3KHTA

Crystal structure of response regulator from hahella chejuensis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
132
structure length
132
Chain Sequence
b'SKRVLVVEDNPDDIALIRRVLDRKDIHCQLEFVDNGAKALYQVQQAKYDLIILDIGLPIANGFEVMSAVRKPGANQHTPIVILTDNVSDDRAKQCMAAGASSVVDKSSNNVTDFYGRIYAIFSYWLTVNHCQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
publication title Crystal structure of response regulator from Hahella chejuensis
rcsb
source organism Hahella chejuensis
molecule tags Signaling protein
total genus 46
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3khtA00
1KMIY 4ZPJA 4ZYLA 2W42A 4ZMRA 2PUEA 3CHYA 4E7PA 3CZCA 3MQ4A 3HZHA 1JHZA 5DLEA 1QNLA 2GKGA 3LTEA 4JOQA 1VPWA 3Q15C 4KQCA 3CG4A 1BDIA 4MAAA 2LBPA 4JA2A 4NICA 5HKOA 3IP9A 2HQBA 2FMFA 3KLOA 3SG0A 4HNSA 4LRQA 2ZWMA 4OLAA 3L49A 2FQYA 1JYFA 1Z15A 4PYRA 3LKBA 5DCLA 3O2JA 4MR8B 5TQ2A 3C3MA 2QU7A 3QELB 1PHRA 1ZITA 4H60A 4WUTA 3OLXA 4Z9BA 1DRKA 3LUKA 3G1WA 3IPCA 3CRNA 2F8TA 4ETIA 4RKQA 2WRZA 3DLBA 4XARA 1KGSA 2E4YA 2R4QA 5JS1A 4DADA 3TB6A 1NTRA 3F6CA 3JPYA 3LUAA 1WETA 1YMVA 1AB5A 3H1EA 3CZ5A 1TVMA 3W9SA 3GA5A 1A2OA 4N0QA 4S05A 3C97A 3MM4A 3C3WA 4WZZA 4Z0NA 4OLBA 2R47A 1URPA 4TLMB 2WJAA 2PUCA 1DBPA 4RK6A 3OLZA 3JTEA 4OG2A 1MAVA 2FLWA 3ROFA 4F06A 3N0XA 4WWHA 3I5AA 3OM0A 3RVKA 1W25A 4N41A 3LUJA 4RY8A 4L4UA 3O74A 2FTKE 4LZLA 4Z4EA 2XDYA 2E4UA 4Q6WA 2PMCA 3JVIA 4RK7A 5IULC 2IPNA 4KZKA 3M6MD 1U04A 4OATA 4YV7A 4ZMSA 1DCFA 2LP4Y 1NXOA 4MS4A 1EWTA 3QX8A 1JDNA 3A0UA 4RXMA 1DC7A 2FN9A 1NXSA 1NXVA 3QLVA 3E61A 3GWGA 3B2NA 5IUKC 3C6QA 2L18A 4RXUA 3GV0A 4WXMA 5TPWB 4MQEA 2H3HA 4MRMA 3GBVA 3GBPA 1E2BA 1Z17A 1ZN2A 2FQWA 3IDOA 5CNKA 2JBAB 4F8JA 3OQNA 3HM9A 1Z16A 2BGGA 2RJNA 4WT7A 4D6YA 2QXYA 3LMKA 4W5TA 2HPHA 5HSGA 3H5WA 1QQBA 3EQZA 1U2QA 2IKSA 3O75A 4IMIB 3KSMA 2KYRA 5TPZA 2WB4A 3I42A 1LJLA 3BREA 3KG2A 5B3JC 3N53A 1JBEA 1YS6A 2FVYA 4QPJC 4ZJPA 1GLGA 1LBHA 3HJFA 2HQOA 3D02A 4OBBA 4L85A 3EQ2A 4XAQA 1QMPA 1F4VA 5GOTA 4CBVA 5BQ3A 3HDVA 3QEMA 5FWYB 3CTPA 5EWLA 3QK7A 1RZRA 2LIVA 3BILA 3NNDA 2F8SA 5GQSA 1M5UA 1SXIA 4G97A 3HXMA 1JL3A 4YO7A 5I4CA 4E7OA 5ED4A 1E6MA 4EYOA 2L17A 4LDZA 4KQ9A 1ZY2A 2MYNA 2QR3A 3H1FA 4YP9A 3FFWA 1S8NA 2E4VA 4MS3B 5EWMA 2GI4A 4PZ0A 2IPLA 3EJWA 3NNSA 4FB4A 2PLNA 3SQNA 1A0OA 4FE7A 4TN5A 5CNIA 5FBKA 3FFXA 3JS5A 2FMIA 2WMYA 2GBPA 2QV0A 4G0ZA 2I6FA 1SRRA 3HS3A 4MLDA 5IEBA 3N75A 2A9QA 2E4XA 4G0OA 1A04A 1C4WA 4M88A 4XLTA 5IUNC 1JLKA 5JNUA 4RS3A 3CU5A 3CNBA 1QO0A 1ISSA 3RVLA 2FW0A 3EAFA 9ABPA 1JFTA 1EFAA 1FFWA 4ML3A 3SAJA 2MYPA 3JVDA 3KKEA 1D1QA 4DQDA 2PAFA 2QSJA 3LOPA 1QPZA 3QLVC 5KC9A 1TM2A 4EUKA 4RK4A 3T6KA 1P6QA 1YK0A 1K68A 3H1GA 2FLKA 1P2FA 2M98A 1QKKA 3N8IA 3G85A 4RV5A 6CHYA 1U2PA 1Y1LA 4KK3A 2PUBA 3MYYA 4G0XA 3JY6A 1BA2A 3KYJB 1MIHA 1NXTA 2R25B 3I09A 4MR8A 5KC8A 1FFGA 4D74A 3QELA 1E6LA 3TX6A 3MF4A 1GCGA 1XHEA 1DG9A 4NV3A 3SNKA 3SY8A 2FEKA 4W5NA 3GYBA 3EGCA 1NXPA 1DCMA 4RDCA 1APBA 1M2FA 1QP4A 1ZH2A 3LKVA 1PEAA 4MQFB 2JVIA 3H75A 1Z18A 1NXXA 1E6KA 1D5WA 3EODA 1DZ3A 5E3JA 3RVNA 2PE5A 1FFSA 5EWJB 3L6UA 3KTOA 2MYTA 4IILA 1SXGA 1M2EA 2HSGA 4O5AA 4N0PA 1ABEA 3FFTA 4RY9A 4F12A 4YCSA 5DTEA 4LE0A 4RZSA 5D2CA 2ID7A 2A9PA 1RXEA 2WY2D 2MYUA 1FQWA 1GUBA 3A0RB 5PNTA 2YHAA 5KQMA 2JVKA 4Z4GA 1P6UA 2LUOA 2NT3A 4Z9AA 1C0EA 3TD9A 5F64A 2JCGA 4WXEA 3F7NA 5JNSA 3RVMA 4RK0A 3ROTA 4D6XA 2PUAA 5JS2A 3HK2A 1PUXA 2QVCA 3T95A 3N0RA 3RVOA 4O1HA 3HUTA 3Q7SA 5FWXA 4JASB 1TLFA 4MR7B 4MR9B 1YS7A 5CHYA 4KVFA 3RH0A 5JNTA 1JFSA 5TQ0B 3H5LA 4YR7A 3O21A 5TPWA 7ABPA 2JBAA 6ABPA 4RKRA 5KQPA 4N76A 1YTUA 3SM9A 4RK1A 2RGYA 3BBLA 3DBIA 5IUJC 3IP5A 4Z4CA 4MLCA 3O2SB 2QZJA 4GNRA 1ZDMA 3HCWA 4P1ZA 2V0NA 4MQEB 3RVJA 5C5EA 3KCNA 1GUDA 4ETMA 1ZESA 3OLVA 4LE2A 5DKFA 1RNLA 4KRFA 3KYIB 3H5OA 4EY3A 3HDGA 1SXHA 1LBIA 2PL9A 2PJUA 4PE5B 4YGXB 3O1IC 2CWDA 1TMYA 4LDAA 1GCAA 2O20A 4PEVA 2N9UA 4YLEA 5KI6A 5T3YA 1YIOA 3HV2A 4MS1B 1MB0A 3DGEC 4RK5A 3MA0A 3O1JC 4JB0A 2FMKA 3DZDA 2J48A 2QW1A 2CHEA 4HYEA 1M5TA 3KS9A 1YK1A 4N03A 3IP6A 3QEMB 3OQMA 1CHNA 3IPAA 3CLKA 2Q5CA 8ABPA 4Q7EA 4MS3A 3CS3A 3MMNA 1U0SY 2IPMA 3R0JA 4Z4FA 3LFTA 4IGAA 4P98A 4YS6A 3OM1A 1DC8A 4KREA 2TMYA 3Q7RA 4KV7A 4HNRA 1J56A 3URMA 1L5ZA 2M1ZA 4KMRA 1XHFA 3HSYA 1Z26A 4QYMA 1HEYA 3K9CA 3DLHA 1QQAA 3K4HA 3FMVA 4EYQA 1EWVA 1JDPA 3RVSA 2PL1A 2IDMA 4IMJB 1P8AA 5JNVA 4JB2A 4RSMA 4G0MA 1PEYA 1ZGZA 4W5OA 1DRJA 1R8JA 4G0YA 3NBMA 5HQJA 1USKA 4IRXA 3OLWA 1XWWA 2X7XA 2NZVG 5DGCA 1RPJA 4KFCA 3HO1A 3KLNA 3NHMA 1BDHA 1OXKB 2JRLA 3HEBA 2NUBA 4RWEA 3M9WA 1EAYA 4Q6BA 3N0WA 1VKRA 2IOYA 4MGEA 4UHJA 2IYNA 4KK4A 3H6HA 4G86A 3QLUA 1MB3A 1Z13A 3HVRA 1ISRA 1PNRA 3OLYA 2WJWA 5TQ2B 4NCBA 3F73A 5CNMA 5B3JA 1W9HA 2H0AA 3I45A 3O2QB 1VRVA 4W5QA 4TMYA 4MQFA 3GT7A 4RY0A 4TLLB 3VNBA 4YWHA 3EULA 1BDJA 3H5TA 3E3MA 3H5VA 2P9HA 4RU1A 5EWJA 3IP7A 3RVRA 5C5CA 5BR1A 2B4AA 4O1IA 1JWLA 4G0PA 1YMUA 4H3HB 2L2QA 1QP0A 3LUHA 3LUGA 2PKXA 3Q41A 2OENG 2A9OA 5ABPA 1U8TA 1B00A 2FEWB 1JYEA 2A9RA 5FBHA 4EGSA 5T7BA 4S04A 2FSPA 4KPYA 5JNRA 2MSWA 1BVHA 3RQIA 2PUGA 1DBQA 4FE4A 4JAVC 5TQJA 3H6GA 5TPZD 3NNNA 1PNTA 1USIA 1VLZA 5IX8A 1H9CA 4ETNA 2E4WA 1K66A 4Z4IA 3DGFC 4QICA 1OXBB 4EVQA 1RXIA 2FQXA 3LUCA 1Z2EA 2IPAB 4UHKA 5IC5A 5KQLA 5KWSA 5CNJA 1CYEA 3VNAA 3LUDA 5JNWA 1MVOA 2CHFA 3CKMA 2YHBA 3OO0A 4HNQA 4XXHA 4MR7A 3OMXA 1FSPA 1JH9A 1KRXA 2GWRA 4MR9A 5HM6A 1RZRD 5KQGA 5TQ0A 3EDCA 3FGZA 3QEKA 1D4ZA 3M9XA 4MS4B 4XASA 3S99A 2MSKA 3LUFA 4F3TA 2FEPA 2ZAYA 1YVUA 3OQOA 1JX6A 1F51E 5BRAA 3D8UA 1EWKA 2ID9A 1SD5A 1DBWA 2FN8A 3NHZA 2RDMA 4Z99A 4F11A 4QYWA 5FWXB 3P9YA 3RVPA 2AYXA 3UUGA 3ILYA 1KRWA 1IIBA 4GPAA 2VUHB 3H5IA 2RJOA 4LE1A 1NY5A 2FXIA 4MRMB 1DJMA 4EVSA 1T34A 4MYRA 4PICA 3RVQA 2LPMA 4YRZA 1EHCA 1JF8A 3BRSA 2PUFA 1Z25A 2JB9A 3CFYA 3GRCA 4B09A 4N47A 3T8YA 3BRQA 3UK0A 5TE9A 3FDFA 3UKJA 3QLUC 5FWYA 1ZGGA 1TJYA 4G0QA 4XFKA 2NT4A 3QLTA 3A3KA 4IF4A 1QO0D 5IBQA 4EVRA 1JFVA 1ABFA 1Z2DA 2CD7A 1ZHHA 3A10A 2MSLA 4H3KB 4OTZA 1DCKA 2DRIA 3KHTA 2JVJA 4MS1A 1AB6A 4EYGA 5BRJA 4NCAA 3O1HB 2R48A 2FMHA 2OQRA 4RXTA 3Q9SA 1ZH4A 2P4UA 5EWLB 3MIZA 1DP4A 1D2AA 2AYZA 4DN6A 2VYCA 3TO5A 2VK2A 3TMYA 3ILHA 3CG0A 3F6PA 3OO1A 5IEJA 4LX8A 4KNYA 2E4ZA 2QVGA 2JK1A 1USGA 2VUIB 3OMWA 2FKAA 1UDRA 4W5RA 2GX6A 3GL9A 1L5YA 2HJ9A 1I3CA 5EWMB 1BAPA 3N6VA 4EYKA 2B1JA 3C3KA 3T38A 1ZAYA 1LJUA 4Y9TA 4Z4HA 1NATA 1NXWA 1CEYA 2L19A 2NZUG 1QP7A 3HUUA 1Z12A 2PUDA 2HQRA 1ZVVA 1LK0A 3JPWA 4NQRA 1D1PA 3KJXA 3Q7TA 4JP1A 3QX9A 4MPTA 2WWVD
chains in the Genus database with same CATH superfamily
4K6MA 2D0IA 2FPMA 4DMMA 3JZIA 3VYVA 2XNCA 4L5YA 2PMKA 4TKMA 3TZQA 3ZWWA 4V1CB 3SS9X 4ZCIA 2REQB 3A6EA 3QI2A 4EBBA 2PBZA 2BFWA 5ALRA 3M6WA 2HJRA 1M34A 4RPJA 4OHKA 1P2TA 4Q4JA 1H8HA 2PQ0A 3T3OA 1IBCA 5IKMA 4TKUA 5BOSB 3KYDB 4MWTA 3V48A 1VPVA 1L4KA 3AH8A 3GI1A 4HLNA 3SG0A 1R0CA 2PS3A 1ONSA 2OAGA 3I1YA 4HYYA 4URHA 2GBLA 3E8XA 4UBJA 3X0DA 3NHPA 1JH8A 2NSYA 3B5EA 3AVPA 1R5NA 1ST2A 3F4KA 1M74A 5JBNA 3HCRA 5KWEA 1VCMA 4WI1A 4WUTA 5BNTA 2Z1MA 1MG5A 1EZ1A 5HJ7A 3SCZA 4C2UA 1P7VA 5IVHA 3GGJA 3TUJC 4HVLA 4AIIA 1XYGA 1EQAA 3IA7A 2E4YA 3TQFA 3JQFA 4CKWB 2XJ4A 4UE3S 3U0BA 4OV6B 3A1NA 4DNPA 3F6CA 1MVNA 3GRYA 2YVLA 4LC1A 1JLHA 4AMYA 2VR1A 1WW8A 1Y34E 1ZUIA 4AJLA 4P93A 3D6TB 4J1SA 1HFKA 1LS1A 1ZUNB 3W9YA 5JSUA 2CF6A 4Q37A 3H6KA 1Y42X 4WZZA 1N2HA 4WKGA 1E6EA 3PUVA 5H5JA 2B5OA 1XTPA 2GILA 4BAZA 1XAGA 1BN7A 1LF5A 3I64A 4E5MA 1Q0LA 3S1SA 3NVAA 4YRKA 4KP7A 1LDMA 2ZSEA 4H27A 1TOAA 5AESA 3CSUA 3DVRX 1N1MA 1RMYA 3QA9A 2NSJA 2YWBA 4PPNA 2E4UA 1AKUA 3P5BA 3MHTA 3ZWYA 4I4TA 5HIMA 3ZHBA 5KTPA 1F0KA 2O8DB 4LF7B 2DQZA 1U02A 1KBQA 3P0IA 3PITA 3RRFA 2AXEA 3UF0A 3W8DA 4LBZA 4N3GA 4XSHA 5AKKA 1Z62A 2Z4RA 5JSFA 3F90A 5JCOA 1P39A 1GN8A 3D8HA 4TVOA 1KOLA 3FI0A 4B4KA 1OGYA 5JFOA 1PV2A 1QFJA 1RI5A 1MR3F 2NSDA 3G8AA 5ALHA 3MJ4A 4C78A 3E61A 1B6GA 4ABTA 3V8VA 4BJ1A 2QORA 2L18A 1TK9A 2NU9A 2NUPA 3F5DA 3ZU5A 1E9BA 1QCDA 2XT0A 4NNOA 4PN3A 4MCIA 1JI0A 3E7XA 3MTJA 4X62B 1E2BA 4N65A 4FFVA 2FETA 3PL1A 5CNKA 5DNCA 3TG8A 3W6NA 3EARA 4P3KA 3I2GA 4V0SA 4DBVO 1Z6TA 3P52A 4V0QA 1DHRA 1U2QA 2Q5IA 1VOTA 4OQXA 5A9RA 4QREA 2XVMA 3ULKA 4D82A 4MQLA 3KPYA 1RT9A 1P9RA 2JLSA 2P7HA 1Y6QA 5J58A 4R8RA 4EKDA 2REXB 1YS6A 2FVYA 2NO1A 4E0BA 3KVNA 3I53A 3WI7A 3L7CA 4QG3A 1QHFA 4TVBA 4QOJA 1A77A 2P2CA 3FNIA 5IJ9A 5T5QA 4FS8A 5IXYA 1L5SA 4Y2PA 4WOKA 1V25A 2W2LA 1UDAA 2A0XA 3CKLA 5FWYB 5EMHA 5EWLA 2EATA 4MUAA 2LIVA 1J2EA 1XJWA 3BILA 3BICA 3K4QA 3QBJA 4FMBB 1E60A 4DLVA 2DMRA 3P20A 1G9XA 2ERCA 2OLEA 2X5NA 5DM70 4KDRA 1MJGA 1XNGA 4GKKB 3D4PA 3WO0A 4KQ9A 3BWYA 1ZY2A 4ZHSA 5KMGB 1QUFA 2WYHA 1N2GA 1RRFA 3R09A 3HB7A 4E08A 2E4VA 5FI5A 4MS3B 4PZEA 4PYKA 2XA2A 1RYEA 1U1DA 1OPXA 3FCSB 1L4EA 1SC4A 4Y0VA 5FHRA 5ICGA 2VDWB 3RYFB 4X00A 1S9HA 1LD3A 5FBKA 4IZOA 2FWRA 1HA3A 1U2TA 2QZZA 2PO7A 1LK5A 2UYYA 2X9GA 4AUMA 4QGBA 1N7IA 2YFQA 1PJLA 2H1VA 4WRRA 1VM6A 3E23A 1V2HE 3AU9A 4WINA 5SZJA 4PAWA 1IRIA 4EL5A 1MB4A 3SXJA 1G8YA 4JSRA 4LOLA 4PAGA 2QRJA 2QYTA 5J9FA 4CMGA 5EUBA 3SAJA 2HJVA 2A5YB 1NVTA 4NYMQ 5COBA 5J2TF 4NBLA 3HKBB 3BWMA 4L1KA 4MWSA 3OA2A 4EQZA 1OJLA 5EXXA 2IEIA 4U00A 4YV2A 2II6A 3I4LA 3A1UA 2JFFA 2HF7A 5LA6F 2XZTA 5AOCA 2ET6A 2ZUCA 4DHWA 5ENDA 2JAHA 1Y1LA 2KJQA 1WR8A 2GF0A 1J1ZA 5LB4A 2F6RA 4BPBA 4G0XA 3MYRA 4XIFA 4J3JA 3CVOA 1C1DA 5AI0A 4EB6B 4LYAA 1HL7A 1GR0A 2G06A 1CDOA 4MVJM 5DULA 3LECA 1M34B 4G1VA 4B9AA 4DLRA 3FZYA 2Q0SA 4ZCSA 2W2KB 2WU0A 3VZPA 2Y0PA 3BXZA 1KEKA 2NZ8A 4NV3A 4Z7NB 9MHTA 4Y2UA 1IXYA 4F92B 3ZXYA 1Y48E 1Z4MA 5AW3A 1M2FA 3H9QA 2XPCA 4KTTE 4S1NA 2Q41A 3QVGB 1JIJA 1Q17A 3E7FA 1FA9A 3M3PA 1RHJA 1HYQA 1PEAA 1WPXA 3PFBA 5L4LA 3AGPA 4JOBA 1XC7A 1DFIA 1UBFA 2LDXA 1P0PA 4FHFA 1E6KA 3CW8X 1H2YA 3RVNA 4C89A 5JXIA 1Z0UA 2FH5B 4JP2A 3WZLA 1G18A 5EJ2A 4D46A 2VSNA 4G8DA 1D5CA 5SZIA 3ECCA 1GNVA 4XUDA 4GZ6A 3R0ZA 3CX4A 5KNBH 3TQOA 4M9ZA 3WXBA 1T1JA 4E14A 3PGVA 1XF9A 1WMEA 1CVLA 4HDAA 4XX0A 4HS9A 3SXUA 1XLTC 1Q92A 4DR6B 1E4EA 1FS4A 1N7GA 2V6GA 1EGMB 2XGSA 1CUBA 3QV2A 4PINA 5AWFC 1GKLA 3L8HA 1ZK4A 4QYIA 4CIVA 1N8NA 3C14C 1DT3A 3CYFA 4KN9S 4BS9A 1XNRB 3KC2A 5JS2A 4ZWNA 3S28A 3VOSA 4D3XA 1TEZA 3N0RA 4RKFA 4M6WB 4U6NA 1ORVA 3EPLA 5D5QA 2ZI4A 1CJVC 4BCBA 1J4AA 2PZAA 3TQCA 3SJUA 1CJUC 4BEVA 2F00A 1FTYA 4TTIA 1LDEA 1YS7A 2HA3A 1P6XA 2PRIA 3EIXA 3UGQA 5KSWB 2R0QC 1SEVA 1I1NA 3QHPA 4OP1A 3LOQA 3WK8A 3JSXA 1A7AA 2UUOA 4A8HA 4OIFA 1NMZA 1JKIA 1KEEB 2Q29A 4RD6A 5H3HA 1R7RA 3SJBA 4CV2A 4J7XA 5AJZA 4MTCA 1R16A 3Q12A 1YI0A 1T91A 3FDJA 2P2YA 2IYWA 2WKPA 1TQHA 3IP5A 4QM6A 3OX2A 5AW5A 5HUHA 1GZUA 3MVEA 1T1IA 5D87A 2IP2A 5TF4A 4WLUA 5DOZA 2OD2A 1X0XA 1I14A 3V4VB 3OEEA 3PXXA 1CUXA 2DKFA 5GIOE 3OIVA 2R2AA 3OPYI 4F6CA 1AUQA 1GOTA 2OOKA 2FPKA 4ETMA 3RSHA 3HTXA 1TI7A 1PDVA 2FW8A 2IU4A 2DE0X 3PEWA 3DTVD 1TKCA 5LYYA 1XA3A 3ZE6A 4MEBA 3DT9A 6LDHA 5GV7A 5F33A 4A27A 4EUNA 2C4KA 4NX2A 1BHO1 4EDFA 5EJEA 1PW7A 2O7QA 4ARAA 3AINA 2MINA 3Q9LA 3R3XA 3H9BA 3GD7A 1E5XA 4J0QA 5IJ9B 1WMAA 1J0AA 3KQSA 4O2BA 2P5YA 1EHYA 5DGHA 5ANRB 4JI4B 2D4AA 1LWNA 2QX8A 5IJXA 5C5IA 4IJKA 3IAS6 1Q7GA 2Q5CA 1WVGA 2OFFA 4MI6A 8ABPA 1AN9A 2IEBA 3RLIA 4JVSB 2V6MA 4TQUS 4NWIA 3STTA 3K9WA 1JEAA 3JWGA 3OU2A 2TMYA 1CF4A 1T8SA 1YR2A 1SM4A 4YP7A 3VR2A 3EOZA 1J56A 3SZLA 3URMA 2J08A 4G4SO 2CDCA 2R84A 4ODIA 3GFOA 1R6UA 3EQ6A 2C57A 5H83A 1YB6A 1QM5A 1TUGA 1G3IA 3RG2A 3GFGA 3VU9A 1VBMA 3CH6A 4XSGA 5ALDA 5KBYA 3JQ8A 2RAVA 4IWNA 4ZICA 2FX2A 2XTMA 4JB2A 4AB1A 2NG1A 1O89A 4X90A 4KOAA 2JLWA 4G0MA 2FPIA 4FBGA 4PC7A 1HNZB 1XROA 4G0YA 4GWKA 2INGX 4QE3A 2CD9A 1UBHS 3R9KA 2E1RA 3RSQA 4IRXA 1WG8A 3QUCA 2CJPA 3UV3A 4HC4A 3NJ4A 3UG7A 2JRLA 3WTCA 4AKIA 2WF5A 4X24A 2O9JA 1CDDA 3NRBA 1C7FA 3HVKA 3N0WA 4NNPA 5H9VA 5M7EA 4LCBA 1NOIA 2I7VA 4OQPA 2UYHA 4B7UA 3VOBA 5KPJA 1TCVA 4ZHQB 1FX0A 4GKBA 1MB3A 1TMKA 2FPPB 1DKNA 3CSDA 2XMSA 2EZUA 1K5DA 1KI9A 5BYKA 4EPWA 4KQKA 1LK7A 1Z6AA 4I1SA 1XYYA 2Q2VA 3GRAA 2C5FA 1C1DB 3LCUA 5ALUA 2NM0A 4HAYA 3AJEA 3FJOA 3WLKX 1P5HA 1QE5A 4JELA 4JLAA 2M6RA 2OCXA 3IYLW 4HXEB 4RFLA 1QF9A 1Y33E 3A1TA 4TLLB 5IKOA 3VNBA 4DZRA 2Q9AA 1B0AA 2WSIA 3H5VA 3MTAA 2YKGA 4LNUB 1E96A 1TU4A 5CJPA 3QRWA 4IRUB 1L5QA 4LN1A 4GS5A 5JH7B 1Z63A 1GRRA 1FUKA 2BR3A 1QP0A 4EG1A 2GSWA 3THOA 3GROA 5T8KA 4YPOA 4OHBA 1KAHA 2IC5A 1AXGA 3MWGA 3D4LA 5C1IA 5G0SA 3KKKA 4Z5XA 1CS0B 3MWEA 1A27A 3LQQA 2I3ZA 4ZO8A 4Y1FA 2AH5A 3CXUA 3G2OA 4M0DA 3W5CA 1GTVA 1BKDR 1K66A 3GVXA 1RZVA 2X4LA 3AR4A 3DGFC 1OXBB 2YXDA 4OLJA 3R4VA 2DBZA 1XELA 1R4AA 2FQXA 2IPAB 4PGGA 3KTFA 4RSHA 5E7MA 4F2HA 1UPCA 5ISMA 1E1QD 3HACA 4DG5A 4ZDKA 5KTMA 4PVCA 3ZJYA 3QVTA 4IDQA 2YHBA 2YX1A 3QG5A 1BS2A 4UBNA 5HFAA 5K3DA 1Q3KA 4YO8A 3RS3A 1IDOA 3GRPA 5DWDA 4A2WA 5HM6A 1KRXA 2XIQA 2V7UA 4D9CA 3VVBA 4FWTA 1HF3A 4F85A 1RBQA 2OFWA 3JV7A 1EUDB 3OZEA 4NBSA 1M6EX 2NZJA 1OZAA 3MB8A 1G7SA 3TGWA 4I3HA 1YQUA 2MSKA 3IT0A 1WXQA 3V1MA 1BW9A 4QBHA 4ND2A 4UEWA 2E0IA 4H17A 4L5CA 1UM8A 2ON6A 4JC5A 3ZVNA 3EWAA 2GRJA 3BGVA 4F6LA 1J0EA 2C5LA 2R68A 4CCYB 4WW0A 3VR6A 5CLHA 2P1DA 1W6UA 3PFCA 2LTAA 5H9WA 1JHOA 2RJOA 4NC9A 1YHZA 3O82A 3OFSA 1OFGA 4F9EA 3MEQA 4RX1A 2MCFA 2ZUEA 5CA0F 4DT1A 4P3PA 3DLIA 3IT2A 1XA0A 3ZDFA 1MNAA 1G17A 1NR7A 1PJAA 4ZZ2A 3R7WA 3FOFC 1W2GA 1YDWA 4D80A 1QRUA 1F3LA 1GGFA 3E1GA 4K40A 1OXMA 3IP3A 1RQLA 5LQMA 1IULA 1HSOA 5K3CA 4TXNA 1VCIA 3LVRE 1PEKE 3L6RA 1CZKA 1XGKA 3ADCA 1CLUA 4M0MA 4OREX 5JO0A 1NJ1A 2XT6A 2EKBA 2P9FA 3EDMA 3PF8A 2RKOA 5JAHA 2BMDA 4BQRA 3GLFA 3KQKA 2QTCA 1KAQA 3CVJA 3DFZA 3PEFA 3GGOA 4DLPA 2I6GA 4UHDA 5L3VA 4NCAA 4E21A 4TV9F 4P3OA 3OP4A 2V96A 1F6WA 3OZDA 2W70A 1E5VA 2VO1A 5LIPA 3ESRA 5EE1A 4M3NA 1KPIA 1AZSC 1Y89A 2UZIR 1FDVA 1QKIA 1VYTA 2XGMA 1MD9A 3DBHA 3K16A 4FCCA 3GAFA 2MTBA 1P0IA 3T1NA 3SZ3A 3VZSA 2I3AA 1UDRA 4BNZA 2CXXA 4WZBB 4C7JA 4U2EA 1O3YA 4CKZA 2RHJA 3GL9A 3RAPR 4W6QA 3FJ1A 1V16B 4LHYA 2AD5A 1C9DB 2B1JA 3TLMA 1WSBA 5LXTF 4EUSA 2BAGA 2XYPA 2VHWA 1QTIA 1M7GA 2ZJ3A 4LJ4A 4Q4AA 3P2IA 5TEVA 1L5OA 1NQ5A 2QB5A 4RGVA 3U9SA 3HNRA 5BW6B 4D96A 1XXHB 2QQEA 3C48A 2O0MA 5A5DA 3W6PA 4LSMA 2D1FA 4JV5B 2AG1A 1SCKA 1KARA 1ZVKA 2DVMA 2OVBA 4ZYLA 1GTSA 5BW5A 2C2ZA 3P94A 1M1NA 4MULA 1W48A 1XRQA 5LKAA 3CUEF 4IJQA 5J2TA 1IPFA 1ULTA 1SCNE 5JPIA 3IRUA 3WL4A 1JW9B 2PRZA 1UAGA 1BE0A 3ISTA 3L82B 5EE5B 3AZOA 3BTSA 3CJTA 4KQCA 3JQPA 1UINA 5ALTA 1OAKA 3ZHSA 5LA6A 5JBQA 1H93A 1N5JA 2FPIB 1MX3A 2IIQA 4ZEOA 3KJHA 2BM8A 4HNSA 1N6HA 1ZWKA 5ALEA 5CGQB 2GCPA 4OLAA 4KJZA 4NL4H 3LIPA 4PSCA 4PYRA 5TQ2A 4ZGWA 3DVSX 4J2HA 3Q9UA 1Y63A 4RGYA 1NFRA 5F3DA 4DEYA 1V71A 2VQ3A 3BZBA 4I55B 4ZT2A 1SQFA 1XVTA 4AS1A 4KBGA 4NPCA 4RAQA 4TT8A 4W9NC 5ERGB 4AKSA 2AOTA 4HDSA 3RUAA 2ZDHA 4DRXA 1FX0B 2BONA 2R4QA 4Q1AA 2H9IA 1NG1A 3EG5A 2HV8A 1NTRA 4MJLA 3UWOA 2RH4A 3BOSA 2UUBB 4PLFA 2GVZC 4V0RA 3W9SA 3DE5X 4EHKA 5E8JA 3RIYA 1SK9A 2P2SA 4BN4A 1JKJA 1QE3A 4GMGA 1ZZEA 2HMAA 1DZIA 4HFNA 3K94A 1ZINA 1EVYA 1KJIA 1WB6A 3I83A 5IS2A 2EZ8A 4PCUA 4MUNA 3U3KA 1K86A 3ZLTA 4HFRA 4C0QC 4F06A 3ROFA 1A4IA 1N7HA 2WEKA 3B7GA 1H6DA 3DO8A 1Q20A 1W25A 2ZLBA 3HKCB 3ZK7A 4CIDA 1KPHA 2OCDA 1NSFA 2XBLA 3HC7A 2V7XA 1OH6A 3MERA 1G0NA 2XDYA 3GPBA 2ZB3A 1P81A 4IICA 1GCOA 1T2FA 4M21A 3Q4GA 1DX6A 1CX9B 4ZAXA 3HWSA 5FWAA 1RPNA 1F0NA 1QYWA 1WZIA 2F67A 3HB0A 5I6DA 3W5BA 2ECPA 1GNRA 4ZOBA 1V1MA 1FUEA 5DLYA 4UOZA 2C96A 3OPNA 1H2XA 1VHJA 4HXGA 4Q1CA 5CFZA 4L07A 4QOIA 4V2UA 4NYJQ 1G8GA 3QX8A 2OG1A 3RTCA 4GZ5A 3OPXA 5J2UB 4LK3A 2CNBA 3BWBA 2G0NA 1MG0A 3KD3A 4LJ6A 1GDDA 2EJCA 2V74B 4ZOLF 3CUYA 5FBWB 2GEVA 3ZHTA 1GDHA 1U0EA 2I6QA 4OJQA 3FDXA 1MPXA 4YRCA 5DH9A 1YJCA 5FCDA 2P3LA 5TMBA 3UJAA 4I5EA 2V6IA 3ZE2B 3JYQA 4RL6A 5E4TA 4DA0A 4P0QB 4HL6A 3LWNA 3LD9A 2VNSA 2BZ1A 4EZEA 3SC6A 5LUBA 4BKQA 1NP6A 3I9LA 4JKOA 1JG4A 1EX1A 4D6YA 4OX9B 2UXBB 3LMKA 2XXJA 4A3SA 4TMFA 3VZRA 5CBPB 5L45A 3B20A 4MJ3A 3E18A 2PD3A 2YINC 2BEUA 1EE9A 3CURA 1GL7A 2BUBA 1GCIA 3WBFA 2AR9A 2DT5A 4HAXA 2Y99A 3GW8A 4MVJH 1L5GB 4OO3A 1DQRA 1E0DA 1KEPA 2Q21A 4DHEA 1JJBA 1O97C 1SULA 1GILA 1W4AA 3EMKA 2VK8A 4MUMA 1PUIA 5KDOA 4ZVNA 2OV8A 1TKAA 2HQOA 3LE8A 4M8SA 5JRZA 3A31A 4QU9A 1PE0A 4XAQA 1DAFA 1F4VA 2H08A 4BLOA 2VF7A 5BQ3A 2B82A 3AERB 4N6GA 1UBTS 2JIRA 2QRKA 1RRPA 3EIFA 4H3VA 4Q3LA 1LTHR 3PS9A 1RZ3A 2ZT6A 1AQIA 1ZN7A 4KR9A 2X0NA 1PDOA 4BYMA 1XU9A 1Q7EA 4BU0A 5GQSA 1IHXA 4G97A 3HXMA 3MQ2A 3IIEA 3QMVA 4M46A 3L0SA 4RF5A 2SNIE 3THSA 5KYTA 1JIIA 2FG6C 3B9PA 4LI0A 4KO4S 2PKYX 1MORA 2DPHA 1XMPA 4H7IA 3WGMA 1S8NA 4D9EA 3I9FA 4GKJB 5B5SA 1U1IA 5EWMA 3U3XA 1UOQA 2I2XB 2YNMD 4N48A 2IF0A 3SQNA 1DIAA 1CP2A 1A82A 1REQA 5CNIA 1C2YA 3SHOA 4XPIA 4A6DA 2RG7A 2MSDB 2YOHA 1N2CE 2IS4A 1DE0A 3SBEA 1OKKA 4F97A 5JJLA 2VPIA 1N3YA 3AR7A 4LJ7A 3IP8A 1QYCA 1ODCA 3UK6A 2XRZA 3H9UA 3NB0A 1E2DA 2AG5A 3H4VA 2YMPA 3OPVA 4D98A 4Q4AB 4YAKA 3TECE 4GMDA 1E0JA 1CE8A 3ABSB 1KSGA 2PSDA 4ONEA 1H42A 2FWAA 2B21A 2NACA 3F71A 3GT4A 3LOPA 3SHQA 1W7AA 1UKVY 2YBDA 2YYYA 4IUCS 4OK6A 1L7PA 4DL9A 2AJBA 5J4KA 2EU8A 3H1GA 4B3TB 2FLKA 3BWDD 1DC6A 2PX5A 1ILWA 1ZKMA 3C3JA 2ODWA 2Q7XA 4G5FA 4XSVA 2H1OA 1BMFA 3OIGA 4PCLA 1NULA 3AUXA 4A8TA 4CW7A 3BCHA 4AY5A 2Y1OA 2WTNA 4RDXA 2PUBA 4FLMA 1KFBB 1NXTA 1SRQA 3H3FA 4BNTA 5NULA 3M1LA 3SFZA 4KR6A 1CQXA 3WSVA 2WJJA 2GA9A 2O8FA 4DE5A 1MXFA 3AFIA 1GGEA 3LHKA 1SUPA 2WP0A 3L5OA 4DGSA 2PT9A 5GV8A 3OT1A 1QP4A 1DWOA 2DH5A 3GIDA 3HP7A 1Z74A 3GVPA 4MQFB 1OYOA 4L6IA 2IV7A 4AMBA 1MA3A 4RVCA 3UPTA 2ZATA 3LPNA 4JOCA 1A1VA 1EU1A 2O6HA 5L3QB 1V41E 4FEGA 2KSQA 4HDSB 1ES9A 4I4IA 5KWJA 4DRXB 4AC9A 3V8RA 3QEOA 3OT5A 5IAKA 4XGRA 4OXQA 3NRCA 4URFA 2V3CC 2FHSA 5ECWA 2VHQA 4DLYA 4ZJYA 5J1SB 3AIKA 3Q7QA 2ZOSA 1V35A 1DDGA 3Q72A 1KZ6A 1NN5A 5LWQA 2D13A 2Z98A 1XALA 1LUAA 2R7KA 4GECA 1B1CA 4UAVA 2R00A 4RABA 4UEJA 1PD1A 4CIAA 2DM6A 4MUXA 4RIHA 3WG9A 1FYXA 2BKVA 4QXAA 2WOJA 3B5JA 3GU3A 2R6AA 4OXIA 3LBFA 5SICE 4C06A 4RK0A 4IOJA 3ROTA 4D79A 3MT7A 4NH0A 1PUXA 2NYRA 3T95A 1PSWA 3UK1A 4ALIA 2FK7A 1PJ8A 1GNLA 3IA2A 4IHAA 1WRBA 2YY6A 4R1OA 1NBIA 1EBBA 4PO8A 3FVWA 4LI3X 2XWPA 3V7UA 1GAQA 3UB3A 2ZB8A 3FIJA 3P9KA 3HYRA 3J7AC 3B3JA 2PTHA 3ZCQA 4EW6A 4DLTA 3LVBA 5B3KA 1IMOA 3Q40A 4JJGA 4EEKA 1A9XA 4ARCA 3BRWA 2Y1KA 4UAUA 3T12A 2FVXA 5LP6F 3K5WA 1MF7A 5GP1A 4D8UA 1VBFA 5K4GA 1MV8A 4EF6A 4MDYA 5IUJC 2BGWA 3KUXA 3DMTC 3HCFA 4GM4A 3GPIA 4WKPA 3AYXB 1IHDA 5CA0A 3ET5A 5K0EA 1VSTA 1PVVA 2O2HA 2ZULA 2D2XA 3CLSD 1UDBA 2ZSFA 1ISJA 4BVEA 1QTQA 3VUEA 2GZSA 1M72A 4WLOA 3DOEA 4DQVA 5DX1A 1N2ZA 2HHCA 1GAJA 1Z5ZA 3MCZA 2BF7A 5M5BA 4YMLA 1NUUA 2ZU0C 3N2KB 2XUFA 4I08A 1YRWA 1L5KA 5BY2A 4G4GA 5I5EA 1U9JA 5CMLA 3KQVA 3MWDB 3TS1A 3HDGA 4QOEA 2O5CA 4GGMX 1GAXA 2VAWA 3BFVA 4YGXB 3ZOZA 5L4NA 1TGVA 1CZHA 2GLTA 4P7KA 1X8KA 5J4YA 1IATA 3HV0A 5EZYF 2AF3C 2WIDA 3CV3A 4TV9A 1VGQA 3WL6A 4X1KB 2Q0XA 5AKJA 2ZYAA 3VM6A 1I4WA 2GZMA 3ANLA 3TSWA 2AG6A 1LQUA 2BGNA 3WGZA 2IYSA 3ZWQA 3E27A 5LQNA 4YONB 4WK0B 3GH3A 1TUEA 3BA6A 2VKTA 5K8LA 3C15C 3SD7A 1WPGA 4NONA 3IAUA 4TSFD 2CNKA 4RE5A 4BGIA 1G5RA 1US8B 1GZSA 3NT5A 3PC3A 4WASA 4AY3A 1PFWA 2YWJA 1M8PA 2ZT5A 3KEQA 3OCVA 5DB4A 1LSOA 5ARCA 4LJ8A 1MJFA 2H1SA 1Y6JA 1K8YB 3ETEA 5LXTA 3AI1A 5BWLA 2VNIA 5ENVA 2BCJQ 4NZPA 1PR5A 5AW9A 4ASUD 2O0KA 1DARA 2JS7A 3M1IA 3JQAD 5BPHA 3PDCA 2NP6A 1V3TA 1AHNA 4BYGA 2NPOA 3RVSA 4XPIB 4MMYB 3MJDA 2P9GA 2ZIXA 3GFQA 3FB1A 4GOND 4QPPA 1XI2A 4CU5A 1PEYA 4QTXA 2P78A 1N3LA 5TX7A 2IX3A 1R8JA 2HCTA 2JNWA 4LC9A 3E8MA 3TLXA 2G63A 3O4GA 1L0BA 1ZRSA 4D0LB 3D54D 1P7PA 1TAHA 5DGCA 4DQ0A 5A4MS 5H81A 4BQOA 2A84A 5JJIA 1R4MB 2BMFA 4X7BA 3QUSA 1AMNA 4N0MA 4PLCA 4RTJA 2AFIE 2HSEA 1A2KC 3F6EX 2JD0A 4Q6BA 3CB4A 2IYNA 4XM0A 5C32A 4BO9A 1S2DA 1ODJA 1EB8A 2ORWA 4RKEA 1DADA 4IEIA 1WXFA 5CT4A 2IIPA 5K8VA 1I5OA 2WWGA 2YS6A 5J47A 5F9MA 4MWGA 2VWGA 1XIVA 2GD0A 3ETJA 4S1VA 4ZI2A 1GLVA 3OE1A 4C4TA 3C7TA 1IK6A 1DLIA 1WHTB 1XZEA 1FU7A 2O50A 3H2BA 3PSAA 4MPDA 1O6BA 2RHLA 2WICA 3GBSA 4PNPA 1EP3B 1QG2A 2CUTA 2WFAA 5IU6A 1L7MA 2R7NA 3TTVA 3LUHA 2I1QA 2XZPA 2WVGA 4BWFB 2QTWB 2FZEA 4YQEA 3WLIA 4IG4A 1XZKA 2ZBQA 3ROPA 3ZXXA 3EG9A 1QR2A 3C6KA 2JATA 2ZTMA 3AUYA 2FSPA 4YB8A 1EFUA 3TI7A 4CKXA 3DCYA 5IJZA 2QTFA 1KFEB 2GOYA 4H3SA 3ZD6A 1OLXB 1HQCA 1UPUA 3MTGA 5TPZD 5IX8A 4B43A 1F1BA 1JE1A 4FW8A 4Z4IA 3PRHA 4CM4A 3TR5A 3IMKA 3N6RA 1VSBA 3F5SA 4X41A 3BULA 1GQQA 1SZDA 1QU3A 1Z36A 2FG7C 2I71A 4ZYUA 5FV4A 5AVZA 3BMCA 1D2GA 2WU1A 3ER9A 1NJSA 3O4JA 4V0KA 3KQLA 4LWOA 5I7AA 4DZZA 3QOYA 1R0LA 1XRNA 4W1PA 4DMKA 1ZJYA 4FFLA 4MPRA 2QQ0A 5FPQA 2GK6A 1J8FA 3I72A 2HK6A 3LUFA 3K0AA 4ZOLA 1PQUA 1UC5B 1JDJA 3AIIA 4YRDA 2ZRPA 2CNNA 3FPFA 1X7XA 1JR4A 2LW7A 3KNZA 3F8WA 3UUGA 3WHLA 3KKZA 3G2QA 1SELA 3QYAA 3A58B 5C35A 1ZGBA 1O94D 1F0YA 3AEKA 3RT7A 4U7GA 4C20A 5BNZA 1EWQA 1KMNA 4WECA 4YH1A 5A9SA 4QXOA 1A9XB 1RAEA 3B82A 1M0EA 1O95D 1NKTA 4GRIA 1YFKA 2ECKA 2FR1A 3PJEA 5FAKA 1PU2A 1TF7A 1V5IA 5J23A 3T8YA 1XQXA 3EEIA 3QLUC 3UKJA 3T9DA 5G0VA 4IW3B 4E88A 4LZPA 1WCXA 2NT4A 1SOUA 2ZZKA 4DBLC 4NXMB 1WF6A 4IF4A 1A9TA 5JTUA 3IURA 1ZHHA 4X54A 1PSZA 3F3KA 3MJHA 1X1QA 4ARVA 4EELA 5F23A 2CHGA 2QN1A 3TXAA 4BNXA 4MS1A 3KVRA 3WLEA 4QT0A 3SC2A 1JG2A 3DVLA 6PFKA 5I7WA 1C7RA 2FSFA 2OGWA 1VE9A 2I9PA 1QZTA 1D2AA 4BAGA 3HJTA 4A2PA 1IHUA 3CG0A 4LJ5A 2X5KO 4TYMA 1P1CA 1T3ZA 1VHQA 2C82A 5DM1A 4TV9B 4HX5A 1CQPA 1PD0A 3ZDXB 3MWFA 3WKBA 4NKRA 1O08A 2SECE 1IXSB 3PHHA 4CUJA 1W4LA 1YUBA 4I5GA 2C29D 4ND4A 1L7NA 3HXLA 3B1YA 1GO2A 1PJQA 1OFHA 1FDRA 2HGSA 4G23A 2ONYA 1NXWA 2ZUVA 5JLJA 1C8BA 3EFOB 4DABA 2A58A 4GVLA 3KQHA 1NI5A 3OWOA 2AFHE 1UZLA 4MITA 3GFSA 4PLHA 4EPVA 1MKYA 4OKIA 2IDKA 3W34A 1NDHA 5BORA 1FDTA 2QTLA 3L0CA 3ZPXA 4JUBA 1HFWA 1NYTA 4MW2A 1KVRA 4YMIA 1JPNA 1PLKA 2EGHA 1SXJC 1PFGA 2O4CA 1A3CA 5L7YA 1Y4DE 2W22A 2IW1A 1WSAA 3OLCX 2OZLA 2H00A 4YJFB 3LTEA 2FUG6 4PFSA 2MU1A 2ZIXB 1GEEA 3AFNA 3GD5A 5TDHA 3FPKA 4H6PA 3ILXA 1N6LA 1A8QA 1Z28A 4ZQBA 3R5XA 4YV1A 4GC9A 2VPTA 4J8PA 2BJHA 3FHLA 3H9JA 4FZ3A 4IH9A 4QUIA 1DOZA 3NWJA 5FLEX 2J09A 3MPOA 3AXTA 1J7KA 3UFXA 1T1GA 3PNOA 1JDSA 2ZI7A 4H60A 2UZ1B 4TV8B 2C3OA 2WVJA 3R3JA 3X3HA 3IPCA 4Q1BA 5CLIA 4IJMA 4ZXPA 1N0VC 1KJJA 1FP1D 3RFTA 4CG3A 1NJ6A 1RRMA 1PVOA 1XMXA 3HBFA 1RPTA 2DT8A 1UJ5A 2O1EA 1IXRC 2P9CA 4OJNA 1A5TA 2ZBPA 3V3KA 4B46A 4DV6B 4CM9D 1UM9B 4RULA 4D0NA 2D2VA 3TXYA 2XE8A 2W58A 1HYHA 4UM9D 5LLSA 3BF8A 3CO0S 4KU4A 5AJXA 4BJ3A 3E7PA 1ZL2A 3C3XA 2PRSA 4L28A 4AKGA 2YIDA 2FR8A 3OZAA 1KAOA 4UHHA 2G07A 1GL3A 4RD3A 1E1KA 3D0OA 5G1NA 2AOUA 4LRXA 1KSJA 1XEWX 2R7LA 3L4BA 4JA0A 5JQGB 3T4UA 4CM1A 1IONA 4EEZA 1HLGA 2GRUA 2CWWA 4NIMA 1RAFA 5E6RA 2W6OA 1N1DA 2WT4A 2CEKA 1U0RA 1BHSA 2ID8A 1A2BA 2C04A 5SZHB 1F60A 5HKBA 3U1BA 2ARKA 1QSGA 1CR2A 4A6PA 1JTEA 3EWIA 5LN1A 3VH4A 1J0XO 1U11A 1W44A 2BTOA 3ICQB 3OMLA 3WRXC 3G59A 1CJMA 4J75A 3PPWA 1PIWA 1W19A 1NXVA 2YN4A 3BMCB 1G7RA 3H84A 3I5MA 3IBYA 3IKVA 3EXG1 4JI8B 3K9QO 3SFVA 3ZW9A 1VHWA 4B3FX 4DUZB 3PFKA 3AKCA 4ND1A 1KJWA 1U3GA 1XL1A 2JGIA 3CNLA 3JATA 1EX7A 5G4LA 2Q2OA 4AJ1A 2BGLA 3PUHA 1L4FA 2PRYA 3JYLA 1NHWA 2W2PA 4QNMA 1NAIA 3KD2A 3Q3JB 4YJ3B 3GJ8A 3TW0A 5LDHA 1EFVB 4QJ5A 1I2AA 5K2OA 4BO3A 3MJFA 1J2RA 3IKJA 4O4HA 4UDXX 2O1XA 3V97A 4XTRA 3W2FA 1YFJA 4A8JB 4AN4A 1HOXA 2H92A 3N8GA 1PK9A 5JU6A 3NDRA 4WHMA 2ASVA 1AKWA 5CU7A 4BMYA 3B13B 4UBMA 4PHHA 3ENWA 2OAP1 3DVAA 3DB1A 3LLSA 1ZD4A 1ICIA 1QIKA 3DOHA 4OUDB 4UE2A 3CNHA 3TSYA 1OI3A 3PUIA 4HN2A 1H0HA 2ZJ2A 3ZHXA 3NP7A 5EFZA 4LV8B 3ETHA 1SBQA 2G17A 2RARA 4QUDA 3LVFO 5EZYA 4DDKA 3KFXA 2J30A 1UBSB 2XRMA 3U0VA 4YCLA 4B76A 2AKAB 2CN1A 4MRSA 2CZGA 3QSYA 2IH4A 5EZ6B 1BO6A 1MAWA 1ZC4A 2LCFA 1M76A 5D5PA 2BSXA 3RJZA 4E7OA 3I6YA 5ED4A 1KYQA 3SF8B 1QZZA 4RL4A 4R6XA 1WMSA 4ECAA 1FRNA 1IZYA 2X86A 1MW9X 1P2BA 4Y1GA 4DJ5X 4UNRA 2QNIA 4YAWA 1RWQA 3AR2A 1YRLA 2TMDA 4ROTA 3SICE 3JAKB 4FB4A 1II9A 3WRYC 3GXOA 2GFQA 2FJ0A 2PUCA 3C5CA 1BH6A 3NEYA 1BYUA 1NX9A 3F47A 2HRRA 2IP4A 4OHMA 3RG8A 2A9QA 4RNDB 1FC0A 2HFJA 3TI9A 4B0PA 1CJSA 3O83A 2FFJA 2Q5EA 2X8JB 3HJRA 3OTGA 3GVCA 4H59A 1A50B 2JLRA 3HRKA 4TMXA 3T9BA 2UZ4A 3BS4A 1ISSA 5IWCA 1NLYA 3JR7A 4ZODA 2A14A 2GRAA 5MF6A 5TB5A 4ML3A 2G4VA 1TL7C 3LCCA 2YN2A 1QPZA 2XB2A 1ZOLA 2VZ9A 1TM2A 3LV8A 2BGMA 2JH9A 5B30A 2ZXEA 3EXFA 1BDBA 4R8VA 1JTVA 6CHYA 3MZ0A 5IKPA 3A8TA 3R3HA 3IRVA 4KK3A 4WNAA 4DCMA 1L8LA 2N1MA 4YLGA 3H99A 1KR5A 1NU8A 3S1AB 1MO6A 3SFTA 3LGXA 3MOIA 2AG8A 1T6ZA 2O1WA 3DMRA 3X43A 5KSZA 1GTZA 1WUYA 1QOZA 3F5QA 3KQQA 4L6AA 5SYNA 3GDOA 1XDUA 1HDOA 2Q9UA 4TSRA 3VDQA 5F2NA 1RQ2A 4BOYA 3WK5A 2DCUA 2FEKA 5LP1A 4FBMA 4JP3A 1DCMA 4NBTA 2Q3EA 3UGJA 4GLJA 1M1UA 4L0QA 5DPMA 4YRQA 5EIBC 1ZH2A 3UFXB 3WKCA 1U1GA 4E5UA 1TFUA 3PYXA 4QULA 4M2LA 3PUXA 2ZWVA 3H75A 5FFMA 1FCJA 1Q2XA 3DZ8A 4E07A 1MQ9A 5JZOA 2VQDA 2PUVA 2PE5A 4O8ZA 1DIBA 1RWWA 2DWOA 3H8JA 3KTOA 2MYTA 2W9XA 4NJMA 2HH9A 4AZVA 3IBGA 5ARBA 2B2CA 3TLGA 3P9CA 1ZXLA 3DF7A 3X1JA 2RHWA 3Q8WA 2IBSA 3IEPA 3VO8A 4A92A 3H7IA 2ZJ7A 4GIBA 3NLLA 3PCXA 3ZG6A 3DZIA 4MVJI 3W8RA 3NKLA 1NBOA 2VP6A 5DYGA 4PQEA 3A27A 2QP9X 3K6KA 5JHGB 2QN6A 2G70A 2PLWA 4G65A 3PDIA 4C0WA 4D3DA 3TAHA 3WWPA 4DV3B 2JCGA 2H9AA 1RC1A 3T5TA 3SYNA 1U2GC 1YHYA 4NLLA 4XFDA 4TWBA 2AOUB 2J87A 4UCQA 5HCIA 3SC4A 2FUG1 2R6HA 5G0TA 1XWFA 3TR0A 4M9SA 3CWCA 2PFGA 2YWGA 2WSSD 1SBIA 1EA5A 3VI4B 1IN1A 5EQTA 1QVRA 4KFRA 3TD2A 1OFUX 2EGGA 5JWRA 1L7OA 2KLBA 1RYNA 2PT7A 3AHCA 3DJFA 1EBUA 1PRYA 3JTMA 3W5HA 4CMIA 1NVBA 3WIDA 4CHTA 3I52A 4Q39A 2QL7A 2BM0A 3NHSA 1B8OA 1I36A 3R5JA 5GMOA 3SM9A 3WLMA 2PX8A 1AKNA 1ZK1A 4IDBA 4RGBA 3DD5A 5EUCA 4L4RA 3EZ9A 5KZMB 1ZR4A 2AFIA 4LJ9A 4GPIB 4GX1A 4FZ5A 2IXDA 5KHAA 3EEOA 1TZBA 2YTZA 2V0NA 3JATB 1V8PA 4H6XA 1F2DA 2ZI3A 3D0RA 3HI6A 4P1ZA 5DI3A 4WKOA 4JMPA 2P2NA 3SLRA 1KI4A 5I9SA 3TLEA 1MEOA 4JL6A 1KP2A 2DECA 3SSNA 3A9UA 3B6IA 2YWFA 5F76A 3GAZA 1NU6A 3GNQA 4LE2A 4W4TA 5A04A 3M83A 1G66A 1LVHA 3RIHA 3X1WA 4O4HB 5HIKA 4D9NA 4KRFA 3K2BA 1KQ3A 3ZGLA 2VRCD 1QFZA 3L07A 5DHSA 5FEMA 3W6UA 4KHZA 4RUKA 5B58T 4M1TA 4YLEA 3P7MA 4J0KA 4ZI3A 4FJ2A 5ICCA 4RF4A 4KNWA 1W0JA 2XUKA 1H9AA 2FQ1A 3IERA 2ZPTX 4MK4A 3VO2A 4KKXB 1GA1A 3C3CA 4NH4A 4PC3A 1J2JA 5EP2A 2H06A 4B47A 2NVBA 5K8CA 4ND5A 1MHPA 4IJ5A 4Z3OA 1Z2OX 1NMXA 4AJJA 3K2EA 2BZSA 3ROXA 1NDUA 3CLKA 4CF4A 5JJBA 4K9RA 1YDFA 3VKWA 3MMNA 1MJGM 3OZXA 2GS9A 4G25A 1CLEA 1UP7A 2W6IA 5T4EA 4FCTA 2O8EB 5BYBA 5FNVF 2D1YA 1QHEA 4CF6A 3RAFC 3PG5A 5ALQA 1RM5A 3AKEA 2SBTA 1JDZA 1CR1A 1TD1A 1N5RA 3HUEA 3WWZA 3WSTA 3M3DA 2YYSA 3I6ZA 1TKBA 2RMKA 4UFNA 1OBVA 4JLJA 2B36A 4ITUA 3PXEA 3A9CA 5AVKA 2AS0A 1P1IA 2CFIA 3BHNA 1PN3A 2A7QA 3PXGA 1EDOA 3EDRA 1E8MA 2OHVA 3H2SA 4MO2A 1U0OC 4AO7A 5JXGA 5D5HA 3THWB 4F3YA 3UK7A 1KK3A 3WDLA 3VDXA 1K8RA 1EFLA 3RS5A 3DE1X 4LFAB 5D3MB 5HQJA 1JHYA 4GP6A 1HG1A 5DCUA 4FEYA 2ZTLA 2GN8A 2ZIWB 1ELOA 1NM5A 2ZWIA 1JN0A 1U4SA 3BFJA 3NHMA 2ZBVA 1MABB 4U0KA 4RPHA 3V6LA 2P6OA 2X0FA 1CQZA 5EINA 3VAYA 3WHKA 4EGQA 4B85A 4Q01A 2IGBA 2R751 3X2EA 2X7JA 5CIWA 3UBTA 1S02A 5JBIA 3CZ4A 3HVRA 4MKRA 1U7HA 5HVNA 3WS7A 5TLSA 1S0UA 3KO8A 1IHPA 5T6BA 1W30A 5JEDA 1QOQB 2HMVA 3B36A 4BV3A 4JVOA 1UZNA 1W36B 1R4NA 3NS7A 3F2VA 3VYRB 1C29B 3KSZO 4OOFA 2KM1A 4MNTA 5JCZA 3FH0A 3VOTA 3L04A 1NL3A 2R6ZA 4W5QA 3VSAA 1WM1A 2VCEA 2JJ2A 3D8SA 1GXSA 1WKBA 1Y3FE 2CK3A 2OP1A 1L7VC 1ZI8A 3PPYA 2X0DA 1XE3A 3GRZA 3WMFA 2GCGA 2CLEB 1J25A 1NMQA 1E1RD 3PRKE 1XTZA 4EZBA 4H4CA 4MX8A 3ZU4A 5JJKA 4FYHA 4DUGD 3UJCA 3P9IA 1ETHA 2PGDA 3JQAA 4MV4A 2VNHA 5AJVB 3TTSA 4JQCA 4RYDA 3ICEA 2W6NA 3IJ5A 4WL0A 1N6NA 1OYWA 2Q0HA 2P2DA 4CGZA 1GZ3A 2AKYA 2W2TA 3IL2A 1AUOA 5LR6A 4MUIA 3ABOB 2CYCA 1YKGA 3LBHA 3HPRA 1D04A 4NULA 2BRUA 3TLGB 3GLGB 3DAGA 4EVQA 1M67A 4UCWA 3LTNC 1FRFS 2QG6A 3K2QA 3ENNA 3M33A 4N7JA 4Y6RA 2C8LA 4AG5A 1Z07A 2A5JA 4JQYA 3WMEA 4PFKA 1BX0A 1QV7A 3CKMA 2FB9A 3FDIA 4NHOA 4OCZA 1WPQA 3QJGA 5BWCA 1S89A 2AFHA 5EHQA 4OI1A 3TSCA 1T1EA 1V7PC 5CDHA 4LQLA 4C5CA 4F6RB 1X8LA 2PKQP 3OCYA 3TGLA 3EVNA 1EXDA 4Y6SA 2UUAB 4N7RA 3UOGA 3T7SA 2QZ9A 1JX6A 1RI1A 3OZCA 1EBFA 5U4QA 5KNBD 2DFTA 2V55B 1CR4A 3JQBC 1KHHA 3HN6A 1ISIA 3OUZA 3P9YA 4QDUA 5FI3A 4EB3A 3ILYA 3C5HA 3PHJA 1KH3A 1DPGA 1E3WA 3I8OA 4EW2A 1CP3A 2WFLB 4OSPA 4QO8A 3UAOA 2EOAA 2B61A 4N5MA 3NIWA 5EIXA 1T0HB 4CUZA 1X7WA 3QE0A 2IXTA 3V55A 3FBGA 5AKZA 1D4OA 2IT1A 1UJ2A 5A5GA 5FPPA 4B09A 4K7JA 4TX1A 3SZMA 5KYGA 1T15A 3REFA 5HIAA 3BWCA 4XQCA 3VHXA 3VHRA 1RTKA 2O5EA 2P5SA 3W6OA 4JNCA 5D8DA 4O63O 1GQOA 4OEHA 1QGDA 3NTQA 4BTEA 2A5LA 1Z2DA 2CD7A 4DLUA 1O0CA 2MSLA 4KFTA 1JWAB 3V8MA 3C8UA 1Y9AA 1Z7EA 2J9RA 2N1BA 1S4MA 3GLVA 3K1YA 2ZWOA 4HO1X 4AW9A 3DEHA 3M34A 2VP2A 2FUNB 4QFCA 2BBOA 5ED0A 2GAAA 4M8NE 4C5BA 4BX2A 4ZI7B 5IF9A 2X4IA 2Z58A 1IUPA 2R6DA 3GJSA 3ZKWA 4FMDF 3FNBA 1T2VA 4OGGA 2E6UX 3C3YA 1DO2A 1K8XB 1XRSB 2DTXA 5ADVA 1Z7BA 3ILHA 1RCTE 2FX5A 2VAMA 4LOJA 4XB1A 3OLQA 3WZ2A 3AFMA 4PANA 2OQ2A 1WBDA 1N4AA 3E5NA 3FRIA 4JLKA 1RHRA 4AMVA 1HDRA 1USGA 2P62A 4INAA 2FKAA 4NRDA 5COQA 1F06A 1IOVA 2IHJA 3TPZA 4FFWA 4PX5A 1ZOPA 4DGQA 4YRSA 3ND8A 2VP3A 2QSZA 3G7NA 4REMA 2NNWB 3NHRA 3WMWA 2E5LB 1NATA 3KYCA 5DNYB 4GSKA 4UTRA 5K6AC 1ZEJA 3HUUA 4L78A 2P2LA 4CT0A 1HX7A 2B30A 1T26A 3ZUGA 2PUDA 1KZGB 4N7BA 4EECA 4U2BA 2PTGA 1W47A 3NUQA 5BN5B 5I7HA 1ZM2A 3TEFA 3WGGA 2GF9A 4GFDA 2RGCA 2ZRLA 2JJQA 3H7AA 4OHCA 4R0VA 1TO1E 4E7PA 2Y3IA 4INOA 2R6FA 5CVJA 5B2FA 1BGVA 4NR0A 5FH9A 3H0KA 4LTDA 1T2CA 1IEVA 2GETA 3BT7A 4D6PA 1M54A 3H2GA 4GVPA 1NV9A 4HH4A 3ZVKA 3ZBTA 3PX7A 1QGUB 3FGNA 3N76A 5LNK1 4V0NA 1BDIA 4C0KA 1WNTA 4B1FA 5ITZB 3KLOA 4FYIA 3IB3A 3PHBE 1MCZA 1RAHA 4OHFA 2GD6A 3EGVA 5AHOA 1CYDA 1XRLA 3JARA 4NJEA 2Y6UA 1ODLA 3EAQA 3UJDA 5MGNA 2ATVA 1YR7A 3Q5EA 1D1TA 4PFQA 4HCJA 4FDUA 5ESWA 5TGDA 1MIOB 3GYGA 2VATA 2WT9A 4JLWA 4ZVUA 4EY8A 2VJOA 4OHYA 4P3NA 3S27A 4ETIA 1LZKA 1ECGA 2PQ2A 5CLQA 4Q7JB 2CLDX 2YVKA 2CDAA 2FV8A 5GTDA 5FUMA 2GK4A 3B52X 3K09C 1JDBC 2CFOA 1L7DA 3GJ6A 1YONA 4K9PA 1B41A 3ZHYA 3WKAA 4JYZA 4DR5B 4ZK2A 1R4NB 1YZQA 2Q3LA 2N46A 1SOVA 2Q9CA 2R62A 4Z0HO 3BDIA 3SZOA 4DDWA 5C80A 4BVLA 3RW9A 4RZ2A 1KFCB 2Y2UA 4G07A 4TLMB 3N05A 4ZALA 5H8WA 4AY2A 1CY8A 2QX4A 2VNJA 1YDHA 3CW9A 5FI1B 4DDTA 1XL0A 1B16A 2XTJA 2ANCA 1XEAA 2P69A 1OA1A 3IEIA 4PG6A 1PFQA 3BKXA 3WX0A 3OZIA 3GX1A 4HYTA 4ZVOA 3I2IA 3ZJVA 4OF4A 1RHKA 4GUDA 3ZE0B 4Q6WA 4PHCA 1EVQA 3A1EA 2EKZA 3VI3B 2WYWA 3BORA 5C8YF 3BIOA 2PCLA 1C9JA 4PRZA 1X77A 1MGPA 1R0KA 4RK7A 5FR2A 3SEZA 1RWPA 2ZRNA 4HF7A 1OA0A 1T3SA 2IPNA 3QYPA 3D8RA 3QUTA 2VKQA 3FN4A 4LZOA 3DFIA 5DLQC 1RC8A 1RLTA 2JGKA 2WJZB 2VTDA 4ZT7A 4A6XA 4PYOA 2KPOA 4J29A 4V3CA 4K9KA 3PXDA 1WUJS 3TNJA 2HK7A 1RRGA 4XLZA 4EJ0A 1JMKC 1H2WA 2XYRA 1ZRNA 1YU6A 2RHTA 3KPWA 3KR9A 1RVV1 1E2UA 3ZHUA 2FUCA 2YJGA 1EGHA 4PR0A 2ZM5A 3IALA 1DV2A 1E59A 3EUEA 1ISPA 2H5EA 3ZDBA 3BAFA 4HDCA 4EJFA 2Y93A 1ZONA 1EIWA 4GYJA 2JAUA 2HPHA 1UAYA 1XZIA 1OVMA 4B6FA 2QM3A 2IKSA 2H65A 4KQGA 4XCXA 4A7PA 4ZDJA 4YMUA 2AV6A 1P18A 2Q6OA 3BXHA 2O06A 3V4FA 3GZJA 1MQSA 2WB4A 4ZDIA 2JCXA 2Y71A 3ONNA 2H2FA 2HR1A 2VHUA 3LSYA 3DEKA 4LOKA 2ZETA 5C34B 2P6RA 2J4FA 4EHAA 4ZJPA 2WYOA 2HA0A 3HJFA 1X80A 1P33A 4JLOA 1GGHA 3K0FA 4W6ZA 4AIRA 2TECE 4AWXA 3Q88A 3VYUB 2P79A 3WP1B 2MSNA 1JRLA 3VISA 4B4VA 1Q15A 4QO7A 5BSHA 3ZWOA 1JR3D 1ZMOA 4WAUA 5AH0A 3L7IA 1MQ8B 1X1BA 2Z30A 4JP5A 1SUCA 2AEFA 4M1WA 1L4NA 1I4OA 2JHPA 1KVQA 3MSXA 3KPVA 2Y1DA 4WCFC 2J9YB 3ZNQA 3ZHQA 5K3FB 4MA4A 2OCYC 3WIVA 4IZ6A 3ROMA 2WU3A 4GPD1 3B9QA 1XLTA 4TS3A 3ITEA 4JBGA 4TQAA 1A9QA 2D5LA 4O29A 1O6ZA 4PY2A 4YP9A 3ZKWB 4A0HA 4ZVSA 3HFSA 2CFSA 4QVKA 4AS2A 4G5GA 1GL9B 5FNVA 4A8PA 5ES4B 4TZ6A 3T7JA 3JQ7A 2QD3A 2NP7A 3OJXA 4MQ4A 3I3OA 4IDOA 1QHGA 4ZP1A 4QUGA 2JGJA 3COZA 1IM2A 5EKSA 1DSSG 3PVCA 1DAEA 4L5AA 4MJXA 1KH2A 2AEEA 2JH3A 3NCHA 2J32A 4ANFA 1A04A 1K89A 1KY5A 1FW8A 1ZMBA 3KB1A 5IUNC 4FZJA 5FPKA 2C94A 1BVRA 1BX1A 1OR8A 1ANKA 2HI0A 1O58A 3CNBA 2V5UA 3NGLA 4NFHA 2AF4C 3KYCB 4QU8A 3VTAA 2OXCA 3DMPA 2BCEA 3PLRA 1GV0A 1S3FA 5JADA 1NN1A 1TIKA 4YUVA 5E9QA 1RKQA 4RZXA 5I7SA 2CNLA 2PV7A 4ARUA 1EK5A 2MT9A 2BR5A 4KPUA 1DKMA 2H7CA 1XD9A 2W6JA 4QQFA 2VLIA 4RK4A 2VDQB 2XQIA 1OIWA 1ONBA 1U2DC 3NM4A 2NUAB 1GKUB 2EDAA 3F78A 3G85A 3GOHA 3JAWA 4FOLA 1SCJA 3L46A 4LDPA 2WAXA 4OI4A 1Z7GA 4XPZA 5A4DA 1ZNWA 1M2OA 2NYAA 4RCVA 4F5YA 4D74A 1H69A 1SIWA 3KQOA 3CC8A 4P22A 1T5IA 1WCIA 1Z37A 3DCJA 4P4SA 3MF4A 5U9CA 1PV4A 1UBCA 4QEDA 1U5CA 1MH1A 1CXZA 2V4UA 2ORIA 3U40A 3FSGD 3F49S 3KWFA 3OTOB 3JQQA 4F96A 5CCXA 4N5IX 3GJ5A 4PPGA 1PBTA 3HB5X 1Y6ZA 4IH4A 3TZKA 3LKVA 1M1XB 4WKNA 1KEWA 3B3GA 3OICA 4RDHA 4GLFA 3H13A 9LDTA 3MSCA 1Q1GA 4EMSA 2QEQA 5LIRA 3BHIA 2UYCA 4XEUA 4OA8A 2V6JA 3DM9B 4WZAB 3NU1A 2FJUA 1PCXA 3ND5A 3UT5B 4F4HA 4ILEA 4M36A 4Q66C 3RHSA 2HWYA 1OBFO 3PRJA 4YEDA 3CRW1 5CDSA 3VNQA 4UATA 1F8XA 4JR2A 1EK0A 1RXEA 3GN1A 1NBMA 3WLRA 3TRJA 3A2NA 3OHPA 5AOBA 3CA8A 1SZJG 2XE6A 3E1KA 3A0RB 3F6YA 2YHAA 1EM6A 1XP8A 3M4NA 4K9OA 1AH2A 4NBUA 2EKLA 2ZKIA 3HE3A 2GYWA 3TD9A 2E7ZA 1UBKS 1FMLA 2VN8A 3KKLA 1KEZA 4AQYB 1FNNA 4ZZ0A 4CEIA 1EUYA 4C0AC 4LGYA 2IE0A 3SQMA 1RE1A 1IBLB 4R9VA 1T8YA 3MCUA 2PYDA 4MR7B 2M6LA 2QTMA 3R8XA 1Q7BA 3MBIA 4IDPA 3QU7A 2WDZA 4NENB 5EVCA 1KKMA 4Z7OB 1TIBA 5JNTA 5CHEA 4EY4A 1GPNA 2DFPA 1ECCA 3S2FA 4DBZA 4QDTA 4TPKA 4BVKA 4LEIA 1P19A 1G21E 2JHGA 2CXUA 3M9LA 4N40A 1E3LA 3AXSA 1XX6A 3CZMA 4PYIA 4DS3A 3AKDA 2PFKA 2FNAA 1TZJA 2HOQA 4FOTA 3EPJA 2VK1A 3GH1A 1JR3E 2J67A 1RKUA 2K2WA 3IILA 4Y6GB 3O7WA 1VL1A 3RSFA 1P5ZB 7REQA 5C8ZA 2JAPA 3I04A 1TM5E 4WXRA 5E8RA 4LRUA 3NUZA 3IQGX 2I8LA 1KVUA 5C5EA 2PEYA 2PSHA 4KZPA 1SCAA 1MTZA 1TUIA 3BIJA 4C2AA 3ZTYA 1KMHA 4JFAA 4J6FA 1G38A 3EZLA 4MUGA 4H7DA 5JOQA 1ZL0A 4O5OA 1L4HA 1CS4C 1P7CA 4QUBA 1EDDA 1WHSA 4NI5A 3MT0A 1NQVA 2AOXA 3ACDA 4GX5A 4I9HA 4LQ4A 2YHIA 3L8FA 1QJ4A 1HO3A 1T8RA 4KRYA 3BQ9A 4WTOA 3W8FA 2HAEA 4YMWA 3JZDA 2ZRJA 4LECA 1E79A 1PI3A 3WQQA 1U8CB 4Y2YA 1W6RA 3UAZA 3DZDA 3RJTA 4G0VA 2FFHA 1IWPB 3DD1A 5K51A 4MVJD 3TZEA 4HNVA 3KOMA 3ELDA 4BQNA 3KZOA 2A33A 2CMKA 3TPCA 2H2DA 3D3JA 5AP9A 4EBFA 2Q99A 4J3NA 1U0SY 1PJSA 4LHWA 4ZAYA 5K8UA 1Y8RB 1ZW1A 2C7BA 2PY6A 1BMQA 4CRWB 3EUAA 1NQOA 4LC0A 6AT1A 1N2XA 1XTSA 3OM1A 3AB3A 4LJRA 2BHSA 1KYZA 2FRDC 4LMBA 3Q7RA 2BZ0A 3L93A 4II3A 3CX8A 4OJMX 1ULAA 1LSUA 1VLJA 3PC4A 1WWKA 4W7SA 1RPZA 1XHFA 2E3JA 2QR2A 3CKKA 4EI7A 4ARZA 2CFRA 3UOWA 2G5GX 3D2BA 5AKLA 4HB2A 2WK1A 3DOUA 3FZNA 4NMLA 4Y67A 5MHTA 2R8ZA 4FR2A 4L08A 5FD8A 5IAAA 3OFND 4IMJB 1NTOA 3Q5DA 4IPTA 4G5XA 4ZU6X 4BV9A 5AVUA 5KYWA 2GBGA 2R4UA 1WDWB 1EWRA 1NXQA 4I1YA 3K1AA 1XPJA 4HEA6 4OB7A 3WXMA 2OPHA 4RW0A 1KYYA 1IN6A 1GPDG 2DR3A 2BHNA 2PK3A 1KO1A 2J7PD 2VDVE 1NRXA 1NYQA 1M3SA 1A8UA 1G1MA 4K9NA 4O02B 4OOEA 1YA6A 3RSGA 4I66A 1CVIA 3HEBA 1MO5A 1YFLA 4AFNA 2ACWA 1LI5A 2CNWA 2J3DA 2B25A 2OGUA 5I5GA 5IVDA 4M1KA 5T6MA 1RPAA 3N8HA 1VPDA 2DPXA 2WTXA 4KPUB 3RASA 4GBGA 2ZB7A 3L6OO 4A82A 2M9MA 3W05A 5A0VA 4U8HA 2Y27A 2WJWA 3OLYA 1HYBA 5CTAA 1KDOA 3JAWB 1W2HA 5SY9A 4KRGA 2CE2X 2GAJA 3E8SA 4LBYA 1ZGCA 4HTFB 4XQEA 2VZLA 1TTHA 3HA2A 1A4XA 1M2OB 2F1JA 2RK6A 1MRNA 1WF3A 3WVNA 5GZ1A 5MGBA 1XMOB 3NANA 1VYHA 2FQQA 3LA8A 4RE6A 1I6WA 1T5TA 3L0OA 1R5JA 4MAMA 1L5NA 3TOSA 2WNHA 2CCKA 1YVPA 2IYFA 1L3BA 1KTVA 4KIFA 3FVTA 2QL5A 1E9VA 5ALMA 2YOGA 3W90A 1NOJA 3BD8A 3T5DA 3DC7A 3ZTTA 13PKA 1KYWA 4KO8A 3MWJA 2A9OA 2PYIA 5AVJA 3TCNA 5ELLA 2ZYTX 3LF1A 2Z2YA 5IKEA 1Z8FA 4X1YA 1P4SA 4HSGA 1NP7A 4Q19A 2AVNA 3TQQA 3ASYA 3EEQA 4RMGA 3V42A 2BDEA 2Z4TA 3LL4A 3TUZC 4UMFA 2PBLA 2DGDA 4QICA 1VXOA 1XVLA 1QGED 1ZLXA 4BASA 1Y82A 3NV7A 5B6JA 3NWEA 4HWTA 5JFGA 5KQLA 2V3WA 3R40A 5C8YA 1Z29A 1JJAA 4GGPA 4HRAA 1NNLA 1MT0A 1ORHA 1ZCZA 2OM2A 5KYYA 1L5MA 4UCXA 3MFQA 5HJ5A 1PWHA 4K88A 1F48A 4OBWA 4HH3C 2X58A 3UPDA 1RZRD 3S5UA 1EFTA 4NZ9A 1Q1QA 3PIDA 1LB1B 4ALNA 3HCBA 4MW4A 2Z1NA 1SUAA 4XB6B 3TW8A 1PYOA 4YX9A 4XM2A 4BBJA 4HEQA 4KX5A 3S29A 4Z4QA 2ZJAA 3KR1A 4UAGA 3G0IA 4MRMB 5INTA 4R8SA 1C9YA 2RGNC 2H8GA 1R6XA 3VVMA 3UMSA 2NO4A 2NAPA 1N33B 5B7GA 3Q8MA 4Y0NA 2QX7A 2FYTA 1DFGA 4B45A 2A9VA 1Z6ZA 2EBHX 5FJIA 4V3BA 4MVJE 2FGJA 2KHZA 3ICVA 1BRMA 3EFBA 3DZJA 1EQ2A 3QXJA 1EK6A 1QH8A 2WM8A 1QO0D 1WDKA 2CC2A 3A2MA 4QDJA 4JJ6A 1ZCAA 4JEHA 2F43A 2HCJB 2O1SA 2VHVA 2XW6A 3HB9A 4ZTUB 1Z0IA 1LPAB 4JYMA 3D6HA 3K8YA 4H77A 3CX3A 4LOIA 2F9MA 2JIOA 3VPBA 1EFRD 1VIVA 1SK8A 4UTVA 5IABA 1W5BA 1WHSB 1YJQA 3D3NA 3LFUA 2H5IA 2C5EA 3H05A 2VYCA 3SPXA 1YA8A 2MSCB 2X5XA 2YHIB 3M5CA 3UN1A 2P9TA 2IYLD 4JI5B 3RC9A 2IY7A 1AO3A 4P58A 5L3ZA 3NHUA 4LYHA 2CCJA 4I8DA 1HDZA 2QHXA 3HY4A 2YJ5A 5EIEA 2EJUA 5KU7A 1SVUA 1T2UA 1XZAA 4FMDB 3NPMA 4PR3A 4BQQA 2YFYA 3HRIA 2G72A 1K9VF 2QTVB 2VPQA 3D3EA 3MW8A 4MV0A 4P35A 4UU8A 1M1YE 5ICFA 2HDOA 1V6SA 4RMJA 4RZHA 1Z6QA 2YZ7A 2BEVA 1Y1TA 3SOPA 4D4HA 2EJTA 1H1LA 1ZJ6A 3ZCUA 4DLLA 3AF3A 4M1OA 4NVRA 1XD2A 2B4YA 2G7MC 4Q3DA 5AHRA 3VDNB 4AUEA 3GLIA 1C5KA 3NCTA 5EY5B 4CFSA 1UC9A 1T5BA 1W581 2FE4A 2HQRA 1IDN1 1M8GA 4UBKA 2IYRA 2J6IA 4J90A 3SIWA 2OCIA 2NSHA 1E0AA 1XJCA 4MPTA 2WPDD 5FLKA 4ENWA 1QYIA 3LXMA 4U2KA 5FUXA 2HY7A 1SKUA 4XGKA 4ARZB 1R0SA 5AKIA 5HZMA 1L8XA 2QD2A 3I6IA 1G8KA 4B31A 2XCRB 2CCGA 2DPGA 3C3AA 3MB5A 4KAAA 1VSQA 3KJZA 1RQPA 3N7AA 5C1OA 4C0BA 2FY8A 3L3BA 1UR5A 3EUFA 3T1QA 3RRBA 1VI6A 3K1AB 2B34A 4EL0A 3NORA 4XJVA 1QC5A 3VR6H 1F2VA 2NO0A 5DHFA 1IE3A 5B55A 1IY8A 5KREA 2E89A 3QOFA 3SKXA 3ANXA 2QMYA 3C8MA 2QU7A 3JSAA 1PHRA 5TR9A 2ZANA 2BL4A 1UK6A 3GEDA 4GPBA 1BFDA 1A88A 3DLBA 3Q11A 5CFOA 4V1CI 1XPRA 2AJLI 3BG5A 1LSJA 2XMBA 3PGLA 3MJRA 4M7WA 3JPYA 1Q21A 2G76A 1YMVA 4DC0A 3CZ5A 2GEUA 4GMKA 4L7VA 4L9RA 5EYPB 5G3ZA 1A2OA 2I76A 4WESA 1O7JA 1LLCA 3MXOA 4M0LA 4EG6A 2WT8A 3C1OA 3NHWA 3R5KA 1EDZA 5CT9A 4EB0A 1URPA 2PGNA 1NF3A 1GSAA 1XEXB 1XZLA 2F62A 3EVFA 3JTEA 1OH8A 4HAUA 3DUWA 2CKMA 3WGKA 3TZ6A 1Y4AE 2D5CA 1XZQA 3D4OA 5AJTA 3FHCB 3O74A 2FZ5A 4IVQA 2QD4A 4KXNA 3HA7A 2X19A 3PEUA 5ETJA 1I0LA 1SVLA 1QV9A 3WL8A 4NARA 3P2MA 4S0XA 2OCPA 1RYYA 2ZU6A 4HEA1 3HH8A 2DXIA 3AVXA 3DWIA 2OYSA 2X6RA 3O9ZA 3RHFA 4C6TB 1I94B 5IVKA 2I6TA 1U04A 4OGWA 1TKRA 4ZVQA 1KK1A 4LHEA 4U7JA 1WABA 4O59O 2GPYA 3I32A 3N2IA 5TNXA 2RHGB 4HMPA 5D7NA 1KNXA 1T8TA 2DFDA 2Z5LA 3LFHA 1DC7A 3R6GA 1VIAA 3TOCA 3WMGA 1FOEB 5KYYB 2AEMA 2VXCA 2XMGA 4RCZA 4WCDA 2CLLB 3WNQA 4K8RB 2XDWA 4M9XA 5IMBA 3DULA 2C9ZA 3BK2A 4BLTA 2H1FA 3ODPA 3TFQA 2Z3VA 4UEOA 1Z17A 2Z9DA 4XYBA 4CKYA 3K96A 3A04A 3O9VA 3S2EA 4DRZA 2MSEB 1Q6ZA 2H52A 3EQZA 5E9JA 3FRHA 3FWHA 2X2OA 3QBEA 3TOZA 5EHIA 3GLHE 5FWDA 4XE5A 2XBUA 4EKYA 4ZEMA 2CB0A 3DL4A 3MWYW 4PYLA 2XT9A 2QMQA 2VVTA 4WOBA 5B3JC 1SU7A 2AA3A 5DM2A 5H1YA 5CJ2A 1K7XB 3IUJA 5EXDA 2ODAA 3V4OA 2I6UA 4JUDX 2NU8A 3WLLA 5I8PA 1G291 3E9DA 2FPXA 3U62A 3AVUA 5FLYA 1QMPA 2GAIA 4UU0A 3O3OB 4CWAA 1J1IA 1XTBA 5A02A 4IVPA 4Y2HA 3BXOA 5FTJA 5BUQA 4ICIA 3W2TA 3A3YA 2PMWB 4EI2A 1EFPA 3GQBB 3NEAA 1LBQA 3M81A 1OHHA 2OZKA 3I1JA 1T3TA 5JCXA 4MP8A 4OYHA 1UJ4A 1EJBA 2Z0MA 2I8CA 3GELA 4UFOA 1WY5A 1U8AA 4L3WA 4I0WB 4YO7A 4B71A 1NUAA 4KYUA 4URYR 2Q27A 4A0QA 3B1XA 1ISFA 4LDZA 1DC5A 2V54A 1H9BA 3WWYA 3PLAE 4QARA 3VGJA 3DKPA 5DP2A 2A4KA 5EJAA 5DGTA 4HAZA 2BM1A 2OSBA 4EO4A 3GA7A 4WLVA 3QFCA 1C1XA 4MIOA 5HQ3A 4JIGA 5LWHA 5AVVA 2HA5A 2Q6KA 2Y0DA 4XFJA 1TVEA 5EIFA 1YIAA 2KX7A 3EGXA 1OAOA 2O8BA 2WMYA 2A35A 3VJMA 1N5MA 2PT5A 3UGTA 2NO7A 1SRRA 1T6XA 4DMHA 2QPAA 4K81B 2QG4A 3AEUA 3AO0B 1ZD9A 5C7OO 5FPYA 3BIXA 2A4MA 3NGMA 4IWYA 3MMPA 1AKVA 4NDZA 5BW4A 3AUJB 721PA 3QY0A 4W5WA 2BMEA 1RAIA 2ZAOA 3PCRB 3HO6A 2PUTA 1K0UA 2FRVA 2VUSA 4IIJF 1XD2B 2GD2A 5BP7A 3GLIB 4PS0A 4IIGA 3IC5A 4FC7A 3VAAA 3QBVA 3W4IA 3JVDA 3T7RA 3L8ZA 4DQDA 1UPAA 1G21A 1QVAA 1WSWA 1NBAA 1KAMA 2P35A 2XQJA 3GDWA 2PRKA 3QLVC 4WMLA 4BMVA 4EUKA 2PZKA 3DMTA 5IYZA 4RC9A 5FLXA 3U4QB 2UAGA 4NZMA 5IAOA 1Z82A 1RRVA 3A1SA 1ZUWA 2NU6B 3CPSA 1JR3A 2R2GA 1A76A 3QGMA 4S1TA 5EAIA 4RHXA 1AUXA 4N6NA 3SBDA 2C54A 1UANA 1N8SA 2WKQA 4MR8A 4RACA 4KH1A 1OLUA 4HUTA 3AHIA 3TX6A 3RYTC 1NVFA 3IXMA 1UT6A 2YQZA 1I9CA 2WLTA 3DFUA 3IVCA 2DUWA 4UBOA 1TJ3A 1GU0A 1X9HA 4RTOA 3GZNB 2EEPA 3KLMX 4YQYA 3TZLA 1WCV1 1NVAA 4KQXA 2XDAA 1D09A 1ZH8A 2ECQA 2ETVA 2P8JA 3OIWA 4CQJA 4CTNA 3N86A 4I1PA 1I4TD 2FZLA 3E03A 3LLUA 5C8XA 2B7LA 2E4AA 1PK8A 1NJ2A 3EX7C 2JGDA 2FF7A 1YC5A 2FR0A 4B4UA 4HQFA 2OFXA 4PPQA 5DN6D 2C7OA 2ISSD 4OHUA 4BJHB 1I3MA 3LHDA 1G6HA 3K0CC 4EM6A 5MDHA 4X5OA 1JEOA 1SUFA 5DTEA 1TXGA 2OTCA 5EXTA 4LAFA 1KK0A 4PLYA 2XXAB 2JCBA 3AR5A 2MYUA 4AZSA 3B51X 1N2BA 2XGJA 4MDHA 2AQIA 2ISQA 2OLJA 1GUBA 1S8OA 1PWZA 4OFXA 4MIKA 4EYSA 3OBIA 1BHJA 2RI0A 2NT3A 1C0EA 4UTPA 5JEEA 1QQ6A 5F64A 3BB4A 3HGQA 3WHIA 5P21A 1PSDA 1U5BB 2H8KA 3F7NA 5ECYA 4C7XA 3IVMA 2C7QA 2Z3ZA 2JLYA 5HKKA 3TD6A 5KJCA 3R6LA 4OXXA 4D56A 3IPXA 4FGKA 4DOMA 2CDNA 4ZQHA 3W1WA 4RFSA 1VE3A 5K3AA 5BT8A 5BPFA 4PLZA 1FY2A 1CRPA 2J9XB 1OV6A 1R88A 2V9ZA 1P5RA 5DYYA 4JJ7A 1CUWA 2JHFA 1C1HA 5ALLA 4JI1B 1BXRB 1J8YF 2YN0A 4GOOD 5JRJA 4TS9A 3CVUA 2JAXA 3IBCA 4UVDA 1T5HX 1E2MA 5GGYA 2IH5A 2OY0A 2IVFA 3IPRA 3TL6A 1DXOA 2ZROA 3PHIA 2GERA 1O9BA 3QQPA 3RROA 4NS1A 1RYDA 2RC5A 1U8ZA 4N5DA 3EXIA 4RORA 1T8PA 3IUBA 5B37A 2VRCA 5DF1A 2FZWA 2C9DA 3FVQA 2JLAA 3PEVA 4XM1A 5LDGA 5LQSA 4EHBA 2AMLA 2D59A 2QRMA 1ZXXA 1EA7A 4C4XA 2AI3A 4FR5A 3MJTA 3WR5A 1XZFA 4RBNA 5REQB 3KCNA 3T7KA 4N5HX 3QEBZ 1E63A 1GUDA 2BTQA 2P68A 2V7BA 2ZSUA 4DA6A 5HPYB 4UDOA 4NQZA 1G3RA 1U0LA 2M2IA 4FS3A 3ANSA 3QX7A 4WDRA 5LJLA 1PT8A 2WA2A 3LW8A 3KT6A 2I2BA 3L7YA 4KWHA 2A1UB 4XDZA 1X7YA 1SXHA 1THZA 3IQXA 1D6SA 2P91A 2A0WA 4PE5B 3T5MA 1RKXA