3KHTA

Crystal structure of response regulator from hahella chejuensis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
132
structure length
132
Chain Sequence
SKRVLVVEDNPDDIALIRRVLDRKDIHCQLEFVDNGAKALYQVQQAKYDLIILDIGLPIANGFEVMSAVRKPGANQHTPIVILTDNVSDDRAKQCMAAGASSVVDKSSNNVTDFYGRIYAIFSYWLTVNHCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Response regulator
publication title Crystal structure of response regulator from Hahella chejuensis
rcsb
source organism Hahella chejuensis
total genus 46
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3khtA00
1LBIA 2O20A 4HNQA 3QELB 4ZJPA 5KQGA 3CG0A 1NATA 1PHRA 3IPAA 4YR7A 5TPWB 3TX6A 3LKBA 3MIZA 4HYEA 2F8TA 5JNSA 2KYRA 1A2OA 4Z9BA 4EYOA 5BQ3A 4D74A 3C3WA 1K68A 4MR8B 3SNKA 5BRJA 3LOPA 3LUKA 3M6MD 1FFGA 3SQNA 1QQAA 4YGXB 4P1ZA 4Z4GA 4MS1A 4G0OA 3GRCA 3RVKA 2PLNA 2QVGA 1QKKA 2PMCA 2HQBA 3O2SB 4OTZA 2LBPA 2QV0A 3IPCA 2V0NA 4H3HB 1VPWA 3Q7SA 4G86A 7ABPA 4MR9A 5HSGA 4YP9A 4S05A 5ABPA 3F6CA 3O1IC 3H5OA 4MRMA 4Z4EA 1J56A 1U04A 4Z4CA 3EQ2A 1DP4A 4FE4A 4XFKA 1EAYA 4F12A 4LZLA 1JFTA 3LKVA 4F8JA 4RK0A 1DBQA 3KKEA 4EVRA 2GX6A 4XASA 3IP6A 5JS2A 1IIBA 4EVQA 3D8UA 3RVLA 2NT3A 1R8JA 3FFXA 5TQ0B 4PE5B 1M2FA 2GKGA 4MR9B 2WRZA 5DKFA 1OXKB 3CG4A 1BDJA 2FSPA 3I09A 1JFSA 1M2EA 1U2PA 4PYRA 3H6HA 4TLMB 1SRRA 3CS3A 2JBAA 1JWLA 3CHYA 3HK2A 5TQ2A 3CZCA 4RKQA 2VYCA 2JVKA 4N76A 4WXEA 5F64A 1PNRA 2FQXA 1JDNA 2FKAA 3BREA 2FQYA 3RVNA 4Z4IA 3QX8A 4E7PA 1QO0D 1SXHA 4MYRA 1GCAA 2A9RA 2MYPA 4Z4HA 1APBA 3UK0A 5B3JC 4JA2A 4MS4A 4O1IA 2E4UA 5FWYA 1ZDMA 5CNJA 1DRKA 3CFYA 2HQOA 4H60A 3H1FA 2FEPA 2MSLA 3ILHA 3A3KA 5TQ2B 2VK2A 1BVHA 3IP5A 4EUKA 4N0PA 5KQLA 2QVCA 3K4HA 1DRJA 2JCGA 1PEAA 3BRQA 1YIOA 5B3JA 6CHYA 1I3CA 1D5WA 4WUTA 4EGSA 5T7BA 5DCLA 3E3MA 3O1HB 4TLLB 4EYGA 2LUOA 2CHEA 2XDYA 1WETA 1MVOA 1Z2EA 1U8TA 4RK1A 2ZWMA 1KRWA 1L5YA 3N0WA 3DLBA 5FWYB 3QEMA 4QPJC 4ZPJA 3OLXA 1Z2DA 4EVSA 3HM9A 4DQDA 2PE5A 1ZH4A 5IEBA 5DTEA 5EWLB 4ZMRA 8ABPA 1LBHA 3FGZA 3DLHA 1DG9A 3D02A 4YWHA 4DADA 2R48A 1TVMA 3EJWA 3OM0A 2R4QA 3DGFC 3GL9A 3S99A 1XHFA 3C6QA 4P98A 1QNLA 2WMYA 4MQEB 3CKMA 3MQ4A 3TO5A 4G0ZA 3SG0A 4PICA 1MAVA 2RJNA 3JVDA 1ZESA 1W25A 4RY0A 4WWHA 4JB0A 4OG2A 3LFTA 3RVOA 5JNWA 3KSMA 4WZZA 2MYUA 1H9CA 2WWVD 4MQFA 3O75A 5CNIA 2PAFA 5KC9A 3H5VA 2NUBA 1C4WA 3NHMA 5GQSA 2PUDA 1Z18A 1VRVA 2FEKA 4GPAA 5TPZD 1ZAYA 4RZSA 1Y1LA 1TM2A 4G0PA 1F4VA 1ZGGA 1BAPA 4LX8A 4EYKA 1HEYA 3HUTA 4JOQA 4NCAA 1ZGZA 3C3MA 4RY9A 2HSGA 1PNTA 2NT4A 3RVSA 1JBEA 4YV7A 2FN8A 1A0OA 1D1PA 1TLFA 4N41A 2QZJA 4N03A 4G0YA 3TB6A 4YRZA 1F51E 3OQOA 2L17A 3A0RB 1SXGA 3KYJB 2A9OA 2MSKA 1AB5A 2OQRA 3NNNA 3SM9A 1JF8A 5IEJA 1QO0A 2IYNA 2WY2D 2PUBA 1EWVA 1USIA 1Z26A 1XWWA 3DGEC 2GWRA 1ZITA 3MM4A 3KYIB 3KTOA 5EWMA 4RU1A 1ZY2A 3Q7RA 4KV7A 3F7NA 3HCWA 4NV3A 4MS3A 3T6KA 2PUAA 1EWKA 5E3JA 2NZUG 5IC5A 2FLWA 3Q15C 3JTEA 5PNTA 1QPZA 2AYXA 1M5UA 5EWJA 3HV2A 2PUEA 5BR1A 3IP9A 1YMUA 1GCGA 1ISRA 4Z4FA 2FEWB 4LE2A 4MS1B 5IUNC 1KGSA 2NZVG 1MIHA 3IDOA 1ZH2A 3VNAA 2W42A 3Q9SA 5JS1A 3A0UA 1ISSA 3OLYA 1U2QA 3O74A 2RJOA 3TMYA 4KZKA 4G97A 4DN6A 1VLZA 4JASB 4JB2A 2FMKA 4Z9AA 4MS3B 1A04A 4PEVA 3RH0A 3EODA 4MRMB 4ZMSA 5EWJB 1RNLA 3O1JC 4KK4A 1KRXA 5IULC 2CWDA 3OLWA 3G1WA 1P6UA 3T8YA 3KCNA 4MGEA 3ROFA 3CNBA 3B2NA 4KK3A 3OO0A 1B00A 5JNUA 3O2JA 6ABPA 1L5ZA 3OO1A 1Z13A 2MSWA 1TJYA 3RVMA 1P2FA 2A9QA 4N0QA 5IX8A 4WXMA 5KWSA 4KPYA 4YS6A 1C0EA 5JNVA 3JPYA 4QYMA 4LDAA 4Q6BA 4RXTA 2JBAB 1E6MA 4RK4A 2GBPA 3FMVA 4RS3A 5TPZA 5BRAA 3T38A 2MYNA 1JFVA 4RXUA 2L18A 2PKXA 4UHJA 3QK7A 3KJXA 2FLKA 4IILA 4W5RA 2CHFA 3CZ5A 1QP7A 5TE9A 3ILYA 4WT7A 3JS5A 1ABEA 4L85A 4MS4B 3UUGA 3LUJA 3EQZA 4KQCA 1QP4A 1FFSA 1DBPA 1CEYA 2RGYA 5DLEA 3I5AA 5ED4A 1Z16A 3TD9A 4XXHA 3F73A 5GOTA 3CU5A 4D6YA 4W5NA 3QLVC 4XAQA 3MMNA 3N75A 4RXMA 3HXMA 1USGA 9ABPA 3KLNA 4O5AA 4W5QA 1PUXA 1K66A 4F11A 2L19A 4G0MA 2QXYA 3KS9A 3OM1A 3H1GA 3QEMB 4UHKA 3QX9A 4OBBA 1NXTA 3QLVA 3CLKA 2M98A 3MYYA 3N6VA 1EHCA 3F6PA 3KG2A 3LMKA 3P9YA 4IMJB 1USKA 1BDHA 4MLCA 3EDCA 1YS6A 3C97A 3OLVA 3RQIA 2P9HA 3UKJA 1E2BA 1Z15A 2E4ZA 4Z99A 4JAVC 1AB6A 4FB4A 1RXEA 1XHEA 4ML3A 4MAAA 4RDCA 3QELA 1DJMA 4EY3A 2IKSA 1ABFA 3HUUA 2BGGA 3OMWA 3M9XA 1NXVA 2RDMA 3M9WA 1JLKA 2X7XA 3R0JA 4IMIB 3GA5A 5FBKA 1VKRA 3H75A 5TPWA 2WJAA 5C5CA 4G0XA 3ROTA 4MQFB 3OQMA 3JVIA 1P6QA 2DRIA 4GNRA 3URMA 1D2AA 3I45A 4MR8A 1Z17A 3LUCA 1NXPA 2PL9A 2QSJA 3GBPA 1DZ3A 3H5WA 3IP7A 1QQBA 3OLZA 4KQ9A 1ZVVA 4KREA 1JDPA 5FBHA 3HO1A 1URPA 2LPMA 1DC7A 2JRLA 4HNSA 4RK7A 2JK1A 4JP1A 3EGCA 2F8SA 3FDFA 4Y9TA 1ZN2A 2MYTA 2E4VA 3HDVA 4QYWA 5FWXA 5CHYA 4CBVA 2IPLA 4IRXA 1FQWA 3GYBA 2FTKE 5KQPA 4B09A 3W9SA 4RWEA 4S04A 4E7OA 3LUAA 5KC8A 3LUFA 4KFCA 4KNYA 3N8IA 1Z12A 1S8NA 1YK1A 3LUDA 5JNTA 1GUDA 1SD5A 1DCMA 2P4UA 3A10A 1RPJA 2TMYA 3OMXA 1JYFA 1GUBA 4NCBA 1JH9A 1MB3A 3N0XA 5TQJA 2OENG 1FSPA 3RVJA 2N9UA 4YLEA 2FMIA 4Z0NA 5FWXB 4YO7A 5EWMB 1EFAA 1LJUA 5TQ0A 2LIVA 1NXOA 4OLBA 3GBVA 3E61A 2E4XA 2Q5CA 2JVIA 1YMVA 4EYQA 2PUCA 1T34A 1LJLA 1YS7A 3BBLA 4OATA 4O1HA 1M5TA 5T3YA 3K9CA 2PUFA 5IUKC 3Q41A 1CYEA 2FVYA 5I4CA 3FFWA 4D6XA 1PEYA 4RK6A 5HQJA 3HJFA 2I6FA 2HPHA 4M88A 1P8AA 2FMHA 3VNBA 2H0AA 1E6KA 4TN5A 3H6GA 3H5TA 3HSYA 4ETIA 2FW0A 3RVPA 3LUHA 3BRSA 5DGCA 4PZ0A 4W5TA 2IDMA 1CHNA 3HZHA 4IGAA 4YCSA 1GLGA 3HDGA 3KLOA 1YVUA 2VUIB 3L6UA 5CNMA 1RZRA 4LE1A 4MR7A 2IOYA 3H5IA 3SY8A 2YHBA 4XARA 4IF4A 4H3KB 1QMPA 5HKOA 2CD7A 3EAFA 1DC8A 1UDRA 4G0QA 3HEBA 4RKRA 1NXXA 4W5OA 1FFWA 4RY8A 4RV5A 2FXIA 2VUHB 2R47A 3I42A 3H5LA 2JB9A 2GI4A 2HQRA 3KHTA 3QLUC 4LRQA 2E4WA 2PL1A 2PJUA 4RK5A 2JVJA 3QEKA 4MLDA 1JL3A 1OXBB 1NTRA 4Q6WA 3NHZA 3H1EA 3N0RA 2ZAYA 4MR7B 1QP0A 2R25B 3GWGA 1TMYA 2ID7A 3JPWA 3OQNA 2M1ZA 3MA0A 1BA2A 1W9HA 3G85A 3GT7A 5EWLA 1DCKA 4TMYA 4KRFA 3C3KA 5IBQA 3QLUA 1RXIA 1JYEA 1NXSA 2FN9A 2FQWA 3O2QB 2B1JA 3QLTA 4LE0A 1EWTA 5IUJC 3N53A 5C5EA 5KQMA 2IPMA 4KVFA 1KMIY 4KMRA 1ZHHA 4MQEA 4MPTA 4ETMA 3RVQA 2J48A 4OLAA 5JNRA 1E6LA 3NNSA 3LTEA 5D2CA 3HVRA 4N47A 2QW1A 1NXWA 1U0SY 2WB4A 1DCFA 2IPNA 3BILA 2FMFA 4ETNA 3DZDA 3GV0A 4L4UA 4XLTA 1RZRD 1MB0A 3HS3A 4HNRA 4NICA 5CNKA 2PUGA 1D4ZA 3EULA 1SXIA 3CRNA 3FFTA 3DBIA 2QU7A 2IPAB 3MF4A 3O21A 2B4AA 2H3HA 4LDZA 1NY5A 5HM6A 1JX6A 1LK0A 2QR3A 4NQRA 3SAJA 1DBWA 2AYZA 1BDIA 1YTUA 4Q7EA 4FE7A 4ZYLA 2HJ9A 3JY6A 1Z25A 2L2QA 2WJWA 3NBMA 4QICA 3CTPA 2YHAA 4F06A 2ID9A 2A9PA 1YK0A 3LUGA 5KI6A 3NNDA 3Q7TA 3T95A 2LP4Y 2E4YA 4RSMA 3RVRA 1JHZA 4F3TA 3L49A 1D1QA
chains in the Genus database with same CATH superfamily
2QTLA 5A03A 3C1UA 2V9ZA 2FE4A 2BAGA 2LKDA 3SC6A 2WSBA 4CM7A 3RHSA 5EJIA 4TV8F 4YR7A 3LX8A 2WU4A 1P2TA 2GSWA 2EG5A 2JK0A 3KYCB 3RFVA 5ICGA 1F5SA 3ZI0A 4U2EA 4DCOA 4II2A 1NN1A 4MRAA 3V7NA 3AXTA 1IRXA 5BXQC 1RLJA 1B8VA 4HAVA 4LGVA 5T5QA 2RH9B 3EUFA 1EK6A 1L5QA 5D3QA 1RTTA 5KTKA 3KQKA 2RCNA 4WXPA 5JCPA 4RL4A 2M32A 3VAZA 3LX4A 2UDPA 1LRJA 1HG1A 3M83A 1VYHA 1VLJA 4C01A 4B5KA 1BQEA 4RVHA 4YUZA 2AX4A 2BCGY 2RKBA 1QQAA 1G8KA 3IAS6 1Y8CA 3GRCA 3IX7A 1UAYA 3ZGVA 2EARA 4KLCA 2XDQB 5TDHA 3K7EA 3RRFA 3CLSD 1QRRA 4H3HB 2VSNA 3HDQA 5JS7A 1N2BA 3Q7SA 4RIIA 3SKXA 4NATA 2G70A 1WPQA 4WZAA 4ZZ0A 1ZK2A 4DYVA 1ZIXA 1ZNXA 5EXDA 2P69A 3CVJA 3DAPA 1N9KA 4J7CA 1CFZA 1QZTA 2JBHA 1EVKA 2FSVC 4RTKA 3AZQA 5AVWA 3D5TA 3NHSA 1XEWY 3NYWA 2H51A 3C87A 1UAAA 4LBVA 1X70A 2B2XA 2YXDA 5J63A 3GLHE 4AJPA 4EGQA 3PFNA 1T3SA 2GKGA 3CMCO 4RIGA 2AMYA 2HL6A 1B0UA 5IT0A 1ZXBA 4CPDA 1C9JA 5DM4A 4XCXA 4B6FA 4FWIB 5EQFA 4ND2A 4R3WA 4UTOA 3VX3A 3KVYA 2H4ZA 1EEHA 5TQ2A 1JBKA 1HKHA 3STVA 5A1JA 4ZZIA 1EESA 1V4VA 1W8DA 1PNRA 2QUKA 5KMGA 5LJLA 3NBYC 4M1TA 3OCUA 2C1EA 2GHQA 4FNGA 1HDRA 3EXHB 1OU4A 2V1UA 4D82A 1TPYA 3K9FC 5TF4A 1MG5A 4B3GA 2MYPA 3D6VA 3ESDA 1BYIA 1JDJA 4AS2A 1GZ7A 5HE9A 3RU9A 2XCSB 2R79A 4J0JA 1DRKA 3AUJB 1VIAA 1ZM2A 1KZ6A 2J3DA 2XEXA 1O0SA 3L9WA 4KYTA 5FI5A 5TQ2B 5C8DA 3PB3A 1AZTA 2UYYA 1NF8A 1RJFA 1TA0A 2WSYB 5JUWA 4FEGA 4W8HA 1Z7GA 1IJEA 1GIAA 1Y4SA 3H1AA 2D6FA 2YIVX 2HT1A 3UK7A 3NM6B 3UAVA 2WUGA 1P75A 1U2GC 1CBUA 4FOLA 4E3WA 4EL0A 5BWCA 5FTLA 4UD2A 3JAKA 4EYGA 1GFSA 4K9PA 2R85A 2YWCA 3ZXXA 5JAHA 1OKKA 3FTEA 1O94C 2ZBQA 2RBKA 3MRSA 3U1BA 1BMFA 4BVAA 2ZUBA 4Y2SA 1K27A 3BSSA 1XDZA 3SYMA 3IQZA 4HXEB 1QG0A 3UXHA 5IEBA 1AS3A 1VFPA 4JVSB 4MJXA 3VR5H 1CQPA 5DNDA 1J20A 3U3OA 1T25A 2DTDA 2ISSD 3DFUA 3KQMA 2P4EA 4YAEA 3GUYA 4KRGA 1N32B 5I9SA 4QX6A 3U16A 2CSUA 4QFCA 2RC5A 1MAWA 2NSLA 2RHHA 3CKMA 4ZO9A 2O8FA 2A6PA 3EASA 3L0DA 1MTOA 2IEZA 4FFSA 4QU8A 4ZYUA 1JB1A 4QGSA 2QTVA 1QHNA 3N6XA 1N0HA 4PIPA 3PWSA 2BUAA 2IYVA 3T3EA 3OA2A 4E31A 5CEFA 2ZE6A 3RVOA 4HN2A 3F5FA 4AD8A 1Y37A 5F4ZA 4AECA 3SZGA 2WYHA 1E89A 2DKNA 1TU0A 4LJ8A 1LQ2A 2Q6VA 2Y1CA 3NB0A 5TT1A 3H2BA 3NBUA 4S2UA 1WB5A 2OGUA 3NHPA 1X7YA 4XYBA 1Y1LA 4QE3A 5FA5A 2O8FB 1IATA 2VQDA 4FKBA 5H83A 4JOQA 3RADC 4XD7D 2X8LA 1WMAA 3P9IA 1PNOA 2EFDB 2QTVB 3OOJA 2NUPA 3EGEA 1K8QA 1V9LA 5K51A 4JQOA 2XQVA 4CIYA 1VKNA 1JBEA 1ZO8A 2DBVO 2PQ0A 3TQCA 2UVQA 3TK1A 2FSIA 3LCMA 1JEQB 2G8NA 2PKEA 3FUVA 3EBLA 1PDWA 2FSUA 3UJHA 1F2TA 1T2VA 1G18A 3R3UA 4ZO6A 3ZY5A 4CF5A 3TW4A 3IRVA 3QXCA 2X13A 3OU7A 4D0LB 4PYNA 1GYQA 1X7YB 3M6VA 1LPMA 2YVKA 1XCGB 1CK4A 1R4MA 4ND3A 3CRQA 3SIXA 4A27A 4EL5A 5IEJA 2H65A 3PQCA 4GMDA 4XOIA 3OF5A 2Z5GA 5AW3A 4YMIA 1G8SA 4NDAA 4YTEA 1CVRA 3N76A 5THQA 2L42A 2QRJA 1E3EA 1FUYB 2VNKA 3WXBA 4DLWA 3ZHBA 1JKMA 5IZCC 3PUXA 2Q3JA 2QX4A 1GPDG 2WAOA 2PEZA 1TF5A 2ETXA 4MHOA 4E12A 3AUUA 1UJNA 3HCWA 4AJ4A 3R7SA 4DUPA 4FB5A 2ZT8A 1JMKC 2JIPA 3JTEA 2X77A 1NYQA 3AF3A 2VHXA 1MG0A 4CDRA 5K01A 5DSZA 4HUTA 1EHYA 1KORA 1GEEA 1GCGA 4Y6LA 4P86A 1NUAA 5J5CA 4KDFA 5AHOA 3TQTA 1U9CA 3RWMB 1GCUA 2ZOSA 1Z47A 3W3AD 3OLYA 5AW1A 5MN6A 4YRQA 3IB6A 1H8HA 2G4CA 4JASB 4A73A 1B8PA 5I7SA 1RHMA 2PY6A 3ZI4A 3MFQA 2AOUB 2NZWA 4NAHA 4PEVA 2VRCD 5BQ5A 3TBFA 1QHEA 4AS3A 1V6AA 3WZMA 2XWSA 1KRXA 1HYBA 1EYZA 2D5LA 2P2SA 1SKUA 4K3UA 5AR1A 4G23A 3LPLA 3OZCA 3KCNA 3GJSA 4KO3S 3IQDB 4EUHA 1T6NA 4MP6A 4MWCA 5A2QA 1KVTA 2XB9A 2ZWPA 2HWYA 3QG1A 4MVJG 3DOFA 4OJYA 3C6YA 3FZYA 4XM0A 3UPTA 2G1PA 2OB1A 4WACA 3FMOB 3M82A 5REQA 3W90A 4F0JA 4ZCIA 4MPDA 5D86A 1TYAE 2YIDA 1MVNA 2X9QA 3O82A 4KBYA 2XOEA 4PBTA 3DSRA 5JTUA 1N5RA 1Q3HA 1VB3A 1QFXA 2ZE5A 4M1ZA 4HLCA 4KVGA 3M4YA 2D0PB 5L53A 1ZX1A 1V3UA 4IIYA 2OO3A 4MW2A 2A0UA 2F8LA 3U61B 4KWTA 1K8RA 3FMVA 2OGWA 1EVJA 1E0JA 2R97A 5BQPA 1NC3A 1JSCA 1SPBS 3DMNA 4FGLA 4I4TA 5KOHB 2PKCA 5F9MA 4UHJA 4M36A 2Z3VA 3HDTA 1UIMA 2FLKA 1IUKA 5F3WB 3CB4A 4P7KA 5KYVA 1L4UA 4RE6A 4YIKA 5ALFA 4EYOA 2DWOA 2JD0A 3KVOA 5U9CA 4C5CA 2V7XA 3W4KA 2PBFA 4L85A 1T8SA 1COWD 4KFTA 4NZ9A 5K3BA 4KDEA 1JSZA 1ZSVA 3D2AA 5EJ2A 4ER3A 4F8YA 3B6JA 1MHPA 2XVMA 1GNTA 1TRHA 3NALA 1OPXA 2RK6A 3TOZA 3CJQA 3F98A 4IGEA 2INGX 1QHHB 4I5IA 1CQXA 5DXJA 2H1SA 4RD6A 2B99A 5D3KA 1VIYA 2HMYB 2QG6A 3M1YA 2C54A 4Y9SA 2BISA 1POWA 3MT7A 4PN3A 2F9FA 2OHVA 1SRQA 2IOFK 2VP0A 3LP5A 4QXRA 1RM3A 1E77A 2AN4A 3GA7A 1DRVA 2XCQA 1PFGA 1E79D 1CB7A 1EM8B 3IESA 3GEDA 2O3JA 3F8TA 5J2TA 4TL9A 2PSEA 4RVDA 4K9KA 4ZFNA 3BKXA 1W36C 4MROA 1JEYA 2QLMA 2VJCA 2R60A 5DHSA 2HKIA 3UWMA 4U5QA 2BWJA 4URHA 4PN7A 7REQA 2IZ5A 3NP7A 5IDXA 4G1CA 1W9MA 5CLGA 2HIMA 4AC9A 4ZJUA 3MSXA 1EWYA 2PX6A 4WPGA 1ZIOA 1M73E 2BM9A 5E7JA 4O33A 3OKCA 1VCMA 3MJHA 1MEJA 4B2LA 3IHWA 3UT6A 2UZIR 3G9XA 4O4JA 5TEVA 3WKBA 2WJAA 2EVWX 3UMBA 4NPHA 2GAFA 1CZLA 2GJ8A 1JEYB 4PR3A 2QNBA 3FJYA 4PYMA 5DHPA 1T36A 1P6QA 2UZ3A 4N39A 3ZHUA 1AC5A 4UD6A 4KFSA 1OFTA 3UWDA 2CLKB 3AUKA 3PJEA 3SNHA 3SZOA 4WXYB 3KXKA 2WDZA 4X63A 4PGAA 2OCGA 1PFVA 3O8BA 4R3NA 1EFKA 2JGKA 1XN1A 2WEKA 1AKEA 2F3SA 2DKFA 2XUZA 1PT8A 3ED5A 1IL0A 1E2MA 1EX9A 1DC7A 4RABA 1RWXA 5E9QA 4AP9A 4QRHA 1B6RA 1W4BA 2GO7A 2XPCA 3VHXA 5KQRA 5KYGA 1D3AA 2CB9A 2BRUC 1IG3A 2YFHA 4NP6A 3AKYA 2ZDGA 3CUUA 2P30A 5F12A 2NZ2A 3WGZA 3MMZA 3SQXA 3LSYA 1RRMA 2NO6A 5IF3A 1C9EA 1LK5A 1P4SA 5LB4A 3ZCUA 1UMDB 2G0AA 1DADA 1DKNA 1R8QA 3AFHA 3LUFA 3TW6A 5K8UA 3MW8A 1RACA 3OOEA 4ZDIA 2ZP1A 1SD5A 1WA5A 2Y2UA 5TMBA 3QBVA 1XJ5A 4KPGA 1GUBA 4ZOEA 1MQ9A 2VDRB 4DA7A 1IRIA 1KIAA 1MEOA 2OB2A 4K26A 3UJ8A 4Y2HA 4U7GA 1JH9A 2TECE 1MAAA 1P5JA 3BWYA 5IJ0B 3HFGA 1TT7A 2GPWA 3E5RA 5CCEA 1EFAA 2AB0A 4BO9A 1FYEA 3K70D 4BNTA 2BKXA 1Z0SA 1E62A 2Y92A 4NENA 4AO7A 3D5QA 3ZY6A 1AMOA 1KPHA 2Z2YA 4UXHA 3EA0A 3SSAA 2Z2IA 4IS3A 4Z9FA 5IUKC 1WXIA 1PZGA 2ODPA 2VDQB 3ZE0B 2WF8A 2FVYA 1F17A 2WF6A 5LDHA 3KVVA 3EJ6A 2YS7A 3KOMA 3UB4A 4EPXA 1HRDA 4HNUA 1TZBA 2BEWB 2ZJ0A 3CZPA 4Z1MD 4N40A 1L7QA 1XZLA 1ODKA 5JO0A 5DGCA 2ZWOA 3NS7A 4YT5A 3TBKA 5J43A 4G2TA 1YNSA 4NENB 3DCIA 3KLOA 3L6UA 5HF8A 4PIVA 5ITZA 2GARA 3Q7PA 1DFIA 2IOYA 4MWGA 1KKUA 1STOA 1UK6A 2AFVA 2J46A 2VDOB 3BRCA 2XUFA 3LHDA 5DTIA 1Z88A 3TL2A 4AX4A 3PHIA 1XA0A 2FF5A 3MC1A 1GPYA 3L6RA 2XUDA 3IAEA 3O2NA 2GF9A 4IVPA 3VO1A 2JIOA 1E4YA 1JMVA 1Z4QA 3F7OA 1ZGAA 1DAOA 3M6WA 4QJBA 2A7XA 3UUEA 1IAVA 3NATA 3ILVA 5T4EA 5HZKA 4NEQA 3N2KA 1Y9JA 3QUSA 2EL7A 3UJ7A 4Y2PA 1ISIA 1D4OA 1V5EA 3V1YA 1NTRA 5ITZB 1ZD1A 2DQKA 1YZKA 2H9YA 1LX7A 3AYZB 5AQEA 2I3AA 1F20A 3VR2D 3KQNA 1G6OA 3O7MA 1LK7A 1T6ZA 1TQ2A 2WG0A 1ZYUA 1XMVA 1DCKA 5G41A 3B1FA 3GEPA 5K5EA 2VBFA 4P84A 3C3KA 3AI7A 2EJTA 1VI5A 2W6QA 3PUYA 4LTDA 1C9DB 1XO1A 1XQXA 5AM2A 3LC2O 4DLKA 1R0WA 1GRCA 1I01A 1EPUA 3H5NA 1P62B 4WK2B 3SIRA 4M38A 1G4UR 3DV0B 3EAQA 3SI7A 3NT2A 5ALUA 3IP8A 4M7PA 5JNRA 1DAMA 2APJA 5JG7A 3AUAA 3VX4A 4AMVA 3AVYA 5JHHB 5T4HA 2DQZA 3R3ZA 4TM7A 2SBTA 3TRFA 4KNVA 1OJ7A 3TTSA 3WDKA 3PWZA 5CFOA 1O96B 1YZHA 1MRSA 3H3XA 1AZSC 4DWJA 3AIMA 4MQBA 4E03A 1NVWQ 1TVKB 3OG9A 3EXG2 2YQZA 3NH9A 4D92A 4NZPA 3R0ZA 1CUFA 4IVRA 4R6XA 3LYHA 4D44A 1ZK4A 1FJGB 4BP9A 1SBTA 1WABA 2FN7A 3F9CA 2B34A 3VYWA 4ZI7B 1CPYA 3Q9NA 1NSYA 4G56A 4ITVA 3V6LA 3VR4D 3GJRA 4FT2A 3VKFA 4B3TB 3PEFA 3TOSA 1SC6A 3ZGNA 4B3FX 2VK4A 2X9VA 2CW5A 1OI2A 5GZ3A 5ICSA 1Z74A 2W6IA 4FN4A 4U4AA 3ZPXA 5LNK6 1VLHA 4JLJA 4QICA 2QDXA 3RJ5A 3VDQA 2Y1OA 2IT1A 4F93B 1JTVA 1PGOA 4JB3A 2WIAA 1SZJG 1QC5A 3Q7TA 1QANA 3UJ3X 5K8IA 4AUEA 2H5IA 3M49A 5L3RA 2CXQA 1JI0A 4PZCA 4LMPA 3KDPA 3RK4A 4PC3A 1WW8A 2J6BA 4TVBA 2QPTA 4FCVA 4WAUA 1NZDA 4JX8A 1L4LA 4NF2A 1KI6A 4PFJA 1Z6AA 3BD6A 2XNHA 2P0YA 1J07A 2ZS7A 2PZLA 1KVUA 1N3IA 3RUAA 1OA1A 4HTFB 5DT2A 1NF2A 4FYJA 4DR7B 3JZDA 3UC9A 2WWYA 5HJ5A 1PTJC 3OJOA 4N7BA 4OSEA 5G0TA 1QC5B 3AO0B 4PGHA 2Q7OE 3ADBA 3ER6A 3MS7A 2O2YA 4BX3A 1ISGA 1UXOA 1QYRA 2Q5IA 1A27A 5ILQA 1G0OA 5CYOA 1JHYA 1RBZA 3Q6MA 1TYBE 4HK4A 2IIQA 4Z8XA 4PG6A 5EP3A 4DMKA 1JG4A 3RS8A 1VSVA 3QEAZ 4WSOA 1KI6B 1WKBA 2RONA 1U3FA 5EJFA 3KEMA 3PEVA 1MOPA 2PFSA 2K2QB 1W35A 2FH5B 2GEJA 4DEXA 4IXTA 5JPIA 1NX6A 4W6ZA 2B1QA 4ZVRA 3D8BA 3PDJA 1RBYA 3ASZA 4QT0A 1WO8A 4YP9A 2WTMA 3VZQA 1BE0A 1DDOA 2HSDA 3DDWA 3FYCA 3AESA 3H5OA 1X19A 3KB1A 1CERA 1W0JD 1W85B 3LFHA 3O1IC 2PZMA 4FJ1A 4GXQA 5PGMA 2IGBA 5SZIA 3UK2A 1VFNA 3JARA 4I6JA 3LSTA 4PPGA 3AHDA 2WUDA 1N7HA 2WF5A 2ZKIA 4JYMA 1PFYA 2VAXA 1EK1A 3QI2A 3RRMA 4DDKA 2XGJA 3EGOA 3EGXA 4MIYA 3V2IA 1SBZA 3Q3HA 2CNBA 3WLRA 2GAIA 4R2WA 4CLOB 3D8UA 1R2QA 4R1SA 1FOEB 2F43A 1SWWA 4L0DA 2FFQA 4PNPA 3V6MA 4BTLA 4EKEA 2FSPA 4G25A 2J3IA 2FSVA 4FOSA 4WFJA 1RP7A 3TLKA 1P4AA 2MWMA 3EH2A 3H6HA 1CRWG 4ECAA 2XUPA 4OP3A 1GT91 4A0SA 4C0JA 3UJBA 5L3VA 4EJ2A 2FFBA 1ZH8A 4JLSA 3GRUA 1N0VC 4LQ4A 1ZI8A 3PFCA 3N2IA 3EGXB 5F33A 3S1LA 1UBTS 2DFTA 2RGEA 5HWSA 1VP3A 2OBFA 2RBGA 3DTNA 1UFKA 3CRMA 3U3MA 4XRGA 2WIBA 3A3NA 1LNSA 1Y34E 1G8FA 2ZPTX 3SZUA 3GEGA 3QX8A 5BUZA 3PPVA 2XVZA 3ETNA 3O9VA 1IAQA 1MCZA 5AOCA 1M76A 5LUBA 3TZBA 2FZVA 1NDQA 2PMKA 1APBA 3ZTYA 5B3JC 1V9CA 4MS4A 2YKGA 4O02B 2WQ7A 2VP2A 5K3FA 3D4OA 1KEZA 6PFKA 3PC3A 1ZLXA 5CNJA 2HRCA 2M9MA 5KCMA 2COKA 1B74A 2II6A 2ZBUA 4O2AB 3IELA 4OM8A 5IT4A 5H82A 5CA0A 1DRJA 1NBWB 1M6VB 9GPBA 5CPFA 3SLGA 3IXLA 1XZIA 2EKPA 1R8SA 4TLLB 3D7NA 1V8PA 4QVGA 4EHAA 3I9KA 4R5MA 3A1WA 1P61B 3FETA 3I9V1 2R5NA 1U0RA 2WJHA 3P0JA 4LC1A 3H8JA 3LXXA 3TUJC 2QJOA 5K3FB 1HQCA 2V3WA 1Z2DA 1DQPA 2OR3A 3DEIA 4ZPJA 5JMPA 3VH3A 1KU0A 2NIPA 3LPDA 1HNNA 3ZE9A 1E6WA 4KVZA 1EINA 1U2GA 3EXIA 4RNDB 3UA3A 4F9FA 5BW4A 4NRDA 3TLMA 2Q9CA 2D5CA 3ON5A 4DG8A 1O94A 3TOXA 2C8VA 3W9BA 3DGFC 5HUJA 2QTAA 1BXKA 3C6QA 3BXEA 3NEJA 3T0IA 1AK1A 1BD4A 1PD1A 1UXJA 1GDHA 4YMGA 3WAKA 3SG0A 1K4MA 3VUFA 4HSGA 2Q9BA 2K7FA 2NZXA 4NXNB 3LY7A 1E69A 3CXRA 1JJBA 3KQSA 4DHWA 1EGVB 3CONA 4G8DA 3D7MA 4D0GA 4WWHA 2H08A 4I36A 1MKYA 4ARAA 1DT5A 4NU5A 2YMLA 3PGLA 3CE6A 3EXIB 2JAOA 5B30A 3FOCA 1CUJA 3HACA 2W2XA 1LUAA 4B79A 4OQNA 3FOAA 3NDIA 4KOAA 2YS6A 2R84A 4G81A 3PNMA 2JIDA 1II0A 2BE7A 2OESA 3CJRA 4IWXA 4O8ZA 5LA6A 2G9UA 3RSFA 2DUMA 4ZV4A 4X3CA 1R8XA 1JIJA 1TTPB 3NFYA 2AX3A 3PI6A 4KVAA 1TU3A 1P0QA 3DWEX 1A9OA 2WD8A 2Z1NA 4RY9A 4XYLA 3FUUA 8ATCA 1IBSA 1C8BA 1JAHA 3EZ2A 2OA0A 4DSZA 4FKMA 3QVXA 5IKPA 3G0GA 4R2XA 2GAOA 3MUOA 1W59A 3FDZA 1HQDA 1TLFA 2H52A 4D80A 2ZCJA 2BGJA 3PC8C 4QD3A 4A7PA 3GG9A 1MPXA 2BKVA 4ZHSA 3ULKA 1Y0BA 2UZ0A 5DULA 1ZOIA 2WTNA 4ZVTA 1MO4A 4BZWA 2I71A 2Z6UA 2JCYA 3NNNA 1E6CA 3UV3A 6ADHA 1DC5A 1PGQA 4MWSA 4KKXB 1L5KA 3RS5A 4GMGA 1FU4A 4JP8A 1ZHOA 2EBFX 1AXRA 2PS3A 2ZSKA 3PVCA 4LRXA 4C4YA 5ALGA 1TU4A 1XCLA 2BFAA 3A9TA 1E3QA 2G9ZA 1ZITA 3VBCA 4B48A 4HFMA 1RBQA 4TMXA 5DNCA 3IBCA 3DKKA 4ATNA 2HHCA 3NIDB 2GPTA 1MX9A 5IC5A 4DR6B 2J3LA 4B8YA 2LE0A 4E1BA 4U2FA 1AU9A 1XJ0A 1ISRA 2QR2A 5IZCA 2HRZA 2VAVA 1J7KA 3VR3A 4BNWA 4RZQA 1I36A 1U02A 3CX4A 3QQ5A 5JDIC 3GJTA 3NGMA 1BXRB 5ULLA 4DJJA 4F5DA 1D09A 2RJOA 1ONBA 2JIQA 2BELA 1NG1A 4J03A 2EC5A 1HY3A 3PX3A 3Q5DA 1AQYA 1UFRA 4LFAB 2WDPA 4P0TA 5LIRA 1BMTA 1Q0ZA 3LT5A 1J97A 1B8UA 5G0WA 3DZIA 1V37A 2CWDA 2FHSA 3FVQA 5J4KA 2QT1A 3ZR4B 4EHLA 3E9CA 1B6GA 3E15A 4BU1A 3ER8A 3ADKA 1HDYA 2AQ8A 1RQ7A 1E2PA 3QM1A 1H2FA 1U81A 1M74A 3PNYA 4GW3A 4M98A 5DM0A 4B17A 1VP9A 5IABA 2V6GA 2O2CA 2BBSA 3AW9A 3KJHA 1Z13A 4UATA 1EIWA 3VR5A 1AS0A 1J8QA 3Q7QA 3F6RA 3KALA 1P6XA 4LQLA 1WB4A 5FAKA 4CM4A 2PXAA 2JZNA 3M6UA 4RC9A 1C0EA 2OFXA 3BD7A 3MRTA 4BE9A 3NWPA 1FW6A 4Y67A 4JYCA 1S2NA 4JBYA 4HNAA 1BRTA 2JLRA 2ZTVA 3MERA 3HR7A 4G1BA 4RZUA 4WD3A 2G71A 1VKJA 2ECPA 2GBPA 3FI9A 4FX2A 4I81A 2YNMC 3GRKA 3FUXA 3MWYW 2C9YA 3H05A 1GTVA 2OXEA 2BFEA 3I04M 3O8DA 5JBIA 4C7KA 5AUQA 1JFVA 2JHAA 3FHCB 3R0QA 2NV6A 4WXRA 1U28C 4BWYA 1AVTA 3MXOA 2ZRCA 2HWXA 3RI3A 5ARCA 4BQEA 1S89A 1LF5A 4EYEA 1E3JA 4H31A 4B4DA 1J0AA 4PX5A 3RT7A 3ZWKA 4OUDA 1BIFA 1QJCA 4IHAA 4J7AA 4JUDX 4O6VA 1GZVA 4L95C 4HWOA 3K9BA 4AXBA 3ILYA 4QWWA 2P3SA 1NBMA 1RWNA 4IPTA 2JGLA 4KBFA 2VH5R 4HCJA 5JJKA 4IDPA 1HEIA 3SCZA 1ZVMA 3ORYA 4FWTA 3LQQA 5KOIA 2CXSA 2BFEB 3V2GA 2O0KA 2W11A 2XKKA 4MW5A 4P92A 2ZEJA 4NFSA 4OQMA 3WWYA 1R50A 3THWB 1WQ4A 2JI4A 3OIDA 2NTVA 1XELA 2R68A 2V0CA 2AVDA 3WQQA 3C45A 5AD1A 1MJFA 2VDKB 1PSDA 1G9SA 2LDXA 4G0MA 1JECA 3P96A 4MLPA 4R8RA 4F1WA 1Z4JA 3FTFA 1Z33A 4HQLA 1B0AA 1P7WA 4PU0A 5DNAA 3GLGE 5ENVA 4Z4EA 1JU4A 3TX2A 4ZICA 4ALIA 5GJWC 4TVSA 1ADBA 5EMMA 3P4UA 1T5HX 4FZVA 5B64A 3WK8A 3BMQA 4YJHA 2BM0A 5JI2E 2CEKA 3ZBPA 3F1LA 3TLAA 1KE1A 1R9JA 5IJAA 3SJZA 2EF0A 2CFIA 1HR0B 5I9IA 1MEEA 1HE8B 3QELA 1DJMA 4EY3A 3X1MA 4J9UE 4XZ3A 3AB7A 1BS2A 1KC3A 2GUGA 1O95C 4Q9HA 1JLKA 3WGGA 3R0JA 3GGGA 4UDXX 1E8MA 3UCEA 3WVNA 2EJUA 1PSZA 4US1R 4FDLA 2E7ZA 5A5VA 4NZNA 2X5NA 5TMPA 3K0CC 2WTEA 5LN1A 1YDHA 2Y66A 1V4BA 4DDUA 3KJQA 4MR8A 5F35A 2RCYA 5DHUA 4F1KA 3X2FA 5EIOA 3B6EA 2DMRA 4M9RA 1ORTA 3B52X 2C4NA 1IB6A 1P60A 4Q1AA 3T15A 4BVGA 1QOZA 1YZ3A 2R7AA 4QGBA 1W36B 1R4ZA 4HNSA 2JRLA 5I9NA 3ENWA 4I4TF 2ZQ5A 1P1RA 2OLJA 4Q3EA 1PZFA 1ZRNA 4L3WA 4MV1A 1J70A 3HH8A 4KR3A 4DC0A 3GLIA 1H0RA 1O4VA 3RYFA 2WAYA 4Y98A 2ERYA 4O3MA 1FQWA 1QZZA 5HRCA 1V3TA 1YJ8A 4ARIA 3ROXA 2AA3A 1KY4A 1XC7A 2WK1A 4A16A 2BRUA 1UJ6A 1S8NA 1FTQA 4P08A 3HBFA 2XBLA 2Z09A 3KUDA 2ZI6A 2E5FA 3QNUA 1GL3A 4M1WA 5JZBA 3A04A 1USVA 2PRZA 1KI8A 3CNNA 1MB3A 3UXYA 5CITA 1IBLB 3QWHA 4XQCA 2ONJA 1QWSA 3K9HA 1FSPA 1T5SA 3ZCPA 1Y80A 1ODCA 4Z0NA 4X0EA 4L8GA 5IPFA 2D2EA 4QXAA 1AQNA 1O5OA 1LJUA 4X3OA 3Q2OA 4TMFA 1KDYA 5ALHA 4FBMA 2GTPA 2GK4A 4ERNA 1PR5A 4P82A 4DMFA 2B9EA 2P2NA 4WL0A 3B12A 5J2TF 4DNOA 1DWUA 4R2JA 4D0RA 3MTBA 2IW3A 4NCKA 2ZRMA 5SICE 3WFJA 3KHSA 1C2YA 3G8YA 1ZD9A 2IEIA 1XAHA 2Q1WA 2C7BA 3D1JA 3HEMA 1WNFA 4RK6A 3WMRA 5I3ZA 1OBHA 4L02A 5JXJA 3QE3A 1WUKS 2QRZA 1E1MA 4IOMA 2BCJQ 4DR4B 2IUYA 5CLHA 3TJMA 3CKKA 4DLNA 4YP6A 2JHCA 3MAJA 2XYQA 3LL7A 4PZ0A 4IUCS 5G4LA 4JR0A 4C1BA 2YDYA 5LIPA 4DS3A 5I7VA 3WS7A 5B1EA 4O4JF 1FUKA 1VSTA 2KQUA 3CWQA 2RHOA 2J45A 4B3XA 4KQWA 3E7PA 1EUDA 3IUPA 3U1TA 4E5KA 3PYMA 3WGVA 1U98A 4JNCA 2F1RA 1DARA 3BB4A 4RMIA 4GKKB 1TEHA 1JAIA 1DC8A 2ZJ6A 3EAFA 3IPLA 1BSVA 3QP9A 5DF1A 5G53C 4CLRA 1EVQA 3CN9A 3GNSA 1SXJE 3NRCA 3I4FA 5EYPA 1FUIA 4OQYA 2IQIA 3Q6NA 4RV5A 1L5LA 2EFCB 1EH5A 3SC2A 5EC8A 2JB9A 2DFPA 2Y76A 1GL9B 3EW9A 1I6LA 3HYLA 3LX6A 4LYHA 3IR7A 2B4YA 5KVCA 4HDQB 1JL3A 4OFZA 3LIPA 4C3UA 1WXDA 1YWGO 1XEWX 1DSSG 3C7KA 2P67A 1ZD5A 4O4HB 3T7TA 2W2TA 1KMCA 2AG5A 4JSYA 4BNYA 1DINA 2Z5FA 4HP8A 2WI8A 6AT1A 2WZCA 3IURA 3FKQA 2W2QA 2G1AA 3BS4A 3R8XA 4GE0A 3WL5A 5LZ4A 1JYEA 1VCNA 4H16A 4OH7A 4QQKA 4S1VA 5EYPB 4B6PA 2JAPA 4XW2A 4FGJA 3IA7A 5EE1A 3AIOA 1J5PA 3SC2B 2QMQA 4XGKA 1LJ8A 1ZGBA 2WWRA 1KR5A 2I1QA 5AW0A 4IP0A 1GGNA 1VL2A 3VJMA 3RVQA 4OLAA 5KWVA 1OT5A 3U7JA 2RHTA 1Y7IA 3C1TA 1G5FA 3QUQA 2VT3A 2VHTA 1EJ2A 3LJKA 2B78A 2P4QA 3OU2A 4BJ6A 1IY2A 1DCFA 3AVQA 4R31A 3WGJA 2AKYA 3TPZA 4ZVSA 5DX0A 5EE3A 3U4HA 2HHJA 4RJTA 1ULZA 2Y6UA 1B3RA 1NQTA 4MV0A 3R7AA 1NLYA 2C3MA 2R8BA 5AKLA 3IOBA 4Q3OA 5FO0A 3W1WA 3WGNA 1Y1SA 3HO6A 1MOSA 3NP9A 4C7MA 3PA8A 1H6AA 4LXQA 3MT9A 3WTCA 4AROA 1X7GA 4J07A 4D4KA 4Z7NB 4PNHA 1ETUA 3I9V6 5HM6A 1JX6A 3UMCA 3BH6A 3UJPA 2QTCA 1RLIA 3HA5A 3S0JA 4HRYA 1CR4A 1ENYA 4WA7A 1ZISA 2PXXA 3FLBA 2G63A 1D4FA 4XFDA 1TAHA 1NPYA 3DULA 2QW8A 3DWIA 4TOIA 2ID8A 3DFIA 3NPAA 4OIMA 3NBMA 3VHLB 4GR4A 1GLVA 1R9GA 2YHAA 3NPMA 4F06A 3FMGA 3IQEA 2EZ9A 1GFWA 3U4QA 5C5DA 1EWQA 2BE9A 2OZPA 3BE6A 3KE8A 1K89A 2HCTA 3OUZA 2W6MA 2SKCA 3RTEA 5THXA 2HI0A 3ZHZA 3JR7A 4HGOA 4ZJPA 2WPDA 2ZB2A 4HNQA 3N2GB 4YRAA 1QYVA 2XT9A 1CUBA 2B0CA 3AGPA 3UWKA 2FW1A 2R2AA 2QS9A 2RI6A 3PS9A 4P3YA 1WCYA 2W00A 1WSWA 1Q12A 4BX9A 3KTDA 1G7CA 4JKOA 3AJEA 4A4DA 3U4QB 3Q8LA 2H2DA 5DLPA 4HLQB 1SM4A 2FXVA 4WGGA 4BNLA 4A8HA 4TWRA 3WO1A 3U7EB 4H0CA 3BMNA 2P6MA 3LOPA 5FULA 3CUWA 4MNTA 1WQ3A 5DBEX 1ZRSA 3FAKA 3LLMA 2ZUWA 2QVBA 4H1TA 3WOVA 1E1LA 4TLDA 5CVEA 5L7YA 1YJAA 1SG0A 4EAQA 4E33A 4HDCA 1SCDA 3O2SB 3KUUA 2DEUA 1JWAB 2ATVA 3FPSA 2QV0A 3QMPA 1PTJA 3GFVA 5C0OE 2JAQA 3WBJA 1SD2A 4LOKA 4XCVA 2V0NA 1PZMA 3FZGA 4GOOD 1ZCBA 1Q20A 1UBSB 4BS9A 4JEHA 1R1DA 4LF8B 2VWQA 1YAHA 3I2KA 4AJLA 2CMDA 5KKNB 3LBNA 2QT0A 1HURA 4MKGA 3ZHXA 3AG5A 2QAJA 2QMOA 4RTLA 4ZZ2A 4DLZA 3AVWA 4YJKA 2VTBA 3AI3A 4LZLA 5B37A 1V5IA 2FOXA 2PV0A 2NYVA 4ZC1A 1TUBB 3F5SA 1YR7A 3D3NA 4LJ5A 3O6VA 4OKSA 1R8JA 5C7OO 2O7QA 1SY7A 1V5WA 4JEIA 2VAMA 5BW5A 4DMRA 2XAAA 1T9AA 5G2OA 1ISJA 4YXWD 4DSAA 3PEUA 3WQSB 3WX0A 3CS3A 4HDNA 3RS4A 4EPTA 2RD2A 2JBAA 2XLBA 4KAAA 5EUMA 5MGBA 2VDUE 4ZARA 1UKCA 3HCRA 2W70A 3ICQB 4EPWA 4YJ2A 1Z2AA 4R8LA 1H2RS 1M2OB 2PLFA 2WFAA 2WIFA 4KNWA 4MAMA 2HO4A 2ISQA 1NT4A 1PUJA 1X1BA 2HIAA 1ZNYA 4X20A 4XWYA 3Q85A 1VG8A 2QWXA 3S5UA 2H06A 4LHXA 1I8TA 3FPJA 3TFWA 4MYRA 1DC6A 4DCJA 3GEIA 3FX2A 5TGZA 5FX2A 5DNYB 5HOEA 3IVCA 4HVCA 5BMVA 4Z9YA 3BJMA 4BZZA 4BUJA 1P9WA 4V0MA 2YHUA 2RAUA 4DY4A 1TTQB 4ZOQI 2J5XA 1DEHA 5T41A 2FEPA 1E2JA 1NR7A 2B8EA 1JBQA 3BFVA 3G9ZA 2X1HA 3WQBA 1JDVA 1YC2A 1L4FA 1UJ4A 2ZRJA 1IBRA 3IP5A 1VSUA 4TZ0A 2ZJBA 5KNDH 4UM5A 4X9XA 1EZ4A 4CMHA 2RGRA 1TCUA 4MUHA 4MICA 5B3JA 1GV0A 2IFTA 1E3MA 2R8OA 4MRNA 5KYTA 1G63A 4MYTA 2G09A 5JXGA 1EG2A 5BYJA 3E3MA 3KBOA 2G04A 3DB1A 1M34A 4ON9A 3HB4X 1CT9A 3RYIB 2O5EA 1BXGA 2JLXA 4KIFA 3V00A 4IXNA 3E9EA 3DNMA 4FMBB 1OYOA 1U0FA 2REOA 1PYGA 4CM9A 1XWFA 3NUGA 4ZMRA 3FGZA 1WZIA 3K2EA 1MO3A 4CKWA 1AGRA 1NNSA 3D02A 1QYCA 2J8ZA 2OECA 4BP1A 3L02A 5EP1A 2FPXA 2KJQA 2VHEA 4FUQA 4ND6A 3ZNQA 3UTDA 4CIWA 4P98A 3W5HA 3KJFA 1IQ0A 4MV5A 3I32A 3ZHQA 2WYVA 4JXXA 1M34B 3R7LA 2NSJA 4EQ6A 3KXLA 3V8QA 4EITA 4K5QA 4AG3A 1IBCA 1BXGB 2A5GA 2W6JD 3BUSA 2Q29A 2NU8A 1PT7A 4G8CA 2TRSB 4HC4A 5JNWA 4JOBA 5ARBA 4YLYA 2YIMA 4D57A 3G7NA 3EIHA 5AW6A 1QVAA 5HKBA 1VPEA 1FTSA 2ORED 3BXZA 4DIOA 2ZIEA 5GQSA 4N7RA 3EGDA 1BXZA 3F3KA 3P9SA 4KXUA 2VSQA 4C4AA 4HJXA 2YWJA 1QH8B 3UZUA 2FG7C 3NV9A 1PZHA 1UKEA 3CZAA 4EQ6B 3C3MA 4FSDA 4U7WA 1RC1A 3E82A 3CVUA 1JQLB 4OQDA 2COUA 1BX1A 4BAGA 1LW6E 1NLUA 1DWOA 4XIYA 1UP7A 2EWMA 2J3EA 3E1KA 4B71A 3WG9A 3UJNA 1YQWA 2BFNA 3V34A 4L4ZA 4EATA 5KKAA 5DLQC 4LSWA 1E2UA 4EY5A 2AZXA 5EUCA 1IZYA 1MGOA 2G5GX 3EGDB 3QE2A 1PS8A 4F6LA 3EVAA 4YRZA 3LT4A 4ZJZA 3A0RB 1D9ZA 3KB8A 3TRIA 4NXMB 3IIIA 1LY1A 1BOFA 3Q5GA 4LZPA 5LYYA 5IANA 5CD9A 1TK2A 1JF8A 3G13A 2IV2X 2BI4A 2XB6A 3LD9A 4MOWA 4A23A 3FMIA 1XZAA 4E32A 3T1HB 2QUAA 3E8XA 3PC8A 4CL2A 1ADYA 3I6YA 3WSVA 5CA0F 2XI4A 2FRDC 1ZK0A 5H5JA 2GXUA 4MWOA 3Q10A 2XUHA 2RG1A 4FDMA 4EMBA 3TF5A 3KYIB 2WHYA 5HMMA 4H77A 4NIMA 3JD3A 4CMEC 1EWKA 3HY3A 5E3JA 1P1KA 2AYXA 2FPOA 4Q39A 4MP3A 4HWTA 4PYJA 1LH0A 1YMUA 2HDOA 1SBIA 2VIIA 3L0ZA 1U8AA 1W19A 2D7JA 1X1TA 4OOFA 4WLUA 3RROA 3TMKA 1OAAA 2HSZA 4XB6B 2P41A 3E7DA 4IFEA 2J0VA 5BOVA 4BMNA 1UR5A 4ARSA 4CYMA 3Q9SA 4RHUA 2DYKA 1SUIA 2A0KA 1PJTA 4KZKA 1NVVR 3ROZA 3PQ7A 4D8VA 5IF9A 1JR4A 5EHQA 4EBBA 1N2OA 1QHGA 2FN3A 3K30A 3IHTA 4PC7A 2YBDA 4ZMSA 2NSHA 1M2JA 3BIFA 3DZFA 4QBHA 4KK4A 1B1AA 5G4KA 3SJAA 1WY7A 5A5FA 1C8KA 5JDIA 3O4RA 3G1WA 3E9ZA 1EP1B 5E6RB 3H19A 2BFDB 4YXFA 5KSZA 3OVMA 4UE2A 3T1QA 3PR3A 4IQFA 3RARA 3KJEA 2DC1A 5DN9A 1N2CE 5BR7A 1OLXA 4HB4A 4X7RA 5AJUA 2WIKA 5TLSA 5BUSA 3E7FA 2YW2A 3ER9A 5LA6F 2I7CA 2VZLA 2KWIA 2R6CA 3BWEA 3DP7A 3HYTA 3MGKA 3SLKA 4P7FA 3RAJA 2J9FB 4OHBA 1Z28A 1X9GA 1SZPA 1LDGA 2W2LA 4QYMA 2YVAA 1IYZA 1UKVY 4Q6BA 3S4YA 1Z3IX 3DEHA 3L93A 3C7DB 1X7WB 3D3WB 4HPWA 3TKYA 2NPIA 3K09C 3PVSA 5H80A 3MXTA 3NC0C 3T1VA 4OQLA 4J94A 4Q3KA 4L51A 3KQWA 2QF7A 3O8NA 3LCVB 1FY2A 3GC6A 4TSFD 4YMLA 2GASA 3OLQA 1CTQA 2ZFUA 3TTXA 2O5RA 4XGNA 2IX3A 1DJQA 4RF2A 4QYIA 4Y9UA 2X7HA 1D8TA 2YNMA 4Q24A 1U1EA 3BL6A 3ZYZA 4C0SA 1ABEA 3QG5A 3AM5A 3JASA 2JANA 3D9QX 1U28A 5HK9A 2QK4A 2YJZA 2FZEA 3ZZUA 2UYCA 4ID3A 4OGKA 4IRUB 5LQJA 1XX6A 4HLUC 5LXTA 2QRUA 1XV5A 1LBTA 1RCTE 2B61A 5AP9A 5EQJB 3TJRA 4UW9A 2WHPA 4YRSA 2SICE 1OBCA 2Z98A 1FLDA 3BD9A 1USGA 3H3JA 4QEZA 1M33A 4QUIA 4RVCA 3C8DA 4M8LA 2Z95A 4BNHA 1NTOA 5D3ZA 5E1MA 1U4OA 4EKYA 2C42A 2O0MA 5LQSA 1R18A 5FTMA 5HQTA 1YI1A 4PSDA 4RM2A 2X0JA 1YMQA 1E7QA 3KBBA 1XPOA 3VR4H 2JFZA 2DAPA 2HWWA 3FVRA 3T54A 1E9EA 2WAMA 4BJ3A 4U2DA 5CGZA 1G7SA 2QN7A 1TLLA 2H2HA 2WHPB 3TS1A 5J4LA 2CDCA 1SGWA 1OIWA 2VQ6A 1SU7A 4FZRA 3WV4A 4WKGA 3A6PC 4B85A 3RPEA 4A91A 4JXZA 1U0NA 3LXRA 1U63A 5LOVA 3E9NA 1JXMA 4J0DA 4NHEA 5CB0A 4RD0A 1Z63A 4CQLA 1ZKMA 2BI8A 1NUHA 1ARZA 3R2JA 4JENA 3CF4A 4LMRA 1XXHA 5TPWA 5AKKA 4HRVA 5ITVA 2QENA 4P5DA 2ZXEA 3BF8A 2Z8ZA 4HLDA 3SX0A 4O25A 1QGZA 2DRIA 3PJDA 1XK7A 4PLZA 4I1SA 2DCUA 2ZE7A 1SQSA 1KQPA 2X3UA 1I2AA 4X6YA 3UOGA 4B6GA 4OXKA 1ISFA 1O95A 3GDGA 1SMKA 3MIIA 1VLQA 5CT5A 1SKYB 3FNHA 3HCAA 3CSSA 4NJEA 2YZNA 4OHXA 1OWPA 4KGDA 1FQKA 4CG0A 5J40A 3FF4A 4LF7B 1IN1A 1TYEB 3K0CA 3ZWYA 4CM8A 3N86A 1I5OA 4JL6A 1T5DX 1XXHB 2QYSA 3WHLA 3WMXA 1ZL0A 5JCOC 3EQ6A 3OZXA 4KMMA 5EOVA 4Y9TA 1GPLA 1Y98A 3OPYA 3IMFA 4AK9A 2ZJ1A 1F7VA 4X85A 4CBVA 4IRXA 1VLLA 2JG3A 2FU5C 5AM5A 4M8NE 1G59A 2HF8A 4ALJA 3AVTA 1G6Q1 2OZKA 4P2BA 4E7OA 3H2IA 4Q34A 5KJFA 1H1LB 1HTBA 1PFKA 1RCUA 2G1JA 2X40A 3ZG6A 3C3EA 1SUWA 3QIAA 3G6KA 1JIVA 3RRZA 1V43A 3UK6A 4DC1A 4NJEB 2XXAB 3WDMA 2P4UA 3DMGA 1RXSA 3CW2A 3D4NA 4H1VA 5DHRA 4CM8B 1GQQA 2YJGA 5CA1B 4DRXA 1MO2A 3MTQA 1CUDA 1LKZA 4R3UC 1AQJA 2O50A 2ZIVB 5AW8A 3OPYB 4IVQA 2DFLA 3FTQA 4DM7A 2YFQA 2IY9A 3VAYA 2ZRPA 5C32A 1DNPA 3ND6A 5TQ0A 3MZ0A 2FDCA 4GWLA 1UDWA 3F5MA 4RCYA 3W5AA 4KR2A 3ONWA 1WEKA 2YXLA 3WISA 2GHTA 1YMVA 4FGZA 1HE3A 2H1LA 2F8MA 4D5GA 5BSHA 5D84A 2JDID 2CNLA 2OKCA 2IZ7A 3Q41A 1PWYE 4LCBA 4UKDA 1T4CB 4U0KA 3FFWA 3QVGB 2NU7A 3UT0A 3GLVA 1EQUA 2Q0QA 4P36A 2Q8NA 2WUWE 4JYZA 1FMFA 1EDEA 4AO8A 4DPLA 2FZ5A 4I5DA 2VPQA 2NV2B 1D4AA 3P0RA 4YQEA 4YROA 5M3BA 2UU9B 3H6GA 3HKEA 2L82A 5HE8A 3VKWA 4DJAA 1T1EA 4KIWA 3RBAA 1VMAA 3L8FA 3W4JA 3JD0A 3WGTA 2P9FA 2XVXA 2ZRIA 4AF8A 4UUQA 1YR2A 3M1AA 3RRBA 4BLVA 3B20A 5FHRA 1VHLA 3TM4A 3ZDZB 3SY8A 3FB4A 3W1EA 1S3IA 4WK6A 3X1XA 4QLBA 2A57A 5TJ9A 4NCXA 1S9HA 3QKSA 4NYIR 1DU4A 5GTDA 4BO0A 4RKRA 1KY5A 1NXXA 5AM1A 2CJYA 3ICOA 4CMKA 2FLVA 2WTXA 4NOJA 3U1VA 3UMMA 5A04A 1SUCA 2XHEA 1Y33E 1V6CA 1CIPA 2VF2A 4UBJA 1D0IA 2O1XA 4TLAA 2VPWA 4YHBA 1ZW6A 4QPPA 1FVFA 5DGDA 4B31A 4XD2A 4A8TA 3OTOB 3PQDA 4Q1DA 1KWGA 4KAJA 1C14A 1PE0A 2IXTA 4LGMA 2DHEA 2G5TA 4ADSG 1CY8A 1A5SB 2BGNA 2POQX 3ZCVA 3U7IA 3TM5A 3QKSB 1AHHA 1PHPA 5I5EA 5JHGB 2R4UA 5HW0A 3Q3EA 3FTNA 4H27A 3N2LA 3M2TA 1XQYA 5JMTA 4FXPA 1VB5A 3E3NA 3QVKA 2XT0A 4D56A 3DO6A 1GZUA 1QK4A 4KVFA 4KXXA 1U1GA 1YE8A 2NO0A 2QLNA 3GWZA 4U7TB 4A1OA 1JVBA 1G4HA 3AEQB 4G6ZA 3HYSA 2AZ4A 4MPTA 2QBYA 1N78A 2AFHA 3V4VB 4QELA 2E0IA 3DKRA 5AI8A 3LF1A 1YBVA 3I61A 5AVRA 3D6FA 2ST1A 3D6NB 4ZVQA 2Q07A 2VJYA 3W7BA 2BGMA 1VE1A 2XBUA 2ZDQA 3QUAA 4PRYA 2WP0A 3FCSB 3DNPA 3L8HA 3KP1A 1YASA 4CEIB 3FFTA 2VQFB 3H0CA 4MI1A 5DX8A 1M10A 2C2XA 5KNBD 3KFLA 3VDNB 2HMWA 4K0RA 1ZCJA 4I1UA 4LDPA 4DNFA 4ZHQB 5L40A 1KFBB 1Y3FE 3K6JA 1XZGA 3WYCA 4GZMA 5ITSA 2WOOA 1IZZA 3HPRA 3G02A 3FDXA 3A6EA 3WNQA 1JMYA 1U3GA 2AJCA 2V5VA 3I8XA 1VE3A 2Q1XA 3U0VA 2B21A 3W2IA 5A06A 2YYAA 4QGAA 3RVRA 1CRZA 5IXYA 2XTZA 3JQ7A 4LHYA 4UUAA 4D41A 4IV8A 2CMHA 1C4OA 2XMPA 4XH9B 5C51B 3IPAA 2V6FA 1GGKA 3TVYA 2COEA 2F2TA 1I7DA 4C5BA 5JSZB 2GK6A 4ZTUB 2HADA 3WTBA 4K6KA 1Y42X 1LV8A 4U7PB 1ATIA 1NNEA 4TQGA 1A95A 3UV7A 3EZLA 3IJRA 5IJZA 1PR6A 2XCTB 5BRJA 4RV4A 5DASA 5TT0A 5IKMA 3K9GA 2AQKA 2VK1A 2B25A 3H42B 1H69A 5AUNB 1B76A 4DXHA 5H02A 2BDUA 2Z9DA 1Z39A 2AF4C 1NBHA 1ZSYA 3OPNA 3RVKA 1XK6A 2GFHA 2HQBA 2ATCA 3WRYC 1X38A 4ZP1A 3RABA 4M0PA 4RZIA 3OT1A 3C48A 5HGJA 4UHCA 5KWEA 4ZAFA 3W4IA 2Q0HA 5LQMA 1CIVA 2OCKA 2HJHA 5EKXA 3VU3A 4AY6A 5B4UA 3INGA 1FMCA 3ZCTA 1TTTA 4MRMA 1C7FA 3PK0A 3R7BA 4GKAA 1BKSB 1Y5MA 2VUSA 5ICMA 2GQ0A 5CVTA 1K06A 2RGWA 1UKYA 1ZCAA 3H2JA 1UJCA 1JR3D 2I6GA 3HN6A 1ZK1A 4DF3A 1ZUWA 4F12A 3K8YA 3HSKA 1UDXA 3U3ZA 1DAGA 3I2HA 4E3ZA 3AQ4A 5K8TA 2P1ZA 5GM2A 1R16A 2AF3C 1DBQA 3M7IA 5KS2A 4TZ6A 1O08A 3VOTA 3ZLVA 2ZYWX 1ZD2P 3ZCSA 5JS2A 2PU7A 3OFND 3PD1A 3OT1B 4DVJA 4DQVA 4HX9A 4L75A 3JALA 2VVTA 2XGMA 5A5EA 4PAGA 5JVDA 1MLDA 3DAYA 3MS4A 1OXKB 3CG4A 4A8JC 1BDJA 1FNCA 1R3UA 2H1IA 4FGWA 4QC2A 3EZFA 3RUDA 3UJCA 4FHCA 4LG1A 2NQTA 3I2FA 1F8YA 2MIIA 3TR0A 1YDGA 2ZW9A 5FRDA 4MA0A 3PL5A 3WYNA 3WKDA 4AW9A 1SVLA 3GP3A 3FSRA 3H9BA 4JLWA 4JKYA 1RAGA 1Q11A 1HNWB 2D3TA 2HWKA 5DN6D 1TAGA 2FR0A 2Z4RA 4LJ7A 3T3PB 1D2EA 6NULA 5DTJA 4IZ6A 4IG4A 2YV3A 3D3EA 2X7JA 1GOTA 4K2HA 2ACVA 1GAEO 2AEJA 4P5PA 4RA9A 5ADVA 4BBPA 1O03A 3I9NA 3KELA 1GTSA 5JXWA 3ET4A 4EELA 1Z0DA 3MJCA 3NHJA 1GM5A 1YJCA 2FOLA 4O1IA 1C5KA 3RNLA 3FWZA 4ZIRB 1NKTA 3SYTA 1NOIA 3IPRA 1OR8A 3JX9A 1YRBA 5DMHA 1BFUA 4QUAA 1E2KA 3LWNA 3NETA 3IUQA 5IFKA 4JSRA 3T5DA 1X7XA 2IY7A 5HCNA 1PJCA 5KQLA 2R8PA 4WESB 1B41A 3DZCA 4XD7A 4Z3KA 2FZWA 3FFBA 4J4BA 1IDOA 3BF7A 1AURA 1PJ4A 2O14A 2EP8A 1QMGA 1GU0A 1I3NA 1NVTA 3AIKA 3AHFA 1M8GA 3P71T 2ZWMA 1OBVA 2IVZA 2V59A 3ND5A 2AMFA 2GCIA 3OP4A 3L6BA 4JJEA 4RY2A 5IKOA 2WBLC 1GPH1 4K8RB 4QFBA 4ESEA 2GVNA 5DRTA 1I30A 2ONKA 5EWLB 1KH1A 4AP6A 3LG2A 2HMUA 3ZD7A 1T8WA 4DUGD 1X7XB 1CUHA 1GQRA 3PGA1 1X9IA 5CLLA 3S99A 5IXSA 3ORSA 1T24A 4GIBA 1C8LA 4W6QA 2V7VA 4GPD1 4PPYA 5CDHA 2PXHA 2XUGA 4L15A 3WQHA 1YR3A 4K6OA 2PH7A 1KZGB 2FE1A 2QSZA 1KEKA 2W93A 1QF6A 1J21A 3ZLBA 3ZXUB 1O3YA 1VPDA 2PH5A 1A5AB 3VV3A 1RC8A 3SC4A 3IE2A 4FR5A 1MV8A 2P9JA 4JB0A 1HLPA 4Y6RA 5AO9A 1X1RA 4BRSA 1OI7A 2XDAA 2YUIA 4ZVMA 2EQ5A 4YMTA 3QV1A 4L74A 3ABRB 4XSGA 3MOSA 4LWZA 521PA 4J6FA 4EPYA 3LRXA 2X3YA 4IJMA 3RW9A 1JE0A 2YTZA 3EXG1 3OE7A 3S1AA 1ZM4A 3DJFA 1JTFA 2KB0A 2P2ZA 1DAFA 1F4VA 2JFOA 1J2JA 1H2ZA 1W0KD 4R98A 3DDUA 5JT1A 1U7XA 2QM7A 3U40A 2C5EA 4I8XA 3DHYA 4OYLA 3BGWA 3R09A 1XJQA 2VRCA 1EUQA 3M5CA 4QUEA 4AX8A 5ERGB 3BXOA 1XD2A 4CV1A 3EK2A 3VPDA 2QNIA 2JLSA 3IULA 4MWEA 3KDAA 4UHEA 4N41A 4QRDA 2B83A 2C99A 5IM5A 4B4UA 5BMVF 4HZUA 1J2EA 2C7RA 3CINA 3U4IA 3RIGA 2JJYA 1WB6A 2F1OA 4N6NA 4BLOA 1K7EB 1H1TA 3NV7A 4PLTA 3UAWA 2BSXA 2PS0A 1HFWA 1EDDA 1Y48E 3CKLA 3COPA 1V25A 5HF9A 2PUBA 2R5WA 4FJ2A 5DT9A 3SXPA 1WP9A 5JFOA 4LHVA 3B7WA 3NG1A 2RBEA 3MJ4A 2R7NA 1GTZA 1JHQA 1NGSA 5AYVA 5I4IA 4IUDS 3TR5A 4Q4AB 2GF0A 1YBAA 3F7NA 3JQ6A 2Y93A 4J4TA 1YO6A 3S27A 4KWIA 5JWRA 1XF1A 1DX9A 3OM9A 3VQTA 1RD4A 1W6RA 4GOMD 4RAQA 4ECEA 3L9XA 2FRDA 1AV7A 2P7HA 2ZKLA 3GFPA 4Z51A 1KL7A 3H2SA 2HHLA 2WF9A 4K40A 5G02A 3LDUA 4DLVA 1VMDA 3E03A 3M89A 3MTDA 3NOXA 3PHBE 3ZKWA 3B8HA 3RS3A 1U6KA 4CMEA 3LCUA 1T9DA 1TCCA 2BHLA 2QL9A 3K8QA 1COWA 2DWUA 3LGSA 3TZKA 4ZKDA 3LC1O 2WM9B 1G7TA 1OF1A 2X2PA 3KX2A 5MHTA 3TW8B 5KNDA 3SVZA 2E1PA 4L5CA 4IJUA 1MZPA 1G1AA 1X92A 2DFKB 3F67A 2FFAA 4RIEA 2R66A 1R12A 3OLWA 3NEYA 3T8YA 3M34A 2Y1GA 4HV4A 1IN8A 2IVFA 2H1WA 4OM7A 3A4LA 3L82B 4R2HA 4H35A 2OM6A 2VLIA 2WKRA 3P1JA 3GZNA 5H59A 3II6X 5TMEA 1XPRA 3DOOA 2I66A 4GOJA 3GLFB 3O84A 1XZEA 3H3FA 5JWHA 2H2AA 4FGKA 4FHGA 3EIWA 3WZ2A 5C1DA 3BJIC 3HB7A 1REQB 1Z7EA 4QBKA 4B43A 4ZCLA 4P93A 3MPOA 1Q5PA 3S55A 3ZZ1A 1QM5A 2A3NA 3HNPA 1LPNA 7YASA 1ESNA 1E3SA 4G4SO 3OAAD 2ORYA 3C3PA 3UB2A 1HTTA 4AULA 4DMCA 1W5FA 2MYNA 2ERXA 3OFKA 3WRWA 2DFVA 3EF3A 2CYBA 1J5XA 1B4DA 1UINA 1ML4A 2CK3A 2X4DA 3JVUA 5D7NA 1W30A 3MJFA 3AVVA 4TTSA 4NBLA 1P2SA 2QZ4A 1KJ8A 4FCTA 5FA8A 1VIDA 5MDHA 3L1IA 1V7PC 5CFNA 1YF3A 3K09A 1HNXB 2NO9A 2D1RA 1CHDA 1UBRS 2PUWA 2SNIE 1YSCA 1WCXA 3IMCA 2PX2A 1RRGA 4WY5A 1T0PA 2BFFA 2GYWA 5JJ5A 2ZB8A 3VTAA 3TIGA 4CG3A 1ZOPA 2GA8A 4N5MA 5LZ9A 1EXDA 4QVIA 1B16A 1MT0A 2NPOA 2WG1A 3HYRA 2JJQA 2W22A 3GLQA 1TVCA 3ETEA 4JA0A 3U5ZB 4V3BA 5EKSA 1X3LA 5DM2A 2HXGA 2H57A 3A28A 2F3QA 4TX1A 3HXMA 2QA5A 4A6XA 1L4BA 4M76B 3K0KA 3WL6A 4E22A 2P5TB 3G2QA 3CPEA 1DS6A 4F11A 3U7GA 4HLUA 1RADA 4AJNA 1O0BA 3KS9A 3ZTTA 3TL3A 2BFFB 4KV9A 3AEUA 3D6HA 3UPUA 3GA0A 1QG4A 1LC0A 2LCQA 3VZDA 1PTKA 1EHCA 1VKHA 4LQCA 1NKSA 4PSAA 4CLXA 1QLHA 1E4EB 2JGEA 3DQPA 3VC2A 2CDBA 5EIBD 3ODGA 3MBKA 1WDTA 2W6OA 4IDBA 1NVVQ 1Z35A 2EDCA 4IJ5A 5JRZA 3DM5A 3T7AA 5B1DA 4RD4A 1K2WA 2OV1A 3PQ3A 4ALLA 4D7AA 1C7JA 1CJUC 3UJ6A 5CVCA 5IBCA 2ZSUA 4GPZA 4RFSA 2M6KA 1DQSA 3FNRA 1BWPA 1ZN7A 2Z3WA 2B30A 3W8RA 1GFIA 4PYIA 3C5WP 4HWKA 4QQRA 4IJVA 3PPIA 2OD7A 4YRCA 4HEHA 2IHBA 1AGXA 2P6OA 1BFDA 1PEKE 3MS2A 5C5CA 1JS1X 4AZ3A 3H4TA 1N2HA 3FTDA 4F4HA 2PL9A 3KWLA 3MGAA 3GBPA 1ECJA 3H11B 2C2HA 3I6BA 4JBGA 4PLWA 2Y6VA 3PNQA 4RFSB 5IYZB 3G2JA 1E1RD 1UPXA 1GQFA 1VHWA 4TKMA 4J7UA 3W5UA 5JEDA 4Z1MA 4JP1A 1QFYA 2LVBA 3K6SB 5HJ7A 3QNWA 3TGLA 3GRFA 1ZN2A 4MRVA 4KGXA 4AAYA 4G9EA 3USES 3RIEA 1E2HA 3R9WA 3TFOA 3GR6A 4RA6A 2A86A 3J81k 3GDOA 3M5WA 1T2DA 2X0NA 3W2HA 1ORWA 1GPJA 4LDJA 1B3BA 4H7KA 4TXMA 4AMYA 3T1TA 1KOGA 2OBMA 1TZCA 2JAXA 1E4OA 1TJ5A 4PXAA 2H5LA 4EO7A 1L7MA 1NKVA 5LXTF 3AV0B 1Z0FA 1Q74A 2OLKA 2FPWA 2TMYA 4M8SA 4ENPA 4R9SA 2X86A 2OBLA 4IDOA 5I4BA 5BSTA 1PFWA 1TGVA 2JPDA 4EY7A 2R6JA 4P58A 4GX1A 2D4HA 5CG2A 4EW1A 4RA6B 5FBRB 2ZWIA 3BZBA 4HWSA 4MZDA 4QU5A 4RMNA 2REBA 3GELA 1PVVA 5BN4B 4AY4A 3GBVA 2YOFA 1TMKA 4LJKA 4NMHA 3AFGA 4YVFA 4ZCMA 1C4KA 5DBFA 2WJ3A 3FSGD 2EHJA 5FPPA 3MCVA 3KR2A 1YBMA 2J6IA 5FJJA 5AW4A 3UG7A 2GWHA 3G2PA 4JWKA 4QPDA 3UAZA 5B6PA 1I7PA 1NOJA 4PRKA 1SAYA 1PCXA 3BHNA 2V7PA 5BNFA 4G5GA 3F78A 5K05A 2Q5FA 5LOVF 3DMFA 1V95A 2W71A 4KR7A 2FAXA 3VR0A 1J8MF 1Y9DA 1R8YA 1CHNA 1RRVA 1JHRA 1P1HA 3A9WA 2Q50A 3VMFA 1H5NA 4WZ6A 3I5MA 2VWGA 4CJXA 4E07A 1IM8A 3IUYA 2B3TA 4PX9A 3H5IA 3KWFA 3KKKA 4H4DA 3P9RA 3ACBA 3QU5A 2X2FA 2HQ1A 1XMOB 2C5SA 3I6IA 1VJTA 4PLHA 2XTMA 1CVLA 3M4ZA 5ALZA 4JCCA 3BEOA 4LOIA 3VR4A 8ADHA 4JJ4A 1THTA 1MB2A 3GCXA 1WVMA 2R47A 3CEJA 1Q1EA 3HQ4O 1P5FA 3NTLA 2A5LA 1V47A 3EEYA 4QL3A 5A4JA 1JA9A 3Q2IA 4Y2RA 5CDUA 2X0FA 1MC8A 4MLDA 4XM2A 3FNGA 4J0EA 3PUZA 4MHTA 1K8ZB 3OZVA 1T5TA 1K2VN 3WFZA 1QVZA 3I34X 2PSDA 4CM6A 2CL6X 3BK1A 3NFRA 2CXPA 2GN1A 1ICEA 4E2XA 1I13A 2CMGA 5GJBA 3U7QA 1DHRA 4I2NA 4OFXA 4S1PA 1G21B 4Q4CA 1JZTA 1YZNA 1DWQA 3BHMA 3OJEA 5AKIA 3AJDA 1ATZA 5DW0A 3VZCA 5JW6A 3CWCA 3TOCA 4ZAWA 4OGWA 1HGXA 1KMIY 2RFLA 4JT4A 4OQ4A 2BI7A 4YI5A 2XNSA 1DJNA 1E60A 3QOYA 4B40A 3Q8MA 1E6LA 4FUTA 5F78A 4RH0A 1JFLA 1EFDN 3BSFA 3K9QO 5EQDA 2O3RA 3JWJA 2WB4A 3PFWO 3W2TA 1O1YA 4B7AA 2FMFA 5E9WA 4HVLA 4ER6A 1SOVA 2G4LA 4BL5A 2RGAA 1CP2A 1XU9A 1SG6A 4DSTA 1MB0A 1RZRD 5KDDA 3G0DA 1QH0A 1T9BA 4MWTA 5JPCA 1BG6A 3FHTA 4BB0A 2F55A 2IPAB 4H9GA 5K6AC 5BVGA 3HABA 1U0BB 2ID4A 3CC8A 2I80A 3L4EA 2NV0A 4LS3A 3SS7X 1ML3A 2DTXA 2BGIA 5IZ4A 4ZEXA 2F90A 1F3LA 1ZJWA 1W0JA 1NUQA 1OZ0A 3DYVA 3ZIAD 3ZWXA 4YHHB 3UGJA 3WSWA 1MOZA 2HJVA 3MRVA 3WIUA 5LD2B 3HK2A 4AYWA 2XY4A 1U7OA 3CLUC 3T95A 1IHXA 1Y5RA 2E4YA 3HJAA 3R4VA 1PD0A 3EIUA 4KXQA 4QREA 1JDUA 2NVUB 1CU1A 3LPMA 5AJWA 5BVGB 3ADOA 4YRMA 3AJRA 2X0DA 4ESOA 5BSFA 2QUIA 4P54A 3DG9A 1QP0A 2B1GA 1VA5A 5K7SA 1QTIA 2H1HA 2I7XA 4FMDF 3GLHA 4BLRA 3CO5A 4LOHA 4CEHB 1GAXA 1HT2E 2ADMA 3ZWOA 1A69A 4GYYA 3VZSA 1NQOA 5ERYA 4XDHA 2SECE 3UFBA 2H1OA 1CY0A 1A2QA 1IDN1 3G0IA 2ICAA 2P9EA 2PQ2A 3L1HA 3RFXA 3OESA 1IUNA 2EJCA 3ZJ5A 2AFIB 3PEWA 4TSRA 3LUKA 1R3DA 4HDSA 3RRNA 1I0LA 2DB3A 1NW3A 4M53A 3AFOA 3KZMA 1L7AA 1KI1A 1MUUA 3VU8A 4MMYB 2GN4A 1U3CA 3KTAB 4XVHA 2D13A 2JRCA 1B2RA 1J0EA 3CBQA 4I9NA 3NHBA 3VSAA 4BMVA 3LBFA 5I9MA 3COZA 1L1QA 2LBPA 3I76A 3MMSA 5FA6A 2I62A 3GLHB 5C3UA 2NYUA 2N0SA 1LI7A 2V4MA 3AB8A 4YRGA 3HHPA 5ADUS 3HA7A 4GNKA 2XBMA 4WKNA 4A92A 4G86A 5FUMA 1C29B 4GSLA 3W8FA 4BYMA 4E6EA 2IXDA 3F6CA 4QNNA 2NXEA 3VOBA 4ALNA 4DZRA 2P40A 3B3FA 1HYQA 5FV4A 1JEEA 3WRYA 3BL8A 1KTIA 4XFKA 4W8GA 3R0IA 3DT6A 2QRHA 2PBLA 3CRRA 3WYBA 4FNOA 4C7XA 1H4SA 3QNMA 4JJ8A 3K4PA 3HKDB 2Y67A 1W5TA 3SGLA 1KH2A 4MP8A 3WBKA 2X41A 3AR6A 3GUCA 4P32A 4OJKA 1HORA 4GC9A 3PP8A 3AH8A 2PCLA 4IINA 3VC3A 1O9HA 3B6KA 4ZT7A 4NBSA 1FBTA 2VLBA 4OK3A 4LWQA 2XV1A 3GT0A 3G0CA 3CT4A 1SCUB 4PYRA 3HB1A 3ONEA 5KWJA 1PJRA 4KXYA 4MDFA 3PKJA 3LF2A 3VVBA 5EZ5A 1NW9B 3W7VA 1MQAA 5LZ8A 2G9RA 2Q3BA 3F46A 1N6NA 3E1SA 1FF9A 4PONA 4XX1A 2BHTA 4MJ3A 4QDKA 4ZU6X 1VI6A 4F3NA 4A8JA 4PS1A 5BV1A 2IHUA 3JYQA 6GPBA 1QIKA 5EY5B 4HSEA 4YRIA 3TFQA 1QTQA 2ZUSA 1Z2OX 4EYSA 3V97A 3L41A 2WKSA 4HAOA 1I9CA 1AE1A 3OE5A 1VPTA 2CFRA 3PITA 4GQBA 3WGOA 4EB6B 1Z8DA 3ICPA 3O8OA 5J4YA 2EW2A 2VH1A 1JHUA 2QZ9A 1FL9A 3OHSX 4KXMA 5D6OA 3WK7A 3FDJA 3AU9A 1BVHA 2IP1A 3I4LA 3JWEA 4A8JB 3RKSA 1Z08A 1WJGA 1LRLA 5CBPA 4B6OA 2I1WA 4KLZA 2FGKA 4P34A 4AMBA 1VYTA 2BMFA 3BTOA 3KK0A 3O9MA 1JNYA 1XP5A 2C3UA 3EVFA 2XDYA 5G1PA 3ZK9A 2EERA 3QSYA 1WNTA 3TEFA 5AW9A 4PZPA 1L7RA 1FPQA 1EVZA 2W43A 4D9MA 5I8PA 1KDVA 4E5NA 5CW2A 1GUAA 1SUAA 1YQXA 3C1OA 3O47A 4PQFA 4CGYA 1AQIA 5L4NA 3F97A 3KETA 3HM9A 3X1YA 2PE5A 1E3IA 3OTGA 3OE1A 4NYMQ 1KMHB 3JATB 3A1TA 4QEDA 4DLPA 2QTWB 5CBPB 1WZUA 2GH1A 4O4IB 4UE3S 1E6UA 3I53A 2AJTA 4J7XA 4CHGA 4FEAA 1PGJA 3ADDA 3MCAA 4K0KB 3T3MB 1LXCA 1ZG3A 4HB2A 2WMYA 3UB3A 4G8BA 3AUXA 1JG3A 2R00C 3BRWA 4HD8A 4LHSA 3BVPA 4OHOA 4UARA 4L9RA 2DQYA 5A5GA 2KLBA 3ABSB 1PIWA 1W25A 3SMQA 5DBIA 4MV8A 5H16A 2P5UA 3O4FA 3OCXA 1P0PA 5HDBB 1YS2X 5JVDF 5AMXA 2R7LA 3DS8A 4LRSB 3ZVMA 2BLNA 2WICA 4AY3A 4CKCB 5K0BA 2HB6A 3DF7A 4J75A 4LZAA 3NM5A 4TRJA 3FHLA 3NHMA 4WLVA 3ZJ4A 4CN8A 5BNWA 2FW7A 2H4XA 3HFSA 4AWXA 5HIAA 5KNLA 3BL5A 2CUKA 7AT1A 2VG8A 3MYRA 4KO2S 1H2XA 4M83A 1OV6A 4I55A 1UOPA 3NBZC 1JEOA 4XSHA 4CKZA 1DCTA 2OE2A 1FTNA 5CJ2A 5JJIA 3EGIA 3IAHA 1KK0A 3GROA 3HDJA 1CQZA 1T4MA 1VE9A 3F74A 2J3MA 3PNPA 4A0HA 4JP5A 4BEBA 3G89A 4KG7A 3IVRA 8GPBA 1I51A 3KYDA 1CUCA 4BCCA 2GZRA 5MN5A 1YB2A 3OCWA 2RH8A 3D4BA 1Y3AA 3NT5A 1PWXA 3NH6A 5C18A 2PSFA 4KH0A 3FPKA 1C9YA 3HZZA 4MKIA 4I55B 4YV1A 5EJ7A 1ZIYA 4E5UA 4JROA 2QT9A 3HUDA 2ZT6A 3CNHA 3E6AA 2PX0A 4LJ4A 4G9GA 4UAJA 3TD6A 3PUVA 2VRBA 1WPGA 3CGGA 3CX6A 1AUXA 1BS9A 2HZBA 1WM1A 3MM4A 3QXGA 2EJWA 4Q01A 4BASA 1R15A 2AK2A 4P38A 4ZKEA 3VTZA 1EI9A 3BFKA 1GA1A 4YUAA 4H6WA 1XEAA 1R4AA 1M5UA 3TE7A 3HV2A 2MDTA 1GKLA 3JYNA 3TKAA 4FEEA 1N9GB 4BZPA 1JB9A 1Q77A 4R4JA 2FEWB 2J4DA 1E1CA 2IZ6A 3ITKA 1JFFA 4Q3DA 1KGSA 5DYWA 1Q0UA 1M0TA 1Q6YA 4AS1A 1GKKA 1G7RA 2ZJ2A 1R9NA 1QFSA 3L92A 4BJ5A 3LVBA 3QKRA 2JLBA 2D5IA 4OBWA 1O97C 5HNKA 4URZR 5CFRA 4O0MA 1UPCA 4ZVLA 4CR7A 3M33A 4DGSA 6YASA 3C3AA 3LT1A 2YWBA 3OT5A 1HL3A 2AQHA 1XDGA 4LI3X 2E18A 1JXOA 1YUBA 3DE5X 3QVMA 4JL5A 2GILA 3DONA 4EX7A 1HKUA 4CL0A 3FKJA 1JFFB 5FBQB 4HDRA 3WY9A 1QIFA 1QORA 4HATA 5LMCA 5EP4A 3K1JA 3FCXA 3QKRB 3S2SA 1KFEB 4MUNA 4QOIA 4OHZA 5IS2A 1F1JA 5KWSA 1EQAA 1SCBA 1Q7GA 1ZFNA 4F4FA 4KPYA 2G1KA 4DIBA 5E0KB 4BMSA 1P7VA 3D31A 3N0VA 4GXRA 4M3NA 3U56A 4PBRA 1SHTX 1M8PA 3FLAA 2GRAA 2AJLI 4WV3A 1RI3A 2O3UA 1E6MA 3M81A 4V38A 4ZTBA 1SR8A 2OUKA 2Z9CA 4GO1A 4Y2JA 3A7DA 4C0WA 3AR3A 4HDRB 5BRAA 4R1PA 1E1QA 4M6WA 1WOMA 5DIFA 1JQAA 1V16A 3KT0A 4NG4A 2A1UA 2L18A 2ZJZA 2PR2A 4YJGB 5FO1A 4BIIA 2QD3A 2P79A 2FPPA 1SUFA 4Q9DA 4C03A 4EI2A 5DHAA 1Y3HA 5I01A 1RFGE 2BC9A 4QXPA 3SPXA