3KHCA

Crystal structure of escherichia coli alkb in complex with ssdna containing a 1-methylguanine lesion
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
207
structure length
207
Chain Sequence
b'PWQEPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKAEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGKKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase alkB
publication title Structural and mutational analysis of Escherichia coli AlkB provides insight into substrate specificity and DNA damage searching.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase/dna
total genus 49
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2009-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3khcA00
4NJ4A 2FDFA 3BI3A 4ZS3A 4QKFA 3RZKA 3RZJA 4QKBA 4O61A 3O1PA 2FD8A 3S5AA 4NRQA 3BUCA 3I49A 4NPMA 3O1SA 3KHBA 3O1VA 3O1UA 5DABA 5F8PA 3LFMA 4IE0A 2IUWA 2FDGA 4NRMA 3T4HB 3H8XA 4NIGA 3T4VA 3I3QA 3RZGA 2FDIA 3KHCA 4MG2A 4IDZA 4IE5A 3H8OA 2FDKA 2FDHA 3S57A 4NROA 3BKZA 3BIEA 2FDJA 4QKDA 4IE6A 4NIHA 4CXYA 3RZLA 4JHTA 3RZMA 3H8RA 3O1TA 4O7XA 3I3MA 3O1MA 4CXWA 4NRPA 3O1RA 4IE4A 3BU0A 4MGTA 3BTXA 3BTYA 3I2OA 4CXXA 4QKNA 4NIIA 4IE7A 4NIDA 4RFRB 4ZS2A 4QHOA 3BTZA 4OCTA 4ZHNA 3T3YA 4NPLA 3O1OA 3RZHA
chains in the Genus database with same CATH superfamily
1H6YA 2ZZJA 1S0FA 2R7EB 4XBLA 3W5NA 4HT1T 2V4AA 3OGSA 1UPSA 4PJYA 3H1WA 3ZYRA 1LOGA 1HJFA 5K4LA 1J1TA 3U07A 3WVJA 2ZGRA 4I30A 2B4KA 5GLWA 3SHRA 4QKBA 1UZZA 3ORJA 2VPVA 4XHBA 5FZ1A 3LSDA 2FD8A 2Y26A 4N53A 3C7OA 1RUG3 1H6XA 3SCGA 1JUHA 4JTNA 1MR5A 1AZDA 2PN5A 4KBBA 1S0EA 3NNJA 4BDVB 2PHXA 4GJYA 1VLNA 5JUVA 2HBUA 3LFIA 1CR7A 4D7TA 4AEDA 4M0HA 5IVYA 4MHUA 5FPVA 4I09A 5FK7A 4MXWA 3T1LA 3SKVA 4ASKA 3O1VA 1W6PA 5LA0A 1RUD2 1CAXA 2JKXA 5IT6A 2OVUA 4A6SA 2GN7A 5IVFA 1WCUA 3LOIA 3TEZA 2Q8CA 5AC92 1FMD2 4XZUG 4DOUA 3RPQA 2D7FA 3ZN6A 2CAUA 5EJ3A 1OLMA 5HCFA 2GSYA 4LO4B 3P3PA 4O9GA 4RS5C 2D6LX 3HNMA 2W3JA 5FZ6A 4QHZA 5K9YA 5BNNC 1AL22 2XR4A 2OPKA 1F5FA 2VBBA 4AHYA 1UXZA 1H1MA 2C0ZA 2XMLA 3NJVA 4DUXA 4GULA 4JGZC 3PU3A 3N9NA 1QXRA 4ZU5A 5CA6A 4XVHA 3J8F2 2W68A 5CISA 5CVRA 4XJWA 2BV4A 2FDHA 3BPSA 1RUG1 5LA2A 4FPLA 1ZA7A 2QFEA 5FO8B 2IXIA 1RB8G 2OPWA 5LK5A 3NKTA 5F3EA 1YWKA 2VTFA 3J7MA 3THPA 4P00B 5GM0A 2R073 3CZJA 2VH9A 1AR62 3LDRA 1ND3A 1NXMA 4K3UA 1R1ZA 5ISLA 3UGHA 1GQPA 2VBPA 1OLME 3ZXFA 4AL9A 2JG9A 2VAUA 4NMIA 2DFBA 2W1SA 2WR9A 4CU8A 1GWMA 3GYDA 4Z8BA 3POGA 5DAXA 1GNYA 1ZNPA 3O1TA 3D6EA 2CGPA 2V5YA 4XFHA 3WNXA 2FHRA 1HV0A 2DUPA 4IV3A 1CJDA 5CYYA 5DUWA 5H9SA 5IATA 2XQRA 1KFXL 2ZXQA 4EV0A 3LEKA 4FTBA 1C5HA 3LDBA 3WDTA 4LHSA 3LCPA 3PVBB 4QB1A 2YU2A 3OPZA 5A3UA 5JZGC 5DPNA 1SPPB 4UW3A 3OYWA 1N1SA 1RXFA 4QX7A 2VZRA 3I2OA 2WL1A 1EYBA 4A4AA 2VC9A 1WZXA 4TWTA 4NR1A 4L11A 3PIGA 2CL2A 1JHJA 2WDBA 5T50A 5EFUA 1PZ9A 3W20A 5DZFA 4H2AA 3WDWA 1JS9A 3BVCA 2PFWA 1OURA 3NV1A 2QE3A 2R071 1W28A 2CY6A 5T54A 5F5QA 3MIGA 3LSEA 5FIXA 2OIIA 5C3RA 4DEVA 2ZGUA 2D6OX 4LK6A 4QGLA 4QX5A 4QXHA 3VDCA 4DUVA 5A3TA 1LOFA 1QH7A 4BQ5A 2YY1A 3CKHA 5EYYA 1PO23 4FPGA 1PGW1 3NKGA 3MW3A 1PX3A 2JB8A 3A7QA 3MIFA 3MYXA 3J7HA 4KG8A 4Q8LA 1BMV1 1K3IA 5FP4A 1UD1A 1GV9A 2JENA 1RUG2 1TG7A 3KF3A 2NP0A 4FPJA 4QMAA 2ZACA 2VZSA 1OQDA 2SBAA 4P5HA 3LA3A 5FJHA 3FJSA 3GZAA 2ZGPA 4MGQA 1PMJX 2B7YA 5KC6A 4UBHA 2Y6LA 3KHBA 3TNQA 3H8UA 1VAVA 3DV8A 4BQ1A 1LAJA 2ADEA 2ZTNA 1RUJ2 1JBCA 1OHFA 2VXRA 5IVJA 5FBZA 1Q56A 2D97A 4QX0A 2WN2A 1PZ7A 3OUIA 5FYMA 2PHTA 1TZOA 1PM4A 4CEYB 2WBKA 3AZWA 3RYKA 3S6PA 4EZHA 1AX1A 2AZ5A 1HRV3 2BQPA 5AFBA 2A6ZA 5BYNA 1RL3A 3KT4A 4D6RA 4BLJA 1VP6A 4NPRA 4L0PA 1CJPA 1U12A 3EB7A 4FPEA 4CPBD 4HLTA 1PZ8A 4LHNA 1GLHA 2DUOA 1LB2A 3OG2A 1VALA 3LA2A 1H8TB 5FMBA 3T0AA 4Z92B 2YYOA 1WWYA 3LIHA 2JECA 2EXIA 3LWCA 4QPIC 1WW7A 3H1YA 4IV1C 4M3CA 3TBDA 1DYOA 4AVTA 4B8EA 1XBFA 1MS0A 1MZ6A 4PDWB 1NCRA 1EPZA 3ZYHA 3ZXAC 3BIEA 1CX4A 5A33A 2Q8EA 4FQZA 3AJYA 1QF3A 2NMNA 4AVVA 1GU3A 2AGSA 4BA6A 4JV4A 4Y1YA 2A7AA 4YW4A 5JR7B 3DKQA 3CBNA 3I54A 1UKRA 4PI0A 5FYBA 2R043 3I3MA 1RHI3 3GHNA 1UZ0A 2R061 2ZKNA 3GGLA 1MZFA 3V64A 3I2GA 4QU2A 2VUAA 2ADDA 2TNFA 1HRV1 3SMHA 2VZ1A 4YVSC 2FCTA 4M4RA 1HB1A 1RUI2 1S55A 3RNSA 2X05A 2O1QA 1B35B 4ZY9A 2C24A 1DQ0A 1G8WA 1SHWB 3KWVA 2C1FA 2K46A 2LRPA 1GSLA 1QJU3 2WNUA 3KB5A 3QCWA 4BZ4A 4QT6A 3GZUC 4CEWB 5IFPA 4M3CE 1SDWA 1IS4A 1W8FA 5L7OC 5I0RA 5FUPA 4XFIA 2W46A 4P5YA 5FZ8A 4GH4A 5FYSA 5IVBA 1O3TA 1VRH3 1WMEA 3E97A 3P6BA 5H9PA 2CHHA 5KR7A 5BNPB 3AB0A 4NIIA 3VD3A 1MQTC 5J96B 1NLSA 2JD9A 3MIDA 4Z1VA 4NIDA 1IPSA 4XYXA 2ZMLA 3R4DB 3I2JA 4OI4A 1QJY1 2WNVA 3IT8A 4Q27A 1YXWA 4LJHA 4A45A 4NPLA 5C6CA 1UYYA 2B42B 3JZVA 3K4ZA 1FV2A 4IEQA 4RR3C 5KHGA 3HT1A 2PHRA 4O65A 4G9SB 3S30A 3K48A 2NYYA 3ILFA 4XFBA 1R64A 1OSGA 3I2DA 5FCCA 3RS6A 3RRDA 4AZZA 5KXEA 2RHPA 3T2QA 1W6OA 1PO22 1RHI1 1AYN3 1V0AA 2ZAHA 4ARXA 3AXEA 5F7UA 2AC1A 5DUXA 1QQP3 3VDDB 5F6LB 1ULPA 2EVXA 2WO7A 1S0CA 1V6LA 1ZRIA 1ZBA2 2KM2A 1D7PM 3QBQA 4Q4W3 3DUIA 3PDQA 2VQAA 3I49A 5E8AA 3I2HA 3OBAA 1QJU1 5FZ3A 1MEC3 1KRIA 5A80A 3O1SA 4OFGA 4H55A 2ID4A 1LHOA 3MHZA 1GZTA 1VRH1 3W58A 2VZ3A 3ITQA 1S1AA 1Q8VA 4QB6A 2IZWA 4CDXC 1PK6A 4CDUA 2HEWF 2D6MA 2PHDA 2ZX0A 5CKQA 1I6XA 2IUWA 4FAGA 2YG0A 5FUIA 4JQRA 2UY9A 1PVC3 1ZA4A 3ZMNA 3T4HB 1HRV2 1W2AX 4R9CA 1C4RA 2OUHA 1OKOA 4GB33 4W6YA 4WM8A 2R32A 3AYAA 5ACA3 4QPWA 5E6HA 2GC3A 5EV7A 3I59B 3KLSA 5LRSA 4WZCA 3JB8A 1DZTA 3I3EA 5IK5A 4YLZA 4Q8KA 3ZIXA 1AYN1 1O3QA 1QQP1 2ZX1A 4LBKA 3U0ZA 4IE5A 1AYM3 2R0HA 2VL4A 1UKGA 1LGNA 3CU7A 3WG1A 4KWLA 4AGGA 4Q1PA 5G05L 3MUZ1 4DXZA 1NLQA 3IM0A 4IGPA 1EPWA 2WO3A 4XTPA 1AXYA 4CDQB 1YYNA 4P08A 2F4PA 4Q4W1 4XF3A 3ZFGB 2PLV3 3IPVB 2VD7A 4FPOB 2FDJA 4N43B 2BW8A 1MEC1 3C7EA 4ATFA 4LLOA 2I2SA 3BYWA 5FY0A 4PHZA 3V56A 1O3SA 2Y8KA 2VW0A 1OH4A 1REDA 3MEPA 1XE7A 4Y20B 3H0OA 5T5PA 3O0WA 3USSA 1JZ4A 2R042 2RS33 4O7XA 3SITA 2R30A 1US3A 3KQRA 3B02A 2YDEA 1E57A 4MVTA 2DCYA 4OHYA 1PVC1 4JGYC 1RTVA 2WQZC 1BXHA 3J26N 4MZUA 4I3GA 1TMF3 3VBSB 3AP4A 1VBC3 4KU7A 4WM7B 3HT2A 4J1XA 3ZDSA 3W5MA 4ZXEA 2Q5TA 5FY9A 3T08A 1CWPA 5GLUA 4NVPA 4AXOA 1QJU2 3CL1A 3ZOIA 3DXTA 5JCTA 5A7WA 1WW6A 2A6YA 4BIOA 5LCWL 4OQ8A 5A6XA 4IEPA 1OVPA 3OGJA 4LBMA 4UXAA 1KEXA 3HN1A 1AYM1 1IG3A 3K46A 4GWJA 5BNOB 1UF2C 3WF2A 4TN7A 1W8HA 4AI0A 4CZSA 4DFSA 1U5YA 2JG8A 3JBG3 3LA7A 4HETA 4A6OA 3LKJA 3VD7A 3TN92 4CP1A 1C8M3 2IVIB 2JWPA 2IXKA 1W2TA 3I3BA 3BCWA 4GA9A 4FBFA 2VUJA 2DU1A 2J7MA 4AF9A 3JUUA 5C71A 1ZBE2 4IERA 3RZHA 3PUIA 2X5IA 2C6SA 4HK8A 5FZEA 1JYCA 4ZXKA 1AYN2 3WNOA 1QQP2 5FZBA 2HWC3 2RJ2A 2W91A 4IXLA 3AVSA 2QQMA 1VAKA 3FMGA 1KQRA 4MO3M 4Q0QA 4AHZA 5FZHA 3AYEA 3DCQA 2BUKA 1U5XA 2GMEA 4Q4W2 4Y5SA 3VBFC 5F37A 4XDQA 5J1XA 5FWJA 5C4WC 3VBUA 4YZ5A 1XXNA 4ZZ8A 1NA1B 5K0UB 4D6QA 1JYWA 5EHDA 5F1RA 2DVBA 5KXCA 1ONAA 3MFAA 5T5OA 1OC1A 1UX6A 5GJ6A 1ZRDA 3P1IA 1FNYA 1ASJ3 4JKLA 5JI7A 1WLTA 3JBG1 3URFA 2XHKA 2WJSA 1UL9A 1CIYA 3FL7A 4OI0A 1C8M1 1W9FA 1GP6A 1UX7A 4GB32 3E5XA 1YQ8A 1XNKA 4KMQA 1VBD1 2J1TA 2VULA 4K1ZA 5IAXA 1A34A 1CX1A 4WV8A 3MLKA 5JAXA 3ZYFA 2FZ2A 1L3JA 3WF3A 5FR3A 1GMMA 4UF0B 5C8WA 1DBNA 1E5SA 2E9QA 2XL7A 3OPTA 2QQIA 3VBRA 1GBGA 2GZWA 1BVVA 2HWC1 1LHVA 1QH6A 5FMCA 3M3OA 3ACHA 4R4XA 1PM7A 4G3YC 1HN0A 5GLZA 2A3WA 2Z79A 3N9QA 5FZAA 1QDCA 1AL0G 3RJRA 3SNMA 2P3IA 1DQ6A 2VTXJ 3EO6A 1AXZA 1XC6A 3ZFEB 2PLV2 4EN8B 2D98A 1ODMA 1JMUB 2Y0OA 3M8LA 4ORFA 2OX0A 3N9MA 1NCQA 4Q0SA 1X7NA 1J58A 2JEMA 4BB3A 5FDBA 3OUHA 5JOWA 5CKNA 3B01A 2D44A 2RS32 2VZUA 1ASJ1 4Q5OA 1XSQA 2PMWB 4DXRA 5FUNA 4NE9A 5IJRA 5C9AC 3DF0A 4NAMA 2LS6A 4XPVA 4CUAA 4FFHA 5IUQA 4JDNA 3HBZA 1O4YA 2EALA 4COWA 1TMF2 3AZZA 1N1VA 2YBKA 1VBC2 4QD2A 1CZSA 1K5MC 2CYFA 3AMHA 1OQ1A 4AK3A 2VE1A 4D0QA 5ANQA 3T0BA 2Y38A 5FY4A 5DAQA 3BTXA 3POIA 1RJ7A 2Q30A 2B5HA 2BERA 3GJBA 3UGFA 2BGCA 2VOXA 1NE6A 2XVKA 1F4AA 5D1IA 5FPXA 4XABA 1K42A 2ZGKA 1W0NA 4LNVA 2RMU3 1RGSA 5J36A 1NCRC 4QKNA 2UYBA 1GZCA 4I0BA 4AW7A 1WD3A 4B7EA 5FZ7A 4Q4Y3 3JBG2 5A3WA 5G04L 3RZJA 1C8M2 4RHV3 5AVAA 3N36A 3WNLA 1R092 1ULDA 2EXKA 4IL7A 5A32B 4P9JA 1V6IA 2RDNA 1YFWA 3PMSA 2ZEZA 2MNGA 4W65A 4W50A 5LATA 2OA2A 2OW4A 3ZVXA 2UWAA 2VJXA 1HW5A 2HWC2 1PNFA 1RUH3 2J42A 4XJ8A 1YJKA 2OZ6A 2UY8A 4GIQA 1RMU3 2C9KA 1H2KA 3CQOA 3PMEA 4XXPA 3RG0A 4UWDA 3EYPA 1XJAA 2HEVF 1L7QA 3BUCA 1HRI3 1YQCA 1D0HA 4KL1A 4N9HA 4XW3A 1T2XA 1L7LA 1LULA 2DVAA 1LJ7A 2D3SA 1W6NB 2WWSA 2WZ8A 1PGL1 5GZEA 1W06A 3EHKA 3U75A 4D94A 4XMAA 4YYOA 5CKMA 3FX3A 2RMU1 2YFZA 3GALA 3RJ2X 1Q43A 4L92A 4EN9B 3SH5A 1ASJ2 2ZOEB 2CGNA 1TNFA 1VBE3 3T2TA 4C0HA 2E31A 2XKOA 4Q4Y1 2EXHA 3S5QA 3M3EA 1FX5A 5LW9A 1QDOA 1XNTA 3IDCB 4RHV1 3LF7A 2ZZQA 5JSPA 3LEMA 4M4PA 4LKFA 4ES9A 3HNBM 3POYA 4PIZA 5IVEA 1CPMA 2PAMA 4BQ2A 2RV9A 5GZGA 4N7IA 3KQ4B 1HXS3 2XWJB 1XNCA 3AMQA 2J1EA 3IWZA 1N3PA 1RYYA 3VBOB 4XACA 1DYKA 4A3ZA 2GALA 4PLOA 3RMYA 2F4LA 3E6CC 1SPPA 3BU7A 1POV0 1RMU1 1XYOA 1QOSA 3TAYA 3HPNA 3PUHA 3ETQA 1HRI1 3VDBA 2GNDA 3VD5A 5F3CA 2K0GA 4Q29A 4Y33A 1J84A 2VW2A 1SBFA 1FMD3 1E5RA 3C3VA 3AP7A 3IIAA 4AI2A 4BCUA 4H7LA 4S2DA 1S4CA 3NAPB 4XC9A 2QQVA 3EJKA 2XG3A 4HXCA 3VHRA 2ZPXA 3E6BA 3ZXLA 4C91A 5K8SA 1WMDA 3MLJA 3KGLA 4KG0A 4OUMA 1RVF2 1OT5A 1VBE1 1AL23 2IXHA 2TEPA 4B29A 3O1RA 4MLOA 2ZBJA 4ET7A 1WBLA 3ES4A 4F7ZA 1RUC3 1S0GA 4OMCA 4DRRA 1CPNA 2UYAA 4RGGA 1QJX3 4CUCA 4K6BA 2JIGA 4LBQD 4BJ0A 1DHKB 2WT2A 5F5AA 1UQXA 4EYUA 1HXS1 5T3NA 1PGL2 4CVUA 4E2GA 4HL0A 2DUQA 2J1SA 5EQUA 5AFEA 4K20A 3FBYA 3FWEA 4OZXA 4XBNA 1AR63 4XUOA 4LO8A 2D6KA 2HLEA 3KCYA 3POBA 4QPYA 4Q4Y2 3FBMA 1QHDA 4RFRB 4RGAA 3H42B 4HVRA 2WFF2 5C7GA 5C8CA 4CEYA 5ACA2 3VBHC 3CDZB 3NRUA 1I3HA 4FP2A 2WSVA 3RZZA 2Y6JA 5AC91 1OMIA 1FMD1 2PHWA 3D3AA 1E5IA 1UU5A 2B39A 3HQXA 1U0AA 2VZOA 3AL5A 2DCJA 1SZBA 4CCLA 2BGPA 3VV1A 4HN0A 5ABJC 4AI3A 1UZYA 4QKFA 1L7RA 3U78A 2JDYA 1A8DA 2JXAA 4LITA 1AL21 1GYKA 3WHUA 5B4NA 2YB7A 3WW4A 1RUH2 4LBJA 5CB7A 1RUC1 2PAEA 2B9UA 1RMU2 2A6XA 5L9VA 1LECA 1QJX1 3IDEA 2JDMA 2OUJA 1HX6A 3M70A 2JE9A 1H8TA 2Y6GA 4AFBA 1D4M2 3RYPA 4RS5B 1LR5A 3WQBA 2LUWA 2O8OA 2LROA 1HV1A 1RC6A 2XLGA 4WVMB 5BNNB 5FXXA 4NN0A 4PDWA 1YC61 4QQ2A 3ZX7A 4XF1A 3MW4A 4CU9A 2ZGLA 3MUY1 4TSVA 4YPJA 5DAVA 5LZ6A 4JGZB 1AR61 3KGZA 1XU1A 2O14A 2P2KA 1VBE2 4IEUA 1NG0A 2Q1FA 2C9AA 4R9BA 4YZ4A 2VZQA 1LU2A 2XKPA 3VKFC 1C57A 3E1F1 4CCOA 2YUEA 1OXCA 1DGRA 1QXJA 5JPNB 4N9IA 3ZMOA 5CIRA 1FI2A 3I8TA 4XEZA 5CFDA 4AHWA 4GWNA 1ZREA 5BPXA 3T4VA 1M4WA 1F9KA 1HDKA 1DU3D 2XONA 1HXS2 2HH9A 1JZ6A 2QBXA 3IB3A 2WSUA 2XBO2 4CCEA 2NN8A 1B35A 2WIIB 4BQ3A 4CCJA 2Z42A 3POFA 4CEWA 1X8EA 1EP0A 2P1BA 3MI8A 4JHZA 2E51A 4LT5A 3K75B 1P8JA 1CD3G 4JZRA 4IW3A 3VN4A 4TYSA 1F15A 3VBUC 1F35A 4YVWC 2XQXA 3MPPG 4OHZA 1RUJ3 3H9AA 4D7SA 5BNPA 5LEJA 1FPN2 2X53S 4COZA 3RFRA 4CP9B 4FAHA 2WWUA 2C4XA 4FOVA 4FPHA 2H0BA 4XF4A 5H9RA 3KMHA 3GBGA 5CG8A 4PF1A 2E32A 3ZSJA 1SFPA 3FLPA 1KDKA 2JE8A 3C8XA 5IWFA 5EIYB 5JZGB 2IXJA 4LA3A 3VZKA 3ZN5A 2BNOA 2WA3A 1CN1A 1WA4A 2VMGA 4XJUA 1LNSA 4Y4RA 2RDSA 1Z7S3 3LAGA 5A6ZA 1DGLA 2VCBA 1UXXX 4Q4V3 2G1MA 3O1MA 4NRPA 5KHHA 5DDJ2 3H50A 3UKVA 5DUVA 1RUC2 3FHIB 5D8AC 4W6WA 1RITA 3WY6A 3DGTA 1QJX2 5FZ4A 3HEIA 3VDDA 4GZ9A 2VCCA 5IHRA 1U5IA 3RDIA 4BM8A 4FVVA 5EJ1B 1XRUA 4C1XA 4YM2A 1AHSA 2HWF3 4QPGC 2D43A 1T6GC 2PYTA 2W9XA 3W21A 1AX2A 2ZGQA 3SCHA 5CBLA 1DFQA 2QQKA 3KT7A 2V09A 1VJ2A 5HBAA 1J3RA 5JOZA 4YZ3A 4ZS2A 1RUJ1 1BBT3 4XZPA 5DQ0A 5FZDA 1MZEA 3BIWE 1JW6A 1TQ5A 4RQPC 4W6XA 5FY1A 3KV4A 5B2GB 4YM0A 3OD0A 4X6QB 5JDBA 3HN3A 3H3ZA 2FDFA 4K21A 3GZEA 5JR2A 3SXWA 5FZOB 5FK8A 3PVEA 4DXSA 1RUI3 1SLIA 1YQ6A 2BVBA 3I59A 1Z7S1 4I02A 4W8JA 4Q4V1 3SH3A 3ZM8A 3IIIA 4HKWA 4ISRA 4QXBA 3NJXA 3GNEA 2J1VA 3PJYA 5FREA 2GAUA 2PQSA 4CUBA 4RL7A 4COVA 1ZRRA 3GF6A 3UT0A 5C3QA 1XOYA 3JQXA 4M3CF 4EN6B 4LHKA 4COUA 2P17A 1SEFA 5HCHA 5GZFA 5FBJA 4CDQA 4D69A 2VMEA 2HWF1 3ZFGA 3NQHA 2OXBA 3IPVA 4E9KA 2Q1ZB 4N43A 4P9XA 1YFYA 2A75A 2HWD3 4GD4A 4P9GA 5FYTA 3F95A 1W8OA 4Y20A 4R9AA 2I07B 3B9CA 3NO8A 4HKOA 2W94A 5GALA 1BBT1 2WNEA 4QPIB 3TEXA 1CGPA 2W1WA 3U11A 4IV1B 4NHYA 3CZUA 2PHLA 4ZKTB 4FFFA 4TXWA 3VBSA 5GLTA 2JDHA 3ZN4A 4WM7A 4CP0A 4XMIA 5L9BA 2FDIA 1ZBA3 2XH6A 3AM2A 3HOBA 2XJUA 4A3XA 1RUI1 5CZKA 4AWDA 2ET1A 2ZMKA 1BJQA 1ZZ9A 4IDZA 4LPLA 2DWRA 1UU6A 4SBVA 5FY7A 1UCXA 3TYJA 3WF0A 2R16A 5FKCA 5F39A 3A21A 2WWJA 5BNOA 5BV6A 5I93A 3UNPA 4YVSB 1QXPA 4K8RB 1YO8A 3DPRC 5DN2A 1F8VA 4RFT0 3WCSA 3M4FA 1EAH3 2IWGB 2ZABA 3WW2A 4AFAA 2P4EA 5FOJB 1X9TA 2GC0A 4IE6A 2EIBA 5L7OB 1JZ3A 3AP6A 2WAOA 4ITCA 2HWD1 3JB4C 1NKGA 1UY0A 1HIXA 2BWCA 3H8RA 1Z7S2 4E2SA 4Q4V2 1LENA 1MQTB 3LQCA 3NV4A 4LO7A 4U2AA 3MW2A 4EWEA 1G6NA 3POWA 2J1UA 4KGGA 2VU9A 4QQPA 1PO21 4JAAA 2P6HA 1ZZ7A 4ZZ5A 1SLBA 2DTWA 1OOPC 2PXJA 4RR3B 1ZBA1 2HWF2 1AF9A 4E8CA 4QQLA 4FOWA 5FFOC 1TME3 3MF9A 3J9SA 3GBWA 5C70A 1OFNA 5K0UA 1NA1A 2R1DA 3D4KA 3GCXA 3PTRB 4V2WA 3W59A 4LBNA 1NT0A 1VB2A 1JZ2A 4AQTA 5FPZA 1IQDC 1J83A 4LK7A 3T0DA 4AFMA 1BBT2 2B8MA 2BGOA 1H2MA 4P02B 2VNVA 1VMJA 2WFPA 5DZGA 1VB4A 1EUUA 1GQGA 1EV12 4RA0A 3KD4A 5HXVA 1EAH1 1NZCA 2WO1A 2GMMA 1S0IA 4B4RA 4YG6A 1SCSA 3WCRA 3WF1A 3ZR5A 2XJQA 1GP4A 5L73A 2OZJA 1W8NA 3WG3A 1MVEA 3WV6A 4BXSV 2W1QA 2JDUA 3ILRA 3VL9A 4DY3A 5I0DA 5EWSA 4CDXB 4UF0A 3AX4A 5CFCC 5J3UA 5KXBA 1XSRA 1LGBA 1V00A 1S0DA 2JX9A 5HV4A 2WS93 5BXXA 1CESA 1NOVA 2CTVA 3H3LA 3LB9A 5FZFA 4AI8A 2A1XA 4TZDA 1GZWB 3HBKA 1OUXA 2XGXA 4LR4A 5DUUA 2VG9A 1JYVA 1JU3A 5JSOA 1UIKA 1F4HA 4J6GA 4LQRA 3ZFEA 3TN93 1JZ5A 2XJSA 1TME1 4HONA 2ZHKA 2I74A 4XCBA 1XB9A 1HQNA 2HWD2 3SEEA 4LLFA 1ZBE3 2VQTA 3JCIA 2OT7A 5FXVA 2GH8A 5KWRA 1IZ3A 3UKNA 4INDA 1W2NA 1OD5A 1SFNA 2VNGA 2FDGA 2R041 2WT0A 4LE3A 1NXD1 4PLMA 1W3VA 5EYXA 3WP5A 3H8XA 2ZCWA 1LOCA 1YFUA 4A41A 3CJIB 4PI2A 3PLQA 1DCSA 4PF5A 3VGIA 1GWKA 3MO4A 2DVFA 2P3YA 3ZN6B 1JYIA 3ZFFC 5GKAC 3HQUA 1OA4A 1WGPA 5LY1A 2P3JA 1OBNA 2J1RA 1POV3 1XE0A 4QQHA 2P37A 2WQ8A 4BU2A 2J22A 2JDZA 2WS91 5KHJA 4JGYB 2YBPA 2ZHLA 4ES8A 4FI9A 1XU2A 2VGDA 1HLCA 1SLTA 4FP3A 4E4SA 1GOHA 1AXKA 1W8TA 3MV11 3P3NA 3R6SA 1ZZ8A 4FT8A 1US2A 4QHBA 3T2OA 3FHAA 1EAH2 4W4ZA 5EZWA 3TN91 1NX9A 1FT9A 2PHUA 5A32A 3EXUA 3ZPOA 1LHNA 3DYMA 3OBTA 4CDWB 3RZLA 5FZGA 5FYZA 4IGQA 4D6SA 1BK0A 1DQ5A 1ZBE1 4Y1XA 5J09A 5CFDC 3HVDA 4N53C 2VZTA 1KITA 1WCSA 3VZJA 5FPBA 5M0TA 3N3HA 3Q8CA 2ZX4A 4AEDC 4AQSA 3FC0A 1H9WA 5I0SA 1TME2 4B4QA 1R083 1BZWA 2WA4A 4LBQB 1ULGA 1W6NA 4AQ2A 1V70A 4KI5M 4XAAA 1ALYA 1POV1 5FQ0B 3ASIA 1W9SA 1YUDA 2E53A 4RSUA 1Q8PA 4FTSA 2QQPA 3IKWA 3DYPA 3I2KA 3PUAA 3A23A 2X10A 5F2WA 3WG2A 4AVAA 1YRZA 1BEV3 1UWWA 1SG3A 3VBFB 2R0FA 5I8TA 4X8NA 1ZZBA 5K7PA 2Y6KA 2UWBA 3LOBA 5C4WB 3NV3A 3DEMA 3ECQA 1BVP1 2ZGOA 2LALA 4C1WA 2DU0A 2ZA9A 4NJ4A 3U1XA 5JOXA 4GB31 2R1BA 4XIKA 2D5FA 3CO2A 1YNAA 3N35A 1KJRA 5KBFA 5HCAA 1WKYA 5T55A 1LEMA 2JIJA 3FFQA 2D5HA 5FZMA 4GAZA 4XTMA 5E88A 4H14A 3VBOA 2WS92 3PUQA 4A7YA 1G9AA 3ZSMA 2VMFA 1QWRA 4GJZA 4B3NA 1Q8OA 1V9U2 1IKPA 2NM1A 4CPBA 4RD7A 1VBA3 1ND3C 5J98B 3RI9A 5KHIA 4P14A 3ZXKA 2BNMA 3H3UA 3PL0A 4HZFA 4YW5A 2JG9C 1WMFA 1Y4WA 3WNPA 1R081 2VM9A 1AR83 3UGGA 3AYDA 4O9EA 2PLV1 1Y43B 2VECA 2DBIA 1CAUB 2JD4A 1R093 4HBNA 1Y3TA 1G86A 1WLCA 2P5BA 3B93A 4QX1A 5F2SA 5DABA 3INAA 3J4UH 4FTEA 3WSOA 1SLCA 5FY8A 3U14A 4IUGA 4IV3C 1BEV1 3THTA 2RS31 2CV6A 3QH7A 4PQQA 1W90A 2YXSA 2A71A 5JMCA 2CGOA 5E89A 4AEMA 4DB5A 3K3NA 5C3OA 1TMF1 3S7EA 3I3QA 1VBC1 3AKRA 3IDBB 1W39A 4OQ9A 4X6RB 1XQNA 1W6QB 4BISA 2D3RA 4LBOA 3WQ1A 4BQWA 4KQ7A 5HI0A 2F17A 1H4HA 1D0GA 3IBMA 4YW7A 3KV9A 4HVOA 3ZXDA 3UETA 5C9AB 1GP5A 4PIXA 1QGLA 1VAMA 1J3QA 2XWBB 4Y1ZA 2FDKA 1VR3A 1FNZA 1BKZA 4JDOA 5FAXA 1K5MB 3AKTA 3KVAA 3BKZA 3NNGA 4MHRA 4PLNA 1V6KA 3PUSA 1GKBA 5EPAA 3MZHA 3GCWA 4QKDA 5DG1A 1JZ7A 2O0OA 2XJRA 3ACGA 1AR81 1JTZX 4EN0A 1F5JA 1ZYBA 3ALQA 3POEA 4FO9A 5A7NA 1R091 1LOFC 4B1MA 2A6WA 3TWIA 4YGDA 3VKLA 5A7OA 1HQLA 1RIRA 1MS3A 2H6BA 1KS4A 4Q0PA 1ND2B 1ENRA 4LUMA 4N90A 3UJQA 5B4XA 3ACLA 5FYHA 3TEWA 2C26A 4YZ2A 4UFJA 1IS6A 2LTNA 1K12A 4TTGA 1RUE3 1R082 1UYZA 2ARCA 2VBDA 4WVMA 1ZZCA 2IXLA 5BNNA 3KSCA 4Q0UA 1W04A 4OI1A 2GU9A 4IESA 1HB3A 3ZDVA 3OPWA 2HWE3 4MGSA 1WD4A 2IC1A 3VUOA 2Z2SB 4C8DA 2X8KA 4JGZA 4LHLA 5JXGA 3IAQA 1W6MB 4BLIA 4EN7B 1BEV2 3HR9A 2QKDA 1RVF3 2ERFA 3V0BB 1JXNA 3ZO0B 2CNAA 4BQXA 2YPDA 2IVJA 1BLZA 1YCIA 3TB0A 1I9RA 1N3OA 4YWAA 3BI3A 2J1AA 1MS1A 2GNMA 5LB6A 3CEWA 4A7KA 3RZKA 4WBBA 4TLGA 4CCDA 4HKLA 3LIGA 2Z4FA 1D2SA 1LEDA 1QIQA 4FPKA 1CAWB 3VZMA 3AKSA 3T30A 2XJTA 3MIHA 5GLVA 5FZ9A 4E4ZA 1QKQA 1VBA2 3FE5A 2AR6A 3HIFA 3HWJA 4R4ZA 4UFLA 3WG4A 5CNAA 2RM22 4CP9A 4CU7A 4WVZA 2WFF3 1AR82 1PMIA 2VVEA 3MPBA 1GWLA 2WT1A 1IQAA 4KWKA 3V65A 3LPGA 1CQ9A 3AMMA 4D3WA 2UU8A 2Y0IA 1TEIA 2A3YA 3MLLA 1X8MA 3J7LA 5JZGA 2D3PA 4JTOA 3K3OA 4Y24A 1W8ZA 4BIFA 4A42A 2CWMA 3OB8A 2B9VA 1S0BA 3E5QA 3OUJA 4MOAA 3B7MA 1NLRA 1HN1A 3RMXA 1RVF1 4NRMA 3OGGA 3FUOA 4HVQA 1YI9A 2RS13 1IG0A 1SLLA 2E33A 2IFWA 3VZOA 2WNUC 2IXCA 1AX0A 3RGBA 5ANNA 1UMIA 5TSWA 3JU9A 1DP0A 1N1YA 5FPLA 1D4M3 2YGMA 3UESA 4GH4C 2E7AA 2CDPA 4MG2A 5GZCA 4Q4X3 1QNWA 1UO9A 1WLWA 2YPJA 2ZGSA 3OEAA 5FPAA 4BOWA 1UY3A 1WCKA 1YJLA 2JDNA 3H8OA 1MS9A 1A3KA 5LASA 2WC2A 2WAAA 2WNVC 1T6BX 4NWVA 3S57A 4GXLA 4XHXA 2CSGA 4YG3A 4F8AA 3ACFA 1H0BA 3SC7X 2XLFA 4MYEA 3WP4A 2WFF1 5A3LA 1H1AA 1DZRA 4BK4A 5ACA1 1ZRCA 2BWAA 3AP9A 3KF5A 2BZDA 2QZ3A 4TLFA 4FPFA 2JJ6A 5I8SA 1W2UA 3RZMA 5LBBA 4YW2A 1WW5A 1A78A 3UK9A 4XILA 4LKSA 1AR93 4XJAA 2Q0AA 5FZOA 4F83A 2X29A 2XBO3 1JHNA 1Q5OA 2NQYA 2ARAA 4FSJA 5JPMB 1S2KA 2UWCA 2ZEYA 4YW1A 1ACCA 3VBHB 1RUH1 4NIAA 3PU8A 1IS3A 5CADA 1D4VB 5FP8A 1NQJA 1RUE2 3O7OA 2WO2A 1D4M1 1FPN3 3M1HA 4KWUA 3TOJA 2B45X 3QH6A 5ABJB 1HKDA 2E6VA 5JXJA 4Q4X1 3WQ0A 1PK6C 4CDUC 2HWE2 1ZZ6A 5A7QA 4BQ4A 1AJOA 2I45A 1SCRA 3NSTA 2YZ4A 2HWB3 3QOPA 4LUKA 4WVWA 4B4PA 1OA3A 4WM8C 2WUHA 4P9LA 4XUTA 4GKXA 4QPIA 4BMEA 1PO12 5DDJ3 4OMDA 3N7MA 4IV1A 1WMXA 2BEOA 3OY8B 4MADA 1Q3EA 4C90A 1VMHA 2WKKA 3E5UA 3MGUA 1DZQA 4QX3A 1H4GA 2YBSA 3OTFA 3ZIWA 1FAYA 1QJFA 1ZVFA 1H2NA 1UIJA 2N7GA 1UY1A 3DXUA 2JICA 1O59A 4NUBA 5F6KA 3F2ZA 4ASMB 3WXPA 2D93A 3ES1A 5JSRA 2ARXA 4P9IA 2WINB 1QY4A 2XBO1 4P9WA 4EROA 2WABA 3U4XA 1ULFA 2Y33A 3N7KA 5FYCA 3WP3A 1W9WA 1IGOA 1I5ZA 2PELA 3FUQA 5ERLA 4UFKA 2DV9A 3ZSLA 3UYJA 4GMP0 1Y7BA 2ZHNA 4LEJA 4NHLA 3ZKUA 4AVBA 4YVSA 2MHFA 5FMDA 1FPN1 4K9SA 1EUTA 3PURA 3ABZA 1YFXA 1ENQA 4BYYA 2R49A 4K1YA 2QQWA 2RDRA 3AJZA 2XHNA 3HQRA 2FZ1A 1KD7A 1OF4A 4RGKA 5CG9A 1W8WA 1E5HA 1OPMA 5F8PA 5L7OA 3RWNA 4L97A 4Z2AA 5IYYA 4N8MA 4AVCA 4SLIA 2GN3A 3I2FA 1XYPA 1COV3 2ZGTA 4YVWB 5IK8A 5FMOS 4PIYA 4XJZA 4KBZA 2RS12 3LZZA 2VOTA 3WDXA 5DDJ1 3AMNA 1XPWA 5CAZA 3AC0A 2GC1A 3H7YA 3JQWA 2KA3A 1Z78A 2QVSB 2HKXA 2XJPA 3KVBA 1V6OA 2E63A 2R6QA 2Z69A 3MDPA 3GM8A 1YIFA 4D7YA 1A6CA 4RR3A 4DNYA 1H1IA 4Y22B 4AOCA 3A0KA 3RQ0A 4MGYE 4Q4X2 4AAPA 1LESA 3K2OA 2JG8C 1GQHA 5D8AB 4YM1A 1FYUA 1LTEA 1N1TA 2V73A 5A7PA 4XFAA 2QDNA 3UL2A 2WYFA 5FXZA 1G9BA 2DCKA 4XDPA 2MEV2 2VUDA 2X5IC 2ZEXA 2TBVA 3A22A 1DDLA 4QPGB 1QOOA 4YRDA 5LA9A 3G6JB 1J1LA 4OZOA 4S2HA 3T1MA 4NIHA 5KC5A 3B5LB 2MPFA 1WA6X 4AEJA 4GKYA 1PHMA 2WYSA 1AR92 1R1A2 3SEPA 2YC4A 3VL8A 4BK5A 4AFCA 1LOAA 4RQPB 4LBLA 4L99A 1LOEA 4N7UA 4BE3A 4BQYA 4FFIA 4QDSA 2VTXA 2QCSB 3ZLIA 2ORXA 4KH9A 2VUCA 3N4MA 2Q4SA 1GZWA 2IFRA 1ZM1A 2D6NA 3AP5A 2CWSA 4CSWA 4XCAA 1G9FA 3AVRA 4I01A 4GWMA 2XB6C 3NNMA 2ENRA 3PVNA 1SMVA 1REFA 5T52A 3PNAA 3W9AA 3WOGA 2FMYA 3L2YA 4OHWA 3AZYA 1OKQA 1H30A 4UFHA 4E8DA 3I4IA 4IE7A 4FXGB 4GALA 2ATFA 4OYUA 2HWB2 1W0OA 3J7NA 5LEKA 4DO0A 5A3OA 5EJZB 1GR3A 2EAKA 1W99A 3BTZA 3NNFA 3IAPA 4ZHNA 2Q1MA 3GXUA 3M3IA 1QNYA 4LKEA 3T3YA 3ZSEA 4AYUA 3PJQA 4ZU4A 4DIQA 4OHVA 2PHFA 3ZYIB 1AR73 1GOFA 3B00A 3CJIA 1SACA 1C1FA 3VBRC 3BN6A 1UOFA 5FP7A 3O12A 4L2NA 2SLIA 1CAVB 1S0JA 3ROUA 3ACIA 4DRVA 1OVSA 2VMDA 1OA2A 4NHXA 2NPIA 1DF0A 2PTMA 5A1AA 2W2IA 4FXKB 4UYBA 3KV5A 4HK9A 1J59A 4JGYA 4NRQA 1KJLA 1JN2P 3H1MA 1SBEA 1W0PA 3LD8A 4UW4A 1NCQC 4QU1A 1VE0A 4YGBA 3U4SA 2YV8A 3I3DA 4FOQA 3T09A 1AVBA 2ILMA 1EV13 3N9LA 5F5CA 1N3QA 5JOYA 2CAVA 3WX5A 4BH9A 1REEA 1BCXA 3K4AA 4UAPA 3D0JA 4CDWA 3N9OA 3VD4A 1QJEA 4CE8A 2WQ4A 5FZCA 2RR13 3MFCA 4FOYA 1COV2 1JYNA 5LBEA 5J48A 3USUB 1YIPA 5A1LA 2AH2A 2XJVA 2GP3A 2A5ZA 3DPRB 4G4FA 1LCLA 1LOBA 2W5FA 2ZX3A 4OVEA 2QUOA 5JVVA 1C5IA 3KV6A 5FYIA 2BJSA 2BU9A 4WZFA 2V4VA 2DDUA 1AR71 3FHQA 5FKBA 1JH5A 2EAAA 4J25A 3FN9A 4I3PA 1Q8QA 2VW1A 4XBQA 5F5IA 2NMOA 4LBQA 2BRTA 2ZGMA 4IGOA 1DQ4A 4LIUA 3I2IA 2WZEA 3DKWA 3R0RA 5DAWA 3IN9A 5FQ0A 1HJGA 1APNA 2YHJA 4FQ4A 3T2PA 2H0VA 1JOPA 4MX3A 4NROA 5JXIA 4E2QA 1DGWX 1OOPB 2FCVA 3ZYBA 1G9DA 3V0AB 4QM9A 1QOTA 1DIWA 3VBFA 3QACA 4HANA 3OOXA 1GICA 1DYPA 4EQVA 4WVVA 3TNPB 5C4WA 3VZLA 1EV11 3B94A 4RN5A 5HPOA 4QB2A 2DVGA 2YMZA 3O14A 3DL3A 1ZRFA 1Q8SA 4ZONA 1YEWA 3M7AA 4DINB 1UZVA 2JDKA 1LKNA 1C8NA 2RR11 4HPKB 3TEYA 2VZPA 4MV2A 2WN3A 3KT1A 2GMPA 3O5SA 4JKMA 4QXKA 4Y5TA 5D2AA 3IZOA 1JOBA 2BBAA 4Y1VA 1F31A 3Q8AA 4OUSA 3FLTA 2RJKA 1OFSA 4AAXA 4UW5A 5JLVA 1ENXA 4JC1A 5J7MA 3BU0A 1SQ4A 5CU1A 3KZ4C 1ULCA 4HN1A 1RXGA 1OPOA 1STMA 2L9LA 5DG2A 1QJZA 3BTYA 5CFCB 1IPKA 4XFGA 1CAUA 4CXXA 4Y3OA 5FXWA 4META 4E4HA 3D82A 3U37A 3K4DA 5DAPA 3WNNA 4EZ4A 4R8HA 4QHOA 3R05A 4LE4A 3BALA 2OYZA 1BQPA 4XQDA 2D6PA 2CDOA 1MS4A 2D40A 5FLHA 2GNBA 4LA2A 4CU6A 4I2OA 4AVSA 2O8QA 1DQ2A 2WZR3 1AR72 3PTYA 1CIWA 2VVFA 5FLIA 2R063 2JB4A 1CONA 4ZS3A 5L9RA 3NMBA 1O91A 2XLAA 4CCCA 4P9YA 3C7HA 1W6QA 4CRQA 1JYXA 5C33A 3B9IA 4PT6A 1JZ8A 5FO9B 3A4UA 1PNGA 3ZR6A 2DCTA 4XUQA 5C9AA 5FPUA 1W05A 4PBPA 1G9CA 2WLPA 5LY2A 4DXTA 5FYVA 3ZYGA 2FMDA 1GNHA 1K5MA 1DGWA 2NLRA 2DTYA 1TE1B 3MICA 4XQWA 3WP6A 4XURA 4YNIA 3SKJE 4R52A 2V5DA 3ZFFB 2DBNA 2AEYA 2A73B 4OHXA 4XUPA 3LEGA 3ETPA 5FWEA 3LFMA 3VHNA 1CZVA 2G9FA 2VO5A 1QJY3 2RR12 2ZJCA 3MV01 1GZ9A 4FPYA 1O3RA 2R072 2AUYA 2Y6FA 4JVAA 1ND2A 5LK7B 1UW8A 5FP9A 1K45A 3D5OA 1LHUA 3K51A 1ST8A 4QX8A 5LBCA 2XUMA 4PBOA 2WZR1 1V9U3 1LHWA 3NW4A 2QQLA 4JDMA 1PGW2 2W47A 1HB4A 3KHCA 4OUEA 1IS5A 1SFYA 1BMV2 5JWPA 2W39A 4JRAA 5FRAA 1PX4A 5CFDB 3EMRA 3E6DA 1IOAA 4M00A 4N53B 2A3XA 5A3PA 5JXHA 3QD6A 2ZAAA 2QTWB 3NJZA 5IFTA 1HB2A 5C8CC 4Y26A 1F2NA 4CEYC 3A0NA 3Q9OA 1CVNA 4UW6A 5A1FA 1NY71 3CIHA 2QJVA 1W6MA 3B3QE 3NWKA 4OI2A 3ZSKA 2VMHA 4AEDB 2A6VA 2PA7A 1O7FA 2Y64A 2ZS6B 3D8CA 1URXA 3GHMA 3M3CA 3DYOA 4MXWB 5E16A 2E7QA 4Y4YA 1POQA 3B69A 4CCNA 4KGQA 3V0BA 4CP2A 1JU4A 4CXYA 1W6PB 2OKXA 2KD7A 1CAXB 1O8PA 2JDPA 3N7JA 4UFMA 4JRLA 4RYDA 4XJ9A 3THDA 2W1UA 2ORZA 4CXWA 1NQDA 1RUOA 1S2BA 2B46X 1DQ1A 1H8TC 4IEZA 2X09A 4JQTA 5APAA 4BWOA 4YM3A 5DMYA 2Y34A 2Z5WA 2VOVA 1CAWA 1H8VA 4OLLA 4YFZA 5FO7B 4PDWC 3N7LA 1RUF3 3RYRA 1V9U1 4YSFA 2AENA 5IVCA 1GOGA 1WUVA 5F9TA 1B09A 3KM5A 1X33A 5JI9A 2EICA 3JXSA 1M06G 2YFUA 4NO4A 3M2MA 3LPFA 4MUVA 3ATGA 4HG6B 4E4DX 1OLQA 2VVDA 3OEBA 1MPXA 4YFWA 4DY5A 1KGYA 2ZKLA 1RUNA 1K5JA 3DN7A 3MIEA 3BPZA 3WUDA 3H7JA 2VOKA 4C0BA 1ND3B 1UN1A 4CA9A 1XYNA 4Q26A 5A7SA 2GDFA 3HJRA 2JG9B 2Y60A 1UY4A 2VQUA 1B35C 3GZTB 2VOWA 2WZR2 4L8QA 1X82A 3ZYPA 1I1EA 4CEWC 2AACA 2BP6A 2R062 3WNMA 2BBVA 2WRAA 4URTA 2XDVA 4UT5A 4QX2A 2YU1A 3ENRA 5LBFA 1H2LA 2FBEA 2QZ2A 3WT3A 1UNBA 4QGMA 4Z07A 3Q8EA 4GMP3 4IV3B 2EXJA 2ZEWA 4Q2FA 5BNPC 2BOJA 2P6CA 2DURA 2VQ0A 5SV8A 1NY72 2W87A 4XE9A 2GP5A 2V72A 3JD73 3OCPA 5GZDA 1MACA 2QQOA 4DUWA 1RUF1 1OQEA 4HFSA 3WD5A 1O8SA 3O0XA 3Q8BA 2XUEA 4BHPA 3PIJA 2AYHA 3OYWB 1KDMA 2VCMA 3HNYM 4MH0E 4MSVA 2WZPP 1X50A 5FZIA 5FZKA 5F3GA 4YG0A 2JDAA 4LULA 4XF0A 2OS2A 1UOJA 1QJY2 4S2FA 3R4UA 1YI7A 3FFZA 4AEKA 3VDDC 1UAIA 2BTVC 4ASLA 1FOD3 1PVXA 2F6BA 1A8MA 2WLQA 3DECA 3VKNA 4A2UA 1MVQA 3CJIC 3RVHA 1Y9GA 2EIGA 2JKBA 3OF1A 1YLLA 4NIGA 2XL9A 1UYPA 2C5DA 2RS53 3FZ3A 3VBHA 1D2QA 4XQ4A 5IAVA 3EBRA 2G19A 1RHI2 3BB6A 3GJAA 2XPJA 4HMZA 3WZ1A 1UMZA 3OJBA 2VZVA 3WW1A 2BFUL 1C28A 1ZX5A 2RM23 2QDRA 3IDAA 4FCAA 3ELNA 3OD4A 3SH4A 5ABJA 5LA1A 1QU0A 4GMP1 4XETA 1JYTA 1EY2A 1W2OA 1WLDA 3NAPA 4DS0A 4IEOA 3JD71 3WR0A 1MZ5A 1PGSA 4LORA 5FMOL 5LRRA 4CDWC 5FZ0A 4LO6B 1AJKA 5J37A 1NUKA 3OGRA 1VRH2 5DXDA 3VB9A 5I8YA 4DMIA 2RE9A 1WCQA 3OY8A 1BK1A 1UZWA 3KCXA 4XF9A 2OQ7A 2ETEA 4ATEA 4BPZA 4XIOA 4UI9L 1FOD1 1PMHX 1LODA 1VBD3 3LEIA 2DCZA 3AKQA 1KXGA 2OQ6A 4QGNA 1IKQA 3VD9A 3NL1A 4XOGA 3S0MA 4JCKA 4CDQC 4AE2A 3CMGA 3ZFGC 2PAKA 2RS51 2XXZA 2Y6HA 2YC2A 4LO5B 1MS5A 1RUF2 4PQ9A 4DPNA 5LWBA 1N47A 4N43C 4YGCA 2W95A 3L9JT 1Y9QA 1DLCA 3AL6A 4IEVA 4LMFA 2HBTA 3VHPA 5HXMA 4I0AA 1VBA1 5FYYA 1WBFA 5EP9A 2BYVE 2RM21 5C5TA 1Y9MA 5I0TA 3ST7A 3ZXGA 2ET7A 3Q8FA 2QQNA 3KCCA 1O4ZA 2EA7A 5HV0A 3MBWA 1XE8A 4M3CB 2HYXA 2WNOA 4IQPA 5L36A 4AQ6A 3O0VA 5JIUA 1MEC2 1NCRB 3UJOA 1LU1A 3VKMA 4BMBA 5A33B 2E26A 4YVWA 3VBSC 4M0NA 3ILNA 1HQWA 4WM7C 5FYUA 4OULA 4A7ZA 2LW8A 2AREA 5I91A 3K77A 3OSDA 4YW3A 3WHTA 2W52A 4H7MA 4ZPIA 5C8CB 4V1PA 4COYA 3ZPYA 5A3NA 5KHKA 4FPCA 1VRBA 2XOMA 1PVC2 1AUYA 2H6CA 5AVPA 4RS5A 4Y22A 3AZXA 2K2SA 4KU8A 3WDVA 4AI1A 4D8MA 5T5LA 3NVCA 1IPJA 3I7DA 4NOTA 5BNOC 4AFDA 3FLRA 4HOOA 4B1LA 4DQAA 3JD72 5D8AA 1OI6A 4U36A 2WNUB 4I0WB 4JKKA 4QAWA 2RDQA 4CUGA 4QDQA 2ZX2A 5JMOA 3WLUA 2NZ9A 1QMJA 2XVLA 1TVGA 3WNKA 4GH4B 2BPA2 4LTAA 1AYM2 5FTTC 4QPGA 1PO13 3BODA 1VPHA 4EJRA 1J3PA 2FCUA 2ZHMA 3WDYA 1RINA 4X8PA 3SQOA 2ZMNA 4Z82A 4QQOA 2G4IA 4YZ1A 2PQQA 1SLAA 2WNVB 4HSJA 4IE0A 4DZGA 1X9PA 1FOD2 1O6UA 4AGRA 2YGLA 1BYHA 2YC0A 1VMFA 4NAOA 5H9QA 5F3IA 4EWAA 5DZEA 1UYXA 3AK0A 1YQ2A 4RQPA 1W03A 2RS52 3BOPA 4F3JA 2QQJA 5C3SA 3G7DA 5IK4A 2YROA 3VHOA 1UU4A 3CF6E 2ARBA 5K0UC 1NA1C 1W6OB 2JE7A 4XFCA 3HMYA 1RUE1 3OGVA 3ZYJB 1GANA 3PHMA 3S7IA 5FLJA 4LIVA 1GNZA 3WEZA 5BNQA 1WW4A 1G7YA 2DYCA 2DVDA 2HWE1 3BOWA 2P34A 4Q0VA 4LKDA 3BTAA 4AI9A 3ON7A 3D0SA 4QXCA 4EWDA 2ES3A 4A44A 5IK7A 2KR2A 4ZU7A 1JODA 2A70A 1PIV3 1XNBA 2VR4A 4L9BA 3AKPA 1PO11 4JHTA 1IHMA 1PK6B 1ND2C 4CDUB 5A3MA 1NYWA 4JX0A 3VDAA 1MS8A 3UKTA 2QNKA 2W08A 3EQEA 2BVVA 4ISQA 3WINE 1CAVA 1DGRN 1VBD2 4WM8B 4IEWA 5A6YA 4AR2A 3HAGA 5FV3A 4EE2A 3MF6A 2G9ZA 3LDKA 4GWIA 4QDRA 3M3QA 3RI8A 3AXDA 4HSLA 4MXVA 3ZFEC 4AG4A 4MGTA 4QM8A 3GBFA 1RJ8A 5FY5A 4XDOA 2VNOA 3AFGA 4UBGA 2VMIA 5FOBB 3POSA 3X29B 2P3KA 1GUIA 2G9GA 3CNAA 2GNTA 2TUNA 3I97A 2MEV3 4MGKE 5T5JA 4M01A 2RG4A 1X36A 2GH2A 1DLLA 3IMMA 4IETA 1FXZA 4ARYA 4XAEA 3NV2A 2RVAA 2Q8OA 3ZXJA 4AHXA 1VBB3 4OCTA 1R1A3 5JIAA 4DEQA 2W0XA 3USUA 3VKOA 2HJIA 1DG6A 1FV3A 3DPRA 1W9TA 3O1OA 4UFIA 4LOTA 1PIV1 2RS11 4NHKA 3APBA 1GFF2 4GQ7A 4CTEA 3SLIA 1ODNA 2FQPA 4NWWA 2BDRA 3THCA 3MIBA 1CZTA 1Z0HA 3NJYA 2DF7A 1OF3A 4O61A 5IW0A 3C7FA 5SV5A 1JI6A 3O1PA 1O5LA 4XUNA 3WQ7A 3S5AA 2QQUA 3P5BA 3CLPA 2E7TA 4KWJA 4AGVA 1VIWB 5D21A 3GDBA 1TNRA 1SBDA 3CHXA 4H3WA 5A7WB 3TRSB 1XNAA 1QEXA 1OOPA 2EIDA 2LM3A 1W9YA 4NPMA 4UOJA 1KFUL 3V0AA 1YQ5A 3OBRA 1XNDA 2HEYF 1C3HA 2MEV1 4V2VA 3O1UA 3LE0A 4E27A 2RJLA 3ME2A 1RUD3 3NNLA 2JG8B 4IEYA 3ZXEA 3WUCA 4K7JA 3KS7A 5E1RA 3N9PA 1ENSA 3VLBB 4FFGA 4B7KA 4CCMA 1VBB1 5AC93 4HPKA 1AR91 1R1A1 3WF4A 4KNCA 1NE4A 1UY2A 2UURA 4XXAA 1LGCA 1OH3A 3LGRA 3OBZA 1W3XA 2X5IB 4YW6A 5I0UA 3CJXA 4R9DA 3L2HA 1UOBA 3QLQA 5F32A 1WCDJ 3WDUA 3C2UA 3RZGA 1S2EA 3BGAA 1V6MA 1U5ZA 5C5UA 1BHGA 2ZGNA 5A6QA 2AEZA 2BFUS 3UV9A 3J8F3 4Y1UA 5CFCA 5FZLA 1OLRA 1O4TA 2EF6A 4LXLA 5A70A 3RSJA 5EXOA 5KXDA 1SDDB 4PCRA 1JUIA 4IEXA 4LOSA 4K40A 4J1WA 2HWB1 3VBUB 4CCKA 2VCAA 4Z2WA 5BUVA 5BY5A 1MQTA 4MGIE 1V6NA 2RMU2 2XVGA 1H9PA 4MGZE 2VMCA 5L19A 1PIV2 1C1LA 1ULEA 4Y5Z0 4BXFA 4S2GA 2CU5A 1RUD1 4RHV2 3VBOC 2DFCA 1JOJA 4NHMA 3ZKYA 4QWNA 3AMPA 3U10A 2BOIA 1NZIA 3SISA 3RWKX 1UPIA 1YHFA 2K9ZA 3AYCA 3HD8B 3IMNA 4CYDA 5C3PA 1KS5A 1O5UA 4K8FA 4YARA 1OUSA 2W92A 4IE4A 4YGEA 5FP3A 3POJA 3SCFA 5IVVA 2HYKA 1FATA 2EIEA 3AZVA 1ULOA 1UMHA 2GC2A 1LRHA 3AFKA 3NAPC 3VBRB 3R4SA 5HCBA 2KXLA 3VZNA 2BNNA 3ZFFA 2VXJA 4XFFA 3C7GA 5FJKA 1OD3A 3J8F1 1HRI2 3PVOA 4ONUA 2VY0A 2Q8DA 1W8UA 3WW3A 5CEHA 1VBB2 4URAA 1UOGA 1NCQB 2VNRA 1COV1 1V6JA 4CDXA 1NAEA 4Q1RA 1I5PA
chains in the Genus database with same CATH topology
4NJ4A 2FDFA 3BI3A 4ZS3A 4QKFA 3RZKA 3RZJA 4QKBA 4O61A 3O1PA 2FD8A 3S5AA 4NRQA 3BUCA 3I49A 4NPMA 3O1SA 3KHBA 3O1VA 3O1UA 5DABA 5F8PA 3LFMA 4IE0A 2IUWA 2FDGA 4NRMA 3T4HB 3H8XA 4NIGA 3T4VA 3I3QA 3RZGA 2FDIA 3KHCA 4MG2A 4IDZA 4IE5A 3H8OA 2FDKA 2FDHA 3S57A 4NROA 3BKZA 3BIEA 2FDJA 4QKDA 4IE6A 4NIHA 4CXYA 3RZLA 4JHTA 3RZMA 3H8RA 3O1TA 4O7XA 3I3MA 3O1MA 4CXWA 4NRPA 3O1RA 4IE4A 3BU0A 4MGTA 3BTXA 3BTYA 3I2OA 4CXXA 4QKNA 4NIIA 4IE7A 4NIDA 4RFRB 4ZS2A 4QHOA 3BTZA 4OCTA 4ZHNA 3T3YA 4NPLA 3O1OA 3RZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ4 A;  2FDF A;  3BI3 A;  4ZS3 A;  4QKF A;  3RZK A;  3RZJ A;  4QKB A;  4O61 A;  3O1P A;  2FD8 A;  3S5A A;  4NRQ A;  3BUC A;  3I49 A;  4NPM A;  3O1S A;  3KHB A;  3O1V A;  3O1U A;  5DAB A;  5F8P A;  3LFM A;  4IE0 A;  2IUW A;  2FDG A;  4NRM A;  3T4H B;  3H8X A;  4NIG A;  3T4V A;  3I3Q A;  3RZG A;  2FDI A;  3KHC A;  4MG2 A;  4IDZ A;  4IE5 A;  3H8O A;  2FDK A;  2FDH A;  3S57 A;  4NRO A;  3BKZ A;  3BIE A;  2FDJ A;  4QKD A;  4IE6 A;  4NIH A;  4CXY A;  3RZL A;  4JHT A;  3RZM A;  3H8R A;  3O1T A;  4O7X A;  3I3M A;  3O1M A;  4CXW A;  4NRP A;  3O1R A;  4IE4 A;  3BU0 A;  4MGT A;  3BTX A;  3BTY A;  3I2O A;  4CXX A;  4QKN A;  4NII A;  4IE7 A;  4NID A;  4RFR B;  4ZS2 A;  4QHO A;  3BTZ A;  4OCT A;  4ZHN A;  3T3Y A;  4NPL A;  3O1O A;  3RZH A; 
#chains in the Genus database with same CATH topology
 1H6Y A;  2ZZJ A;  1S0F A;  2R7E B;  4XBL A;  3W5N A;  4HT1 T;  2V4A A;  3OGS A;  1UPS A;  4PJY A;  3H1W A;  3ZYR A;  1LOG A;  1HJF A;  5K4L A;  1J1T A;  3U07 A;  3WVJ A;  2ZGR A;  4I30 A;  2B4K A;  5GLW A;  3SHR A;  4QKB A;  1UZZ A;  3ORJ A;  2VPV A;  4XHB A;  5FZ1 A;  3LSD A;  2FD8 A;  2Y26 A;  4N53 A;  3C7O A;  1RUG 3;  1H6X A;  3SCG A;  1JUH A;  4JTN A;  1MR5 A;  1AZD A;  2PN5 A;  4KBB A;  1S0E A;  3NNJ A;  4BDV B;  2PHX A;  4GJY A;  1VLN A;  5JUV A;  2HBU A;  3LFI A;  1CR7 A;  4D7T A;  4AED A;  4M0H A;  5IVY A;  4MHU A;  5FPV A;  4I09 A;  5FK7 A;  4MXW A;  3T1L A;  3SKV A;  4ASK A;  3O1V A;  1W6P A;  5LA0 A;  1RUD 2;  1CAX A;  2JKX A;  5IT6 A;  2OVU A;  4A6S A;  2GN7 A;  5IVF A;  1WCU A;  3LOI A;  3TEZ A;  2Q8C A;  5AC9 2;  1FMD 2;  4XZU G;  4DOU A;  3RPQ A;  2D7F A;  3ZN6 A;  2CAU A;  5EJ3 A;  1OLM A;  5HCF A;  2GSY A;  4LO4 B;  3P3P A;  4O9G A;  4RS5 C;  2D6L X;  3HNM A;  2W3J A;  5FZ6 A;  4QHZ A;  5K9Y A;  5BNN C;  1AL2 2;  2XR4 A;  2OPK A;  1F5F A;  2VBB A;  4AHY A;  1UXZ A;  1H1M A;  2C0Z A;  2XML A;  3NJV A;  4DUX A;  4GUL A;  4JGZ C;  3PU3 A;  3N9N A;  1QXR A;  4ZU5 A;  5CA6 A;  4XVH A;  3J8F 2;  2W68 A;  5CIS A;  5CVR A;  4XJW A;  2BV4 A;  2FDH A;  3BPS A;  1RUG 1;  5LA2 A;  4FPL A;  1ZA7 A;  2QFE A;  5FO8 B;  2IXI A;  1RB8 G;  2OPW A;  5LK5 A;  3NKT A;  5F3E A;  1YWK A;  2VTF A;  3J7M A;  3THP A;  4P00 B;  5GM0 A;  2R07 3;  3CZJ A;  2VH9 A;  1AR6 2;  3LDR A;  1ND3 A;  1NXM A;  4K3U A;  1R1Z A;  5ISL A;  3UGH A;  1GQP A;  2VBP A;  1OLM E;  3ZXF A;  4AL9 A;  2JG9 A;  2VAU A;  4NMI A;  2DFB A;  2W1S A;  2WR9 A;  4CU8 A;  1GWM A;  3GYD A;  4Z8B A;  3POG A;  5DAX A;  1GNY A;  1ZNP A;  3O1T A;  3D6E A;  2CGP A;  2V5Y A;  4XFH A;  3WNX A;  2FHR A;  1HV0 A;  2DUP A;  4IV3 A;  1CJD A;  5CYY A;  5DUW A;  5H9S A;  5IAT A;  2XQR A;  1KFX L;  2ZXQ A;  4EV0 A;  3LEK A;  4FTB A;  1C5H A;  3LDB A;  3WDT A;  4LHS A;  3LCP A;  3PVB B;  4QB1 A;  2YU2 A;  3OPZ A;  5A3U A;  5JZG C;  5DPN A;  1SPP B;  4UW3 A;  3OYW A;  1N1S A;  1RXF A;  4QX7 A;  2VZR A;  3I2O A;  2WL1 A;  1EYB A;  4A4A A;  2VC9 A;  1WZX A;  4TWT A;  4NR1 A;  4L11 A;  3PIG A;  2CL2 A;  1JHJ A;  2WDB A;  5T50 A;  5EFU A;  1PZ9 A;  3W20 A;  5DZF A;  4H2A A;  3WDW A;  1JS9 A;  3BVC A;  2PFW A;  1OUR A;  3NV1 A;  2QE3 A;  2R07 1;  1W28 A;  2CY6 A;  5T54 A;  5F5Q A;  3MIG A;  3LSE A;  5FIX A;  2OII A;  5C3R A;  4DEV A;  2ZGU A;  2D6O X;  4LK6 A;  4QGL A;  4QX5 A;  4QXH A;  3VDC A;  4DUV A;  5A3T A;  1LOF A;  1QH7 A;  4BQ5 A;  2YY1 A;  3CKH A;  5EYY A;  1PO2 3;  4FPG A;  1PGW 1;  3NKG A;  3MW3 A;  1PX3 A;  2JB8 A;  3A7Q A;  3MIF A;  3MYX A;  3J7H A;  4KG8 A;  4Q8L A;  1BMV 1;  1K3I A;  5FP4 A;  1UD1 A;  1GV9 A;  2JEN A;  1RUG 2;  1TG7 A;  3KF3 A;  2NP0 A;  4FPJ A;  4QMA A;  2ZAC A;  2VZS A;  1OQD A;  2SBA A;  4P5H A;  3LA3 A;  5FJH A;  3FJS A;  3GZA A;  2ZGP A;  4MGQ A;  1PMJ X;  2B7Y A;  5KC6 A;  4UBH A;  2Y6L A;  3KHB A;  3TNQ A;  3H8U A;  1VAV A;  3DV8 A;  4BQ1 A;  1LAJ A;  2ADE A;  2ZTN A;  1RUJ 2;  1JBC A;  1OHF A;  2VXR A;  5IVJ A;  5FBZ A;  1Q56 A;  2D97 A;  4QX0 A;  2WN2 A;  1PZ7 A;  3OUI A;  5FYM A;  2PHT A;  1TZO A;  1PM4 A;  4CEY B;  2WBK A;  3AZW A;  3RYK A;  3S6P A;  4EZH A;  1AX1 A;  2AZ5 A;  1HRV 3;  2BQP A;  5AFB A;  2A6Z A;  5BYN A;  1RL3 A;  3KT4 A;  4D6R A;  4BLJ A;  1VP6 A;  4NPR A;  4L0P A;  1CJP A;  1U12 A;  3EB7 A;  4FPE A;  4CPB D;  4HLT A;  1PZ8 A;  4LHN A;  1GLH A;  2DUO A;  1LB2 A;  3OG2 A;  1VAL A;  3LA2 A;  1H8T B;  5FMB A;  3T0A A;  4Z92 B;  2YYO A;  1WWY A;  3LIH A;  2JEC A;  2EXI A;  3LWC A;  4QPI C;  1WW7 A;  3H1Y A;  4IV1 C;  4M3C A;  3TBD A;  1DYO A;  4AVT A;  4B8E A;  1XBF A;  1MS0 A;  1MZ6 A;  4PDW B;  1NCR A;  1EPZ A;  3ZYH A;  3ZXA C;  3BIE A;  1CX4 A;  5A33 A;  2Q8E A;  4FQZ A;  3AJY A;  1QF3 A;  2NMN A;  4AVV A;  1GU3 A;  2AGS A;  4BA6 A;  4JV4 A;  4Y1Y A;  2A7A A;  4YW4 A;  5JR7 B;  3DKQ A;  3CBN A;  3I54 A;  1UKR A;  4PI0 A;  5FYB A;  2R04 3;  3I3M A;  1RHI 3;  3GHN A;  1UZ0 A;  2R06 1;  2ZKN A;  3GGL A;  1MZF A;  3V64 A;  3I2G A;  4QU2 A;  2VUA A;  2ADD A;  2TNF A;  1HRV 1;  3SMH A;  2VZ1 A;  4YVS C;  2FCT A;  4M4R A;  1HB1 A;  1RUI 2;  1S55 A;  3RNS A;  2X05 A;  2O1Q A;  1B35 B;  4ZY9 A;  2C24 A;  1DQ0 A;  1G8W A;  1SHW B;  3KWV A;  2C1F A;  2K46 A;  2LRP A;  1GSL A;  1QJU 3;  2WNU A;  3KB5 A;  3QCW A;  4BZ4 A;  4QT6 A;  3GZU C;  4CEW B;  5IFP A;  4M3C E;  1SDW A;  1IS4 A;  1W8F A;  5L7O C;  5I0R A;  5FUP A;  4XFI A;  2W46 A;  4P5Y A;  5FZ8 A;  4GH4 A;  5FYS A;  5IVB A;  1O3T A;  1VRH 3;  1WME A;  3E97 A;  3P6B A;  5H9P A;  2CHH A;  5KR7 A;  5BNP B;  3AB0 A;  4NII A;  3VD3 A;  1MQT C;  5J96 B;  1NLS A;  2JD9 A;  3MID A;  4Z1V A;  4NID A;  1IPS A;  4XYX A;  2ZML A;  3R4D B;  3I2J A;  4OI4 A;  1QJY 1;  2WNV A;  3IT8 A;  4Q27 A;  1YXW A;  4LJH A;  4A45 A;  4NPL A;  5C6C A;  1UYY A;  2B42 B;  3JZV A;  3K4Z A;  1FV2 A;  4IEQ A;  4RR3 C;  5KHG A;  3HT1 A;  2PHR A;  4O65 A;  4G9S B;  3S30 A;  3K48 A;  2NYY A;  3ILF A;  4XFB A;  1R64 A;  1OSG A;  3I2D A;  5FCC A;  3RS6 A;  3RRD A;  4AZZ A;  5KXE A;  2RHP A;  3T2Q A;  1W6O A;  1PO2 2;  1RHI 1;  1AYN 3;  1V0A A;  2ZAH A;  4ARX A;  3AXE A;  5F7U A;  2AC1 A;  5DUX A;  1QQP 3;  3VDD B;  5F6L B;  1ULP A;  2EVX A;  2WO7 A;  1S0C A;  1V6L A;  1ZRI A;  1ZBA 2;  2KM2 A;  1D7P M;  3QBQ A;  4Q4W 3;  3DUI A;  3PDQ A;  2VQA A;  3I49 A;  5E8A A;  3I2H A;  3OBA A;  1QJU 1;  5FZ3 A;  1MEC 3;  1KRI A;  5A80 A;  3O1S A;  4OFG A;  4H55 A;  2ID4 A;  1LHO A;  3MHZ A;  1GZT A;  1VRH 1;  3W58 A;  2VZ3 A;  3ITQ A;  1S1A A;  1Q8V A;  4QB6 A;  2IZW A;  4CDX C;  1PK6 A;  4CDU A;  2HEW F;  2D6M A;  2PHD A;  2ZX0 A;  5CKQ A;  1I6X A;  2IUW A;  4FAG A;  2YG0 A;  5FUI A;  4JQR A;  2UY9 A;  1PVC 3;  1ZA4 A;  3ZMN A;  3T4H B;  1HRV 2;  1W2A X;  4R9C A;  1C4R A;  2OUH A;  1OKO A;  4GB3 3;  4W6Y A;  4WM8 A;  2R32 A;  3AYA A;  5ACA 3;  4QPW A;  5E6H A;  2GC3 A;  5EV7 A;  3I59 B;  3KLS A;  5LRS A;  4WZC A;  3JB8 A;  1DZT A;  3I3E A;  5IK5 A;  4YLZ A;  4Q8K A;  3ZIX A;  1AYN 1;  1O3Q A;  1QQP 1;  2ZX1 A;  4LBK A;  3U0Z A;  4IE5 A;  1AYM 3;  2R0H A;  2VL4 A;  1UKG A;  1LGN A;  3CU7 A;  3WG1 A;  4KWL A;  4AGG A;  4Q1P A;  5G05 L;  3MUZ 1;  4DXZ A;  1NLQ A;  3IM0 A;  4IGP A;  1EPW A;  2WO3 A;  4XTP A;  1AXY A;  4CDQ B;  1YYN A;  4P08 A;  2F4P A;  4Q4W 1;  4XF3 A;  3ZFG B;  2PLV 3;  3IPV B;  2VD7 A;  4FPO B;  2FDJ A;  4N43 B;  2BW8 A;  1MEC 1;  3C7E A;  4ATF A;  4LLO A;  2I2S A;  3BYW A;  5FY0 A;  4PHZ A;  3V56 A;  1O3S A;  2Y8K A;  2VW0 A;  1OH4 A;  1RED A;  3MEP A;  1XE7 A;  4Y20 B;  3H0O A;  5T5P A;  3O0W A;  3USS A;  1JZ4 A;  2R04 2;  2RS3 3;  4O7X A;  3SIT A;  2R30 A;  1US3 A;  3KQR A;  3B02 A;  2YDE A;  1E57 A;  4MVT A;  2DCY A;  4OHY A;  1PVC 1;  4JGY C;  1RTV A;  2WQZ C;  1BXH A;  3J26 N;  4MZU A;  4I3G A;  1TMF 3;  3VBS B;  3AP4 A;  1VBC 3;  4KU7 A;  4WM7 B;  3HT2 A;  4J1X A;  3ZDS A;  3W5M A;  4ZXE A;  2Q5T A;  5FY9 A;  3T08 A;  1CWP A;  5GLU A;  4NVP A;  4AXO A;  1QJU 2;  3CL1 A;  3ZOI A;  3DXT A;  5JCT A;  5A7W A;  1WW6 A;  2A6Y A;  4BIO A;  5LCW L;  4OQ8 A;  5A6X A;  4IEP A;  1OVP A;  3OGJ A;  4LBM A;  4UXA A;  1KEX A;  3HN1 A;  1AYM 1;  1IG3 A;  3K46 A;  4GWJ A;  5BNO B;  1UF2 C;  3WF2 A;  4TN7 A;  1W8H A;  4AI0 A;  4CZS A;  4DFS A;  1U5Y A;  2JG8 A;  3JBG 3;  3LA7 A;  4HET A;  4A6O A;  3LKJ A;  3VD7 A;  3TN9 2;  4CP1 A;  1C8M 3;  2IVI B;  2JWP A;  2IXK A;  1W2T A;  3I3B A;  3BCW A;  4GA9 A;  4FBF A;  2VUJ A;  2DU1 A;  2J7M A;  4AF9 A;  3JUU A;  5C71 A;  1ZBE 2;  4IER A;  3RZH A;  3PUI A;  2X5I A;  2C6S A;  4HK8 A;  5FZE A;  1JYC A;  4ZXK A;  1AYN 2;  3WNO A;  1QQP 2;  5FZB A;  2HWC 3;  2RJ2 A;  2W91 A;  4IXL A;  3AVS A;  2QQM A;  1VAK A;  3FMG A;  1KQR A;  4MO3 M;  4Q0Q A;  4AHZ A;  5FZH A;  3AYE A;  3DCQ A;  2BUK A;  1U5X A;  2GME A;  4Q4W 2;  4Y5S A;  3VBF C;  5F37 A;  4XDQ A;  5J1X A;  5FWJ A;  5C4W C;  3VBU A;  4YZ5 A;  1XXN A;  4ZZ8 A;  1NA1 B;  5K0U B;  4D6Q A;  1JYW A;  5EHD A;  5F1R A;  2DVB A;  5KXC A;  1ONA A;  3MFA A;  5T5O A;  1OC1 A;  1UX6 A;  5GJ6 A;  1ZRD A;  3P1I A;  1FNY A;  1ASJ 3;  4JKL A;  5JI7 A;  1WLT A;  3JBG 1;  3URF A;  2XHK A;  2WJS A;  1UL9 A;  1CIY A;  3FL7 A;  4OI0 A;  1C8M 1;  1W9F A;  1GP6 A;  1UX7 A;  4GB3 2;  3E5X A;  1YQ8 A;  1XNK A;  4KMQ A;  1VBD 1;  2J1T A;  2VUL A;  4K1Z A;  5IAX A;  1A34 A;  1CX1 A;  4WV8 A;  3MLK A;  5JAX A;  3ZYF A;  2FZ2 A;  1L3J A;  3WF3 A;  5FR3 A;  1GMM A;  4UF0 B;  5C8W A;  1DBN A;  1E5S A;  2E9Q A;  2XL7 A;  3OPT A;  2QQI A;  3VBR A;  1GBG A;  2GZW A;  1BVV A;  2HWC 1;  1LHV A;  1QH6 A;  5FMC A;  3M3O A;  3ACH A;  4R4X A;  1PM7 A;  4G3Y C;  1HN0 A;  5GLZ A;  2A3W A;  2Z79 A;  3N9Q A;  5FZA A;  1QDC A;  1AL0 G;  3RJR A;  3SNM A;  2P3I A;  1DQ6 A;  2VTX J;  3EO6 A;  1AXZ A;  1XC6 A;  3ZFE B;  2PLV 2;  4EN8 B;  2D98 A;  1ODM A;  1JMU B;  2Y0O A;  3M8L A;  4ORF A;  2OX0 A;  3N9M A;  1NCQ A;  4Q0S A;  1X7N A;  1J58 A;  2JEM A;  4BB3 A;  5FDB A;  3OUH A;  5JOW A;  5CKN A;  3B01 A;  2D44 A;  2RS3 2;  2VZU A;  1ASJ 1;  4Q5O A;  1XSQ A;  2PMW B;  4DXR A;  5FUN A;  4NE9 A;  5IJR A;  5C9A C;  3DF0 A;  4NAM A;  2LS6 A;  4XPV A;  4CUA A;  4FFH A;  5IUQ A;  4JDN A;  3HBZ A;  1O4Y A;  2EAL A;  4COW A;  1TMF 2;  3AZZ A;  1N1V A;  2YBK A;  1VBC 2;  4QD2 A;  1CZS A;  1K5M C;  2CYF A;  3AMH A;  1OQ1 A;  4AK3 A;  2VE1 A;  4D0Q A;  5ANQ A;  3T0B A;  2Y38 A;  5FY4 A;  5DAQ A;  3BTX A;  3POI A;  1RJ7 A;  2Q30 A;  2B5H A;  2BER A;  3GJB A;  3UGF A;  2BGC A;  2VOX A;  1NE6 A;  2XVK A;  1F4A A;  5D1I A;  5FPX A;  4XAB A;  1K42 A;  2ZGK A;  1W0N A;  4LNV A;  2RMU 3;  1RGS A;  5J36 A;  1NCR C;  4QKN A;  2UYB A;  1GZC A;  4I0B A;  4AW7 A;  1WD3 A;  4B7E A;  5FZ7 A;  4Q4Y 3;  3JBG 2;  5A3W A;  5G04 L;  3RZJ A;  1C8M 2;  4RHV 3;  5AVA A;  3N36 A;  3WNL A;  1R09 2;  1ULD A;  2EXK A;  4IL7 A;  5A32 B;  4P9J A;  1V6I A;  2RDN A;  1YFW A;  3PMS A;  2ZEZ A;  2MNG A;  4W65 A;  4W50 A;  5LAT A;  2OA2 A;  2OW4 A;  3ZVX A;  2UWA A;  2VJX A;  1HW5 A;  2HWC 2;  1PNF A;  1RUH 3;  2J42 A;  4XJ8 A;  1YJK A;  2OZ6 A;  2UY8 A;  4GIQ A;  1RMU 3;  2C9K A;  1H2K A;  3CQO A;  3PME A;  4XXP A;  3RG0 A;  4UWD A;  3EYP A;  1XJA A;  2HEV F;  1L7Q A;  3BUC A;  1HRI 3;  1YQC A;  1D0H A;  4KL1 A;  4N9H A;  4XW3 A;  1T2X A;  1L7L A;  1LUL A;  2DVA A;  1LJ7 A;  2D3S A;  1W6N B;  2WWS A;  2WZ8 A;  1PGL 1;  5GZE A;  1W06 A;  3EHK A;  3U75 A;  4D94 A;  4XMA A;  4YYO A;  5CKM A;  3FX3 A;  2RMU 1;  2YFZ A;  3GAL A;  3RJ2 X;  1Q43 A;  4L92 A;  4EN9 B;  3SH5 A;  1ASJ 2;  2ZOE B;  2CGN A;  1TNF A;  1VBE 3;  3T2T A;  4C0H A;  2E31 A;  2XKO A;  4Q4Y 1;  2EXH A;  3S5Q A;  3M3E A;  1FX5 A;  5LW9 A;  1QDO A;  1XNT A;  3IDC B;  4RHV 1;  3LF7 A;  2ZZQ A;  5JSP A;  3LEM A;  4M4P A;  4LKF A;  4ES9 A;  3HNB M;  3POY A;  4PIZ A;  5IVE A;  1CPM A;  2PAM A;  4BQ2 A;  2RV9 A;  5GZG A;  4N7I A;  3KQ4 B;  1HXS 3;  2XWJ B;  1XNC A;  3AMQ A;  2J1E A;  3IWZ A;  1N3P A;  1RYY A;  3VBO B;  4XAC A;  1DYK A;  4A3Z A;  2GAL A;  4PLO A;  3RMY A;  2F4L A;  3E6C C;  1SPP A;  3BU7 A;  1POV 0;  1RMU 1;  1XYO A;  1QOS A;  3TAY A;  3HPN A;  3PUH A;  3ETQ A;  1HRI 1;  3VDB A;  2GND A;  3VD5 A;  5F3C A;  2K0G A;  4Q29 A;  4Y33 A;  1J84 A;  2VW2 A;  1SBF A;  1FMD 3;  1E5R A;  3C3V A;  3AP7 A;  3IIA A;  4AI2 A;  4BCU A;  4H7L A;  4S2D A;  1S4C A;  3NAP B;  4XC9 A;  2QQV A;  3EJK A;  2XG3 A;  4HXC A;  3VHR A;  2ZPX A;  3E6B A;  3ZXL A;  4C91 A;  5K8S A;  1WMD A;  3MLJ A;  3KGL A;  4KG0 A;  4OUM A;  1RVF 2;  1OT5 A;  1VBE 1;  1AL2 3;  2IXH A;  2TEP A;  4B29 A;  3O1R A;  4MLO A;  2ZBJ A;  4ET7 A;  1WBL A;  3ES4 A;  4F7Z A;  1RUC 3;  1S0G A;  4OMC A;  4DRR A;  1CPN A;  2UYA A;  4RGG A;  1QJX 3;  4CUC A;  4K6B A;  2JIG A;  4LBQ D;  4BJ0 A;  1DHK B;  2WT2 A;  5F5A A;  1UQX A;  4EYU A;  1HXS 1;  5T3N A;  1PGL 2;  4CVU A;  4E2G A;  4HL0 A;  2DUQ A;  2J1S A;  5EQU A;  5AFE A;  4K20 A;  3FBY A;  3FWE A;  4OZX A;  4XBN A;  1AR6 3;  4XUO A;  4LO8 A;  2D6K A;  2HLE A;  3KCY A;  3POB A;  4QPY A;  4Q4Y 2;  3FBM A;  1QHD A;  4RFR B;  4RGA A;  3H42 B;  4HVR A;  2WFF 2;  5C7G A;  5C8C A;  4CEY A;  5ACA 2;  3VBH C;  3CDZ B;  3NRU A;  1I3H A;  4FP2 A;  2WSV A;  3RZZ A;  2Y6J A;  5AC9 1;  1OMI A;  1FMD 1;  2PHW A;  3D3A A;  1E5I A;  1UU5 A;  2B39 A;  3HQX A;  1U0A A;  2VZO A;  3AL5 A;  2DCJ A;  1SZB A;  4CCL A;  2BGP A;  3VV1 A;  4HN0 A;  5ABJ C;  4AI3 A;  1UZY A;  4QKF A;  1L7R A;  3U78 A;  2JDY A;  1A8D A;  2JXA A;  4LIT A;  1AL2 1;  1GYK A;  3WHU A;  5B4N A;  2YB7 A;  3WW4 A;  1RUH 2;  4LBJ A;  5CB7 A;  1RUC 1;  2PAE A;  2B9U A;  1RMU 2;  2A6X A;  5L9V A;  1LEC A;  1QJX 1;  3IDE A;  2JDM A;  2OUJ A;  1HX6 A;  3M70 A;  2JE9 A;  1H8T A;  2Y6G A;  4AFB A;  1D4M 2;  3RYP A;  4RS5 B;  1LR5 A;  3WQB A;  2LUW A;  2O8O A;  2LRO A;  1HV1 A;  1RC6 A;  2XLG A;  4WVM B;  5BNN B;  5FXX A;  4NN0 A;  4PDW A;  1YC6 1;  4QQ2 A;  3ZX7 A;  4XF1 A;  3MW4 A;  4CU9 A;  2ZGL A;  3MUY 1;  4TSV A;  4YPJ A;  5DAV A;  5LZ6 A;  4JGZ B;  1AR6 1;  3KGZ A;  1XU1 A;  2O14 A;  2P2K A;  1VBE 2;  4IEU A;  1NG0 A;  2Q1F A;  2C9A A;  4R9B A;  4YZ4 A;  2VZQ A;  1LU2 A;  2XKP A;  3VKF C;  1C57 A;  3E1F 1;  4CCO A;  2YUE A;  1OXC A;  1DGR A;  1QXJ A;  5JPN B;  4N9I A;  3ZMO A;  5CIR A;  1FI2 A;  3I8T A;  4XEZ A;  5CFD A;  4AHW A;  4GWN A;  1ZRE A;  5BPX A;  3T4V A;  1M4W A;  1F9K A;  1HDK A;  1DU3 D;  2XON A;  1HXS 2;  2HH9 A;  1JZ6 A;  2QBX A;  3IB3 A;  2WSU A;  2XBO 2;  4CCE A;  2NN8 A;  1B35 A;  2WII B;  4BQ3 A;  4CCJ A;  2Z42 A;  3POF A;  4CEW A;  1X8E A;  1EP0 A;  2P1B A;  3MI8 A;  4JHZ A;  2E51 A;  4LT5 A;  3K75 B;  1P8J A;  1CD3 G;  4JZR A;  4IW3 A;  3VN4 A;  4TYS A;  1F15 A;  3VBU C;  1F35 A;  4YVW C;  2XQX A;  3MPP G;  4OHZ A;  1RUJ 3;  3H9A A;  4D7S A;  5BNP A;  5LEJ A;  1FPN 2;  2X53 S;  4COZ A;  3RFR A;  4CP9 B;  4FAH A;  2WWU A;  2C4X A;  4FOV A;  4FPH A;  2H0B A;  4XF4 A;  5H9R A;  3KMH A;  3GBG A;  5CG8 A;  4PF1 A;  2E32 A;  3ZSJ A;  1SFP A;  3FLP A;  1KDK A;  2JE8 A;  3C8X A;  5IWF A;  5EIY B;  5JZG B;  2IXJ A;  4LA3 A;  3VZK A;  3ZN5 A;  2BNO A;  2WA3 A;  1CN1 A;  1WA4 A;  2VMG A;  4XJU A;  1LNS A;  4Y4R A;  2RDS A;  1Z7S 3;  3LAG A;  5A6Z A;  1DGL A;  2VCB A;  1UXX X;  4Q4V 3;  2G1M A;  3O1M A;  4NRP A;  5KHH A;  5DDJ 2;  3H50 A;  3UKV A;  5DUV A;  1RUC 2;  3FHI B;  5D8A C;  4W6W A;  1RIT A;  3WY6 A;  3DGT A;  1QJX 2;  5FZ4 A;  3HEI A;  3VDD A;  4GZ9 A;  2VCC A;  5IHR A;  1U5I A;  3RDI A;  4BM8 A;  4FVV A;  5EJ1 B;  1XRU A;  4C1X A;  4YM2 A;  1AHS A;  2HWF 3;  4QPG C;  2D43 A;  1T6G C;  2PYT A;  2W9X A;  3W21 A;  1AX2 A;  2ZGQ A;  3SCH A;  5CBL A;  1DFQ A;  2QQK A;  3KT7 A;  2V09 A;  1VJ2 A;  5HBA A;  1J3R A;  5JOZ A;  4YZ3 A;  4ZS2 A;  1RUJ 1;  1BBT 3;  4XZP A;  5DQ0 A;  5FZD A;  1MZE A;  3BIW E;  1JW6 A;  1TQ5 A;  4RQP C;  4W6X A;  5FY1 A;  3KV4 A;  5B2G B;  4YM0 A;  3OD0 A;  4X6Q B;  5JDB A;  3HN3 A;  3H3Z A;  2FDF A;  4K21 A;  3GZE A;  5JR2 A;  3SXW A;  5FZO B;  5FK8 A;  3PVE A;  4DXS A;  1RUI 3;  1SLI A;  1YQ6 A;  2BVB A;  3I59 A;  1Z7S 1;  4I02 A;  4W8J A;  4Q4V 1;  3SH3 A;  3ZM8 A;  3III A;  4HKW A;  4ISR A;  4QXB A;  3NJX A;  3GNE A;  2J1V A;  3PJY A;  5FRE A;  2GAU A;  2PQS A;  4CUB A;  4RL7 A;  4COV A;  1ZRR A;  3GF6 A;  3UT0 A;  5C3Q A;  1XOY A;  3JQX A;  4M3C F;  4EN6 B;  4LHK A;  4COU A;  2P17 A;  1SEF A;  5HCH A;  5GZF A;  5FBJ A;  4CDQ A;  4D69 A;  2VME A;  2HWF 1;  3ZFG A;  3NQH A;  2OXB A;  3IPV A;  4E9K A;  2Q1Z B;  4N43 A;  4P9X A;  1YFY A;  2A75 A;  2HWD 3;  4GD4 A;  4P9G A;  5FYT A;  3F95 A;  1W8O A;  4Y20 A;  4R9A A;  2I07 B;  3B9C A;  3NO8 A;  4HKO A;  2W94 A;  5GAL A;  1BBT 1;  2WNE A;  4QPI B;  3TEX A;  1CGP A;  2W1W A;  3U11 A;  4IV1 B;  4NHY A;  3CZU A;  2PHL A;  4ZKT B;  4FFF A;  4TXW A;  3VBS A;  5GLT A;  2JDH A;  3ZN4 A;  4WM7 A;  4CP0 A;  4XMI A;  5L9B A;  2FDI A;  1ZBA 3;  2XH6 A;  3AM2 A;  3HOB A;  2XJU A;  4A3X A;  1RUI 1;  5CZK A;  4AWD A;  2ET1 A;  2ZMK A;  1BJQ A;  1ZZ9 A;  4IDZ A;  4LPL A;  2DWR A;  1UU6 A;  4SBV A;  5FY7 A;  1UCX A;  3TYJ A;  3WF0 A;  2R16 A;  5FKC A;  5F39 A;  3A21 A;  2WWJ A;  5BNO A;  5BV6 A;  5I93 A;  3UNP A;  4YVS B;  1QXP A;  4K8R B;  1YO8 A;  3DPR C;  5DN2 A;  1F8V A;  4RFT 0;  3WCS A;  3M4F A;  1EAH 3;  2IWG B;  2ZAB A;  3WW2 A;  4AFA A;  2P4E A;  5FOJ B;  1X9T A;  2GC0 A;  4IE6 A;  2EIB A;  5L7O B;  1JZ3 A;  3AP6 A;  2WAO A;  4ITC A;  2HWD 1;  3JB4 C;  1NKG A;  1UY0 A;  1HIX A;  2BWC A;  3H8R A;  1Z7S 2;  4E2S A;  4Q4V 2;  1LEN A;  1MQT B;  3LQC A;  3NV4 A;  4LO7 A;  4U2A A;  3MW2 A;  4EWE A;  1G6N A;  3POW A;  2J1U A;  4KGG A;  2VU9 A;  4QQP A;  1PO2 1;  4JAA A;  2P6H A;  1ZZ7 A;  4ZZ5 A;  1SLB A;  2DTW A;  1OOP C;  2PXJ A;  4RR3 B;  1ZBA 1;  2HWF 2;  1AF9 A;  4E8C A;  4QQL A;  4FOW A;  5FFO C;  1TME 3;  3MF9 A;  3J9S A;  3GBW A;  5C70 A;  1OFN A;  5K0U A;  1NA1 A;  2R1D A;  3D4K A;  3GCX A;  3PTR B;  4V2W A;  3W59 A;  4LBN A;  1NT0 A;  1VB2 A;  1JZ2 A;  4AQT A;  5FPZ A;  1IQD C;  1J83 A;  4LK7 A;  3T0D A;  4AFM A;  1BBT 2;  2B8M A;  2BGO A;  1H2M A;  4P02 B;  2VNV A;  1VMJ A;  2WFP A;  5DZG A;  1VB4 A;  1EUU A;  1GQG A;  1EV1 2;  4RA0 A;  3KD4 A;  5HXV A;  1EAH 1;  1NZC A;  2WO1 A;  2GMM A;  1S0I A;  4B4R A;  4YG6 A;  1SCS A;  3WCR A;  3WF1 A;  3ZR5 A;  2XJQ A;  1GP4 A;  5L73 A;  2OZJ A;  1W8N A;  3WG3 A;  1MVE A;  3WV6 A;  4BXS V;  2W1Q A;  2JDU A;  3ILR A;  3VL9 A;  4DY3 A;  5I0D A;  5EWS A;  4CDX B;  4UF0 A;  3AX4 A;  5CFC C;  5J3U A;  5KXB A;  1XSR A;  1LGB A;  1V00 A;  1S0D A;  2JX9 A;  5HV4 A;  2WS9 3;  5BXX A;  1CES A;  1NOV A;  2CTV A;  3H3L A;  3LB9 A;  5FZF A;  4AI8 A;  2A1X A;  4TZD A;  1GZW B;  3HBK A;  1OUX A;  2XGX A;  4LR4 A;  5DUU A;  2VG9 A;  1JYV A;  1JU3 A;  5JSO A;  1UIK A;  1F4H A;  4J6G A;  4LQR A;  3ZFE A;  3TN9 3;  1JZ5 A;  2XJS A;  1TME 1;  4HON A;  2ZHK A;  2I74 A;  4XCB A;  1XB9 A;  1HQN A;  2HWD 2;  3SEE A;  4LLF A;  1ZBE 3;  2VQT A;  3JCI A;  2OT7 A;  5FXV A;  2GH8 A;  5KWR A;  1IZ3 A;  3UKN A;  4IND A;  1W2N A;  1OD5 A;  1SFN A;  2VNG A;  2FDG A;  2R04 1;  2WT0 A;  4LE3 A;  1NXD 1;  4PLM A;  1W3V A;  5EYX A;  3WP5 A;  3H8X A;  2ZCW A;  1LOC A;  1YFU A;  4A41 A;  3CJI B;  4PI2 A;  3PLQ A;  1DCS A;  4PF5 A;  3VGI A;  1GWK A;  3MO4 A;  2DVF A;  2P3Y A;  3ZN6 B;  1JYI A;  3ZFF C;  5GKA C;  3HQU A;  1OA4 A;  1WGP A;  5LY1 A;  2P3J A;  1OBN A;  2J1R A;  1POV 3;  1XE0 A;  4QQH A;  2P37 A;  2WQ8 A;  4BU2 A;  2J22 A;  2JDZ A;  2WS9 1;  5KHJ A;  4JGY B;  2YBP A;  2ZHL A;  4ES8 A;  4FI9 A;  1XU2 A;  2VGD A;  1HLC A;  1SLT A;  4FP3 A;  4E4S A;  1GOH A;  1AXK A;  1W8T A;  3MV1 1;  3P3N A;  3R6S A;  1ZZ8 A;  4FT8 A;  1US2 A;  4QHB A;  3T2O A;  3FHA A;  1EAH 2;  4W4Z A;  5EZW A;  3TN9 1;  1NX9 A;  1FT9 A;  2PHU A;  5A32 A;  3EXU A;  3ZPO A;  1LHN A;  3DYM A;  3OBT A;  4CDW B;  3RZL A;  5FZG A;  5FYZ A;  4IGQ A;  4D6S A;  1BK0 A;  1DQ5 A;  1ZBE 1;  4Y1X A;  5J09 A;  5CFD C;  3HVD A;  4N53 C;  2VZT A;  1KIT A;  1WCS A;  3VZJ A;  5FPB A;  5M0T A;  3N3H A;  3Q8C A;  2ZX4 A;  4AED C;  4AQS A;  3FC0 A;  1H9W A;  5I0S A;  1TME 2;  4B4Q A;  1R08 3;  1BZW A;  2WA4 A;  4LBQ B;  1ULG A;  1W6N A;  4AQ2 A;  1V70 A;  4KI5 M;  4XAA A;  1ALY A;  1POV 1;  5FQ0 B;  3ASI A;  1W9S A;  1YUD A;  2E53 A;  4RSU A;  1Q8P A;  4FTS A;  2QQP A;  3IKW A;  3DYP A;  3I2K A;  3PUA A;  3A23 A;  2X10 A;  5F2W A;  3WG2 A;  4AVA A;  1YRZ A;  1BEV 3;  1UWW A;  1SG3 A;  3VBF B;  2R0F A;  5I8T A;  4X8N A;  1ZZB A;  5K7P A;  2Y6K A;  2UWB A;  3LOB A;  5C4W B;  3NV3 A;  3DEM A;  3ECQ A;  1BVP 1;  2ZGO A;  2LAL A;  4C1W A;  2DU0 A;  2ZA9 A;  4NJ4 A;  3U1X A;  5JOX A;  4GB3 1;  2R1B A;  4XIK A;  2D5F A;  3CO2 A;  1YNA A;  3N35 A;  1KJR A;  5KBF A;  5HCA A;  1WKY A;  5T55 A;  1LEM A;  2JIJ A;  3FFQ A;  2D5H A;  5FZM A;  4GAZ A;  4XTM A;  5E88 A;  4H14 A;  3VBO A;  2WS9 2;  3PUQ A;  4A7Y A;  1G9A A;  3ZSM A;  2VMF A;  1QWR A;  4GJZ A;  4B3N A;  1Q8O A;  1V9U 2;  1IKP A;  2NM1 A;  4CPB A;  4RD7 A;  1VBA 3;  1ND3 C;  5J98 B;  3RI9 A;  5KHI A;  4P14 A;  3ZXK A;  2BNM A;  3H3U A;  3PL0 A;  4HZF A;  4YW5 A;  2JG9 C;  1WMF A;  1Y4W A;  3WNP A;  1R08 1;  2VM9 A;  1AR8 3;  3UGG A;  3AYD A;  4O9E A;  2PLV 1;  1Y43 B;  2VEC A;  2DBI A;  1CAU B;  2JD4 A;  1R09 3;  4HBN A;  1Y3T A;  1G86 A;  1WLC A;  2P5B A;  3B93 A;  4QX1 A;  5F2S A;  5DAB A;  3INA A;  3J4U H;  4FTE A;  3WSO A;  1SLC A;  5FY8 A;  3U14 A;  4IUG A;  4IV3 C;  1BEV 1;  3THT A;  2RS3 1;  2CV6 A;  3QH7 A;  4PQQ A;  1W90 A;  2YXS A;  2A71 A;  5JMC A;  2CGO A;  5E89 A;  4AEM A;  4DB5 A;  3K3N A;  5C3O A;  1TMF 1;  3S7E A;  3I3Q A;  1VBC 1;  3AKR A;  3IDB B;  1W39 A;  4OQ9 A;  4X6R B;  1XQN A;  1W6Q B;  4BIS A;  2D3R A;  4LBO A;  3WQ1 A;  4BQW A;  4KQ7 A;  5HI0 A;  2F17 A;  1H4H A;  1D0G A;  3IBM A;  4YW7 A;  3KV9 A;  4HVO A;  3ZXD A;  3UET A;  5C9A B;  1GP5 A;  4PIX A;  1QGL A;  1VAM A;  1J3Q A;  2XWB B;  4Y1Z A;  2FDK A;  1VR3 A;  1FNZ A;  1BKZ A;  4JDO A;  5FAX A;  1K5M B;  3AKT A;  3KVA A;  3BKZ A;  3NNG A;  4MHR A;  4PLN A;  1V6K A;  3PUS A;  1GKB A;  5EPA A;  3MZH A;  3GCW A;  4QKD A;  5DG1 A;  1JZ7 A;  2O0O A;  2XJR A;  3ACG A;  1AR8 1;  1JTZ X;  4EN0 A;  1F5J A;  1ZYB A;  3ALQ A;  3POE A;  4FO9 A;  5A7N A;  1R09 1;  1LOF C;  4B1M A;  2A6W A;  3TWI A;  4YGD A;  3VKL A;  5A7O A;  1HQL A;  1RIR A;  1MS3 A;  2H6B A;  1KS4 A;  4Q0P A;  1ND2 B;  1ENR A;  4LUM A;  4N90 A;  3UJQ A;  5B4X A;  3ACL A;  5FYH A;  3TEW A;  2C26 A;  4YZ2 A;  4UFJ A;  1IS6 A;  2LTN A;  1K12 A;  4TTG A;  1RUE 3;  1R08 2;  1UYZ A;  2ARC A;  2VBD A;  4WVM A;  1ZZC A;  2IXL A;  5BNN A;  3KSC A;  4Q0U A;  1W04 A;  4OI1 A;  2GU9 A;  4IES A;  1HB3 A;  3ZDV A;  3OPW A;  2HWE 3;  4MGS A;  1WD4 A;  2IC1 A;  3VUO A;  2Z2S B;  4C8D A;  2X8K A;  4JGZ A;  4LHL A;  5JXG A;  3IAQ A;  1W6M B;  4BLI A;  4EN7 B;  1BEV 2;  3HR9 A;  2QKD A;  1RVF 3;  2ERF A;  3V0B B;  1JXN A;  3ZO0 B;  2CNA A;  4BQX A;  2YPD A;  2IVJ A;  1BLZ A;  1YCI A;  3TB0 A;  1I9R A;  1N3O A;  4YWA A;  3BI3 A;  2J1A A;  1MS1 A;  2GNM A;  5LB6 A;  3CEW A;  4A7K A;  3RZK A;  4WBB A;  4TLG A;  4CCD A;  4HKL A;  3LIG A;  2Z4F A;  1D2S A;  1LED A;  1QIQ A;  4FPK A;  1CAW B;  3VZM A;  3AKS A;  3T30 A;  2XJT A;  3MIH A;  5GLV A;  5FZ9 A;  4E4Z A;  1QKQ A;  1VBA 2;  3FE5 A;  2AR6 A;  3HIF A;  3HWJ A;  4R4Z A;  4UFL A;  3WG4 A;  5CNA A;  2RM2 2;  4CP9 A;  4CU7 A;  4WVZ A;  2WFF 3;  1AR8 2;  1PMI A;  2VVE A;  3MPB A;  1GWL A;  2WT1 A;  1IQA A;  4KWK A;  3V65 A;  3LPG A;  1CQ9 A;  3AMM A;  4D3W A;  2UU8 A;  2Y0I A;  1TEI A;  2A3Y A;  3MLL A;  1X8M A;  3J7L A;  5JZG A;  2D3P A;  4JTO A;  3K3O A;  4Y24 A;  1W8Z A;  4BIF A;  4A42 A;  2CWM A;  3OB8 A;  2B9V A;  1S0B A;  3E5Q A;  3OUJ A;  4MOA A;  3B7M A;  1NLR A;  1HN1 A;  3RMX A;  1RVF 1;  4NRM A;  3OGG A;  3FUO A;  4HVQ A;  1YI9 A;  2RS1 3;  1IG0 A;  1SLL A;  2E33 A;  2IFW A;  3VZO A;  2WNU C;  2IXC A;  1AX0 A;  3RGB A;  5ANN A;  1UMI A;  5TSW A;  3JU9 A;  1DP0 A;  1N1Y A;  5FPL A;  1D4M 3;  2YGM A;  3UES A;  4GH4 C;  2E7A A;  2CDP A;  4MG2 A;  5GZC A;  4Q4X 3;  1QNW A;  1UO9 A;  1WLW A;  2YPJ A;  2ZGS A;  3OEA A;  5FPA A;  4BOW A;  1UY3 A;  1WCK A;  1YJL A;  2JDN A;  3H8O A;  1MS9 A;  1A3K A;  5LAS A;  2WC2 A;  2WAA A;  2WNV C;  1T6B X;  4NWV A;  3S57 A;  4GXL A;  4XHX A;  2CSG A;  4YG3 A;  4F8A A;  3ACF A;  1H0B A;  3SC7 X;  2XLF A;  4MYE A;  3WP4 A;  2WFF 1;  5A3L A;  1H1A A;  1DZR A;  4BK4 A;  5ACA 1;  1ZRC A;  2BWA A;  3AP9 A;  3KF5 A;  2BZD A;  2QZ3 A;  4TLF A;  4FPF A;  2JJ6 A;  5I8S A;  1W2U A;  3RZM A;  5LBB A;  4YW2 A;  1WW5 A;  1A78 A;  3UK9 A;  4XIL A;  4LKS A;  1AR9 3;  4XJA A;  2Q0A A;  5FZO A;  4F83 A;  2X29 A;  2XBO 3;  1JHN A;  1Q5O A;  2NQY A;  2ARA A;  4FSJ A;  5JPM B;  1S2K A;  2UWC A;  2ZEY A;  4YW1 A;  1ACC A;  3VBH B;  1RUH 1;  4NIA A;  3PU8 A;  1IS3 A;  5CAD A;  1D4V B;  5FP8 A;  1NQJ A;  1RUE 2;  3O7O A;  2WO2 A;  1D4M 1;  1FPN 3;  3M1H A;  4KWU A;  3TOJ A;  2B45 X;  3QH6 A;  5ABJ B;  1HKD A;  2E6V A;  5JXJ A;  4Q4X 1;  3WQ0 A;  1PK6 C;  4CDU C;  2HWE 2;  1ZZ6 A;  5A7Q A;  4BQ4 A;  1AJO A;  2I45 A;  1SCR A;  3NST A;  2YZ4 A;  2HWB 3;  3QOP A;  4LUK A;  4WVW A;  4B4P A;  1OA3 A;  4WM8 C;  2WUH A;  4P9L A;  4XUT A;  4GKX A;  4QPI A;  4BME A;  1PO1 2;  5DDJ 3;  4OMD A;  3N7M A;  4IV1 A;  1WMX A;  2BEO A;  3OY8 B;  4MAD A;  1Q3E A;  4C90 A;  1VMH A;  2WKK A;  3E5U A;  3MGU A;  1DZQ A;  4QX3 A;  1H4G A;  2YBS A;  3OTF A;  3ZIW A;  1FAY A;  1QJF A;  1ZVF A;  1H2N A;  1UIJ A;  2N7G A;  1UY1 A;  3DXU A;  2JIC A;  1O59 A;  4NUB A;  5F6K A;  3F2Z A;  4ASM B;  3WXP A;  2D93 A;  3ES1 A;  5JSR A;  2ARX A;  4P9I A;  2WIN B;  1QY4 A;  2XBO 1;  4P9W A;  4ERO A;  2WAB A;  3U4X A;  1ULF A;  2Y33 A;  3N7K A;  5FYC A;  3WP3 A;  1W9W A;  1IGO A;  1I5Z A;  2PEL A;  3FUQ A;  5ERL A;  4UFK A;  2DV9 A;  3ZSL A;  3UYJ A;  4GMP 0;  1Y7B A;  2ZHN A;  4LEJ A;  4NHL A;  3ZKU A;  4AVB A;  4YVS A;  2MHF A;  5FMD A;  1FPN 1;  4K9S A;  1EUT A;  3PUR A;  3ABZ A;  1YFX A;  1ENQ A;  4BYY A;  2R49 A;  4K1Y A;  2QQW A;  2RDR A;  3AJZ A;  2XHN A;  3HQR A;  2FZ1 A;  1KD7 A;  1OF4 A;  4RGK A;  5CG9 A;  1W8W A;  1E5H A;  1OPM A;  5F8P A;  5L7O A;  3RWN A;  4L97 A;  4Z2A A;  5IYY A;  4N8M A;  4AVC A;  4SLI A;  2GN3 A;  3I2F A;  1XYP A;  1COV 3;  2ZGT A;  4YVW B;  5IK8 A;  5FMO S;  4PIY A;  4XJZ A;  4KBZ A;  2RS1 2;  3LZZ A;  2VOT A;  3WDX A;  5DDJ 1;  3AMN A;  1XPW A;  5CAZ A;  3AC0 A;  2GC1 A;  3H7Y A;  3JQW A;  2KA3 A;  1Z78 A;  2QVS B;  2HKX A;  2XJP A;  3KVB A;  1V6O A;  2E63 A;  2R6Q A;  2Z69 A;  3MDP A;  3GM8 A;  1YIF A;  4D7Y A;  1A6C A;  4RR3 A;  4DNY A;  1H1I A;  4Y22 B;  4AOC A;  3A0K A;  3RQ0 A;  4MGY E;  4Q4X 2;  4AAP A;  1LES A;  3K2O A;  2JG8 C;  1GQH A;  5D8A B;  4YM1 A;  1FYU A;  1LTE A;  1N1T A;  2V73 A;  5A7P A;  4XFA A;  2QDN A;  3UL2 A;  2WYF A;  5FXZ A;  1G9B A;  2DCK A;  4XDP A;  2MEV 2;  2VUD A;  2X5I C;  2ZEX A;  2TBV A;  3A22 A;  1DDL A;  4QPG B;  1QOO A;  4YRD A;  5LA9 A;  3G6J B;  1J1L A;  4OZO A;  4S2H A;  3T1M A;  4NIH A;  5KC5 A;  3B5L B;  2MPF A;  1WA6 X;  4AEJ A;  4GKY A;  1PHM A;  2WYS A;  1AR9 2;  1R1A 2;  3SEP A;  2YC4 A;  3VL8 A;  4BK5 A;  4AFC A;  1LOA A;  4RQP B;  4LBL A;  4L99 A;  1LOE A;  4N7U A;  4BE3 A;  4BQY A;  4FFI A;  4QDS A;  2VTX A;  2QCS B;  3ZLI A;  2ORX A;  4KH9 A;  2VUC A;  3N4M A;  2Q4S A;  1GZW A;  2IFR A;  1ZM1 A;  2D6N A;  3AP5 A;  2CWS A;  4CSW A;  4XCA A;  1G9F A;  3AVR A;  4I01 A;  4GWM A;  2XB6 C;  3NNM A;  2ENR A;  3PVN A;  1SMV A;  1REF A;  5T52 A;  3PNA A;  3W9A A;  3WOG A;  2FMY A;  3L2Y A;  4OHW A;  3AZY A;  1OKQ A;  1H30 A;  4UFH A;  4E8D A;  3I4I A;  4IE7 A;  4FXG B;  4GAL A;  2ATF A;  4OYU A;  2HWB 2;  1W0O A;  3J7N A;  5LEK A;  4DO0 A;  5A3O A;  5EJZ B;  1GR3 A;  2EAK A;  1W99 A;  3BTZ A;  3NNF A;  3IAP A;  4ZHN A;  2Q1M A;  3GXU A;  3M3I A;  1QNY A;  4LKE A;  3T3Y A;  3ZSE A;  4AYU A;  3PJQ A;  4ZU4 A;  4DIQ A;  4OHV A;  2PHF A;  3ZYI B;  1AR7 3;  1GOF A;  3B00 A;  3CJI A;  1SAC A;  1C1F A;  3VBR C;  3BN6 A;  1UOF A;  5FP7 A;  3O12 A;  4L2N A;  2SLI A;  1CAV B;  1S0J A;  3ROU A;  3ACI A;  4DRV A;  1OVS A;  2VMD A;  1OA2 A;  4NHX A;  2NPI A;  1DF0 A;  2PTM A;  5A1A A;  2W2I A;  4FXK B;  4UYB A;  3KV5 A;  4HK9 A;  1J59 A;  4JGY A;  4NRQ A;  1KJL A;  1JN2 P;  3H1M A;  1SBE A;  1W0P A;  3LD8 A;  4UW4 A;  1NCQ C;  4QU1 A;  1VE0 A;  4YGB A;  3U4S A;  2YV8 A;  3I3D A;  4FOQ A;  3T09 A;  1AVB A;  2ILM A;  1EV1 3;  3N9L A;  5F5C A;  1N3Q A;  5JOY A;  2CAV A;  3WX5 A;  4BH9 A;  1REE A;  1BCX A;  3K4A A;  4UAP A;  3D0J A;  4CDW A;  3N9O A;  3VD4 A;  1QJE A;  4CE8 A;  2WQ4 A;  5FZC A;  2RR1 3;  3MFC A;  4FOY A;  1COV 2;  1JYN A;  5LBE A;  5J48 A;  3USU B;  1YIP A;  5A1L A;  2AH2 A;  2XJV A;  2GP3 A;  2A5Z A;  3DPR B;  4G4F A;  1LCL A;  1LOB A;  2W5F A;  2ZX3 A;  4OVE A;  2QUO A;  5JVV A;  1C5I A;  3KV6 A;  5FYI A;  2BJS A;  2BU9 A;  4WZF A;  2V4V A;  2DDU A;  1AR7 1;  3FHQ A;  5FKB A;  1JH5 A;  2EAA A;  4J25 A;  3FN9 A;  4I3P A;  1Q8Q A;  2VW1 A;  4XBQ A;  5F5I A;  2NMO A;  4LBQ A;  2BRT A;  2ZGM A;  4IGO A;  1DQ4 A;  4LIU A;  3I2I A;  2WZE A;  3DKW A;  3R0R A;  5DAW A;  3IN9 A;  5FQ0 A;  1HJG A;  1APN A;  2YHJ A;  4FQ4 A;  3T2P A;  2H0V A;  1JOP A;  4MX3 A;  4NRO A;  5JXI A;  4E2Q A;  1DGW X;  1OOP B;  2FCV A;  3ZYB A;  1G9D A;  3V0A B;  4QM9 A;  1QOT A;  1DIW A;  3VBF A;  3QAC A;  4HAN A;  3OOX A;  1GIC A;  1DYP A;  4EQV A;  4WVV A;  3TNP B;  5C4W A;  3VZL A;  1EV1 1;  3B94 A;  4RN5 A;  5HPO A;  4QB2 A;  2DVG A;  2YMZ A;  3O14 A;  3DL3 A;  1ZRF A;  1Q8S A;  4ZON A;  1YEW A;  3M7A A;  4DIN B;  1UZV A;  2JDK A;  1LKN A;  1C8N A;  2RR1 1;  4HPK B;  3TEY A;  2VZP A;  4MV2 A;  2WN3 A;  3KT1 A;  2GMP A;  3O5S A;  4JKM A;  4QXK A;  4Y5T A;  5D2A A;  3IZO A;  1JOB A;  2BBA A;  4Y1V A;  1F31 A;  3Q8A A;  4OUS A;  3FLT A;  2RJK A;  1OFS A;  4AAX A;  4UW5 A;  5JLV A;  1ENX A;  4JC1 A;  5J7M A;  3BU0 A;  1SQ4 A;  5CU1 A;  3KZ4 C;  1ULC A;  4HN1 A;  1RXG A;  1OPO A;  1STM A;  2L9L A;  5DG2 A;  1QJZ A;  3BTY A;  5CFC B;  1IPK A;  4XFG A;  1CAU A;  4CXX A;  4Y3O A;  5FXW A;  4MET A;  4E4H A;  3D82 A;  3U37 A;  3K4D A;  5DAP A;  3WNN A;  4EZ4 A;  4R8H A;  4QHO A;  3R05 A;  4LE4 A;  3BAL A;  2OYZ A;  1BQP A;  4XQD A;  2D6P A;  2CDO A;  1MS4 A;  2D40 A;  5FLH A;  2GNB A;  4LA2 A;  4CU6 A;  4I2O A;  4AVS A;  2O8Q A;  1DQ2 A;  2WZR 3;  1AR7 2;  3PTY A;  1CIW A;  2VVF A;  5FLI A;  2R06 3;  2JB4 A;  1CON A;  4ZS3 A;  5L9R A;  3NMB A;  1O91 A;  2XLA A;  4CCC A;  4P9Y A;  3C7H A;  1W6Q A;  4CRQ A;  1JYX A;  5C33 A;  3B9I A;  4PT6 A;  1JZ8 A;  5FO9 B;  3A4U A;  1PNG A;  3ZR6 A;  2DCT A;  4XUQ A;  5C9A A;  5FPU A;  1W05 A;  4PBP A;  1G9C A;  2WLP A;  5LY2 A;  4DXT A;  5FYV A;  3ZYG A;  2FMD A;  1GNH A;  1K5M A;  1DGW A;  2NLR A;  2DTY A;  1TE1 B;  3MIC A;  4XQW A;  3WP6 A;  4XUR A;  4YNI A;  3SKJ E;  4R52 A;  2V5D A;  3ZFF B;  2DBN A;  2AEY A;  2A73 B;  4OHX A;  4XUP A;  3LEG A;  3ETP A;  5FWE A;  3LFM A;  3VHN A;  1CZV A;  2G9F A;  2VO5 A;  1QJY 3;  2RR1 2;  2ZJC A;  3MV0 1;  1GZ9 A;  4FPY A;  1O3R A;  2R07 2;  2AUY A;  2Y6F A;  4JVA A;  1ND2 A;  5LK7 B;  1UW8 A;  5FP9 A;  1K45 A;  3D5O A;  1LHU A;  3K51 A;  1ST8 A;  4QX8 A;  5LBC A;  2XUM A;  4PBO A;  2WZR 1;  1V9U 3;  1LHW A;  3NW4 A;  2QQL A;  4JDM A;  1PGW 2;  2W47 A;  1HB4 A;  3KHC A;  4OUE A;  1IS5 A;  1SFY A;  1BMV 2;  5JWP A;  2W39 A;  4JRA A;  5FRA A;  1PX4 A;  5CFD B;  3EMR A;  3E6D A;  1IOA A;  4M00 A;  4N53 B;  2A3X A;  5A3P A;  5JXH A;  3QD6 A;  2ZAA A;  2QTW B;  3NJZ A;  5IFT A;  1HB2 A;  5C8C C;  4Y26 A;  1F2N A;  4CEY C;  3A0N A;  3Q9O A;  1CVN A;  4UW6 A;  5A1F A;  1NY7 1;  3CIH A;  2QJV A;  1W6M A;  3B3Q E;  3NWK A;  4OI2 A;  3ZSK A;  2VMH A;  4AED B;  2A6V A;  2PA7 A;  1O7F A;  2Y64 A;  2ZS6 B;  3D8C A;  1URX A;  3GHM A;  3M3C A;  3DYO A;  4MXW B;  5E16 A;  2E7Q A;  4Y4Y A;  1POQ A;  3B69 A;  4CCN A;  4KGQ A;  3V0B A;  4CP2 A;  1JU4 A;  4CXY A;  1W6P B;  2OKX A;  2KD7 A;  1CAX B;  1O8P A;  2JDP A;  3N7J A;  4UFM A;  4JRL A;  4RYD A;  4XJ9 A;  3THD A;  2W1U A;  2ORZ A;  4CXW A;  1NQD A;  1RUO A;  1S2B A;  2B46 X;  1DQ1 A;  1H8T C;  4IEZ A;  2X09 A;  4JQT A;  5APA A;  4BWO A;  4YM3 A;  5DMY A;  2Y34 A;  2Z5W A;  2VOV A;  1CAW A;  1H8V A;  4OLL A;  4YFZ A;  5FO7 B;  4PDW C;  3N7L A;  1RUF 3;  3RYR A;  1V9U 1;  4YSF A;  2AEN A;  5IVC A;  1GOG A;  1WUV A;  5F9T A;  1B09 A;  3KM5 A;  1X33 A;  5JI9 A;  2EIC A;  3JXS A;  1M06 G;  2YFU A;  4NO4 A;  3M2M A;  3LPF A;  4MUV A;  3ATG A;  4HG6 B;  4E4D X;  1OLQ A;  2VVD A;  3OEB A;  1MPX A;  4YFW A;  4DY5 A;  1KGY A;  2ZKL A;  1RUN A;  1K5J A;  3DN7 A;  3MIE A;  3BPZ A;  3WUD A;  3H7J A;  2VOK A;  4C0B A;  1ND3 B;  1UN1 A;  4CA9 A;  1XYN A;  4Q26 A;  5A7S A;  2GDF A;  3HJR A;  2JG9 B;  2Y60 A;  1UY4 A;  2VQU A;  1B35 C;  3GZT B;  2VOW A;  2WZR 2;  4L8Q A;  1X82 A;  3ZYP A;  1I1E A;  4CEW C;  2AAC A;  2BP6 A;  2R06 2;  3WNM A;  2BBV A;  2WRA A;  4URT A;  2XDV A;  4UT5 A;  4QX2 A;  2YU1 A;  3ENR A;  5LBF A;  1H2L A;  2FBE A;  2QZ2 A;  3WT3 A;  1UNB A;  4QGM A;  4Z07 A;  3Q8E A;  4GMP 3;  4IV3 B;  2EXJ A;  2ZEW A;  4Q2F A;  5BNP C;  2BOJ A;  2P6C A;  2DUR A;  2VQ0 A;  5SV8 A;  1NY7 2;  2W87 A;  4XE9 A;  2GP5 A;  2V72 A;  3JD7 3;  3OCP A;  5GZD A;  1MAC A;  2QQO A;  4DUW A;  1RUF 1;  1OQE A;  4HFS A;  3WD5 A;  1O8S A;  3O0X A;  3Q8B A;  2XUE A;  4BHP A;  3PIJ A;  2AYH A;  3OYW B;  1KDM A;  2VCM A;  3HNY M;  4MH0 E;  4MSV A;  2WZP P;  1X50 A;  5FZI A;  5FZK A;  5F3G A;  4YG0 A;  2JDA A;  4LUL A;  4XF0 A;  2OS2 A;  1UOJ A;  1QJY 2;  4S2F A;  3R4U A;  1YI7 A;  3FFZ A;  4AEK A;  3VDD C;  1UAI A;  2BTV C;  4ASL A;  1FOD 3;  1PVX A;  2F6B A;  1A8M A;  2WLQ A;  3DEC A;  3VKN A;  4A2U A;  1MVQ A;  3CJI C;  3RVH A;  1Y9G A;  2EIG A;  2JKB A;  3OF1 A;  1YLL A;  4NIG A;  2XL9 A;  1UYP A;  2C5D A;  2RS5 3;  3FZ3 A;  3VBH A;  1D2Q A;  4XQ4 A;  5IAV A;  3EBR A;  2G19 A;  1RHI 2;  3BB6 A;  3GJA A;  2XPJ A;  4HMZ A;  3WZ1 A;  1UMZ A;  3OJB A;  2VZV A;  3WW1 A;  2BFU L;  1C28 A;  1ZX5 A;  2RM2 3;  2QDR A;  3IDA A;  4FCA A;  3ELN A;  3OD4 A;  3SH4 A;  5ABJ A;  5LA1 A;  1QU0 A;  4GMP 1;  4XET A;  1JYT A;  1EY2 A;  1W2O A;  1WLD A;  3NAP A;  4DS0 A;  4IEO A;  3JD7 1;  3WR0 A;  1MZ5 A;  1PGS A;  4LOR A;  5FMO L;  5LRR A;  4CDW C;  5FZ0 A;  4LO6 B;  1AJK A;  5J37 A;  1NUK A;  3OGR A;  1VRH 2;  5DXD A;  3VB9 A;  5I8Y A;  4DMI A;  2RE9 A;  1WCQ A;  3OY8 A;  1BK1 A;  1UZW A;  3KCX A;  4XF9 A;  2OQ7 A;  2ETE A;  4ATE A;  4BPZ A;  4XIO A;  4UI9 L;  1FOD 1;  1PMH X;  1LOD A;  1VBD 3;  3LEI A;  2DCZ A;  3AKQ A;  1KXG A;  2OQ6 A;  4QGN A;  1IKQ A;  3VD9 A;  3NL1 A;  4XOG A;  3S0M A;  4JCK A;  4CDQ C;  4AE2 A;  3CMG A;  3ZFG C;  2PAK A;  2RS5 1;  2XXZ A;  2Y6H A;  2YC2 A;  4LO5 B;  1MS5 A;  1RUF 2;  4PQ9 A;  4DPN A;  5LWB A;  1N47 A;  4N43 C;  4YGC A;  2W95 A;  3L9J T;  1Y9Q A;  1DLC A;  3AL6 A;  4IEV A;  4LMF A;  2HBT A;  3VHP A;  5HXM A;  4I0A A;  1VBA 1;  5FYY A;  1WBF A;  5EP9 A;  2BYV E;  2RM2 1;  5C5T A;  1Y9M A;  5I0T A;  3ST7 A;  3ZXG A;  2ET7 A;  3Q8F A;  2QQN A;  3KCC A;  1O4Z A;  2EA7 A;  5HV0 A;  3MBW A;  1XE8 A;  4M3C B;  2HYX A;  2WNO A;  4IQP A;  5L36 A;  4AQ6 A;  3O0V A;  5JIU A;  1MEC 2;  1NCR B;  3UJO A;  1LU1 A;  3VKM A;  4BMB A;  5A33 B;  2E26 A;  4YVW A;  3VBS C;  4M0N A;  3ILN A;  1HQW A;  4WM7 C;  5FYU A;  4OUL A;  4A7Z A;  2LW8 A;  2ARE A;  5I91 A;  3K77 A;  3OSD A;  4YW3 A;  3WHT A;  2W52 A;  4H7M A;  4ZPI A;  5C8C B;  4V1P A;  4COY A;  3ZPY A;  5A3N A;  5KHK A;  4FPC A;  1VRB A;  2XOM A;  1PVC 2;  1AUY A;  2H6C A;  5AVP A;  4RS5 A;  4Y22 A;  3AZX A;  2K2S A;  4KU8 A;  3WDV A;  4AI1 A;  4D8M A;  5T5L A;  3NVC A;  1IPJ A;  3I7D A;  4NOT A;  5BNO C;  4AFD A;  3FLR A;  4HOO A;  4B1L A;  4DQA A;  3JD7 2;  5D8A A;  1OI6 A;  4U36 A;  2WNU B;  4I0W B;  4JKK A;  4QAW A;  2RDQ A;  4CUG A;  4QDQ A;  2ZX2 A;  5JMO A;  3WLU A;  2NZ9 A;  1QMJ A;  2XVL A;  1TVG A;  3WNK A;  4GH4 B;  2BPA 2;  4LTA A;  1AYM 2;  5FTT C;  4QPG A;  1PO1 3;  3BOD A;  1VPH A;  4EJR A;  1J3P A;  2FCU A;  2ZHM A;  3WDY A;  1RIN A;  4X8P A;  3SQO A;  2ZMN A;  4Z82 A;  4QQO A;  2G4I A;  4YZ1 A;  2PQQ A;  1SLA A;  2WNV B;  4HSJ A;  4IE0 A;  4DZG A;  1X9P A;  1FOD 2;  1O6U A;  4AGR A;  2YGL A;  1BYH A;  2YC0 A;  1VMF A;  4NAO A;  5H9Q A;  5F3I A;  4EWA A;  5DZE A;  1UYX A;  3AK0 A;  1YQ2 A;  4RQP A;  1W03 A;  2RS5 2;  3BOP A;  4F3J A;  2QQJ A;  5C3S A;  3G7D A;  5IK4 A;  2YRO A;  3VHO A;  1UU4 A;  3CF6 E;  2ARB A;  5K0U C;  1NA1 C;  1W6O B;  2JE7 A;  4XFC A;  3HMY A;  1RUE 1;  3OGV A;  3ZYJ B;  1GAN A;  3PHM A;  3S7I A;  5FLJ A;  4LIV A;  1GNZ A;  3WEZ A;  5BNQ A;  1WW4 A;  1G7Y A;  2DYC A;  2DVD A;  2HWE 1;  3BOW A;  2P34 A;  4Q0V A;  4LKD A;  3BTA A;  4AI9 A;  3ON7 A;  3D0S A;  4QXC A;  4EWD A;  2ES3 A;  4A44 A;  5IK7 A;  2KR2 A;  4ZU7 A;  1JOD A;  2A70 A;  1PIV 3;  1XNB A;  2VR4 A;  4L9B A;  3AKP A;  1PO1 1;  4JHT A;  1IHM A;  1PK6 B;  1ND2 C;  4CDU B;  5A3M A;  1NYW A;  4JX0 A;  3VDA A;  1MS8 A;  3UKT A;  2QNK A;  2W08 A;  3EQE A;  2BVV A;  4ISQ A;  3WIN E;  1CAV A;  1DGR N;  1VBD 2;  4WM8 B;  4IEW A;  5A6Y A;  4AR2 A;  3HAG A;  5FV3 A;  4EE2 A;  3MF6 A;  2G9Z A;  3LDK A;  4GWI A;  4QDR A;  3M3Q A;  3RI8 A;  3AXD A;  4HSL A;  4MXV A;  3ZFE C;  4AG4 A;  4MGT A;  4QM8 A;  3GBF A;  1RJ8 A;  5FY5 A;  4XDO A;  2VNO A;  3AFG A;  4UBG A;  2VMI A;  5FOB B;  3POS A;  3X29 B;  2P3K A;  1GUI A;  2G9G A;  3CNA A;  2GNT A;  2TUN A;  3I97 A;  2MEV 3;  4MGK E;  5T5J A;  4M01 A;  2RG4 A;  1X36 A;  2GH2 A;  1DLL A;  3IMM A;  4IET A;  1FXZ A;  4ARY A;  4XAE A;  3NV2 A;  2RVA A;  2Q8O A;  3ZXJ A;  4AHX A;  1VBB 3;  4OCT A;  1R1A 3;  5JIA A;  4DEQ A;  2W0X A;  3USU A;  3VKO A;  2HJI A;  1DG6 A;  1FV3 A;  3DPR A;  1W9T A;  3O1O A;  4UFI A;  4LOT A;  1PIV 1;  2RS1 1;  4NHK A;  3APB A;  1GFF 2;  4GQ7 A;  4CTE A;  3SLI A;  1ODN A;  2FQP A;  4NWW A;  2BDR A;  3THC A;  3MIB A;  1CZT A;  1Z0H A;  3NJY A;  2DF7 A;  1OF3 A;  4O61 A;  5IW0 A;  3C7F A;  5SV5 A;  1JI6 A;  3O1P A;  1O5L A;  4XUN A;  3WQ7 A;  3S5A A;  2QQU A;  3P5B A;  3CLP A;  2E7T A;  4KWJ A;  4AGV A;  1VIW B;  5D21 A;  3GDB A;  1TNR A;  1SBD A;  3CHX A;  4H3W A;  5A7W B;  3TRS B;  1XNA A;  1QEX A;  1OOP A;  2EID A;  2LM3 A;  1W9Y A;  4NPM A;  4UOJ A;  1KFU L;  3V0A A;  1YQ5 A;  3OBR A;  1XND A;  2HEY F;  1C3H A;  2MEV 1;  4V2V A;  3O1U A;  3LE0 A;  4E27 A;  2RJL A;  3ME2 A;  1RUD 3;  3NNL A;  2JG8 B;  4IEY A;  3ZXE A;  3WUC A;  4K7J A;  3KS7 A;  5E1R A;  3N9P A;  1ENS A;  3VLB B;  4FFG A;  4B7K A;  4CCM A;  1VBB 1;  5AC9 3;  4HPK A;  1AR9 1;  1R1A 1;  3WF4 A;  4KNC A;  1NE4 A;  1UY2 A;  2UUR A;  4XXA A;  1LGC A;  1OH3 A;  3LGR A;  3OBZ A;  1W3X A;  2X5I B;  4YW6 A;  5I0U A;  3CJX A;  4R9D A;  3L2H A;  1UOB A;  3QLQ A;  5F32 A;  1WCD J;  3WDU A;  3C2U A;  3RZG A;  1S2E A;  3BGA A;  1V6M A;  1U5Z A;  5C5U A;  1BHG A;  2ZGN A;  5A6Q A;  2AEZ A;  2BFU S;  3UV9 A;  3J8F 3;  4Y1U A;  5CFC A;  5FZL A;  1OLR A;  1O4T A;  2EF6 A;  4LXL A;  5A70 A;  3RSJ A;  5EXO A;  5KXD A;  1SDD B;  4PCR A;  1JUI A;  4IEX A;  4LOS A;  4K40 A;  4J1W A;  2HWB 1;  3VBU B;  4CCK A;  2VCA A;  4Z2W A;  5BUV A;  5BY5 A;  1MQT A;  4MGI E;  1V6N A;  2RMU 2;  2XVG A;  1H9P A;  4MGZ E;  2VMC A;  5L19 A;  1PIV 2;  1C1L A;  1ULE A;  4Y5Z 0;  4BXF A;  4S2G A;  2CU5 A;  1RUD 1;  4RHV 2;  3VBO C;  2DFC A;  1JOJ A;  4NHM A;  3ZKY A;  4QWN A;  3AMP A;  3U10 A;  2BOI A;  1NZI A;  3SIS A;  3RWK X;  1UPI A;  1YHF A;  2K9Z A;  3AYC A;  3HD8 B;  3IMN A;  4CYD A;  5C3P A;  1KS5 A;  1O5U A;  4K8F A;  4YAR A;  1OUS A;  2W92 A;  4IE4 A;  4YGE A;  5FP3 A;  3POJ A;  3SCF A;  5IVV A;  2HYK A;  1FAT A;  2EIE A;  3AZV A;  1ULO A;  1UMH A;  2GC2 A;  1LRH A;  3AFK A;  3NAP C;  3VBR B;  3R4S A;  5HCB A;  2KXL A;  3VZN A;  2BNN A;  3ZFF A;  2VXJ A;  4XFF A;  3C7G A;  5FJK A;  1OD3 A;  3J8F 1;  1HRI 2;  3PVO A;  4ONU A;  2VY0 A;  2Q8D A;  1W8U A;  3WW3 A;  5CEH A;  1VBB 2;  4URA A;  1UOG A;  1NCQ B;  2VNR A;  1COV 1;  1V6J A;  4CDX A;  1NAE A;  4Q1R A;  1I5P A; 
#chains in the Genus database with same CATH homology
 4NJ4 A;  2FDF A;  3BI3 A;  4ZS3 A;  4QKF A;  3RZK A;  3RZJ A;  4QKB A;  4O61 A;  3O1P A;  2FD8 A;  3S5A A;  4NRQ A;  3BUC A;  3I49 A;  4NPM A;  3O1S A;  3KHB A;  3O1V A;  3O1U A;  5DAB A;  5F8P A;  3LFM A;  4IE0 A;  2IUW A;  2FDG A;  4NRM A;  3T4H B;  3H8X A;  4NIG A;  3T4V A;  3I3Q A;  3RZG A;  2FDI A;  3KHC A;  4MG2 A;  4IDZ A;  4IE5 A;  3H8O A;  2FDK A;  2FDH A;  3S57 A;  4NRO A;  3BKZ A;  3BIE A;  2FDJ A;  4QKD A;  4IE6 A;  4NIH A;  4CXY A;  3RZL A;  4JHT A;  3RZM A;  3H8R A;  3O1T A;  4O7X A;  3I3M A;  3O1M A;  4CXW A;  4NRP A;  3O1R A;  4IE4 A;  3BU0 A;  4MGT A;  3BTX A;  3BTY A;  3I2O A;  4CXX A;  4QKN A;  4NII A;  4IE7 A;  4NID A;  4RFR B;  4ZS2 A;  4QHO A;  3BTZ A;  4OCT A;  4ZHN A;  3T3Y A;  4NPL A;  3O1O A;  3RZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...