3KH0A

Crystal structure of the ras-association (ra) domain of ralgds
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
102
Chain Sequence
b'NLYFQGNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ral guanine nucleotide dissociation stimulator
publication title Crystal structure of the Ras-association (RA) domain of RALGDS
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 23
structure length 102
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3kh0A00
3DVGX 4KVGB 4TUUA 1JRUA 4GU2A 1TBEA 2DYBA 3JSVA 3R7RA 3UGBB 1QZEA 2KVRA 2L05A 2O6VA 2N9PC 1Q0WB 1YX6B 2KHWB 2YVCA 5AZFA 2KX0A 3HM6X 3PGEA 3RCZA 4ANVA 2FIDA 4RM9A 3L08A 3VTVA 3R3MA 2NCNA 2KJ6A 2JF5A 3EHVA 3PHXB 1V86A 5IA7A 2ZZPB 2KNBA 2L8JA 4G0NB 4MSMB 4XC2A 3PSEB 4BOSC 2MLBA 4HDOA 1MG8A 2L3ZA 3ZLZA 2L76A 2M17A 2GMIC 1WMHA 3A9JA 4PS8A 4EUTA 4ZRJA 1Q1OA 2UYZB 2HE7A 3HK0A 3OJ4B 4AWJA 5LXIB 1J8CA 2JT4B 1UBQA 2BYFA 2AL3A 3V60A 4MH0E 3KUZA 2BKFA 2K39A 3DVGY 2D07B 4K81A 4ZDVA 2J0MA 4FLHA 3R7QA 3B08A 1E5WA 1WJUA 4EFOA 1VD2A 4MGZE 5DPSA 2ZCCA 3A1QB 3NZSA 4OVVA 2JZZA 3A33B 1Q5WB 2G45B 4IWQA 2C60A 1WXVA 5EDSA 3WALA 4B9KA 1WGHA 4B95A 5CHWA 5BO4B 3OLMD 1SGHA 1WX9A 1OEYA 2JY6A 2QHOA 2LRWA 2MRPA 5AZGA 2J0KA 2M0XA 2KX3A 3SDLC 2PJHA 1K8RB 2UWQA 1P9DU 4YL8A 1J19A 3UQBA 1KJTA 3L0WB 4E74A 2KZRA 4G3XB 2BYVE 2PEAA 1WIAA 2KJHB 2XK5A 4NJ6A 4TQ0A 2A4ZA 1SE9A 4ZRIA 3OJ3A 2O2VB 3TBLD 3X23A 5L95C 2KKCA 4BKSA 2MBHA 1Y8RC 3DCGA 3IBEA 4NNJB 1PQSA 1L7YA 2FCMA 2WYQA 3VHTC 2N4FA 3RUIB 3TJPA 1P3QU 4PS7A 4AP4C 2KTFA 2DENB 3IFWB 5J18A 4ANWA 3AI5A 3U30A 4DHZE 2KLCA 2GBKA 3EECA 4ICUA 3H6NA 2BF8B 2OJRA 3PRMB 3CF6E 2K8HA 2JZ3B 2KDBA 1WX8A 1ZW7A 4MGKE 2NBUA 4RMAA 3WANA 1D3ZA 2DAFA 2LUEA 2PE6B 4KV2A 3KYCD 4W9IA 2K1FA 4ZRKA 3DPDA 4PS3A 3W1SC 3NY5A 5D7GA 2LGXA 2AWTA 2OOBB 5DPTA 3UINB 5HKHA 2KK8A 2C9WB 2N7EA 2ZVNA 1WXSA 2D11A 4OVUA 3QQ8B 4KSKC 1E8WA 2J7QB 3H7PB 2I1KA 2LZ6A 4KIKA 4W9KA 4MSQB 1WZ0A 1M94A 1P98A 2FNJB 4DWFA 5JHBA 2LVQA 3S2AA 4WWNA 3A9KB 1X1MA 4BKTA 3L13A 4K7WA 4FBJB 4W9JA 2IO0B 2KANA 1WM2A 1WYWB 1UD7A 2BPSA 3QIJA 1WGGA 3ZNHB 1WX7A 3HIZA 3MTNB 2KC2A 4NQKE 4XX5A 4II3B 2PE9A 3WAPA 2L0TA 5AEKB 1I42A 2KWVB 2GOWA 4NY0A 1S3SG 4HCPB 4ZYNA 2IO1B 4W9GA 2KQ7A 4HWIB 2IY0B 3CSFA 4K7SA 4FJYA 5FR6A 5LLIA 4NQLB 1EF1A 4WWOA 2ZPYA 3RZFA 3PLUA 2KN5A 3UIPB 3RZWC 3ZW3A 3IHPC 4E3CA 4P7IA 2N9EB 1UZXB 1RRBA 3UF8A 4WJQA 4AJYB 2RSUA 4CHKA 1E8YA 3DBRI 3RD2A 1RAXA 2M8SA 3AU5A 3L17A 4HJKA 3P2BA 4M8MA 2KMCA 3N3KB 4JGHB 1YD8U 4X57B 3PV1A 3DBLI 1KLVA 4FN2A 4GGQA 3DVNV 1WR1A 4IM0A 1NI2A 3M63B 2MWSB 2WDTB 3KH0A 3ONSA 3TIXA 2KDIA 1R4NI 1E90A 1FXTB 3AULA 2WWZA 4GDLB 4BFRA 2K6DB 2KWCA 3N30A 3GZNI 4DHZB 2L7RA 3V6EB 1BT0A 3JYUA 2FAZA 1GUAB 4BOZB 2AYOB 1IYFA 4HK2A 1C3TA 4GDLA 1WJ6A 1WXMA 2KOXA 4FULA 4BKGA 1WZ3A 2NBVB 2DAJA 1SIFA 2K8BA 1WGYA 5DPRA 2GBJA 1LQBA 4WJNA 1ISNA 2A5UA 2IO2B 2K6QA 4I6PA 5GMVA 1CMXB 3ENEA 2V3SA 4KZCA 1YQBA 1GNUA 4DHJD 2NPTB 3MHSD 4II2B 4FJZA 3DQVA 2R2QA 3ZIMA 4JIOU 3QA8A 4AUQC 5L83A 4NJ7A 4KZ0A 3ZNGC 1TZ1A 2NBWB 3ZVVA 5TR5A 4GDKB 2BYEA 3CMMB 4IUMB 4JLCA 4MJSB 3AU4A 4W9EA 4M8NA 1WJNA 2BGFA 1NBFC 5J2RA 3EC8A 2BKRB 3A1QA 2C7NB 3BY4B 3RT3B 4A20A 4GDKA 2AL6A 2BWES 5IAAC 4KDLB 3APFA 3ZNID 1J0GA 4TKNA 4NPNA 2O6VD 3DBSA 4EOYA 1NDDA 3VAWA 2KTRB 2DZMA 5CHFA 2DZJA 2NVUI 3ZDTA 2MBOA 2KO3A 3QC8B 3LDZE 3H9DA 2KLGA 1G6JA 4WJPA 4W9FA 3R66C 4I6NB 1E7UA 2G4DB 2LJ5A 3ZNZB 3L10B 2LVOA 2CHWA 2FIFA 2DZKA 5JHAA 5D94A 2K25A 3IG3A 3MJWA 4LJOB 4HVBA 4JQWC 5CX3A 3V61A 3VUYA 3VUWA 5C23A 2D3GA 1IPGA 1OTRB 4KSLC 4LJPB 2O2VA 2XBBC 1KOTA 2C7HA 1WI0A 2KDFB 4CYEA 3QCAA 4GMVA 2DYOA 5D6JB 1E8XA 4MGIE 4PYZA 1WR6E 2ASQA 3NS8A 4W9DA 3B1LX 1WFYA 4G50A 2JUOA 4MDKE 1V9JA 3ZTDA 3APDA 1R4MI 2IO3B 4AOFA 3D32A 4A3PA 2JXXA 2LI5A 4BBNC 1V6EA 1YIWA 4ICVA 4BVUC 2N7DA 4AJWA 2FUHB 3HHMA 4MM3A 2EMSA 2ZVOA 1OQYA 3V62A 3VVWB 1VCBA 3PRZA 1RFAA 2DHZA 2LRUA 1YX5B 2R2OA 2YLMA 2Z59B 3SHQA 3I3TB 3DOWA 3H7PA 1GJZA 2FCSA 2DYMA 3A9KA 3QHTA 3PS6A 2J0JA 3M62B 5D2MB 1V5OA 1WM3A 2MP2B 1EF5A 2N1VA 3JVZX 2MQJA 1LM8B 2LGDA 2KC1A 5JH5C 2MSED 1GG3A 1WXAA 3VH3B 1WF9A 2C5LC 3WA0A 4LCDE 4IWOA 4DHJB 2MBBB 4HXDA 2W9NA 3Q3JA 2ZNVC 3TL5A 5J17A 2KMAA 4IM2A 4BKSD 2LGYA 4DBGA 5DCNA 3UIOB 2G3QB 3W1YA 1LXDA 4PYUA 2M1MA 4E71A 3VTWA 2ZCBA 4G11A 3VQIA 2D2QA 1UH6A 1H4RA 4KDIC 3ZKJC 3K9PB 4LDTD 2GBNA 4GSWA 4N9F4 2GBRA 3C0RB 4IW0A 1EUVB 3PVLA 4FA6A 2JWZA 3VTUA 2D10A 2MCNB 2I1JA 4WWPA 2IYDB 2KXJA 3JSVB 3PZDA 3U7DA 2MBQA 2MA9B 2O6VB 3WIMA 4EEWA 4ANXA 1P1AA 2BWFA 4MEMA 4IWPA 3KVFB 4CO7A 3WAMA 3IVFA 5CTRC 1I35A 4I6LB 2C7MB 2WX0A 3RYTA 4DDGD 1Z5SB 2KQSA 3NZUA 1AARA 3VXWA 4GIVA 3DDCB 4FHKA 2ZJDA 1OEYJ 4DK5A 2IZVB 3PREA 1H8CA 3T8MA 3PHWB 3ZRFA 2JPHA 3EFUA 4A3OA 5LXHA 3QJZA 3QWZB 1T0YA 2LXAA 2Z0DB 1ZGUB 3A4RA 2KFKB 2ZEQA 3DVNU 1Z2MA 1E7VA 1WMHB 3A9JB 2RR9A 3K9OB 2NPTA 3DBHI 3KYDD 4DXAB 3KUCB 3PRPB 3H1UA 3ZO5B 4DDID 2KFKA 1V81A 4XZ4A 3M95A 4W9HA 5G2NA 1GC6A 1WRDB 4FJVB 1L2NA 3T9LA 1UBIA 4MJSA 4EKUA 1ZKHA 4HDQA 1UELA 3ZRCA 5E6NA 3V6CB 1TGZB 3AXCA 3SU8X 4NAWB 2K8CA 2LVPA 4IM3A 4HLEA 2NS5A 2CKHB 2L00B 3VDZA 3PLVA 2JRHA 1WY8A 5JZEB 2RD0A 2WX1A 3LJ3A 1U4AA 1WGDA 2KTRA 4NAWA 2HTHA 4FHJA 1XT9B 2KFJA 1A5RA 3ECIA 3X0WA 4JL9A 5G55A 3PTFC 2Y5BB 3QK0A 4URKA 3UQAA 2LWPA 4F8CB 2N1WA 4WJOA 2CHZA 1C1YB 3RULA 2KWUB 2XK5B 2CR5A 1IP9A 1YJ1A 2VRRB 3ZTCA 2CS4A 2FCQA 1V5TA 2RGFA 4W9LA 5E6OA 1WGRA 3VFKA 1UGMA 3GOEA 3Q3FA 3QX1A 5KHQA 1WJ4A 1XD3B 4GN1A 4B6WA 1RLFA 4IG7B 4HCNB 2PPHA 1V49A 1P0RA 3ALBA 1GC7A 4LDTB 2L0FA 1OGWA 2V4LA 3ZDMC 2CU1A 2B3AA 2JVCA 2DX5B 3QARA 4K1RB 3O65B 3KW5B 2LD9A 4F1SA 4WAAA 1XQQA 2N9XA 2MBEA 2CHXA 2Z0EB 1HE8A 2NR2A 1LFDA 3L16A 1EO6A 3OAWA 4GOCA 4M0WB 4EZKA 2EKEC 3W1SA 2HD5B 4BBNF 1KM7A 3QAQA 3VUXA 3HM3A 4KIKB 1WH3A 3NOBA 4TQ1A 4GB9A 2V1YA 2IY1B 3VH4B 3A4SC 5C1ZA 4ASWC 2AEHA 5E6PA 4EZLA 1V80A 1WE7A 3M3JA 2LXCA 3SD5A 3WAOA 2HJ8A 4W9CA 2MW5A 5CHVC 3U8ZA 5AZHA 4HPMB 2MP2A 2IBIB 3ZUNA 2REXA 4RM8A 3TMPB 3N32A 2FCNA 3JW0X 4EZJA 4FADA 1WE6A 3PT2B 3BINA 2MX2A 3ML8A 3PPAA 4K7UA 3KUDB 2XEWA 3ML9A 1TTNA 4F7ZA 1V2YA 3TCAA 2KJRA 4GXBA 5DPWA 2LASA 2EMTA 2ZNVB 4IC7B 3APCA 3CSTA 2KDEB 3B0AA 4MELA 2KD0A 3H7SA 3NHEB 2DZIA 2GBMA 1S1QB 2G4SA 4J6IA 1E8ZA 4TV3A 2M4NA 3L54A 2JRIB 4WQOB 1F9JA 5KHOA 4ANUA 4MGYE 2RPQA 2ZPNA 4HPLB
chains in the Genus database with same CATH superfamily
1TBEA 3UGBB 3U4EG 2KVRA 3BIID 2O6VA 2KHWB 3RNEC 2VZKB 4XWTA 5AZFA 4REZA 1K50A 1I4QA 3L08A 1L0YB 2WDVB 3TEWA 1F52A 2D3CA 1ROEA 4MSMB 4XC2A 3W9CB 1B1ZA 1PGXA 1XCQL 4R3DA 4BOSC 2MLBA 3NRZA 4HDOA 1MG8A 3C8YA 3AE9B 4ZRJA 3R2TA 2JT4B 2BYFA 2X8XX 1C9FA 3DVGY 4K81A 2V9HA 1VD2A 4MGZE 5DPSA 1ET6A 4ITKA 3MC9A 4OVVA 2G45B 2C60A 3WALA 1WGHA 5CHWA 3TSSA 1FFUA 3OLMD 1EU3A 1FCCC 2JU6X 1SEBD 1SGHA 1WX9A 2QHOA 1XLOA 2LRWA 2VH2A 4YL8A 3PO0A 1KRHA 3LB8C 4NJ6A 4ZRIA 1YMHE 5L95C 2WXMA 4BKSA 2MBHA 3ZGZA 1PQSA 1L7YA 2FCMA 2QCZA 3TJPA 4RGOS 3EECA 3NVYA 3MC8A 2BF8B 1ZW7A 1YJJA 4ZRKA 3NY5A 1V1OA 2OOBB 3UINB 4M0WA 1DOIA 2NTTA 2N7EA 3IAS1 4KSKC 2J7QB 2LZ6A 4KIKA 1ACCA 2FNJB 2KANA 3NVVA 1WGGA 1YJIA 1FMAD 3OG5A 4XX5A 3NZ3A 1S3SG 4M01A 1TS5A 1T0RC 1L6VA 2AX5A 4IDIA 3IHPC 3P4QB 2N9EB 3UF8A 3NJTA 1F2RI 1CJEA 2M8SA 3AU5A 4HJKA 3P2BA 2KMCA 1FO4A 3MP9A 4IM0A 1TKEA 1SE4A 2WXKA 3VRBB 1R4NI 4JWUC 2SEBD 4XDDA 3SEBA 3N1XC 2MEKA 3V6EB 2FAZA 3P1MA 1IYFA 4BKGA 2NBVB 4C4VA 3E9SA 1SIFA 1WGYA 3ZQ4A 5DPRA 5AUIA 2GBJA 1LQBA 2I2YA 1YQBA 1QOGA 1N5WA 4DHJD 2WP9B 3DQVA 1K51A 4JIOU 3ZNGC 1L0XB 5AUKA 2Y5PA 3ZVVA 2HDEA 1J7AA 3EC8A 1ZXHA 2QILA 4GDKA 2AL6A 4KX6B 2J53A 1JWUD 2DZMA 2WDRB 2MBOA 4WJPA 1ZE3D 4CQNA 3BK1A 1JCKB 3L10B 2DZKA 5JHAA 2BTEA 2IGDA 5D94A 2K25A 3OWEB 1P7EA 4JQWC 5CX3A 3V61A 3VUWA 1V97A 1LO5D 1OTRB 3GS2A 1WI0A 1TT5B 4OVZA 2LGSA 2ASQA 2K3UA 1ET9A 2JUOA 1V9JA 3ZTDA 3APDA 2IO3B 1F2RC 3D32A 1FRRA 2WLBA 4BBNC 1V6EA 1YIWA 1T3QA 2JYEA 1VCBA 2R2OA 3DOWA 2INPE 4S0RA 1FPYA 4USAA 3PS6A 2WXQA 2QEJC 3VR9B 2KC1A 5JH5C 1LGRA 3NS1A 1RFKA 2MBBB 4DHJB 3TL5A 4IM2A 2LGYA 4YSZB 3W1YA 1LXDA 4PYUA 1UWXA 4YTMB 4LDTD 2GBNA 4GSWA 4N9F4 1A70A 3PVLA 2JWZA 3VTUA 4L2YA 4FXCA 2I1JA 2QIEB 4TSSA 3RI7C 3U7DA 2MBQA 1N63A 3H8HA 4ZYSA 1C4PA 3WAMA 1T0QC 2WX0A 3RYTA 2KQSA 4KKJA 1AARA 1XLPA 3DDCB 1OEYJ 2KAJA 2GRIA 2JPHA 3EFUA 2Z0DB 3U7ZA 1ZGUB 3A4RA 2KFKB 1E10A 1WMHB 3A9JB 3K9OB 3UI3A 2NPTA 4RNAA 1D6EC 4DDID 4XZ4A 5G2NA 2DBYA 4MJSA 4EKUA 1N5XA 5D3IB 1RYJA 5D3DA 3V6CB 1GB4A 4NAWB 2LVPA 1F1HA 2CKHB 2JRHA 4NAMA 1MHHE 2KTRA 3AE4B 3X0WA 4JL9A 3PTFC 3BVMA 2Y5BB 3QK0A 2LWPA 1WRIA 1C1YB 3RULA 1VRAB 4RFBA 1SJHD 2CR5A 4WH4A 1L6UA 1C78A 3AE2B 2D3BA 3QX1A 1WWTA 1XD3B 3GE8C 3E56A 4B6WA 4IG7B 2PPHA 4LDTB 3Q3NC 3QARA 4K1RB 4WAAA 4C00A 2Z0EB 1EWCA 1EO6A 4GOCA 4EZKA 2H88B 4BBNF 3DBLB 4YXDB 4GB9A 1C4CA 1ZP0B 2IY1B 1E9MA 4ASWC 5E6PA 3WCQA 1FEHA 4W9CA 1DOXA 4HPMB 2IBIB 3NG0A 3Q6BA 2FCNA 2B76B 4EZJA 4K7UA 1TTNA 5DPWA 2L32A 3CSTA 1STEA 2W3RA 2KD0A 1QLBB 2DZIA 4J6IA 1E8ZA 2M4NA 1HEZE 3L54A 2JRIB 3AB5A 4KVGB 1MI0A 4TUUA 1ZDXA 4GU2A 3R7RA 2N9PC 4L23A 2K22A 3HM6X 4ANVA 2FIDA 3R3MA 2NCNA 2IGHA 2I38A 1V86A 5HFYA 1XF5L 5IA7A 2V3NA 2ZZPB 4HJGE 2KN4A 4K3BA 3PSEB 1JWBD 2L3ZA 2M17A 5G5HA 2GMIC 1N60A 4OZAA 1QILA 3RNCC 3OJ4B 1J8CA 2XN9C 3V60A 1UBQA 1BXTA 3ZJVA 3B2FA 2GB1A 4ZDVA 3B08A 1FRDA 3BVGA 4M02A 2IPKD 4OZCA 3NZSA 1Q5WB 4IWQA 1R4MB 1WXVA 5FR3A 1BMLC 4B95A 1OFFA 5EE3A 3KQ4A 5MPOA 3U2SC 2JY6A 2MRPA 3Q14C 5AZGA 2M0XA 3Q8EA 4RF0A 1K8RB 4TMAB 2K5PA 1KJTA 3R8BA 2KZRA 4G3XB 4E74A 2BYVE 2PEAA 1Y56A 3TUOA 4Q2JA 2KJHB 2XK5A 2A4ZA 1GB1A 3Q8BA 3X23A 4LNNA 1EU4A 1SXTA 2WYQA 3AE1B 2N4FA 3RUIB 2M19A 1V8CA 1Q10A 4MT5A 4DXFA 3AI5A 2KLCA 3PRMB 2KDBA 1WX8A 2NBUA 1IGCA 2DAFA 2LUEA 2PE6B 2K1FA 4JWSC 1JWMD 3DPDA 4PS3A 5D7GA 4MM3B 2AWTA 5DPTA 4XWWA 2KK8A 1WXSA 2D11A 4OVUA 4W9KA 3EGRA 2ICIA 3S2AA 4WWNA 1VJKA 5IKCM 1UWMA 1I4PA 4K7WA 4FBJB 2QJLA 4W9JA 2L1AA 3QIJA 1UD7A 3ZJUA 4WAFA 3W2DA 1TIFA 4A9AA 4DXGA 4YSYB 4II3B 3WAPA 2GOWA 1L4DB 2IO1B 4W9GA 3AV8A 4NQLB 1EF1A 2ZPYA 3PLUA 4E3CA 3RZWC 3ZW3A 1PGBA 1KFYB 2FE8A 4CHKA 5BYQA 4OHJA 2WU5B 3DHGC 1ZXIA 3N3KB 4JGHB 5HI1A 2WNMA 4X57B 2RDHA 2JZPA 3DVNV 1NI2A 3M63B 2YEPF 2MWSB 5EE9A 1SE3A 2WWZA 2QMTA 4GDLB 4US8A 2KWCA 3GZNI 2NTSA 4DHZB 1J7CA 2L7RA 2J4XA 1BT0A 3JYUA 1XEEA 3L4PA 1WJ6A 3ZXVA 4FULA 2K8BA 2WGSA 4AQ7A 2A5UA 2IO2B 2K6QA 4I6PA 4XGAB 3ENEA 3KWLA 3MHSD 4B0EA 1J7BA 5BMHA 4RGNA 4HPPA 2X38A 1TZ1A 1YN5A 4IUMB 3AU4A 4M8NA 1I4RA 1NBFC 3A1QA 4A20A 2BWES 2RDGA 1F77A 3APFA 3ZNID 2O6VD 1NDDA 1TZOA 5CHFA 4HKQA 2KO3A 2KLGA 3AE3B 2AQ3B 3R66C 4I6NB 1E7UA 1E0ZA 2LJ5A 3ZNZB 3MFGA 2CHWA 2FIFA 1B9RA 2KVZA 1WXQA 3HUIA 3VUYA 4S17A 4KSLC 2O2VA 2XBBC 1TKYA 3BYTB 3TEYA 4GMVA 2WXJA 1E8XA 4YTPB 4PYZA 3AEBB 3VRAB 1WR6E 3SFEB 4A90A 2PMVA 4A3PA 2JXXA 4ICVA 4AJWA 3HHMA 2ZVOA 4WURA 3DHHC 3PRZA 2DHZA 3LXFA 1YX5B 2YLMA 2Z59B 3SHQA 3H7PA 1GJZA 3NVZA 2FCSA 3A9KA 3Q3OC 4WQMA 3QHTA 4XYCA 2J0JA 1WM3A 2MP2B 4HKZE 2MQJA 1LM8B 1GG3A 4P1CC 1WF9A 2C5LC 1IBXA 1SBBB 2W9NA 3Q3JA 3DBHB 5J17A 4BKSD 3UIOB 4L1BA 3P4PB 2M1MA 3MHZA 4E71A 3VTWA 2ZCBA 2D2QA 1UH6A 4WIPA 4KDIC 2INCC 3HVDA 1MJDA 3C0RB 4IW0A 3RNAC 1EUVB 3SR6A 3T3NA 1I4XA 4WWPA 1DOYA 1YNTE 2O6VB 4ANXA 3ETRA 4MEMA 5CTRC 4C7ZA 2BS4B 1I35A 3NZUA 2WXGA 2WU2B 1H8CA 2KACA 3T8MA 2J52A 3Q2AC 4QAYA 4N6EB 2RR9A 3KYDD 3DBHI 3BZDB 3AM9A 3KUCB 3ZO5B 2KFKA 3B2GA 4B0MA 2FUG1 1WRDB 2M0AA 1UBIA 2D5GA 1KLGD 1ZDVA 3ZRCA 2LFIA 1FD6A 3SU8X 2K8CA 3RPFC 2RD0A 4NAWA 3P4SB 2HTHA 1FFVA 2KFJA 2BBCA 1A5RA 3AEDB 2JWUA 4URKA 3UQAA 2LHDA 2W54A 1GOZA 1FNUA 3AE8B 1IP9A 1YJ1A 2CS4A 3J9CA 1JQ4A 2R61A 4RH6A 1UGMA 1TJEA 1AN8A 2TSSA 2PVGC 1WJ4A 4GN1A 1RLFA 1AYFA 1NENB 1V49A 3ALBA 3RNFC 2L0FA 3ZDMC 2DX5B 1C76A 2J42A 3KW5B 2LD9A 2N9XA 3DBRB 2MBEA 4LNFA 1LFDA 4M0WB 2EKEC 1XXGA 2HD5B 2CJOA 1QKZA 4KIKB 4N58A 1WH3A 2PLPA 3AEAB 4TQ1A 1MG4A 5C1ZA 2AEHA 4GLSC 1V80A 2LXCA 2MW5A 4KGSA 3N32A 2WXHA 3JW0X 4FADA 1VZ7A 1WE6A 3C19A 2MX2A 3PPAA 4F7ZA 3DHIC 2LASA 3V05A 2EMTA 2ZNVB 2BS3B 4IC7B 3H7SA 2GBMA 1HZ6A 4WQOB 4MGYE 3MC0B 3DVGX 1JRUA 2DYBA 3JSVA 1QZEA 2L05A 3O13A 1Q0WB 2RMMA 2ACZB 2OHFA 3RCZA 3VTVA 2D3AA 2KJ6A 2JF5A 3PHXB 3I5JC 4YSXB 2KNBA 2L8JA 4G0NB 4C4VB 2PTLA 3I63C 2V3PA 3DWMA 1Q1OA 2UYZB 4LLGM 3HK0A 4AWJA 4MH0E 3KUZA 2BKFA 2K39A 4FLHA 5IP4D 2M56B 1IUEA 2BW2A 5EE0A 3AE5B 3A33B 4B9KA 4WWMA 5BO4B 2MJDA 1MVKA 1OEYA 2LHEA 3SDLC 2UWQA 1HA5A 2WXNA 1J19A 3NUHB 1ZUD2 3P42A 5I4DA 1QQRA 3N1ZC 3AH7A 1HZ5A 2IDYA 1SE9A 2KKCA 1Y8RC 3DCGA 1SB3C 3Q69A 1P3QU 4PS7A 4AP4C 2KTFA 5J18A 4KGRA 4ANWA 4DHZE 4ZHOA 2GBKA 3W5VB 3H6NA 4MGKE 4RMAA 1D3ZA 1HQRD 3VR8B 4LK0M 1JRPA 5HKHA 2ZVNA 3V3XA 5JXVA 1WZ0A 1M94A 1P98A 1EM7A 1X1MA 2KMMA 2MJ3A 3ZJTA 4ZRQA 1WYWB 4BZAA 2DLBA 3ZNHB 1WX7A 2LGIA 4NQKE 2PE9A 1JW9D 5AEKB 2KWVB 1I42A 4HCPB 4ZYNA 2KQ7A 4HWIB 2WDQB 2IY0B 4K7SA 1PYWD 4FJYA 5FR6A 5LLIA 4WWOA 2KN5A 3UIPB 2WXFA 4A55A 1UZXB 3FILB 4PK1A 4WJQA 3Q3MC 1JWAD 4AJYB 1MPEA 1E8YA 1TS4A 5HHDG 3L17A 4M8MA 1YD8U 2BB6A 3PV1A 4AS1A 3DBLI 1KLVA 1WR1A 3ONSA 3KH0A 1FXTB 5G5GA 2K6DB 3N30A 1F0ZA 2BVCA 2AYOB 3HRDD 4HK2A 1C3TA 4GDLA 1WXMA 2KOXA 3PZ7A 4MH8A 1XCTL 3AN1A 1ISNA 5GMVA 1CMXB 2HJ1A 2V3SA 4IKGA 4NJCA 2NPTB 4II2B 2KWDA 4FJZA 1GAQB 1PUTA 3QA8A 2W82A 4NJ7A 3U52E 3AEGB 5TR5A 3AE6B 4JLCA 4MJSB 1TKGA 1WJNA 3GP7A 5J2RA 4C7YA 2C7NB 3BY4B 4ACFA 1DYQA 3BK2A 5IAAC 4N59A 1KLUD 4TKNA 4EOYA 3VAWA 2KTRB 3TEXA 2DZJA 2NVUI 1JMLA 3ZDTA 2ONQA 1K53A 3H9DA 2DNFA 2WXRA 2JQRB 5BMGA 4ARIA 3MJWA 4LJOB 1SE2A 1CK1A 2INNE 1V1PB 1ESFA 3QCAA 4OW0A 1L0VB 2W3SA 5IN7A 1DGJA 4MGIE 1E7PB 1VR9A 3NS8A 2ZW0A 3B1LX 4MDKE 1R4MI 4ARCA 4AOFA 1VZ6A 2QC8A 1N62A 4C56C 3CIRB 1OQYA 5IOIA 3V62A 1RFAA 2LRUA 2ON8A 1XLQA 1TS2A 3M62B 1T5XD 1EF5A 3JVZX 1UNSA 1YN3A 2WQYB 1WXAA 3VH3B 3WA0A 1C79A 4LCDE 4IWOA 4HXDA 3N1YC 2HTME 4DBGA 5DCNA 5E6JA 4G11A 1H4RA 3ZKJC 2WS3B 4FA6A 2WXIA 2MCNB 2N0SB 2IYDB 2KXJA 5T8IA 3WIMA 4EEWA 2LEKA 1I7HA 1P1AA 2BWFA 4IWPA 3KVFB 4I6LB 2Z8LA 3VXWA 4GIVA 1YQ4B 4FHKA 2ZJDA 1CZPA 2IZVB 2LMCA 4YT0B 2WXPA 3ZRFA 5LXHA 2CU3A 1T0YA 3PZ8A 1YQ3B 3TEZA 1VDVA 3DVNU 3BYYB 1E7VA 3SFDB 1UGJA 4DXAB 1I4HA 3PRPB 3H1UA 3M95A 1GC6A 4LNOA 2PW9A 1ENFA 1ZKHA 4O1NA 1UELA 2N9KA 2PIAA 4IM3A 4HLEA 2MHJA 2H89B 3VDZA 3PLVA 3R2IA 1WY8A 4UDUC 5JZEB 2WX1A 3LJ3A 1U4AA 2L52A 4FHJA 5G55A 4EE2A 3RNGC 4F8CB 4WJOA 2XK5B 2VRRB 3IT4B 1V5TA 2RGFA 1WGRA 3VFKA 5KHQA 3AE7B 3Q8AA 1CQVA 2V4LA 3P4RB 2JVCA 3O65B 4F1SA 1PGAA 1XQQA 3IAM1 2CHXA 2NR2A 3L16A 3OAWA 1KM7A 3NOBA 2V1YA 4HEA1 1R4NB 3FKYA 3EUB2 1WE7A 3EFCA 1UUPA 3SD5A 3WAOA 2HJ8A 1ZOYB 1C77A 4US9A 2REXA 1SSNA 3TMPB 1NEKB 1PFDA 2EKIA 3BINA 3ML8A 2XEWA 1NYRA 2Y5CA 1V2YA 4P6VF 3APCA 3LYYA 2G4SA 4TV3A 1F9JA 5KHOA 4ANUA 2ZPNA 1NYQA 3AECB 3T3OA 5C2TB 1QOAA 1YX6B 2YVCA 2KX0A 1QOFA 2V0GA 3PGEA 3BVZA 2V4IB 4RM9A 1T0SC 1K52A 3IT6B 3EHVA 5BYSA 2KT7A 4BAXA 2GI9A 1KF6B 1D4BA 3MJ5A 1BUIC 3NVWA 1AW7A 2AQ2B 3RN9C 3ZLZA 2L76A 1NI3A 1WMHA 3A9JA 4PS8A 4EUTA 4XE0A 2L83A 2HE7A 5LXIB 2PKOA 1TY0A 2AL3A 2JYTA 1ZPSA 2D07B 4LNIA 4DQOC 2J0MA 3R7QA 1E5WA 1WJUA 4EFOA 1FXAA 2BT6A 2PVOD 2BQQA 2ZCCA 3A1QB 2JZZA 5EDSA 1FNWA 3IXSA 4RGMA 4JE3B 2LUMA 1D5ZC 2J0KA 2KX3A 2PJHA 1P9DU 2AQ1B 1QT9A 3UQBA 3L0WB 4RGTA 3N20C 1WIAA 2JSVX 4TQ0A 2KQ4X 3OJ3A 2O2VB 3TBLD 4A8XC 4K3CA 4XDCA 3IBEA 4NNJB 3VHTC 5BMIA 2DENB 3IFWB 2DWQA 3U30A 4ICUA 2OJRA 3CF6E 2K8HA 2JZ3B 3WANA 1N6ZA 4J3OD 4KV2A 2BYTA 3KYCD 4W9IA 3W1SC 2LGXA 4LNKA 2C9WB 3GE3C 1JWSD 3QQ8B 1E8WA 3H7PB 2I1KA 4DWFA 1JALA 4MSQB 1TYGB 1JROA 2IGGA 5JHBA 2LVQA 3A9KB 2INDC 4BKTA 5FK9C 2QSDA 3L13A 2NMQA 2W55A 2IO0B 1GPXA 1WM2A 2BPSA 5IO9A 2IJ0A 2EELA 1IBXB 3HIZA 3MTNB 2KC2A 2L0TA 3ZXRA 4NY0A 1FXIA 3CSFA 3RZFA 4JX1C 3AEFB 4P7IA 2JX5A 5LNK1 1RRBA 4ZRPA 2G9HD 3B9JA 1WGKA 2RSUA 3DBRI 2KYWA 3RD2A 1RAXA 3FILA 1N61A 3BWUD 1T6BX 3FC4A 2BB5A 2LJIA 1I4GA 4FN2A 4GGQA 2YEPB 2GLSA 2WDTB 3TIXA 2KDIA 2Y3AA 1C4AA 1E90A 3Q8FA 3AULA 4BFRA 1SIJA 2N7JA 2CJNA 4ZOHC 1GUAB 4BOZB 5EE1A 4YTNB 1WZ3A 2DAJA 4WJNA 1IGDA 5TSSA 4KZCA 1GNUA 2R2QA 3ZIMA 4AUQC 5L83A 4JPSA 1MFWA 4KZ0A 2NBWB 4GDKB 2BYEA 3CMMB 4W9EA 1HXYD 2BGFA 3AEEB 2BKRB 2ZW1A 1FNVA 3RT3B 1SJED 1FM0D 4PT5A 1R7SA 4KDLB 1WSPA 1J0GA 4NPNA 3DBSA 3AMZA 3QC8B 3LDZE 2BS2B 1G6JA 4W9FA 1UF0A 2G4DB 1MHXA 2LVOA 1D5XC 4IOIE 3IG3A 4HVBA 1QF6A 4KGTA 5C23A 2D3GA 1IPGA 3P63A 4LJPB 1KOTA 1QOBA 1NVID 2C7HA 2KDFB 4CYEA 4HRSA 3HVZA 2DYOA 1OQRA 5D6JB 1V1PA 1EWYC 2K0PA 4W9DA 1WFYA 4G50A 2LI5A 1FCLA 2E6XA 4BVUC 2N7DA 2FUHB 4MM3A 1RWSA 1VLBA 2EMSA 2Q5WD 3VVWB 4LTUA 3GB1A 3I3TB 1M4VA 2DYMA 4C80A 5C3JB 1TY2A 5D2MB 1V5OA 5BYRA 2N1VA 2LGDA 2MSED 1FIQA 1HTQA 2ZNVC 5FKAC 2KMAA 3N9YC 2G3QB 3VQIA 3I57A 3K9PB 5H8YE 2GBRA 3RFZB 2K9XA 2QDFA 2SAKA 1TS3A 2D10A 1P7FA 5GXGB 2FBWB 3JSVB 2G1EA 3PZDA 4ZHPA 2MA9B 3CWIA 3Q8CA 4P16A 4CO7A 3IVFA 2MJEA 2C7MB 4DDGD 1Z5SB 4DK5A 3PREA 3PHWB 4A3OA 3QJZA 3QWZB 1D5MC 2LXAA 3FAHA 2ZEQA 1Z2MA 2WXOA 1SF0A 1V81A 3KLSX 4W9HA 2OEDA 4RF1A 4FJVB 1L2NA 4A6QA 1WYGA 3T9LA 4MACA 3RNBC 4HDQA 4H2AA 5E6NA 1TGZB 3AXCA 4OZBA 3ZYYX 2N9LA 1KH0A 2NS5A 4KKIA 2L00B 4YWGG 1WGDA 2VZKD 1XT9B 5H92C 2RDBC 3ECIA 4HROA 2N1WA 3KWVA 2CHZA 2JXTA 2KWUB 1HTOA 3I9V1 4NZLB 3ZTCA 2OJWA 2FCQA 4W9LA 5E6OA 2XNAC 3GOEA 3Q3FA 1RM6C 2UU7A 1L4ZB 3URYA 4M00A 4HCNB 4RCOA 2WXLA 3DWGC 1P0RA 1GC7A 1AWDA 1OGWA 2CU1A 2B3AA 1XLNA 1PDXA 1HE8A 1KTKA 3EA6A 2KDMA 3W1SA 3QAQA 3VUXA 3HM3A 2RPVA 1XO3A 3VH4B 3A4SC 2WHIA 4P1BC 4EZLA 3W5UB 3M3JA 1OQQA 3GZNB 5CHVC 3U8ZA 5AZHA 2MP2A 3ZUNA 2E3TA 5HG2A 4RM8A 3PT2B 3KUDB 3ML9A 3TCAA 2KJRA 4GXBA 2MH7A 2KDEB 3B0AA 4MELA 3NHEB 1L5PA 1S1QB 4D2KA 2VH1A 1YN4A 1VZ8A 3RMKC 3ABVB 1YOVB 2RPQA 4HPLB 1E6EB
chains in the Genus database with same CATH topology
3DVGX 4KVGB 4TUUA 1JRUA 4GU2A 1TBEA 2DYBA 3JSVA 3R7RA 3UGBB 1QZEA 2KVRA 2L05A 2O6VA 2N9PC 1Q0WB 1YX6B 2KHWB 2YVCA 5AZFA 2KX0A 3HM6X 3PGEA 3RCZA 4ANVA 2FIDA 4RM9A 3L08A 3VTVA 3R3MA 2NCNA 2KJ6A 2JF5A 3EHVA 3PHXB 1V86A 5IA7A 2ZZPB 2KNBA 2L8JA 4G0NB 4MSMB 4XC2A 3PSEB 4BOSC 2MLBA 4HDOA 1MG8A 2L3ZA 3ZLZA 2L76A 2M17A 2GMIC 1WMHA 3A9JA 4PS8A 4EUTA 4ZRJA 1Q1OA 2UYZB 2HE7A 3HK0A 3OJ4B 4AWJA 5LXIB 1J8CA 2JT4B 1UBQA 2BYFA 2AL3A 3V60A 4MH0E 3KUZA 2BKFA 2K39A 3DVGY 2D07B 4K81A 4ZDVA 2J0MA 4FLHA 3R7QA 3B08A 1E5WA 1WJUA 4EFOA 1VD2A 4MGZE 5DPSA 2ZCCA 3A1QB 3NZSA 4OVVA 2JZZA 3A33B 1Q5WB 2G45B 4IWQA 2C60A 1WXVA 5EDSA 3WALA 4B9KA 1WGHA 4B95A 5CHWA 5BO4B 3OLMD 1SGHA 1WX9A 1OEYA 2JY6A 2QHOA 2LRWA 2MRPA 5AZGA 2J0KA 2M0XA 2KX3A 3SDLC 2PJHA 1K8RB 2UWQA 1P9DU 4YL8A 1J19A 3UQBA 1KJTA 3L0WB 4E74A 2KZRA 4G3XB 2BYVE 2PEAA 1WIAA 2KJHB 2XK5A 4NJ6A 4TQ0A 2A4ZA 1SE9A 4ZRIA 3OJ3A 2O2VB 3TBLD 3X23A 5L95C 2KKCA 4BKSA 2MBHA 1Y8RC 3DCGA 3IBEA 4NNJB 1PQSA 1L7YA 2FCMA 2WYQA 3VHTC 2N4FA 3RUIB 3TJPA 1P3QU 4PS7A 4AP4C 2KTFA 2DENB 3IFWB 5J18A 4ANWA 3AI5A 3U30A 4DHZE 2KLCA 2GBKA 3EECA 4ICUA 3H6NA 2BF8B 2OJRA 3PRMB 3CF6E 2K8HA 2JZ3B 2KDBA 1WX8A 1ZW7A 4MGKE 2NBUA 4RMAA 3WANA 1D3ZA 2DAFA 2LUEA 2PE6B 4KV2A 3KYCD 4W9IA 2K1FA 4ZRKA 3DPDA 4PS3A 3W1SC 3NY5A 5D7GA 2LGXA 2AWTA 2OOBB 5DPTA 3UINB 5HKHA 2KK8A 2C9WB 2N7EA 2ZVNA 1WXSA 2D11A 4OVUA 3QQ8B 4KSKC 1E8WA 2J7QB 3H7PB 2I1KA 2LZ6A 4KIKA 4W9KA 4MSQB 1WZ0A 1M94A 1P98A 2FNJB 4DWFA 5JHBA 2LVQA 3S2AA 4WWNA 3A9KB 1X1MA 4BKTA 3L13A 4K7WA 4FBJB 4W9JA 2IO0B 2KANA 1WM2A 1WYWB 1UD7A 2BPSA 3QIJA 1WGGA 3ZNHB 1WX7A 3HIZA 3MTNB 2KC2A 4NQKE 4XX5A 4II3B 2PE9A 3WAPA 2L0TA 5AEKB 1I42A 2KWVB 2GOWA 4NY0A 1S3SG 4HCPB 4ZYNA 2IO1B 4W9GA 2KQ7A 4HWIB 2IY0B 3CSFA 4K7SA 4FJYA 5FR6A 5LLIA 4NQLB 1EF1A 4WWOA 2ZPYA 3RZFA 3PLUA 2KN5A 3UIPB 3RZWC 3ZW3A 3IHPC 4E3CA 4P7IA 2N9EB 1UZXB 1RRBA 3UF8A 4WJQA 4AJYB 2RSUA 4CHKA 1E8YA 3DBRI 3RD2A 1RAXA 2M8SA 3AU5A 3L17A 4HJKA 3P2BA 4M8MA 2KMCA 3N3KB 4JGHB 1YD8U 4X57B 3PV1A 3DBLI 1KLVA 4FN2A 4GGQA 3DVNV 1WR1A 4IM0A 1NI2A 3M63B 2MWSB 2WDTB 3KH0A 3ONSA 3TIXA 2KDIA 1R4NI 1E90A 1FXTB 3AULA 2WWZA 4GDLB 4BFRA 2K6DB 2KWCA 3N30A 3GZNI 4DHZB 2L7RA 3V6EB 1BT0A 3JYUA 2FAZA 1GUAB 4BOZB 2AYOB 1IYFA 4HK2A 1C3TA 4GDLA 1WJ6A 1WXMA 2KOXA 4FULA 4BKGA 1WZ3A 2NBVB 2DAJA 1SIFA 2K8BA 1WGYA 5DPRA 2GBJA 1LQBA 4WJNA 1ISNA 2A5UA 2IO2B 2K6QA 4I6PA 5GMVA 1CMXB 3ENEA 2V3SA 4KZCA 1YQBA 1GNUA 4DHJD 2NPTB 3MHSD 4II2B 4FJZA 3DQVA 2R2QA 3ZIMA 4JIOU 3QA8A 4AUQC 5L83A 4NJ7A 4KZ0A 3ZNGC 1TZ1A 2NBWB 3ZVVA 5TR5A 4GDKB 2BYEA 3CMMB 4IUMB 4JLCA 4MJSB 3AU4A 4W9EA 4M8NA 1WJNA 2BGFA 1NBFC 5J2RA 3EC8A 2BKRB 3A1QA 2C7NB 3BY4B 3RT3B 4A20A 4GDKA 2AL6A 2BWES 5IAAC 4KDLB 3APFA 3ZNID 1J0GA 4TKNA 4NPNA 2O6VD 3DBSA 4EOYA 1NDDA 3VAWA 2KTRB 2DZMA 5CHFA 2DZJA 2NVUI 3ZDTA 2MBOA 2KO3A 3QC8B 3LDZE 3H9DA 2KLGA 1G6JA 4WJPA 4W9FA 3R66C 4I6NB 1E7UA 2G4DB 2LJ5A 3ZNZB 3L10B 2LVOA 2CHWA 2FIFA 2DZKA 5JHAA 5D94A 2K25A 3IG3A 3MJWA 4LJOB 4HVBA 4JQWC 5CX3A 3V61A 3VUYA 3VUWA 5C23A 2D3GA 1IPGA 1OTRB 4KSLC 4LJPB 2O2VA 2XBBC 1KOTA 2C7HA 1WI0A 2KDFB 4CYEA 3QCAA 4GMVA 2DYOA 5D6JB 1E8XA 4MGIE 4PYZA 1WR6E 2ASQA 3NS8A 4W9DA 3B1LX 1WFYA 4G50A 2JUOA 4MDKE 1V9JA 3ZTDA 3APDA 1R4MI 2IO3B 4AOFA 3D32A 4A3PA 2JXXA 2LI5A 4BBNC 1V6EA 1YIWA 4ICVA 4BVUC 2N7DA 4AJWA 2FUHB 3HHMA 4MM3A 2EMSA 2ZVOA 1OQYA 3V62A 3VVWB 1VCBA 3PRZA 1RFAA 2DHZA 2LRUA 1YX5B 2R2OA 2YLMA 2Z59B 3SHQA 3I3TB 3DOWA 3H7PA 1GJZA 2FCSA 2DYMA 3A9KA 3QHTA 3PS6A 2J0JA 3M62B 5D2MB 1V5OA 1WM3A 2MP2B 1EF5A 2N1VA 3JVZX 2MQJA 1LM8B 2LGDA 2KC1A 5JH5C 2MSED 1GG3A 1WXAA 3VH3B 1WF9A 2C5LC 3WA0A 4LCDE 4IWOA 4DHJB 2MBBB 4HXDA 2W9NA 3Q3JA 2ZNVC 3TL5A 5J17A 2KMAA 4IM2A 4BKSD 2LGYA 4DBGA 5DCNA 3UIOB 2G3QB 3W1YA 1LXDA 4PYUA 2M1MA 4E71A 3VTWA 2ZCBA 4G11A 3VQIA 2D2QA 1UH6A 1H4RA 4KDIC 3ZKJC 3K9PB 4LDTD 2GBNA 4GSWA 4N9F4 2GBRA 3C0RB 4IW0A 1EUVB 3PVLA 4FA6A 2JWZA 3VTUA 2D10A 2MCNB 2I1JA 4WWPA 2IYDB 2KXJA 3JSVB 3PZDA 3U7DA 2MBQA 2MA9B 2O6VB 3WIMA 4EEWA 4ANXA 1P1AA 2BWFA 4MEMA 4IWPA 3KVFB 4CO7A 3WAMA 3IVFA 5CTRC 1I35A 4I6LB 2C7MB 2WX0A 3RYTA 4DDGD 1Z5SB 2KQSA 3NZUA 1AARA 3VXWA 4GIVA 3DDCB 4FHKA 2ZJDA 1OEYJ 4DK5A 2IZVB 3PREA 1H8CA 3T8MA 3PHWB 3ZRFA 2JPHA 3EFUA 4A3OA 5LXHA 3QJZA 3QWZB 1T0YA 2LXAA 2Z0DB 1ZGUB 3A4RA 2KFKB 2ZEQA 3DVNU 1Z2MA 1E7VA 1WMHB 3A9JB 2RR9A 3K9OB 2NPTA 3DBHI 3KYDD 4DXAB 3KUCB 3PRPB 3H1UA 3ZO5B 4DDID 2KFKA 1V81A 4XZ4A 3M95A 4W9HA 5G2NA 1GC6A 1WRDB 4FJVB 1L2NA 3T9LA 1UBIA 4MJSA 4EKUA 1ZKHA 4HDQA 1UELA 3ZRCA 5E6NA 3V6CB 1TGZB 3AXCA 3SU8X 4NAWB 2K8CA 2LVPA 4IM3A 4HLEA 2NS5A 2CKHB 2L00B 3VDZA 3PLVA 2JRHA 1WY8A 5JZEB 2RD0A 2WX1A 3LJ3A 1U4AA 1WGDA 2KTRA 4NAWA 2HTHA 4FHJA 1XT9B 2KFJA 1A5RA 3ECIA 3X0WA 4JL9A 5G55A 3PTFC 2Y5BB 3QK0A 4URKA 3UQAA 2LWPA 4F8CB 2N1WA 4WJOA 2CHZA 1C1YB 3RULA 2KWUB 2XK5B 2CR5A 1IP9A 1YJ1A 2VRRB 3ZTCA 2CS4A 2FCQA 1V5TA 2RGFA 4W9LA 5E6OA 1WGRA 3VFKA 1UGMA 3GOEA 3Q3FA 3QX1A 5KHQA 1WJ4A 1XD3B 4GN1A 4B6WA 1RLFA 4IG7B 4HCNB 2PPHA 1V49A 1P0RA 3ALBA 1GC7A 4LDTB 2L0FA 1OGWA 2V4LA 3ZDMC 2CU1A 2B3AA 2JVCA 2DX5B 3QARA 4K1RB 3O65B 3KW5B 2LD9A 4F1SA 4WAAA 1XQQA 2N9XA 2MBEA 2CHXA 2Z0EB 1HE8A 2NR2A 1LFDA 3L16A 1EO6A 3OAWA 4GOCA 4M0WB 4EZKA 2EKEC 3W1SA 2HD5B 4BBNF 1KM7A 3QAQA 3VUXA 3HM3A 4KIKB 1WH3A 3NOBA 4TQ1A 4GB9A 2V1YA 2IY1B 3VH4B 3A4SC 5C1ZA 4ASWC 2AEHA 5E6PA 4EZLA 1V80A 1WE7A 3M3JA 2LXCA 3SD5A 3WAOA 2HJ8A 4W9CA 2MW5A 5CHVC 3U8ZA 5AZHA 4HPMB 2MP2A 2IBIB 3ZUNA 2REXA 4RM8A 3TMPB 3N32A 2FCNA 3JW0X 4EZJA 4FADA 1WE6A 3PT2B 3BINA 2MX2A 3ML8A 3PPAA 4K7UA 3KUDB 2XEWA 3ML9A 1TTNA 4F7ZA 1V2YA 3TCAA 2KJRA 4GXBA 5DPWA 2LASA 2EMTA 2ZNVB 4IC7B 3APCA 3CSTA 2KDEB 3B0AA 4MELA 2KD0A 3H7SA 3NHEB 2DZIA 2GBMA 1S1QB 2G4SA 4J6IA 1E8ZA 4TV3A 2M4NA 3L54A 2JRIB 4WQOB 1F9JA 5KHOA 4ANUA 4MGYE 2RPQA 2ZPNA 4HPLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVG X;  4KVG B;  4TUU A;  1JRU A;  4GU2 A;  1TBE A;  2DYB A;  3JSV A;  3R7R A;  3UGB B;  1QZE A;  2KVR A;  2L05 A;  2O6V A;  2N9P C;  1Q0W B;  1YX6 B;  2KHW B;  2YVC A;  5AZF A;  2KX0 A;  3HM6 X;  3PGE A;  3RCZ A;  4ANV A;  2FID A;  4RM9 A;  3L08 A;  3VTV A;  3R3M A;  2NCN A;  2KJ6 A;  2JF5 A;  3EHV A;  3PHX B;  1V86 A;  5IA7 A;  2ZZP B;  2KNB A;  2L8J A;  4G0N B;  4MSM B;  4XC2 A;  3PSE B;  4BOS C;  2MLB A;  4HDO A;  1MG8 A;  2L3Z A;  3ZLZ A;  2L76 A;  2M17 A;  2GMI C;  1WMH A;  3A9J A;  4PS8 A;  4EUT A;  4ZRJ A;  1Q1O A;  2UYZ B;  2HE7 A;  3HK0 A;  3OJ4 B;  4AWJ A;  5LXI B;  1J8C A;  2JT4 B;  1UBQ A;  2BYF A;  2AL3 A;  3V60 A;  4MH0 E;  3KUZ A;  2BKF A;  2K39 A;  3DVG Y;  2D07 B;  4K81 A;  4ZDV A;  2J0M A;  4FLH A;  3R7Q A;  3B08 A;  1E5W A;  1WJU A;  4EFO A;  1VD2 A;  4MGZ E;  5DPS A;  2ZCC A;  3A1Q B;  3NZS A;  4OVV A;  2JZZ A;  3A33 B;  1Q5W B;  2G45 B;  4IWQ A;  2C60 A;  1WXV A;  5EDS A;  3WAL A;  4B9K A;  1WGH A;  4B95 A;  5CHW A;  5BO4 B;  3OLM D;  1SGH A;  1WX9 A;  1OEY A;  2JY6 A;  2QHO A;  2LRW A;  2MRP A;  5AZG A;  2J0K A;  2M0X A;  2KX3 A;  3SDL C;  2PJH A;  1K8R B;  2UWQ A;  1P9D U;  4YL8 A;  1J19 A;  3UQB A;  1KJT A;  3L0W B;  4E74 A;  2KZR A;  4G3X B;  2BYV E;  2PEA A;  1WIA A;  2KJH B;  2XK5 A;  4NJ6 A;  4TQ0 A;  2A4Z A;  1SE9 A;  4ZRI A;  3OJ3 A;  2O2V B;  3TBL D;  3X23 A;  5L95 C;  2KKC A;  4BKS A;  2MBH A;  1Y8R C;  3DCG A;  3IBE A;  4NNJ B;  1PQS A;  1L7Y A;  2FCM A;  2WYQ A;  3VHT C;  2N4F A;  3RUI B;  3TJP A;  1P3Q U;  4PS7 A;  4AP4 C;  2KTF A;  2DEN B;  3IFW B;  5J18 A;  4ANW A;  3AI5 A;  3U30 A;  4DHZ E;  2KLC A;  2GBK A;  3EEC A;  4ICU A;  3H6N A;  2BF8 B;  2OJR A;  3PRM B;  3CF6 E;  2K8H A;  2JZ3 B;  2KDB A;  1WX8 A;  1ZW7 A;  4MGK E;  2NBU A;  4RMA A;  3WAN A;  1D3Z A;  2DAF A;  2LUE A;  2PE6 B;  4KV2 A;  3KYC D;  4W9I A;  2K1F A;  4ZRK A;  3DPD A;  4PS3 A;  3W1S C;  3NY5 A;  5D7G A;  2LGX A;  2AWT A;  2OOB B;  5DPT A;  3UIN B;  5HKH A;  2KK8 A;  2C9W B;  2N7E A;  2ZVN A;  1WXS A;  2D11 A;  4OVU A;  3QQ8 B;  4KSK C;  1E8W A;  2J7Q B;  3H7P B;  2I1K A;  2LZ6 A;  4KIK A;  4W9K A;  4MSQ B;  1WZ0 A;  1M94 A;  1P98 A;  2FNJ B;  4DWF A;  5JHB A;  2LVQ A;  3S2A A;  4WWN A;  3A9K B;  1X1M A;  4BKT A;  3L13 A;  4K7W A;  4FBJ B;  4W9J A;  2IO0 B;  2KAN A;  1WM2 A;  1WYW B;  1UD7 A;  2BPS A;  3QIJ A;  1WGG A;  3ZNH B;  1WX7 A;  3HIZ A;  3MTN B;  2KC2 A;  4NQK E;  4XX5 A;  4II3 B;  2PE9 A;  3WAP A;  2L0T A;  5AEK B;  1I42 A;  2KWV B;  2GOW A;  4NY0 A;  1S3S G;  4HCP B;  4ZYN A;  2IO1 B;  4W9G A;  2KQ7 A;  4HWI B;  2IY0 B;  3CSF A;  4K7S A;  4FJY A;  5FR6 A;  5LLI A;  4NQL B;  1EF1 A;  4WWO A;  2ZPY A;  3RZF A;  3PLU A;  2KN5 A;  3UIP B;  3RZW C;  3ZW3 A;  3IHP C;  4E3C A;  4P7I A;  2N9E B;  1UZX B;  1RRB A;  3UF8 A;  4WJQ A;  4AJY B;  2RSU A;  4CHK A;  1E8Y A;  3DBR I;  3RD2 A;  1RAX A;  2M8S A;  3AU5 A;  3L17 A;  4HJK A;  3P2B A;  4M8M A;  2KMC A;  3N3K B;  4JGH B;  1YD8 U;  4X57 B;  3PV1 A;  3DBL I;  1KLV A;  4FN2 A;  4GGQ A;  3DVN V;  1WR1 A;  4IM0 A;  1NI2 A;  3M63 B;  2MWS B;  2WDT B;  3KH0 A;  3ONS A;  3TIX A;  2KDI A;  1R4N I;  1E90 A;  1FXT B;  3AUL A;  2WWZ A;  4GDL B;  4BFR A;  2K6D B;  2KWC A;  3N30 A;  3GZN I;  4DHZ B;  2L7R A;  3V6E B;  1BT0 A;  3JYU A;  2FAZ A;  1GUA B;  4BOZ B;  2AYO B;  1IYF A;  4HK2 A;  1C3T A;  4GDL A;  1WJ6 A;  1WXM A;  2KOX A;  4FUL A;  4BKG A;  1WZ3 A;  2NBV B;  2DAJ A;  1SIF A;  2K8B A;  1WGY A;  5DPR A;  2GBJ A;  1LQB A;  4WJN A;  1ISN A;  2A5U A;  2IO2 B;  2K6Q A;  4I6P A;  5GMV A;  1CMX B;  3ENE A;  2V3S A;  4KZC A;  1YQB A;  1GNU A;  4DHJ D;  2NPT B;  3MHS D;  4II2 B;  4FJZ A;  3DQV A;  2R2Q A;  3ZIM A;  4JIO U;  3QA8 A;  4AUQ C;  5L83 A;  4NJ7 A;  4KZ0 A;  3ZNG C;  1TZ1 A;  2NBW B;  3ZVV A;  5TR5 A;  4GDK B;  2BYE A;  3CMM B;  4IUM B;  4JLC A;  4MJS B;  3AU4 A;  4W9E A;  4M8N A;  1WJN A;  2BGF A;  1NBF C;  5J2R A;  3EC8 A;  2BKR B;  3A1Q A;  2C7N B;  3BY4 B;  3RT3 B;  4A20 A;  4GDK A;  2AL6 A;  2BWE S;  5IAA C;  4KDL B;  3APF A;  3ZNI D;  1J0G A;  4TKN A;  4NPN A;  2O6V D;  3DBS A;  4EOY A;  1NDD A;  3VAW A;  2KTR B;  2DZM A;  5CHF A;  2DZJ A;  2NVU I;  3ZDT A;  2MBO A;  2KO3 A;  3QC8 B;  3LDZ E;  3H9D A;  2KLG A;  1G6J A;  4WJP A;  4W9F A;  3R66 C;  4I6N B;  1E7U A;  2G4D B;  2LJ5 A;  3ZNZ B;  3L10 B;  2LVO A;  2CHW A;  2FIF A;  2DZK A;  5JHA A;  5D94 A;  2K25 A;  3IG3 A;  3MJW A;  4LJO B;  4HVB A;  4JQW C;  5CX3 A;  3V61 A;  3VUY A;  3VUW A;  5C23 A;  2D3G A;  1IPG A;  1OTR B;  4KSL C;  4LJP B;  2O2V A;  2XBB C;  1KOT A;  2C7H A;  1WI0 A;  2KDF B;  4CYE A;  3QCA A;  4GMV A;  2DYO A;  5D6J B;  1E8X A;  4MGI E;  4PYZ A;  1WR6 E;  2ASQ A;  3NS8 A;  4W9D A;  3B1L X;  1WFY A;  4G50 A;  2JUO A;  4MDK E;  1V9J A;  3ZTD A;  3APD A;  1R4M I;  2IO3 B;  4AOF A;  3D32 A;  4A3P A;  2JXX A;  2LI5 A;  4BBN C;  1V6E A;  1YIW A;  4ICV A;  4BVU C;  2N7D A;  4AJW A;  2FUH B;  3HHM A;  4MM3 A;  2EMS A;  2ZVO A;  1OQY A;  3V62 A;  3VVW B;  1VCB A;  3PRZ A;  1RFA A;  2DHZ A;  2LRU A;  1YX5 B;  2R2O A;  2YLM A;  2Z59 B;  3SHQ A;  3I3T B;  3DOW A;  3H7P A;  1GJZ A;  2FCS A;  2DYM A;  3A9K A;  3QHT A;  3PS6 A;  2J0J A;  3M62 B;  5D2M B;  1V5O A;  1WM3 A;  2MP2 B;  1EF5 A;  2N1V A;  3JVZ X;  2MQJ A;  1LM8 B;  2LGD A;  2KC1 A;  5JH5 C;  2MSE D;  1GG3 A;  1WXA A;  3VH3 B;  1WF9 A;  2C5L C;  3WA0 A;  4LCD E;  4IWO A;  4DHJ B;  2MBB B;  4HXD A;  2W9N A;  3Q3J A;  2ZNV C;  3TL5 A;  5J17 A;  2KMA A;  4IM2 A;  4BKS D;  2LGY A;  4DBG A;  5DCN A;  3UIO B;  2G3Q B;  3W1Y A;  1LXD A;  4PYU A;  2M1M A;  4E71 A;  3VTW A;  2ZCB A;  4G11 A;  3VQI A;  2D2Q A;  1UH6 A;  1H4R A;  4KDI C;  3ZKJ C;  3K9P B;  4LDT D;  2GBN A;  4GSW A;  4N9F 4;  2GBR A;  3C0R B;  4IW0 A;  1EUV B;  3PVL A;  4FA6 A;  2JWZ A;  3VTU A;  2D10 A;  2MCN B;  2I1J A;  4WWP A;  2IYD B;  2KXJ A;  3JSV B;  3PZD A;  3U7D A;  2MBQ A;  2MA9 B;  2O6V B;  3WIM A;  4EEW A;  4ANX A;  1P1A A;  2BWF A;  4MEM A;  4IWP A;  3KVF B;  4CO7 A;  3WAM A;  3IVF A;  5CTR C;  1I35 A;  4I6L B;  2C7M B;  2WX0 A;  3RYT A;  4DDG D;  1Z5S B;  2KQS A;  3NZU A;  1AAR A;  3VXW A;  4GIV A;  3DDC B;  4FHK A;  2ZJD A;  1OEY J;  4DK5 A;  2IZV B;  3PRE A;  1H8C A;  3T8M A;  3PHW B;  3ZRF A;  2JPH A;  3EFU A;  4A3O A;  5LXH A;  3QJZ A;  3QWZ B;  1T0Y A;  2LXA A;  2Z0D B;  1ZGU B;  3A4R A;  2KFK B;  2ZEQ A;  3DVN U;  1Z2M A;  1E7V A;  1WMH B;  3A9J B;  2RR9 A;  3K9O B;  2NPT A;  3DBH I;  3KYD D;  4DXA B;  3KUC B;  3PRP B;  3H1U A;  3ZO5 B;  4DDI D;  2KFK A;  1V81 A;  4XZ4 A;  3M95 A;  4W9H A;  5G2N A;  1GC6 A;  1WRD B;  4FJV B;  1L2N A;  3T9L A;  1UBI A;  4MJS A;  4EKU A;  1ZKH A;  4HDQ A;  1UEL A;  3ZRC A;  5E6N A;  3V6C B;  1TGZ B;  3AXC A;  3SU8 X;  4NAW B;  2K8C A;  2LVP A;  4IM3 A;  4HLE A;  2NS5 A;  2CKH B;  2L00 B;  3VDZ A;  3PLV A;  2JRH A;  1WY8 A;  5JZE B;  2RD0 A;  2WX1 A;  3LJ3 A;  1U4A A;  1WGD A;  2KTR A;  4NAW A;  2HTH A;  4FHJ A;  1XT9 B;  2KFJ A;  1A5R A;  3ECI A;  3X0W A;  4JL9 A;  5G55 A;  3PTF C;  2Y5B B;  3QK0 A;  4URK A;  3UQA A;  2LWP A;  4F8C B;  2N1W A;  4WJO A;  2CHZ A;  1C1Y B;  3RUL A;  2KWU B;  2XK5 B;  2CR5 A;  1IP9 A;  1YJ1 A;  2VRR B;  3ZTC A;  2CS4 A;  2FCQ A;  1V5T A;  2RGF A;  4W9L A;  5E6O A;  1WGR A;  3VFK A;  1UGM A;  3GOE A;  3Q3F A;  3QX1 A;  5KHQ A;  1WJ4 A;  1XD3 B;  4GN1 A;  4B6W A;  1RLF A;  4IG7 B;  4HCN B;  2PPH A;  1V49 A;  1P0R A;  3ALB A;  1GC7 A;  4LDT B;  2L0F A;  1OGW A;  2V4L A;  3ZDM C;  2CU1 A;  2B3A A;  2JVC A;  2DX5 B;  3QAR A;  4K1R B;  3O65 B;  3KW5 B;  2LD9 A;  4F1S A;  4WAA A;  1XQQ A;  2N9X A;  2MBE A;  2CHX A;  2Z0E B;  1HE8 A;  2NR2 A;  1LFD A;  3L16 A;  1EO6 A;  3OAW A;  4GOC A;  4M0W B;  4EZK A;  2EKE C;  3W1S A;  2HD5 B;  4BBN F;  1KM7 A;  3QAQ A;  3VUX A;  3HM3 A;  4KIK B;  1WH3 A;  3NOB A;  4TQ1 A;  4GB9 A;  2V1Y A;  2IY1 B;  3VH4 B;  3A4S C;  5C1Z A;  4ASW C;  2AEH A;  5E6P A;  4EZL A;  1V80 A;  1WE7 A;  3M3J A;  2LXC A;  3SD5 A;  3WAO A;  2HJ8 A;  4W9C A;  2MW5 A;  5CHV C;  3U8Z A;  5AZH A;  4HPM B;  2MP2 A;  2IBI B;  3ZUN A;  2REX A;  4RM8 A;  3TMP B;  3N32 A;  2FCN A;  3JW0 X;  4EZJ A;  4FAD A;  1WE6 A;  3PT2 B;  3BIN A;  2MX2 A;  3ML8 A;  3PPA A;  4K7U A;  3KUD B;  2XEW A;  3ML9 A;  1TTN A;  4F7Z A;  1V2Y A;  3TCA A;  2KJR A;  4GXB A;  5DPW A;  2LAS A;  2EMT A;  2ZNV B;  4IC7 B;  3APC A;  3CST A;  2KDE B;  3B0A A;  4MEL A;  2KD0 A;  3H7S A;  3NHE B;  2DZI A;  2GBM A;  1S1Q B;  2G4S A;  4J6I A;  1E8Z A;  4TV3 A;  2M4N A;  3L54 A;  2JRI B;  4WQO B;  1F9J A;  5KHO A;  4ANU A;  4MGY E;  2RPQ A;  2ZPN A;  4HPL B; 
#chains in the Genus database with same CATH topology
 1TBE A;  3UGB B;  3U4E G;  2KVR A;  3BII D;  2O6V A;  2KHW B;  3RNE C;  2VZK B;  4XWT A;  5AZF A;  4REZ A;  1K50 A;  1I4Q A;  3L08 A;  1L0Y B;  2WDV B;  3TEW A;  1F52 A;  2D3C A;  1ROE A;  4MSM B;  4XC2 A;  3W9C B;  1B1Z A;  1PGX A;  1XCQ L;  4R3D A;  4BOS C;  2MLB A;  3NRZ A;  4HDO A;  1MG8 A;  3C8Y A;  3AE9 B;  4ZRJ A;  3R2T A;  2JT4 B;  2BYF A;  2X8X X;  1C9F A;  3DVG Y;  4K81 A;  2V9H A;  1VD2 A;  4MGZ E;  5DPS A;  1ET6 A;  4ITK A;  3MC9 A;  4OVV A;  2G45 B;  2C60 A;  3WAL A;  1WGH A;  5CHW A;  3TSS A;  1FFU A;  3OLM D;  1EU3 A;  1FCC C;  2JU6 X;  1SEB D;  1SGH A;  1WX9 A;  2QHO A;  1XLO A;  2LRW A;  2VH2 A;  4YL8 A;  3PO0 A;  1KRH A;  3LB8 C;  4NJ6 A;  4ZRI A;  1YMH E;  5L95 C;  2WXM A;  4BKS A;  2MBH A;  3ZGZ A;  1PQS A;  1L7Y A;  2FCM A;  2QCZ A;  3TJP A;  4RGO S;  3EEC A;  3NVY A;  3MC8 A;  2BF8 B;  1ZW7 A;  1YJJ A;  4ZRK A;  3NY5 A;  1V1O A;  2OOB B;  3UIN B;  4M0W A;  1DOI A;  2NTT A;  2N7E A;  3IAS 1;  4KSK C;  2J7Q B;  2LZ6 A;  4KIK A;  1ACC A;  2FNJ B;  2KAN A;  3NVV A;  1WGG A;  1YJI A;  1FMA D;  3OG5 A;  4XX5 A;  3NZ3 A;  1S3S G;  4M01 A;  1TS5 A;  1T0R C;  1L6V A;  2AX5 A;  4IDI A;  3IHP C;  3P4Q B;  2N9E B;  3UF8 A;  3NJT A;  1F2R I;  1CJE A;  2M8S A;  3AU5 A;  4HJK A;  3P2B A;  2KMC A;  1FO4 A;  3MP9 A;  4IM0 A;  1TKE A;  1SE4 A;  2WXK A;  3VRB B;  1R4N I;  4JWU C;  2SEB D;  4XDD A;  3SEB A;  3N1X C;  2MEK A;  3V6E B;  2FAZ A;  3P1M A;  1IYF A;  4BKG A;  2NBV B;  4C4V A;  3E9S A;  1SIF A;  1WGY A;  3ZQ4 A;  5DPR A;  5AUI A;  2GBJ A;  1LQB A;  2I2Y A;  1YQB A;  1QOG A;  1N5W A;  4DHJ D;  2WP9 B;  3DQV A;  1K51 A;  4JIO U;  3ZNG C;  1L0X B;  5AUK A;  2Y5P A;  3ZVV A;  2HDE A;  1J7A A;  3EC8 A;  1ZXH A;  2QIL A;  4GDK A;  2AL6 A;  4KX6 B;  2J53 A;  1JWU D;  2DZM A;  2WDR B;  2MBO A;  4WJP A;  1ZE3 D;  4CQN A;  3BK1 A;  1JCK B;  3L10 B;  2DZK A;  5JHA A;  2BTE A;  2IGD A;  5D94 A;  2K25 A;  3OWE B;  1P7E A;  4JQW C;  5CX3 A;  3V61 A;  3VUW A;  1V97 A;  1LO5 D;  1OTR B;  3GS2 A;  1WI0 A;  1TT5 B;  4OVZ A;  2LGS A;  2ASQ A;  2K3U A;  1ET9 A;  2JUO A;  1V9J A;  3ZTD A;  3APD A;  2IO3 B;  1F2R C;  3D32 A;  1FRR A;  2WLB A;  4BBN C;  1V6E A;  1YIW A;  1T3Q A;  2JYE A;  1VCB A;  2R2O A;  3DOW A;  2INP E;  4S0R A;  1FPY A;  4USA A;  3PS6 A;  2WXQ A;  2QEJ C;  3VR9 B;  2KC1 A;  5JH5 C;  1LGR A;  3NS1 A;  1RFK A;  2MBB B;  4DHJ B;  3TL5 A;  4IM2 A;  2LGY A;  4YSZ B;  3W1Y A;  1LXD A;  4PYU A;  1UWX A;  4YTM B;  4LDT D;  2GBN A;  4GSW A;  4N9F 4;  1A70 A;  3PVL A;  2JWZ A;  3VTU A;  4L2Y A;  4FXC A;  2I1J A;  2QIE B;  4TSS A;  3RI7 C;  3U7D A;  2MBQ A;  1N63 A;  3H8H A;  4ZYS A;  1C4P A;  3WAM A;  1T0Q C;  2WX0 A;  3RYT A;  2KQS A;  4KKJ A;  1AAR A;  1XLP A;  3DDC B;  1OEY J;  2KAJ A;  2GRI A;  2JPH A;  3EFU A;  2Z0D B;  3U7Z A;  1ZGU B;  3A4R A;  2KFK B;  1E10 A;  1WMH B;  3A9J B;  3K9O B;  3UI3 A;  2NPT A;  4RNA A;  1D6E C;  4DDI D;  4XZ4 A;  5G2N A;  2DBY A;  4MJS A;  4EKU A;  1N5X A;  5D3I B;  1RYJ A;  5D3D A;  3V6C B;  1GB4 A;  4NAW B;  2LVP A;  1F1H A;  2CKH B;  2JRH A;  4NAM A;  1MHH E;  2KTR A;  3AE4 B;  3X0W A;  4JL9 A;  3PTF C;  3BVM A;  2Y5B B;  3QK0 A;  2LWP A;  1WRI A;  1C1Y B;  3RUL A;  1VRA B;  4RFB A;  1SJH D;  2CR5 A;  4WH4 A;  1L6U A;  1C78 A;  3AE2 B;  2D3B A;  3QX1 A;  1WWT A;  1XD3 B;  3GE8 C;  3E56 A;  4B6W A;  4IG7 B;  2PPH A;  4LDT B;  3Q3N C;  3QAR A;  4K1R B;  4WAA A;  4C00 A;  2Z0E B;  1EWC A;  1EO6 A;  4GOC A;  4EZK A;  2H88 B;  4BBN F;  3DBL B;  4YXD B;  4GB9 A;  1C4C A;  1ZP0 B;  2IY1 B;  1E9M A;  4ASW C;  5E6P A;  3WCQ A;  1FEH A;  4W9C A;  1DOX A;  4HPM B;  2IBI B;  3NG0 A;  3Q6B A;  2FCN A;  2B76 B;  4EZJ A;  4K7U A;  1TTN A;  5DPW A;  2L32 A;  3CST A;  1STE A;  2W3R A;  2KD0 A;  1QLB B;  2DZI A;  4J6I A;  1E8Z A;  2M4N A;  1HEZ E;  3L54 A;  2JRI B;  3AB5 A;  4KVG B;  1MI0 A;  4TUU A;  1ZDX A;  4GU2 A;  3R7R A;  2N9P C;  4L23 A;  2K22 A;  3HM6 X;  4ANV A;  2FID A;  3R3M A;  2NCN A;  2IGH A;  2I38 A;  1V86 A;  5HFY A;  1XF5 L;  5IA7 A;  2V3N A;  2ZZP B;  4HJG E;  2KN4 A;  4K3B A;  3PSE B;  1JWB D;  2L3Z A;  2M17 A;  5G5H A;  2GMI C;  1N60 A;  4OZA A;  1QIL A;  3RNC C;  3OJ4 B;  1J8C A;  2XN9 C;  3V60 A;  1UBQ A;  1BXT A;  3ZJV A;  3B2F A;  2GB1 A;  4ZDV A;  3B08 A;  1FRD A;  3BVG A;  4M02 A;  2IPK D;  4OZC A;  3NZS A;  1Q5W B;  4IWQ A;  1R4M B;  1WXV A;  5FR3 A;  1BML C;  4B95 A;  1OFF A;  5EE3 A;  3KQ4 A;  5MPO A;  3U2S C;  2JY6 A;  2MRP A;  3Q14 C;  5AZG A;  2M0X A;  3Q8E A;  4RF0 A;  1K8R B;  4TMA B;  2K5P A;  1KJT A;  3R8B A;  2KZR A;  4G3X B;  4E74 A;  2BYV E;  2PEA A;  1Y56 A;  3TUO A;  4Q2J A;  2KJH B;  2XK5 A;  2A4Z A;  1GB1 A;  3Q8B A;  3X23 A;  4LNN A;  1EU4 A;  1SXT A;  2WYQ A;  3AE1 B;  2N4F A;  3RUI B;  2M19 A;  1V8C A;  1Q10 A;  4MT5 A;  4DXF A;  3AI5 A;  2KLC A;  3PRM B;  2KDB A;  1WX8 A;  2NBU A;  1IGC A;  2DAF A;  2LUE A;  2PE6 B;  2K1F A;  4JWS C;  1JWM D;  3DPD A;  4PS3 A;  5D7G A;  4MM3 B;  2AWT A;  5DPT A;  4XWW A;  2KK8 A;  1WXS A;  2D11 A;  4OVU A;  4W9K A;  3EGR A;  2ICI A;  3S2A A;  4WWN A;  1VJK A;  5IKC M;  1UWM A;  1I4P A;  4K7W A;  4FBJ B;  2QJL A;  4W9J A;  2L1A A;  3QIJ A;  1UD7 A;  3ZJU A;  4WAF A;  3W2D A;  1TIF A;  4A9A A;  4DXG A;  4YSY B;  4II3 B;  3WAP A;  2GOW A;  1L4D B;  2IO1 B;  4W9G A;  3AV8 A;  4NQL B;  1EF1 A;  2ZPY A;  3PLU A;  4E3C A;  3RZW C;  3ZW3 A;  1PGB A;  1KFY B;  2FE8 A;  4CHK A;  5BYQ A;  4OHJ A;  2WU5 B;  3DHG C;  1ZXI A;  3N3K B;  4JGH B;  5HI1 A;  2WNM A;  4X57 B;  2RDH A;  2JZP A;  3DVN V;  1NI2 A;  3M63 B;  2YEP F;  2MWS B;  5EE9 A;  1SE3 A;  2WWZ A;  2QMT A;  4GDL B;  4US8 A;  2KWC A;  3GZN I;  2NTS A;  4DHZ B;  1J7C A;  2L7R A;  2J4X A;  1BT0 A;  3JYU A;  1XEE A;  3L4P A;  1WJ6 A;  3ZXV A;  4FUL A;  2K8B A;  2WGS A;  4AQ7 A;  2A5U A;  2IO2 B;  2K6Q A;  4I6P A;  4XGA B;  3ENE A;  3KWL A;  3MHS D;  4B0E A;  1J7B A;  5BMH A;  4RGN A;  4HPP A;  2X38 A;  1TZ1 A;  1YN5 A;  4IUM B;  3AU4 A;  4M8N A;  1I4R A;  1NBF C;  3A1Q A;  4A20 A;  2BWE S;  2RDG A;  1F77 A;  3APF A;  3ZNI D;  2O6V D;  1NDD A;  1TZO A;  5CHF A;  4HKQ A;  2KO3 A;  2KLG A;  3AE3 B;  2AQ3 B;  3R66 C;  4I6N B;  1E7U A;  1E0Z A;  2LJ5 A;  3ZNZ B;  3MFG A;  2CHW A;  2FIF A;  1B9R A;  2KVZ A;  1WXQ A;  3HUI A;  3VUY A;  4S17 A;  4KSL C;  2O2V A;  2XBB C;  1TKY A;  3BYT B;  3TEY A;  4GMV A;  2WXJ A;  1E8X A;  4YTP B;  4PYZ A;  3AEB B;  3VRA B;  1WR6 E;  3SFE B;  4A90 A;  2PMV A;  4A3P A;  2JXX A;  4ICV A;  4AJW A;  3HHM A;  2ZVO A;  4WUR A;  3DHH C;  3PRZ A;  2DHZ A;  3LXF A;  1YX5 B;  2YLM A;  2Z59 B;  3SHQ A;  3H7P A;  1GJZ A;  3NVZ A;  2FCS A;  3A9K A;  3Q3O C;  4WQM A;  3QHT A;  4XYC A;  2J0J A;  1WM3 A;  2MP2 B;  4HKZ E;  2MQJ A;  1LM8 B;  1GG3 A;  4P1C C;  1WF9 A;  2C5L C;  1IBX A;  1SBB B;  2W9N A;  3Q3J A;  3DBH B;  5J17 A;  4BKS D;  3UIO B;  4L1B A;  3P4P B;  2M1M A;  3MHZ A;  4E71 A;  3VTW A;  2ZCB A;  2D2Q A;  1UH6 A;  4WIP A;  4KDI C;  2INC C;  3HVD A;  1MJD A;  3C0R B;  4IW0 A;  3RNA C;  1EUV B;  3SR6 A;  3T3N A;  1I4X A;  4WWP A;  1DOY A;  1YNT E;  2O6V B;  4ANX A;  3ETR A;  4MEM A;  5CTR C;  4C7Z A;  2BS4 B;  1I35 A;  3NZU A;  2WXG A;  2WU2 B;  1H8C A;  2KAC A;  3T8M A;  2J52 A;  3Q2A C;  4QAY A;  4N6E B;  2RR9 A;  3KYD D;  3DBH I;  3BZD B;  3AM9 A;  3KUC B;  3ZO5 B;  2KFK A;  3B2G A;  4B0M A;  2FUG 1;  1WRD B;  2M0A A;  1UBI A;  2D5G A;  1KLG D;  1ZDV A;  3ZRC A;  2LFI A;  1FD6 A;  3SU8 X;  2K8C A;  3RPF C;  2RD0 A;  4NAW A;  3P4S B;  2HTH A;  1FFV A;  2KFJ A;  2BBC A;  1A5R A;  3AED B;  2JWU A;  4URK A;  3UQA A;  2LHD A;  2W54 A;  1GOZ A;  1FNU A;  3AE8 B;  1IP9 A;  1YJ1 A;  2CS4 A;  3J9C A;  1JQ4 A;  2R61 A;  4RH6 A;  1UGM A;  1TJE A;  1AN8 A;  2TSS A;  2PVG C;  1WJ4 A;  4GN1 A;  1RLF A;  1AYF A;  1NEN B;  1V49 A;  3ALB A;  3RNF C;  2L0F A;  3ZDM C;  2DX5 B;  1C76 A;  2J42 A;  3KW5 B;  2LD9 A;  2N9X A;  3DBR B;  2MBE A;  4LNF A;  1LFD A;  4M0W B;  2EKE C;  1XXG A;  2HD5 B;  2CJO A;  1QKZ A;  4KIK B;  4N58 A;  1WH3 A;  2PLP A;  3AEA B;  4TQ1 A;  1MG4 A;  5C1Z A;  2AEH A;  4GLS C;  1V80 A;  2LXC A;  2MW5 A;  4KGS A;  3N32 A;  2WXH A;  3JW0 X;  4FAD A;  1VZ7 A;  1WE6 A;  3C19 A;  2MX2 A;  3PPA A;  4F7Z A;  3DHI C;  2LAS A;  3V05 A;  2EMT A;  2ZNV B;  2BS3 B;  4IC7 B;  3H7S A;  2GBM A;  1HZ6 A;  4WQO B;  4MGY E;  3MC0 B;  3DVG X;  1JRU A;  2DYB A;  3JSV A;  1QZE A;  2L05 A;  3O13 A;  1Q0W B;  2RMM A;  2ACZ B;  2OHF A;  3RCZ A;  3VTV A;  2D3A A;  2KJ6 A;  2JF5 A;  3PHX B;  3I5J C;  4YSX B;  2KNB A;  2L8J A;  4G0N B;  4C4V B;  2PTL A;  3I63 C;  2V3P A;  3DWM A;  1Q1O A;  2UYZ B;  4LLG M;  3HK0 A;  4AWJ A;  4MH0 E;  3KUZ A;  2BKF A;  2K39 A;  4FLH A;  5IP4 D;  2M56 B;  1IUE A;  2BW2 A;  5EE0 A;  3AE5 B;  3A33 B;  4B9K A;  4WWM A;  5BO4 B;  2MJD A;  1MVK A;  1OEY A;  2LHE A;  3SDL C;  2UWQ A;  1HA5 A;  2WXN A;  1J19 A;  3NUH B;  1ZUD 2;  3P42 A;  5I4D A;  1QQR A;  3N1Z C;  3AH7 A;  1HZ5 A;  2IDY A;  1SE9 A;  2KKC A;  1Y8R C;  3DCG A;  1SB3 C;  3Q69 A;  1P3Q U;  4PS7 A;  4AP4 C;  2KTF A;  5J18 A;  4KGR A;  4ANW A;  4DHZ E;  4ZHO A;  2GBK A;  3W5V B;  3H6N A;  4MGK E;  4RMA A;  1D3Z A;  1HQR D;  3VR8 B;  4LK0 M;  1JRP A;  5HKH A;  2ZVN A;  3V3X A;  5JXV A;  1WZ0 A;  1M94 A;  1P98 A;  1EM7 A;  1X1M A;  2KMM A;  2MJ3 A;  3ZJT A;  4ZRQ A;  1WYW B;  4BZA A;  2DLB A;  3ZNH B;  1WX7 A;  2LGI A;  4NQK E;  2PE9 A;  1JW9 D;  5AEK B;  2KWV B;  1I42 A;  4HCP B;  4ZYN A;  2KQ7 A;  4HWI B;  2WDQ B;  2IY0 B;  4K7S A;  1PYW D;  4FJY A;  5FR6 A;  5LLI A;  4WWO A;  2KN5 A;  3UIP B;  2WXF A;  4A55 A;  1UZX B;  3FIL B;  4PK1 A;  4WJQ A;  3Q3M C;  1JWA D;  4AJY B;  1MPE A;  1E8Y A;  1TS4 A;  5HHD G;  3L17 A;  4M8M A;  1YD8 U;  2BB6 A;  3PV1 A;  4AS1 A;  3DBL I;  1KLV A;  1WR1 A;  3ONS A;  3KH0 A;  1FXT B;  5G5G A;  2K6D B;  3N30 A;  1F0Z A;  2BVC A;  2AYO B;  3HRD D;  4HK2 A;  1C3T A;  4GDL A;  1WXM A;  2KOX A;  3PZ7 A;  4MH8 A;  1XCT L;  3AN1 A;  1ISN A;  5GMV A;  1CMX B;  2HJ1 A;  2V3S A;  4IKG A;  4NJC A;  2NPT B;  4II2 B;  2KWD A;  4FJZ A;  1GAQ B;  1PUT A;  3QA8 A;  2W82 A;  4NJ7 A;  3U52 E;  3AEG B;  5TR5 A;  3AE6 B;  4JLC A;  4MJS B;  1TKG A;  1WJN A;  3GP7 A;  5J2R A;  4C7Y A;  2C7N B;  3BY4 B;  4ACF A;  1DYQ A;  3BK2 A;  5IAA C;  4N59 A;  1KLU D;  4TKN A;  4EOY A;  3VAW A;  2KTR B;  3TEX A;  2DZJ A;  2NVU I;  1JML A;  3ZDT A;  2ONQ A;  1K53 A;  3H9D A;  2DNF A;  2WXR A;  2JQR B;  5BMG A;  4ARI A;  3MJW A;  4LJO B;  1SE2 A;  1CK1 A;  2INN E;  1V1P B;  1ESF A;  3QCA A;  4OW0 A;  1L0V B;  2W3S A;  5IN7 A;  1DGJ A;  4MGI E;  1E7P B;  1VR9 A;  3NS8 A;  2ZW0 A;  3B1L X;  4MDK E;  1R4M I;  4ARC A;  4AOF A;  1VZ6 A;  2QC8 A;  1N62 A;  4C56 C;  3CIR B;  1OQY A;  5IOI A;  3V62 A;  1RFA A;  2LRU A;  2ON8 A;  1XLQ A;  1TS2 A;  3M62 B;  1T5X D;  1EF5 A;  3JVZ X;  1UNS A;  1YN3 A;  2WQY B;  1WXA A;  3VH3 B;  3WA0 A;  1C79 A;  4LCD E;  4IWO A;  4HXD A;  3N1Y C;  2HTM E;  4DBG A;  5DCN A;  5E6J A;  4G11 A;  1H4R A;  3ZKJ C;  2WS3 B;  4FA6 A;  2WXI A;  2MCN B;  2N0S B;  2IYD B;  2KXJ A;  5T8I A;  3WIM A;  4EEW A;  2LEK A;  1I7H A;  1P1A A;  2BWF A;  4IWP A;  3KVF B;  4I6L B;  2Z8L A;  3VXW A;  4GIV A;  1YQ4 B;  4FHK A;  2ZJD A;  1CZP A;  2IZV B;  2LMC A;  4YT0 B;  2WXP A;  3ZRF A;  5LXH A;  2CU3 A;  1T0Y A;  3PZ8 A;  1YQ3 B;  3TEZ A;  1VDV A;  3DVN U;  3BYY B;  1E7V A;  3SFD B;  1UGJ A;  4DXA B;  1I4H A;  3PRP B;  3H1U A;  3M95 A;  1GC6 A;  4LNO A;  2PW9 A;  1ENF A;  1ZKH A;  4O1N A;  1UEL A;  2N9K A;  2PIA A;  4IM3 A;  4HLE A;  2MHJ A;  2H89 B;  3VDZ A;  3PLV A;  3R2I A;  1WY8 A;  4UDU C;  5JZE B;  2WX1 A;  3LJ3 A;  1U4A A;  2L52 A;  4FHJ A;  5G55 A;  4EE2 A;  3RNG C;  4F8C B;  4WJO A;  2XK5 B;  2VRR B;  3IT4 B;  1V5T A;  2RGF A;  1WGR A;  3VFK A;  5KHQ A;  3AE7 B;  3Q8A A;  1CQV A;  2V4L A;  3P4R B;  2JVC A;  3O65 B;  4F1S A;  1PGA A;  1XQQ A;  3IAM 1;  2CHX A;  2NR2 A;  3L16 A;  3OAW A;  1KM7 A;  3NOB A;  2V1Y A;  4HEA 1;  1R4N B;  3FKY A;  3EUB 2;  1WE7 A;  3EFC A;  1UUP A;  3SD5 A;  3WAO A;  2HJ8 A;  1ZOY B;  1C77 A;  4US9 A;  2REX A;  1SSN A;  3TMP B;  1NEK B;  1PFD A;  2EKI A;  3BIN A;  3ML8 A;  2XEW A;  1NYR A;  2Y5C A;  1V2Y A;  4P6V F;  3APC A;  3LYY A;  2G4S A;  4TV3 A;  1F9J A;  5KHO A;  4ANU A;  2ZPN A;  1NYQ A;  3AEC B;  3T3O A;  5C2T B;  1QOA A;  1YX6 B;  2YVC A;  2KX0 A;  1QOF A;  2V0G A;  3PGE A;  3BVZ A;  2V4I B;  4RM9 A;  1T0S C;  1K52 A;  3IT6 B;  3EHV A;  5BYS A;  2KT7 A;  4BAX A;  2GI9 A;  1KF6 B;  1D4B A;  3MJ5 A;  1BUI C;  3NVW A;  1AW7 A;  2AQ2 B;  3RN9 C;  3ZLZ A;  2L76 A;  1NI3 A;  1WMH A;  3A9J A;  4PS8 A;  4EUT A;  4XE0 A;  2L83 A;  2HE7 A;  5LXI B;  2PKO A;  1TY0 A;  2AL3 A;  2JYT A;  1ZPS A;  2D07 B;  4LNI A;  4DQO C;  2J0M A;  3R7Q A;  1E5W A;  1WJU A;  4EFO A;  1FXA A;  2BT6 A;  2PVO D;  2BQQ A;  2ZCC A;  3A1Q B;  2JZZ A;  5EDS A;  1FNW A;  3IXS A;  4RGM A;  4JE3 B;  2LUM A;  1D5Z C;  2J0K A;  2KX3 A;  2PJH A;  1P9D U;  2AQ1 B;  1QT9 A;  3UQB A;  3L0W B;  4RGT A;  3N20 C;  1WIA A;  2JSV X;  4TQ0 A;  2KQ4 X;  3OJ3 A;  2O2V B;  3TBL D;  4A8X C;  4K3C A;  4XDC A;  3IBE A;  4NNJ B;  3VHT C;  5BMI A;  2DEN B;  3IFW B;  2DWQ A;  3U30 A;  4ICU A;  2OJR A;  3CF6 E;  2K8H A;  2JZ3 B;  3WAN A;  1N6Z A;  4J3O D;  4KV2 A;  2BYT A;  3KYC D;  4W9I A;  3W1S C;  2LGX A;  4LNK A;  2C9W B;  3GE3 C;  1JWS D;  3QQ8 B;  1E8W A;  3H7P B;  2I1K A;  4DWF A;  1JAL A;  4MSQ B;  1TYG B;  1JRO A;  2IGG A;  5JHB A;  2LVQ A;  3A9K B;  2IND C;  4BKT A;  5FK9 C;  2QSD A;  3L13 A;  2NMQ A;  2W55 A;  2IO0 B;  1GPX A;  1WM2 A;  2BPS A;  5IO9 A;  2IJ0 A;  2EEL A;  1IBX B;  3HIZ A;  3MTN B;  2KC2 A;  2L0T A;  3ZXR A;  4NY0 A;  1FXI A;  3CSF A;  3RZF A;  4JX1 C;  3AEF B;  4P7I A;  2JX5 A;  5LNK 1;  1RRB A;  4ZRP A;  2G9H D;  3B9J A;  1WGK A;  2RSU A;  3DBR I;  2KYW A;  3RD2 A;  1RAX A;  3FIL A;  1N61 A;  3BWU D;  1T6B X;  3FC4 A;  2BB5 A;  2LJI A;  1I4G A;  4FN2 A;  4GGQ A;  2YEP B;  2GLS A;  2WDT B;  3TIX A;  2KDI A;  2Y3A A;  1C4A A;  1E90 A;  3Q8F A;  3AUL A;  4BFR A;  1SIJ A;  2N7J A;  2CJN A;  4ZOH C;  1GUA B;  4BOZ B;  5EE1 A;  4YTN B;  1WZ3 A;  2DAJ A;  4WJN A;  1IGD A;  5TSS A;  4KZC A;  1GNU A;  2R2Q A;  3ZIM A;  4AUQ C;  5L83 A;  4JPS A;  1MFW A;  4KZ0 A;  2NBW B;  4GDK B;  2BYE A;  3CMM B;  4W9E A;  1HXY D;  2BGF A;  3AEE B;  2BKR B;  2ZW1 A;  1FNV A;  3RT3 B;  1SJE D;  1FM0 D;  4PT5 A;  1R7S A;  4KDL B;  1WSP A;  1J0G A;  4NPN A;  3DBS A;  3AMZ A;  3QC8 B;  3LDZ E;  2BS2 B;  1G6J A;  4W9F A;  1UF0 A;  2G4D B;  1MHX A;  2LVO A;  1D5X C;  4IOI E;  3IG3 A;  4HVB A;  1QF6 A;  4KGT A;  5C23 A;  2D3G A;  1IPG A;  3P63 A;  4LJP B;  1KOT A;  1QOB A;  1NVI D;  2C7H A;  2KDF B;  4CYE A;  4HRS A;  3HVZ A;  2DYO A;  1OQR A;  5D6J B;  1V1P A;  1EWY C;  2K0P A;  4W9D A;  1WFY A;  4G50 A;  2LI5 A;  1FCL A;  2E6X A;  4BVU C;  2N7D A;  2FUH B;  4MM3 A;  1RWS A;  1VLB A;  2EMS A;  2Q5W D;  3VVW B;  4LTU A;  3GB1 A;  3I3T B;  1M4V A;  2DYM A;  4C80 A;  5C3J B;  1TY2 A;  5D2M B;  1V5O A;  5BYR A;  2N1V A;  2LGD A;  2MSE D;  1FIQ A;  1HTQ A;  2ZNV C;  5FKA C;  2KMA A;  3N9Y C;  2G3Q B;  3VQI A;  3I57 A;  3K9P B;  5H8Y E;  2GBR A;  3RFZ B;  2K9X A;  2QDF A;  2SAK A;  1TS3 A;  2D10 A;  1P7F A;  5GXG B;  2FBW B;  3JSV B;  2G1E A;  3PZD A;  4ZHP A;  2MA9 B;  3CWI A;  3Q8C A;  4P16 A;  4CO7 A;  3IVF A;  2MJE A;  2C7M B;  4DDG D;  1Z5S B;  4DK5 A;  3PRE A;  3PHW B;  4A3O A;  3QJZ A;  3QWZ B;  1D5M C;  2LXA A;  3FAH A;  2ZEQ A;  1Z2M A;  2WXO A;  1SF0 A;  1V81 A;  3KLS X;  4W9H A;  2OED A;  4RF1 A;  4FJV B;  1L2N A;  4A6Q A;  1WYG A;  3T9L A;  4MAC A;  3RNB C;  4HDQ A;  4H2A A;  5E6N A;  1TGZ B;  3AXC A;  4OZB A;  3ZYY X;  2N9L A;  1KH0 A;  2NS5 A;  4KKI A;  2L00 B;  4YWG G;  1WGD A;  2VZK D;  1XT9 B;  5H92 C;  2RDB C;  3ECI A;  4HRO A;  2N1W A;  3KWV A;  2CHZ A;  2JXT A;  2KWU B;  1HTO A;  3I9V 1;  4NZL B;  3ZTC A;  2OJW A;  2FCQ A;  4W9L A;  5E6O A;  2XNA C;  3GOE A;  3Q3F A;  1RM6 C;  2UU7 A;  1L4Z B;  3URY A;  4M00 A;  4HCN B;  4RCO A;  2WXL A;  3DWG C;  1P0R A;  1GC7 A;  1AWD A;  1OGW A;  2CU1 A;  2B3A A;  1XLN A;  1PDX A;  1HE8 A;  1KTK A;  3EA6 A;  2KDM A;  3W1S A;  3QAQ A;  3VUX A;  3HM3 A;  2RPV A;  1XO3 A;  3VH4 B;  3A4S C;  2WHI A;  4P1B C;  4EZL A;  3W5U B;  3M3J A;  1OQQ A;  3GZN B;  5CHV C;  3U8Z A;  5AZH A;  2MP2 A;  3ZUN A;  2E3T A;  5HG2 A;  4RM8 A;  3PT2 B;  3KUD B;  3ML9 A;  3TCA A;  2KJR A;  4GXB A;  2MH7 A;  2KDE B;  3B0A A;  4MEL A;  3NHE B;  1L5P A;  1S1Q B;  4D2K A;  2VH1 A;  1YN4 A;  1VZ8 A;  3RMK C;  3ABV B;  1YOV B;  2RPQ A;  4HPL B;  1E6E B; 
#chains in the Genus database with same CATH homology
 3DVG X;  4KVG B;  4TUU A;  1JRU A;  4GU2 A;  1TBE A;  2DYB A;  3JSV A;  3R7R A;  3UGB B;  1QZE A;  2KVR A;  2L05 A;  2O6V A;  2N9P C;  1Q0W B;  1YX6 B;  2KHW B;  2YVC A;  5AZF A;  2KX0 A;  3HM6 X;  3PGE A;  3RCZ A;  4ANV A;  2FID A;  4RM9 A;  3L08 A;  3VTV A;  3R3M A;  2NCN A;  2KJ6 A;  2JF5 A;  3EHV A;  3PHX B;  1V86 A;  5IA7 A;  2ZZP B;  2KNB A;  2L8J A;  4G0N B;  4MSM B;  4XC2 A;  3PSE B;  4BOS C;  2MLB A;  4HDO A;  1MG8 A;  2L3Z A;  3ZLZ A;  2L76 A;  2M17 A;  2GMI C;  1WMH A;  3A9J A;  4PS8 A;  4EUT A;  4ZRJ A;  1Q1O A;  2UYZ B;  2HE7 A;  3HK0 A;  3OJ4 B;  4AWJ A;  5LXI B;  1J8C A;  2JT4 B;  1UBQ A;  2BYF A;  2AL3 A;  3V60 A;  4MH0 E;  3KUZ A;  2BKF A;  2K39 A;  3DVG Y;  2D07 B;  4K81 A;  4ZDV A;  2J0M A;  4FLH A;  3R7Q A;  3B08 A;  1E5W A;  1WJU A;  4EFO A;  1VD2 A;  4MGZ E;  5DPS A;  2ZCC A;  3A1Q B;  3NZS A;  4OVV A;  2JZZ A;  3A33 B;  1Q5W B;  2G45 B;  4IWQ A;  2C60 A;  1WXV A;  5EDS A;  3WAL A;  4B9K A;  1WGH A;  4B95 A;  5CHW A;  5BO4 B;  3OLM D;  1SGH A;  1WX9 A;  1OEY A;  2JY6 A;  2QHO A;  2LRW A;  2MRP A;  5AZG A;  2J0K A;  2M0X A;  2KX3 A;  3SDL C;  2PJH A;  1K8R B;  2UWQ A;  1P9D U;  4YL8 A;  1J19 A;  3UQB A;  1KJT A;  3L0W B;  4E74 A;  2KZR A;  4G3X B;  2BYV E;  2PEA A;  1WIA A;  2KJH B;  2XK5 A;  4NJ6 A;  4TQ0 A;  2A4Z A;  1SE9 A;  4ZRI A;  3OJ3 A;  2O2V B;  3TBL D;  3X23 A;  5L95 C;  2KKC A;  4BKS A;  2MBH A;  1Y8R C;  3DCG A;  3IBE A;  4NNJ B;  1PQS A;  1L7Y A;  2FCM A;  2WYQ A;  3VHT C;  2N4F A;  3RUI B;  3TJP A;  1P3Q U;  4PS7 A;  4AP4 C;  2KTF A;  2DEN B;  3IFW B;  5J18 A;  4ANW A;  3AI5 A;  3U30 A;  4DHZ E;  2KLC A;  2GBK A;  3EEC A;  4ICU A;  3H6N A;  2BF8 B;  2OJR A;  3PRM B;  3CF6 E;  2K8H A;  2JZ3 B;  2KDB A;  1WX8 A;  1ZW7 A;  4MGK E;  2NBU A;  4RMA A;  3WAN A;  1D3Z A;  2DAF A;  2LUE A;  2PE6 B;  4KV2 A;  3KYC D;  4W9I A;  2K1F A;  4ZRK A;  3DPD A;  4PS3 A;  3W1S C;  3NY5 A;  5D7G A;  2LGX A;  2AWT A;  2OOB B;  5DPT A;  3UIN B;  5HKH A;  2KK8 A;  2C9W B;  2N7E A;  2ZVN A;  1WXS A;  2D11 A;  4OVU A;  3QQ8 B;  4KSK C;  1E8W A;  2J7Q B;  3H7P B;  2I1K A;  2LZ6 A;  4KIK A;  4W9K A;  4MSQ B;  1WZ0 A;  1M94 A;  1P98 A;  2FNJ B;  4DWF A;  5JHB A;  2LVQ A;  3S2A A;  4WWN A;  3A9K B;  1X1M A;  4BKT A;  3L13 A;  4K7W A;  4FBJ B;  4W9J A;  2IO0 B;  2KAN A;  1WM2 A;  1WYW B;  1UD7 A;  2BPS A;  3QIJ A;  1WGG A;  3ZNH B;  1WX7 A;  3HIZ A;  3MTN B;  2KC2 A;  4NQK E;  4XX5 A;  4II3 B;  2PE9 A;  3WAP A;  2L0T A;  5AEK B;  1I42 A;  2KWV B;  2GOW A;  4NY0 A;  1S3S G;  4HCP B;  4ZYN A;  2IO1 B;  4W9G A;  2KQ7 A;  4HWI B;  2IY0 B;  3CSF A;  4K7S A;  4FJY A;  5FR6 A;  5LLI A;  4NQL B;  1EF1 A;  4WWO A;  2ZPY A;  3RZF A;  3PLU A;  2KN5 A;  3UIP B;  3RZW C;  3ZW3 A;  3IHP C;  4E3C A;  4P7I A;  2N9E B;  1UZX B;  1RRB A;  3UF8 A;  4WJQ A;  4AJY B;  2RSU A;  4CHK A;  1E8Y A;  3DBR I;  3RD2 A;  1RAX A;  2M8S A;  3AU5 A;  3L17 A;  4HJK A;  3P2B A;  4M8M A;  2KMC A;  3N3K B;  4JGH B;  1YD8 U;  4X57 B;  3PV1 A;  3DBL I;  1KLV A;  4FN2 A;  4GGQ A;  3DVN V;  1WR1 A;  4IM0 A;  1NI2 A;  3M63 B;  2MWS B;  2WDT B;  3KH0 A;  3ONS A;  3TIX A;  2KDI A;  1R4N I;  1E90 A;  1FXT B;  3AUL A;  2WWZ A;  4GDL B;  4BFR A;  2K6D B;  2KWC A;  3N30 A;  3GZN I;  4DHZ B;  2L7R A;  3V6E B;  1BT0 A;  3JYU A;  2FAZ A;  1GUA B;  4BOZ B;  2AYO B;  1IYF A;  4HK2 A;  1C3T A;  4GDL A;  1WJ6 A;  1WXM A;  2KOX A;  4FUL A;  4BKG A;  1WZ3 A;  2NBV B;  2DAJ A;  1SIF A;  2K8B A;  1WGY A;  5DPR A;  2GBJ A;  1LQB A;  4WJN A;  1ISN A;  2A5U A;  2IO2 B;  2K6Q A;  4I6P A;  5GMV A;  1CMX B;  3ENE A;  2V3S A;  4KZC A;  1YQB A;  1GNU A;  4DHJ D;  2NPT B;  3MHS D;  4II2 B;  4FJZ A;  3DQV A;  2R2Q A;  3ZIM A;  4JIO U;  3QA8 A;  4AUQ C;  5L83 A;  4NJ7 A;  4KZ0 A;  3ZNG C;  1TZ1 A;  2NBW B;  3ZVV A;  5TR5 A;  4GDK B;  2BYE A;  3CMM B;  4IUM B;  4JLC A;  4MJS B;  3AU4 A;  4W9E A;  4M8N A;  1WJN A;  2BGF A;  1NBF C;  5J2R A;  3EC8 A;  2BKR B;  3A1Q A;  2C7N B;  3BY4 B;  3RT3 B;  4A20 A;  4GDK A;  2AL6 A;  2BWE S;  5IAA C;  4KDL B;  3APF A;  3ZNI D;  1J0G A;  4TKN A;  4NPN A;  2O6V D;  3DBS A;  4EOY A;  1NDD A;  3VAW A;  2KTR B;  2DZM A;  5CHF A;  2DZJ A;  2NVU I;  3ZDT A;  2MBO A;  2KO3 A;  3QC8 B;  3LDZ E;  3H9D A;  2KLG A;  1G6J A;  4WJP A;  4W9F A;  3R66 C;  4I6N B;  1E7U A;  2G4D B;  2LJ5 A;  3ZNZ B;  3L10 B;  2LVO A;  2CHW A;  2FIF A;  2DZK A;  5JHA A;  5D94 A;  2K25 A;  3IG3 A;  3MJW A;  4LJO B;  4HVB A;  4JQW C;  5CX3 A;  3V61 A;  3VUY A;  3VUW A;  5C23 A;  2D3G A;  1IPG A;  1OTR B;  4KSL C;  4LJP B;  2O2V A;  2XBB C;  1KOT A;  2C7H A;  1WI0 A;  2KDF B;  4CYE A;  3QCA A;  4GMV A;  2DYO A;  5D6J B;  1E8X A;  4MGI E;  4PYZ A;  1WR6 E;  2ASQ A;  3NS8 A;  4W9D A;  3B1L X;  1WFY A;  4G50 A;  2JUO A;  4MDK E;  1V9J A;  3ZTD A;  3APD A;  1R4M I;  2IO3 B;  4AOF A;  3D32 A;  4A3P A;  2JXX A;  2LI5 A;  4BBN C;  1V6E A;  1YIW A;  4ICV A;  4BVU C;  2N7D A;  4AJW A;  2FUH B;  3HHM A;  4MM3 A;  2EMS A;  2ZVO A;  1OQY A;  3V62 A;  3VVW B;  1VCB A;  3PRZ A;  1RFA A;  2DHZ A;  2LRU A;  1YX5 B;  2R2O A;  2YLM A;  2Z59 B;  3SHQ A;  3I3T B;  3DOW A;  3H7P A;  1GJZ A;  2FCS A;  2DYM A;  3A9K A;  3QHT A;  3PS6 A;  2J0J A;  3M62 B;  5D2M B;  1V5O A;  1WM3 A;  2MP2 B;  1EF5 A;  2N1V A;  3JVZ X;  2MQJ A;  1LM8 B;  2LGD A;  2KC1 A;  5JH5 C;  2MSE D;  1GG3 A;  1WXA A;  3VH3 B;  1WF9 A;  2C5L C;  3WA0 A;  4LCD E;  4IWO A;  4DHJ B;  2MBB B;  4HXD A;  2W9N A;  3Q3J A;  2ZNV C;  3TL5 A;  5J17 A;  2KMA A;  4IM2 A;  4BKS D;  2LGY A;  4DBG A;  5DCN A;  3UIO B;  2G3Q B;  3W1Y A;  1LXD A;  4PYU A;  2M1M A;  4E71 A;  3VTW A;  2ZCB A;  4G11 A;  3VQI A;  2D2Q A;  1UH6 A;  1H4R A;  4KDI C;  3ZKJ C;  3K9P B;  4LDT D;  2GBN A;  4GSW A;  4N9F 4;  2GBR A;  3C0R B;  4IW0 A;  1EUV B;  3PVL A;  4FA6 A;  2JWZ A;  3VTU A;  2D10 A;  2MCN B;  2I1J A;  4WWP A;  2IYD B;  2KXJ A;  3JSV B;  3PZD A;  3U7D A;  2MBQ A;  2MA9 B;  2O6V B;  3WIM A;  4EEW A;  4ANX A;  1P1A A;  2BWF A;  4MEM A;  4IWP A;  3KVF B;  4CO7 A;  3WAM A;  3IVF A;  5CTR C;  1I35 A;  4I6L B;  2C7M B;  2WX0 A;  3RYT A;  4DDG D;  1Z5S B;  2KQS A;  3NZU A;  1AAR A;  3VXW A;  4GIV A;  3DDC B;  4FHK A;  2ZJD A;  1OEY J;  4DK5 A;  2IZV B;  3PRE A;  1H8C A;  3T8M A;  3PHW B;  3ZRF A;  2JPH A;  3EFU A;  4A3O A;  5LXH A;  3QJZ A;  3QWZ B;  1T0Y A;  2LXA A;  2Z0D B;  1ZGU B;  3A4R A;  2KFK B;  2ZEQ A;  3DVN U;  1Z2M A;  1E7V A;  1WMH B;  3A9J B;  2RR9 A;  3K9O B;  2NPT A;  3DBH I;  3KYD D;  4DXA B;  3KUC B;  3PRP B;  3H1U A;  3ZO5 B;  4DDI D;  2KFK A;  1V81 A;  4XZ4 A;  3M95 A;  4W9H A;  5G2N A;  1GC6 A;  1WRD B;  4FJV B;  1L2N A;  3T9L A;  1UBI A;  4MJS A;  4EKU A;  1ZKH A;  4HDQ A;  1UEL A;  3ZRC A;  5E6N A;  3V6C B;  1TGZ B;  3AXC A;  3SU8 X;  4NAW B;  2K8C A;  2LVP A;  4IM3 A;  4HLE A;  2NS5 A;  2CKH B;  2L00 B;  3VDZ A;  3PLV A;  2JRH A;  1WY8 A;  5JZE B;  2RD0 A;  2WX1 A;  3LJ3 A;  1U4A A;  1WGD A;  2KTR A;  4NAW A;  2HTH A;  4FHJ A;  1XT9 B;  2KFJ A;  1A5R A;  3ECI A;  3X0W A;  4JL9 A;  5G55 A;  3PTF C;  2Y5B B;  3QK0 A;  4URK A;  3UQA A;  2LWP A;  4F8C B;  2N1W A;  4WJO A;  2CHZ A;  1C1Y B;  3RUL A;  2KWU B;  2XK5 B;  2CR5 A;  1IP9 A;  1YJ1 A;  2VRR B;  3ZTC A;  2CS4 A;  2FCQ A;  1V5T A;  2RGF A;  4W9L A;  5E6O A;  1WGR A;  3VFK A;  1UGM A;  3GOE A;  3Q3F A;  3QX1 A;  5KHQ A;  1WJ4 A;  1XD3 B;  4GN1 A;  4B6W A;  1RLF A;  4IG7 B;  4HCN B;  2PPH A;  1V49 A;  1P0R A;  3ALB A;  1GC7 A;  4LDT B;  2L0F A;  1OGW A;  2V4L A;  3ZDM C;  2CU1 A;  2B3A A;  2JVC A;  2DX5 B;  3QAR A;  4K1R B;  3O65 B;  3KW5 B;  2LD9 A;  4F1S A;  4WAA A;  1XQQ A;  2N9X A;  2MBE A;  2CHX A;  2Z0E B;  1HE8 A;  2NR2 A;  1LFD A;  3L16 A;  1EO6 A;  3OAW A;  4GOC A;  4M0W B;  4EZK A;  2EKE C;  3W1S A;  2HD5 B;  4BBN F;  1KM7 A;  3QAQ A;  3VUX A;  3HM3 A;  4KIK B;  1WH3 A;  3NOB A;  4TQ1 A;  4GB9 A;  2V1Y A;  2IY1 B;  3VH4 B;  3A4S C;  5C1Z A;  4ASW C;  2AEH A;  5E6P A;  4EZL A;  1V80 A;  1WE7 A;  3M3J A;  2LXC A;  3SD5 A;  3WAO A;  2HJ8 A;  4W9C A;  2MW5 A;  5CHV C;  3U8Z A;  5AZH A;  4HPM B;  2MP2 A;  2IBI B;  3ZUN A;  2REX A;  4RM8 A;  3TMP B;  3N32 A;  2FCN A;  3JW0 X;  4EZJ A;  4FAD A;  1WE6 A;  3PT2 B;  3BIN A;  2MX2 A;  3ML8 A;  3PPA A;  4K7U A;  3KUD B;  2XEW A;  3ML9 A;  1TTN A;  4F7Z A;  1V2Y A;  3TCA A;  2KJR A;  4GXB A;  5DPW A;  2LAS A;  2EMT A;  2ZNV B;  4IC7 B;  3APC A;  3CST A;  2KDE B;  3B0A A;  4MEL A;  2KD0 A;  3H7S A;  3NHE B;  2DZI A;  2GBM A;  1S1Q B;  2G4S A;  4J6I A;  1E8Z A;  4TV3 A;  2M4N A;  3L54 A;  2JRI B;  4WQO B;  1F9J A;  5KHO A;  4ANU A;  4MGY E;  2RPQ A;  2ZPN A;  4HPL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...