGRA 1GZWB 2GSYA 2X5IA 4ZZ8A 1QJFA 4PDWA 4CEYC 5A80A 4PQ9A 1K42A 2ZX0A 1OLMA 4MUVA 3VDDA 1JH5A 1RGSA 1CX4A 1UZZA 5GLVA 1W8TA 4XTPA 3AP9A 2H6BA 4A7ZA 3H3UA 2BJSA 3I2JA 2FDKA 5A6YA 4COZA 4N43A 2VBDA 3IDCB 2FCUA 2KD7A 2MEV3 3T3YA 2OKXA 1CJDA 2YC4A 3K77A 1KEXA 1I1EA 4INDA 1V6NA 5BNOB 2W92A 3AP6A 4MADA 4UW3A 4XXPA 1HV0A 2BGCA 4JGYC 2W5FA 4FPEA 3ZPOA 4LE4A 2VVEA 3NJYA 5C4WB 3MV11 2JDYA 1WUVA 3AB0A 4NIIA 1JZ6A 5JXHA 2F17A 4XETA 4XCBA 4V2WA 4EJRA 3W5NA 1VE0A 1TME1 4AEDC 2FZ1A 4Q4V3 3H8RA 2Y34A 2O14A 2J1AA 1SMVA 2OIIA 1BK0A 1VBB1 4WZCA 3NJVA 1GZWA 2VXJA 3H0OA 1JZ3A 1FPN3 2UWBA 4JZRA 3OY8A 2E33A 4LHKA 4W4ZA 3MIHA 1UMHA 2OX0A 3ACGA 4GJYA 4WM8A 4Y5Z0 4D3WA 4ZZ5A 3I97A 4QWNA 4RGGA 1TQ5A 4H14A 1RB8G 3AL5A 3J8F3 4X8NA 1PGL1 1CAXB 4IV1A 2ZZQA 4AQSA 5JXIA 2JG8C 1UX7A 1W8NA 1HQNA 2Y26A 5FZGA 1AR93 4M0HA 3SKVA 4QDSA 4J25A 2HWD3 2JX9A 3C7OA 5DPNA 3VZKA 4CVUA 3QD6A 4XF4A 2ZGLA 1NA1A 4EN7B 3ZMOA 1DQ1A 1SPPB 1B35A 4M4PA 1O3RA 1HQWA 4BQWA 2YU2A 3T2PA 1SLTA 1F5JA 4GAZA 2LW8A 4FPGA 1JU3A 3LPFA 5F32A 1PNGA 3JCIA 2QQJA 2WZR3 4Y1UA 3D0JA 2W1SA 1POQA 2O0OA 4XHBA 4ZPIA 1PK6A 2VW2A 4UBHA 1Y9MA 4I3PA 3WQ7A 3TEXA 3VUOA 3NV3A 5EJ3A 5FMOS 1H4GA 3NSTA 2JDKA 5T3NA 1YCIA 1M4WA 1J84A 3K46A 4GWMA 4K3UA 2AH2A 3WDVA 1AXYA 4MZUA 4G3YC 4Z92B 3FUOA 2W08A 2YXSA 3HQXA 4J1XA 1U5ZA 1RUD3 3VKNA 2X10A 2D97A 4W65A 1YYNA 4B1LA 2J1TA 4LBLA 3S7IA 2HEWF 2RS31 1UWWA 3Q8BA 1R1A1 1AX2A
chains in the Genus database with same CATH topology
1X50A 5DZEA 2X29A 2EXHA 2KXLA 4CDXB 1SCRA 3ME2A 3H3ZA 4IV3B 1K5MC 3AKSA 4N53A 4MGIE 4I0BA 3SITA 3BCWA 4AVBA 4KWJA 4HFSA 1QJX2 2VULA 3DPRA 5BNNA 1C8M1 1J3QA 3VZLA 1G86A 3N7LA 4SBVA 2IFRA 4K40A 3VBSB 2CTVA 3B02A 2WZPP 1HXS1 4IEZA 5FLIA 1QKQA 2R041 1OPOA 4WM7A 3SH4A 1KXGA 1O5UA 1QOTA 4Y20A 4AGGA 5K8SA 3AZXA 4Q4X2 1XRUA 2ETEA 5DDJ1 1W2UA 4BYYA 3FMGA 2DF7A 1BBT1 2P34A 3H7JA 3SH3A 1FMD3 1AR91 2D6MA 1KRIA 2D43A 2EA7A 5L36A 2IXHA 2HWF3 1QJU3 1R081 3N35A 4E27A 5CB7A 2YDEA 1UU6A 2WINB 4QQPA 1H8TA 2CV6A 1BXHA 3JU9A 3M3EA 3VN4A 4RQPC 5JOXA 3G7DA 2SBAA 1RUNA 4XF0A 2SLIA 3O7OA 1I5ZA 4XPVA 1N47A 2AENA 4Q8LA 3W59A 3JQXA 4FVVA 1DBNA 1IHMA 4AFDA 2HWE3 4Q2FA 3MZHA 1Q8OA 3J8F1 5C33A 2RS32 2ZABA 3FLTA 4HMZA 2QUOA 2V09A 4B7EA 4FXGB 3R6SA 3J9SA 4P9GA 2ZJCA 3D82A 3URFA 5CFDB 4QM9A 4XEZA 1W0PA 5ABJC 4AI3A 4MXWA 1FOD3 1ONAA 2QE3A 3RG0A 2NMOA 5KHHA 1FV2A 1OPMA 3H7YA 3ETQA 4KBBA 2A73B 1RMU2 4AFAA 4AWDA 1X8EA 1XYOA 5FCCA 2BYVE 4NN0A 2OA2A 1UPIA 1NXMA 2Z2SB 3WCSA 5KBFA 4XFCA 3VBHA 1HW5A 2OZJA 4MVTA 2DVFA 2AZ5A 3ZXJA 4GMP1 4YG0A 2WS93 4A2UA 1UF2C 4LBMA 4P14A 4FSJA 4BQ1A 2D6LX 4IEWA 1XU1A 2XVKA 3IDBB 2VH9A 3VBHB 2A7AA 4OHXA 3ILNA 1GZ9A 2PHFA 4QGMA 2O8OA 4XXAA 3ZVXA 3M4FA 2ZMNA 2HKXA 4YZ4A 4B29A 2AR6A 3M7AA 4ASMB 1BVP1 3FE5A 1OHFA 1N1VA 1RUJ3 1EPZA 1UU5A 2QQPA 2PLV3 5EXOA 3ZSLA 1O7FA 1FT9A 1YJLA 4LR4A 3SMHA 1RL3A 4M3CF 4V1PA 3VL9A 4MXWB 4JC1A 2I2SA 5JOYA 1CAUB 1S0JA 1VR3A 5A32A 2EXKA 4QHBA 4F83A 2B39A 2VUJA 3M2MA 1BZWA 1YFXA 3FFQA 1MS1A 4UXAA 3VBOC 3BALA 5FQ0A 1KS4A 4COUA 1AZDA 4AEKA 1WD4A 1MEC2 5JI9A 4IESA 4OLLA 4XQ4A 1ZRCA 3AX4A 2GH2A 4I30A 1EPWA 1F5FA 1NE6A 1PVC2 3HN1A 4SLIA 3WVJA 3RYKA 4XQDA 1VAKA 5FQ0B 5C8CB 3JB8A 5KHKA 2JEMA 2WNEA 1JW6A 4EWEA 4N7IA 5L7OA 1ENRA 2B42B 2RS12 3O14A 3R4UA 4YFWA 3RI8A 1CAUA 1TMF2 4Y1VA 5LK7B 2BPA2 1EP0A 1ULCA 4M01A 4UW6A 4BHPA 1N1SA 4RHV1 1OA3A 1RUE3 1O4YA 1C1LA 4WM8C 1U12A 2GU9A 3NAPC 4DRRA 2QVSB 3MIDA 1UL9A 3KCCA 2IZWA 1F2NA 3BODA 2EVXA 4OFGA 3ZIXA 3TYJA 3ZYPA 2DCKA 1OFNA 5J7MA 3ZN4A 4QQOA 1XU2A 2XJPA 5HI0A 1RUG2 4Q4Y3 4LBJA 1DLLA 1KITA 4GA9A 2UWCA 4RS5C 2MEV2 2XL9A 3IWZA 2WLQA 4CP0A 1WMFA 1C8M2 2WLPA 1S0CA 3DPRB 3SCGA 1PGL2 1QNYA 2RMU3 3AKPA 5T5OA 3ZSKA 4JGYB 2XWJB 5FDBA 1MS8A 2JE9A 2D3SA 4XDQA 3D4KA 3LOBA 1AYM3 3OTFA 2IXIA 4BMEA 1VLNA 1IOAA 3KT7A 1XYNA 1GV9A 2R072 1VALA 5H9QA 1GQHA 2ZHKA 2HWD1 4GH4A 1AYN2 3MIFA 5SV8A 4M00A 3HT2A 5F6KA 1VBA2 4AF9A 3H1YA 1NXD1 2VOXA 4LBQD 4Q26A 1I3HA 3MDPA 3MW2A 5ACA1 4LT5A 3AXDA 4O9GA 1AR71 4R52A 3WCRA 2PFWA 4Y24A 4AGVA 3AKRA 1NZCA 4CDWC 1MS0A 1ULDA 1YFWA 4YARA 2HEYF 3GF6A 2GZWA 5DUVA 1UKRA 3AKQA 4XZPA 1MACA 5C4WC 1U0AA 4FAHA 2GMMA 4K1ZA 1CD3G 4QMAA 4R9AA 2DFBA 1ULFA 1VBB3 2HWB1 1XNBA 4IV1B 1VRH2 2WSUA 3BPZA 1PMIA 4AEDA 3WV6A 1CONA 3ZFGC 3RSJA 2FMYA 2X8KA 2WFPA 1DFQA 2WA3A 1D4M2 2R063 1D2QA 1EAH3 4HVRA 4WM8B 3WP4A 3VBOB 3I7DA 4KU7A 2ZZJA 3WX5A 3OY8B 1UD1A 3TAYA 4YW5A 3N3HA 1RUI1 4QGLA 3WINE 5F6LB 3ZX7A 4Y1ZA 4XJ8A 2ZCWA 1HDKA 1FYUA 1HX6A 4Q1PA 2PQQA 3MF9A 1FX5A 1R1ZA 1U5XA 3VDDC 1UMZA 1XNKA 2WFF2 3B69A 4WM7B 4XIOA 4FPHA 4GKXA 4PIZA 4BPZA 1VBC3 1SLBA 1IS6A 3GZAA 4NVPA 3HR9A 3ST7A 4Q1RA 4FQZA 4DNYA 1UZYA 1QMJA 1LHUA 2I74A 1SACA 1UW8A 1BCXA 4PIXA 3B3QE 3M70A 1RTVA 1IPKA 4LUMA 4NPRA 5BUVA 4PDWB 2ERFA 3FHIB 1H4HA 4G9SB 2DUPA 3ZSJA 1NLRA 3WW4A 1YJKA 2IXJA 4HSJA 2XH6A 2CNAA 3UV9A 4P9LA 3M3CA 4DRVA 5FO8B 5JSRA 1W0OA 1AR81 2RMU1 1JTZX 3UKTA 1PGW2 3PLQA 5BNNC 1QJU2 5EV7A 5JLVA 1POV3 2ZGPA 1IQAA 3RDIA 3TNQA 4CDXC 5JDBA 3AXEA 4IV3C 1T6GC 4OULA 4N53C 3LA3A 4L99A 4BWOA 3LB9A 5JR7B 3PVBB 3VZJA 2RM23 1FXZA 1NCQC 4ASLA 3N7JA 2JENA 4Z2WA 3P3NA 3QOPA 1GSLA 1OLQA 5T50A 2JD4A 3AP7A 1LULA 4IEXA 4KG0A 1EV11 2BNNA 4BLIA 3MFAA 2NZ9A 5GKAC 4HN1A 1IS4A 2R1BA 3RI9A 2ARXA 1LHOA 1CQ9A 3NAPA 4KWKA 4QD2A 3WDXA 3WG3A 1QF3A 2H0BA 2D6PA 5J3UA 2RM21 2D7FA 4LO5B 1HKDA 2BBVA 3FWEA 5JSOA 2JKBA 2B45X 1NA1C 2C5DA 1LGCA 2E7QA 3ZIWA 2WZR1 1WW6A 3QCWA 2QJVA 1IS5A 4Z1VA 5LRSA 3SXWA 4GH4C 4PCRA 4PLNA 3ZDSA 3BOWA 5JSPA 1KFXL 2OUJA 4MLOA 4TSVA 4F3JA 2NN8A 2JECA 2WNUC 1BEV2 2IWGB 5JZGC 2A3WA 3IT8A 3ZFGB 5SV5A 1YFUA 2GC0A 3R4DB 2WS92 4A3XA 4Q0SA 1RHI1 2B5HA 1ZYBA 5JPMB 1YFYA 5JOZA 1D4M1 4Q4W3 2VECA 1S0DA 4Y26A 4AXOA 5AVPA 3ZXDA 5BXXA 3LCPA 4YNIA 3AYDA 3KCXA 2CWSA 4M3CE 1ALYA 2X5IB 2YZ4A 3VKMA 3CJXA 2D40A 3AFGA 4CZSA 4XFBA 4WVVA 1DGRN 1HRI1 2XJTA 4XBQA 4ZU5A 3D0SA 4AVTA 2TBVA 2O8QA 1DZRA 4XQWA 1WBLA 5CNAA 3VBRC 4KNCA 4XHXA 1Q56A 1VIWB 4HK8A 1LJ7A 1RHI3 4AEDB 3W9AA 2JICA 3A4UA 1RUH2 3VBFB 2KM2A 2DVDA 1LR5A 1PZ7A 4XFIA 4YW1A 1PO11 4GQ7A 3CU7A 1DQ0A 4N9IA 1U5YA 2V73A 5HXVA 4Q29A 3TB0A 2ZHLA 3U11A 3POWA 2ZPXA 2WSVA 5F5QA 1LECA 2CGOA 3K48A 4O9EA 5DUWA 1O4TA 5FOJB 2ZX4A 4FBFA 4LNVA 2YROA 2P2KA 5GLTA 1N3PA 3U0ZA 4XJ9A 1DHKB 1PVC1 4GH4B 1BQPA 4YM3A 1IKQA 1QWRA 1TMF3 3FUQA 2B7YA 5T54A 5CG9A 2A70A 2CAVA 4BIFA 2A3XA 3CNAA 4AQ6A 4ES8A 3JBG2 3RYRA 1MVQA 4Q4V2 1DF0A 2UURA 4R9CA 4EN6B 1OA4A 3I54A 1MZFA 1FPN2 1LENA 3J4UH 1AVBA 1LTEA 4JGYA 3FJSA 2ZA9A 5I8SA 4BH9A 4R8HA 3ZXAC 4XF1A 4YZ2A 3M1HA 4ZKTB 1OOPB 4AHZA 5TSWA 1BYHA 4HN0A 4N43C 1O3TA 1RIRA 2DYCA 4GKYA 4JDOA 1ENQA 1C8M3 4HZFA 4C90A 3WDTA 4IETA 4HBNA 4QQHA 4MX3A 2OUHA 2NYYA 3OF1A 1Q5OA 4KGQA 5GALA 3NKGA 1MS5A 4YSFA 1BMV2 4PLMA 1CJPA 1LU2A 4E2SA 3KS7A 4QT6A 2NP0A 1W6PB 3ENRA 3CJIB 2VVFA 3T1MA 1LRHA 1NOVA 1ZBA2 4JRAA 1WW5A 3ZMNA 2XJQA 1X33A 2BNOA 2R073 3VV1A 4XE9A 3AMNA 2D5HA 1EY2A 3A0NA 1GKBA 4NHLA 4CP2A 1H1AA 2BW8A 1DGLA 1VBA3 1DIWA 2EF6A 3FLRA 1MQTB 4K21A 5C8CA 1POV1 3EXUA 3AP4A 4IEPA 4ATFA 4PJYA 1YIFA 5A3MA 3CLPA 5CA6A 3HAGA 5JAXA 3GBGA 3V0AA 1GBGA 3H1WA 1ZZ6A 4AGRA 4BM8A 1COV1 3NV1A 3ZYIB 1HRI2 1J3PA 1R092 3JUUA 5DG1A 4YW3A 2ATFA 3WUDA 4K8FA 1RVF3 1PO23 1XE8A 3L2HA 4PBOA 1RUJ1 3RZZA 1N3QA 4B7KA 1K5MA 2XJUA 3Q9OA 1W6QB 2ZKNA 5GZEA 3VHNA 4QM8A 4XMAA 2PHLA 1CGPA 1VBE3 1YI7A 3WW1A 2DCZA 3B9CA 3VZNA 4LE3A 4B8EA 1LHWA 4QPGB 3UL2A 3QLQA 3KT4A 3VBSC 1EAH2 2DCJA 2R062 2A6VA 3GZUC 3EJKA 1C5HA 3X29B 1N1TA 1QDCA 2R0HA 1ENSA 4JDMA 1A3KA 1GNZA 2DCTA 4HKWA 1X7NA 4XFHA 1C28A 1GANA 1G9AA 5I0RA 3IPVB 4AG4A 5LEJA 3N4MA 3S30A 3SH5A 4AVCA 3LA2A 1H2NA 1RMU1 2GAUA 2CGNA 1GYKA 1UIJA 2GALA 3AMMA 3AMHA 1BKZA 1SBEA 4HT1T 3QBQA 1SLAA 4LEJA 5FPXA 2B8MA 1KJLA 4M3CA 2YY1A 1AYN1 1OQDA 2JG9C 4YG3A 1H8VA 5FO9B 4AHYA 2A6YA 3O0VA 3KCYA 3MF6A 3V56A 2VPVA 4BIOA 1G9DA 1LOAA 2ZHMA 2H0VA 5ACA3 5CBLA 4AEJA 3FLPA 5FFOC 3WHTA 2HWE2 1RITA 5K7PA 2W0XA 2YPJA 1AR61 4JGZC 2ZMLA 3WZ1A 5CFDC 4W6YA 1DQ5A 2JJ6A 4JV4A 4HVQA 2Z5WA 4HKLA 2BWCA 2PA7A 2GDFA 1V9U2 4Q0PA 1QJX1 5CFDA 4H7LA 3KMHA 1FOD2 2GMPA 1GICA 1NCQA 1YHFA 2W39A 3HBZA 3MIBA 4YZ3A 1VBE1 1QJU1 5C6CA 1LOGA 3KGZA 1RUC3 2PN5A 2XKOA 1AHSA 1C1FA 1S0IA 2DFCA 1UCXA 4MGYE 4EWDA 1REEA 1A6CA 1ZRFA 1F31A 2IXLA 3OYWB 3CEWA 1COV3 4L11A 1RUOA 1H8TB 2PYTA 3FFZA 5F1RA 2MHFA 1GLHA 4NR1A 4LO7A 4AE2A 4FPLA 1MQTC 4CEWC 4Q0UA 1RUF2 4DINB 5KXCA 1WCDJ 4AVSA 1H2KA 2R071 1POV0 4LO8A 3RPQA 1BVVA 4ONUA 5HCBA 4META 4C1XA 3I59A 2E51A 2Y0OA 5BNOC 3ES4A 4R9DA 4L8QA 4FP3A 1Q43A 3ZPYA 4XJZA 4Y20B 1W6OA 2EALA 4TYSA 4COVA 4NHKA 1SBDA 1BEV1 2XLGA 3VZOA 1RUJ2 4AQ2A 2PLV2 5HBAA 1ZZ7A 3VBSA 2XLAA 4M0NA 4I3GA 5DUXA 2RR12 1RUI2 2VG9A 1ZZ9A 4KQ7A 3BOPA 4JTNA 2BEOA 2RE9A 2XVGA 4E4SA 3M3IA 4BA6A 2P3KA 2PHDA 1CAWA 1QHDA 2HEVF 1YXWA 2YHJA 4Q4W2 4IV3A 4FT8A 5JI7A 2FQPA 4CDXA 2HWC2 2B46X 4YZ1A 3HMYA 4DOUA 5A33A 2LTNA 3INAA 4UW4A 5AFBA 4YG6A 3DGTA 3USUB 4IEVA 4RGAA 4LBQA 4YGCA 3KQRA 1G9BA 5C8CC 2XWBB 2GNMA 1WLTA 2RS11 4YRDA 4RFT0 3KT1A 1YO8A 5E16A 2VNRA 3WDYA 1OSGA 2E63A 1ZNPA 2GC1A 3E5QA 3VKFC 4HKOA 2EIGA 1YRZA 4FAGA 3GALA 1RHI2 1ULEA 2E6VA 2OZ6A 4QPIA 2MPFA 4IQPA 1RUH3 4FPYA 4YZ5A 3U07A 4CEWA 1RUE2 2NPIA 2YGMA 1RUG1 3TN91 1XE7A 3WR0A 4XJUA 1SBFA 1ND2A 1QJZA 2D5FA 1R091 3AK0A 4C0BA 1QXJA 5EFUA 3O0XA 1AR73 4WZFA 4AHWA 5LRRA 2QFEA 1CAXA 4RS5B 1QH6A 2Q8OA 2WS91 3KSCA 4YFZA 2VOVA 3AZVA 1OA2A 2ZX1A 1CVNA 1FNYA 1V6KA 1V9U1 4XFAA 3RYPA 4KH9A 4HPKA 1A78A 2EXIA 2RMU2 4JCKA 3EQEA 1EAH1 1AR82 2R061 3WXPA 4YGEA 4B4RA 1LEMA 3VBRB 4XTMA 5K9YA 4RR3C 3WQ0A 3S7EA 1FNZA 3E5UA 2HWB3 1PZ9A 5GZFA 4B4QA 5AVAA 4FOVA 4Q0VA 3D6EA 4NWWA 3RMYA 4FPKA 3R0RA 4MYEA 2PAMA 1H9PA 5C4WA 2YUEA 2OYZA 2O1QA 1S0EA 1AYN3 1UX6A 2DUQA 4CDWA 3MFCA 5BNOA 5D8AC 2VMHA 4QPIB 1UU4A 2UY8A 1NYWA 5GLWA 2P3IA 4N43B 2WNVC 2VY0A 4OHWA 4I2OA 1X36A 5J37A 2K0GA 3GBFA 3LGRA 3GZTB 5L7OC 4E2QA 4LLFA 3VDDB 4R4XA 3GNEA 5F9TA 4WM7C 3VZMA 5DDJ2 5JOWA 5BV6A 3ZXKA 1G9FA 1QQP1 3IKWA 3JBG1 4LHNA 2D3RA 1UAIA 2ET1A 4IV1C 1ZBA3 1RUH1 3WG2A 3LOIA 1MVEA 3ZN6A 1NCRA 4L9BA 2WNVA 3E5XA 2A6XA 4A7YA 4D7SA 2Z79A 1VRH3 4GXLA 5FLHA 3TN93 5C9AA 3TBDA 1R083 3J26N 1J3RA 2FBEA 4L97A 1DYKA 5JCTA 1BJQA 2GN7A 2IFWA 1D4M3 2R1DA 3BTAA 4WVZA 2XJVA 1DQ6A 1BK1A 5T5LA 4LO4B 4OI2A 3TRSB 1MZEA 3ZFFA 4RR3A 2R043 3MLLA 4YW4A 3GYDA 1DDLA 2R49A 5H9SA 3MPPG 1RVF2 2RS53 3VBUC 4FCAA 1NY71 4OHVA 1W6OB 1H1IA 2WFF3 3M3OA 3S6PA 2GN3A 4RHV3 1HLCA 1SQ4A 4KGGA 5CFCC 3WLUA 2XLFA 4K20A 2JG9A 1NCRC 2X53S 2ET7A 1LOFC 2DVGA 3E6BA 5IK4A 5I0UA 1WD3A 4AFBA 3RJ2X 2XPJA 1HV1A 4TWTA 1YUDA 2JG8A 2ZOEB 2EAKA 2XHKA 3H8UA 3DL3A 4D94A 1PM7A 2ZGSA 3U10A 1I9RA 1VBD1 3E6DA 4BCUA 5I93A 1IGOA 2XGXA 1JXNA 1PO12 1RUD1 3JZVA 3PHMA 4JRLA 4P9WA 1LHVA 2CY6A 4CDQC 3SHRA 3GHNA 1LGNA 1IZ3A 1NCQB 5K0UB 1TMF1 4LULA 4JVAA 5I91A 1XNCA 4OI1A 3IIAA 3HT1A 3FBYA 1PGW1 1WMEA 2NLRA 4EN8B 2AGSA 1O91A 3PTYA 4LBOA 1FAYA 1HRV1 3UK9A 1BBT2 2VMGA 3N7KA 2JXAA 3RRDA 1EYBA 3MGUA 5ACA2 4QXKA 5LK5A 2FMDA 3ZYJB 4EWAA 2D98A 2QZ3A 3WOGA 2YGLA 4YM2A 1HXS2 2ZS6B 2VGDA 4JGZB 1NG0A 1V9U3 4M3CB 5FRAA 4AK3A 3SLIA 2ZGRA 1FPN1 3I8TA 4NOTA 5I8YA 2W68A 4HK9A 4CEYA 4FPJA 3MI8A 1SLCA 4EN9B 3WHUA 3ZXGA 3NW4A 2K9ZA 5D1IA 4IEYA 1TEIA 4MGKE 4S2FA 4CDQA 1Y7BA 5KC6A 3JD73 3RNSA 4C0HA 1OFSA 3M8LA 3L2YA 1JUIA 1D4VB 5CFCB 3AYCA 5IK8A 4DZGA 2WKKA 1OMIA 4MSVA 4BLJA 5BY5A 4P9XA 4ZXKA 1LESA 4Y22B 3V0BB 2HYKA 3G6JB 1ENXA 4WVMB 2XBO3 3T2TA 1HQLA 3R05A 4IEOA 3V0BA 3POYA 1AF9A 3B93A 4QPGA 4I01A 3ZN5A 3PMSA 2WIIB 3ECQA 4WBBA 5CFCA 1VJ2A 4U2AA 4QGNA 2QKDA 4QQ2A 1WCKA 2XJRA 4EROA 5GLZA 3PVEA 1ZVFA 1KDKA 4DMIA 3AFKA 4DXZA 1K5MB 3QACA 2A71A 2R0FA 3AM2A 4RL7A 5I0TA 4CDQB 2ZHNA 1S55A 3OPZA 4UBGA 4Y4YA 4YM0A 4FO9A 2G9GA 2ZX3A