3KHOA

Crystal structure of murine ig-beta (cd79b) homodimer
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
88
Chain Sequence
b'IWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKDSCGTELLVLGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B-cell antigen receptor complex-associated protein beta chai
publication title Structural and Functional Studies of Igalphabeta and Its Assembly with the B Cell Antigen Receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 21
structure length 88
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3khoA00
4U1HB 5C0JB 5KTEL 3THML 1E27A 1YEJH 1JMZA 3B5GA 1MCKA 3TBSB 3C2SA 1KJ2B 3O11B 4AG4H 5GZNC 4PGEA 4IMKC 3I75B 3O2DH 3JUYA 4HPYL 2D7MA 1TCMA 5IT2H 1MHCB 2NY2C 3CFBB 4I3SL 3X3FL 3IFOA 1A6VL 2CO6B 3KS0J 5MEOB 5IMLB 1L9MA 1T20A 3ZKXC 1L7IH 1UXWB 3AS2A 3FN9A 3TC9A 2IQAB 1WAAF 3FQTA 4CU6A 2P8PA 1G9NC 4UT6L 3HN3A 1T2JA 5FF6A 4LCIL 4QTHB 2BSRA 5CEZL 1OAXL 1QSEB 4HGKC 4JZJA 1YYMH 5GISL 3IFLH 3HE7C 5EBLA 2C3VA 1JNLL 4U1MB 3DV4B 3MV7B 2H3NB 2A2QT 3PQYE 4L1HA 3BRDA 1ZGLP 2ICWB 4G9FA 4QT5A 2GSIA 1KIRA 2EEBA 5E5MA 4YHNB 4P4KB 2X05A 3LIZL 2VIRA 4G9FD 3T0AA 2MQ0A 4XCEB 3DV6A 3HMXA 5GS1A 5HHMB 1KNOB 1UJ3C 3QJHA 2C26A 3QIUB 3O9WD 4OD1H 1BMGA 3R8BB 3PHSA 1C5DA 3P30L 4LK4A 4KPHL 4O2FA 3C5JB 4XBGA 3O2VL 4S2SA 5C7XL 2ADJB 1OAUL 4NQEB 3QNZA 3PGDA 4QWWC 3TJHD 4MNQB 4X7EC 4NZUL 5EORL 1ZA3A 4U6YB 5ALCL 3F7PC 3ALWA 5I8EB 5DEFB 3PWNA 3O0RL 3S3JA 3V2AR 3BFOA 5HGBB 3MRCA 3RWDA 1YEKL 5ILTL 5FYKH 1RJYA 2QLVB 5I75B 1BEYL 5D7KD 2I27N 1B4RA 1JI2A 5DS8A 4ERSH 4LHUG 2B1AH 3ORJA 4UDTB 1B90A 3GMLB 1KTKE 1S7VA 5F1NA 1I1CA 5CJXA 5I76A 4BSVA 4HIIA 3RL1B 1VPOL 1RSFA 3P2TA 4RISL 1CI5A 5DI8B 3N1QC 1NGPH 2Y36H 3VGAC 1M05B 1XCTB 4PJIE 4U1LB 3RA7L 3FAXA 1KG0A 1Z0NA 3VE0A 2R0KH 4O00A 1JRHL 1E4KA 4NGHH 3SE8H 1KLUB 4KZEL 1IQDB 4TRPL 3QFJE 1J1PL 2JJSA 2VH5L 3KYMA 1F11A 2DI7A 3PL6B 1YMHA 2J88L 4R26H 4Y5XB 1U8IB 4W4NA 3DRTA 3IU3A 4ZOAA 5DO2D 2P49B 1D9KA 4G43B 3C8DA 3HZKA 1PLGH 4MSWA 4NRXB 3BN9D 3SE9H 3OG6B 1D9KD 1FN4A 2OXHA 4KK5D 3UMTA 3DETC 4YPGA 5DHVB 2QTEA 2UVFA 2Y23A 2EDFA 4N90E 4LGSB 1U95A 2HH0H 4L3AA 1X7QB 4TSBL 5IW1A 3CU7A 2EDJA 5JOEA 5L2KA 1DVFA 4CAGA 1JNNL 1KB5L 4JFFE 5HYQA 3LEYH 5IEHA 1QVOB 2XZZA 4OZGF 4XMLL 5L2KD 1DVFD 4EN3C 1X5FA 4JDTH 2BC4A 1XGYL 1BOYA 2YPLE 4AH2B 1U8PB 1KCRH 1IE5A 4R4FH 2VLLB 3RGVD 3NCYP 2Z8WC 1JZ6A 4M02A 2C9AA 3LDBB 1LO0H 2EH7L 4M7JL 5FGBA 4HK0A 5EU6E 3BH9A 1NBZB 2EDNA 4JFHD 2VDPL 3TCLB 4IRJB 2APFA 2VLRE 1K4DB 2R4RH 5L2JA 1ORSB 5GRUL 1LE5B 3AROA 3VRIA 2P5WD 5DQ9B 5DQDL 5E8EA 1OL0A 4YHZL 2O61A 1FORL 5B38G 3TBTB 4U1NB 3CAFA 4JFDB 3P11L 5SX5H 3QNXB 2VXTL 1A9BB 4CVZB 5GGTH 4Z77B 1QA9B 2XICA 2YUWA 1A02N 1VSCA 4RFOH 4PJDB 4OLZH 2HJFB 4Z7WA 2AJZA 2VE6A 2EDWA 2J8HA 4MMXC 4IOIB 5DD6A 1A7QL 3SKNB 3ZKMD 2GSGA 3ARDA 4U6VL 5IHBA 3WXVH 4UB0L 4X98B 1IGML 1AO7B 3BN3B 4ZFGL 3E6HB 1MCBA 3ARDD 4Z0BL 2COQA 1YN7B 4HIHA 2VL4A 2NY4D 1ZGLA 5F72S 3P0VH 3EYOA 1CXLA 2GJ6B 5FGCE 3ZTNH 4GLRH 5DHYB 1BM3L 1P1ZB 1JHTA 1WSST 2YPKB 4ONFH 3U30C 3U0WH 4WO4B 4HWZA 2ARJQ 5E9DD 3OZ9H 1RFDH 3L3GA 4YXHL 4LSQL 4R90L 4O5LL 3HC4L 1A64A 1KJVA 4XNQA 2HVJA 2JELL 2R23A 4Z78B 5TDPA 1FH5L 2ZUQB 4D9RE 4R7NA 2DQFB 1OAQH 3HZMB 2EEAA 5DJYA 1K9TA 3CX5K 4YGVA 4M93C 1BP3B 1PVHA 5JHDA 2HRPL 4RA3A 5J7CC 5GGRA 3FMGH 2AK4E 3MUY1 4Z5RB 5JHDD 2IADB 5C0GB 2BVQA 3SBWA 5ISZE 2HLFD 3D3VD 3KR3L 3RWJA 4L5FL 2JB6B 4X7TB 4L8CB 1RK0A 5KSAC 4C56B 1K2DB 1BQLH 2QQNL 5MI0C 5HHQA 3JTTB 1KJMB 2J8OA 2WBWB 4OCSL 2HP4A 3WIFA 2F53E 5GRWA 3T3ME 3FTGB 3QHZL 2WWKO 4J2XA 1QLFB 5DSCB 1XGRB 2Z4QB 3T04D 4F9LC 5I66B 3ILPA 2NY6C 3M1BA 5AAMA 3HFMH 3BKJL 4MAYC 2UYLA 3RPIB 4DZBB 2V2XA 4YHIB 2NY3C 3L3DB 3LQAH 4X7SL 4G8GD 3A6OA 4YEEA 2DQTH 4ELMA 1HHJB 1LWRA 4AK1A 2VXSL 4P5KB 4DZ8A 4WENB 2P47B 1PG7H 1JGEA 5IVZB 4M8QB 2PKDA 3EO0A 4OV5A 5HY9A 4PJ7E 4HBCH 4AEHH 4PS4H 3RUGF 1MJUL 4M7KL 4NQCA 1CK0L 3WNNA 1KPUB 4ZUSB 2WINA 1FNGA 3ZYIA 5ICZA 3VXSE 4NQCD 2OS7A 3QWQB 3RKPA 4M1CD 3RGHA 4ACPA 4DAGH 3ZKQD 3PDOB 4X80L 3LKNB 3R06A 3D1MC 4WW1B 1FIEA 2A77L 4P2RB 3MLPA 1ZEAL 1YMMA 4C58B 43CAB 1R3JA 4Q2ZB 1MHEA 5J1TC 1NANI 4XVSH 2AJSL 5DFVD 1T89A 3VRLE 3LKRA 3NCBB 1CICB 3QDGB 1E4WL 4NCC1 5DJZA 3LZFL 2LU3A 3W81A 4GAYB 3V6OA 3RHWK 5JIIA 3Q3GB 1F6FB 3VXRE 3WJLC 3J7HA 3TGXA 1TJGL 2EDHA 4TUJB 1P4LB 3RPKA 2IBZX 4YDLB 1J18A 1IZJA 5CS7A 1P7HL 2RFXA 1NC2B 1LE9A 5DD3L 3JWOL 3HI5H 5EIIB 2FJFB 3TP4A 1A3RL 3KAAA 4JPKL 2C7UB 4WI2A 4CVXB 2V9TA 2MPAH 1NBYA 2FLRT 4UT7H 4WU5B 3CVHL 3QHFH 2Q8AL 4HLJA 4TOYH 3KXFB 2OL3B 4R8WL 5ID0B 5FK9A 4PV8B 4QF1B 3T0EE 3DUUA 4ZPTB 5MERB 1DQDH 2B4CH 1DFBL 2R1YB 3CFIC 3QXDB 4M3JA 2YEZB 4F9PC 1Z9LA 4KRPB 2YXFA 4OFVA 4Y16C 5I8OH 5IMMA 3MRFA 3IFNL 3MJ6A 3ALXA 4Y5YC 2ATPB 3FQXA 2QV2A 1RVFL 4N9GA 1H5BB 1WZLA 3BZFB 1TVHA 4NWTH 3SDYH 5F9WB 2FZ3A 2N7BA 4IOFC 2OMBA 4M48H 3SDDC 5JOPE 4K3DH 3JWOC 1JTOA 2FO4A 2DTML 1QD0A 3H0TB 5KN5B 3PP3K 4Y4HB 3AU1B 1ED3A 3WO4B 4X6DB 3BIAX 2XT1B 4NNPL 1C5CL 4YDJB 4GG6F 1S9XB 5J1AB 5E7BA 1WAAA 1X9QA 2EC9T 1IGTB 3OXSA 1RURH 3BKYH 4IBLT 3KNBA 3BP4A 4XB7A 1LP9E 2YRZA 2DWEB 3NVQA 2WBJC 1YEJL 4ZTPH 1MH5B 3QG6A 5HI4C 4FNLL 3OKNB 4AG4L 4YXLH 2H32A 4OIAA 5CILL 5IT2L 4B0MM 2W9EH 4I0KA 1I1FB 4R4ND 2Z31C 3DHJA 1BZ9B 1L7IL 1RZIB 3TVMC 3WS3B 1F42A 5CIPH 3WUWA 1JTPA 3UX9B 3WNOA 3S5LA 4DQOH 3IDYC 2YD2A 3GSUA 4ZQKB 1G0DA 1YYML 1I1RA 3DO7B 1I3GH 3L5JA 1UM5H 1QPXA 1NFDE 4OCXH 4LSRL 1T1XB 2N56A 1Q0YH 4TTDC 4LLWB 5HVHB 2CKNA 3QAZC 1INDH 1OSPH 1UH3A 3LEVH 4NKOA 4UOJA 4R0LC 2YC1B 4Z95H 5GGQH 1I7ZB 2HJLA 3OB0K 3SGKA 2VAAA 1MVUA 4M7ZB 1EXUB 3QUXC 4OZ4B 1OP9A 3ARQA 4NBYB 4N0CC 1DLFL 3G6DH 2OQJB 4ZXBC 4M6MH 4WU7A 1RI8A 4DFIA 2WP3O 2DJUA 1MCHA 2IFFH 4JKPH 3LRSA 3C6SA 4WV1B 5D2NA 1FVDA 2IQ9H 3QXAB 4PJFF 1M7DA 3VFNA 1E28A 1Q94B 3ECBB 5CBEA 3HNTL 5GHWH 3CSGA 1A2YA 3MNVB 3SJVE 4QCIB 4U1IA 3UJTH 2F8XC 3OAUH 5IKCA 2QSCH 4ZAKC 3H8NA 1KBGH 5DC4B 3BPNB 3DYMA 4M62H 1N64H 1BF8A 2MHAA 3HAEG 1T5WB 2JCCE 2R2EB 5CP3A 1DQMH 5HD8C 4X4XB 1DUYA 3VXME 4XPBH 3PABB 4ERSL 4LLVA 2B1AL 5CHNB 5EBGA 1NAMB 4OD3H 3VXNB 3X11A 4XMPH 5EC1B 3CFDA 3DIFA 3GI8L 2YUVA 3RJDA 4ZYKA 4N8CH 2WLYA 4U3CA 5B3JE 2QSTA 1BQHB 5D96B 3BEVB 1NGPL 2Y36L 3HCVB 1F3JA 4H88H 5FB8B 3UZQA 5F7YC 4NGHL 1MJ8H 1KN2H 1HQRB 4LBEB 3WD5H 1KXQE 4HKZB 1Z9MA 3MMEA 5DRWA 2XZAH 4OZGA 4CJ1A 3W11D 2XACC 3NPZB 1UH4A 2F54D 1GZPB 3CMOH 1PLGL 3MNZA 4UIMA 1AE6H 3SE9L 3MLYH 1S7WB 4G6AD 1DBBH 5IBUB 1MCWM 3BRGC 2FRGP 4GRWB 4TVPH 4PJCF 4WWKC 5A2LH 2C1PB 3I50H 5L9DH 1P84K 5D5MF 5F97E 5I1HL 4KROC 1CLYH 3H9YA 4B50A 1XF3A 3Q6GH 3HS0A 3F8UB 1UB6B 3WFEH 3LEYL 2GFBB 4EDXA 4JDTL 2ZG1A 1F3DH 2YD8A 1CBVH 1KCRL 4R4FL 1JGVH 2H26A 4M7LH 4Y2DC 1ZLUK 1WV7T 1LO0L 4ZNEA 3CUPB 1MOEA 1I8MA 4BUGA 4HS3B 1A6AB 5EZJA 4PJ9B 2R4RL 4X0KB 3FHQA 4YIQB 4N8VA 4U1JA 4P2OD 4JGUA 5EFIB 1CFSB 1KTDA 3O2WH 1X5KA 3GIVA 4LCUB 4NQVB 1RIUL 1U8LA 1Y0LB 2A6IA 1KLGA 3ARZA 5HDBE 4P3WA 1VADA 4PJXF 4LVHB 1MCOH 3M8OL 4XXDA 4QYOB 2DIAA 3NCYS 4RFOL 4XVTH 1TZGH 1H0DA 2CGRH 2P5EB 2RR3A 4ODHL 2J6EH 1UT9A 3WXVL 3EYVA 3GSOA 2AQ2A 5IW6A 2AJUH 4NZRH 1FNHA 4JGJA 4H0GA 2MCPH 5HHOB 3P0VL 5EUKA 3S7GA 1CXIA 5JO5A 3ZTNL 1T3FB 5C8JA 4JG0H 5H94A 4XRCB 5C9JA 4GO6B 4A6YH 1H3VA 2FSEB 3OHXA 3SO5A 5IJKC 3U36A 1RFDL 5IFHH 2IH1A 5DJAB 4DKEH 3TBYA 4MX7A 2CLZA 2ZUUA 4JFXB 5HYSA 5J3HC 5CEZE 4KI1A 4XP5L 2B0SL 4M61A 4Z76B 5F8RC 2C4FT 4JKLA 3B9DA 2QADD 3GSWB 1OAQL 2CLRB 1FVCA 2ZCLH 2FWOA 3NGBC 4O2EB 4D0DA 4HIXH 5HHNA 3JV6A 4CNIB 1N0LA 1AGEA 4ZO8A 3ZE1F 3IDXH 3S3SA 3FMGL 5HGHB 4HPOH 5DLMH 1EBAA 1MIMH 3T8XA 4K8RH 1BVLA 3DOSA 1SYSA 3DTXA 3NIDE 5JW5A 2VXVH 5ID1A 1H3PH 1SYVA 5JUEH 4LCWA 5KS9E 3RUGA 1WZ1H 1BQLL 4HIJA 2EZ0D 3DGGB 4LCWD 1ZLWK 3DX6B 3EDKA 3DWTA 2AKRB 4H8WH 3EFDH 3WLWC 3MRMB 3MRPA 4N0YH 4LP4A 3LQAL 5GS2H 1T1YB 2PR4H 4I4WB 2DQTL 5C9KA 2YD6A 2IAND 5CKAA 3TNNA 2DYPD 3C6LC 3EUUA 1PG7L 5F6IC 5FYJD 4I9WD 4AEIH 5I74B 4PS4L 3K4ZA 5E6IC 3GM0A 1RQ5A 3QFDB 2J7LA 1J11A 1WFTA 3AMKA 3FT3B 3PGFH 4J4PA 2Y6SD 3LKOA 1RIVH 1CU4L 2K1MA 2X1XR 3K8MA 3QIBC 3QUKA 5CGTA 3V5DB 2IH3A 4LKCB 3GGWB 3V9FA 2PYEB 4KMLB 5I6XC 3ZMRA 2HN7A 1MCEA 5K9JH 1UZ8B 3IVKA 4PRAA 4XVSL 1OPGL 4P5TA 3WEXA 2VL5B 3LEXA 4FQXC 4N0RA 1TVDA 1GGCL 3QEQB 4FFWC 4F7TA 3L5WA 4I5BA 3LQAC 4BFIB 3L95A 2DN7A 2YA0A 3LS5H 3IAGC 4PJIA 3PHQA 1FO0A 1UZ6F 4OLYH 3KYKH 4NNXB 1G1YA 4KDTA 3QG7H 3VFTB 3UTZB 1GCFA 4KTDH 4P5MB 3QFJA 3T1FB 4WI3A 5ENWA 4PJHB 4PJ8C 3SDAB 3WIIH 1NGZA 2BCKB 5IGXH 5BS0B 2MPAL 3KDMA 3OKOA 2VLJB 5B39G 4UT7L 3QHFL 1CL7I 3I6LE 1FL3B 3TA3B 5D7IE 4XWGH 1A4JB 5I9QB 3RWFA 1QSZA 1NCTA 4TPRH 1HYSC 3QRGL 1I8KA 3TZVB 1DQDL 1WBZB 2B4CL 3O8XA 3BVNB 4C55A 3VW3H 3FO1A 3MGTB 5TFSL 4PY8I 2A6DB 2P42B 4RAVA 3MBXL 5I8OL 1TVBA 4Q9QH 2VSCA 1QEWA 4XC3H 2IMNA 4N90D 2VLME 3IKCB 1UA6H 4B41A 5AWNH 2IGFH 3S36H 3IFPB 2W38A 4R2GD 4G8EB 1QBML 4P46B 1NMBH 3AS3A 4HCRA 4CGTA 1OTUC 3PE9A 1A5FL 1MRCH 4GKZA 3ZTJH 4M48L 2YPLA 1VA9A 1NSNL 1PEZA 4JFOB 3DX7B 4K3DL 5TQ2H 2R0WL 5CD3A 4MDIA 2CSPA 5AZ2L 3VD9A 2VLRA 2GT9B 4LNVA 4HS6A 2E7LA 3VDAA 3QDJE 5F89B 1HWGB 4CN4A 2VLRD 4N0FA 4XNYH 1URLA 2OZ4A 3I3EA 4PJ5A 4RMQA 4JPWH 1RURL 5ETUA 4LVNC 2W9LA 5BV7H 1XF2A 3TO4B 2XQBH 4PJ5D 5KW9H 1DBMH 2V5YA 4QOKB 5C08E 4OBSA 1LEGB 5D7LB 1RULH 4ZTPL 3MREB 1NCDH 1FG2B 4IM8A 3A6CL 4Y1AB 2BVOA 1MRDH 4YXLL 1KPRB 2JE8A 2VITB 4WUUE 4CBPA 2W9EL 3GMNB 4JFQA 1ACYH 4PRHE 5E2TL 3IDMA 4HKXB 3QIWB 5HHPA 1J8HB 3HG1B 4ENED 4I2XE 1XGQB 4P4KC 1U93A 4DQOL 3UTSE 3MBEA 3HR6A 4DJMA 3MJGX 1UFUA 1I3GL 2GJZA 2XTJD 1KTRL 1UM5L 5D6DC 2EDRA 3WFHA 4LRNH 1CIUA 1TTGA 1Q0YL 2A6KA 3FB8B 4ODXB 1I75A 4X5XA 1WT5C 4Z7UE 2EXWD 3MRIA 3TM6A 1DE4A 4YXKH 1INDL 1ZK9A 2XN9E 3LEVL 3NCCB 2R0ZL 4Z95L 5EBMA 5GGQL 3STBA 2DQIH 4RZCB 2X4TB 2DBLH 3MYZA 1KFAH 3D9AH 4X9BA 3SKUD 1N59B 2GUOA 1BBJA 4PRBA 3MFFB 3IJSB 3G6DL 4M6ML 1JF1A 4LAJH 1PYWB 5BRZE 5F9JA 2IFFL 5DFWH 4JKPL 4KUCD 5IR1B 5JTWA 3C8KA 1HHIB 4JG1L 1NMCC 5ISZA 4Y5VA 4LOUC 4CMMA 5GHWL 5FV1L 4P23C 4PJBB 3GMRB 2V7HA 3UJTL 5KSVA 3GBMH 2F53A 2F58H 3H2WA 3OAUL 3L3KA 2QSCL 1KBGL 4M62L 3ESUF 4XX1G 1N64L 3O3DA 1MQKH 4FQ2H 4U6HA 1GAFH 1NAKH 5K59E 4JQIL 3VGFA 5ACLA 2CPCA 1HHHA 3O6FA 2K3TA 4NQXB 3GRWA 1JBJA 4ODTL 4LHJB 5INDA 4EXPX 2YUZA 3NIDF 5FUZL 4F37K 3O6FD 3RY4A 4OD3L 3MROA 3KPMB 4XMPL 1WTGT 4G6FD 1F2QA 5C2BH 1F8TH 4HV8B 4PJ7A 4G8FA 3D0VA 3RL2A 4XTRC 3T2QA 3D87B 2W9DL 3WFDH 4R96B 4N8CL 4Y5XC 2GTWB 5JDSB 4NOBA 1Q9KB 2ILLA 3AREA 3LKPA 4PJCA 1TZIA 1YPZE 2VDKH 1WISA 4G8IB 3UPRB 3ARED 2Q6WB 4QRSB 2ZG3A 1UG9A 2X4NB 5I18L 5DK0B 1MJ8L 1KN2L 3P4MA 3FFDB 3WXWL 5KSBB 4XPAH 3O4LE 4LMQE 4GW1A 2X1WL 4WHTB 5F7DA 4W70A 3KYOB 3X13A 1JNHB 3HNVH 3QUZB 4EQ3A 3CMOL 1RUAH 3CFKB 1AE6L 3MLYL 2CRZA 4PPTA 3KJ4B 3K4DA 5EU4B 1DBBL 1CLCA 4JRYE 2UZYB 3OR6A 4U7KA 5TDOB 4XPGH 1NBVH 4MD0A 5FM8A 2M26A 2JJVA 4CVUA 1IVLA 3KPNB 5L9DL 1DQTA 3IDIA 1YEGH 4OBRA 3LDBC 4JKKA 5ITFA 4I0PB 1CLYL 2R8SH 4HC1A 1OGAD 4HEPG 1JF5A 1KCLA 3SGEH 3WFEL 5FM5M 2WSKA 4GW5B 4NJ9H 4PJXA 3RBSA 3VFOA 4FTVB 2E3VA 1CBVL 3QH3B 4M1DH 1JGVL 4X6CB 4ZPVB 3L3OB 3O45B 1IL1B 5DUPH 1D7FA 3IRPX 1ZHNB 3WUZA 4C57C 4TQEH 3T0EA 1H15B 5J56B 5C09E 3W0WD 5J6GB 4L4JA 2V2TB 2CDFA 3GMOB 3EFFA 3I84A 5CWSB 3SDCC 2VTFA 3BO8B 1NC4D 4D8PA 1XFPA 4LCCC 2DJSA 4OTXL 4LLYA 4QO1A 1B0RB 3G5XA 2ZCHH 5C6TH 4F2MB 1MCCA 4ORZC 1MCOL 1H3TA 3MX0A 4XVTL 1P5VA 1C08B 1TZGL 4BQ6A 4OFYD 3KHQA 3VXPA 4PTUB 3LS4L 1BFOB 5IQ7H 2P8LB 3QQ4A 2J6EL 5EU5B 4N0UB 1FZKA 5JOPD 1RUKL 2PTTA 4LF3A 3DMMC 4TUKH 2AJUL 4HSQA 3BHBB 4NZRL 3A6BL 3LCYA 1EHLH 4FXKA 5F3HB 1DBAH 1X5ZA 2MCPL 1JP5A 1J1OH 2KZWA 2VN7A 4NO3A 3ARFB 4JG0L 3FOMB 3CDFA 3BUYB 4A6YL 4YZFE 3HRZB 4L3EE 1LP9A 4K71C 5IFHL 4YO0B 1YN6B 4XI5C 3VGDA 4LSVL 1LK3L 3AC0A 4KJPD 1A8JH 3UZVB 1M6OA 7FABH 2GJJA 2WQRA 3QEUB 2ZCLL 3SKMA 5HPMB 5I1LB 2OI9B 3S35X 4QHKJ 1I1AB 3MV9E 2HLAA 3U4AA 1IGJA 2PW2B 4L4VA 4K7PX 3IDXL 5D4QA 4HPOL 3D2UA 5DLML 1ETZB 4NT6A 4L4VD 4L8BB 3VFSA 3RFZC 4K8RL 3BZDA 4IMLB 2FJGB 4X4YB 1R3HA 2FH6A 3QUYC 3ARGB 2PXYD 2VXVL 2OK0H 1MAJA 2CRMA 1B6DA 2YRLA 1H3PL 4JY6B 5I17B 2RAMA 5DMJB 1HXMB 1WZ1L 2KZ1B 3CD4A 3OQ3B 3NPSC 3UPCA 3UEZA 2H1PH 2HG5A 2X4OB 1DDHA 1GYAA 1AHWB 4PRDA 3RTQC 2Z8RA 2VQ1A 3WDJA 5T1KD 1G7QB 2KBGA 3I2CH 2XG4A 2QKIA 4HJGA 4KQ4H 4H8WL 3EFDL 1TPXB 5GJSH 1RJLB 3BZEB 1PDKA 2J8UB 4N0YL 1NUNB 2GW5A 5EULV 5ESVB 2PR4L 3LPGA 3SOBH 1EJ6A 1I8IB 4PJAB 1M4KA 3OKDB 4AEIL 1MFBH 3AM8C 4Z7UF 1RD6A 4YBHA 1IM3A 3SJVA 1KELL 3PGFL 5DUBB 3U46A 3KPSD 4K8RC 1RIVL 4E5XB 2Q86B 5F44A 1JMXA 5HGAB 4QHMB 4KKCC 4NUJB 5B4MD 5ITBH 1CICC 1TNMA 1WZMA 1X5HA 2GK0B 3G6JE 2JCCA 2FGWH 1R3LA 3HC0B 1T1ZA 2EDYA 1J0JA 1FRGH 4P3DA 4X83A 3VXMA 1NFIA 3TJEH 4YDLC 5K9JL 3CLEH 5LXGH 2E8YA 4O4YH 3IKKA 1LNUB 4H8WC 2AVGA 4WI7A 3HC3H 4WW2B 1GC1L 3ZT6A 5EBWB 1C1EH 4HZLB 1LHZA 2AXGB 1VFBB 1WCBA 4MB3A 2DLHA 3BPLC 4OLYL 2MSPA 4BUHA 5D2LE 5L7XL 1A1OB 1SQ2N 3HE6A 3MACH 3MRNB 4KTDL 3U6RB 3WSQH 3CFEA 4U7SA 4ZSOB 4M00A 1JRHI 3ALPA 4JQXA 4O2CB 3WIIL 4MCZA 1R5IB 1SM3H 4KRPC 5GGSB 4LSPL 2NY0C 1DBJL 1PKQE 3P0YH 1GSMA 3D85B 2HAZA 1LEKA 1H5BC 2X9YA 4HK3N 4Q6IA 3DVGA 4GRLC 5F9WC 2J5LB 2XNAB 4TPRL 4YHLH 5DT1H 3CCHB 1PX3A 3VW3L 1YPZF 4KTEH 1GC1C 4WUKH 32C2A 5HYJB 1CFTB 1EUTA 3D18A 3PV7A 4Y4HC 3WO4C 4XC3L 4LEOB 1EJOH 3IXTB 4NPYA 1UA6L 1T1WA 2IGFL 5TDNA 1SMOA 1B0WA 4OAWA 3RVXD 1NMBL 1MLCB 3QWOA 1MRCL 2E7MA 1K8DB 3OPZH 2BVPB 5IESH 2CD0A 1WFNA 1FZMB 2BSTA 5TQ2L 4XVUD 5CP7B 3BE1H 3RIFK 3QUMB 1DR9A 4IMKA 5JMOC 2BMKB 4IEFB 4PRIB 5EDXA 4QRTA 1J12A 1YEIH 5JOFB 5KZCB 5EO9B 4C83B 2IBBA 4PJGB 5DRNA 5CEYA 2NY2D 3ZE2E 4XNYL 1JPSH 3IGAA 1WBYB 5JW3H 4JPWL 4OIBA 3MJ7B 4LHUA 4E41D 1YNKH 2ESVB 3KPPB 3CMGA 1SVCP 1T7WA 2D31B 1FCGA 1A7PH 3HE7A 2XQBL 5KW9L 1FL5A 1DBML 3CIQA 4OCYH 4NRZA 3V4UH 4XMKH 4DW2H 2A83B 1EFQA 4MQXC 3HE7D 1NCNA 4MXWH 5IM7B 3GSQA 1IM9B 2BRQA 2BK8A 2DBJA 5FECB 2B2XL 4GRMB 1MCLA 4MJID 4OF3A 1ACYL 2VC2H 2G5RA 4PLKD 1UJ3A 3HPLA 3L7FA 3CXHJ 4U49A 2R1WB 1XGUB 1W72B 4XAKD 4M7ZC 1FZJA 3R0NA 3KS0H 3CXDL 4LRNL 5CKGA 1RPQA 4WTWA 4Y2OA 2H9GB 3DX9A 2F5BH 4YAQA 4ZFOL 1T22A 5GSRA 4YXKL 4QHKI 1OTSD 3C08H 4NRYA 1HYRC 3G08B 1MFCH 3MOBH 3VA2C 2DBLL 4QWWD 1KFAL 3D9AL 1CD9B 1C12B 1VGKA 1JZ8A 4YFLF 1DSFH 4P9HC 4HWBH 1Q72L 2Q8BH 3IJHB 1ZTXL 2B39A 5B8CB 1DCLA 3BPNC 1MFAH 1FSKC 5TF0A 1WWAX 2A38A 1IGCL 4CW1A 4CADA 3PP3H 1T7XA 1N4XH 3GBML 3VDCA 1ZT1A 2F58L 3MUJA 1DANT 3T4AA 4WFGE 3D6GA 3VWJA 3UTQB 2Z92A 2V9QA 2VDQH 1MQKL 1GAFL 1NAKL 3RZWA 3VWJD 3ZTJG 3UTTD 5B38A 1AIFB 5D96C 1FYTB 4WDIB 1SJHB 4NO0D 3H42L 3REVB 4OQ1A 3U4BH 4ONHA 1FJ1B 1VACA 3F5WA 4M6OH 4U31A 3A67H 5C2BL 2DF3A 3TO2B 2HT4C 3ARBB 3PNWA 5DWUH 1V3MA 1EVUA 2FR4B 5CP3H 4OUUB 4X5WA 4PJEB 3D48R 4PBWD 3JZ7A 1DQLH 4G80B 1R5WA 1G7LA 3QDMB 5MENB 1CD0A 3KPRD 1NANH 2LVCA 1S7TB 3GJFA 4HWEH 1VGEH 1KIPB 4XPAL 4TUOB 4J8RB 3KPLA 1MIEH 1FP5A 2GTZA 1N8ZB 3MRGB 2X1OA 1EO5A 1PQZB 1BD2E 4DK6A 2CK0L 4QXTA 4EN3A 3BP7B 5LCVL 4H5SA 3HNVL 1S9WA 2IG2H 4GG8A 2BNQE 1RUAL 4XGZA 3PJSB 4EN3D 4LLUB 4XPGL 1YNTB 3QPXL 2YN3A 4OF6A 2P24A 3P3YA 1BECA 1YEGL 4D0CA 3G6JF 4WWID 1AFVH 3MV8A 1JWSB 3MXVH 4LMQI 2I07B 1PZUB 4YDKL 4P4RA 2P8MB 35C8L 3MV8D 4U3XA 4I1NB 4NJ9L 2B1HH 4H20H 3B3IA 4LDLB 3BGMA 4M1DL 2AV1A 4GKNB 4JE4B 1W8OA 2HVKA 3CH1A 4G9DB 4RRPG 1VESA 5D7IA 1KTLA 1IGYB 3LKSB 2QR0A 3PWUB 1KB5A 4LVHC 1QTYT 3MV7E 4TQEL 4EXKA 1T4KA 4L9LC 3EDJA 3EYQD 3WKNA 4XX1E 2W0FA 5EUOF 5F88A 2ADIA 2GYSA 1U91B 5H2BB 5FGRA 2O26U 3VJ6B 4LSSH 5IBUG 3TN0B 1P6AB 5HHME 1ERNA 5HDLA 5C6TL 2ZCHL 1X5JA 5CUSH 5CJ5A 2R2BA 5FFLA 5DTFA 4MQ7B 4PLOB 1YUHB 2C4XA 5E00A 1TZHB 3C5ZB 4NZTH 4E0RA 1S5HB 5IQ7L 3GKWH 1HKLL 3C2AH 3D69B 4XNZB 4FQIH 3BZ4B 3FFCB 5DDHA 5J4MA 5F7FA 3OKMA 4TUKL 4JPIB 1BZ7B 2Z91A 4NQEE 3G5ZB 2DAVA 4NKDA 2H2SC 3BW9A 1EHLL 4MNQE 1DBAL 1UVQB 3FQRB 5BJTB 1OB1B 5DJXB 4OLVH 1JGUL 3ARTA 1G7JB 2HJKA 5J8OA 5IEKA 3DUSB 2I9TB 4DGVH 4RMSA 2NR6C 1AH1A 1QNZH 4RSVA 4OZFH 3Q1SL 1N5AB 5D70H 5C08A 5HDQH 2BHZA 1HI6B 2YD9A 4KC3B 4NN7B 4BSWA 5KSAA 3KLAB 2DLFH 2EH8H 5CMAA 4WUUA 4YFLI 5KSAD 4PRHA 1FGNH 3OTTA 1EAPB 5JNYA 4RNRB 2EKSA 3IDNA 3QPQD 4WUUD 2LFGA 3RWIA 1JHKH 1CR9H 3BAEH 1QSFA 4I2XA 4F9LA 1KYOK 1JZ3A 1T7YA 1IEHA 3QCTL 3LRGA 4JCMA 4MAYA 5L88H 3RY5A 5SWQA 1QSFD 1E27B 1RHHA 2YUXA 3VG9B 3LMJH 4KMTH 1MELA 1J0KA 2H6PB 4HKJA 4Z7UA 4BSJA 1ZLUH 5IP4A 1MF2H 2XN9A 2AV7A 2H1PL 3AFLA 1F00I 3TWCH 1KCVH 4W81A 5DUML 1L6XA 4O51B 3I2CL 1Z0MA 4KQ4L 1Q1JH 1NLDH 4JZJB 1PD6A 2X89D 5EBLB 2C3VB 5LJYH 5FOBA 5BRZA 4KUZL 4R97B 5TPWH 5CGYD 1AD9B 3EO9L 1HXYA 3EHBD 4G9FB 2GSIB 1KIRB 3U0PB 1CE6B 5E5MB 1U92B 5EN2B 3MLWH 4XH2A 5C07A 2YD1A 1Y18A 3CFJB 3O9WB 2EDOA 5GS1B 2BDNL 5F7LB 2X40A 2VQTA 5C07D 3QJHB 1OP5K 4ZFFB 5E4EB 4E42B 2AJXH 1IC4L 3VDBA 4C4KT 3M17A 2WWKT 5E56A 4UNVA 2DQGH 3LQZA 5E5RB 3G5VB 5T3XD 3NACH 4O2FB 3K74B 1U2HA 4XBGB 1CXHA 4S2SB 1FRGL 4KGLA 3QNZB 3PGDB 3KYAA 4O4YL 2ZOLB 3P4OA 3ZDXE 1ZA3B 3ULVC 3HC3L 3R4DA 3RRQA 1BJ1H 3RVWC 3PWNB 3V7AE 1U3YA 4JFDE 3SDAC 1XR8B 4J3XA 3RWDB 2J12B 2NTFA 3T4YA 3BD5A 1MFNA 3HI6H 4PR5B 3QEHA 2FO1A 3C5SA 4PJDE 1BJ8A 3TA3C 1YPZA 3LVEA 4WEBH 4CN6A 2WUCH 4F9PA 1MCIA 4RWHA 3MACL 3SDXB 4Y16A 3KPOA 3TZVC 2O5XH 4PGDA 4Y5YA 5D7JC 1S7VB 2YPVH 5F1NB 4MA3A 4TVSa 5E8PA 4Y16D 1XF4A 1SM3L 3AMLA 4HIIB 1CVSC 1LK2A 4PBXA 2IAMD 1SEBA 4G6JH 1LILA 3P0YL 2PCPA 5TQ0L 5A16A 3GSXB 2R1XA 3SDDA 4P46C 1KG0B 5JW4M 1AXSA 5IHUL 4JRYA 4YHLL 5DT1L 1RUQL 1FFNA 1G7MA 2ARWA 1G6RH 4KTEL 4POUB 3KYMB 5D1XC 4WUKL 4XVJH 5DVMA 4Q0XH 3CVHA 3VXTA 2EXYC 1EJOL 4CL7A 4X6EB 4GBXD 5AYQA 3ULUL 1D9KB 1U8QA 3DRQB 3F12B 3MR9A 4XC1H 4NO5B 3GSRA 3HZKB 5EZIH 4DVRH 5K9KA 4MSWB 1P53A 3SO3B 4DUXA 3VFUA 1YDPB 3W9EA 5GJTH 5IESL 1JGDA 3H3PH 2WBJA 2P7TA 1BWWA 4YPGB 4Y4FD 1JV5B 2IBZY 2QQLH 1EA9C 1MJJA 4OKVA 5HI4D 4HGWA 1HHKB 4YR6B 1YEIL 4H0IA 1EO7A 5IW1B 2G75B 2UZIH 5C09A 2Z31A 5L2KB 4HCRH 1DVFB 4DKFH 4NNYA 3HAEA 4L8DA 4C56E 5FIEA 3TVMA 1ZHBA 3OAZK 4TNVF 5EOQL 5IEHB 5I1GL 1JPSL 2X7LA 5C09D 5JW3L 1HOCB 3RGVB 1YNKL 2NXZC 2CDGB 2IALA 3BYYA 1A7PL 3RIAF 5SV4A 3CPLA 4OCYL 3EDEA 4XMKL 3SE3C 3V4UL 4DW2L 4J7RA 4S1DD 2ED9A 3BH9B 5HHOD 1XZ0B 3C8HA 5T33H 4OF5A 4MXWL 3HPJB 4HF5L 5L2JB 4YE4H 3S96B 3ULUC 2WBKA 2OTUB 3H3KA 3QXWA 3B5HA 4R0LA 5FO7B 2O61B 3OX8A 2VC2L 1H3WM 4PP2A 3BQUD 3QUXA 5KVMC 4ZXBA 4LPXA 1V7NH 3OKEA 3FONA 2ITDA 4N0CD 2FJHA 4UTBL 4ZXBD 4Z7WB 2AJZB 4L3EA 1X5XA 1XMWA 5DD6B 2F5BL 5DFTA 5BZWA 2GSGB 3ARDB 2NY4B 3C08L 3QDHA 4S1RL 4M5YH 1WCQA 1MFCL 3MOBL 2APBA 1ZGLB 1WWWX 3HZYB 1FGVH 1EFXA 4LPTA 3MV9A 3TBVB 4OGYL 4ZAKA 5E9DB 1DSFL 1JHTB 1S9YA 1BZQK 1MCRA 4WI4A 1OAZH 4HWZB 2E7CA 4HWBL 1Y6KR 2Q8BL 3L3GB 1R24A 4GS7C 4PB9H 3AVEA 4JM2C 5JLZA 1MFAL 4FP8H 5DD0H 5BVJA 2R23B 3GIZH 5HD8D 4OT1H 3MCKB 4NJAL 5GRXG 5LGKA 3F7YB 1U8HB 5IF0A 4R7NB 3BIKB 3RKDC 5AZEL 2X1QA 1BOGA 5DJYB 1LMKA 1T04B 3CSYB 3P77A 1Q8MA 4Z7OE 2VRAA 4U1GB 4YGVB 3DBXB 3OG4B 3BEWA 4ZUTA 3O3BB 3NA9L 1JYNA 4K55A 5JHDB 3BP5A 5HSFA 5GGRB 3D3VB 5E08H 4K3JL 1H9VA 1KULA 3L9RA 4L3CA 1IAMA 1FPTH 2VAJA 2EC9U 3RWHA 5SWSD 5JIKA 2BNUA 3RWJB 3U4BL 5C0FA 4HIEB 1RK0B 5HHQB 4X7FC 3A67L 3WIFB 1YEDA 3GMPA 2AGJH 5CSBA 4XPFH 5DWUL 3CZJA 4F7PA 3VCLA 4YH6A 4UU9A 3FZUC 2DICA 3EBAA 3NFPB 5JMRA 1WITA 5FYKD 5DURD 3GRWH 1DTUA 3M1BB 4G8GB 3VRJA 1DN0A 2UYLB 2V2XB 1DQLL 3GK8H 3B2VH 2LQRA 4WWKA 3AGVA 4HMCA 3G6JA 4Z7VB 4X6DE 1M71A 4IHOA 3EO0B 3O6MH 3S34H 5HY9B 4Y8AA 1F6AA 4NQCB 2AJVH 4XP6H 4XXCA 2W60A 4I0PC 3SGDI 3ET9F 5A40E 1L0XA 2WINB 1FNGB 3OF6A 5ICZB 4JRXD 2IG2L 4OCWL 2R2HA 1QKZH 4Y2DA 3OF6D 3BISA 3CVIL 4MJ5B 3U9PH 4MXVE 1ULVA 2C1OA 2Y9RT 2XY1A 1QLRA 3LOWA 5LGJA 3QBTB 1MHEB 4PRNA 2APXA 5D2LA 5GZOC 1AFVL 3MSPA 5I1DA 3MXVL 2DS4A 5DMYA 1KPVB 5IBLC 1CF8H 5FM4A 4BKLA 3ZYZA 1KGCD 1DL7L 2B1HL 5GS0H 5HI3C 1PKQA 5CJOH 2VMFA 2MWCA 3SKJL 1BFVH 4FQHB 4QHNA 3U4EA 4Z8FH 4YFEA 2X10A 5FEBA 3V4VH 3SKOA 2E9BA 1YEEH 1LE9B 4ISVA 1WC7A 3LB6C 3T2PA 5D1QD 1F3DJ 5CLWA 2VR5A 4JVUA 1L0YA 4U0RC 2DLEA 4LSSL 4KJWD 5BO1H 1NBYB 2BNRD 4ZUVA 3FT2B 3OJ2C 1F4XH 3D39D 1UEMA 2Z35A 4F8QA 5IJKA 4KHXH 3QI9D 5FK9B 3RZCD 2HT3C 4NZTL 1S7UA 3GKWL 3VFRA 2ICWI 4FQIL 3GI9H 3V5HB 5IFJB 3JVGC 5IMMB 3MRFB 4KKLC 5J3HD 3FQXB 5FCUL 4HUVA 5TF1L 4UTAH 2GHWB 4KVCH 1P7QA 2OI9C 1QG3A 4QXGL 2FECI 5D70L 3TH2T 2BVTA 1P7QD 1TITA 1UYWL 3O81A 5E2VH 5HDQL 4OI9A 4CVWA 1H3GA 2ENSA 3QQNA 4MNHA 4GAFB 2FYYB 1I9RH 3MRLB 2DLFL 4RIRA 2EH8L 3GEWB 2Y7QB 5I8KH 1DQJA 2PYFA 4LCYA 4ZOBA 1FGNL 4X6BA 5KVDH 3OXSB 1JHKL 1KF9B 1CR9L 3KNBB 1AY1L 3MLXL 3VXUE 1AHWC 1FL6B 2UWEF 2MQCA 1A4KA 3WLWD 3I6KA 3LMJL 2DD8L 1TPXC 2DB8A 2FHCA 4KMTL 4JHAH 4HHAB 3C6LA 2H32B 3UAJD 5B39A 5E6IA 1I4FB 3C6LD 1MF2L 2Q7NA 1AQDA 3TWCL 1KCVL 5CCKH 3W39A 1N6UA 3WUWB 1T6VN 5DD1H 4PUBH 1Q1JL 3GSUB 3U9UB 3BIBX 5FKPA 1NLDL 3QIBA 3UPAA 4EUPH 2AERT 2FEDD 5TPWL 4WRLA 1K5NA 2VDLH 1J5OH 3MLWL 1PJ9A 4NKOB 4QRRD 3OV6A 3UJJH 3QJFB 5TGBA 2HJLB 4FQXA 5EO0A 1MREH 1MVUB 1RK1A 4PLJD 1CTOA 4RGOH 1RY7B 4WY7L 1Q0XH 4FQXD 4HUUA 4FFWD 4NYLA 4PD4J 4RFEA 2AJXL 4WW2C 4ZMAT 1QHOA 3KJ6L 3CC5A 3LRSB 5FYJU 3C6SB 3F7VA 3SCMD 1FVDB 3NACL 5CZKA 3I6GA 3WNPA 1QFWI 1M7DB 3VFNB 5HVWA 1E28B 1IJ9A 2J1KA 1IGFH 4UQ3A 1FHGA 1YZZA 4HUWA 4TNWF 5D93C 3RI5F 1CFVL 1A2YB 1UWXK 1WICA 4PJ8A 1BQUA 1HWHB 3EJJX 1IC7L 3VD4A 1N5YL 1IFHH 3QUML 1FNEB 1BLNA 2NY1C 3KYNA 1S9KC 2MHAB 3MRQB 5CD5D 3EJYC 4OZFG 5IB1A 1DUYB 1J0IA 1N2RA 4WEBL 5L0QB 2P5EE 3NCMA 4LLVB 3TBWA 3UYPA 2BVYA 4F3FA 4EVNA 2O5XL 5E8DH 2Q7YA 2LE9A 3DIFB 1BQSA 5IG7A 1QPPA 3MFGB 4ZYKB 1BD2A 5J13B 5B3NA 1JWUA 4JFED 3V52H 1ZA6A 4GSDL 1V7MH 2BNQA 4UV4H 2X9WA 1BD2D 4QXWA 4GAGH 1OTUD 4HAGA 4U1HA 5CEXB 5FYLE 1WQVT 2BNQD 5C0JA 3NCEB 4KKBC 2QHRL 2D7QA 1EEZA 1G6RL 2DDQH 1CDBA 1T2QH 2VLKE 1W2KT 3O11A 4FFYH 4PGCB 4XVJL 2CKBH 2F54B 1IEBB 4K3EH 4Q0XL 1W72L 5AG9A 5DRWB 4OZGB 4F57H 5I73B 1MHCA 1HH9A 1KOAA 3NZHH 5E99H 4D9QD 5IMLA 4WFEE 2I24N 5EZIL 2DQEH 4QNPE 1MI5D 3MNZB 4NWUH 4UIMB 1U3HC 1SMAA 2A73B 2J4WH 1GGUA 3H3PL 5IK3A 2NPLX 5JIPA 3GZKA 3IAQA 5DEGA 5T5FH 1NGQH 2OSLA 4MXVF 4U1MA 3DV4A 5CLTA 1Z2KA 4NCDA 3E0GA 2H3NA 5I2IB 4DK3A 2CIKA 1YQVH 3QXVA 2UZIL 5I1EH 4S0TD 2XY2A 1DQQA 1FLTX 4HCRL 3LPWA 4OD2B 4DKFL 3BJLA 3HS0B 4RMRA 1ITCA 4P4KA 5JXEC 4MA1C 4EDXB 4KHTL 1JYXA 2B7DT 4MD4A 4B53A 1KNOA 1MWAB 1Q38A 5LGHH 5D6DA 2GIYA 1RV6X 3RVVC 2ZP0T 1MHHB 4JY4B 2XWTA 1J9CT 4P2OB 5T33L 1I8MB 1WT5A 4JO2H 5EZJB 4YE4L 2Q3AA 4YPJA 1QRKA 2DWDB 2R0LH 3C5JA 3OGCA 3P73A 1KTDB 1BFSA 1QOKA 1U8LB 5A2JH 3NBNA 2XQYK 1ZVSB 3F7QA 4P2YA 3O4OB 4U6YA 1VADB 3RBGA 1H8NA 1V7NL 1UXSB 5DEFA 4XXDB 5D72H 5MHSD 3PWPE 1H0DB 2XWBA 5LVEA 3VXQB 4ONGH 4K3HA 2NCMA 2PYEE 1O7VA 5B8CC 3GSOB 4P23A 4M5YL 5IW6B 4LOUD 3KWWB 4UDTA 4BM7A 4I3SH 4P23D 5JO5B 1A6VH 3QEQE 2XA8L 5C0CA 1AC0A 1MHPH 1W0YT 1QFOA 5C8JB 2YD5A 4AMKL 1OWRM 5C9JB 5DI8A 3OHXB 5C0CD 1AKJA 3U36B 1OAXH 4PB9L 4U1LA 1OF2A 4OZIF 4GXUM 3TBYB 2CLZB 2QADB 4FP8L 4KKAD 5DD0L 4OT1L 1MAMH 3LQMA 3ULVE 1IQDA 2DL9A 5DMIH 2X70B 2FWOB 5C0IA 4PJHE 3K8LA 1W0WB 2DQDH 4HT1H 4D0DB 2JJWA 3WL9A 3SPVA 1L0QA 4Y5XA 1U8IA 3LIZH 5BS0E 1AGEB 4XTRD 2IBGA 2VLJE 3ARBC 3TV3H 1XIWD 5DC0A 4G43A 4NQTA 4V1DE 1KENH 4BJLA 1CGWA 2CRIA 1FPTL 1SYSB 5JW5B 3PV6B 2VKXA 4Q74A 2E27H 2YR3A 5ID1B 1SYVB 4LCWB 3K0WA 3RUGB 5J11C 1ZWIA 3B2UC 4KPHH 4HIJB 4M43H 1I85C 1MCPH 1X7QA 3FKUS 3O2VH 1F90H 4XPFL 3VMNA 1D5XB 5LWYL 3QQ3A 4JFPB 3C09B 3S3PA 5I1JH 3NIGE 4P2QE 4J3WA 1G9MH 4HUXB 5C0ND 2I9LA 3GRWL 4L1DA 2NYYC 4IRSD 5IVXB 1F4HA 1NJ9A 1SJVA 3MLVL 3O0RH 4MCYA 5T1LD 2DYPB 3GK8L 1U8PA 1TQBB 3TYGH 2VLLA 2AXFA 4HJ0D 4OCRH 3FB7A 1BEYH 5F6HJ 1HILA 3TCLA 5J57B 3O6KH 2CMRL 4J6RH 1F02I 1ORSA 3EOYG 2AJVL 5ICXB 2C3WA 5DQ9A 4Z7NE 1H8OA 3U82B 4RFNB 1WBXB 3H9SE 2NX5D 5DA4A 1QKZL 4LHQB 1UC6A 4U1NA 2ZUTA 2AXHA 4JFDA 3QUKB 1VPOH 3GJFH 2ADFH 4MNGA 4QOKE 4PGBB 1A9BA 4ZDHB 3S37H 5D7LE 2AS5M 1QA9A 1FV1B 2A6JA 3DLQR 4GXUN 1T0PB 3RA7H 4Y1AE 2HJFA 2HN7B 2ZJSL 4FQCH 3VWKC 1ZMYA 1JRHH 3IVKB 3SKNA 4PRAB 5ANME 5EOCH 4YNYB 3VXOA 3R1GH 1L7TL 3WEXB 1CF8L 2AQ3A 3SDCA 4KZEH 2F19H 3T0DA 1J8HE 3HG1E 4LCCA 4F7TB 1KSRA 3SDCD 5GS0L 1YN7A 2Y72A 4HK3J 3ES6B 4TVPD 3TN0C 3EO1B 1BFVL 1N3NA 4W6YB 1NDGB 1NUGA 4Y4KD 3UTPD 1P1ZA 3RDTC 3X14A 3PHQB 5E2JA 3V4VL 1FO0B 3ULUE 4JKMA 3TYFB 1WWBX 1YEEL 2OMNA 2OXGA 1KCSL 2LABA 3DMMA 4Y19E 3QFJB 2W0PA 4Z78A 4XNZC 3DMMD 4LARH 4TSBH 1NGZB 3VFGH 1K4CB 2DQFA 3KDMB 3OKOB 4YBLC 1JNNH 3HZMA 1UWGH 5I16B 1KB5H 1BGXL 1FE8L 3ROLA 1F4XL 1A21A 5IROC 3HUJF 4M5ZL 4KHXL 3RWFB 3T09A 3N9GH 4LIQE 2IPKA 3WHE0 4Z5RA 2PW1A 1VFMA 5C0GA 3V6ZA 3MLZH 4HFWA 4GG6B 2EH7H 4M7JH 5GRVK 4F58H 3DXAA 3GI9L 1FBIH 4RAVB 4R2GB 1QEWB 2HTLC 2JB6A 4X7TA 3ZZ1A 4L8CA 1SBSL 5D6CB 1BJMA 4NN7C 4PJBE 1TCRA 3DXAD 4C56A 5BQ7B 1K2DA 1XF5B 5DQDH 4UTAL 4YHZH 2PO6A 4HX1A 3FTGA 2J6EA 2X5PA 2JJTC 5DSCA 4QNPF 3P11H 2PO6D 5I66A 3B9KC 3QUYA 2VXTH 5CD3B 4DZBA 2PETA 5CINL 4YHIA 2XXMB 2G9HA 3L3DA 1QBLL 2VLRB 5FA3B 4HS6B 1I9RL 4OM1H 4FRWA 4U3HA 2W92A 4P5KA 5I8KL 4AIXA 1QSVA 3IS0X 3K2UH 4U6VH 2MOVA 3RTQA 1PBYA 4KJYA 4A6YA 4EZMA 5KVDL 4KQ3H 4PJ5B 1ZHKA 4HW6A 3VFPB 3U1SL 4ZFGH 1P5UA 3RTQD 1KPUA 4U05A 5HJ3B 4CN1A 4ZUSA 3RY6A 1BIIA 3MLTB 3VI4E 5IB4A 4BYHA 3DX8B 3TIDA 4JHAL 3PDOA 2BVOB 3LKNA 5TE4H 4WW1A 2ZNXA 4EOWH 3QWRA 1KT2A 2VZUA 3AM8A 4YXHH 4R97C 5ADPH 5F96L 4O5LH 4JFQB 43CAA 5KSBE 4Q2ZA 4MB5A 3QWRD 1MEXH 5CCKL 4WFHD 5DD1L 2L0DA 4PUBL 3S4SB 4MDJA 2QEJA 3VMOA 1QRND 2XTJB 3O9WC 5FGCB 1ONQB 4AL8L 1CDIA 1CICA 2SEBB 3X12A 1N7MH 2GJZB 4GAYA 5E4EC 5E94A 3Q3GA 1EHXA 4UI2A 1NMAH 4PJFB 2A6KB 5TE7H 5EZOH 1CT8B 1INQB 1P4LA 2AK1H 2AI0H 4TUJA 3E2HC 2P1YA 1DE4B 4BH8A 2AEPH 1T5XA 3FO0L 2P43B 4NKMB 3KR3H 3TJHC 3V0VA 5DRXB 5EBMB 4L5FH 2FJFA 4HMDA 4AENA 2GUOB 4Z9KB 1BBJB 2WK2A 2EKJA 1T21B 1ZE3C 2R56L 4OCSH 4RGOL 1Q0XL 5ICYA 4JFZH 4CVXA 1JF1B 5B21A 4FTVE 5GS2D 2O5ZH 4X6CE 3S36X 1I7RA 2V5MA 4QF1A 1IGFL 3MUGB 4X7SH 5J12B 4ZPTA 5K93A 5DEZA 4ODBD 5C0AA 2V7HB 2YEZA 1F58H 5FO9B 3KLHC 1RU9H 1IFHL 4JDVA 3L3KB 5C0AD 5CJXC 1MJUH 4PJHF 3WLBA 4JZNB 1A1NB 1PZ5A 1FZOA 1H5BA 2NY0D 3NABH 4P57B 3O3DB 4GRLA 4U6HB 3ARSA 5BVPL 5F6HI 5C0BD 1HDMB 1F3RB 3ZDYE 1HHHB 3O6FB 4OLWL 2WANA 4ELKB 4WTZG 4X80H 4GRLD 4G6FB 5INDB 3H0TA 5KN5A 5ERWA 2A77H 4Y4HA 4N0UE 3IDGA 5ESQA 3MROB 1ZEAH 3N06B 5KOMC 5E8DL 4G8FB 3D0VB 4YDJA 5EIQA 4HG4K 3RL2B 1S9XA 5DO2C 3CX5J 4CUCA 4EI5D 4XPHL 3BN9C 3NIGF 3AREB 4KK5C 4PJCB 3LZFH 2BSSB 4NQDD 3SO3C 2H8PB 1UCBH 4HGMA 5D5MB 2WWMD 2DWEA 3AXLA 4I48B 4NM4H 3UZEA 1S7QB 1T2QL 3P4MB 3OKNA 5ALBH 5ACZA 1PFCA 4RGMB 2CKBL 1RZJL 3NAAH 4K3EL 4APQD 1XR9B 5F7DB 1ZLSL 3JWOH 2Y25A 5BXFA 1A3RH 3TF7C 1J86A 1EAJA 3WS3A 2DQEL 5EPMB 4NWUL 2P46B 2J4WL 2CUIA 3RGVC 4CU7A 3OR6B 4OLUH 4BA8A 4MD0B 2HFTA 5T5FL 1NGQL 4EUPG 3DO7A 2Q8AH 1OGAB 1D5BB 5ITFB 2ZSWB 5I0ZA 2ZPKH 1YQVL 5I1EL 1IC5H 1T1XA 2Z93A 3CZFA 4NDMA 3K1KC 1DFBH 3HNSH 4PJXB 5HI5D 1RVFH 3QZWB 4OZ4A 4FZEH 1YY9C 2J8UE 2OQJA 3W0WB 1RZJC 1ZXQA 1QR1B 3Q5OA 3ZKMC 4PJAE 3QXAA 2CDFB 4YX2H 1UQSB 4NP4H 1NC4B 3S8WA 3EFFB 3VH8G 1Q94A 1VFOA 3ECBA 2VB5A 1TETL 4NNPH 4IS6B 2NY4C 1EHAA 3G5XB 1HKFA 5EG6C 3K2MC 3B6SA 5D72L 1IMHC 3NIFF 3L3IA 2APWA 3VXPB 2R4SL 3D5OF 4ONGL 3QQ4B 2EYSA 2YZ8A 5H8DA 2R2EA 6CGTA 1FZKB 2PTTB 4FNLH 3DSNA 3ILQD 3PABA 4UBDC 3MCLH 1ZKAA 5CILH 4FXKB 4J3TA 5KSUB 3OAYK 3VXNA 3S98A 4QY8A 5EC1A 4DN3L 3O41B 1MHPL 4NO3B 1AQKH 2V5TA 2FX8H 4ZFOA 2GEEA 3P9WB 1MQ8A 5I1AA 3RHWF 3VXUA 2ZWLT 4MS8D 2EC8A 2MMXA 2HLFC 1XGPB 1K85A 1RZ7H 4RGND 3WV0A 3VXUD 1NDMB 3L5IA 4JM2F 5F7EH 1MAML 3DJ9A 3AS1A 1A7RL 1FC1A 3QB7C 4I18B 1WVZA 4LSRH 4OV6F 5DMIL 4RRPA 1AD0B 4G7VH 2XWJB 3OGOE 2DQDL 2X42A 3BSZL 4HKZA 4HT1L 3VFWB 2HLAB 1IGJB 4L4VB 1IT9H 4H25A 4U1KA 1FLRH 4GUPA 3TV3L 1GZPA 3OAZH 4NT6B 1KENL 2PXYB 3WE6A 3VFSB 2UUDK 1DLFH 2HKFH 1R3HB 3VI4F 2VUOA 4CMHB 3PWLB 1EEUA 2E27L 1IAII 1DN2A 2C1PA 1OOAA 5T1KB 4C59B 4M43L 5HYJE 2HG5B 1MCPL 2H2PC 2ZZUT 1F90L 5DMKA 4PRDB 3HNTH 2VQ1B 1UB6A 2N7AA 5I1JL 4HJGB 3MA7B 1G9ML 5IWLC 2GFBA 4M1CC 2YBRA 3MRHA 1ZAGA 1S8DA 3S97C 1G7PB 4S1SL 4RQQB 3TYGL 1MFEH 4FG6D 5JHLL 1BX2A 5A43C 2D3VA 4OCRL 3KG5A 2GK2A 4HS3A 3O6KL 2CRYA 4J6RL 3O3AB 4PG9B 2CH8A 3P4LA 2DKMA 1RAMA 3KPSB 4PJGE 2VZVA 1IM3B 5EFIA 1CFSA 3U46B 1HH6A 1RJZA 3QSKB 3UYOD 4AY0A 1PX4A 2ESVE 3GI8H 1Y0LA 4HXAH 5HHVH 2ADFL 4X6FA 4KRNA 1VFAA 3S37L 3BX7C 1JK8A 3EKCA 4QYOA 2NXYC 4L9LA 1R3LB 1OSZA 4Q58C 3TFKD 1ORQA 4B7IA 4FQCL 3DO3A 1T1ZB 4P3DB 2P5EA 1K8IB 5GSVB 4QTIL 5EOCL 3R1GL 1G9MC 1KXVC 1WFOA 2F19L 4K2UL 2CR3A 1V3LA 1OAKH 4CKVX 3HUJA 3OKYA 1JF6A 1G7HB 1LD9B 1WCBB 1G9EA 3RU8H 3L5XH 5KG9A 2ATKB 5LKNA 4XRCA 1DANU 4NN5C 2O5YL 1TLKA 3ZDYF 1NCBH 5DJAA 3GSVB 3CFEB 3NFNB 2VLKA 4JFXA 3EGSA 4LARL 5I1HH 4MCZB 3VFGL 4TULH 3ZHDA 2VLKD 2CLRA 3FRPG 1UWGL 2F15A 4XCNA 4JANA 4O2EA 1JVKA 4ORGA 1YEFH 3DVGB 1HZHL 3TPKA 5HGHA 3N9GL 4JRWA 2NR6D 1B6UA 3MRKB 3MLZL 1S3KH 3REWB 5IVOA 1ZS8A 4F58L 4H26A 32C2B 1FBIL 3D18B 2X2YA 5HGGS 4KMQA 2FB4L 4NPYB 1NCAH 5TDNB 5LBSL 3DGGA 4S10A 1E4JA 4PGJA 1RIUH 3DX6A 5EO1A 5JDJA 1YEHH 2CUHA 2BSTB 3I02B 4K3GA 2YD4A 3V0AC 5KAQG 3M8OH 4HQQH 2BY0A 2XV6B 4QRTB 2ICEA 2NY2B 5GRZA 4OM1L 1CDYA 5EOTA 5DRNB 4ODHH 4R4NC 4S0SD 4E41B 3K2UL 1CD1A 3INUH 3IGAB 4KQ3L 1RZFH 3MRRB 4JPVH 1GVIA 3WHXB 3HE7B 4PJEE 3L6FB 5E8OA 3HR5B 3SE4C 3F6LA 2OCFD 3K4AA 4KK9D 2RHEA 3PWPA 4EQ2A 2EDKA 3HA0A 5TE4L 4MJIB 4LKCA 3QDME 4EOWL 3GGWA 1CDUA 1P84J 1ZT4B 4L4TE 4D9LH 1OT2A 5ADPL 3FB5A 4ESKA 1OCWH 2IJ0C 2PYEA 3UBXB 5K9OA 3CH8A 4TYUA 1MEXL 1OTTD 4PJAF 4YQXH 3G04A 2V17H 4XP5H 1KJ3H 2B0SH 3L7FB 1A1MB 2VL5A 5ESAA 2DI9A 2NW3B 3STZB 4FQJH 1OWWA 4ODWA 1N7ML 3MRBA 1FZJB 2V9RA 3IXAB 5CBAB 3GHEL 4PRPA 1NMAL 4OFKA 5TE7L 5EZOL 3DX9B 2AK1L 4YAQB 2AI0L 2WLZA 1T22B 2BXZA 3T3PE 5GSRB 3ARXA 2AEPL 3LHPH 4PRPD 4NRYB 3VFTA 4AYFA 5F70A 1YA5A 3ZYJA 1C7TA 3BT2H 4PJHA 4DGYL 1QUNA 3SDAA 1VGKB 2BCKA 4JFZL 4GMTH 5BS0A 3RVWD 3RNQB 2VLJA 5JZ7C 2O5ZL 2FEEL 2ZOKA 4V1DA 3TA3A 4H1LB 4KU1A 3AB0C 3D0LB 4MJ2A 4QRQB 4KVNH 4V1DD 4DUWA 3TZVA 5D7JA 4CW1B 4HKBB 3O3EA 3BVNA 4X99B 1F58L 1RU9L 1ZT1B 1DEEA 5D7JD 3T4AB 1VEOA 4NZJA 2D0HA 4GOSA 3IKCA 3VWJB 4XCFL 3L3HA 3UTTB 2Z92B 3VI3E 3VGAB 4P2QA 3NABL 4P46A 1F6LL 4NO0B 3OBAA 4KWUA 5CSGA 2I25N 1CU4H 4CJ0A 1CGSH 4P2QD 2G2RB 2WMPA 3DX7A 3MLRH 1QYGL 4ONHB 5D1XA 3WBDA 1BJ1J 4RAUA 3SGDH 1I3RB 3F5WB 3FFCE 3CDCA 1MWAL 1CGTA 1EERB 2GT9A 4JREB 4PG2C 3PNWB 1JPST 5F89A 4BZYA 1YMMD 1OPGH 1T7ZA 4DUVA 5J0BA 3H9SA 5I73C 1GGCH 4QHLB 4G6AC 3KPRB 1OY3B 1CGUA 3H9SD 4DCQA 1QR4A 1IBGL 1UCBL 4QOKA 1G7LB 5D7LA 5DVLA 1EMTL 4NM4L 2BY3A 3J8F7 4LGPB 1FNSL 5ALBL 3V8CA 4Y1AA 2X41A 3F7RA 4F7EB 3KPLB 3OXRB 3NAAL 2GTZB 3GB7B 5ANMA 1FNAA 2E9WA 3KVQA 3NH7H 3GMNA 4EN3B 2D2OA 4H5SB 5INCA 4PJGF 3GMMB 4HKXA 3QCVH 2OTWB 2YXMA 3BPCA 3ZKSD 1XGQA 3SE3A 2NXZD 4OLUL 1KJ2H 3PIQB 4D0CB 4CDHA 5A3ID 2ZPKL 4GKSB 1CD8A 4WGVB 1IC5L 2G60H 3MV8B 3FB8A 4P2OC 3QRGH 4QRPA 1AXTH 4LPWA 4PJIF 4Y19A 5EC2A 4P4RB 4OGAC 3HNSL 5T1MB 5TFSH 5GRYA 4QRPD 1QFHA 1UH2A 4JN1H 3MBXH 4Y19D 5HTSA 4RZCA 2X4TA 1UWXH 1N59A 1NGXB 1OGTA 3MFFA 1QBMH 2J2ZA 4FZEL 1ACZA 3CH1B 1BF2A 3IJSA 3O4OC 2QR0B 1A5FH 5DYOA 5BMFH 1NSNH 1T4KB 4OIIL 2R0WH 4N1CA 4G9FE 2XOTA 4YX2L 3U7AA 1QFUL 4NP4L 2VABA 5F88B 2ADIB 5AZ2H 3L7EB 3MLUH 2VJXA 5LAXB 1NCCH 3S6CA 4PJBA 3GMRA 5DJDB 4NC1C 4WHYH 2D03H 4NHUB 2AP2A 2R2BB 5IMKB 5DTFB 4NIKB 2PF6A 5GXBB 1CXEA 4E0RB 4JM2A 1G84A 4OLEA 3WCYA 1Q9WA 3B9VA 4NQXA 4JM2D 3A6CH 3MCLL 2QADC 4OF0A 4NKDB 3BW9B 2YKLH 5IB5B 8FABA 3GMQA 4M93B 4MJ6B 4KFZC 5E2TH 1SJEA 1AQKL 4PFEA 1Z5LB 2FX8L 4UILH 4E9LA 4QHUB 4UUJB 5D7KE 3RIAK 1D5ZB 3DVIA 3DI3B 1I9JH 4MVBC 2EIEA 2JLLA 1IKNC 3FQUA 2X4PA 1RZ7L 1HE7A 2HFEA 1JPGA 1FFPA 4L8SB 5F7EL 2QSQA 4BSWB 5KSAB 4PGZA 4G8IA 3OJDA 3UPRA 4LVOC 3ETBF 4WUUB 3SDXE 2EZ0C 3GSNB 2A74A 2DOCA 4G7VL 3FFDA 4UAOB 5KSBA 3MOAH 4XB8A 5JNYB 4HWBA 1ZVYA 3IDNB 3FAWA 2DQCH 4WHTA 1QSFB 3W9DB 2R0ZH 3PG2A 5IFAL 2XI9A 1IT9L 1JNHA 2OX5A 1FLRL 3C09C 1FFOA 2ICES 4Y88A 3CFKA 5IB2B 1BREA 5HGDB 5EU7C 1RHHB 4NBXB 5EU4A 2HKFL 3S35H 4HKJB 5D8JH 3BD3A 1IILE 1TQBC 4JG1H 5FUOL 3UYRH 1EEYA 5LQBL 2EDTA 4I0PA 4LRIC 4JCLA 4OQTH 5H37G 2IPTH 2Y6SC 1IEAB 3MCG1 5DHVH 4RFNC 2CIIA 3Q6FB 5MP6H 1JWMB 4FTVA 1RZKL 1QFWH 1NGYA 1MFEL 2VNCA 4X6CA 2VDOH 1HXYB 4M03A 1IL1A 5DVNA 4UNTA 4JQIH 1ZHNA 4GW4A 4OF8A 4XH2B 4ZO9A 4DGIL 3EOTH 5FYKU 4ODTH 5C07B 5GZOD 5L2KE 2GITA 4BH7B 2V2TA 5FUZH 3GMOA 3IRZA 3SEPA 1RJCA 1T6WA 1X5GA 4IRZH 2L7UA 3EOBB 2CQVA 5FOJA 4HXAL 5F1IB 2W9DH 1OHQA 4LAQL 5HHVL 1IC1A 5HI3D 4JFHE 4F2MA 3T3MF 5DJ2B 3LQZB 1RIHL 2P5WE 4JEGB 2JIXA 3GJEB 2F9BT 2P8LA 2JIXD 5EU5A 4N0UA 3P4OB 5I18H 1MCJA 3EYUH 3WXWH 1OAKL 4YUEH 1P4IH 3TIEB 1RZKC 3V5KA 5F3HA 3U0TA 2CDEA 4PJ7F 2NTFB 4UZGA 3RU8L 2XPGB 3L5XL 4J3SA 1KACB 1CLOH 2UY7A 3FOMA 2LAAA 1TJIH 3BUYA 4OM0H 3B4NA 1J8KA 2HT3D 4YO0A 1AR1D 1YN6A 1NCBL 4GKOA 4Y16B 3JVGA 3KPOB 4Y5YB 2IAMB 4MA3B 1JI1A 1CXFA 1XF4B 4KKLD 4TULL 3QEUA 1LK2B 4R2GC 3RWGA 1U3ZA 1SEBB 2PCPB 4OFPA 5A16B 4PY8J 2HFFA 4HBQA 5E9DE 3SDDB 1YEFL 3UXFA 2AABL 1OD7A 3ELAT 3VRLF 3B9AA 5J6HA 1P4BL 1VENA 1XAUA 1S3KL 3GNMH 4IMLA 2FJGA 1WUNT 4X4YA 5D1ZC 4GBXB 2LAGB 4U6TA 3BDXA 1S78C 1U8JA 5C92A 4KGJA 3CVHB 4Z0XA 3VXTB 1KUMA 1YY8B 4JY6A 5I17A 1NCAL 2E6JA 1G6VK 3MR9B 1TJHH 2EYTB 5DGRA 2CXGA 3GSRB 1ZSDA 1AHWA 4Y4FB 3VFUB 2BOCA 3QRFM 1YEHL 3D3VE 4OTXH 4B7LA 3BZEA 5EWIH 1W8NA 2GI7A 4HQQL 1MJJB 4OKVB 1ZT7A 4HGWB 3EW3B 5ESVA 1RZGB 3I3BA 3PWJB 2F74B 2ORBH 2MTPA 1U8KB 5C09B 4CRPA 3WJJC 3LS4H 4TTGA 4NNYB 2FX7H 3HAEB 4I0CC 4PJAA 3ZT7A 1ZHBB 5I71B 3HHRB 4OZFA 3INUL 2DKSA 1RUKH 1RZFL 4JPVL 4ENEC 4YWGH 3IDYB 3A6BH 1F4YH 4JDZA 3CNKA 3CPLB 2ZSVA 4G8GE 4JO1H 2XTJC 5HGAA 2XZQL 4NUJA 4M6AA 1WTLA 3AS0A 1U3JA 5I8CB 2GK0A 5C0EB 2YHGA 4D9LL 4Z7VE 1OCWL 4LSVH 2EICA 3BQUB 4R0LB 1LK3H 2K9UA 2QBWA 4P9MH 1TTUA 3OX8B 5DXWA 4YQXL 2KH2B 2V17L 4PP2B 1KJ3L 1LNUA 1CFNA 3MTRA 1Q9OB 1HIML 4ZXBB 2D7OA 4WW2A 4FQJL 3FONB 4HXBL 1OLZA 2FJHB 2Y5TB 5EBWA 4YEFA 1BVZA 1P2CB 3SY0A 3C60C 3WN5B 2AXGA 1ZANH 5BZWB 3N50A 3LHPL 1LP9F 4JZOB 3PQYA 3MYJA 3DURA 3GO1H 3U6RA 3BT2L 5J12C 4ZD3H 2VDML 2DMBA 3PQYD 3ULSB 2OP4H 4G7YH 4GMTL 5DMGD 1R5IA 3M45A 1S9YB 2NY1D 4YDIH 3SQBA 1EVTC 4PBVC 4JO4H 5L8KB 3EAKA 3D85A 1R24B 1XH3B 1XGTA 5JLZB 5BVJB 1EZVY 4HWUA 2XNAA 4KVNL 3CCHA 3S4SG 4KY1H 5IF0B 2RQ8A 4D0BA 1BOGB 1NFDF 5HYJA 3BKML 1CFTA 2A1WL 4YK4C 1EHNA 1X4YA 1CG9A 1CVRA 3BP5B 3IXTA 4BZ2H 4UOW1 2OL3H 1KELH 1CFBA 1FIGH 4WFFE 5SWSB 1CLZL 1MLCA 3L9RB 1S7XA 4L3CB 1CGSL 1OLLA 4J4PD 5HYIA 1M7IA 3MLRL 1QBBA 5CP7A 5C0FB 3X17A 4JLRA 3QUMA 5I0DA 4JN2A 4KKBD 1U8MB 5AD0A 1YEDB 3GMPB 3LD8B 3IJYB 5JOFA 5EO9A 2W65A 2BXYA 5DURB 4PJGA 4RGMC 4PV9A 3VCLB 3MRJB 2JB5H 1U3HA 1WBYA 5CJQL 5DJ0B 3MJ7A 5FGSA 4P5TD 1GC1H 3KPPA 3T65B 3BESR 4OZHE 1U3HD 5B22A 5SWZE 3BWAB 4X7CC 4PREB 1JUFB 4KROB 1U42A 3TNMA 1VKXB 1M71B 5JPMA 4IHOB 5IM7A 2G5BB 3EYSL 1F6AB 4JRXB 2JCCF 4TNWK 1GGIH 1IM9A 5L7XH 2EE6A 5H35B 5JXEA 3MZGB 3MZTA 3NH7L 1JYWA 1QQDA 5F9DC 1WAAE 3BP6B 4NO2B 2X4UB 3QCVL 5JXED 1G6RA 3QFJD 4MMZC 4YHPB 4PD4K 4LSPH 4WJ5B 5DJCB 3ZLQC 1DBJH 1KJ2L 2C1OB 1W72A 5DVKA 2HWZH 5LGJB 5B3JF 3RVVD 2A9MH 5EUOB 4AM0A 5TE6H 2G60L 4GMSH 5I1DB 2VISB 1AXTL 1D6VH 2EDEA 2ERJB 3Q2CA 1B88A 4BKLB 2RCSL 3TLRA 4JN1L 3G08A 1A3QA 3O8XD 4P99A 4JVPA 3RVUD 1OT1A 2BSED 4UDUB 4JFFA 3CK0L 2MCG1 3ZL4L 4UOW0 4HLZH 5FDWB 5L8JB 3U4EB 2DLTA 3GSNH 3RJQB 4HD9A 4JFFD 5BMFL 1CFQA 3WNMA 5D1QB 3IJHA 2RB8A 15C8H 4MJ4A 2YPLD 1WC7B 3C9NB 5EU6A 2BNRB 5F7MC 1UGNA 2EEDA 3MLUL 4XPTH 3D39B 1NCCL 3U2SB 4IIQB 3DROA 5EU6D 5I30L 3OWEA 4X8XA 4ZUVB 3QI9B 3OB8A 2D03L 2FECL 3RZCB 4TN9A 4JO3H 2Z35B 3UTQA 1GH7A 2AJYL 1I9IH 1N6QH 3VFRB 2Y5EA 1AIFA 3ARUA 3HMWL 4WDIA 1SJHA 1A6WH 1I7TA 4GQ9L 1J0HA 4Q6YA 4JAMA 2YKLL 3NGBB 4P9HH 4F15B 4LPVA 3QZWG 4I18C 1NFKA 2B2XH 2DQJH 3E8UH 1NBQA 2ITCA 3ARBA 1K3ZA 1P7QB 4UILL 3IB4A 4OUUA 4PJEA 1GHFH 1I9JL 4YHOH 1CGYA 5DQJB 2PXYC 2WUBH 5HDBF 1NAMH 5C0DA 4G80A 4I8DA 3QIUC 3MBED 3CXDH 1LO3H 3BH8A 4L4TA 1I85A 3L3JB 1DQJB 5T3XH 3MQIA 2PYFB 4LCYB 5M7QA 2YOCA 3B2UD 3MOAL 4J8RA 4X6BB 5SX4I 4L4TD 3MRGA 2DQCL 2AQ1A 2NZIA 4AZ8A 3FO9B 2A9NL 1P7KB 1PQZA 5DJ6B 2GCYB 1DLHB 3BDBA 4G42A 4UIKH 4ODSH 4L29A 4OJFH 1A4KB 4D9RD 2I5YH 3AAZB 1LO5A 2EYRA 3C6LB 3S35L 5D8JL 2AK4A 3T77B 1N26A 5B39B 1Q72H 3ABZA 3T1WA 1ZTXH 4K7PL 1MCQA 3UYRL 1AQDB 1LQSR 2AK4D 4HH9B 6FABH 2F54E 2BERA 5F93C 5I75C 2VO5A 4OQTL 1JWSA 4Z7VF 2HYMA 1IGCH 4OZGE 5HHXH 5ISZD 3FB6B 1BIHA 2EIZB 2IPTL 3STLA 5FKPB 3UP1A 4JJ5A 4GRWH 1XF1A 3U7YL 5GGSY 4BFGA 5B4MC 5MP6L 4F8TA 4ODVL 1QFWL 1S5IH 1C7SA 2F53D 3QO0A 5KOVC 3RIFF 5I6XB 2VDOL 4QRRB 4G9DA 4MA8H 3VWKA 4XNUH 1IGYA 2CLVB 3IETB 4FA8A 3DSFH 3V6FA 3ROOB 4FFZL 3W5NA 1HSAA 5EZLB 3EOTL 3H42H 3VWKD 5TGBB 4FQXB 1G0XA 4MGXA 5EO0B 1GOFA 5FKAB 2C3XA 1RK1B 3MLSL 4F7MA 4DVBA 2FCBA 1G7IB 3FCTB 4IRZL 1A6ZA 4HUUB 4NYLB 5KS9F 3VJ6A 4RFEB 3TN0A 1YECL 3SCMB 1I1YB 2E7BA 3PL6C 4WHYG 4HUKB 3KPTA 3N1PC 3RDTA 3CC5B 3HLAB 1XCQA 3OAYH 3BXNB 1BVKB 4XHJC 3VXSA 2W91A 4MQ7A 1YUHA 3RDTD 4U0QB 1TZHA 1R5VB 4IDLA 4RBPK 3VXSD 1S5HA 3U7WH 4HUWB 4RWYH 1FCCA 4ZG1A 3D69A 5E7FA 3EYUL 1WIOA 1NUFA 1U36A 3BZ4A 3FFCA 2DLGA 4G5ZH 4JPIA 4I77H 5E1HB 3G5ZA 4YUEL 1BLNB 1P4IL 5KAQF 3LSOA 1UVQA 3FQRA 5IROA 2CK0H 3K46A 1OB1A 5DJXA 5LCVH 1R3IH 4U1SA 1DP0A 1CLOL 1A6PA 4X8JB 5EOCJ 1TJIL 4OM0L 1N5AA 2HFGL 1OVZA 3ZKNC 3TBWB 3VXRA 3QPXH 4D2NA 4F3FB 3U79A 2UUDH 4JFEB 4WNQA 2UY6A 3VXRD 3QT2A 4NC1E 5GS0D 3FOLA 1P69B 3SGJC 1H8SA 2ZCKL 1BD2B 4IRJC 4MD5B 4YDKH 1ZA6B 2JJTA 3K8KA 4FFVC 1CIDA 5FYLH 1YYLH 2BNQB 35C8H 3MO1A 4Q9BA 3B9KA 4MXQD 4GXVL 4OZHF 1EEZB 3B9KD 3GNML 1M1SA 1NGWA 4U33A 4X9HA 1AJ7H 2H6PA 1J05B 1ZOXA 2XYCA 4P49A 3MNWA 1I9EA 1MI5B 1HH9B 4XNMA 2AXJA 3IU4H 1QP1A 1AGBA 1TJHL 3EJZC 4LVNB 3T0ED 2C3GA 5E6ZA 5IHZA 1DEDA 1U8NB 2E5EA 4OCLC 4ZO6A 1JNJA 4O51A 5JPNA 5IK3B 4PIRF 3WFBH 2O93L 5AG8A 5DEGB 5EWIL 2OSLB 2QJDA 2XQYG 1WJ3A 5FO8A 1B9ZA 2CIKB 2ORBL 1AD9A 5D7IF 1DQQB 4LCWE 2FX7L 3RUGE 4WO4C 1CZ8H 1HKLH 5EB9A 3U0PA 1CE6A 1UB5A 1U92A 2X9XA 5EN2A 4PLKC 2Z9TA 4WTZA 4YWGL 5KVFL 4MD4B 3CFJA 3O9WA 1F4YL 2H41A 3MGOA 5EU7E 2ZUQC 4ZFFA 5C1MB 1U8OA 5IVXE 4JO1L 1V3JA 3FQWB 1JGUH 2IANE 4E42A 5KJRL 1A7NH 1QO3B 2XWTB 4XP4L 5FYJE 4I9WE 2R9HC 3Q1SH 3G5VA 1OTSC 3OGCB 1IKFL 3P73B 4P9ML 3MA9H 4JB9L 1AXIB 2Y06H 3MJ8B 3V7AG 3F65A 4J12A 1YC7A 2ZOLA 4GAJH 4B5EA 4IJ3B 4EI6B 1T80A 4HUMB 4MAUH 1RMFH 2FL5A 1SY6H 1XR8A 4OFIA 1NMCB 2XWBB 3QCTH 2Q76A 1ZANL 4PR5A 4KTYA 5CIPB 3K7UA 5IJVA 2XXCB 2OJEA 2WIIB 4BQCA 3D2UD 4P23B 2LTQB 3BKCL 2BJML 1NFDA 1I3UA 3SDXA 3GO1L 2ZUXA 4EUPA 4ZD3L 1AP2A 2VXQH 5GRVL 3LV3A 2OP4L 5C0CB 3KLHD 4G7YL 4QGTA 3H3BC 2AJ3A 2D0GA 5DUMH 4GQPH 4YDIL 5J9PB 2BHUA 1AKJB 4XP9H 3VWJC 3GSXA 4JO4L 1IAIH 1QLEH 3UBXG 3ULVH 5MEPA 1OF2B 4ZS6C 4NFDA 4R4BA 3BYTA 3GUTB 4KUZH 4MZ3A 2FIRT 4KY1L 4URTB 4LP5A 3EO9H 4XCYB 4EDWL 3EYFB 5C0IB 3GBNL 2DIBA 2R69L 3TESA 1T66C 1XIWB 3WL9B 5MEQB 3SPVB 3FO2A 4X6EA 4ZTOL 4PTTB 4BZ2L 4JREC 2OL3L 3DRQA 3F12A 2BDNH 1FIGL 4NO5A 1HEZB 3G9AB 1X3DA 3VH8A 1YC8A 1II4E 1YDPA 4UINH 1E4XH 4HFUH 5E2UH 3SJVD 2LV4A 2V7NA 4XAWH 5E5UB 1IC4H 1VEMA 2X4QA 3GM8A 3O3UN 1F5WA 2IF7A 2EO9A 1JV5A 2BY2A 4GG6E 3T08A 3FRUA 5FA4B 1ZWIB 5IIEB 1HHKA 4YR6A 1R3KA 2G75A 3SN6N 3QQ3B 4IRSB 1JFQH 3RWEB 2JB5L 1B0GA 4U4BA 2EDLA 2VQUA 5JORB 5T1LB 2M2DA 3DVFA 2I9LB 3ESVF 3VXMD 4H1LG 1KYOJ 1HOCA 5T1DL 3RGVA 1EX0A 1NJ9B 4WVRA 1AR2A 2GAZB 2CDGA 4MCYB 4PLNC 1MUJA 3VFVA 1R6VA 3JWNC 2AXFB 3FB7B 4PY7B 4FXGB 2P5WA 1HILB 1XZ0A 4AT6A 3HPJA 1C5BH 5K59F 3S96A 1GGIL 2NX5B 5K9QG 3D25B 4D3CH 2OTUA 4FQQA 4U6XB 5FO7A 5C2UB 4PJ5E 1OP3K 4R7DB 3HE6D 2YD3A 3PHOA 2ICCA 2BY1A 4MNGB 4RDQG 4FQLH 2JK5B 2YSSA 2CKBA 4WHDA 4RMWA 5TQ0H 2A6JB 1VFUA 1YY9D 2HWZL 3EYQC 3V6BR 3PUCA 2VN4A 2A9ML 3RAJL 5IHUH 5TE6L 4GMSL 1J1XH 1X5IA 1SBBA 3VXOB 1RUQH 1D6VL 3UDWA 3SDCB 3P9LA 1FG9C 5IMOA 4XWOC 4LCCB 1A7BA 4Y4KB 4MWFA 4L9DA 4LLMA 3HZYA 1W0VA 2XTJE 2EIBA 3ULUH 1VCAA 1N3NB 3TBVA 4Q9RH 5E9DA 4BQ8A 3X14B 3GSNL 3Q5TA 4WI6A 3G6AA 4PJFE 4LASH 1KC5H 3DMMB 1C16B 15C8L 5K33A 3MCKA 1CWVA 4M9OA 4YBQC 3B9EA 1HN1A 3F7YA 1U8HA 3FT4A 3VFMB 4XPTL 4UBDD 3P9MA 5GZND 3BI9X 3WIHL 3BIKA 2HMIC 1EGJL 3MV01 3CSYA 1T04A 4ETQB 5EOQH 3ROLB 5I1GH 4LIQH 3DBXA 4JO3L 1J88A 3O3BA 4TSAH 1IAOA 3RNKA 4K71B 1IAIM 2XZCH 4OLXH 1T03H 3FJTA 3D3VA 3PGCB 1I9IL 2IPKB 4Y89A 1N6QL 3H9HA 2PW1B 2DQUL 3V6ZB 3ZHKA 4LHUD 4RMUA 4QRUB 4HFWB 4NOFA 2V2WA 5F8QC 4UQ2A 3DXAB 1A6WL 4LKXB 4R3SB 3ZHLA 4L8SC 4HIEA 1JZ2A 4HF5H 4P9HL 2M1KA 1TCRB 3QPQC 1DZBA 2DQJL 3E8UL 3IDJB 3UCRA 4C4KO 5HVHC 2PO6B 4HX1B 1GZQB 2UWEB 4UAOC 1NUDA 3NFPA 1GHFL 3PWVA 3S88L 2F5AL 2XA3A 1EPFA 2ENYA 3QUYB 4G8GA 4YHOL 2D7NA 1MSPA 2ZKHL 2WUBL 2G9HB 1NAML 4UTBH 2YA2A 5DZLA 1LO3L 3NPSB 4HZAA 1UM4L 4WGWB 5T3XL 4Z7VA 3RTQB 4KJYB 4A6YB 3S37X 5M94B 4WV1C 5CAYB 1ZHKB 1HNGA 2H2PD 4S1RH 5IWLA 2IFGA 5AAWA 4FQPA 1BIIB 2PUQT 4UIKL 4ODSL 4K7FA 1KB9K 5CEZD 4OJFL 5IB4B 2E7HA 1IZKA 2I5YL 4OGYH 1DUZB 4PJCE 3TIDB 5CGYC 4MJ5A 5IVXF 3FRPA 5D5ME 3EHBC 2NY5L 4YHMH 1UENA 1KT2B 3ZYOA 3ARWA 4YZFF 2KKQA 6FABL 1QRNB 2AEIT 4NJAH 1IAKA 5HHXL 1S7RB 3ARYA 1GXEA 1KPVA 2ZNWA 4MDJB 5KS9A 3ZSTA 5AZEH 1NKRA 3X12B 5DD5H 5KVGH 4MZ2A 3NA9H 3QO1B 5E94B 1S5IL 1V8HA 4HLZG 1KV3A 5C6WH 4K3JH 4FQHA 3JV4A 4MA8L 1NQBA 4XNUL 4AIZA 1OGAE 3TH4T 2NXYD 3DSFL 4BH8B 1T5XB 4JM4H 3KPQB 3VGHA 2FEEI 2FD6H 3V0VB