3KGZA

Crystal structure of a cupin 2 conserved barrel domain protein from rhodopseudomonas palustris
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
145
structure length
145
Chain Sequence
b'SLRAQTAPGRWDGVAVMPYKQTAEAPFQDVSRQLLFADPNLACEWRYFEVDEGGYSTLERHAHVHAVMIHRGHGQCLVGETISDVAQGDLVFIPPMTWHQFRANRGDCLGFLCVVNAARDRPQLPTADDLAELRKDERIADFIRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cupin 2 conserved barrel domain protein
publication title Crystal structure of a cupin 2 conserved barrel domain protein from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 34
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kgzA00
4META 4H7LA 4FBFA 4AVAA 3DL3A 3H8UA 3N4MA 4UBGA 3D0SA 1EYBA 5FPZA 3EHKA 3CL1A 1ZZ9A 4NVPA 3OTFA 3MPBA 4XFCA 1RGSA 2EVXA 4YNIA 2CV6A 1ZREA 1LRHA 1UPIA 4XFIA 4MGKE 4I2OA 4JV4A 2K9ZA 1L3JA 3DN7A 5CU1A 1ZZCA 5I0TA 1YFYA 2XLGA 3LAGA 3E6CC 1O5LA 3R6SA 1IPJA 4HSJA 1RTVA 5I8YA 1O3QA 1CAWA 4MGIE 5EFUA 2QVSB 3UKNA 2H6CA 4LTAA 1QXJA 4Q0UA 3CJXA 2VPVA 2XL7A 3WW1A 1QXRA 1YFWA 1CAXB 5BPXA 4MZUA 4N9HA 4MGZE 3LOIA 5KHJA 4HBNA 1H1MA 1RC6A 1Y9QA 5JR7B 3RYPA 2O1QA 4DINB 2XKOA 1FI2A 3TNQA 2UYAA 2XHKA 1RL3A 2FMYA 4GULA 4P9GA 4PIXA 3OCPA 2GC1A 1ZZ6A 5JCTA 2H6BA 2HKXA 4N9IA 1FT9A 5FLIA 2PYTA 2EA7A 5BUVA 3IDBB 4OLLA 4XF0A 5KHHA 3E97A 1ZVFA 4HVOA 4KWLA 5LRRA 4HN0A 4IEZA 4XF4A 3E6BA 3FWEA 1UW8A 3OGJA 2Z2SB 3NKTA 5C8WA 3BU7A 2QCSB 3CO2A 4I02A 1CAVA 2P17A 4I09A 5F1RA 2OPKA 3I54A 2PFWA 4UXAA 5BV6A 2IXHA 1YWKA 2Z69A 1XE7A 3JZVA 5HI0A 3O14A 5KHIA 1DGRA 3NVCA 4IETA 3H3ZA 4LUMA 1U12A 4ORFA 3VHRA 3CEWA 3M3IA 4FAGA 5JSPA 1J1LA 2MPFA 2OYZA 4LEJA 1NXMA 4WVZA 4JTNA 4A2UA 4IEPA 4IEXA 5I8SA 5KHGA 3WW4A 3SHRA 2ZKLA 1PM7A 2VECA 2CAVA 2PQQA 3D0JA 3BALA 4BIFA 2QDRA 5FQ0B 3RZZA 3MZHA 2E9QA 3BPZA 4HVRA 1LB2A 4QGNA 4F8AA 1DGWA 3LA2A 1V70A 2B8MA 5FCCA 3USSA 3FX3A 4AQ2A 4CYDA 3ZDSA 4E2SA 1I6XA 3EBRA 4LULA 2Y0OA 1RUNA 3S0MA 3FHIB 2ET7A 2QJVA 1WGPA 3RDIA 1CX4A 2GAUA 2Q0AA 1Y3TA 4XFFA 1PMIA 4LA2A 2GU9A 4LUKA 3NSTA 4PIZA 5FLJA 4AVBA 2PAMA 1O3RA 1Q5OA 4MGYE 1UIJA 2PAKA 4O9EA 3EQEA 2QNKA 3KGZA 3IWZA 4FT8A 4I0BA 2O8QA 4IEYA 4PJYA 4EROA 2D5HA 1QWRA 3RYKA 1UCXA 2C0ZA 1EPZA 2H0VA 1X8EA 4IEQA 1OI6A 5LEKA 3U0ZA 3EO6A 4J1WA 1CAUB 3IBMA 4BH9A 1WLTA 4L2NA 4HLTA 3KGLA 3DV8A 4UBHA 4OFGA 2WFPA 3NW4A 1QY4A 4YARA 3FZ3A 5FQ0A 4JVAA 4QGMA 4Q0PA 3TNPB 2XGXA 2D5FA 1CGPA 3SCGA 3ROUA 1HW5A 3GYDA 1ZRCA 1EP0A 4ONUA 4QM9A 4YSFA 4LA3A 2GC3A 4QX5A 3M70A 3MDPA 1YLLA 1DZTA 5CVRA 5AVPA 4BHPA 4Q0QA 3KSCA 2UY8A 3OF1A 4F7ZA 1DZRA 4MV2A 3H1MA 1UD1A 3WW3A 1YFUA 4TLFA 3MYXA 4X6RB 3IIAA 2XLFA 4X6QB 4AQ6A 3FFQA 1ZNPA 2VQAA 2MHFA 1J3RA 1FXZA 2Q4SA 4KL1A 3RPQA 3NJZA 3U11A 4KWKA 5EZWA 4QXKA 3SCFA 1OMIA 4QMAA 3SMHA 4E2GA 5FLHA 5J3UA 2N7GA 2B5HA 4QGLA 5I0UA 2XKPA 2PAEA 1VJ2A 1ZZ8A 5JSRA 4I0AA 3H50A 1CAXA 4ZU5A 2UYBA 2PHLA 5FPXA 1J59A 3E6DA 5KHKA 3E5XA 2CGPA 2DCTA 5JAXA 3HIFA 2GZWA 2GC2A 3WW2A 3PVBB 4XFAA 2D40A 3LZZA 2EAAA 4I3PA 4XFHA 1XE8A 5D1IA 2PTMA 2ET1A 3IDCB 4Q0SA 2IXJA 4MUVA 1LR5A 1CAWB 1SEFA 1ZZBA 1YFXA 4Q29A 4XFGA 3HQXA 1YHFA 3CF6E 4EWAA 2OZJA 1G6NA 3FE5A 3S7IA 1VP6A 3QOPA 1X82A 2ATFA 2FQPA 1NE4A 3S7EA 4FAHA 3ETQA 4D7TA 3SXWA 2PHDA 4J1XA 4XEZA 1NYWA 4JTOA 1NZCA 4EV0A 3H1YA 3D82A 5J7MA 4LLOA 1O5UA 3FJSA 5I8TA 3DKWA 4EWDA 3UKVA 1Q43A 1ZZ7A 3ACLA 4WZCA 4KWJA 4AXOA 2BNOA 4IEUA 4IEVA 4ZU7A 3NL1A 4KU8A 5I0SA 4IESA 4ZU4A 2OA2A 2BEOA 2F4PA 2BNNA 2MNGA 5I91A 2ZCWA 5JSOA 3PNAA 1J3PA 1H1IA 1O7FA 1CAVB 3H1WA 1ZRDA 1GQHA 3LWCA 2K0GA 4MH0E 3H9AA 5E1RA 1YUDA 3E5UA 3OD0A 4IERA 3ES1A 1OD5A 5K8SA 1UIKA 3H7JA 5T3NA 1ZX5A 3RNSA 1EY2A 2BGCA 5BXXA 4EWEA 3H3UA 4YRDA 4XFBA 1XRUA 1SQ4A 5LEJA 3GBFA 4PIYA 1J58A 4HN1A 4HZFA 1GQGA 3G7DA 5I0RA 3I59B 4RD7A 2IXLA 4AVCA 2IXIA 3I7DA 4KU7A 2Q1ZB 4Z07A 2D93A 1RUOA 2B9UA 1O3SA 3PLQA 2UY9A 2GC0A 3L2HA 3QACA 4Z82A 4HSLA 1X8MA 4D7SA 4L11A 4K8FA 1X7NA 3ES4A 2IXKA 3C3VA 3LA7A 1TQ5A 2OZ6A 4R52A 4I01A 1ZRFA 2PA7A 1CAUA 4QM8A 4XF1A 5E16A 3HT2A 4BYYA 5J48A 2ETEA 3CLPA 4HMZA 1IPKA 2IC1A 5BY5A 2V09A 2BYVE 3E5QA 3LA3A 3H7YA 5C6CA 1Q3EA 2CAUA 1O3TA 1WA4A 2BNMA 4YYOA 3U10A 4R8HA 2KXLA 3ELNA 2I45A 5FDBA 4IEOA 4Q0VA 1LKNA 3ST7A 1ZRRA 4IEWA 2Q30A 3HT1A 1VR3A 2GH2A 3BCWA 2WC2A 4O9GA 5LRSA 4B29A 3BB6A 1I5ZA 4XF3A 3I59A 2XLAA 1O4TA 3SCHA 1NE6A 1OFNA 3KCCA 2IXCA 4WBBA 3B02A 4HVQA 5CADA 4XF9A 3RYRA 1J3QA 1JUHA 3UKTA 3KMHA 4E2QA 5I93A 5KBFA 1SFNA 2HJIA 4MX3A 4XETA 3EJKA 2XL9A
chains in the Genus database with same CATH superfamily
4FBFA 4YGDA 4CRQA 3O0WA 4GH4B 2BZDA 3H8UA 2PLV1 2VVFA 4C1XA 3HEIA 1EYBA 1UYPA 4PI0A 1YI7A 1XYOA 5GALA 3EHKA 2Y8KA 1RITA 2C6SA 1POV0 2RJ2A 4X8NA 3NO8A 1T2XA 2YGLA 4FO9A 3TBDA 4C91A 3I49A 4XJUA 4Y5SA 5IWFA 1HV1A 4I2OA 4MGKE 4URTA 4QKDA 1CR7A 3MO4A 4YW7A 2P5BA 5LY2A 3TN93 3J7HA 3V65A 3VN4A 4B4QA 4Y4YA 5JZGB 2GN7A 4BLIA 1AL23 4FOQA 3I3BA 2G19A 1ZZCA 3IB3A 4W6YA 5I0TA 1QJY2 1DYPA 2XLGA 3LAGA 1UZWA 3VD9A 1O5LA 2R073 4QPGA 3M3QA 2BW8A 1KJLA 2JD9A 1YQ5A 1F31A 4P00B 2VNVA 1CAWA 3ZYFA 1MPXA 5LZ6A 2EIEA 4QQ2A 3UKNA 3T3YA 2PELA 4PF5A 2BDRA 4XPVA 5FZ6A 3PUAA 3LSEA 1XNTA 2VPVA 2XL7A 4QPWA 1OLRA 2VZUA 2WNVB 1G9BA 5BPXA 1AJOA 2XUMA 5JPNB 5A33B 4XVHA 1NX9A 1V6IA 3NNGA 2Y0IA 2J1AA 1OF4A 2R6QA 4LR4A 4AFCA 2WN2A 3RYPA 4NPLA 3UGHA 2O1QA 1Z7S2 2DV9A 4RGGA 4DINB 1ZA7A 4XHXA 2R071 1F5JA 1S55A 4AOCA 2VL4A 3A7QA 2WLPA 1SLAA 1I3HA 3AZXA 4N43A 5FMDA 1RL3A 4GULA 3WNNA 5A3WA 4IGQA 5CZKA 4QX8A 4CCCA 2WWSA 1G9AA 3OCPA 2GC1A 2JG9C 1BHGA 2EXIA 2J7MA 5JCTA 1JHJA 5IUQA 4N9IA 2R042 1V6KA 1E5RA 1TME2 5EV7A 1BXHA 3AJYA 1FNZA 3HBZA 1EUUA 5T5OA 5CA6A 3VDDC 2JICA 4DNYA 2FMDA 3ZFGA 5CFCA 5DAXA 1PHMA 2OQ6A 3IIIA 4JGZC 5KHHA 5A7SA 3CDZB 4RHV1 2V72A 4YVSA 5H9QA 5LRRA 2WYFA 3WP6A 4XF4A 3IM0A 5FZOB 4PHZA 3KM5A 3T2QA 1UW8A 1DQ1A 1S4CA 1GQPA 4OI1A 2NMOA 1V6NA 1FX5A 2QCSB 3B94A 2P17A 1RUE2 4MGTA 1L7QA 2OVUA 2OPKA 2O8OA 2ZX4A 3AFGA 3RQ0A 1XNBA 5FKBA 2GN3A 4WVVA 5HI0A 1C28A 3F95A 3NVCA 1HRI2 3H3ZA 4LUMA 3UJOA 1GWMA 2GNMA 5FO7B 4I0WB 3JD73 3B93A 3WVJA 3M3IA 3I97A 4CCOA 1I9RA 2TBVA 1J1LA 2HWC3 3ME2A 1FNYA 2J42A 2RR12 3A22A 3MFAA 2OYZA 1NXMA 1OVPA 4CDXC 3SH5A 1RMU2 2DVAA 5DAQA 1K5MC 3LKJA 4A2UA 4IEXA 3AKTA 1CONA 5F2WA 4RR3A 2A5ZA 5A3NA 4GAZA 2D6MA 2VNRA 3ILNA 2X53S 2PQQA 1W6OB 3GHNA 1N1TA 1PGL2 1U0AA 1SZBA 4YVWB 4EQVA 3RZZA 1WMXA 1YQ8A 2J1EA 2QTWB 3VBUC 5FIXA 4Q4V3 4WM7C 4LO6B 1LB2A 3JD71 4QX7A 4OVEA 4CUAA 4MXVA 4V2VA 1DGWA 2HWC1 3EMRA 3WSOA 3BIEA 1NLRA 5FCCA 3USSA 3ZDSA 5CKMA 1UZVA 5K0UA 1NCRB 5EJ3A 1R092 1OBNA 4DIQA 5GZCA 2EIBA 1N3PA 2EXHA 2LUWA 2VR4A 3EBRA 4BXFA 1FMD2 4BK5A 1I1EA 1WW6A 3GF6A 2GAUA 5FOJB 2Q8OA 3ZFFA 5LY1A 4D69A 4EN6B 2B7YA 3CKHA 2F17A 2GU9A 2WKKA 4UWDA 2WZEA 5FYHA 1S2BA 2PAMA 1Y7BA 4RQPA 1C5HA 1R083 4C0BA 1QJU3 3VBHA 1UIJA 3AP4A 2OT7A 4NRQA 3HVDA 4KMQA 4OHYA 2DWRA 2VQTA 3VZOA 4C8DA 1MACA 1TG7A 4B4PA 4FT8A 1ENXA 2A3XA 4CA9A 2O8QA 4LO5B 4EROA 2JECA 4QWNA 2HYKA 2FHRA 1QWRA 1UCXA 3ZSEA 5DDJ3 2R49A 2ARCA 2H0VA 4IEQA 4CXWA 4LPLA 3WXPA 3IPVA 4M3CE 3WF2A 2W1WA 3AFKA 1QH7A 2KA3A 4BQ5A 1AL0G 4L2NA 4AEJA 2AACA 1YCIA 3ZYGA 1R081 1SBFA 4XAAA 1QJU1 4HOOA 2BFUS 3DV8A 1S0FA 1QJX2 1LTEA 4OFGA 1NLQA 2ZGQA 2WNEA 5CKNA 4FPEA 3T4HB 4CDWA 1UZYA 1AXKA 2R7EB 2J1UA 2VAUA 3TRSB 2GNDA 2WZR3 3I2IA 1VBB2 3UYJA 4D0QA 3MFCA 3TEWA 1IG0A 2P3IA 3CJIC 4JVAA 1RUJ2 1SMVA 2DFCA 3MIDA 4LIVA 4Q0PA 3UL2A 2ZKNA 3TNPB 4X8PA 2VUCA 4ZXKA 2XGXA 3AMHA 5DDJ1 2FBEA 4PLNA 4AEDC 4DRRA 5A3PA 3SCGA 4E9KA 1GZWA 2WO3A 1F2NA 1XYNA 3GYDA 4NWVA 3QH6A 3SISA 3ZIWA 4DMIA 1RUI3 3LEGA 4ONUA 2YC2A 5SV8A 4YSFA 4E8DA 2B9VA 1QQP3 3DYMA 4QX5A 1VBD1 1W9SA 3GJBA 3MBWA 4CVUA 5FWJA 4MHUA 5J96B 2Z42A 5AVPA 4XDQA 5LB6A 1SCSA 4Q0QA 1OQDA 4CDUC 1LECA 2DYCA 2UY8A 4LBQB 5FK7A 1N47A 2WO2A 3HPNA 4LHLA 2QZ2A 5GLVA 5A6YA 5FZAA 3NAPB 2ZGUA 5HCFA 2XMLA 4QX0A 4XDOA 5FZIA 2RJKA 4NOTA 1GWKA 5A1LA 2B4KA 1IZ3A 5T5LA 3NWKA 5CB7A 4I30A 1RUI1 3FFQA 1WA6X 5DUVA 1LGNA 4LKEA 3TEYA 3ITQA 1AR71 1UY1A 1W2TA 1W8TA 4Y1VA 5FP4A 3TYJA 4GIQA 5J1XA 1B09A 2AH2A 2SLIA 3HAGA 3P3PA 2HWF3 3VGIA 2JJ6A 5FPLA 3ZN6B 3DECA 4LBJA 4N53A 4QQHA 2BERA 5ANQA 1Z78A 2DUOA 1UL9A 1VBE2 5FY1A 1S0BA 4W50A 1ACCA 1LOAA 1UYYA 2VW1A 3NNMA 5EZWA 3U11A 4CPBA 4JGYC 4DEQA 2BBAA 3BVCA 4QXKA 5DZEA 5A7PA 1WLCA 1LHUA 1UKRA 4H55A 5FLHA 5J3UA 4Z2WA 2ZGTA 1POV3 1S1AA 4QGLA 3BYWA 1OC1A 1WCKA 5LA1A 1WMFA 2WA3A 1IQAA 1Y9MA 1PVC1 2XKPA 2YU2A 4IV3C 4I0AA 4ZU5A 1CAXA 5JSRA 1PO11 2VVDA 3ZX7A 3U14A 4YG6A 5FBJA 1J59A 3USUB 1E5IA 1CJPA 5C4WC 2E51A 5FY8A 2CGPA 1LOEA 2HWF1 2GC2A 1PM4A 4XFAA 1HXS3 3I3QA 4YLZA 1NLSA 3BOWA 4FFGA 4O7XA 5A6ZA 2ARXA 3R0RA 2W1SA 1V6JA 4LNVA 4QPGB 5BNNC 2PTMA 1B35A 3IDCB 4XCAA 4AHXA 1POV1 3OY8A 1CAWB 5F3GA 4UOJA 2C24A 3ZSMA 1CZTA 3ZLIA 3ZIXA 4NMIA 4OI4A 1S0CA 3J7LA 4E4SA 1YHFA 3CF6E 3I2HA 1Q8PA 2E7QA 2IVIB 4QKBA 2EALA 3ZFGC 1OKQA 3ZN5A 4COZA 5IYYA 2IFWA 3SQOA 2X5IB 2AEZA 2OIIA 4M0HA 4YVSC 2TUNA 1HXS1 3PVEA 3HQRA 3NV1A 4CUBA 1V6MA 2RDRA 3VKOA 3OD4A 1W2OA 3GZUC 5IJRA 2E26A 2ATFA 3OPTA 2YDEA 1Q56A 1HDKA 3JBG3 4HKOA 2FDFA 4W6XA 3KF3A 4CCNA 4N43B 1HQLA 3POGA 2IWGB 2PHRA 3LFMA 3QLQA 4NAOA 1RVF3 4J1XA 3PMSA 2VOTA 1UX6A 3WP3A 4AI9A 1X9TA 1ZM1A 2PLV2 3R4DB 1H8TA 3SH3A 5FZ4A 5J7MA 5KR7A 5DG2A 5LA2A 1UNBA 3N3HA 4Q26A 5HCBA 3RZHA 1JXNA 4XMIA 1UMHA 1BVP1 5CFCB 2JE8A 2PXJA 2A6WA 3DKWA 4IE6A 3UESA 1Q43A 2WWJA 3P6BA 3BODA 2BNOA 4IEVA 1FYUA 3VBRB 2RG4A 4FPGA 5HXMA 2I07B 4V1PA 4YZ2A 1U5XA 5M0TA 5FZ8A 1DG6A 4H14A 3VD4A 3JBG1 5A7WA 3EYPA 1QDCA 2QQMA 5HBAA 2LS6A 3FN9A 2BNNA 1QU0A 4CUGA 3POIA 2Z4FA 4TSVA 1RVF1 5IVEA 1O7FA 3J8F1 5C71A 2W52A 5FJHA 1HQWA 5BNPA 1LEMA 5L9BA 2EIGA 5LK7B 3NNLA 3LWCA 1RJ7A 3H9AA 4AHWA 2MEV3 1XOYA 4LO4B 1ZBE3 2R043 2ZHNA 5E1RA 4AI1A 3AL6A 1VBC3 2W08A 2CL2A 2YPJA 5K8SA 3O5SA 3AB0A 1CIWA 1UIKA 3MUY1 2WINB 3JUUA 1XU1A 2VG9A 1BKZA 3QD6A 2A71A 2BGCA 4QAWA 3TN92 4AWDA 1PMHX 2JDUA 2ZAAA 5DUXA 2D3SA 2G9FA 4JHZA 4M4RA 4YFWA 4OI0A 3VHPA 4UFLA 4AI3A 1XRUA 2R072 4RR3B 4D94A 1L7LA 2VBPA 3DCQA 3T09A 3VKLA 4HN1A 3PTRB 4Y20A 3WINE 1VMJA 3MV01 1GQGA 1PX4A 2DVDA 1ZBE1 3ZFFC 5JXJA 4ZS3A 5F5IA 4RD7A 2IXLA 1VBC1 1OLME 4KU7A 4AW7A 4Z07A 4K21A 5CAZA 1HRI3 3PIGA 2B9UA 3I2KA 2VTXJ 3M3CA 3WG2A 4COWA 1O3SA 2UY9A 1TMF3 4YW4A 4QU2A 3N7LA 1PK6A 5C9AC 2ZHLA 3APBA 1TNRA 1ND2B 3RZMA 4QX1A 4GMP0 4L11A 2ZHKA 4YM0A 5JXIA 1H2KA 3HNBM 5K0UB 4GWNA 3LF7A 3C3VA 4LK7A 3RZKA 1TQ5A 4R52A 1M4WA 3QH7A 4QQPA 2PA7A 4D7YA 3ZYRA 3D4KA 3DPRB 1CAUA 1JHNA 2JDYA 4Q1RA 4E4ZA 1F8VA 4FI9A 4RN5A 4XF1A 5EIYB 3W58A 3CZJA 4D6RA 3GBWA 2BWCA 5CG9A 1LHOA 4BLJA 5A3MA 1C8NA 1VRH1 5A6QA 4HMZA 4NIIA 4RQPB 3TAYA 2ZEXA 1WKYA 1TMF1 4OQ9A 4BISA 1F35A 3B5LB 3VBHB 1E5HA 2W2IA 4LKDA 4CDWC 1NCQC 2V09A 3ZSKA 1QDOA 3K75B 3OBAA 5JLVA 4BPZA 4YGBA 4ET7A 2VOWA 4KG0A 4CCLA 4QHBA 3O12A 1UAIA 1KITA 3POSA 3JQXA 1S0GA 3VL8A 4EN0A 5LA0A 1D4M3 4R8HA 3WQBA 1FATA 2I45A 5FV3A 4WM8B 1PO21 1NA1C 5FDBA 1W06A 4TZDA 4OUSA 5HCAA 3IPVB 5BNOA 1BEV3 1W8UA 3HT1A 3AJZA 4D3WA 2JG8A 3RI8A 2JE9A 4UF0A 1CX1A 1S2EA 5E88A 5LRSA 1KRIA 2C5DA 2ZS6B 4M3CF 2WRAA 3BB6A 4P5YA 4B29A 4E4HA 5L9VA 1FV3A 1F15A 4GJZA 3JD72 4XXAA 1W8WA 4U2AA 1JW6A 2HWC2 3I8TA 2A6VA 4YZ4A 4C1WA 2ZMKA 4HETA 3Q8AA 3WDYA 1NE6A 3ZR5A 3GBGA 1V6OA 1D4M1 1V9U3 5C5TA 3WEZA 1LJ7A 4HONA 4HVQA 4DFSA 4QQOA 3LOBA 1XNAA 2RDSA 3MIEA 3A4UA 4HT1T 4BE3A 5C7GA 3AXEA 1J3QA 1UOBA 1E57A 2C26A 1O8PA 1YQ6A 1BEV1 4L9BA 2EAKA 1JUHA 1P8JA 4PLMA 3UKTA 1QHDA 4L0PA 2RS13 1W28A 1CD3G 3KMHA 4R4XA 4LLFA 4E2QA 5I93A 1LESA 5KBFA 4CU8A 1SFNA 1GP4A 2E7AA 5CYYA 1HJFA 2XBO1 3BOPA 1RHI1 3PJYA 3ZMOA 5CFDC 1TE1B 4JGZA 2B46X 3WUCA 2QKDA 3B9IA 1GV9A 1DGLA 4M4PA 3ZYHA 1DIWA 3ABZA 3DL3A 3N4MA 4Q4Y3 2W95A 2RS53 1UOJA 3FBYA 1RUF3 1R1A3 1V9U1 5FYYA 2RDNA 5IK5A 4DS0A 2G4IA 4XFCA 2ZXQA 4BK4A 1OT5A 2XWJB 1WCUA 1W0NA 2RS11 3OGSA 1Y43B 3ZXEA 1GANA 3PMEA 4QDQA 4B4RA 5AFBA 2HLEA 1F9KA 3DN7A 5AC91 1AR83 4H3WA 2ZGNA 1ZA4A 5JMCA 1R082 1LNSA 1OVSA 1QJU2 4N53B 4P14A 5E6HA 1W6NB 4HSJA 4W6WA 2UWBA 4NN0A 3A0NA 3MGUA 4Q4Y1 1O3QA 2VUJA 2RS51 3T0BA 1RUF1 3AYAA 4XUOA 3BGAA 5EFUA 5FXXA 4CDXA 3SITA 4Q8LA 2CU5A 2H6CA 3D6EA 3AXDA 4GB33 1OXCA 2X09A 3CJXA 4ES9A 2XUEA 3VD3A 1ASJ3 1YFWA 1OQEA 4TYSA 1CAXB 5DDJ2 2YXSA 4Y24A 4MGZE 3LOIA 5FUNA 2ZGRA 4EN8B 5FZLA 4BMEA 5FYVA 1UU5A 5JOXA 1DZQA 2QQUA 2XKOA 3VBUA 1V0AA 4AYUA 1WLDA 2VUDA 4WM7A 1UMIA 4EN7B 5ISLA 5ACA3 1MVQA 5JPMB 4P9GA 4PIXA 3KHCA 2WNOA 1QXPA 2VW2A 4EN9B 3NRUA 5L73A 2E33A 2WZR2 4FOVA 1B35B 2H6BA 4GB31 5FZKA 5ABJA 5A3UA 1VE0A 3OY8B 3Q8BA 3MW3A 3POBA 1K3IA 2PYTA 2VH9A 1JU3A 1H8TC 3WD5A 5CIRA 3SEPA 4KGGA 2XWBB 4L92A 3TEXA 2NZ9A 1AUYA 1ZVFA 4HVOA 1DBNA 2WNUC 3GCWA 1HN1A 1RUI2 1W9TA 4DO0A 4KI5M 1AR72 3OGJA 1JYTA 1K42A 2JEMA 5C8WA 4I3GA 1AXZA 3M3OA 4WVWA 5GZEA 4CU9A 3CO2A 4I02A 5JIUA 1CAVA 4I09A 5F1RA 5C3PA 2VZ3A 4SLIA 4CCJA 1DLCA 2WO1A 3JCIA 2RDQA 3AZWA 2XB6C 4PBPA 4OMDA 2Y6JA 2IXHA 3IKWA 4ITCA 2RHPA 2A7AA 4AVVA 1XE7A 1W6MA 3EB7A 1WD4A 3ATGA 2VZTA 4LITA 4IETA 2YG0A 3ZYIB 4NRMA 1OH3A 2RMU3 4FP3A 1UY2A 4ORFA 1PVC2 1POQA 4QB6A 1PO12 4FAGA 2PHXA 2MPFA 4YGEA 3PUQA 3W5MA 2D3RA 3OBTA 1QMJA 1A78A 3IDEA 4GKXA 2RS33 2QDNA 2QQPA 4WVZA 2HWF2 1EV13 3ILFA 2JDHA 4OHWA 3SHRA 2E7TA 4RYDA 3ZXDA 4RGKA 2HEVF 3VV1A 3D0JA 3OUJA 5C8CA 5IVBA 5BNPB 3LIHA 1XU2A 2GH8A 4BIFA 1OF3A 4YM3A 5FQ0B 2PLV3 4LBMA 1DU3D 2RMU1 3AKPA 1DYKA 1GOGA 3QCWA 2ORZA 4OUEA 5GM0A 2QE3A 3MPPG 4CXYA 4IE0A 3V0BA 3ALQA 1SLLA 3H8OA 2RS31 4AQ2A 3FLPA 2Y6KA 3T2OA 2Q1FA 2VMCA 1EV11 3OB8A 5FY7A 1I6XA 2CWMA 1N3OA 3C7EA 4Y33A 3WX5A 1HXS2 4Q1PA 2VZRA 1ULDA 4QB2A 5FREA 2VZ1A 2VOKA 3VZLA 4CDUA 5KXCA 1O8SA 1RUNA 2NQYA 5JI7A 1WGPA 3CBNA 1CX4A 4QT6A 2AC1A 1YO8A 3KQ4B 3ZO0B 1Y3TA 1Y4WA 2JE7A 5FPVA 2XJUA 4Y20B 3RGBA 1JYVA 4LUKA 2OUHA 1LHVA 5J98B 5D8AA 4AL9A 1H0BA 3WOGA 4O65A 5DQ0A 1RUG3 2D6NA 1KD7A 2WA4A 1ALYA 4O9EA 3ZPOA 2E6VA 3AVSA 3EQEA 3KGZA 1H9WA 2W0XA 2CNAA 3WDWA 1QOTA 2ARAA 4QHZA 1JBCA 1PK6B 1QEXA 3J9SA 1PZ8A 4GMP3 4I0BA 4PJYA 4XE9A 1DQ6A 4NPMA 3VUOA 1NOVA 1WZXA 3RS6A 3JBG2 5FWEA 2CSGA 5L9RA 4JGYA 1OI6A 1PIV1 1GU3A 4BJ0A 1CAUB 1RVF2 3VBFC 3J8F2 3LPGA 3T4VA 1W6PA 3ZXJA 4HLTA 2B39A 4JDNA 4IE7A 4IQPA 1C5IA 3KGLA 3VBSC 4IV3A 1RUG1 4CU7A 1OA3A 2JG8C 2QQVA 1UN1A 3OGGA 3OOXA 4UBHA 3VZKA 3MHZA 3VD5A 1GZCA 4YARA 1W99A 2JDPA 4XYXA 5C4WA 1AX0A 1O4YA 2TNFA 3OEAA 3S57A 4GMP1 2PHFA 5EP9A 2R061 3J7NA 4QPIA 4CEYB 1JZ2A 4RHV3 4QGMA 1VAVA 2VZSA 3CQOA 2C1FA 5EXOA 1NAEA 1CGPA 5F6LB 2A70A 3UGGA 4CEYC 1KFUL 2WABA 5BNNA 5HV4A 1EP0A 1AXYA 4ASLA 4BZ4A 4QM9A 4F3JA 3BTZA 2GC3A 4FPKA 3MDPA 2WZ8A 3FLRA 2MEV2 3MUZ1 1DZTA 5CVRA 5EYYA 1ZBE2 2W87A 4INDA 4G4FA 4BHPA 1W8HA 1VBC2 4UF0B 4Y1XA 3O7OA 4CE8A 1W8OA 1DZRA 2DU0A 1O59A 2LW8A 5IK4A 1Z0HA 3WW3A 1CJDA 4FXGB 5G04L 3WNMA 1AX2A 2KD7A 4LKSA 3GGLA 4X6RB 2BP6A 1I5PA 3IMMA 3IIAA 4GALA 4CP9B 2BV4A 3HN1A 5EHDA 1NQJA 4AQ6A 4S2FA 2JIGA 3LEMA 5KXDA 2K2SA 3MV11 2JG9B 3AL5A 3AZVA 5FTTC 1H8VA 2ZMLA 2L9LA 4UFJA 5EYXA 2ZZJA 3J7MA 2ZHMA 1MEC3 3NJZA 3BTAA 3JB8A 5FMBA 1XSRA 1ZYBA 3R4UA 4GA9A 1VRH2 1X50A 3VDDB 4JGZB 3DXUA 2VNOA 4LK6A 2XHNA 4WVMA 1H2MA 1TMF2 1W2AX 2BGOA 3KVAA 4XBLA 4Y4RA 1QH6A 4EE2A 2N7GA 2B5HA 4CDQC 3MLLA 2DCJA 2DDUA 2VD7A 3H50A 1PGW1 4Q4X3 1ULPA 5FFOC 2JIJA 2VZOA 2R16A 4ISQA 3ZSJA 3PVNA 2C4XA 5E89A 1C1FA 2G9GA 2ZX0A 1QKQA 3AMNA 2BVVA 2OW4A 4J6GA 4COVA 2ADEA 1AX1A 1PO22 2GZWA 3WW2A 1SLBA 2HYXA 1CZVA 2VW0A 4IL7A 1N1YA 4IV1C 1SBDA 2D40A 4SBVA 4LBKA 3LZZA 3WP4A 1MEC1 1S2KA 3PUIA 4CCEA 4JAAA 1G7YA 4QX3A 2NLRA 3LEIA 5BNQA 3IDAA 2BWAA 3TB0A 3DGTA 2Q1MA 3IMNA 4JDOA 2UWCA 1V00A 3AKRA 4NIDA 4LXLA 2D98A 1KGYA 3D3AA 1DF0A 2GP5A 5CKQA 3C8XA 2HEWF 1ZZBA 2ZA9A 2XJRA 4CDXB 1UZZA 4QD2A 1YFXA 4DZGA 2VOXA 5ABJC 1IKQA 3C2UA 3H42B 4Q29A 1K5MB 3C7OA 4Q4X1 5DMYA 1HRV1 5EJZB 2WIIB 2ZTNA 4DXZA 2Y34A 1Y9GA 4D8MA 4NAMA 5FP3A 1D4M2 3KZ4C 2NM1A 4OMCA 5IATA 4GQ7A 1QIQA 1VP6A 4FOWA 5BNOB 1JYWA 1A8MA 1J84A 3KV4A 1H9PA 1BEV2 4CCDA 1C57A 4HK8A 1X82A 4DY5A 1UY4A 5C3QA 3VBUB 1NE4A 4MLOA 4WM7B 2XBO2 4D7TA 4PCRA 1RHI2 2CDOA 3SXWA 4YG0A 3WNOA 4AK3A 2XXZA 4XEZA 4YW3A 5C9AA 2YBKA 3D82A 4OZXA 5BYNA 2KR2A 4BQ2A 4P9XA 1JYNA 1V9U2 5A3LA 3W5NA 1O5UA 1D7PM 3GM8A 3FJSA 3S5AA 1XYPA 5DAWA 5K4LA 2GALA 5I8TA 4P9JA 1LU1A 4LOSA 4IEUA 3NL1A 3SKVA 4K1ZA 2RS12 1GWLA 4A6OA 4JX0A 3ZFEC 3ZSLA 3UNPA 4NIAA 2BRTA 5AC92 5B2GB 1VBD3 1GMMA 5I91A 4GXLA 2XPJA 4NROA 5JSOA 1H1IA 1CAVB 1NCQA 3ACFA 2VBDA 4AGRA 1ZRDA 2YYOA 2LM3A 5C8CC 1W90A 4MH0E 4Q4Y2 2RS52 1RUF2 2D7FA 1R1A2 3NJYA 1YUDA 1VRBA 1W6MB 1NKGA 3OD0A 3AYDA 4NE9A 2FCVA 3PVOA 4RSUA 4XURA 2FCTA 1C8M1 3KT7A 1D0HA 2J1TA 3PUSA 3W9AA 5T3NA 3N9MA 4MGQA 5FZ0A 1FAYA 1NA1A 3O1MA 2W39A 5JWPA 2DCYA 3RNSA 1UPSA 1EY2A 3ZKYA 2DTYA 1AR73 1AR82 3H3UA 3M4FA 3NJXA 3LB9A 3GALA 2DVFA 3T2TA 2VZQA 2W46A 5KC5A 3GBFA 3WDUA 4W65A 5FP8A 4B7KA 4HZFA 1W9YA 2JDMA 3C7HA 3I59B 2Y6LA 3CJIB 2Y38A 1YIPA 3AZYA 1OSGA 3GNEA 3I7DA 4KBZA 1AYN1 1ND3C 1WBLA 4GB32 4BQ3A 2RM21 3QBQA 5D8AC 3K51A 4YW5A 4YW2A 4AEDB 2W9XA 2BGPA 2H0BA 1ASJ2 3PLQA 1PVC3 4R9BA 3THPA 2GC0A 1PO13 2VOVA 2CY6A 4KH9A 3QACA 4Z82A 4C0HA 1XB9A 4DUVA 4MYEA 1OH4A 2D44A 1YJKA 3A0KA 1XJAA 4A42A 3V0BB 1Q8QA 3ZYPA 1KS5A 5IT6A 1X7NA 1ULCA 5CFDA 4PDWC 5ACA2 4AVSA 5IK7A 4NRPA 1ZRFA 1TEIA 2YY1A 1H6XA 3ZXGA 1JZ8A 2Z5WA 1WUVA 5FMOL 2VJXA 3FMGA 1GR3A 4CCMA 5IHRA 2G1MA 3BPSA 1JUIA 3SEEA 2GMPA 2ZGOA 4RL7A 3T2PA 5J48A 5L19A 2HBTA 1US2A 1IS3A 4FPFA 1VB2A 3ECQA 2WSVA 1EUTA 4Z2AA 2IC1A 5BY5A 5GZGA 1F4HA 5FZ3A 4QDRA 2R1BA 4QPIC 3K4AA 3V0AA 1VBA3 1EAH3 4P02B 5C6CA 3O0XA 4UW6A 5AFEA 4AFDA 2KXLA 1W6QA 2X8KA 3IAQA 5F39A 4YPJA 2CWSA 3NNFA 4ASMB 2EF6A 2BVBA 2QFEA 4JGYB 4QX2A 1VB4A 1QJFA 3OGVA 4P9IA 2XJQA 4GWJA 5JDBA 2Q30A 3LQCA 1FPN3 1W6PB 1VR3A 2W94A 4HKWA 5KC6A 3BCWA 4MADA 2QQWA 1O6UA 2VMFA 3ON7A 4IV3B 2DUQA 3RRDA 3N9QA 3AC0A 2RMU2 3O1TA 1X9PA 2XVKA 1AHSA 2X29A 4N7UA 2P1BA 2QZ3A 3NNJA 2CGOA 1VAKA 4NHYA 1MS9A 1VBA1 1EAH1 4NR1A 3RSJA 5C4WB 4O61A 5A32A 4XZUG 2RS32 2ZZQA 4LO8A 1MQTC 2BBVA 1EV12 4WBBA 1ULEA 4P9YA 3HOBA 4BB3A 2VMHA 3TEZA 1IQDC 4NHKA 5GLWA 1RJ8A 2A3YA 3ZXAC 1CN1A 3O1OA 5BNNB 2WFF3 1FPN1 3J8F3 4RFRB 3DYOA 4Y5Z0 1MS0A 3ZMNA 1VMHA 4P9WA 3EJKA 5FYIA 2BOJA 1DQ5A 2BPA2 3U4XA 4QB1A 1JZ5A 4META 5GZFA 2CGNA 3PTYA 5APAA 3ZFGB 4AVAA 2WNUA 3ZR6A 2YFZA 1G9CA 1N3QA 1AR91 1LOCA 4KG8A 4YVSB 5FPZA 1ZZ9A 1RYYA 3MPBA 2VCMA 1BK0A 3RJ2X 2OX0A 3BIWE 1RGSA 2EVXA 2CV6A 2WAOA 1ZREA 1D0GA 1ZBA3 4XFIA 1UPIA 2WFF1 4LMFA 4NHLA 5D21A 5LATA 1L3JA 1PIV2 5DN2A 4R9CA 1XSQA 3Q8EA 1UY3A 2ZAHA 1C3HA 4Q8KA 3J26N 5T55A 1IPJA 4PF1A 1RUG2 2ZPXA 2AGSA 1RTVA 3KLSA 3PU8A 5FZ9A 5JXHA 3Q8CA 1WD3A 4WVMB 3WHTA 3VBOC 3KCXA 4XJZA 1O4ZA 4Q0UA 1WCDJ 3POWA 1DGWX 4AE2A 2FCUA 2XVLA 1ZBA1 2JENA 1QXRA 4ATFA 2A6ZA 5FZCA 1GOFA 5FZBA 1H6YA 1OOPC 4N9HA 1SFPA 1YQ2A 2B45X 3PIJA 2VU9A 5F3EA 1H1MA 1Y9QA 2HBUA 3A21A 4UYBA 2DCKA 1HIXA 3O1RA 1H4HA 4BDVB 5EPAA 2VMIA 1ENQA 1ODMA 1WCQA 2XDVA 1FI2A 3UV9A 4E27A 3URFA 2UURA 3FHQA 1SPPA 3MW2A 1VRH3 1LOFC 4PBOA 4TWTA 4M0NA 1YC61 1ZZ6A 2NMNA 2YFUA 5F7UA 2Q8EA 4AVTA 2HKXA 4TTGA 2FDJA 1R64A 3FC0A 4RHV2 1W2NA 1QNWA 1FT9A 4HG6B 4ZKTB 5LWBA 4ES8A 3T0DA 2EA7A 3DXTA 2X10A 3KHBA 1GLHA 2PHUA 4HFSA 4OLLA 3E97A 2OUJA 4KWLA 2RVAA 2WZPP 1W04A 1H4GA 3NV3A 4IEZA 3BTYA 1JMUB 1HKDA 4K8RB 2CYFA 3ZFFB 1PO23 2YGMA 4AGVA 3A23A 4FQZA 4DUWA 4M01A 3M2MA 1LGCA 3NKTA 4FPJA 4FTSA 1RXGA 1D2SA 5F3IA 4Y3OA 4FFHA 5FZMA 2YROA 3B3QE 1F5FA 2P3YA 3O1SA 4IXLA 1MS8A 3N9OA 3I54A 3AVRA 4CEWC 1LOBA 2ZX3A 2ZBJA 1YWKA 2JKXA 1A3KA 5LBCA 5C9AB 2ERFA 2VZPA 1VIWB 3O14A 5KHIA 3AP6A 2GMEA 4BQXA 3WV6A 3K3OA 2ZGMA 3WF4A 1U12A 4WM8C 1W0PA 3VHRA 4XW3A 2XQRA 3CEWA 1PGW2 1WBFA 2UU8A 2KM2A 4MVTA 3SNMA 1BVVA 3VBFA 1WW4A 3FUQA 5JIAA 3WF3A 4LEJA 4P5HA 1OD3A 3WHUA 1GP5A 3VBSA 4IEPA 5I8SA 1J1TA 1HB2A 4MXWA 5A33A 4AG4A 5B4NA 1ST8A 1U5YA 3WW4A 4A45A 3BN6A 1S0JA 2P6HA 2J1RA 1MEC2 2RR11 4LHSA 2ZKLA 2XBO3 3JU9A 3OG2A 5FZFA 1RHI3 1MZ5A 5SV5A 4YW1A 1RMU1 2VECA 2VXRA 1D4VB 2CAVA 4CDWB 1NCQB 2F6BA 1VAMA 5IAVA 3RMXA 3BALA 3JQWA 4S2HA 3U1XA 2JB4A 4AEKA 2E9QA 3BPZA 1GFF2 4HVRA 1V6LA 5HV0A 1YXWA 1O91A 4MSVA 4QGNA 4Q4X2 4JC1A 1TNFA 1HRV2 3J4UH 4F8AA 1BBT3 1LOGA 1SLCA 3LA2A 4ZZ8A 1JZ7A 1GZWB 2B8MA 5F8PA 1NA1B 1PMJX 4A44A 3FX3A 1YNAA 4FPYA 4RA0A 2Y26A 1W03A 2WS93 3WT3A 4W8JA 4XJ9A 2Y0OA 5AC93 2WQ4A 1WW5A 4Q4W3 2VMEA 3S0MA 4AQTA 3BI3A 2QJVA 2P3JA 4OCTA 1R091 1H30A 3GXUA 1KEXA 2WO7A 4XFFA 1KXGA 4BXSV 1KDKA 1BCXA 5JI9A 3B00A 4PIZA 4A3XA 3NSTA 3N9PA 2D3PA 4IGOA 2XJTA 4YFZA 4LE3A 3RZGA 1Q5OA 1JOJA 1AYM3 1BBT1 2BU9A 1OUSA 2WLQA 4YG3A 2DU1A 2YB7A 5C5UA 2D6KA 2JX9A 4UFHA 2LALA 3IWZA 5A1AA 4K7JA 1X33A 2LRPA 2WS91 4XQWA 5FR3A 1APNA 2D43A 5DAPA 1ULOA 2D5HA 5TSWA 3M3EA 3HJRA 3MF9A 1QOOA 4Q4W1 3RYKA 2Y6GA 2W1QA 5D2AA 4FXKB 3WG1A 2C0ZA 1SLIA 2XG3A 1GSLA 2XR4A 4XQ4A 5CFDB 1LEDA 4NWWA 3WG3A 3U0ZA 4E8CA 1FV2A 3LDBA 4GZ9A 2XOMA 4J1WA 4LIUA 4AAXA 3I2DA 3IBMA 4BH9A 4JRAA 1HLCA 4CDQA 1FOD1 4HXCA 3TWIA 1H2NA 3WNPA 1AYM1 1BJQA 3AMQA 4KBBA 1JODA 3IT8A 2WFPA 1KJRA 4JKMA 3FL7A 1W8NA 4LE4A 3VHOA 1C8M2 4YVWA 5L7OC 3U37A 4BMBA 1DYOA 1RUH3 4IV1A 1MZ6A 2OQ7A 1VBD2 4L8QA 2AREA 3T1MA 1HW5A 4P08A 2A1XA 1MR5A 1W6QB 4A4AA 4B8EA 4YM2A 5FJKA 4LBNA 3B7MA 1NCRA 1NG0A 4LA3A 4NIHA 3OEBA 5IVYA 4K9SA 1UXXX 4RS5C 1K45A 4QXBA 1WLWA 1UMZA 4COYA 3OF1A 4F7ZA 3T08A 3WQ0A 5JR2A 1UD1A 1CPNA 2R30A 1RUH1 1YFUA 4FQ4A 1MS1A 4JKLA 4TLFA 2Y60A 4FVVA 3UGFA 2V4VA 4BU2A 3HN3A 2YHJA 4AFMA 2WQZC 5A32B 3WG4A 4QXHA 3AKQA 1UF2C 3WNLA 1JYXA 1OPMA 1WWYA 2VCCA 1GNZA 1CPMA 1ZNPA 2VQAA 3VD7A 2JDAA 4XCBA 2GDFA 3ACHA 2D6LX 2G9ZA 4RGAA 2ARBA 2A6XA 1FXZA 4QKNA 3GZTB 2Q4SA 4PQ9A 4UFMA 3CMGA 4BQ1A 4FPHA 4KL1A 3SH4A 1H8TB 1DHKB 2W68A 1UYZA 4XDPA 3P3NA 1E5SA 4PI2A 3TOJA 4XUQA 4E2GA 2J1SA 2WNUB 1F4AA 1L7RA 5A3TA 5I0UA 3ZFEA 1H1AA 1XQNA 1ZZ8A 1JZ3A 1KDMA 3KF5A 2UYBA 3VDBA 2PHLA 5A7WB 5FPXA 4LBLA 3E6DA 2I74A 3T1LA 2Y33A 5JOYA 5KHKA 5CEHA 3RZJA 3E5XA 5CBLA 2CDPA 3HIFA 2OS2A 1A34A 4IE5A 4FFFA 3VB9A 1UOGA 3C7GA 2EAAA 1JN2P 5IW0A 5EJ1B 4XFHA 5DABA 1XE8A 2EXJA 3LPFA 3KQRA 4AI2A 5D1IA 4OUMA 4DQAA 2ET1A 4Q0SA 1S0EA 1PGSA 4ZY9A 4FPOB 1VBA2 3R05A 1EAH2 2GMMA 4LBQA 2BFUL 3WR0A 4XFGA 5JOWA 3HQXA 5FMCA 4F83A 3ACIA 4N8MA 4GH4C 2OZJA 4KWUA 1G6NA 4U36A 1CIYA 3KV6A 4A7KA 4EWAA 3NAPA 2BUKA 3FE5A 5FUPA 1RB8G 3OPZA 3S7IA 3GZAA 3QOPA 4TXWA 1PIV3 2HWD3 4Q27A 3THCA 2FZ2A 1ND3A 1FPN2 4XMAA 1G8WA 2J1VA 4BA6A 1RXFA 3S7EA 1OA4A 3ETQA 3WP5A 4AAPA 4FAHA 3JB4C 1GNYA 4UI9L 3ZXKA 2B42B 5T50A 3WDXA 5JZGC 1SPPB 5T5PA 4YZ3A 4JDMA 1NYWA 3WCRA 4JTOA 3ZN6A 4PQQA 5FOBB 1JH5A 2JDZA 2R063 3WQ1A 1H2LA 5LK5A 4LLOA 4B1MA 1BYHA 4PDWA 1KFXL 1YQCA 1VALA 4EWDA 3UKVA 1ZZ7A 3B9CA 3I3DA 4GD4A 1COV3 4KWJA 3ZXLA 4AXOA 4ZU7A 2HWD1 2BQPA 4KU8A 4IESA 2YU1A 2WFF2 4LBOA 4W4ZA 4ZU4A 3T0AA 2W5FA 4TLGA 2OA2A 5CG8A 1HV0A 2WNVC 4PLOA 1IHMA 3ENRA 3PHMA 3USUA 1GUIA 2MNGA 3KVBA 2V5DA 5L36A 3PNAA 5F5CA 1N1SA 4EJRA 2IUWA 3ZYBA 4N7IA 2QQKA 1UYXA 3S5QA 3G6JB 3ORJA 4OI2A 3SMHA 1UU4A 2HWE3 4HANA 1SFYA 4IERA 3ES1A 1OD5A 3C7FA 2JXAA 5CNAA 2X05A 5ANNA 4DUXA 5KXBA 3HWJA 2VNGA 2ZEYA 3H7JA 1COV1 1ZBA2 2ES3A 4Y1YA 3RFRA 1ZX5A 2QUOA 2VO5A 2YV8A 3VBFB 3OSDA 5BXXA 2E63A 4EWEA 4XABA 3VBSB 3RZLA 1HB4A 1PNGA 2O14A 4MXWB 2JG8B 1SQ4A 3TN91 2X5IA 4XHBA 5FZDA 5LEJA 1AL21 1J58A 1OFSA 2W91A 2D6OX 3G7DA 5FZEA 2HWE1 5I0RA 1XNCA 4EZ4A 2ZX2A 3MIGA 3I3MA 2WBKA 1MQTA 1T6GC 4UT5A 1S0IA 2OXBA 2WDBA 3AP7A 3POJA 4HL0A 3K2OA 5B4XA 1QNYA 1NT0A 1UZ0A 4YGCA 5G05L 5FYZA 5LA9A 1GZTA 3WCSA 3I2OA 2FDGA 2XVGA 1X8MA 3MLJA 4HSLA 3CZUA 3VKNA 4D7SA 3N7KA 3K46A 5FPBA 4Y1ZA 2ORXA 3ES4A 4FFIA 5JUVA 2IXKA 3X29B 1ZRIA 1IS6A 3PU3A 4I01A 3VBRA 3ZM8A 4XUPA 4GJYA 2P37A 4EYUA 2A73B 4BYYA 1NY71 4IE4A 4EZHA 1DQ2A 4XJ8A 1CQ9A 4R9AA 2ZEZA 4A3ZA 1IPKA 2O0OA 2Y6HA 1RUD3 5HCHA 1HRV3 1W39A 2WAAA 4BWOA 2YC4A 1PX3A 1OA2A 2DVBA 3OUIA 5EQUA 5FUIA 4YVWC 1BQPA 1HN0A 5T52A 2IZWA 5DXDA 3AP9A 1Q3EA 2CAUA 4K20A 5FPAA 3SLIA 1IPSA 4YYOA 3U10A 4ZPIA 1GICA 1MS5A 2GNTA 3ELNA 3OGRA 4LKFA 4BQ4A 4IEOA 4Q0VA 1SDWA 4Y1UA 2AR6A 2PQSA 1ZRRA 3HD8B 3MLKA 4LHKA 3ST7A 3AMMA 1AZDA 3VBOA 2LROA 1NCRC 4DRVA 4CDQB 5LBFA 5DUUA 2GH2A 3N7JA 2ZACA 1CWPA 5A6XA 4O9GA 1RUD1 1OOPA 4HPKA 3VHNA 3NJVA 2TEPA 3L2YA 2DURA 5BNOC 3AYCA 5FZ1A 5IAXA 3KD4A 3DUIA 2XLAA 4NHMA 5FXWA 5IVCA 5JXGA 1XXNA 3KCCA 3M1HA 4IV1B 5F6KA 2IXCA 2Q8DA 3U75A 3MI8A 5CADA 3U07A 4WV8A 3AM2A 4NIGA 1LOFA 4CP2A 3B01A 4MO3M 1ND2A 1DDLA 1REEA 4DB5A 4DOUA 2XJSA 5LW9A 5H9PA 2YMZA 4UW4A 5ABJB 2P2KA 3DPRA 3O1VA 2XL9A 2EICA 3S6PA 4H7LA 1SLTA 4CUCA 4FTBA 1BBT2 4H2AA 1A8DA 3V56A 3K48A 1DQ4A 1PNFA 1C8M3 1JZ6A 4UBGA 3D0SA 1YEWA 4Q4V1 2VM9A 3H8RA 2E31A 3CL1A 4NVPA 1CVNA 4PT6A 1N1VA 2WWUA 1W3VA 2WS92 3MIHA 3O0VA 1GNHA 3OTFA 2EIDA 4LJHA 1SBEA 5FY5A 4YNIA 3HNMA 4Q4W2 3FLTA 3MEPA 1LRHA 2W1UA 3P1IA 3ZDVA 5KWRA 4CEWA 2E32A 5IK8A 2FZ1A 3LD8A 3M8LA 4UAPA 4JV4A 5FXZA 1Q8VA 2K9ZA 2ENRA 2K46A 3LFIA 5DPNA 4YM1A 2NP0A 5CU1A 5FY9A 1YFYA 1FOD2 1XNKA 3D8CA 5LCWL 3E6CC 3L9JT 4WM8A 1BMV1 4XIKA 2ILMA 3R6SA 2R32A 1REDA 1AYN3 1AYM2 3JXSA 2RM23 2V4AA 5I8YA 4C90A 4MGIE 3O1UA 3LCPA 2CHHA 2QVSB 2ZGKA 3EXUA 1OHFA 2ID4A 3ZPYA 5KXEA 4LTAA 4A6SA 4R4ZA 1QXJA 2FDKA 1UQXA 3ZFEB 3WLUA 3WW1A 4FOYA 4IGPA 4JQTA 4L97A 5T54A 3U4SA 4MZUA 1T6BX 3FFZA 1XC6A 5KHJA 5IVVA 4HBNA 2PN5A 4MG2A 1RC6A 3I3EA 2XONA 3NAPC 5JR7B 5A7NA 5C8CB 1RIRA 1G9FA 2AYHA 5A7OA 3I2JA 4E4DX 2VMDA 3TNQA 5J09A 2UYAA 1TVGA 2XHKA 2FMYA 2AUYA 5HXVA 1LGBA 4DY3A 4LHNA 2VTFA 3GZEA 5IFPA 3N35A 4YWAA 2YC0A 3DYPA 5FKCA 4NO4A 1RUH2 3NV2A 5FLIA 2YBPA 4ZZ5A 4Y26A 4ARXA 5BUVA 2NPIA 3P5BA 3THTA 2WZR1 3IDBB 4XF0A 4CDUB 2VY0A 1DLLA 4HN0A 4AFBA 4ZHNA 1RUC3 5F2SA 3E6BA 5EWSA 3RI9A 2PHWA 3FWEA 4WZFA 3NV4A 2Z2SB 5I0DA 2DF7A 1C4RA 1ND3B 2RJLA 3BU7A 5D8AB 3OPWA 2VBBA 1LHNA 2HWB3 5GZDA 4M3CA 3IN9A 1QQP1 4XACA 3GJAA 3MIFA 2PFWA 5F9TA 3IZOA 1HJGA 3PUHA 4UXAA 2YZ4A 2Z69A 5BV6A 1A6CA 1OKOA 3VDAA 3JZVA 3SC7X 3N36A 4D6QA 5IFTA 1DGRA 2JB8A 4YZ5A 1JZ4A 1KS4A 1W6NA 1SDDB 4AI0A 1UX7A 4XJAA 3WY6A 4QPGC 1LHWA 4PDWB 5JSPA 1RUC1 3D5OA 5H9SA 2WJSA 3LE0A 3POYA 5GLTA 1NXD1 3ZKUA 3N9LA 3THDA 5FYUA 5FBZA 4JTNA 2DFBA 1XE0A 3N7MA 1UOFA 5KHGA 2VVEA 5FK8A 2HWB1 4Y22A 1M06G 4NUBA 1UKGA 2YPDA 1J83A 4COUA 2X5IC 1PM7A 3WF0A 2XJPA 4BIOA 5L7OA 1AR63 4Y5TA 1W05A 1X36A 4R9DA 2QDRA 4JRLA 4QPIB 1W9WA 2WN3A 3MZHA 1HB3A 1AR93 1NQDA 1XNDA 2HH9A 3MICA 1W8FA 4N43C 1GYKA 4LBQD 4DPNA 3WDVA 5HPOA 1UU6A 2ZMNA 1V70A 3K3NA 4N90A 4CYDA 4QHOA 4B1LA 4LQRA 4CCKA 4E2SA 2ZX1A 2AENA 1JU4A 2A6YA 4RS5A 4OHVA 2R0HA 4LULA 3AZZA 5CFCC 3U78A 2Q8CA 1VLNA 3FHIB 3H3LA 1R1ZA 2ET7A 3RDIA 1LCLA 5GJ6A 1AR61 2Q0AA 4AR2A 1REFA 2VE1A 4GKYA 4OULA 3VBRC 3W21A 1PMIA 2LTNA 2RE9A 4LA2A 1NUKA 4M00A 5FLJA 1QJEA 1QJY3 4AVBA 3ASIA 5FYBA 1O3RA 4A7YA 1MQTB 2ZJCA 3INAA 3K4ZA 4MGYE 3ZVXA 5C3SA 2PAKA 3LSDA 3DKQA 4OHZA 2QNKA 2W47A 3T30A 2WT0A 5FYTA 3H8XA 1VPHA 3AMPA 1GKBA 1JOBA 4IEYA 1WCSA 1EPWA 2HWD2 4KNCA 3PURA 1OQ1A 1OPOA 5JVVA 1EPZA 1X8EA 4RFT0 4CTEA 4BOWA 3NMBA 5LEKA 1GBGA 1NZIA 3EO6A 3AX4A 1WLTA 2JD4A 4FTEA 1QJY1 4XUTA 1Z7S3 5FY4A 3VZNA 1US3A 4JHTA 2R062 3KV9A 4UFKA 2FD8A 3NW4A 4RR3C 4K3UA 1QJZA 1QY4A 3CHXA 3ZXFA 3CNAA 3GDBA 3VKMA 1YJLA 2NN8A 3VZJA 2BTVC 3FZ3A 5FQ0A 1COV2 2XQXA 4A41A 3WDTA 4BM8A 1TME3 1D2QA 1U5IA 2P34A 3CU7A 4XJWA 2VQ0A 4BQYA 2V73A 2D5FA 1IS5A 5DG1A 5GLUA 1PZ9A 4AHYA 3OYWA 3ROUA 1ZRCA 4FP2A 3HQUA 2HEYF 1Z7S1 4OZOA 1ND2C 2VQUA 1AL22 5LBEA 3M70A 5IVJA 1YLLA 2D97A 2ADDA 2VTXA 1IS4A 3VBOB 5IVFA 1U5ZA 3GHMA 2HWE2 5K0UC 3M7AA 4OYUA 3KSCA 2QBXA 1BK1A 2WR9A 2W92A 4HK9A 3W59A 1RUE3 3DPRC 4GH4A 4MV2A 1Q8SA 3H1MA 3LEKA 1OOPB 4HPKB 5FRAA 2MEV1 4FCAA 5FPUA 2R041 2F4LA 3MYXA 1TME1 5H9RA 2CTVA 4XTPA 5FAXA 1DQ0A 3ETPA 2XLFA 1JOPA 1G86A 4RQPC 3POEA 3UETA 5FO8B 3WUDA 4X6QB 5J37A 1AVBA 1ODNA 4UFIA 1MS3A 3VBHC 1UO9A 3VLBB 5JZGA 1IG3A 1LAJA 1YIFA 3WQ7A 4DXSA 4G3YC 2GSYA 2J22A 2RR13 4K6BA 4Q5OA 3RWKX 1STMA 2MHFA 4CSWA 1RMU3 1J3RA 3KT4A 1MZFA 3RWNA 4BCUA 1RUE1 3RMYA 5FZGA 1NY72 3LGRA 4QU1A 4XBNA 3RPQA 1WMDA 2WQ8A 4KWKA 3WNXA 2W3JA 3K77A 1W3XA 3SCFA 4XAEA 2BOIA 1OMIA 2VUAA 4QMAA 3Q9OA 4G9SB 2A3WA 1HRI1 1SHWB 4IW3A 4K40A 2DCZA 1DP0A 2JKBA 2WNVA 4QPYA 2PAEA 1VJ2A 2WSUA 4HKLA 3WNKA 2ZGPA 4OHXA 5FO9B 1JTZX 4XOGA 5GLZA 2A75A 5F5AA 2WYSA 4CEYA 5A70A 2VCBA 1KQRA 2VCAA 3RJRA 2DCTA 5JAXA 4CEWB 4LOTA 2YBSA 5C33A 5JMOA 3PVBB 1LODA 1R093 1S0DA 4CU6A 1LENA 4I3PA 1FMD3 4QKFA 3UT0A 1RUD2 5FZ7A 2JWPA 1PGL1 4FPLA 1LU2A 1HB1A 3HMYA 3VZMA 3ZOIA 2IXJA 4MUVA 1OLMA 3KS7A 1LR5A 1SEFA 2JDNA 3WZ1A 5CISA 5F37A 3DF0A 2VC9A 5A7QA 3ZN4A 1GZ9A 2PHTA 4ZS2A 2VXJA 2XH6A 4CP1A 4XXPA 1DFQA 2R0FA 3KV5A 4JZRA 1K5JA 4L99A 1ULGA 1UY0A 3PJQA 4QQLA 2P4EA 5FMOS 2Y6FA 5FZOA 5JOZA 4LORA 4Z92B 4XTMA 1YRZA 3I4IA 4GWMA 2DBIA 1DGRN 4LO7A 4NPRA 5DAVA 4CP9A 1FMD1 4CXXA 2FQPA 1FOD3 1TZOA 2ZGSA 5DUWA 2ZOEB 3ACGA 2V5YA 4B7EA 2VZVA 3POFA 2JG9A 1BLZA 4XBQA 5T5JA 2PHDA 2AEYA 3MW4A 2GP3A 4A7ZA 4AHZA 3KWVA 4H7MA 2Q5TA 1NZCA 4J25A 5LASA 4EV0A 3H1YA 4ASKA 1HX6A 3VDDA 4Q4V2 3KCYA 5FYCA 1IKPA 1QJX3 4N53C 4MGSA 1QOSA 4KQ7A 3KB5A 5A1FA 1VBB3 2DVGA 3ACLA 4WZCA 1RUJ3 4QXCA 5I0SA 3Q8FA 1ENRA 2BEOA 2F4PA 3AYEA 3FUOA 5A3OA 3RG0A 4D6SA 4DXTA 2ZCWA 4P9LA 5LBBA 2DBNA 4B3NA 5K7PA 1J3PA 1W6OA 3N9NA 4ATEA 1G9DA 2DTWA 1MVEA 4M3CB 3H1WA 3WF1A 1BMV2 3B69A 3R4SA 1GQHA 3AK0A 4UW3A 2K0GA 5GKAC 1UXZA 4CZSA 5ERLA 3AKSA 1SG3A 3DEMA 3V64A 1QJX1 1IOAA 3E5UA 3V0AB 5C70A 1K12A 2IFRA 5FYSA 1JYIA 4AEMA 2FDHA 2FDIA 1VBB1 5FP7A 3OBRA 5FP9A 5J36A 2QQLA 2QQOA 1OURA 1R1A1 1RUJ1 1B35C 3ZYJB 1K5MA 3FBMA 3I2FA 4FSJA 4YRDA 4IUGA 1AF9A 2P3KA 4LT5A 4JQRA 2VGDA 4AZZA 1C1LA 4XFBA 4XIOA 1ENSA 4Y22B 1AYN2 1DCSA 1OLQA 4FPCA 2RM22 4JCKA 4NJ4A 1WW7A 2I2SA 3ILRA 1W0OA 4PIYA 2UWAA 1AR81 2SBAA 4Z8BA 5K9YA 4DEVA 2WL1A 4S2DA 3SKJE 5L7OB 1PZ7A 4AVCA 1JYCA 2GNBA 3H0OA 2IXIA 4XC9A 2Q1ZB 4ISRA 2BJSA 2D93A 2P6CA 2WT1A 3OUHA 1JS9A 4GWIA 1RUOA 1VBE3 2IVJA 3FHAA 3VL9A 2C9AA 2Z79A 5FZHA 4ARYA 3L2HA 3VKFC 3BKZA 4AFAA 2ZGLA 5FY0A 5A80A 1ASJ1 1ONAA 2DUPA 2EXKA 3UK9A 4K8FA 4DXRA 1PVXA 4RS5B 3LA7A 2D6PA 5AVAA 2OZ6A 1MS4A 1QGLA 4QM8A 3MIBA 2YUEA 4AQSA 4XZPA 5E16A 1CZSA 1QQP2 1OUXA 3HR9A 4XQDA 3NKGA 1WMEA 3HT2A 3LIGA 5F32A 5ACA1 3MF6A 2WT2A 1VBE1 3PL0A 5FXVA 2ZEWA 4ZXEA 2ETEA 3CLPA 1AJKA 2QQIA 5FYMA 4AI8A 1Q8OA 3K4DA 4QDSA 5BNPC 4XUNA 2BYVE 3E1F1 4UW5A 3E5QA 4MOAA 4CPBD 1RUC2 4V2WA 3LA3A 2VULA 3H7YA 4KGQA 3HBKA 3VDCA 1HQNA 1O3TA 1WA4A 2BNMA 1MZEA 2PMWB 4IDZA 2QQJA 4URAA 3BUCA 2HWB2 2C9KA 3OJBA 3RVHA 3W20A 1IGOA 1XBFA 1SCRA 1ULFA 5F3CA 1GOHA 1LKNA 2Y64A 3AP5A 4IEWA 2OPWA 2VMGA 4NHXA 1JI6A 5DZFA 1GP6A 5C3RA 2AZ5A 1YI9A 2WC2A 3LDKA 2R1DA 1BZWA 1I5ZA 5F5QA 4XF3A 3F2ZA 1VMFA 5DZGA 3KT1A 3S30A 3I59A 2QQNA 1LULA 1QF3A 1XPWA 4BQWA 3CJIA 4Q2FA 2WUHA 2JDKA 1O4TA 1SACA 2ZABA 1W9FA 4AGGA 3SCHA 4JKKA 4AEDA 5C3OA 1OFNA 3NQHA 2XJVA 3CIHA 4Z1VA 1CESA 1W2UA 3B02A 2OKXA 4XF9A 3GCXA 4ZONA 4YZ1A 3BTXA 4MHRA 3RYRA 2NYYA 3HNYM 3OYWB 4TN7A 2RV9A 4K1YA 3LDRA 3IAPA 1PK6C 1URXA 4AF9A 3OBZA 5E8AA 1YYNA 2E53A 1AR62 4XILA 3I2GA 1RINA 1W8ZA 4CP0A 2HJIA 4YW6A 4MX3A 3UJQA 1AR92 1UWWA 4XETA 3O1PA 3BU0A 4S2GA 4OQ8A 3PDQA
chains in the Genus database with same CATH topology
4FBFA 4YGDA 4CRQA 3O0WA 4GH4B 3H8UA 2PLV1 2VVFA 4C1XA 1EYBA 1YI7A 1XYOA 5GALA 3EHKA 1RITA 1POV0 4X8NA 3NO8A 2YGLA 4FO9A 3TBDA 4C91A 4XJUA 1HV1A 4I2OA 4MGKE 4URTA 1CR7A 3V65A 3VN4A 4CEYC 3TN93 5JZGB 4B4QA 4Y4YA 2GN7A 4BLIA 1AL23 4FOQA 1ZZCA 4W6YA 5I0TA 1QJY2 1DYPA 2XLGA 3LAGA 1O5LA 2R073 4QPGA 3M3QA 2BW8A 1KJLA 1F31A 1CAWA 3UKNA 4QQ2A 2PELA 4PF5A 4XPVA 3LSEA 2VPVA 2XL7A 1OLRA 2WNVB 1G9BA 5BPXA 1AJOA 2XUMA 5JPNB 5A33B 1V6IA 2Y0IA 2R6QA 4LR4A 4AFCA 3RYPA 2O1QA 1Z7S2 2DV9A 4RGGA 4DINB 4XHXA 2R071 1F5JA 1S55A 2WLPA 1SLAA 1I3HA 3AZXA 4N43A 1RL3A 4GULA 2WWSA 1G9AA 3OCPA 2GC1A 2JG9C 5JCTA 2EXIA 5IUQA 4N9IA 2R042 1V6KA 1TME2 5EV7A 1BXHA 3AJYA 1FNZA 3HBZA 5CA6A 5T5OA 3VDDC 2JICA 4DNYA 2FMDA 3ZFGA 5CFCA 1PHMA 4JGZC 5KHHA 4RHV1 5H9QA 4YVSA 5LRRA 3WP6A 4XF4A 3IM0A 3KM5A 1UW8A 1DQ1A 4OI1A 2NMOA 1V6NA 1FX5A 2QCSB 3B94A 2P17A 1RUE2 2OVUA 2OPKA 2O8OA 2ZX4A 3AFGA 3RQ0A 1XNBA 2GN3A 4WVVA 5HI0A 1C28A 3NVCA 1HRI2 3H3ZA 4LUMA 3UJOA 2GNMA 5FO7B 4I0WB 3JD73 3B93A 3WVJA 3M3IA 1I9RA 2TBVA 1J1LA 2HWC3 3ME2A 1FNYA 3MFAA 2RR12 2OYZA 4CDXC 1NXMA 3SH5A 1RMU2 2DVAA 1K5MC 3LKJA 4A2UA 4IEXA 3AKTA 1CONA 4RR3A 2A5ZA 2D6MA 2VNRA 3ILNA 2X53S 2PQQA 1W6OB 3GHNA 1N1TA 1PGL2 1U0AA 4YVWB 3RZZA 3VBUC 4Q4V3 4WM7C 4LO6B 1LB2A 3JD71 4OVEA 4MXVA 1DGWA 2HWC1 1NLRA 5FCCA 3USSA 3ZDSA 5K0UA 1NCRB 5EJ3A 1R092 5GZCA 2EXHA 1N3PA 3EBRA 2LUWA 1FMD2 1I1EA 1WW6A 3GF6A 2GAUA 5FOJB 2Q8OA 3ZFFA 4D69A 4EN6B 2B7YA 2GU9A 2WKKA 1S2BA 2PAMA 1Y7BA 4RQPA 1C5HA 1R083 4C0BA 1QJU3 3VBHA 1UIJA 3AP4A 4OHYA 2DWRA 3VZOA 1MACA 4B4PA 4FT8A 1ENXA 2A3XA 2O8QA 4LO5B 4EROA 2JECA 2HYKA 2FHRA 1QWRA 1UCXA 3ZSEA 5DDJ3 2R49A 2H0VA 4IEQA 3WXPA 3IPVA 4M3CE 3AFKA 1QH7A 2KA3A 1AL0G 4L2NA 4AEJA 1YCIA 3ZYGA 1R081 1SBFA 1QJU1 2BFUS 3DV8A 1S0FA 1QJX2 1LTEA 4OFGA 2ZGQA 2WNEA 4FPEA 4CDWA 1UZYA 1AXKA 3TRSB 2GNDA 2WZR3 1VBB2 3MFCA 2P3IA 3CJIC 4JVAA 3UL2A 1RUJ2 1SMVA 2DFCA 3MIDA 4Q0PA 2ZKNA 3TNPB 4X8PA 4ZXKA 2XGXA 3AMHA 5DDJ1 2FBEA 4PLNA 4AEDC 4DRRA 3SCGA 4E9KA 1GZWA 1F2NA 1XYNA 3GYDA 4NWVA 3QH6A 3SISA 3ZIWA 4DMIA 1RUI3 4ONUA 5SV8A 4YSFA 1QQP3 4QX5A 1VBD1 5J96B 2Z42A 5AVPA 4XDQA 1SCSA 4Q0QA 1OQDA 4CDUC 1LECA 2DYCA 2UY8A 4LBQB 1N47A 4LHLA 2QZ2A 5GLVA 3NAPB 2ZGUA 5HCFA 2RJKA 4NOTA 1IZ3A 5T5LA 3NWKA 5CB7A 4I30A 1RUI1 3FFQA 5DUVA 1LGNA 1AR71 3TYJA 4Y1VA 4GIQA 1B09A 2AH2A 2SLIA 3HAGA 3P3PA 2HWF3 3VGIA 2JJ6A 3ZN6B 4LBJA 4N53A 4QQHA 1Z78A 2DUOA 1UL9A 1VBE2 5KWRA 1S0BA 3U11A 2VW1A 1LOAA 5EZWA 4JGYC 4QXKA 5DZEA 1WLCA 1LHUA 1UKRA 4H55A 5FLHA 5J3UA 4Z2WA 2ZGTA 1POV3 1S1AA 4QGLA 1WCKA 2XKPA 2WA3A 1WMFA 1IQAA 1PVC1 4IV3C 5JSRA 4I0AA 4ZU5A 1CAXA 1PO11 2VVDA 3ZX7A 4YG6A 1J59A 3USUB 1CJPA 5C4WC 2E51A 2CGPA 1LOEA 2HWF1 2GC2A 4XFAA 1HXS3 4YLZA 1NLSA 3BOWA 2ARXA 3R0RA 1V6JA 4LNVA 4QPGB 5BNNC 2PTMA 1B35A 3IDCB 4AHXA 1POV1 3OY8A 1CAWB 3ZSMA 3ZIXA 4OI4A 1S0CA 4E4SA 1YHFA 3CF6E 1Q8PA 2E7QA 2EALA 3ZFGC 1OKQA 3ZN5A 4COZA 2IFWA 2X5IB 4M0HA 2OIIA 4YVSC 2TUNA 1HXS1 3PVEA 3NV1A 1V6MA 3VKOA 3OD4A 3GZUC 2ATFA 2YDEA 1Q56A 1HDKA 3JBG3 4HKOA 4W6XA 4N43B 1HQLA 2IWGB 2PHRA 3QLQA 1RVF3 4J1XA 3PMSA 1UX6A 3WP3A 1ZM1A 2PLV2 3R4DB 1H8TA 3SH3A 5J7MA 5DG2A 3N3HA 4Q26A 5HCBA 1JXNA 5CFCB 1BVP1 2A6WA 3DKWA 1Q43A 3BODA 2BNOA 4IEVA 1FYUA 3VBRB 4FPGA 2I07B 4V1PA 4YZ2A 1U5XA 1DG6A 4H14A 3JBG1 1QDCA 5HBAA 2BNNA 1QU0A 4TSVA 1RVF1 1O7FA 3J8F1 2W52A 5BNPA 1HQWA 1LEMA 2EIGA 5LK7B 3LWCA 1RJ7A 3H9AA 4AHWA 2MEV3 4LO4B 1ZBE3 2R043 2ZHNA 5E1RA 4AI1A 1VBC3 2W08A 2CL2A 2YPJA 5K8SA 3O5SA 3AB0A 1CIWA 1UIKA 2WINB 3JUUA 1XU1A 2VG9A 1BKZA 3QD6A 2A71A 2BGCA 3TN92 4AWDA 2ZAAA 5DUXA 2D3SA 2G9FA 4YFWA 4OI0A 3VHPA 4AI3A 1XRUA 2R072 4RR3B 4D94A 3VKLA 4HN1A 4Y20A 3WINE 3ZFFC 1GQGA 2DVDA 1ZBE1 4RD7A 2IXLA 1VBC1 4KU7A 4AW7A 4Z07A 4K21A 5CAZA 1HRI3 2B9UA 4COWA 3M3CA 3WG2A 1O3SA 2UY9A 1TMF3 4YW4A 4QU2A 3N7LA 1PK6A 5C9AC 2ZHLA 3APBA 1TNRA 1ND2B 4YM0A 4GMP0 4L11A 2ZHKA 1H2KA 5K0UB 4GWNA 3C3VA 1TQ5A 4R52A 1M4WA 3QH7A 4QQPA 2PA7A 4D7YA 3ZYRA 3D4KA 3DPRB 1CAUA 1JHNA 4Q1RA 4E4ZA 1F8VA 4XF1A 3W58A 3GBWA 2BWCA 5CG9A 1LHOA 4BLJA 5A3MA 1C8NA 1VRH1 4HMZA 4RQPB 3TAYA 1TMF1 3B5LB 3VBHB 4CDWC 1NCQC 2V09A 3ZSKA 1QDOA 5JLVA 4BPZA 4YGBA 2VOWA 4KG0A 4QHBA 3O12A 1UAIA 1KITA 3POSA 3JQXA 1S0GA 3VL8A 4EN0A 1D4M3 4R8HA 1FATA 2I45A 4WM8B 1PO21 1NA1C 5FDBA 4TZDA 4OUSA 5HCAA 3IPVB 1BEV3 3HT1A 3AJZA 4D3WA 2JG8A 3RI8A 2JE9A 5LRSA 5E88A 1KRIA 2C5DA 2ZS6B 4M3CF 3BB6A 4B29A 1FV3A 4XXAA 3JD72 4U2AA 1JW6A 2HWC2 3I8TA 2A6VA 4YZ4A 4C1WA 2ZMKA 4HETA 3WDYA 1NE6A 3GBGA 1V6OA 1D4M1 1V9U3 1LJ7A 3LOBA 4HVQA 4DFSA 4QQOA 3MIEA 4BE3A 3A4UA 4HT1T 3AXEA 1J3QA 1E57A 4L9BA 1BEV1 2EAKA 1JUHA 4PLMA 3UKTA 1QHDA 2RS13 1CD3G 3KMHA 4R4XA 4LLFA 4E2QA 5I93A 1LESA 5KBFA 1SFNA 2E7AA 2XBO1 3BOPA 1RHI1 3PJYA 3ZMOA 5CFDC 1TE1B 4JGZA 2B46X 3WUCA 2QKDA 3B9IA 1GV9A 1DGLA 1DIWA 3DL3A 3N4MA 4Q4Y3 2RS53 3FBYA 1RUF3 1R1A3 1V9U1 5IK5A 4DS0A 2G4IA 4XFCA 2XWJB 2RS11 3ZXEA 1Y43B 1GANA 3PMEA 4B4RA 5AFBA 5AC91 1F9KA 3DN7A 1AR83 4H3WA 2ZGNA 1ZA4A 5JMCA 1R082 1QJU2 4N53B 4P14A 1W6NB 4HSJA 4W6WA 2UWBA 4NN0A 3A0NA 3MGUA 4Q4Y1 1O3QA 2VUJA 2RS51 1RUF1 3AYAA 5EFUA 4CDXA 3SITA 4Q8LA 2H6CA 3D6EA 3AXDA 4GB33 3CJXA 4ES9A 1ASJ3 1YFWA 1OQEA 4TYSA 1CAXB 5DDJ2 2YXSA 4Y24A 4MGZE 3LOIA 2ZGRA 4EN8B 4BMEA 1UU5A 5JOXA 1DZQA 2XKOA 3VBUA 4AYUA 1WLDA 4WM7A 4EN7B 5ACA3 1MVQA 5JPMB 4P9GA 4PIXA 1QXPA 2VW2A 4EN9B 5L73A 2WZR2 4FOVA 1B35B 2H6BA 4GB31 5ABJA 3OY8B 3MW3A 2PYTA 2VH9A 1H8TC 3WD5A 5CIRA 4KGGA 2XWBB 4L92A 2NZ9A 1AUYA 1ZVFA 4HVOA 1DBNA 2WNUC 1RUI2 1AR72 3OGJA 2JEMA 5C8WA 4I3GA 1AXZA 3M3OA 4WVWA 5GZEA 3CO2A 4I02A 5JIUA 1CAVA 4I09A 5F1RA 4SLIA 3JCIA 3AZWA 2XB6C 4PBPA 2IXHA 3IKWA 4ITCA 2RHPA 2A7AA 4AVVA 1XE7A 1W6MA 1WD4A 3ATGA 4IETA 3ZYIB 4ORFA 2RMU3 4FP3A 1PVC2 1PO12 4FAGA 2PHXA 2MPFA 4YGEA 2D3RA 3OBTA 1QMJA 1A78A 3IDEA 4GKXA 2RS33 2QDNA 2QQPA 4WVZA 2HWF2 1EV13 3ILFA 4OHWA 3SHRA 2E7TA 3ZXDA 2HEVF 3VV1A 3D0JA 5C8CA 5BNPB 1XU2A 2GH8A 4BIFA 4YM3A 5FQ0B 2PLV3 4LBMA 1DU3D 2RMU1 3AKPA 1DYKA 3QCWA 5GM0A 2QE3A 3MPPG 3V0BA 3ALQA 1SLLA 2RS31 4AQ2A 3FLPA 1EV11 1I6XA 2CWMA 1N3OA 3WX5A 1HXS2 4Q1PA 3VZLA 1ULDA 5FREA 2VOKA 4CDUA 1RUNA 2NQYA 5JI7A 1WGPA 1CX4A 4QT6A 1YO8A 3ZO0B 1Y3TA 2JE7A 2XJUA 4Y20B 4LUKA 2OUHA 1LHVA 5J98B 5D8AA 1H0BA 3WOGA 1RUG3 2D6NA 1KD7A 2WA4A 1ALYA 4O9EA 2E6VA 3EQEA 3KGZA 1H9WA 2W0XA 2CNAA 3WDWA 1QOTA 1JBCA 1PK6B 4GMP3 3J9SA 1PZ8A 4I0BA 4PJYA 4XE9A 1DQ6A 3VUOA 1NOVA 3RS6A 3JBG2 4JGYA 1OI6A 1PIV1 1CAUB 1RVF2 3VBFC 3J8F2 3ZXJA 1W6PA 4HLTA 2B39A 4JDNA 4IQPA 1C5IA 3KGLA 3VBSC 4IV3A 1RUG1 1OA3A 2JG8C 4UBHA 1UN1A 3OGGA 3VZKA 1GZCA 4YARA 4XYXA 5C4WA 1AX0A 1O4YA 2TNFA 4GMP1 2PHFA 2R061 4QPIA 4CEYB 4RHV3 4QGMA 1VAVA 2C1FA 5EXOA 1CGPA 5F6LB 2A70A 1KFUL 5BNNA 1EP0A 1AXYA 4ASLA 4BZ4A 4QM9A 4F3JA 2GC3A 4FPKA 3MDPA 3FLRA 2MEV2 1DZTA 5CVRA 5EYYA 1ZBE2 4INDA 4G4FA 4BHPA 1VBC2 4Y1XA 3O7OA 1DZRA 2DU0A 5IK4A 1Z0HA 3WW3A 1CJDA 4FXGB 1AX2A 4X6RB 3IIAA 4GALA 3HN1A 1NQJA 4AQ6A 4S2FA 5KXDA 2K2SA 2JG9B 3AZVA 5FTTC 1H8VA 2ZMLA 5EYXA 2ZZJA 2ZHMA 1MEC3 3NJZA 3BTAA 3JB8A 3VDDB 1ZYBA 3R4UA 4GA9A 1VRH2 1X50A 4JGZB 2VNOA 4WVMA 4XBLA 1H2MA 1TMF2 3SMHA 1QH6A 2N7GA 2B5HA 4CDQC 3MLLA 2DCJA 3H50A 1PGW1 4Q4X3 5FFOC 2R16A 4ISQA 3ZSJA 3PVNA 5E89A 1C1FA 2G9GA 2ZX0A 1QKQA 3AMNA 2BVVA 2OW4A 4J6GA 4COVA 2GZWA 1AX1A 1PO22 3WW2A 1SLBA 2VW0A 4IL7A 4IV1C 1N1YA 1SBDA 2D40A 4SBVA 4LBKA 3LZZA 3WP4A 1MEC1 1S2KA 4JAAA 1G7YA 2NLRA 5BNQA 2BWAA 3TB0A 3DGTA 2Q1MA 3IMNA 4JDOA 2UWCA 1V00A 3AKRA 2D98A 1DF0A 2HEWF 1ZZBA 2ZA9A 2XJRA 4CDXB 1UZZA 4QD2A 1YFXA 4DZGA 2VOXA 5ABJC 1IKQA 3C2UA 4Q29A 1K5MB 4Q4X1 1HRV1 2WIIB 2ZTNA 4DXZA 1D4M2 3KZ4C 2NM1A 4GQ7A 1VP6A 4FOWA 5BNOB 1A8MA 1H9PA 1BEV2 1C57A 4HK8A 1X82A 4DY5A 3VBUB 1NE4A 4MLOA 4WM7B 2XBO2 4D7TA 4PCRA 1RHI2 3SXWA 4YG0A 4AK3A 4XEZA 4YW3A 5C9AA 3D82A 4OZXA 5BYNA 4P9XA 1V9U2 5A3LA 1O5UA 3FJSA 1XYPA 5I8TA 2GALA 4P9JA 1LU1A 4IEUA 3NL1A 4K1ZA 2RS12 3ZFEC 3ZSLA 5AC92 5B2GB 1VBD3 5I91A 2XPJA 4GXLA 5JSOA 1H1IA 1CAVB 1NCQA 4AGRA 1ZRDA 2YYOA 2LM3A 5C8CC 4MH0E 4Q4Y2 2RS52 1RUF2 1R1A2 2D7FA 1YUDA 3OD0A 1W6MB 3AYDA 4RSUA 3PVOA 1C8M1 3KT7A 1D0HA 3W9AA 5T3NA 1FAYA 1NA1A 2W39A 5JWPA 2DCYA 3RNSA 1UPSA 1EY2A 2DTYA 1AR73 1AR82 3H3UA 3M4FA 3LB9A 3GALA 2DVFA 3T2TA 5KC5A 3GBFA 3WDUA 4W65A 4B7KA 4HZFA 3I59B 3CJIB 2Y38A 1YIPA 3AZYA 1OSGA 3GNEA 3I7DA 1AYN1 1ND3C 1WBLA 4GB32 2RM21 3QBQA 5D8AC 3K51A 4YW5A 4YW2A 4AEDB 2H0BA 1ASJ2 3PLQA 1PVC3 4R9BA 3THPA 2GC0A 1PO13 2VOVA 2CY6A 4KH9A 3QACA 4Z82A 4C0HA 4MYEA 2D44A 3V0BB 1YJKA 3A0KA 1Q8QA 3ZYPA 1KS5A 5IT6A 1X7NA 1ULCA 5CFDA 4PDWC 5ACA2 4AVSA 5IK7A 1ZRFA 1TEIA 2YY1A 3ZXGA 2Z5WA 1WUVA 5FMOL 3FMGA 1GR3A 1JUIA 2GMPA 2ZGOA 4RL7A 5J48A 5L19A 1IS3A 4FPFA 1VB2A 3ECQA 2WSVA 2IC1A 5BY5A 5GZGA 2R1BA 4QPIC 3V0AA 1VBA3 1EAH3 5C6CA 3O0XA 4UW6A 5AFEA 4AFDA 2KXLA 1W6QA 2X8KA 2CWSA 4ASMB 2EF6A 2BVBA 2QFEA 4JGYB 1VB4A 4P9IA 2XJQA 5JDBA 2Q30A 4HKWA 1FPN3 1W6PB 1VR3A 5KC6A 3BCWA 4IV3B 2DUQA 3RRDA 2RMU2 2XVKA 1AHSA 2X29A 4N7UA 2QZ3A 2CGOA 1VAKA 5C4WB 1MS9A 1VBA1 1EAH1 4NR1A 3RSJA 5A32A 2RS32 2ZZQA 4LO8A 1MQTC 2BBVA 1EV12 4WBBA 1ULEA 4P9YA 2VMHA 5GLWA 4NHKA 1RJ8A 2A3YA 3ZXAC 1CN1A 5BNNB 2WFF3 1FPN1 3J8F3 4Y5Z0 1MS0A 3ZMNA 4P9WA 3EJKA 2BPA2 1DQ5A 3U4XA 4META 5GZFA 2CGNA 3PTYA 3ZFGB 4AVAA 2WNUA 1G9CA 1N3QA 1AR91 1LOCA 4KG8A 4YVSB 5FPZA 1ZZ9A 3MPBA 3RJ2X 3BIWE 1RGSA 2EVXA 2CV6A 1ZREA 1D0GA 1ZBA3 4XFIA 1UPIA 2WFF1 4NHLA 1L3JA 1PIV2 4R9CA 2ZAHA 1C3HA 4Q8KA 3J26N 5T55A 1IPJA 1RUG2 2ZPXA 2AGSA 1RTVA 3KLSA 3WHTA 1WD3A 4WVMB 3VBOC 3KCXA 4XJZA 1O4ZA 4Q0UA 1WCDJ 3POWA 1DGWX 4AE2A 2XVLA 1ZBA1 2JENA 1QXRA 4ATFA 2A6ZA 1OOPC 4N9HA 2B45X 2VU9A 1H1MA 1Y9QA 2DCKA 1HIXA 1H4HA 2VMIA 1ENQA 3UV9A 1FI2A 4E27A 3URFA 2UURA 3MW2A 1VRH3 1LOFC 4PBOA 4TWTA 4M0NA 2NMNA 1ZZ6A 4AVTA 2HKXA 3FC0A 4RHV2 1QNWA 1FT9A 4ZKTB 4ES8A 2EA7A 4HFSA 1GLHA 2PHUA 4OLLA 3E97A 2OUJA 4KWLA 2WZPP 1H4GA 3NV3A 4IEZA 1HKDA 2CYFA 3ZFFB 1PO23 2YGMA 4AGVA 4FQZA 4M01A 3M2MA 1LGCA 3NKTA 4FPJA 4FTSA 1D2SA 2YROA 3B3QE 1F5FA 4IXLA 1MS8A 3I54A 4CEWC 1LOBA 2ZX3A 2ZBJA 1YWKA 1A3KA 5C9AB 2ERFA 1VIWB 3O14A 5KHIA 3AP6A 2GMEA 3WV6A 2ZGMA 1U12A 4WM8C 1W0PA 3VHRA 4XW3A 3CEWA 1PGW2 1WBFA 2UU8A 2KM2A 4MVTA 3SNMA 1BVVA 3VBFA 1WW4A 3FUQA 5JIAA 4LEJA 4P5HA 3WHUA 3VBSA