3KHOA

Crystal structure of murine ig-beta (cd79b) homodimer
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
88
Chain Sequence
IWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKDSCGTELLVLGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords B-cell antigen receptor complex-associated protein beta chai
publication title Structural and Functional Studies of Igalphabeta and Its Assembly with the B Cell Antigen Receptor.
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 88
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3khoA00
1E4XL 1A5FH 3OR7B 2MQ0A 1RJCA 5LGJA 4MX7A 4QXUH 5DMGC 4N1CA 3LQZA 3QO0A 3MBEC 3L7EA 3VFNB 1X9QA 4S1QH 5JHLH 4PJCB 2KQNA 5HXMA 3OGCB 5CJQH 1DDHB 1YQVH 1CE6B 2XN9A 3EDJA 3AXLB 4JPVL 1IGJA 3WUWA 3RU8H 3QZWG 5IK3A 3GHEL 1IEBA 4XWOC 3ULUH 3FQTB 3SDDD 2X70A 1TCMA 4Y8AA 1CICA 5HYQA 2GJ6B 1IC5L 3U4AA 5JIIA 1QSFE 1KC5L 3WDHA 2MHAB 3AROA 1EFXD 5D2NE 5GZNC 1CDIA 3MTRA 4BUGA 4EZMA 3ZO0A 3MRNB 2K3TA 4EI5A 1WV7T 5HI3C 4QRTA 1Q9WA 2ICES 1YDPB 2P47B 4PJBB 4P5KB 3F6IA 1BREA 5FCUL 4OD3L 4M1GH 4C58B 1OSPH 4W68A 1J0IA 1D5MA 2DL2A 3RVXC 4LLUA 3HPLA 4M7LT 4Z0XB 5EZIL 4G9FD 1OVZA 3IYLW 1MIEH 5DGQA 4NQDD 2J8UB 1BF2A 5JXED 1WTGT 4GUPA 2PR4H 2X4TA 1F8TL 5E6IA 4Q9RL 3SQBA 4MYWB 1NC2A 5T1MA 5IEKA 3LRGA 2AJXH 4U0QB 2FO4B 3T3PE 1AH1A 2B39A 4JZNB 4HIJB 3O2DL 5HGAA 4OJFH 3G9AB 2AV7A 4OQ1A 5I15H 3W0WA 2CRMA 5IVNA 5DR5H 3IU4H 1OARH 2AEPH 1EHXA 3HZVA 4ZFOA 4NRYB 5DMKA 3QIBA 1AGEA 2R9HC 3GMNB 1OAUL 2YSSB 4LBEA 3NGBC 1BFTA 2DQFA 3CSYA 1UC6A 1YEHL 1HN1A 5JNYB 2N7BA 1UWGL 3PIQB 4ZXBB 4U3CA 3HR6A 3VE0B 4X8JA 2GCYA 4NQCE 1DBBH 4UBDD 1RHHA 3GI8H 5DEFB 3OKOA 4MQTB 3BISA 1AGBB 3MZTA 4HIEB 3ZDYE 1T1WA 4MMZC 4XVSL 5FYLH 4U6TA 3MRLB 1FL5B 2BY2A 2D3VA 5E9DE 2DI9A 4H25B 1NGQL 3JTSB 2BC4B 3C6LB 5F6IB 3BIAX 4O02L 2X40A 2RBLA 3X12B 4KDTA 1VFUA 1MCSA 2C4FT 4PV8A 5HHOD 2XTJB 1OW0C 1DR9A 3B4NA 3QRFM 3MLRL 2P5EB 2OSLA 2D2OA 1G9NH 5FOBB 1H8OA 1IRAY 1GL4B 2VR4A 5BMFH 4HQQH 4YAQB 4PRIB 4WTZG 2VN4A 1A6WL 2DMBA 1BZQK 1A22B 4JB9L 2VLKA 5I1DA 1D9KB 1JWMB 5D2LE 3VGEA 2Q1EA 1DANU 1VB9A 2F8VA 1IL1A 3DX7A 4WO4B 3WKMH 3TA3B 2XKNA 4KV5F 4S1SL 4MQSB 5F7YC 4V1DD 4LCUA 3OAUL 5TH2A 4BQ9A 1XH3A 3SE9L 5INDA 5JW4R 3MUGB 2ENYA 4LSVL 4H88L 4LIQH 5E1AB 3VI3F 2YS4A 1ZA6B 4U1GC 4OGXL 5F8QC 3UYPA 1I8KA 4OSUL 1FE8H 1JHKL 3ZYZA 3IDJA 1YECH 3T8XA 3GJEB 4XNQA 1FZJA 2DTMH 3OKEA 5JORB 2V7NA 4J3UA 1ZTXH 1XCQA 3P11L 2R1WB 5BOZG 1OM3L 1GGBL 1MI5E 3VCLB 4JY5L 1G9MC 2P7TB 2QHRH 3F7QA 4QRQB 5FO8B 5JLZA 1VFBA 5EBLB 3MLUL 1VDGA 5I1LA 4HSQA 3VRJA 5K9QI 1WAAF 3BGMA 3AS0A 4MNGB 4NZTL 2VLJD 4EIZC 4ZODA 4WWKD 1EEUA 3BRGC 5HHPA 3OKMA 4MXWL 3KNBB 2H9GB 4JFZH 4PJHF 1F2XK 5FKPA 1MEXL 1ZMYA 2NMSA 3V6BR 2FB4H 2NY7H 4OLVH 2HT2C 4A6YB 1I7RB 2M26A 4ELKB 5DFVC 4LPXA 2NXZB 5EUOE 1UA6L 3EJJX 2Z0BA 1MJ7H 4D8PA 2B2XL 3WMSA 2J5LB 4ZUUB 2HLAB 1JWUA 1F4AA 2V5TA 4FZ8H 1S7WA 1I9RL 4H1LH 1RFDH 1PQZA 1QPXA 1HHGA 5DUBB 3WFHB 1D5XB 4QRUB 5IVXE 3CU1A 4N8CH 2XA3A 1KN2L 3NZHL 3HAEH 4MMXC 4P2YA 2WINA 1A9EA 2ZJSL 2Z92A 1OAQL 5F9WC 2XPGB 1OTTD 3G6JB 2XIDA 4HJ0C 1XGUB 5I8EB 4U2ZA 5FEBA 4JM4H 3V5KA 4YHKL 3C60B 5DHVH 2DKSA 1XZ0A 1D5ZB 4QTIL 3D25B 5FK9B 1EH9A 2XQYK 4NZUH 1LE5B 3GBLA 1AFVL 1NCWL 5DK2B 1UJTA 3MJGX 3TM6A 4QCIB 3UJIL 2VE6B 1MWAA 5CSZB 3GKWL 1HHIA 4R4FL 3HC4H 2BY3A 4F7PA 4E0RA 3GNMH 2ERJC 4RAVA 1N0XH 5TDOB 3DV6B 2HFTA 4ZO8A 1NQBA 5BZDB 4PRNA 5IMLB 3V79C 1AQDA 2ICWJ 4ODHH 1MAMH 1ADQH 3QI9B 4HUMB 4BSVA 4XNMB 4P23B 1OW0A 2MPAH 5J11C 3Q6FB 3ESUF 4LKXB 3MUY1 3T2OA 4LASL 4MB5A 4GW4B 4PJ5E 3BFOA 4JZOB 2EKSA 3S5LG 2XKSA 5KVFH 1KPRA 3QXUA 3N1FC 3LKQB 3LQAC 5GGQL 1A2YB 5K93A 2W9EH 4QGYA 4G42B 2Z91B 3MJ8A 2X4UA 4PRPE 4ZTOL 3P9MB 1NUGA 2IANB 5FGBC 5CGMA 2JB5L 1UKQA 1F02I 3BAEL 4LAQH 1O5DT 5EA0H 4X4MA 4WCYH 5EU3A 4RMSA 1RZKH 4MA7L 3TBSA 3ZDZF 4XCEA 1I7UA 4K2UL 1HDMA 2UVEA 4LCCB 2VYRE 2XTLA 3JWDL 2ZKHL 5HHNA 3VXNA 2R0LH 4PLNC 4WFFD 3BN9C 3KYOB 5ADOH 4UTAL 2F5AH 4KZEL 3WXVL 1TPXB 3RY4A 3CZJA 3NIGE 5GIRB 1HQ4B 2JLLA 4E41D 2XYCA 1GZPA 3U2SB 4ODWA 1SEQH 4M93B 1KSRA 2VISA 1SM3H 1AD9B 3FRUA 1U8HB 1ZLUK 2QSCH 3TBWA 5GPRA 4ALAL 5D93C 1FZOB 1X5IA 3BW9A 4HWUA 3IFLL 2V7HA 1A1NA 4RMWA 3OB0K 3UTSA 5HGDA 1KIRA 1U91B 4PTTB 1G7JA 3AGVA 1GGCH 2K7QA 4J2XA 2VSCA 5AAMA 3CSBA 4B5EA 3FN0H 1EXUB 2YUVA 1CDHA 3AAZA 1CLZH 4UV7H 4J12A 1V5JA 5ELIA 1ZK9A 2OTWB 4FQLL 2CXKA 3OXRB 3OL2A 5LGKA 4MJIA 5I8OL 5IMKB 4N9GB 1LILA 2B1HH 4XI5C 1MQKL 5DVKA 3BZEB 3L5WA 2CUMA 4JDZB 4GMSH 2XA8H 5GRVL 5MENA 4AENA 2R2BB 2JB6A 2HVKA 2V2TB 1U8OB 4YGAB 3PWNB 4WJ5B 3MV7B 3GGWB 4XPBL 1J5OH 1WJ3A 3MACH 4OLEA 2CLRA 4DAGL 4QHLB 4GXVL 4RAHA 5J12B 3RZWA 3S35L 5I1HL 1A4JB 4EOWL 4N5UA 3AU1B 4HPOH 4BK5A 5CEZE 3BH8A 2B7DT 4YHOH 5IVOA 3VWJD 3JUYA 1WC7B 2L7UA 4WFGD 5TE4L 4F15B 4KK9D 3OSKA 5E99L 5F96H 3ARGC 2Q3AA 5FYKU 5GSRA 3L9RB 7FABL 4C83B 4BSWB 3SO3B 4ZD3H 3CLFL 3WUWG 5CJOH 1WBXA 3NCYS 2CDFB 4FG6D 3UTQB 4R26H 4KDVA 4DZ8A 3MJ9L 4TUJA 4DCQA 3NCYP 3BT2H 4M3KB 1QSFA 1FIEA 5DD5H 5DSCA 4CRPA 3PV7A 2E27L 5ESAB 2VZOA 3DRTB 5EUKB 3WNPA 4JJHA 1GOGA 4J6RH 5DUPL 3DIFB 3M1BA 1CXHA 5FGBA 1K2DA 1SY6A 3RQ3A 1TZIB 1I9JL 3LHPL 4N0UE 1LEIA 3V7MA 3ULVH 4R4NC 3VXPA 3V6ZA 2Z9TA 5EO1B 3OF6D 4YBLC 4OLYL 1W2KT 1NEUA 1Q72L 4UDUA 3MLYL 3A67L 3SEPA 1CFNA 1AI1H 1CDGA 1JUFB 3HC0A 2NY2C 1NGPH 3JV0A 1RUPH 5ICXB 3FB6A 1QLEH 1JGUL 4UT6L 4ZNEE 2EE2A 4L3EB 4TSCH 5F93C 3GMRA 4Y5VB 2OBGA 2PCPB 3LN5A 5H35B 3RFZC 3IJYA 1H9VA 2RCSL 2VDLH 3FZUC 3VFSB 4NQXA 5EZLB 4HGKC 2BMKA 2BNRB 4YBQD 1QFHA 1HH9B 3BEWA 1OB1A 1KT2A 3GSUB 4MD5A 1EO7A 3GFUA 1CWVA 1NCAL 3KWWB 4G3YL 1V7ML 2X4SB 3W9DB 4GAJH 4F37F 4NQCA 5D96B 1OWWA 1IMHC 1DL7H 1F58L 1B9ZA 1T7YA 3TIEB 4OGZA 3ZSSA 3GJFA 3QQ9C 4NQUA 3RA7H 2DQCH 1T2XA 3IXTA 3G5YB 3O6MH 4AQOA 4RRPA 1NGWA 4U1HA 1NPUA 1BHGA 4MXVE 4PJ8A 2CO6B 3HMXH 2UUDK 5CZKA 1XGQA 5TFSH 3JV4A 4XNXL 1VACB 1RIHH 1IC7H 5DJXA 3ZT7A 1A7QH 1TQBB 5FGCE 4OZIB 1MCHA 4CMHC 4YE4H 1S7UB 5B38A 1G9ML 2AXHA 1P1ZB 1OT1A 1CG9A 1OCWL 5HJ3A 1Z0NA 3T3ME 1B3JA 1NDMA 3HI6H 3LKSA 1ZLWH 3TT1H 4TVPH 3SKNB 3EYOA 3O6FB 4KGJA 2A6DA 3LEVL 5ALCH 1S9YA 35C8H 3S96A 4IHOA 3K8MA 3O3DB 4OFYA 1JK8B 3GIZH 3KXFA 2DI7A 2NTFA 3ARFB 3ILQC 3LAFA 4K23L 4YHLH 5JOPD 4L8BA 3ARGA 5T1LB 3OBAA 4RFNB 4RBPH 4UIKH 4QRSA 4XCFL 1VEPA 4V2CB 1K4DB 2CK0H 4LSSL 4ZMAT 4HHAB 4XMKL 1F3DH 5KJRH 5I1KL 2WIIB 5DDHA 4X80H 3L3IB 1FO0H 2J8HA 4X6CA 1TZGH 1HIMH 2NLJB 4LSPL 4HJGA 5GRZA 4WI5A 5I2IA 5HHQA 4U1NA 2E7LC 5BXFB 2BJML 3RGHA 2X89D 1LD9A 1YA5A 4LEOB 4LP5A 4OQTH 5I76A 5DYOB 3GB7A 3MLTB 3ZKXC 5K9QG 4LL9A 4FXGA 5D7JC 1KTLB 3P0VH 3L3DB 1A1OB 2P5WB 1F3RB 5BS0E 1FFNA 3KHOA 4Q6YA 2DLFH 4AEHH 3GBML 5GGUA 3TN0B 5E2UL 4LLDB 5DTFA 1G7LA 1KIPB 2QQKH 4ORGB 1GC1C 1N3NA 4ZOEA 4EUPH 5JXAL 3T4YA 3KR3H 1JF1B 4RMUA 3QZWB 1FN4A 4PG2C 4L5FH 1RZJH 5IVXA 3O0RH 4NFBA 4TYUA 2VERN 5CIPB 1ETZA 4F58H 2NX5B 1CL7L 1U8LB 4PJFF 1J88A 3B5GA 5BZWA 2KDGA 1YMME 4C56E 1H3UA 3IGAB 4JHWL 3VGAC 2EH7H 2A73B 2NY0C 4X5WB 5BW7C 2QQNH 3T4AB 4X6EA 4CN1A 1S7SB 4YFEA 1R5IB 4JPKH 3GHBH 1ZA3A 4N0FB 2P1YA 5ERWA 2HKFL 3FFDB 2H8PA 1XFPA 1M05A 5E5MA 3NIDF 1MVUA 4MDJA 4WEUD 1T89C 2AABL 3CH1B 2IADA 1JGDA 1KCVL 1U41A 1ZHBB 1A64A 2Q8BH 2FIKA 2IWGA 3FQUB 3QAZB 3SDXE 1I3VA 1IAKB 3DNKA 3KPOB 1PG7L 4FFWD 2FX7H 2VR9A 3QUKB 4LIQE 5ETUB 2AK4E 3UDWA 2QHLA 1A1MB 5EIIB 5GJSH 2YEZB 4QTHA 5BJTA 2XNAA 5ENWB 4XVTH 4ZXBD 4PJ5A 3RIFF 1GVIA 2HFGH 1WUNT 5FOJA 3WN5C 4KK5D 4KHTH 5D1XC 3QIWD 2VLMD 2VITA 2C3HA 5JHDB 1K8DA 2EYTB 4LFHD 1J1PL 3FCTB 4JJ5A 1I3GH 3TO4C 3VFPB 1N0LA 2NZ9C 4PRPA 4KQ3L 4JRWA 1RHFA 4U1IA 2G75A 3C6LD 5MEPA 2W0KA 4J3VA 4XMPH 5CD5C 1EGJA 2LU7A 2A77H 2GUOA 2XTJD 1LO3H 1A4KA 1B0GB 3MLWH 1F4HA 4PYHA 4DVBB 1IT9L 3K4ZA 2BSSB 4NC2B 5LG1A 3UP1A 3ZE1E 1RJLB 3ARDB 4GW1B 2DMKA 1ODAA 4M6NL 3MLSL 1RZFH 4PRID 5IP4A 3HR5B 4MSWB 1FZMA 1A6ZB 1P4IL 1J86A 3WSQL 1LDPH 3LRSA 4JGMA 4U1MB 4PYGA 1KCRL 1D9KD 4MQ7A 4NKDA 5HDOA 4R3SB 4WO4D 3WO4C 4OZHB 5D7SL 5F88B 3TA3D 3MRMB 5C0EA 3E6FB 2VDQL 1JMXA 4UINL 2YKLL 4CJ1A 5FYJD 4PGBA 3U0TA 1N2RA 3I9GH 5D7JA 5DD1L 4NN5B 2ICEA 1NCTA 3CIQA 1ORSA 2WUBL 1AGFA 3KPTA 4XPAL 4OGAC 2WQRA 1ZT7B 3LQMA 1VCAA 4JFEB 4QHNA 4WEMB 4MJ6A 2DLEA 5C2BL 3RL1A 3QWRA 1HILA 2FLRT 4LQFL 4XAWL 3DOSA 1RUAL 3EYQD 4S10A 4PG2A 3VFTB 1Q9OB 1I1YA 2ID5A 4WI6A 3UTPE 2ZP0T 4HS8H 4MAUL 1U3YA 1U2HA 1NCDL 4ZPVB 2DWDA 4OF7A 1RULH 4I0PC 3O6KH 2ZZUT 2R2EB 2VXTH 2ESVE 4JG0L 5IUSA 1I9IH 4YUEH 4X0KA 4RGNB 2DWEA 2NXZD 4UB0H 2FSEA 4YEFA 1DEEB 1DUYA 4P3CH 2VXQH 1HSBB 4PRAB 4K7PX 5AYUH 1MHEA 3QDGE 3IFNH 4EXPX 5I1JH 4NSKA 3STLA 4K55A 3GMMA 2XWBB 3CLEL 4N5EC 5GGSB 1TZHA 1AR1C 4JZJB 1FL6B 1A8JH 1VGKA 2DJSA 3JTTA 4R96A 1IKNA 4PS4L 3QDJE 4LVOC 4GBXC 1PKQB 2ORBH 3FFCE 5HVWA 5SX4I 15C8L 4OCSH 1TXKA 5EU6B 3ES6A 3KJ4B 4I8DA 3C60D 4M8QA 4UUJB 4OF6A 1CBVH 1F4XH 3I6LE 4IRSC 4G6FB 5DC9B 2C1OA 3SGEI 2RIKA 5T3ZL 4CVXB 1N4XL 5IVZB 1NKRA 2VLRB 3KS0J 2YMXH 1NL0L 2R39A 5AEAA 4G8EB 5DS8A 2FJHA 2VDMH 3L6FA 4M5YL 3CCHB 2VABB 5D1XA 3CAFA 3U4EB 1VSCA 1BX2B 3BKJL 4A6YH 4DUVA 3B8SA 2NY5L 2VAAB 3HE6C 5KSBF 3G5XA 5AZEL 4G7YH 4Y4KC 1UCBL 3VRLE 3U1SH 1HEZA 5EWIL 4HXBH 5A40E 1ZGLB 3BDXA 5DI8A 3UZEA 4B7IA 3J7HA 3VFOB 1G6RB 4LSRH 1T04B 4N0UA 5DJAB 4FQCL 3EYUL 4RGMC 4P23D 5MERA 1DQJA 1OF2A 3LV3A 5IMMA 3HRZA 5T1DH 1MNUL 2ED9A 4F3FA 1RK0A 2Q3ZA 4ODVL 1C1EL 2BOCB 2DF3A 5E2VH 3RX5A 2YPKA 4X4ZA 4OLXL 4Y1AB 1GPOH 3EOAB 1UZ6E 2Z4QB 5MEQB 4GRMA 5J3HD 3RWHB 4F7MB 3S5LB 4E5XB 2VUYA 1JYNA 2FYYB 4FFZL 2LV4A 4MA8L 4ONHA 2IAND 4ZNEA 3RTQC 4KVCH 4O4YL 1HKFA 2FEEI 4RMRA 4XAKE 3MQIA 4BFIA 3VA2C 4AEIH 4QF1B 1EMTL 2CLZB 4RCAA 1G9NC 1H5BC 1T5XA 4DKEH 4H26B 2AXFA 2CDEB 43C9A 4MD0A 3TJEL 1YPZF 3MXVH 4UTBL 2ADFH 4K3JL 1F6AA 4U7SA 4BYHA 1PW3A 4NT6A 2AJSH 3T04D 2EXWC 2OR7A 3DX8A 4O51A 5DZOA 5J1SC 4DWHA 2IBZX 3B6SB 1UB5B 2ZPKL 1DUZA 2IH1A 4QXWA 3ZE2E 4F37K 2EDXA 4PV9A 3B2VL 1DQML 5D6DC 1CQKA 4RRPG 1S5HB 2K9UA 5DXWA 4AY0A 1OAZH 4NNYA 1A7OL 4Y19A 3RWDA 1HHJB 4XPHH 1DBMH 2EEDA 4GAYA 3O4OC 4ODSH 1CN4A 1U8PB 5C6WH 1CLOH 1I75A 4HS3B 1QFUL 4I0PA 1KEMH 3FOMA 2YRPA 4DVRL 5DGRA 4G43B 5HVGB 1OAXH 1RVFH 1WEJL 5IB3B 2BY1A 1MY5A 2J2ZA 1FNGA 3QQ3A 2VDKL 5IHZA 1WGOA 2G60H 1CLYL 3WIHL 2OL3H 4HAGA 4HK0A 3C5ZC 4XCCH 1UCTA 5HVHB 2P24A 3IDUA 2YXMA 4GT7A 2WP3O 4DN4H 2WBJB 4P4RA 3ULVE 1SVZA 3I6KA 1I1AC 4GBXA 1XR9B 1H3PH 2EDQA 5HDBF 5J06A 5E94A 5A16B 2A9NH 4XCNA 1TETH 1ROWA 4XPTL 2HJKB 4IRSA 1RZGA 4AG4H 1YEDA 1CGUA 3D3VD 4S1DD 3MV7D 3KPLB 5T1KB 3OMZA 1LO2L 2ENSA 4NDMA 3HKFA 4MGXA 3D85A 1E6OH 4YC2C 3EHBC 3EYVA 3JWOL 2W60A 2WANA 2WUCH 1C8PA 3GRWL 1KBGL 5L8JB 1NFDE 2Z93B 3HE6A 3RJDA 4K94H 3V52L 1ZSDA 1HYRC 4NZRH 4X9BA 4Y4KA 1ZEAL 1BGXL 3PHOA 5DK0A 4F57H 1HHKA 3G6AB 3GSQB 3RVTC 4MB3A 1A6UH 4OCMC 4TUKL 5LGJB 5BS0A 4DGVH 2ZSWB 4MX7B 4NQSA 4LF3A 3D0LA 3MV11 4JDTL 4CUCA 2O5YL 3LQZB 3QO0B 4JLRA 3ZKQD 2R4SH 4Y16B 2BNQB 2BVOA 2V9RA 3X3FL 5CEZL 4K8RC 1RIVL 3N1GC 2YXFA 1KJ2L 5T3XL 5TDNB 2XN9B 4XTRC 3RL2A 5LKNA 4JPIA 1IGJB 5EOCL 4PJXF 3WUWB 2ADGA 2GY5A 2CRYA 5I30H 5IK3B 1D5IL 5JMRA 1YEJL 4WFEE 1IEBB 1N6QL 2X70B 5KSUB 5TE7H 5GHWL 3VFWA 4UDTA 1IC4L 1Q8MA 4IOFD 4OZ4A 1U6AH 2AV1A 1V3LA 3RTQA 5LGHL 4KI1A 1T3FA 1I8LC 4ZUSA 1OAYH 2FWOA 5F7MC 2EDFA 2R1XA 5HDQH 1X5ZA 2B4CH 2DQHL 4EI5B 3DSFH 1NBYA 1KN4H 1H5BA 3I50H 2ATKA 5SWSA 1BVLA 5FXCH 3FONB 1CD8A 1EJOH 1JPGA 4TVPE 3H42L 4LPTA 3JBG7 4NPYA 1EHAA 5DD3L 2PYEA 1D5MB 4M62L 5C09E 2A1WL 4KQ4L 4U4BA 4G5ZH 5EZOH 4GUPB 1QYGL 5E6IB 2AS5M 3QUMH 3SDCD 3SDXA 4FS0A 2R8SL 5IEKB 1RZKC 1UZ8A 2JK5B 5F7NC 5HGAB 3BOVA 4FFVD 2AV7B 4PIRF 3VGDA 2BNRD 1OAKL 3W0WB 5L9DH 1JFQL 3QCUH 1IKFL 1FLRL 1BAFL 4K9EH 4QHKI 3HZVB 1KB9J 2D7NA 2BVPA 2HH0H 3BMVA 4ZFOB 3U36A 4QLRA 5J6GA 3U7WH 4GXUN 3NTCL 1DLHB 4OM0H 2FRGP 4MVBD 4LBEB 4PJDE 5C0AE 2Q8AL 3CSYB 4Y4HC 4LGSB 2FEEL 4B7LA 5JA8B 5KW9H 2HT3D 2FX8L 4PPTA 1NFIA 4FQXC 5AG9A 5DWUL 1R3LA 3RIFK 4Z76A 4X8JB 2GCYB 1RHHB 1UENA 3C5ZA 3MRPA 1I1RA 2EYSA 2XQBH 2E6JA 4LHJB 4P2QE 1T1WB 1YEKH 1MPAH 3C87A 1CLCA 3EO0A 5DVLA 1I1AA 4G9DA 3T0AA 5SX5H 4X6DF 1A5FL 2W91A 2X9WA 4PGDA 4PJGE 4QXUL 4PV8B 4K71B 3CFJA 4FOMA 1F2QA 3KPRE 4YPGB 5I73C 3RUGE 4NO0A 5INCA 4S1QL 4BQBA 5IMOA 1VEMA 5CMAA 5JHLL 3O6FD 5E8PB 3WNKA 4MWFB 5CJQL 2OSLB 4LP4A 1YQVL 2CKBA 3EFFB 4PGJA 4ZAKC 3RU8L 1MCQA 1AY1H 3H7LA 3VG0H 2AXJA 2NXYC 3ULUL 5F9DC 2VLKB 3MRBA 4QYOA 4ZUWA 5CKAA 3IF1A 5I1DB 4J3OC 1S8DA 3ARFD 5F1SA 4PP1C 3VU2A 1KJ3H 4LOUC 3ARRA 5T1LD 5B3JF 2DRUA 4LCUB 4GRLA 5TH2B 3LEXB 1XH3B 4F2MA 3QEHA 4FQQA 3SN6N 4P48A 5HGHB 2G9HB 3CVHA 5INDB 3MBEB 5FUZH 4ODUA 2W0LA 1DBJH 2JCCF 1QD0A 2YUWA 4M1GL 4BH7A 1OSPL 3IDJB 3T8XB 1OSZB 4XNQB 1FZJB 4BQ6A 1MIEL 3H9YA 3L3OB 3HS0A 2PR4L 2V7NB 2SEBA 2FEDD 1ZKAA 1RJZA 3HB3D 5I6XC 3D2UA 2GT9B 1VFBB 2AJXL 4KDWA 1CXLA 2P5WD 4OJFL 3BGMB 3LKRA 5L0QB 3NFPA 3VD9A 5I15L 3OWEA 2C3XA 4JEGB 5DR5L 2ESVA 4PJXB 2AEPL 1MFCH 1OARL 3IU4L 5E08H 1IM3B 5C0CA 3Q0HA 4ELMF 1GGUA 4X99B 2V6HA 1T7ZA 5FKPB 3MRJA 1Y6NR 3T0DA 3J8F7 4HUXA 5F7LB 4FXKA 1U8JA 3E8UH 2H32A 2YN5A 1BVKA 1KXQE 4D8PB 2COQA 4JM2F 4AZ8A 2NX5D 1G84A 2WNGA 1JWUB 2NCMA 3DECA 5ICYA 4KJQD 3PJSB 1CGXA 4HKJA 3GI8L 1PQZB 1HHGB 1N7MH 5JR1H 3OKYA 2KPNA 1PVHA 5IBLC 1A9EB 5FYLL 2V2XA 2FDBP 3ABZA 3PG2A 2E9IA 3U7YH 3MGOA 2NY1C 3V5KB 3S3JA 1P4LB 5TE6H 3VFUA 3RY5A 1XZ0B 3OG4B 3NGBB 3PWPE 4WHCA 4JFOA 4Y4HA 4DN3H 4JQIH 4PJIE 4TVSa 4KKLD 2HJLA 4FQXA 1CFTA 3MV8E 4OLUH 3ESVF 1G9NL 1MWAB 4C57C 3IJHA 2E6PA 5BMFL 5JDSA 4HQQL 3V2AR 2GJZB 2V9TA 4F7PB 4E0RB 3VXSE 4RAVB 1KYOJ 1MF2H 2HN7A 3TBYA 2JJVA 5C0ND 1CZ8H 1GAFH 1QFOA 2X4RA 5CIPH 4PRNB 3WKML 5KVGH 3P9LB 4UU9B 4M9OA 4XXCC 3QDME 5DJDA 4BSVB 3X3GH 1U8IA 4YNYA 3QUXD 1Z6JT 4LIQL 5ESVB 2VDNH 5JHDD 1BMGA 1N59B 3KYMA 4U0RC 2EKSB 2HFEB 4F7EA 1FE8L 4HAFA 3PUCA 3MYZA 2HTKD 2QV2A 1YECL 1KPRB 1MCRA 1KPUB 4OFDA 2DTML 2H6PA 2XY1A 5E00B 1WLHA 1D3CA 1IEAB 1URLA 1ZTXL 1JNHA 2QHRL 1FDLH 4U1SA 5FO7A 1TNNA 4QRRE 5EU3B 3L7FA 3TBSB 5JW4Q 3QO1A 4XCEB 4L9LC 1FH5H 1AR2A 3QHTC 1P7HL 1NKOA 4JFZL 3NA9H 1QRNE 2VDRH 3OKLA 4U1GB 3QWQB 4KK8C 4QWWD 1EEZA 3MNWA 2FB4L 2NY7L 4OLVL 4XNYH 4XP6H 5HHNB 2RFXA 3BYTA 3VXNB 4R7NA 4XNUH 4NFCA 5CINH 1MJ7L 4POUB 2XWJA 4POYA 3ROLA 4FZ8L 1A7RH 1RFDL 1QPPA 4N8CL 4ODWB 3RDTB 3RKPA 3ZDYF 4OKVA 3BPOC 3CC5B 1L4IA 3VXUD 1HK6A 1MIMH 3F5WA 5IJVA 2VISB 2WZPD 3FRUB 3QP3A 4JFED 5M95B 3TBWB 2BHZA 4JM4L 3KPQA 5KSAC 1WTLA 4KJWD 1P53A 3GSNA 4LQ1A 4LARH 3PWLA 1WCBB 2V7HB 1A1NB 4NZUL 3GSOA 3UTSB 3WUZA 2OCFD 4C4KO 5HGDB 1KIRB 1G7JB 3S35X 5I1GH 1C5BH 5BVJA 4X7EC 3EGSA 2IALA 2IQAA 1ITBB 2ZWLT 5EBMA 4KRPC 1FVDA 3HC4L 1OP3K 5IF0A 4W4NA 3GNML 1JYXA 2HRLA 1N0XL 3KYNA 5DEGA 3DLQR 3BH9A 1WFNA 3V95A 1I3RB 3B9KB 4MJIB 3TYFA 4R2GC 5D2LF 5F9WB 1BJ1H 3CJJA 4RGND 4OFVA 1OTSC 4BQCA 5D7IE 4ODHL 1T21A 3BXNA 3L5WB 4OD1H 1MAML 4JM2B 5AUMA 1VFAB 1ADQL 3MV9A 1FGNH 2FJFA 1ZXQA 1NGYA 4AENB 2XZCH 4KUZH 2MPAL 2HVKB 4MNQE 1T1ZA 1NEZA 1EUTA 2IPUG 2ITCA 5IOPA 4LHUA 1NFDA 4PR5A 5DQ9A 4ZFGH 4EJ1C 4YBHA 5KVFL 1BIIB 1KG0A 3F62A 4JY4A 2WQ8A 1T2QH 3JWNC 4HC1A 4HK3N 4JFDE 4C55A 2W9EL 1ZWIA 1K4CA 1MY7A 2ERJB 2Z8VC 4LLWA 3VMNA 2APWA 1EBPA 3BDYH 3F7YA 4G6FD 5I16A 5BO1H 1TNMA 4JFQA 5ICZA 3QQ4A 5EA0L 1P84J 1YYLH 4WCYL 2VLRD 3MNZA 4XXCA 4PUBH 1RZKL 1VPOH 5MEOB 4E9LA 4TTGA 2QR0A 3O8XC 4PJAE 4O2CA 3HE7A 5J11B 4UT7H 5E6YA 3C6SA 1WBXB 4LEXH 1M71B 2ZCKH 5FYKH 2RR3A 4DZ8B 3P4OA 4WW2C 4UILH 4DCQB 4AMKH 1T0NB 1QSFB 4M43H 2R0LL 5DSCB 4CVZB 4P5TD 1SEBB 5EUOF 5D2NB 5ADOL 1BVZA 2F5AL 2X44D 1T7WA 3M1BB 1K2DB 2DYPA 4KTDH 5GGTH 5ITFA 1KF9B 2YD7A 2BP3A 1MELA 1LEKB 3DSNA 4H0IA 1SEQL 5KVMC 2EDEA 4Y1AD 4PJ9C 1CK0H 3VA6A 4L9LA 1SM3L 3VXPB 2AEQH 2LTQC 3V6ZB 5EOCJ 2QSCL 1CGYA 3LS5H 3C5SB 4N1HB 5DHYA 5AWNL 1WBYA 4F80A 2BRRH 4HKXB 2YD8A 1OTUD 3BZDA 1CFNB 8FABA 3U4BH 2HKHH 3HC0B 4LLAA 1GGCL 4MHHG 3UYOD 3WDIA 3FN0L 4B41A 5EO0A 2A2QT 5IJKC 1CLZL 4UV7L 3U9UA 3IJYB 3TJHC 1RV6X 4IIQB 4TTDD 3PWVA 2VZ1A 1G6RH 1BP3B 3BEWB 4PJDA 2L4OA 4MD5B 2B1HL 1JF5A 5KSAA 3HUJE 2N7AA 4GMSL 2XA8L 4NQCB 3QXVA 3G04B 4KY1H 4G6MH 3D39E 4CU6A 4L9DA 1K5NB 3GJFB 3S6CA 4P2QA 3MACL 1J5OL 3KYAA 3IXTB 4TPRH 1NGWB 4U1HB 5E9DB 2C26A 1OP5H 4HPOL 2X10A 5J13C 2P4AB 3GSRA 1XGQB 3JV4B 4N0CC 4PJGA 4WI9A 4TRPL 5DJXB 4PRDA 3IDMA 1NMAH 4YHOL 2P49B 2ZG2A 3MCG1 3RUGA 2LAAA 2J6EA 3BSZH 5GJTH 5F96L 2IAMC 3SE4C 3CZFB 4H1LG 1MCWW 1YYMH 3BQUC 5EBWA 1MRCH 1MFNA 4JFFD 3PNWA 4OCLC 5EOQH 5HJ3B 1C5DB 5FCSH 3EJYD 4NKMA 4XH2A 4ZD3L 3CFBA 3LKSB 3GUTA 5CJOL 3UXFA 2A6DB 4R26L 1S5IH 1FQ9C 2WBJD 5D2LB 3T2QA 4P3WA 3BT2L 4R4BB 3S96B 4BJLA 3D18A 5DD5L 5IROC 4FQIH 4IHOB 4Z7VE 3VJ6A 1INQB 3ARBD 4KZDH 2FHFA 3IU3A 2NTFB 4J6RL 2CKNA 3L3HA 5DRZB 3VWKA 3NIGF 1NC4D 4L8BB 3ARGB 3LKOB 1ZVSA 4E42A 5T1KD 3RBGA 4LDLB 3ULVL 4QRSB 2ZOKA 1UEMA 4FTVD 3KAAA 1AGDB 1FIGH 3ARQA 4P49A 5I17A 4JFXA 4MD4A 4ZO7A 4X4YA 4DQOH 4GSDH 5JDJA 3SJVA 1MI5B 1AI1L 4OLWH 4U6YA 1ZVHA 1KLUA 1NGPL 1RUPL 5I2IB 5HHQB 4U1NB 1QLEL 4RX4A 4Y8DC 1J10A 4XPFH 5HYSA 5I76B 4Y16D 2BNQD 1X5KA 4TSCL 4FXGB 4YQXH 4AQ1B 4LNRA 1PEZA 2VDLL 3SGJC 1FFNB 2PW2A 4OZFA 1DTUA 5H94A 5BVPH 2XN9D 1P69B 4KKBD 5C2UB 2VKXA 1G7LB 5EUOB 1UVQA 1Q9LA 3FHQA 1N3NB 1D5BA 4YBLB 4U6VH 4GAJL 4I18B 4NRXB 3T4YB 2Z31C 3REWA 4OCXH 1FN4B 4YPJA 3D5OF 1DL7L 2A6JB 4G9FE 4S0SD 5IVXB 2NY2B 1PG7X 4Z9KB 3NCBB 1P6AB 2UV3A 3RA7L 2DQCL 3BRDA 1KLFA 5C08D 4EI5D 3O6ML 2WBKA 1QLFA 1CTNA 5CCKH 5IJKA 1CXIA 1QSVA 1DVFC 3HMXL 2DOCA 4FFYH 5TFSL 4N90D 1RIHL 5IB2A 1IC7L 4X6EB 3CMGA 1A7QL 1T66D 3PWPA 5E8EA 5D5MF 4LLQA 4IBLT 3EIFA 1U3HC 3CD4A 1PAMA 1D6EA 1QQDA 3MGTA 5GS0H 4OF3A 4PJIA 4YE4L 5E5MB 3DPBA 5E6ID 4WEBH 3MV8A 3P3YA 1SYVB 3C8KA 4Y2DC 3NCCB 3HI6L 4GG8A 4I77H 1K8IA 3TT1L 5C8JA 1JGDB 3VXSA 1QBLH 2FIKB 5IG7A 4R9HA 4DTGH 3VDCA 3W0WD 1W72A 3HG1A 5ALCL 5I8KH 35C8L 4NYLA 2WBWB 4KVNH 5BRZA 2QL1A 3PL6C 3QDMA 4HWZA 4P46C 3GIZL 4Y0GA 1MHHA 3DJ9A 3GI9H 4LRIC 4OTXL 3PV6B 1I7ZA 4FZEH 4YHLL 4JO3H 5BJTB 4JRYE 5D70H 1JNJA 2XNAB 4Z78B 2IAMA 4PJ5B 3SE4A 4CMHB 1KB9K 3QB7C 5FA4A 1CD1A 3SCMD 4UIKL 3BQUA 5CEYA 1JZ6A 2ZSVB 1L7IH 4OZGA 1FNHA 2CK0L 4QY8A 4URTB 1K8DB 4JJ5B 5KJRL 2D0FA 4PRPB 2PXYC 5JPNA 3VGHA 3KVQA 4X80L 1FO0L 5FA3B 1TZGL 1HIML 1KUMA 1LP9E 2G75B 4UT9H 5IROA 4JREC 2AJ3A 5MEPB 4LHQB 3VMOA 2WM0A 2GUOB 3P77A 4HDIA 2C3VA 3VRIA 3WFCH 4CL7A 4IRJD 4OQTL 4CN4A 3VMPA 1S7RA 5TQ0H 5ISZE 1S7VA 3P0VL 4V1DE 1JF6A 3QEQE 5J4MA 2DLFL 4AEHL 5EORH 1WFOA 2GK0A 1FZMB 3WFEH 4WDIA 4WU5B 1CGVA 2QQKL 4QHKJ 2VL5A 3LRSB 4LPWA 1EO5A 1U9KA 2VQ1A 3KR3L 4ZS6C 2IEPA 4MQ7B 4NKDB 5IKCA 4L5FL 1RZJL 5C0EB 4I2XE 3O0RL 1AC6A 3VI4E 4F58L 1SBBA 5A43C 5DMGD 4ZFZA 3BPCA 1GZQA 5SWZE 3U0TB 3MBED 4N68A 5DD0H 3ZKXB 3EOYG 2EH7L 5SWQB 2ICEB 5IHLB 3SGJA 1E0OB 2QQNL 1ORSB 1AGFB 5KSVA 4GRWE 4JPKL 3GHBL 5IW1A 1Z2KA 4UIMA 4HZAA 5DRNA 3FB5B 4MJ6B 4QXTA 4XWOD 4KROC 3RL1B 4GKZA 1HILB 5HD8C 2OS7A 2H45A 2YOCA 2Z31A 4O9HH 3O2WH 3ULUF 2WLYA 2I26N 3FMGH 1KXVC 2F19H 3T3MF 4X8XA 2J7LA 2FECL 2C7UB 1J11A 3N9GH 2Q8BL 5GZND 2YK1H 3HRPA 3N1PC 2C3WA 1DANT 4XVUC 3B9VA 5HI3D 4FA8A 3MV01 4FQHA 4WFHD 2FX7L 1A0QH 3VGAB 5D7IA 1FZKA 2NY0B 2R23B 3EDFA 5C0IA 1FCCA 2O93L 2V17H 5GJSL 3RVXD 1QBAA 4LLMA 1H0DA 2DWEB 3DURA 5A3IC 2J4WH 1U3HA 3FOLA 1NEZG 4NM4H 4XVTL 1UEYA 4L8CB 4LHUG 1MHEB 4HWBA 4NSKB 3STLB 4KHTL 3GMMB 4U6XB 1ITCA 4Y2DA 1H8NA 2EE9A 2BZDA 4JFDA 1TZHB 1RSFA 4WU7B 1OGTA 4Q9QH 5F1KC 1VGKB 3JTTB 4R96B 4C4KT 1KJ2B 2IC2A 2ICCA 2R9HD 3C2SA 3ES6B 4QHUB 4MLSA 3PL6A 2A77L 2DMCA 4P4KA 4QOKE 3D69B 4P46A 3ALXA 1DQLH 1LO3L 4ETQA 2HMIC 3MLWL 4PJAA 1HCVA 4LRIA 1HXYA 1BD2D 2UY6A 3BIKA 5LAXA 4JFHD 3NCJH 3PXJA 2FZ3B 3AFLA 1F00I 1AQKH 2VQUA 5CAYB 3ZLQC 1MLBA 3WN5B 5DS8B 2FJHB 3L6FB 1MH5A 5D1ZC 5D1XB 1RZFL 4EVNA 5CKGA 3IDYC 4K9EC 1F90H 3TO4B 1LDPL 3G5XB 1NJ9B 2PXYA 1HEZB 4APQC 5HYFA 4I4WA 4WVRA 5DI8B 2GHWB 3DHMA 4N0UB 4R8WH 4DFIA 1P5VA 1FYHB 3QG7H 3KDMB 1KYOK 1DQJB 1OF2B 3LV3B 4FQ2H 5IMMB 3HRZB 3I9GL 3ZYOA 4J3TA 4F3FB 1N6VA 1J18A 1RK0B 1MCNA 2VOTA 4NKIH 2YPKB 1B88A 3SE3A 1JMZA 1DCLA 4GRMB 2YD2A 3T0ED 1JPFA 5JA9A 3LSOA 3P9WB 1MWAH 3S98A 3WO4B 2VNCA 4K3HA 2ADIB 3I6GA 4J1UB 4QRPD 4BFIB 4Q58C 1IFHH 4XBPB 1C7TA 4HS8L 5JW4N 1U8KB 3DV4A 1T5XB 2GFBA 4RFEA 4YXKH 2AXFB 5C9JB 1RULL 2QQLH 1LO4H 2BY0A 3IJSB 1CI5A 1ZLVK 3WKNA 4MD0B 3HUJA 4JN2A 3O6KL 1CQYA 2VXTL 4RQQA 1I9IL 4YUEL 4UB0L 5KS9E 3D39A 3DX8B 2VXQL 4P3CL 4WV1C 3FQRA 2UUDH 1IC1A 2IH1B 3FQXA 4UBDC 3ARSA 3IFNL 5E2TH 3FB7B 5EOTB 5I1JL 3IAQA 4WI2A 2OM5A 3B3IA 4PV9B 2FHBA 3FO0H 1ZGLM 1ZANH 4NNYB 3RDTD 2VL4A 1SYSA 2VSDA 3BP6B 3RWDB 4GW5B 3HMWL 2ORBL 4L29A 1FHGA 4DZBA 4EUPG 5FGCB 4OUUA 4OCSL 5IW6A 4YH6A 3R0NA 5HGBA 3FOMB 1CBVL 4F9LC 1F4XL 4KGLA 2ZCHH 5FYKE 2J12B 1OY3B 5DFVD 1IGTA 2FX9H 2NNAA 1JZ2A 3IAGC 1FNGB 3MLPA 3EYFB 1EJ6A 3BKCH 4HPYL 3QQ3B 5IHZB 2YMXL 5JIPA 3S3PA 1QSEA 2VDML 5HYJE 1JPTH 4HK0B 3F7VA 4PJ7A 4A6YL 2P24B 4X5LA 4G7YL 5KOVC 3B9KD 4MJID 4DW2H 3U1SL 4LVOB 3QBTB 4HXBL 4GBXB 4JM2D 3FRPA 1YY9C 4LSRL 2CGRH 1XIWC 4XP1H 2YA2A 4XCNB 4RDQF 2VIRA 4ISVB 1RZGB 4H8WH 3ARYA 5IQ7H 1YEDB 3PP4H 2CXGA 5T1DL 2WK2A 3RZCB 5EU4A 4GG6A 4X9IA 3QPQC 5LVEA 3B9DA 5E8DH 2B0SH 4NDMB 5E2VL 3SKMA 3EOBB 3D85B 5D1ZA 1PD6A 1GPOL 4M7LH 3EYVB 2W60B 1PEWA 2CPCA 3NOIA 5FM4A 4Q0XH 5GZOC 1ZSDB 1MCPH 4YXLH 4Y4KB 1OT2A 4WNQA 4APQA 5DK0B 4KVCL 5HYSG 3BP5B 4AEIL 3OAZK 5BS0B 2XXCB 3SY0B 4LF3B 1XCTA 3DUSA 4RGMB 4OZFG 1NLDH 4K7FA 4G6JH 1QACA 5E0QA 4JKWA 3BVNA 4JCMA 4NFDA 4DKEL 5JW4M 2Y06H 2MCPH 2QBWA 3QNZB 3V6FA 2W1NA 3MXVL 2KQMA 4FXLA 3FO9A 2ADFL 1C7SA 1FLTX 1QSFD 3CUPB 2ADGB 2AJSL 4G9FA 2BNUB 3FB8B 3P4NB 3MBXH 2XICA 3VFWB 4PJEA 4UDTB 4OZ4B 2AV1B 3LKPA 3RTQB 1YMMB 4C56B 1T3FB 1LK2B 3U7AA 4ZUSB 1OAZL 2FWOB 1JN6A 2X4PA 4XPHL 1NBYB 1DBML 4GKSB 3MRKA 1H5BB 4ODSL 2ATKB 3AC0A 5DVMA 1JI1A 1CLOL 1BVLB 1M4KA 1KEML 1JPGB 4GQPH 4NPYB 4KRMB 4LSQH 1OAXL 1RVFL 4XC1H 1XGPA 3L95A 4WV1A 1EDQA 4OIIH 2O26U 1CR9H 2G60L 2Q7YA 4YWGH 3SDXB 3TFKD 2OL3L 1OQOA 4XCCL 3LD8C 1EERB 2B1AH 2XZZA 3LQAH 2VUOA 1FG9C 4DN4L 1S7QA 2AK4B 5FO9A 5H8DA 1YJDH 4LU5H 3O4OB 3TZVC 3U36B 2BVPB 1H3PL 5J6GB 1T0PB 5DQJB 1SY6H 3AUVA 4NN7C 4OT1H 1TETL 5HHOA 1LDSA 4NQCD 2W38A 4AG4L 1S78C 4WENB 5L2KE 2CRIA 1NFIB 1QP1A 5IFAH 2NZIA 1CXEA 5D71H 5T5FH 2V2WB 5E9DD 1E6OL 3C5ZB 1UZ6F 3MRFB 2WUCL 1HOCA 5EPMA 3Q3GB 2V5MA 5TPWH 4K94L 4OCYH 4NZRL 3EO0B 5H2BA 4H20H 4F57L 1I1AB 3I3EA 4XI5D 2J1KA 3IDIA 5ISZA 3NN8A 3OR6A 4V1DA 4PGDB 1A6UL 4DGVL 1XIWA 3QFJD 3WXWH 3QEQA 3CFJB 1J0JA 2R4SL 4NO0B 1UQSB 4S1RH 5HGGS 4H1LB 3UTZA 5CMAB 4MXQC 1F3DJ 1IQDA 3V7AE 5AD0B 3WCYA 1N64H 4YC2B 1QO3A 5I30L 2CIIB 1BFOA 5AAWA 2E5EA 4I2XA 5EC1A 3MRBB 4G7VH 4QYOB 4ZUWB 3IF1B 5TE7L 3GJFH 4OFYD 3WFZA 1BZ7B 1KTRL 1U6AL 5SWZA 4Z7UE 5DHVB 5TF1H 3ARGD 1OAYL 1OGAE 1R24A 1W0VA 1QVOB 1XF1A 2H26A 4XHQA 3X14A 4F2MB 3QEHB 4FQQB 5HDQL 2B4CL 2IMNA 5IB1B 3DSFL 1HZHH 3CVHB 4K07A 1KN4L 3I50L 3RWCA 4PJCE 3B2UD 1I8MA 1EJOL 1XF2B 4M7ZC 5CD3A 3WJJC 1MI5D 1Z9OA 2OXGA 3LDBC 2WV3A 4G5ZL 5EZOL 4M1DH 2SEBB 3QUML 1CVRA 2QLVB 1RJZB 3CXHJ 4U2YA 3MA7B 4Q2ZA 2AQ1A 1FVCB 4G8GE 4M5ZH 4D9RE 3LKRB 4XBEH 3NFPB 1NSNH 5L9DL 5DJ6A 3QCUL 3BGAA 2ESVB 3LVEA 3ULVF 4R4ND 4XCYA 2HH0L 5CHNA 3IETA 3U7WL 3NIFE 3WJLC 1BBDH 4HUXB 2EDJA 1G7QB 1WBZA 1LO5A 1IGCH 3QDGB 4FXKB 5HSFA 2H32B 1U93A 3DETC 2GW5A 1BVKB 3OXSA 5I66A 2NY2D 5KW9L 3G08A 3TO2A 1WWWX 3H9SD 2YBRB 4O2EA 4X7TA 5ICYB 4Z8FH 4IMKA 3QDJB 4X9GA 3FFCB 2XQBL 3FZUD 2DLIA 1YEKL 1MPAL 2VXUH 3BPNB 2V2XB 3MRGA 2XZQH 5ID0A 2UWEF 1UJ3C 3DYPA 3TZVA 3MGOB 4I48A 4N8VA 3VD4A 2EDTA 4M48H 4Z77A 1JBJA 3E3QE 4U1KA 3NBNA 5CZXC 5HPOA 1T0MA 3WYRA 4JFOB 4PTUB 4XP4H 4Y4HB 4Y5YC 5F1OB 1V8HA 1I4FA 2HJLB 4FG6C 3K46A 4FQXB 4G8FA 4HCRA 1LK3H 4B0MM 5JDSB 2VLME 2FHCA 1YEIH 1Y6KR 1AY1L 3VG0L 3FQWA 2HN7B 1LNUB 2X05A 2EDDA 4ZSOA 2X4RB 2YZ1A 1KJ3L 5GS1C 3KLSA 2EXYC 3IVKB 4LVNC 3K8LA 3QA3A 4PJ5D 4U49A 2DQGH 3TGXA 4BH8A 4IM8A 1NAMA 1U8IB 4Z7WF 5I73B 4M3JA 3ZKMC 3FT3B 5FUZL 3KYMB 3QIUC 1DBJL 2ADJA 3PWJB 5J56B 4PRPD 3LKNA 3U48A 4ZAKB 2NY6C 2A9MH 3FO1A 2H6PB 3IFPA 2Q76A 2NXYB 3AB0C 3TH3T 2XFXB 2Y25A 3K0WA 5JIHA 4G80B 3WO3B 2PYFA 1JNHB 1HXMA 3C9NA 1RUQH 4ORZC 4U1SB 2MCG1 4HLZG 5FO7B 3EBAA 1T1YA 1MHCA 4OV5B 1Z5LA 4OFKA 3L7FB 3SDYH 3HZMA 1F45A 3QO1B 2ZUVA 1MFCL 1F11A 2X42A 5KS9A 4MJ5A 4LPUA 3HZYB 4POZC 1EEZB 2DQTH 3ZTJH 3MNWB 1KPVB 4Z6AT 3E8UL 3WJJA 1HWGB 2RFXB 1I3UA 2EZ0C 4X83A 4R7NB 2D4DA 4HKBA 4GOSA 4JRXD 1GH7A 3M17B 2XWJB 3ROLB 3RWJA 4X98A 5GRUH 3LPFA 4JFYA 5I6XB 3FQNA 1WT5C 2EDRA 3QEGH 1N7ML 3L3KA 5JR1L 3G6DH 1KCKA 4OKVB 1EGJH 5CP7A 4YFDB 3F5WB 4CNIB 4IJ3C 3C2AH 3U7YL 3H9HA 3GMOA 3T1FB 3G9VA 1LE9B 5GSVA 1HQRA 3KPQB 5EU5B 5FDYA 3GSNB 5TE6L 3WJLA 3PWLB 1WZ1H 3FT2A 4HFUH 4PG9A 3PABA 5HYJA 2GSIA 3GSOB 4ZUVB 4UMGA 2KZ1B 4DN3L 1M1SA 4HH8A 4JQIL 4OLUL 5BVJB 3EGSB 4DK3A 2IQAB 5EBMB 5I0DA 4HEME 1FVDB 5IF0B 3S9DB 1WK0A 2H41A 5LWYH 4HW6A 1QLRB 3OKKA 1MF2L 5DEGB 3BH9B 2IJ0C 2MOVA 3FRPG 1CZ8L 1CGSH 1GAFL 4HGWA 4Z18A 1G9EA 3TYFB 5FFLA 1YN7A 4NRZA 1UJ3A 1BECA 5KVGL 2EO1A 5DVOA 4HV8A 3BXNB 5AUMB 1J9CT 1GGYA 3MRDA 2L0DA 2FJFB 3X3GL 1NGYB 4PB9H 5EDXA 4RA3A 5F7EH 1NEZB 4P2CG 4Y5YA 3SDAB 2VDNL 1YN6A 1KB5A 2ITCB 3MREA 4LHUB 5CEZD 1MAJA 5IOPB 1NFDB 4PR5B 4BQ8A 5DQ9B 1GC1H 4JY4B 4P3DB 3HI1A 3MA9H 2E8YA 1ZWIB 1K4CB 1KV3A 1OHQA 1T4KA 2CUIA 2EDBA 2LE9A 4MCYA 3SKUD 4LLWB 5CBEB 2Z8WC 5GS0C 3WNMA 2DTSA 1HHHA 5I16B 4WW2F 4XNZC 4JFQB 5ICZB 1FDLL 5GS1A 4KI5F 4TSAH 4NJ9H 2Q6WA 3IXAA 5GRYA 4NO2A 4OI7A 4PJBF 3DX6B 5D1XD 1GGIH 1Y0LA 2F54D 5DJZA 1FH5L 1XF4A 3RVWC 5BV7C 1FYTE 1ED3A 4OF8A 3GDBA 3OF6A 4X6BB 3NA9L 2VDRL 3TO4D 3X13B 3QIUA 4U0RB 3MYJA 4XNYL 4XP6L 2AXGA 4MZ2A 2J8UF 1BZ9A 4ODTH 4XNUL 5CINL 3U9PH 3AY4C 4N8PA 5DD6B 5CD5D 1R3HB 5F7HA 3IRZA 5F7UA 5M94B 2D03H 1A7RL 1P7QB 1PKOA 1PLGH 2BSTA 2DYPB 5ITFB 3LY6A 3MRIA 5IHBA 1I8IA 5IV2A 3HLAA 1C08A 1MIML 4L9LB 5C09B 4BKLB 3ZE0E 3DO7A 4LCYA 2ZUSA 2R69H 3AS2A 4NWUH 2D31A 1QBMH 1WQVT 4LARL 4HUVB 5DHYB 1RJYB 1WBYB 1MFAH 4RA0C 2DD8H 5JO5A 5F7WC 4KV5E 4L4VE 8FABB 2CSPA 1H8SA 2KKQA 5F21B 5I1GL 1C5BL 1Q9KA 5EO0B 3GMPA 4OI8A 3QIBC 1Q1JH 1WT5A 32C2B 3U9UB 3VI3E 2WLZA 5HY9A 3PWVB 3BPOB 3E3QC 2EDWA 2Y07H 4PJDB 5C0AB 5CEXA 2ZCLH 5KAQF 3U0WH 1N5AA 2EYRA 1YEGH 1CDCA 1FO0B 5L2KA 2YZ8A 5KSAB 4OD1L 1HCFX 1UH2A 1FGNL 3IDNA 4KC3B 1CTOA 2CIKA 4KK5C 2IFFH 2XZCL 4KUZL 3QIWC 2BOBA 5CWSA 4CMMA 1X5JA 5IR1A 1WAAE 2P8LA 5HI4C 4P2QB 5FB8A 1AP2A 4QHMA 4P2RD 5DRXA 3ECBA 1RAMA 5C0RH 2JJSC 4ZFGL 3WHE0 4KRPB 4XHJD 1T2QL 4PJHE 3O3AA 4KDTC 3SPVA 1E27A 4PFEA 3CDCA 3GSRB 1KGCE 4K3EH 4PJGB 2BRQA 3ULUD 3BDYL 3IDMB 4PRDB 5BO1L 1LEGA 3KPRB 4R2GB 2DKUA 4EUPB 4CADB 3RUGB 3MRHA 3NZ8A 5MENE 1EFQA 1YYLL 5MI0C 1R5WB 3AVEA 3W5MA 4RNRA 2VMFA 4PUBL 1VPOL 3PNWB 4PLJC 5C07D 3D3VE 4NKMB 4XH2B 4UT7L 4D0CA 3MV7E 4N5ED 3P4MA 1AR1D 4ZYKA 4LEXL 1L0QA 2ZCKL 5FYKL 2W9LA 4HD9A 4UILL 4AMKL 1LHZA 4JO1H 4WO4C 1ORQB 4M43L 4Z7UA 3D18B 5HYEA 2BXYA 1FFRA 3OR7A 1OGAA 3VJ6B 4RMVA 4YHYC 4BA8A 4S2SB 2X89A 4Z7QE 3IU3B 4FQJH 1IM9A 3R06A 2Y72A 2W0FA 4HS6A 1FNFA 3RZCD 4PJCA 1ZVSB 3OGCA 4G6AD 4HBQA 4KTDL 5GGTL 4E42B 3VFRB 2LAGB 2ZOKB 3O8XB 3D85D 1CK0L 1DSFL 4IDLA 5I74C 2AEQL 3NH7H 2Y4SA 1LWRA 2FBOJ 3DXAD 3FQTA 3LS5L 5KVDH 5I17B 4MD4B 4X4YB 4R90H 1AJ7H 4Y4KD 2BRRL 4WW2B 3I02A 3QULB 4JQVC 4P5MA 3U4BL 2YUZA 2HKHL 1KLUB 5L8KB 1JZ8A 4G8GA 1OQXA 3AY4A 3HPJA 5HYSB 2D7MA 2H1PH 3RPIA 1FAKT 5GISH 4XPGH 3G5VA 4TQEH 3EO9H 3MNVA 2PN5A 4LNRB 4HMEA 3RX8A 4D9LH 4PLKC 5IM7A 5H94B 3G6JF 4OZFB 1G6RL 1HI6B 2YC1A 4PJ9B 5FYLD 1E6JH 3LN4A 2LTQB 2J8UA 1UVQB 1Q9LB 5KOMC 2R0KH 1U92A 4PRHE 3REWB 5C0BE 1INDH 3RTQD 1YMMD 4C56D 4KY1L 4G6ML 3HC3H 2DI8A 4JY6B 2KBGA 3D9AH 1EHNA 3ZDZE 1QLFB 1FAIH 2VLLA 2JELH 4I3GA 4PRBB 4TPRL 2QADD 5I9QC 5CBAA 1IAOA 2I9LB 4ZPTA 4N8VG 5IB2B 2I24N 3FTGB 1NMAL 3PWPB 3A6BL 3E6HB 3EDEA 3VXME 1X6LA 4LLQB 2EXWD 1F3JA 3BSZL 4ZXBA 4KAQH 3MGTB 4PJIB 2XWTA 3MV8B 1YYML 1MRCL 3CFIC 5EOQL 1L9MA 3C8KB 3QIWA 3I75A 4AM0A 4GG8B 1U58A 1K8IB 5C8JB 2LVCA 2I07A 5IG7B 2I60H 5IB5B 3MRLA 2AK4D 1S5IL 3MRRA 5IT2H 2PW1A 2JJSA 5HI5D 3JUZA 4R0LB 4NYLB 5DJCB 3JTSA 4FQIL 1ES0A 4M03A 1ACZA 5I71C 3TVMC 5J13B 1H3XA 3QDMB 4HWZB 3V0VB 4KZDL 4JDVA 5L7XH 2IAMB 5DMIH 2D9QB 3PXHA 5FOBA 1VKXB 5FA4B 3V6OE 1JNNH 3BQUB 5CEYB 1A21A 3D1MC 1QFWH 3C5ZD 2P8MA 1FIGL 5FUCE 4AK1A 3DVGA 2C9AA 3NA4A 3P0YH 3VD3A 4DQOL 1JWMA 4GSDL 1ZLWK 5JPNB 3KLHC 4WO4A 5EFIB 1I1AD 1ZGLP 4OLWL 4KHXH 1T22B 2P48B 2AJ3B 3KXFE 3DVFA 4QRRB 3WFBH 4HDIB 4NN6C 3P77B 5TQ2H 2C3VB 5J9PB 3BEVA 3BN3B 1RZIA 1TQCC 4XPFL 3MUGA 3PGDA 1S7RB 1R3IH 1UM4H 5LXGH 4YQXL 1S7VB 1ZA6A 1QRNB 1QFPA 2AP2A 2A74A 2PTTA 1FC2D 5BVPL 2BVTA 1YEEH 3TESA 4YHMH 2BVUA 3EHBD 4RBPK 1KTDA 5I1AB 4HWEH 2VL5B 3WV0A 2D9CA 4EDWH 1KNOA 2VQ1B 4U6VL 4X6CE 1XR8A 4RZCB 2J3SA 2R1WA 5J1AA 1TPXC 4OCXL 2P7TA 2BSED 5IKCB 5EBLA 4JQVA 5JOEA 4KTEH 3RVTD 4H8WC 4MNGA 2X4QB 5JUEH 4ZFZB 3BPCB 1GZQB 5CCKL 1WITA 2OXHA 4K8RD 3QJFB 4FFYL 1TDQA 2C4XA 2A0LD 4ELKA 1I7RA 1MRDH 3N06B 4BZYA 4UIMB 5DRNB 1OP3H 5GS0L 3UTPD 4WY7H 4WEBL 4CVWA 4YDLC 2OR9H 4LLVA 2CKBH 3WFHA 3L3GA 4QRUA 4X6FA 4I77L 3MC0A 2AW2A 4U6HA 1BFSA 1QBLL 1G7HA 4DTGL 4ZO6A 5B21A 5D9SA 3O45B 2XPGA 2ESVD 5I8KL 3CPLA 1A02N 2FO1A 4KVNL 4FQHB 2ATPA 3IFOA 4C59B 1RUMH 5D7IB 1FZKB 1DVFB 4MLIA 5C0IB 4Z7VF 5I18H 3O3UN 4O00A 2JIXA 3KYKH 1D5ZA 3DX9B 3D25A 3QDGD 5FK9A 1LE5A 4LLMB 4TSBH 3GI9L 5CILH 3DVIA 4MNQB 5GRJH 3DURB 4FZEL 5BCAA 1YEFH 4S1DC 4JO3L 3CVHH 1U3HB 3FOLB 5D70L 5I75C 2VE6A 3WE6A 4K8RH 1MJ8H 1EVUA 3M8OH 4X9FA 5CSZA 5ALBH 2B5IC 3QDJD 1TTUA 4Y2DB 3FFCD 1DBKH 1NUNB 1NAKH 4JFDB 1CDBA 4IOIB 1X7QA 4NM8H 1OGTB 4XX1E 1RZ7H 3I6LD 5BZDA 5IMLA 4F15C 4Y5XB 4UT9L 2VXSH 1NCUA 3TVMA 3UTTD 3CX5J 3PL6B 3NFNA 3WFCL 4P23A 4XC3H 1T6VN 4NOFA 4PJAB 4FQ1H 3BIKB 5TQ0L 2KZWA 2GAZA 1FYTA 1KJMA 1M7IA 4JZOA 4FQXD 4ZFOL 1MH5B 4YDIH 5EORL 1IQWH 4EVNB 2H32H 3WFEL 1YJDC 1S9VA 1U3JA 4IOFC 1IGMH 1J87A 1MCIA 4HBCH 4YK4C 2PXYB 2GYSA 2QKIA 1G7MA 3QXAA 1WWCA 1FPTH 3I3BA 2HJFB 4HFWB 1T80A 4JREB 3RAJH 1T5WA 3T2NH 4I0KA 1JP5A 1N8ZA 2NW2A 4M9PA 5DD0L 4EDXB 2OL3B 2IQ9H 1E4KA 3QUYC 2UZIH 1JYVA 4I5BA 4ZAKD 4L4VA 4X7SH 4XAKD 3UBXI 3KYOA 4N0YH 1A6AA 4NUJB 3SDCC 1JPFB 3UBXA 4O9HL 3O2WL 3FMGL 2R56H 2F19L 4PP1D 5GIRA 1L9NA 3I6GB 1KEGH 3N9GL 4IS6A 2YK1L 5GRXG 4JVWA 3ARPA 3QR2A 4HKZA 3DV4B 2NY3B 2GFBB 4RFEB 5C3TA 1A0QL 3DMMC 4YIQA 4K3GA 5I0ZA 1FZOA 1S7XA 3HUJB 4MVBC 3VXUE 1YNTB 2LABA 2V17L 4RQQB 4QXGH 4OZIF 4PP2A 2H2SD 4MDIA 3D39B 2J4WL 1WAAA 4LRNH 3O9WC 3FN9A 3OJDA 4NM4L 4KROB 2F74B 3FQRB 3FQXB 4X7DC 2YWYA 4PJ8C 3CSGA 3WBDA 3B3IB 2VDOH 4PJHA 2OTWA 5JMOC 4J4PC 3OXRA 5CP3A 3KPPA 1SYSB 4Q9QL 4D0DB 1WZKA 2HRPH 4DZBB 2VO5A 4ZTPH 5IFJA 4I1NB 1LP9F 1BJ1J 1UH3A 4PB0H 4OUUB 3W9EB 5IW6B 4JDZA 3IB4A 3G5ZB 2HLFC 3V6OC 4KJYA 3RWFA 3WD5L 1X5AA 1DQLL 3V7AG 1IGTB 5EU7E 4ERSH 2V2TA 3D3VA 1FV1B 3MV7A 5FUCC 4PJFE 3DARA 3NCJL 3V0AC 3PDDA 1AQKL 2D7OA 8CGTA 2XQYG 4Z7OF 4ODXB 3ULVD 1A4JA 1C16B 1WICA 1F90L 1HE7A 4Z7VB 3PQYE 2OZ4A 5IBLD 3ZL4H 3ARFC 4OBSA 3T77A 3T09A 2Y6SC 2Y7QB 1UWEH 2FH6A 4UOW1 2XOTA 1SMAA 1FG2A 4R8WL 3VI4F 3QG7L 2VIRB 1CT8A 3QUMB 4FQ2L 1IVLA 3SDAD 2VLRE 2CDFA 1BOGA 5D1QD 3VD5A 1ACYH 4NKIL 3GSNH 3SKMB 5D1ZB 2EDKA 2D7QA 5ESAA 3IDYB 4F33A 3EZJB 4ZS7H 3SHSA 1AIFA 1CFSA 1ZS8A 3HB3C 1JGEB 5CS7A 3DIFA 4NC1E 4NHCH 2IH3A 1MWAL 4WNQB 4APQB 3BRFA 1QZ1A 5K9KB 1NLBH 1YNLH 4OCWH 4UNVA 1C5CH 1IFHL 3VGFA 3GSXA 5KVEH 4PBVC 1DBAH 4W6WB 4JANA 3K3QA 1U0QA 4K7FB 4WWID 4YXKL 1LO4L 3T1WA 3V6FB 3DUUB 1EPFA 3QUYA 4PRHA 5F9JB 3EAKA 3FO9B 5DO2C 5C0BA 1E4WH 1JUFA 3ROOA 4NJAH 3W82A 2Y36H 3SDCA 1JHTB 4F8TA 4KJQC 5E2TL 3VXQB 3T0VA 1P7QD 3LKPB 1BQSA 3FO0L 5H35A 2DYPD 1ZANL 5DT1H 4M7KH 1K3IA 4HC1H 4YJZL 1JN6B 4TVPD 3S7GA 2X4PB 1KENH 2QSVA 3K2UH 3MRKB 3MCLH 1QKZH 3GSUA 3VXMA 5C09D 3KWWA 4P0DA 3DMMA 3OX8B 4KK8D 5F72S 3BO8B 1ONQA 3BKYH 5IIEA 2ZCHL 4QT5A 1P6FA 2FX9L 1RURH 2V5RA 5D7KD 4G8IA 4W6YB 1XGPB 2ARJQ 3L95B 3O9WA 4WV1B 3CFEA 2MKWA 3G5YA 3BKCL 1WWAX 2FIRT 2Q7YB 1V3MA 1MCWM 2YPVH 4CU8A 4HX1A 3U6RA 1JPTL 3BP4B 3NAAH 4Y19E 3UDWC 4J4PA 1J0KA 4DUXA 1S7QB 4OB5H 3WFDH 4DW2L 5C0AD 3F7RA 5EN2A 2C1PA 4JRYB 4AJ0A 5KSAD 3PWUB 1S7UA 5EZJA 2CGRL 4XP1L 3V6OA 4MJ2A 2FR4A 1P1ZA 3K2MC 2R15A 3QUXC 4BFEA 3VFVA 4H8WL 5IQ7L 1JHLH 3PP4L 2D0GA 4P2QD 4Y4FD 1J05B 3ARED 5E8DL 3TCLA 2B0SL 2HTKC 4JFFE 4KRPD 3VH8A 4M7LL 1LP9B 1HOCB 1QR1B 2WWKO 4Q0XL 3SE8H 3T2PA 5EPMB 1JK8A 1MCPL 4YXLL 4OZHF 1YY8A 3ARFA 4QO1A 3KPRD 4R2GD 1JTTA 5H2BB 2QSQA 2BDNH 2YRZA 5FHBH 1OTSD 3IKKA 5T1LA 3IDIB 1MUJA 5ISZB 3NN8B 3OR6B 4V1DB 1QFWM 1HINH 3DI3B 1XIWB 4WHYG 3QEQB 1K4DA 1NLDL 3EKCA 3ZKNC 4G6JL 3REVA 4HHAA 4JHAH 3UTZB 3ELAT 2Y06L 2WIIA 4YDVB 3L3JA 1W8OA 4FTVE 2D0HA 1B2WH 3RVVD 4I2XB 5EC1B 3MBXL 5E4EC 4ZFFA 4QKXB 5SWZB 5DYOA 3TBTA 2OMBA 1KTLA 1W0WA 4ZDHA 1DFBH 1HKLH 1A6VH 4EN3C 1R24B 4OBRA 1W0VB 2H26B 2NPLX 2VB5A 3O8XD 2YD4A 4GRWB 5DJYA 4NO3A 4LLDA 3RWCB 1Y18A 1KIPA 2GJ6D 1I8MB 1XF5A 4KJWC 4NZDA 2E6QA 3MRQA 4LK4A 5K59E 2J6EH 5KSBE 4OUOA 4HEPG 4RGOH 5TGBA 1AKJB 2EO9A 5HPMB 5L8LB 4HH9A 3RWEA 5DA4A 4KI5D 4LSQL 2ICWA 4XC1L 1MFBH 2W9DH 1ZHLA 1DN0A 2NX5A 5I1CH 3FAXA 2E8ZA 4OIIL 5CGYC 5ECJE 1CR9L 4YWGL 3RWGA 4Q9CA 3C09C 2BK8A 2YR3A 3FHAA 3F65A 4Q2ZB 2A73A 4X5WA 3S3SA 3TBVA 2B1AL 4U7MA 3LQAL 5C08E 2K1MA 5SWSE 1I7TB 3VXTB 3SGDH 1A6PA 4PJ9D 1YJDL 4LU5L 4P9HC 5EU7C 4XCYB 1Z3GH 4DKFH 3IETB 2ZUYA 2DIBA 3MXWH 2PYEE 1SY6L 4N90E 2CLVA 4OT1L 3VXRE 1EK3A 1QHPA 1U93B 4KKCC 2E7CA 3OXSB 1ZHBA 4P57B 3ALWA 3G08B 2HTLC 5FECB 1IKNC 5IFAL 5D71L 2FL5A 4O2EB 3O3BA 3STZA 3RRQA 5IESH 3KPOA 5T5FL 3U46B 5ADPH 4P2OB 3WIFA 1TCRA 3LD8B 4KK6C 4WGVB 1YPZE 5TPWL 5D6CA 2A6KA 4OCYL 1U2CA 4QOKB 1A1MA 3NCMA 3M07A 5LQBH 5DFWH 3MRGB 3PWPD 5ID0B 1NCBH 1GIGH 3R4DA 1E28A 4H20L 3TZVB 3QHZH 1KLGA 2AGJH 4I48B 5ENWA 1S7TB 4N8VB 2DQEH 4Z77B 5F7DB 3MV8D 1T03H 2GSGA 3WXWL 3RI5F 3BWAA 3OG6B 3QUXA 2JJUA 4R6UA 3HZKA 4OZFH 2AEWA 4R7DA 2DJUA 4S1RL 1M7DA 2EYTA 5IFHH 1UH4A 1XEDA 1I4FB 4G8FB 1LO0H 4NC1C 4A2MA 3S8WA 1N64L 1B6UA 4P5TC 4FABH 3FQWB 2LFGA 4G7VL 4N0CD 2UY7A 1CD0A 5E95B 2C5DC 3I3DA 3UROR 2X9YA 2P5ED 2VKWA 5TF1L 2R0WH 3RNQA 3QA3B 1OWRM 4LVHC 3BQUD 4BH8B 5FF6B 4OD2A 1NAMB 4UZGA 5SX5K 1HZHL 2EICA 1A6ZA 3RKDC 5F71A 4RISH 3PP3H 2X1WL 4OFPA 4NQVB 3QPXH 2ADJB 4WTZA 5F88A 2YA0A 3UBXG 5FM5O 3FO1B 1MCCA 3IFPB 5HDBE 3K80A 4KKNA 5ACMA 4QRRD 4M1DL 1IILE 5HBBA 1RK1B 3S36X 3BX7C 5CFHA 1BQLH 1HXMB 3C9NB 5E8NA 1W72H 2JE8A 3MJ7A 2CH8A 3H7BA 4M5ZL 4EN3A 1QRND 2VR5A 4XBEL 1Z5LB 1G7PA 4YHIA 3HZMB 1KOAA 1NSNL 2BHYA 2GJJA 3LH2H 3VXUA 4RAUA 3T08A 1CFVH 1BF8A 1F11B 1EUUA 5KS9B 4MJ5B 1BBDL 3DROA 3CFKA 4M7ZB 4NO5A 1IGCL 2A83A 3K4DA 4HKBB 3LDBB 3MLVH 4UNTA 4K7PY 1KIUA 2EH8H 3X11A 3RWJB 4X98B 7CGTA 1JPSH 4Q6IC 4Y2OA 5FYJU 4JFYB 4Z8FL 4M1CC 3FQNB 4ZPVA 3V4VH 3L3KB 1TFHA 1JWSB 2VXUL 3MODH 2R2EA 5C0CE 3CDGA 4NGHH 5CP7B 1CDJA 2XV6B 2XZQL 3H9HB 3GMOB 1UM6H 5J1TC 1B0RA 1HQRB 2ZNXA 4PJFA 4M48L 4CU7A 2XY2A 5C7XH 3FT2B 3L5XH 3EUUA 3PABB 4PG9B 5HYJB 2XWBA 2GSIB 4XP4L 1U95A 5GGSA 2RQ8A 4YZFF 5HVHC 3IS1X 2ZOLA 1FL6A 3MR9B 3PQYA 3WL9B 1LK3L 4D94A 1K6QH 1U8MA 2O5XH 1YEIL 3NFSH 3TEUA 3BDBA 1IGIH 5FKAB 1DVFD 2W65A 4NIKB 3OKKB 3ZYJA 3ARBC 4HGWB 1QHOA 4CJ0A 5E1HB 4KFZC 4XXDA 4MNQD 1UJ3B 3WS6C 4HV8B 5GRWA 2VLRA 2DQGL 5C6PB 3LIZH 3HI5H 2VABA 3LEYH 1BD2E 4Y2DD 4M00A 4XP5H 2R4RH 4Y5YB 4JFDD 3L5JA 4JFHE 1KB5B 5J8OA 3C8HA 1JTPA 2PNDA 3QI9D 2A9ML 4P5TA 3EJZD 1N5YH 1AO7E 1T4KB 4MCYB 3DVNA 3CMOH 1JVKA 3PL6D 1RUKH 2EDOA 1HHHB 1RUQL 5GS1B 2FD6H 1MCDA 2Q6WB 3VW3H 4LVNB 4ODBD 4NO2B 4ONOA 2EIBA 1G0XA 2BOCA 3O2DA 3SDYL 1UGNA 1VFMA 5SV3A 1X6NA 3CX5K 1XF4B 4ZG1A 2Z4QA 1ED3B 3QIUB 1EA9C 4JO2H 2DQTL 1JE6A 2PXYD 4BELD 1QA9A 4HWBH 4X6DE 2NY6B 3N1MC 4GAGH 2DL9A 1BZ9B 3HHRB 1QNZH 1EHLH 2IBZY 3QG6A 3T0EE 4QF1A 1WIOA 2ITDA 2CLZA 3AB0B 3FL7A 3INUH 5GRUL 4JR9H 1R0AH 4HIIB 3OAYH 2ZUWA 4HUNB 3QEGL 4H26A 4QRPE 4GS7C 1I8IB 1RU9H 3G6DL 5IV2B 2AI0H 3HLAB 1E4JA 1EGJL 4GKNB 3WLWC 5AYQA 3C2AL 4PY7A 3DO7B 1CE1H 3KPNB 4LCYB 4NCDA 3TNNB 5DVNA 1UB5A 1WZ1L 3MROA 5MHSE 1UWXK 4CBPA 4HFUL 3EYSH 1EEYB 5JO5B 5ID1A 2YPLB 3HCVB 1D7FA 3O11A 4YDKH 2GEEA 1G7IA 25C8H 4ZOCA 1HHJA 1BJ8A 4Q6IA 4YX2H 1U8PA 2NY3D 4I0CC 2CRZA 5LWYL 2JCCE 3QHFH 1TITA 4TNVF 5HY9B 1PJ9A 5B38G 1ZT4A 2DDQH 3VXOA 1CGSL 1EZVX 5JOFB 1RMFL 4IJ3B 4HG4J 2EYRB 5IB3A 5DRWA 4HULB 3D39D 5IEHA 3Q48A 4M6MH 5E5UB 5L2KB 5HD8D 3D48R 3SCMC 3IDNB 4CW1A 4XVJL 2CIKB 4JFFA 4PB9L 4W81A 2BOBB 5CWSB 4CMMB 5F7EL 4WW1B 4NCC2 4YFLI 4TUOA 3VH8G 3UC0H 1EIBA 3S37H 1AP2B 12E8H 4QHMB 5DRXB 2WBJA 3ECBB 4XVUD 3JWDC 1GC1L 4QEGA 2EC9T 4ELME 1XR9A 3O3AB 4PLOB 3U82B 3MA9L 3SOBH 1AE6H 3JXAA 4KUCD 3ARBA 2HJKA 4IRJC 2E7MA 1LEGB 4UOW0 5F3BA 4LKCA 4PBXA 1UT9A 1NC4A 3MV9E 4TSAL 4HLZH 4NJ9L 4Y89A 3MRHB 3STBA 3KPLA 3VG9C 5A3ID 3WS6A 1MVFA 2DJ4A 2X1PA 5T1KA 2X4OA 5CSGA 3NACH 3EOTH 4FTVA 1GGIL 4D0CB 2AJYH 4PGEA 1ZLSH 3P4MB 4ZYKB 2VDPH 3UPAA 4KTYA 4Z7NF 4Z7UB 3G6AA 3PDGA 4GRLC 4L8DA 2R2HA 4ODTL 3U9PL 1OGAB 2ZSWA 3PF2A 4X5XA 3L7EB 3QNYA 5FM5M 1MCLA 2HMID 1IM9B 4XNZB 4Y16A 2BNQA 2D03L 3R06B 2W0FB 1PLGL 4NHUA 2WWKT 3QEUA 4HS6B 5J0BA 5DK3A 5KSBA 5TDNA 3CXDH 1YMHA 5D1ZD 2XRAH 1F5WA 3LZFH 1CICB 5BV7B 5HYQB 2R29H 1AGCA 2R69L 5KSUA 1FGVH 4NWUL 4NZJA 3TPKA 1QBML 5GS2H 1MFAL 2DD8L 3I02B 2ZUXA 4APQD 4P5MB 2NR6D 3U30C 5L0QC 2F58H 1Y6MR 3IAPA 4G8GB 2OI9B 3IDGA 4QRTB 5C08A 1Q9WB 1QFWI 3HPJB 1HWHB 3RPIB 1Q1JL 3DYMA 4L4TE 3G5VB 2IBBA 3MNVB 4L1HA 5C70A 3FONA 3V5HA 3QXTA 4FN0A 3C8DA 4OV6F 5IM7B 5KG9A 4LLUB 5CSBA 3HPLB 5L88H 1JYWA 5JZ7D 3VXRA 4DOHB 2YC1B 3QFDA 4L3CA 1VADA 3RX7A 2Y07L 3U0WL 2ZCLL 3V4UH 3LN4B 1F4WH 2X4TB 2X9XA 1YEGL 3RIAF 4MHHI 1YUHA 1IBGH 4XT1C 5K9JH 1MRFH 1WZMA 1NC2B 5T1MB 4L3ED 3IDXH 3MUJA 1U92B 2FATL 2HVJA 3GIVA 2F8XC 2IFFL 4XX1G 1J1OH 2JK5A 4AH2A 3FO2A 1R3JA 4OLZH 3O4LE 1YPZA 5B8CC 2PKDA 5C0RL 2VLLB 1BLNA 5DMKB 3QIBB 1AGEB 3ZTJG 5CBAB 5GGRA 1DLHA 1IAOB 4JQXC 4Q7DA 2DQFB 4ZPTB 4K3EL 3RJQB 4MA3A 1F3JB 2P8PA 2MKLC 1J8KA 1HNGA 3SCMA 2XWTB 3OKOB 4LVEA 3I84A 3RI5K 1ZE3C 3QIWB 4RMTA 3I75B 4AM0B 2QTEA 1U58B 1QRKA 2XXMB 4GJTB 3VDBA 2I07B 3T65A 1TJGH 3MRRB 4TNWF 2PW1B 2A6IA 2ZUUA 4JO1L 3UMTA 1ES0B 4JRYD 5C9KA 1L0XA 4IRJA 4YPGA 4FQJL 5HHXH 1OP5K 1NFKA 4JDVB 5E8PA 4MWFA 5MI0B 3QFJE 2VH5H 2FGZA 3EFFA 1ZHKA 4GFTB 1SJEA 3FKUS 2P8MB 1UACH 2X6MA 3NH7L 1BFVH 3DVGB 5KVDL 3ZE0F 3T0EC 1IL1B 4OCRH 1RZ8A 2EECA 3DX7B 4R90L 1AJ7L 2XKNB 1ZHNA 1FCGA 3U0PA 1NMCC 5ISZD 1MJJA 5ABDE 4OGYH 1YY9D 3I2CH 3LEXA 1XIWD 4YHYB 3S34H 3QEQD 3BEVB 5HGHA 4GMTH 2G9HA 1RZIB 3MBEA 3RNKA 2H1PL 3LB6C 3IKCA 3PGDB 5GISL 5F1NA 4XPGL 4TQEL 1I8KB 3EO9L 4H0HB 4M8VA 3QPQD 1S9XA 2A74B 2PTTB 4D9LL 4JG1H 1PDKA 4LCWE 1OSZA 3QXDA 3OKEB 4YR6A 1QR4A 1E6JL 2X1OA 1JTOA 4FQPA 5I74B 1IGYA 1KTDB 1XCQB 3L3OA 2R0KL 3SJVE 5GZOD 1KNOB 5KN5A 5JLZB 1XR8B 4C54A 5J1AB 4MA1C 2UYLA 5SWZD 5I1LB 2GT9A 2YD3A 3VRJB 1INDL 4D9QE 3HC3L 3RDTC 3D9AL 3MLZH 4ZNCD 2G5RA 5HHPB 3TN0D 3OKMB 5F6HI 1FAIL 3SO5A 4PJXA 2JELL 4XP9H 1AC0A 1IM3A 4F7TA 4X99A 5T5NG 4DUWA 4BSJA 1Z9MA 1AKJD 4GXUM 1J0HA 4KAQL 2XG4A 1DBBL 1EO8H 1S7WB 1G0YR 4LLVB 3PJSA 3L3GB 5T3ZE 4X6FB 1DLFH 2WINB 5ANME 5GGRY 4U6HB 2Z92B 1G7HB 2EIZA 3QUZC 3H9SE 1BM3H 5J6HA 2I60L 5B8CA 5D9SB 3B9KC 3GO1H 4AEEA 5IT2L 3CPLB 3MJ9A 4HMCA 2KUTA 4LPYA 2ATPB 2CO7B 3BKMH 3IFOB 5I9QB 4JM2C 4R97C 1P4LA 4LPCA 2M8XA 4JQXA 2JIXB 4Z7QF 1DQTA 4WHTA 1BD2A 1A3RH 5L7XL 4GRWH 2UZXB 1M6OA 2OMNA 3P2TA 5DMIL 1HHIB 3WE6B 1JNNL 4LPVA 1QFWL 2GJZA 5B4MD 3UJJH 2OK0H 4P2OD 3BJLA 5DF0A 3HG1E 1X7QB 3B43A 1AO7A 2CDGA 3P0YL 4QOKD 5BRZE 1AQDB 3OB8A 3TZVD 3P9LA 4KHXL 5I71B 4UU9A 3TVMB 3HE7C 3WFBL 3NFNB 5TQ2L 3WHXA 1S78D 1PBYA 2I25N 2WWMC 3QWOA 1R3IL 1UM4L 4UAOC 5LXGL 5ESVA 2GAZB 1FYTB 1N59A 3KPSE 2F5BH 1KJMB 1M7IB 2HFEA 4FRWA 4OZGE 3W11D 1YEEL 4YHML 1KPUA 1TVBA 5EIQA 3MJ8B 4X6DA 4YXHH 5E00A 2X4UB 1KJVA 3UO1H 5D2NC 4HWEL 1S9VB 1IEAA 3T0EA 4EDWL 4J7RA 5CZVH 2YD1A 5JIKA 2QKIB 3T3PF 2JF1A 3BD3A 1G7MB 3QXAB 3BUTA 5F7KC 1EVTC 4QRPA 4KTEL 3ARDD 4GQ9H 1T5WB 1I7UB 4KXZH 2OQJA 4NN6B 5JUEL 1HDMB 1N8ZB 1TQCB 2NW2B 5D7LE 1NBVH 1G1YA 4A2LA 4MXQD 3QJHA 1LQSR 4RWYH 1MRDL 2N4IA 4I5BB 4L4VB 5DJ2A 2M2DA 5A1AA 1A6AB 4WY7L 1PY4A 3TFKC 5D72H 2OR9L 3UBXB 1GZPB 4HCRH 2CKBL 4JRXE 4PREA 3CFDA 4IIQC 3RDTA 1II4E 1U42A 2JCCA 1J8HE 4IS6B 5IQ9A 3CC5A 3KLDA 5MP6H 4HKZB 5F1IA 5HHVH 4HT1H 3BW9B 1RUML 1BQHA 1JZ3A 4YIQB 1S7XB 2OJZH 4WUUE 5AWNH 1F4YH 5I18L 4TNVK 1WCBA 3KYKL 4ONGH 4TSBL 5LBSH 4PP2B 5CILL 1NAMH 5GRJL 1YEFL 4MDIB 3QNXA 3CVHL 2VJXA 3OKNA 3OJDB 1FFOA 2HG5A 4K8RL 1CFQA 1MJ8L 3M8OL 3AAZB 1PSKH 5ALBL 4YDLB 2EDHA 4WI3A 3BP7A 4ELMA 4PJHB 1DBKL 1O0VA 1NAKL 5F44A 2Z8RA 3KPPB 3QUZA 4NM8L 2MTPA 3WEXA 1I3RA 1RZ7L 3B9KA 4I3SH 5FYKD 4M6OH 5IFJB 5FDWA 2VXSL 4JM2A 4BZ1H 1VFAA 5MENB 5E2WH 2ZNWA 2JB6B 4KJYB 3RWFB 4GH7B 3V9FA 4XC3L 3RWIA 3EFDH 5HYJD 3DETD 1F6FB 4FQ1L 1SJHA 2CLRB 3D3VB 1PY9A 3WNLA 3TCXA 5J7CC 4LGRB 1JPST 1RPQA 5I75B 4EQ3A 2OLDA 4UQ3A 4OKDA 1BIIA 2B5IB 1VENA 5J57B 4YDIL 4RSVA 1IQWL 5EU6D 5C0DA 3BH8B 3UAJD 2EDLA 5DFTA 3DGGA 4NWTH 2VXVH 4X7CC 5FUOH 4TRPH 4CDHA 1KCSH 1IGML 4X6CF 3VWKC 5T3XE 4HBCL 3T77B 5D5ME 4LAQL 5GSRB 1FPTL 1F42A 1IAIH 1CL7I 3RAJL 1FG2B 1JGLH 5MEOA 3FT4A 5ESQA 3T2NL 1CT8B 2F53E 5CZXD 3H6JA 5GRVK 3B2UC 5FIEA 4TUJB 1M71A 5HDLA 1BOGB 2IQ9L 3MJ6A