3KHTA

Crystal structure of response regulator from hahella chejuensis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
132
structure length
132
Chain Sequence
b'SKRVLVVEDNPDDIALIRRVLDRKDIHCQLEFVDNGAKALYQVQQAKYDLIILDIGLPIANGFEVMSAVRKPGANQHTPIVILTDNVSDDRAKQCMAAGASSVVDKSSNNVTDFYGRIYAIFSYWLTVNHCQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
publication title Crystal structure of response regulator from Hahella chejuensis
rcsb
source organism Hahella chejuensis
molecule tags Signaling protein
total genus 46
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3khtA00
1GUBA 1SD5A 2IPMA 3N6VA 1UDRA 3DLHA 1DP4A 1TLFA 3QLVA 1PEAA 1URPA 5TQ0A 2L2QA 4JOQA 2MYNA 2PUFA 1NTRA 4JASB 3HEBA 1CEYA 4MR9B 5TPZA 3IP6A 2FMIA 3QX9A 2XDYA 4PICA 4MS3B 1YTUA 4KRFA 1MB0A 3IPAA 4XXHA 4KK4A 2IYNA 4F12A 2JVKA 4YO7A 3DBIA 1E2BA 2AYZA 2R4QA 4Z0NA 3A10A 3CZ5A 5TPWB 3N0RA 3OLXA 4N0QA 4NQRA 2P4UA 4RK4A 5HQJA 2PAFA 4NCAA 1Z2DA 3NNNA 3KSMA 3OQMA 2E4VA 2RGYA 3L6UA 1Z13A 1U8TA 2QXYA 3CS3A 3E3MA 4MLDA 5KC9A 1ZH2A 4P98A 2R47A 4MQEB 5GOTA 2PUCA 4G0MA 1GUDA 2M1ZA 4MS4B 5FWYB 3O21A 1BVHA 4N41A 2QU7A 1ZN2A 3F6CA 1FFGA 2WRZA 4Z4GA 4RS3A 1H9CA 5BRAA 3N53A 1ISRA 4RDCA 2FN9A 3SAJA 3M6MD 2JBAB 1EAYA 3I09A 4RXUA 4WZZA 2FKAA 4S04A 3LUFA 3CZCA 4H3HB 3URMA 4JAVC 4DADA 3CHYA 1P6UA 4MQFB 3HUUA 1ZDMA 4Z4IA 1XHFA 1JF8A 2E4XA 5TPZD 1TM2A 4S05A 3O1IC 2JVIA 3HSYA 2GWRA 4W5TA 3N75A 1L5ZA 3LFTA 4WXMA 5JS2A 4OLAA 4KFCA 1DRJA 1QO0D 4HYEA 4MAAA 5T3YA 2LPMA 3H6HA 3H5WA 2PKXA 3MYYA 5FWXA 1YVUA 1ZGGA 4RSMA 2PUDA 3H5VA 1DCMA 3MMNA 1B00A 3GRCA 4F11A 3QEMA 3H6GA 4MPTA 4WWHA 3HDVA 3GA5A 3NNSA 5IUKC 1EHCA 3MF4A 4G0PA 2FLKA 5JNVA 2HJ9A 3FMVA 3MA0A 1SRRA 1ZY2A 3QLUA 4RY8A 3R0JA 2LUOA 3SY8A 1NY5A 2PUEA 1DC8A 1LBIA 1MAVA 3O2SB 2J48A 3LUJA 5IX8A 1DJMA 1NXVA 4WT7A 1QPZA 4RK0A 2VUHB 4D6YA 3ROTA 3W9SA 4MS1A 1YK1A 4H3KB 2WB4A 3FFWA 3CU5A 3UKJA 2CWDA 2NZUG 5TQ0B 1MB3A 2A9PA 3RH0A 2WY2D 3A3KA 5FBKA 3EDCA 2HSGA 4LX8A 4Z99A 2PUAA 2AYXA 4Q6WA 1D1QA 3LUCA 1JDNA 3CFYA 4PYRA 4E7PA 5KQLA 1QP4A 2OENG 2IOYA 3IP7A 1JX6A 5E3JA 3SM9A 1OXKB 1DCFA 3N8IA 3H5OA 1QKKA 3H5IA 4KVFA 2GI4A 1U0SY 1VLZA 3RVPA 1E6MA 4TMYA 1C4WA 3BRQA 3TMYA 4ETMA 4W5RA 3QELA 3RVKA 3HK2A 4N0PA 4ETNA 1Y1LA 3NBMA 4HNQA 4RWEA 4YWHA 5KQPA 1USGA 3OMWA 4KZKA 2E4UA 1OXBB 2PUGA 2WMYA 1NATA 3DZDA 1JL3A 4XAQA 5TQJA 2JCGA 3CKMA 1RZRD 4G0OA 2VUIB 5BRJA 8ABPA 3QX8A 4FE7A 5C5EA 3CRNA 2WWVD 4O5AA 3LMKA 5IULC 1NXXA 3P9YA 4YLEA 5IUNC 3GT7A 2FQWA 1RXEA 3QLTA 4LE1A 4KMRA 3O2QB 5JNUA 1CYEA 3JPWA 3LOPA 5CNKA 4Q6BA 3M9XA 1QO0A 4MYRA 1PNTA 5CNJA 1T34A 3D8UA 3DGFC 2V0NA 4QICA 1PUXA 2FTKE 2GKGA 3BRSA 3OMXA 4G86A 1Z18A 1JWLA 3BILA 4MRMA 2QR3A 1YK0A 2IPLA 2ZWMA 1J56A 4XARA 2MYPA 7ABPA 1TMYA 5FWXB 3OLZA 1QNLA 3O1JC 4M88A 4RK1A 4LE0A 4KREA 3VNAA 3HZHA 3I45A 3ILYA 5EWLB 4ZJPA 1LK0A 3OLWA 5FBHA 4Z4HA 1APBA 3RVLA 3N0XA 4FE4A 3S99A 1QP7A 4RKQA 2MSWA 1ZAYA 1FQWA 2ZAYA 1ABEA 4GNRA 3KG2A 1ZESA 1ISSA 4NICA 3M9WA 3SQNA 3F73A 3JPYA 2ID9A 2FQXA 5JS1A 2E4YA 1RXIA 3O74A 2M98A 1LBHA 1M5TA 4MR7A 3O1HB 3IP9A 2QW1A 3RVOA 2JB9A 1M2FA 2KYRA 2VK2A 2RJNA 1U2QA 3EAFA 3FDFA 4JP1A 4RK7A 1DRKA 5KI6A 1VPWA 4OG2A 4WUTA 3HO1A 4EY3A 2WJWA 3HXMA 1MVOA 4N76A 4QYWA 1A2OA 1KGSA 1PEYA 5TQ2B 3N0WA 3C6QA 1SXIA 5EWMB 3EODA 5EWJA 1YS6A 1LJUA 5EWLA 1XHEA 5CNMA 1WETA 1FFSA 2MSKA 1NXSA 1Z25A 1FSPA 2IKSA 3KYJB 2F8SA 1YMUA 3OO1A 1P2FA 3I5AA 3EJWA 1NXOA 5CNIA 1PNRA 4RK5A 2L18A 3JVDA 4L85A 4MR9A 4MR8A 3KLOA 2FW0A 4MS3A 3C97A 5HKOA 1F51E 1BA2A 5PNTA 4OBBA 3EQ2A 2NUBA 4YV7A 4GPAA 2JVJA 2NT3A 3HM9A 5DCLA 5TPWA 5JNSA 5T7BA 1DG9A 4G97A 2IPNA 1RZRA 4DQDA 5KQGA 1BDIA 3QEKA 5JNTA 3RVMA 3KKEA 3ROFA 1DBQA 5IBQA 4PZ0A 4G0QA 3Q7RA 2QVGA 2RJOA 3H75A 2WJAA 1D5WA 1K66A 1FFWA 4MQEA 9ABPA 1JYEA 4Z4CA 5HSGA 1QQAA 2BGGA 5FWYA 3F6PA 3GWGA 3LUGA 4HNRA 5JNWA 2FXIA 1GCAA 1TVMA 3LUAA 2FMFA 1IIBA 2GX6A 3C3KA 2FMKA 1PHRA 3KJXA 4RY0A 5D2CA 2FEKA 1Z16A 4HNSA 4KK3A 3NHZA 4QYMA 2IDMA 3O2JA 1QMPA 3OLYA 3OO0A 5B3JC 5F64A 3K4HA 1W25A 3TX6A 3GBVA 2QV0A 5DLEA 1DC7A 2FMHA 1Z12A 4IRXA 3CG0A 3TB6A 2FQYA 2VYCA 4N03A 4CBVA 1NXTA 4RXTA 4MQFA 1AB5A 2B1JA 5HM6A 2QZJA 3GL9A 3H1GA 3E61A 2F8TA 1VRVA 3QLVC 4D74A 1P8AA 2Q5CA 4RZSA 4OATA 2HQRA 3FFTA 2PUBA 3TD9A 1YMVA 4RXMA 1EWTA 4EUKA 4YCSA 3K9CA 2PE5A 5C5CA 1DZ3A 2A9OA 1A0OA 3OM0A 1JDPA 4IMIB 3RVQA 5JNRA 4O1IA 4MGEA 3GYBA 3KHTA 1E6KA 3CTPA 3SNKA 4G0YA 3GV0A 3H5LA 4TLLB 4UHKA 3MIZA 4LE2A 1I3CA 2B4AA 4LRQA 5CHYA 3QK7A 3EGCA 3RVJA 3KLNA 3FGZA 3GBPA 3OM1A 3D02A 2TMYA 3HV2A 2GBPA 3H5TA 3JS5A 4PEVA 1QP0A 3LUHA 1GCGA 2FN8A 2PMCA 4XFKA 3KTOA 1QQBA 1LJLA 4LZLA 1YIOA 3CNBA 3RQIA 4JB2A 3A0RB 3RVRA 1JFSA 3RVNA 3QEMB 3JVIA 3C3WA 4QPJC 4MR8B 3T38A 1JH9A 3CLKA 4KV7A 4Z9BA 2I6FA 4Y9TA 4KQ9A 4W5NA 3DGEC 1K68A 3EQZA 1M2EA 4ZMSA 4W5OA 1CHNA 5KQMA 4D6XA 3ILHA 3KCNA 4EYKA 4FB4A 4TLMB 4MS1B 1BDJA 2HPHA 4RK6A 3VNBA 3BBLA 4YR7A 4G0ZA 4F06A 4KQCA 4YP9A 1KRWA 1ZVVA 2P9HA 3IDOA 2R48A 3HVRA 1ZITA 1KMIY 3NHMA 3DLBA 1YS7A 5TE9A 3IP5A 3L49A 3OQNA 2ID7A 4B09A 1ZGZA 5KC8A 4LDZA 4YGXB 1EWKA 1USKA 1SXHA 1S8NA 3BREA 3RVSA 5ED4A 2JRLA 6CHYA 3H1EA 2W42A 1RNLA 2A9QA 1MIHA 3Q9SA 3QLUC 4KNYA 1E6LA 5DTEA 3JTEA 5GQSA 3Q41A 4MLCA 4F8JA 3Q7TA 4WXEA 1EFAA 1TJYA 3NNDA 3UUGA 4XASA 4OTZA 1EWVA 4NV3A 4EVRA 3QELB 1GLGA 3F7NA 4Z4FA 1Z26A 3EULA 5BR1A 1P6QA 3UK0A 3KYIB 2R25B 4ZPJA 4ZMRA 2FSPA 3LKBA 5DGCA 1VKRA 1R8JA 2PL9A 2PJUA 1JFTA 1NXPA 2HQBA 2MYTA 3C3MA 3HS3A 4IMJB 4RKRA 4UHJA 5KWSA 4EVSA 2YHAA 4XLTA 2FVYA 1F4VA 4EYOA 3HCWA 1D1PA 2CHFA 4IGAA 1DCKA 3LKVA 2RDMA 4KPYA 4MS4A 1JLKA 4ETIA 3H1FA 2FEPA 2MSLA 1D4ZA 2LP4Y 3HUTA 1C0EA 1U04A 2PL1A 3Q15C 3I42A 2FLWA 4PE5B 3T6KA 2JK1A 2X7XA 2HQOA 4O1HA 5IC5A 1U2PA 3MQ4A 3MM4A 4Z4EA 2JBAA 2LBPA 3OLVA 4NCBA 1AB6A 4E7OA 3TO5A 2NT4A 4JB0A 4MRMB 1Z15A 1USIA 4ML3A 1DBPA 2LIVA 5ABPA 2QVCA 1Z17A 2L17A 1ZH4A 2A9RA 4IILA 1L5YA 2O20A 3A0UA 4OLBA 1M5UA 3KS9A 1RPJA 4LDAA 5IEJA 4TN5A 1KRXA 1BAPA 2E4WA 4DN6A 5TQ2A 2E4ZA 2CD7A 2QSJA 3T95A 2NZVG 4EVQA 5EWMA 4YRZA 4ZYLA 1JHZA 4Z9AA 2IPAB 5IEBA 4RY9A 5I4CA 2DRIA 2CHEA 2H0AA 3HDGA 3Q7SA 1D2AA 3O75A 4RV5A 1BDHA 3JY6A 4H60A 1JBEA 2L19A 1SXGA 4L4UA 4MR7B 3B2NA 1JFVA 1W9HA 4YS6A 3LUKA 3LUDA 3HJFA 1XWWA 1ZHHA 4P1ZA 6ABPA 5IUJC 2N9UA 3FFXA 2PLNA 3SG0A 1DBWA 3G1WA 3CG4A 4N47A 3T8YA 4F3TA 5B3JA 1JYFA 4EGSA 4JA2A 4RU1A 5DKFA 4Q7EA 1HEYA 2YHBA 4W5QA 3IPCA 1A04A 2H3HA 2MYUA 3G85A 3LTEA 3OQOA 1ABFA 2OQRA 1Z2EA 4G0XA 5EWJB 2FEWB 4EYGA 4EYQA 1NXWA 5BQ3A 4IF4A
chains in the Genus database with same CATH superfamily
3QLEA 4CKBA 4DUGA 1XQXA 3G5TA 3S40A 1UF9A 2WMNB 4PYLA 2ILVA 3K9GA 4G25A 2ZRFA 1EJBA 3O2NA 1CUBA 4MVJD 3GNQA 3HI4A 5CVJA 1IY9A 1NTRA 3I04A 3PI7A 2WWWA 1KMHB 1YKFA 4RLFA 5ILQA 5IDXA 3D0KA 5F76A 3JZAA 3NOXA 5E8RA 4IOMA 1MB0A 1WPXA 3ZV3A 3OJWA 3O92A 3I6ZA 4K9NA 1CJBA 1YDHA 1ZIOA 4OHPA 3NM4A 3PICA 1XUOA 1Z3IX 3QPBA 2R4QA 4CRWB 2VZ8A 1FDUA 2B8WA 5TPWB 4F9GA 1EX7A 4FQ8A 2EEPA 3ECAA 5DNDA 4XWKA 1XTQA 4ZT5A 3OVMA 4BJ6A 4JP2A 1YZNA 4DR3B 2FZ5A 4E51A 2H57A 3CS3A 4QT0A 2ZR7A 2V0CA 1X2EA 3JR7A 4PLCA 2DWQA 2AYYA 2DVMA 4DV1B 4G0MA 4YCCA 1AA6A 1BE8A 4AO7A 1W4RA 3WNVA 4Y2PA 4DA7A 3O8OB 5KOJA 3DP7A 4RDIA 3H05A 1W96A 1ORTA 3KOYA 4AMZA 4AU1A 1DKRA 5KTRA 1KZGB 5A4AA 2WUEA 3IE0A 3WK7A 3D6VA 4WA8A 3QV2A 1BS9A 1PWHA 3EOZA 2VTBB 4FSHA 1QWSA 1TA0A 3NXSA 3AM4A 3K71B 1EUCA 3GP8A 1EFPA 4QEDA 2JBAB 5M34A 3TBKA 1C4OA 3FHJA 1WSAA 2C2HA 4BAZA 1ODKA 1VBFA 3RHZA 1TCVA 4S04A 1H5NA 1LLDA 1UXIA 1FTSA 3C2QA 1F3LA 2IGTA 1DG1G 3URMA 3VTAA 1WX1A 2EQAA 1OZFA 1VSTA 4HKTA 5E4YA 1E62A 5K0LA 1U8XX 3UT6A 3FUWA 2ZCVA 4KPUB 5BQOA 2Y92A 2ACEA 3LIIA 4TXHA 3R7BA 2AVNA 5JS2A 4JLAA 4LRTB 4BP9A 3UFXA 1P7WA 3WISA 4MOWA 2ZIXA 1M34B 1C29B 2R6R1 2V6IA 5IW8A 4YDSA 4Z3KA 1M6VA 2BRUC 2IIQA 2BMAA 5HBRA 1GITA 1QH0A 4MPTA 2R7MA 3L0IB 3RT1A 5FCDA 1ULTA 4RMNA 5JW6A 4G0PA 1LX6A 1J99A 1N5OX 1T9KA 1WP9A 2B94A 2BBTA 2NO5A 5G0UA 4A8JB 3T7CA 1CVRA 2GPJA 2OQ2A 3D8TA 3SF0A 2P2CA 4KQWA 4EG5A 1U3VA 3CEAA 1QORA 4MV1A 4PZ9A 2DEUA 4MDFA 4FNMA 2ODEA 3GIDA 2FZGA 2PG3A 3FNRA 4KE7A 4Q7QA 3IP8A 4H3KB 4UFOA 2R7NA 2C00A 4UTXA 1KHHA 4MWGA 2B2NA 5A6VA 1R5BA 1GUYA 1I7PA 1RVV1 3MPOA 4MYTA 3S29A 2C59A 1D2NA 4I5FA 3MHTA 1Q6ZA 1KKLA 2BEKA 3DL2A 2XUZA 3G1TA 1LTQA 3GVCA 3LOQA 3MIIA 2BCJQ 5FBKA 4FSDA 1B0UA 2XUJA 5IWCA 1WDTA 5ED0A 4JIMA 2WIFA 5I9NA 3K0HA 2AQHA 4URZR 4BVFA 3K1TA 5IYZB 5AI8A 3L0ZA 4MYHA 1L5VA 2XCIA 4Y3UA 1K08A 4C7JA 4JL5A 2IOYA 4GM1A 3UCFA 1GTG1 3I8OA 2GZ3A 2IUFA 1FP1D 1YCHA 3KYCB 2GETA 5CYGA 3A14A 1A7JA 2I4TA 2YVUA 4YRNA 2VDQB 2F3RA 3B38A 5ER6A 4DF3A 3C24A 3FVTA 2VNJA 4UHCA 1W49A 1E6MA 1B2LA 2JIZD 4O4HA 4OQQA 3O3MB 3BRQA 3KAQA 1BD3A 5AJTA 1DJLA 2AUMA 3MK31 2WFMA 4R1TA 3MEQA 2HIGA 4M0MA 5T4FA 1JEJA 2ZWOA 5FRDA 5K3OA 3PFFA 3UKDA 4D4MA 2AI2A 3CLSC 4WNYA 5ALDA 3N8NA 4QOEA 4NDNE 2OZLA 1G7SA 3DZDA 1KO7A 3OZTA 3HDQA 1NPYA 5EG5A 4PGAA 2W83A 2QSUA 1M8PA 2ZI7A 1HDOA 1OWNA 4RDHA 2Y6VA 4ARZB 4NAVA 3OCWA 3TGPA 4YUXA 2HPAA 3AUFA 4JGBA 2JFQA 1EIZA 4YLEA 2OCIA 3GT7A 1X1TA 3N07A 3GF4A 3ZKWB 2ARKA 5K3FB 2HSDA 3H1PA 1SVUA 3RIYA 3LOPA 4JBHA 1ZM7A 4U6SA 3U7FB 3PZBA 4C0QC 2V0NA 1MEEA 3IAM6 621PA 2GKGA 1G8JA 1Z5GA 2ID8A 4GPZA 3BRSA 3E3NA 3Q2IA 3SFTA 3VHRA 4WL0A 4XARA 4DBLE 3F3KA 6ADHA 2ZTHA 2JLZA 3T52A 2D2FA 3N0TA 4GHWA 1QNLA 1GO2A 3E8XA 3O1JC 5AHOA 2EYUA 3HY3A 4IIJF 3VX4A 3ONEA 3LPCA 3A9RA 4BNDB 1PR1A 2QENA 1G0OA 2BSXA 2RG7A 1DKPA 2FPOA 2YN0A 4JELA 2MSWA 4OMFG 4Q3EA 5B1DA 4LC0A 5JECA 5E0OA 3H5RA 1XU7A 3BZWA 1SEVA 3DP9A 3M9WA 5FNZA 3AYZB 1THMA 3W5IA 1IBMB 1XNRB 1U2RA 2AOUB 3AX6A 5G02A 4M38A 3UXYA 1KRHA 3TRKA 2VHZA 3KXKA 1SOUA 1R0RE 5H83A 1PV2A 1HNXB 2NZ8A 3IP9A 1V9LA 1OXVA 1VKNA 4GR5A 4HNHA 4MUIA 4X1YB 4YJ2B 2RJNA 1XPOA 1EXNA 3SJUA 5AM0A 1XVTA 4RGBA 2H2HA 5ELXA 5KYVA 2FOIA 1R4ZA 3AWDA 4C4RA 2QYTA 2ZRAA 3AR3A 3FOAA 1MF7A 3TLKA 3RYFB 5E7MA 3FZEA 4EQ6A 3HXMA 2HLDA 4C7BA 4ZEMA 4XVUA 2OLEA 4WA7A 4X91A 1N1MA 1PG5A 4IS3A 2TMDA 3B1XA 3CEPB 5EWMB 5M29A 4GLBA 3AHDA 4MUEA 1X1DA 4Z53A 1DIGA 1MJ5A 2NXNA 1YBFA 2QN7A 4YAUA 5EKUA 1Z25A 3AEXA 1I1NA 3E81A 3MAAC 1USUA 3OJEA 1Z6GA 2B30A 2C84A 2Y1WA 2PWAA 4FP9A 4WOPA 3SFVA 4CG3A 4F9TA 3B5EA 3DOUA 1F6BA 1V7CA 3KEQA 2O8CB 3EWSA 1XZNA 1VYVA 1ZVJA 2GS9A 3NQ41 2VK4A 2QTMA 2H0RA 2LV8A 2WSBA 2X19A 4QWMA 4B2YA 1NM5C 4CNBA 1Z07A 2PCJA 3FD8A 2P62A 4UASA 2WHPB 1EWRA 3HA3A 1UKAA 4IX1A 3AVVA 2VXCA 3PTZA 4IQGA 3HM9A 3DB1A 1F8YA 3BMQA 3TZQA 1T1EA 3U3DA 2F59A 3IHTA 3KVRA 3RSQA 4XPIA 1QCCA 1MXHA 5B12A 2QHXA 1R37A 5IHXA 3FW1A 1GQ2A 2SECE 4LY6A 4NIMA 5GJVC 3EDRA 2AX4A 1OBCA 4XVRA 1OYYA 2PZMA 2XNSA 3HXTA 1E9VA 4YRBA 3KSDO 4KLAA 5HSGA 4QEKA 3FSGA 3SHTA 4EGJA 2QIOA 3EWIA 1VC2A 3DM5A 5FLKA 5B1IA 2ZRNA 5IZ4A 3QGMA 3AR4A 1CK4A 1KQ3A 4NBNA 3V00A 3QU2A 5JMPA 1YZLA 1GARA 2FR0A 2WYOA 3OQ1A 3CH4B 3WRVA 2E3JA 1IXRC 5DTJA 3BE4A 3SEZA 5J43A 3QE2A 5DI9A 1M0EA 2NV2B 3D54D 4KH0A 5I3CA 4A1OA 1HY3A 2Y4NA 4ZC8A 5LB2A 2WF5A 3VR5A 3CUYA 4KL8S 2XB6A 2WAYA 2A1UB 4BX9A 5DEIA 5FOWA 3UCXA 4GBJA 3IKLA 1GCUA 2ZKLA 3CM0A 4RO0A 5ELLA 2GBGA 2K6GA 4BLOA 5LQAA 1FLNA 3ZDEA 1Z7YA 1EDEA 3GL9A 4ENRA 2I7TA 4CKCB 4IOKA 3IDSA 4ZAXA 1CNEA 4D74A 1PGPA 4L6CA 1L8AA 5DE3A 1W7AA 1I1QB 3G6WA 3B48A 2H4HA 3OJLA 3FFTA 4LZOA 1FTNA 1SUCA 1T0HB 2C9MA 1F6DA 1BEUB 5A1TA 2ZXUA 4NYMQ 4P53A 4AQYB 4JFRA 4ENPA 3REQB 4EB8A 2YZMA 4YHHB 3G6KA 3LDFA 2O4UX 2UYOA 4V0SA 5J9FA 1A0OA 4XJXA 1JDPA 5DBIA 3ZXXA 1XVVA 2W8ZA 1S2IA 5LQUA 2LNDA 3FCCA 4BLVA 3ZU6A 4UU1A 3HFRA 4NF2A 1TGYA 2QUAA 2W6MA 5IJXA 4I55F 4BMCA 4PPGA 5M04A 1VPEA 2Z04A 1AK1A 2O2SA 2R85A 3UN1A 1CLUA 4GMXA 2FEXA 3TPFA 1DO8A 1DQZA 1ADBA 1OA1A 3ETJA 5HWSA 4MYSA 3A6HA 3H8WA 5KTKA 3PUXA 3WADA 3WL5A 1V1RA 5JBIA 3JS5A 2HLPA 3AG6A 5K0GA 5FYDA 5LOVA 2I6XA 2R1TA 4B9AA 1J2TA 4WLVA 3WBKA 4WZBE 3DS8A 5JAIA 3BWDD 2ZS9A 3RB8A 1QQBA 2REBA 3QRWA 2H1FA 4JB2A 2HR1A 3KE9A 3CB2A 2QUIA 4DSOA 2APJA 3H86A 4UC0A 1RHRA 1M1NB 1PFYA 1H9BA 2XECA 5IM5A 3I04M 1GTVA 5TJ9A 1D4OA 4B3SB 1W36C 1E6WA 3KYDB 1XBTA 5IBPA 1HLDA 2IZ1A 4CKWB 4HB4A 3IOCA 3TW6A 2WP8J 1XZMA 5BT8A 4U7DA 2WPDA 1N9ZA 4CLHA 2C4NA 4FHDA 3T1NA 3NAMA 4L5CA 3HHEA 1SVMA 3NASA 3IIEA 1PK8A 2AI3A 2VSOA 1EVQA 3CH7A 3FHOA 4C07A 3ESRA 4DPKA 2EARA 2Y1LA 1LRJA 3O8RA 1YGYA 2QTBA 1D2MA 1M2VA 1K7CA 2IHYA 2EJWA 1NJ6A 2OO7A 5TE9A 3V3TA 4PPYA 4X95A 3ORHA 4JBIA 3KBBA 5TGDA 1DAIA 1GAWA 3AVYA 5FV7A 2CSXA 4F9FA 1M6HA 2O14A 3HP1A 2QN8A 2GFQA 2YVLA 2Z0MA 4NAUA 1SK9A 1FSSA 1OHHA 1THGA 1TW3A 2J32A 2O2YA 3H84A 4QU9A 3OZAA 3WKCA 4IIJA 4Q21A 1VSUA 2H7YA 3QLUC 1XX6A 1E3WA 2QL6A 5B30A 1NKVA 3OTHA 2FWRA 3VTKA 5FLXA 3H7IA 3UYLA 1FVFA 4YH1A 2EKDA 4JKYA 5FP0A 3O7WA 3R3ZA 4Y2SA 1V25A 5AUQA 5B1HA 1U8AA 3RUDA 1XF9A 3MTQA 3D6NB 1CFJA 1P80A 4MUFA 4RJKA 5I9BA 1M0TA 5SZHB 3ZV7A 1H4QA 1HA3A 4G2TA 1CZKA 4OHRA 3WGJA 4B46A 1X7XB 1P62B 3I6YA 1P6QA 3N8DA 3OM9A 3AERA 3KYIB 1EFTA 1OAOC 1R0SA 4B75A 1JEDA 3WDSA 2XRYA 3BRWD 5CG2A 1KFCB 3CX6A 4N12A 2PJUA 2ODTX 4GLJA 5AKKA 5FL7A 1CW2B 1EVZA 1ZW1A 2JFYA 1Z4QA 3MG9A 4TZKA 4W9NA 1OFVA 3ZLTA 4CMEC 1MX3A 4E5KA 4L7VA 5L4NA 3KQLA 3SR3A 1TTQB 4C29A 4BZQA 1ESMA 1RW4A 2LXNA 4NYJQ 1UQRA 4LUCA 4QVIA 2BMJA 3UAYA 4ISCA 1ZJ5A 2YR0A 5SICE 3GUUA 1JIIA 1ZD2P 2W0MA 4CIYA 1WB4A 2YIDA 4B35A 3GNTA 3CF2A 3QHPA 1HYGA 1P4RA 1VMEA 2W00A 5CFQA 4KWIA 1E7SA 3VR6D 1WIWA 3TK1A 3MQ4A 2HGSA 1NFQA 2QG6A 1V3QE 1N8NA 4J4TA 1HORA 2IGBA 1B6SA 5EEHA 4FFWA 2JH9A 4E5YA 1G2PA 1LDMA 3IHKA 2IXGA 2D00A 4B4WA 1T4CB 1Q20A 2PKQP 2REXB 1LCIA 3DHVA 3DDWA 1OSNA 2ZRJA 1W2WB 3INRA 4LMAA 5AVJA 3ND8A 2OC9A 1DTWB 1X3LA 2OFFA 1A5TA 3F4KA 3GT4A 4MUGA 3SC2B 2UZIR 2NU6A 1NYQA 1IM2A 3T95A 3H9BA 5IAAA 3TDMA 3L2OB 1XXHE 1KMQA 4PAMA 5AI4A 3V8EA 2B4RO 2P68A 3OUTA 2ATIA 3RRFA 3FZNA 1UK6A 3T3HA 2A5LA 4HAYA 4DLVA 3KXLA 3ZK9A 1JBEA 4H17A 4QUAA 3D8HA 2BBSA 3CUSA 1ODIA 3VC2A 4FFSA 1UBJS 1HOXA 3SIWA 3OEYA 4NCIA 5AH0A 3TMKA 4XOIA 4CIVA 4XOUA 2N9UA 3ENKA 4D9JA 4TSRA 5EQTA 3ZJUA 4EPRA 2QP9X 5ALVA 3DMPA 2NSHA 1E2FA 1QH8B 3M0EA 4BMVA 1JSCA 2C88A 2JI4A 3L18A 4I9NA 1SBIA 1MNQA 1MC5A 4FINA 4K86A 4GPTA 5FLYA 4P93A 4BNIA 4MDEA 4K6FA 1C30A 2AEEA 3NHFA 4R83A 2QAIA 3LL4A 4OKSA 1QRDA 3S2GA 1HDRA 3TIVA 1G7RA 5HVNA 4EYGA 1FZQA 1NXWA 1ZCJA 2I9KA 2VDOB 1V48A 1DP4A 1TLFA 5DBFA 3FTEA 2PWBA 2YNMC 2HRBA 1EH5A 1ID1A 3NFYA 5F3RA 3BK2A 1L7RA 3LBFA 4ZVQA 1DKLA 3TLEA 2VUSA 3NBFA 4Z1OA 1FYVA 4JY7A 2BF4A 4GI1A 4WFQA 5ITZA 1H3FA 1EE2A 4L8WB 4PICA 1KIFA 3T4EA 1S1CA 3KQWA 4LVOA 3BXZA 2F48A 3KQMA 2AOXA 3MWDB 4Q9LA 4F2PA 4YRGA 2BH9A 3HB5X 1E2BA 1TM1E 1XCJA 4DAEA 4FVTA 1PN3A 4CEHB 2UVQA 3GW8A 3H2GA 3OLXA 3P0HA 2ZUTA 5BNTA 2C3OA 5F5XA 1GG2A 4C0BA 3SE7A 3WNZA 2GDJA 3U16A 4V0NA 2J5KA 4I55A 1ZD3A 5FOUA 3DBLA 4J7AA 1U8TA 2ISSD 1VPLA 3FGPA 3K16A 3H87A 4P98A 2VSNA 9LDBA 2RHMA 1XIVA 1XELA 4EKYA 5K01A 2B82A 3TOCA 2JASA 2ZRMA 5AMXA 4I19A 3DT8A 3QPWA 1CRPA 4ZZIA 1BVHA 2QUKA 3FG9A 4N41A 1K4MA 3EZXA 3M2PA 3AR6A 3IGFA 3LJKA 1BSVA 3L0OA 4L2IB 2EJTA 2JEOA 3U4AA 3PKIA 4LQLA 3NEPX 1DOAA 2OHGA 2CNWD 3OP1A 2OUKA 4RMGA 4PRYA 4RXUA 1KI7A 1KE2A 3N2GA 5KYXA 4ND2A 1RKUA 3ADPA 3ZW8A 3E9CA 4OGFA 5TGTA 4I4CA 5JCXA 3CZCA 2VNHA 3EXIA 3RIEA 3F3SA 4H1TA 3UMMA 3D8SA 2J0SA 1A8UA 5I6DA 4MRVA 4HNGA 2X41A 2E4XA 3RT9A 3TM4A 2V7WA 1LTHR 2J9ZB 2OHFA 2CDRA 1BU8A 2ZW9A 1CBUA 3D5EA 2V7GA 2FGKA 4FLFA 4KWHA 1GOTA 5HF5A 1RQGA 1DFGA 5BWBA 4MAAA 2DOKA 2EV9A 2O6LA 2NQ8A 1UP7A 2LPMA 3LUBA 4JLWA 3UAGA 1POXA 2J33A 4IDCA 2C7QA 4ZOEA 3N59A 4BQOA 4HDCA 5KJCA 2ZE7A 2X0DA 2QRHA 3T0GA 2RAUA 5GAJA 3JQ9C 3UT5A 1TT7A 1I0ZA 3V7YA 4D6PA 4RV4A 2CV0A 2X8BA 1G5PA 3VNUA 1C2TA 1NUAA 2OD2A 3DMYA 1KDPA 1SG6A 3DSRA 3F4LA 3HL4A 5ALKA 3T7RA 2ZE6A 1QBGA 1JR2A 3MA0A 1TFRA 4CGYA 4DA9A 4QTYA 4HAXA 4IDAA 3IAUA 4G23A 5H5JA 1MA3A 3S2IA 2XRMA 3PX7A 1MAVA 3INGA 3MWGA 2VDJA 1YQ9A 3NB0A 2Z1NA 4HDNB 2FYTA 3STWA 4BIMA 1HE4A 3AL3A 2GKSA 3I4LA 4O2BB 3C6BA 4N7RA 5FWDA 1X74A 3S2YA 3F90A 1L2TA 2IYRA 1C1YA 1HEIA 4ME6A 3QPCA 2QT9A 3CU5A 2PWPA 4PN7A 1Z45A 1ZCFA 1O57A 4E6EA 3ZCQA 7YASA 4NL4H 3KU4A 1SUIA 4IGKA 2YY5A 3DBRA 3NTQA 4LX8A 3M6AA 1OCEA 4UD6A 2HA6A 1D1QA 4LVNA 3RF7A 1YRWA 4C0AC 4QTTB 1IXKA 4PGGA 2WIKA 4Q9JA 5JAZA 5KYTA 4KXFB 4GMFA 3UAXA 1CUEA 3AJRA 3GGCA 5ALPA 4GNKA 1DE0A 3TFWA 1JLMA 2GEUA 3IBFA 3OEHA 3RTDA 2AG6A 3LS2A 1QQ5A 1RACA 2SKDA 5FIUA 3FSEA 1P9WA 2WKRA 1QKKA 1PCXA 2O2XA 3ROEA 4HLUC 3U26A 3ZGNA 1TFUA 4UQLA 4CLXA 1XFAA 3ZD8A 1POWA 4HBGA 2J9RA 4TMYA 4YK7A 4OHZA 1BCSB 1LSSA 1UBGA 4JB8A 1CUYA 1QOQB 4RE6A 4ETNA 4UTZA 1JR3D 3VTZA 1N5IA 3MTGA 3RUAA 1Y1KE 2XYPA 4BEVA 1C4XA 1SBNE 4C0XA 1TEHA 4L3WA 2B4KA 2OZPA 4X90A 4A0FA 2VYND 3GX1A 4JENA 5HFJA 3C98A 5P8WA 5MFZA 3D7MA 2WP0A 4X8MA 4FE7A 4KODA 5CXUA 1W85A 2NVWA 4HH0A 4RZQA 2HRRA 2DWPA 2CW5A 1EA5A 1FC0A 1XZCA 1Z6AA 3SF8B 1Z4LA 1MH1A 4MUHA 5HKKA 1TU0A 3CRMA 3BXOA 4LDQA 4YAFA 3E9DA 2R62A 1JALA 2QW0X 2QZ9A 4BQNA 2MMCA 1I01A 5KSPA 1W4CA 5H80A 2MINB 3RR2A 4CM8B 4UDNA 2G17A 4Z0PA 3RSFA 2GZMA 3VDMA 4IUDS 2EFHB 4QVGA 3GJSA 1ILWA 2DFDA 4IIXA 3VYWA 1GRCA 4WY8A 2YWEA 2CXNA 4KG7A 4UHBA 3PFKA 2D5LA 2FGJA 2PT9A 4G89A 4M88A 1KI6A 3E9RA 3DW1X 4WN9A 1MC4A 5SZIA 1GTZA 3SJ7A 3WBBA 1N36B 2J46A 1AURA 1GU0A 1W8DA 1TIPA 3OOYA 3L7AA 4JVMA 3HL0A 3PJEA 3LDAA 3IAAA 1V8OA 1WG8A 2ZVJA 3OCJA 4WJLA 4YCBA 3U3KA 4DY4A 2AZMA 3TW8B 3PEWA 3FJ1A 2DY0A 1G8FA 4BWYA 3UGJA 3CO0S 4TWIA 3JATB 2VZ0A 5A5GA 3J7AC 1TC2A 3AYXB 2QLJA 2FSGA 3R40A 4LI0A 1M2FA 2NUAA 3GLUA 1E2MA 1QTIA 3IKVA 3MOGA 3GCDA 4EJ2A 1N25A 2BDTA 2ETXA 3F47A 3W6UA 4UHEA 4RKFA 2LIPA 4AUEA 1M73E 3FYDA 3HDHA 4J9UE 4UM9B 5FKJA 5BNIA 1H05A 5HJEA 3P19A 4KNVA 2E4AA 4K9DA 1H1LA 1MJGA 4IYRA 5H59A 2ODBA 1BGWA 3TCKA 4EA6A 3IODA 5GZ1A 2QGNA 1A2OA 1T2DA 2R5WA 4D41A 1U1EA 1ZL2A 4UUMA 2DSTA 5CLLA 2AXPA 3NBKA 1FDTA 4MRNA 4YJ3F 5CYFA 4UOEA 1H9AA 2YRFA 2ZAOA 3DCYA 4ILKA 5I7AA 3PIRA 4LN1A 1HZJA 2HU2A 2VN8A 3ITNA 4U63A 5SY6A 1JHXA 1KYQA 4DXHA 4B9EA 3D6UA 4EJSC 1IHOA 1UIRA 1YMUA 2YWGA 1AS3A 4QUHA 1D3AA 1J8DA 3WSTA 3L7DA 1NXOA 4P58A 4PC1A 1YA4A 1GCIA 1N3LA 4BBPA 4G0WA 3FNBA 3HBAA 4MR9A 1PJ8A 1WZIA 2XXJA 4LPSA 5DTQA 3H97A 3B3GA 3C97A 2QTHA 3OTQA 3OTOB 4U5QA 2H1HA 4MA0A 3BG5A 1MDBA 1X9IA 5FTJA 1QGYA 2FWJA 5CX4A 4KQMA 4RQUA 3JQ6A 3U39A 3HR4A 2PH1A 4RL4A 1TE2A 2C5LA 3KTFA 1S2OA 1ZLXA 4PCAA 1RZRA 3HJAA 1I14A 4RZ3A 5TF0A 3RW9A 3OCXA 3M9LA 4K2AA 3GFPA 3OBIA 3CZMA 3WAGA 3TZHA 1CLEA 2I7CA 2IC5A 1WSBA 3QVTA 4PZ0A 1OASA 2CZGA 1Z4PX 1MU0A 2XMZA 1C7FA 1JB1A 1D9ZA 3OH8A 3UCEA 4AFNA 4CEJA 5K0FA 5HGXA 3AI1A 1Z4NA 1JS1X 4RLSA 5B2ZA 4EUEA 2R6AA 3M34A 2GX6A 3C3KA 1VDZA 4ZO9A 2UYGA 4ZOCA 1VCMA 1O94D 1NR5A 1U2DC 1EFRD 4E2ZA 3QQPA 5GADl 3TQTA 2B2XA 3AFOA 4LMBA 3G8CA 3AIIA 4C2TA 4Y6GB 1WUYA 3OLYA 3NKFA 2PBFA 3ILXA 3O4VA 3K2QA 4RKWA 4RPKA 3AHJA 3GBVA 2QT0A 4KLNA 5CX1A 5I7WA 3HUEA 3CONA 2XV1A 4MTLA 2FSHA 2HK7A 1P4JA 1B23P 1H85A 3G02A 1JTEA 3E61A 3MBIA 3T3NA 1E1CB 3L04A 2MMGA 3OURA 2Q5CA 4RZSA 4QUIA 4BV8A 4OF4A 4BO2A 4CF5A 1Q1ZA 2RJ3A 3A4MA 5AW5A 4CMIA 2I2CA 2RH5A 1CRWG 5ICMA 4K9OA 1PJ4A 4KACA 1QRAA 3P9PA 4BFUA 3ZWAA 3RBAA 2JNWA 4EELA 4V0OA 4EW3A 2C54A 3RSLA 1AKTA 2FX3A 4WQMA 1YQDA 1DZ3A 1Q84A 1QHYA 4X6YA 2ANBA 4KYIB 4UW9A 1WOYA 5ALTA 3WRXA 3TW4A 4ZD6A 1C9MA 4IXWA 1F0YA 2KLHA 3I9LA 3UB4A 4CUJA 1TJPB 4F4IA 1ENYA 1U8CB 3ZDRA 5HW0A 1E8NA 3KJIA 2FU5C 4TV9F 4OQMA 1XTZA 2EXXA 3OLQA 3U1TA 2B4AA 3FOFC 4QG7A 3D31A 1TQDA 4U2KA 2PY6A 4TS9A 5KWJA 2R1ZA 3KDSE 4UM8B 3H8SA 3V4LA 1E1QA 1HMYA 4B3FX 1FQKA 3R0ZA 2GILA 3OKCA 4HRAA 1H42A 4LOIA 3NHYA 5KWIA 4DR7B 1PQYA 2B1IA 3WB2A 2DR2A 4BGIA 2Y1EA 1R16A 2HPZA 4FYXA 4I3GA 1XRLA 4RIHA 1M1YE 1JFSA 2GJ8A 2PX2A 3WC4A 1U9IC 2IH2A 1XEWY 4B0OA 1GPUA 2W2KB 2YC4C 3R3XA 4CI9A 1U0JA 1KH1A 5JJIA 3BHIA 1TUBA 1SZJG 4BO7A 3NS7A 4S1OA 4E2YA 1I5EA 4HATA 1BMFA 1P91A 2D1YA 2A14A 2ZJ0A 2VHYA 1B26A 2C77A 3EPJA 2VQFB 2W2XA 3NWPA 3LO8A 1JA9A 3OIGA 3F97A 5DXJA 2QYOA 2CCKA 2Q6TA 3I37X 3M4NA 2P1DA 3RTCA 4EI7A 5BWMA 3I2GA 1IPEA 2XNDA 5WRFA 1DOHA 5ELMA 5JJKA 3OT4A 4WLOA 4FHGA 3T5BA 2JFXA 4GSKA 3IVRA 2C1XA 2AZDA 2HYDA 3IDOA 4HN4B 4O3FA 1NVVQ 1W87A 3VVMA 3HYSA 3OP4A 1QGDA 2C2BA 1G4HA 2DQSA 1RRGA 1RZ3A 3BXFA 3CF4A 4ASUD 5JT1A 2W6QA 1Z73A 4QYXA 3SQLA 1V39A 3MGKA 4CIDA 3BREA 3W6NA 5LJIA 3HLTA 1LSUA 2CJXA 3ZW7A 2XCSB 5T6BA 4LC9A 4P4GA 3U4GA 3WWPA 2J3LA 4K88A 4CMHA 4HVLA 3F6RA 2XUAA 2W8BB 5A6SB 4AZWA 2EGHA 4QUBA 5BSWA 2H7XA 5E1MA 4DUGD 2EEZA 2R1VA 4YV2A 4BJHB 1Q1BA 2HA0A 2WF8A 3GEDA 3IUBA 2AQIA 4KIGA 2C9OA 3P45A 3UV3A 3H2YA 2ZVPX 1EWVA 3IJPA 3KUUA 4DCPA 2DHDA 5ARBA 3GLIE 2VDUE 3F7NA 2FDXA 5DHFA 1TX4B 1VKZA 1QU3A 5AW6A 1QC5B 1QE0A 3DTVD 2ZAMA 2GFHA 4R41A 1ILEA 1VDMA 4XI9A 2ZT7A 2UZ0A 1VKRA 5DM0A 3AHGA 4JQZA 4X20B 5EY5B 3EWAA 4EJMA 1D03A 1IMJA 4RKRA 2XUPA 5KWSA 3L0DA 3AXSA 5BNWA 3Q8KA 2G70A 1T24A 3E9QA 1IOLA 2G6TA 1UXHA 4M36A 2EP5A 2H07A 4IGEA 2FP4A 4LQ4A 4YJ3A 5JFTA 3OT5A 3KFLA 1NYLA 3OPMA 2MSLA 3RFXA 3L5OA 4EB0A 1J2YA 1PJ2A 4U9UA 4DIDA 1SEPA 3L8EA 3GZNB 2C99A 1GRRA 3BXXA 2GXSA 4Q1CA 4YRTA 3K1ZA 2OYRA 1Y7HA 2EW8A 4DZRA 4CF4A 1FFXA 3PGJA 1W48A 2W6PA 3KM0A 1WMEA 4S1WA 4D5GA 5IMBA 1LZLA 4N3GA 5IJ9B 4B7CA 2LBPA 3D7SA 1HOTA 3A9TA 1T6YA 4E7OA 1E2DA 1DWUA 3GJRA 5C53B 2NVUA 2WIGA 1CE8A 2OP1A 4CLEA 2OBXA 4HT3B 4JSYA 1SQSA 4RPCA 5P21A 4BE4A 2IUYA 4E3ZA 1U3GA 4OXYA 2O20A 3ZXIA 4YP0A 3IHLA 1X7ZA 1K92A 4E2WA 1E9CA 1PYDA 4XWYA 2H5IA 1Q92A 1RP1A 3AUAA 5HFNA 2VNAA 5JIBA 3MN1A 1QFZA 1ZN8A 2QD5A 3PC8A 3N7AA 3SDZA 3BCHA 1BHSA 3QLJA 1K5PA 3W9YA 4E4RA 2RKBA 2FMXA 2HU5A 4AMGA 4CG0A 4QDZA 3Q2KA 2XUIA 3Q7SA 4Q1AA 3FCOA 3RS7A 5LWHA 4WINA 1Z4JA 4H4DA 1NQVA 2XAAA 4JLSA 2OOKA 3R75A 5JJ5A 2G0AA 3Q10A 4K3UA 5EXSA 2QP3A 2PO5A 3MYRA 4CIBA 1PZHA 4MW1A 1PJBA 5H7XA 3VPSA 4PRLA 3R6LA 4JJ8A 3C6YA 4CNQA 1C0IA 4J03A 1RWWA 4PSKA 5CA1F 1I7SB 3GJQA 2H4FA 4HDOB 2ASVA 3CXRA 2HHCA 5TS3A 2EERA 3DEZA 1PDVA 3RFFA 4K3VA 4L75A 3ESCA 3I1YA 1JJBA 4UDOA 4D96A 4AKIA 2YHBA 4IAOA 3CCBA 2XZPA 3IAEA 4MKZA 3FPSA 5GGYA 2J9FB 3B5JA 3WGUA 5LQKA 3D64A 1T9HA 4MW9A 4GVXA 5LA6B 3VJKA 2D59A 2VYQA 4EYQA 2C0PA 1CUHA 1T0PA 5A3JA 5A4FS 2GJ4A 2MOKA 4LZPA 5B4TA 4M4SA 2DY1A 3EDQA 3P9NA 2QUZA 3FGNA 4LXIA 3VQTA 5TQ0A 3QFSA 4CMKA 2IPXA 1CSEE 4K03A 1L4EA 3BGIA 3CTMA 4JYBA 3WP0A 2E2WA 4FBLA 4N39A 1UXKA 4X54A 3PUKA 5KJFA 2FMIA 4N65A 1RCFA 1UAGA 1WRBA 3D3WA 4N6NA 4ZALA 2GDZA 4UNSA 3AV3A 3QUQA 2DH5A 4NP6A 4BJ5A 1KH2A 2AYZA 2YBEA 1JFLA 3OETA 4TRJA 1ZH6A 2VFAA 3FF1A 4CPDA 2XD9A 2FKNA 7ABPA 4FMBB 3RREA 3OTWA 5SYNA 3JQ7A 4KGXA 3EEYA 4KXQA 1HZZA 4ZT7A 1AZWA 3UHAA 2TRSB 1NWCA 2ZYGA 1SM4A 4K6GA 1NJ8A 3RFUA 1V4VA 3GEPA 5EKDA 4GP7A 4F71A 2QPTA 3RTBA 1P4AA 2GHIA 4KEAA 1GNTA 4FBGA 4UNNA 3K0SA 1X39A 3IILA 3BMOA 4FOLA 4Z5XA 5C32A 3U7RA 2Q27A 5A03A 1W581 1ZJJA 4UE2A 3S8MA 2C2XA 2D54A 5HFAA 2QU7A 1JQJC 5JCJA 4DCNA 1ZN2A 1RYYA 2F90A 2A86A 2ZIVB 3U4CA 4G5OA 5ULLA 4DLLA 3UOWA 4FXPA 3O5AA 4B2PA 3VU0A 1EAYA 4KQ6A 3WGZA 4HUQA 4BZZA 3L6DA 4L08A 2W0SA 1TAQA 2B8NA 1A1SA 2D1RA 2A6PA 4B8YA 5LMNB 4K28A 3LUFA 3PYXA 2AFIE 1FL9A 4GUDA 5L51A 4CT0A 2PUWA 1SKQA 4YYEA 4R9SA 4MQUA 2LTAA 1Y34E 1AGPA 1CQIA 4IHJF 4L51A 1L4KA 5AVUA 1HNNA 1R27A 1S1MA 4S05A 1Q1QA 2B1QA 4GQIA 4GRIA 5IN4A 4HEA1 1MJGM 3LFTA 4HYTA 3ZNNA 3U5ZB 4KJZA 3FJOA 3KALA 4BCDA 4LXQA 4D9MA 2IE0A 1GYQA 1Y8QB 2XPCA 4P38A 1LXCA 4MW5A 2YJTD 3SM3A 1RI5A 1W1UA 1XA4A 2XCLA 4FMPA 2PKCA 5C8VA 2W37A 4LJ7A 3HA5A 5ALGA 5DNUA 4QYIA 4EHIA 2EQBA 1Y7PA 4JQOA 1JLHA 5JPCA 1KEEA 2W98A 5JDCA 1C7ZA 1QYXA 4M7WA 2PHZA 1CVIA 1O89A 2X0IA 3H0EA 3Q85A 4FPXA 3E9MA 3FUTA 5BPFA 3CJQA 3F1LA 4P3PA 1RXWA 1RWNA 4WT7A 1OLOA 4TVBA 3IEPA 4XCVA 9GPBA 5DYGA 4TLDA 2C4HA 5GPBA 3W9SA 3FZGA 5EINA 4BFLA 4RHXA 2IUSA 5JAQA 3FFWA 1C7EA 1HQKA 2Q1WA 5A3VA 3QF4A 2CWDA 1A69A 3LXMA 5TR9A 1N2OA 1CZRA 3IUYA 4II2A 4QLOA 2C98A 3W5JA 1Y3CE 4FU0A 1WHTB 5GY7A 1RWKA 2W43A 4PYMA 3R9WA 3VHQA 2HO4A 3QW2A 2G9NA 2JFPA 1NRJB 5AW9A 1FDOA 2ZATA 2PDAA 2X3YA 3OE5A 4FR5A 2AN1A 2RHWA 4PYRA 4DGSA 1W73A 4FYHA 4PNEA 4MUNA 2HLDD 1P73A 1JHUA 5EMKA 2F43B 1ATZA 4MWDA 1JX6A 1PGOA 2JLQA 3P9SA 4R6WA 5I9SA 4BC1A 5JNLA 2B21A 3W3AH 2GK3A 4A8JC 5JHGB 3EFOA 2FX5A 4L4SA 1DAHA 4N7BA 3GDGA 2W2TA 2OBBA 2X5KO 2ZB2A 4MVYA 1Q0HA 1YD7A 3CLVA 3AOEC 4Z3OA 1RC8A 1VJGA 1NW9B 3CPSA 3D8NA 4GE3A 2FPIA 1PW7A 3T1OA 1CJUC 3JD4A 5CXQA 3P20A 2ZPAA 2ZZMA 3CN7A 1ODTC 4IJVA 1DFHA 1OD6A 3ZZTA 4DLRA 3B12A 1WDLA 3ENVA 4KRFA 4OMCA 1SG0A 4G0VA 3HGQA 1NN3A 3D4LA 1BEEA 1YC5A 3SC6A 4HSEA 5GOZA 4BKRA 1O6GA 4TQGA 1I24A 2H1WA 1GADO 2OE2A 3JQQA 2ET6A 4URUR 5DPMA 1UDAA 2P6UA 3NM6B 3COPA 5L7YA 4IDBA 4CUKA 4KR6A 1DXHA 1EFUA 4N8DA 1G4AE 3D7KA 4NATA 4YP5A 2WWVD 2EZ4A 1B6RA 2O3UA 4LKOA 1GR0A 5EJIA 1KAQA 1XOIA 3KJZA 3T06B 3GAFA 3ZTTA 2BGLA 4TRNA 3C5CA 3RC2A 3D3NA 2BM9A 3P5SA 4HMOA 3VJRA 3FSGD 1HDCA 2Q7OE 1X0VA 3LT5A 4FXOA 5BY2A 3JRNA 1YVRA 1UWLA 1LC0A 4F60A 1AJEA 2EBHX 3D0RA 2PWZA 4JYAB 2PJZA 4QICA 4OQNA 1MAUA 2GFIA 4TRRA 4WXHA 4XYBA 3TUJC 3ZWQA 2FI1A 2ZJFA 4RPHA 3O1LA 3ZU3A 1TCUA 1DKNA 4G67A 1JDVA 2AUTA 1JWLA 4MRMA 3U3JA 1EM6A 5CA1A 121PA 2W48A 2Z6VA 3VR5D 2XCTB 1EGMB 1NMXA 3QFRA 1ODCA 4HZUB 5E3IA 2O8EB 3JU3A 4PZZA 3UJ3X 1PR3A 4N5IX 4B6QA 2ZUFA 2QM8A 4BQSA 1QZUA 4KBFA 2QQGA 4UOZA 1WUIS 1JMYA 1EMDA 3C8ZA 2I80A 4ZO4A 4V02A 2YVAA 3COVA 5LB4A 4UU0A 1OLXB 1FVOA 3V8MA 4I1RA 1HLGA 4O25A 1ZK1A 4QHSA 1H2WA 2ZS8A 4ZVRA 1FVXA 3I9MA 3PF8A 2M98A 4R51A 5I7SA 3PDIB 3VZBA 3VNRA 1ZUD1 4NCHA 3Q7IA 4X7MA 5IM4F 2F7SA 1S3IA 1PO7A 2W6JA 3KOUA 2WTNA 4OV6B 5EZSA 4RTPA 4I2NA 1P2GA 4ZC1A 1FMCA 2PN1A 1IBKB 4MI6A 4YMWA 3IXQA 3K0FA 4LF6B 1V16A 2PRYA 1OVMA 3IERA 3PQ7A 1R6XA 4B3XA 4HJXA 3H65A 3HO1A 4MB0A 1HX7A 5EA2A 3B1WA 3JQBA 1OAKA 3O8QA 4DBZA 1PQ4A 5HNKA 5CK4A 1TT5B 3PFNA 1E2QA 3KBOA 4LRUA 4I4IA 3DFZA 1GUZA 2HIHA 3A1SA 3DCIA 3KYJB 3OO1A 4LGYA 3SIPA 4CU5A 2IS1A 2VJAA 1ACJA 3WMEA 4IPTA 2BZ1A 5JEEA 2P3QA 2IHTA 3OZUA 1CQZA 4E1VA 2QX7A 3TDNA 2O6HA 4IINA 1FU4A 3PE4A 1I5RA 2BI7A 2WU8A 3V97A 1C3OB 4HRVA 5JSZA 2WTMA 4Z0HO 5AVYA 2Y1CA 5PNTA 1MFZA 1BWPA 4R2KA 4XEHA 4EPYA 4G65A 4R2HA 5JFGA 5JZBA 3DHYA 3ESQA 3A36A 1KVQA 1DJOA 4FMDF 3FWZA 1DG9A 5KDLA 1TLLA 2NSYA 3KZNA 5H8WA 4EQZA 3MS7A 1OU0A 5LKAA 1UZAA 4D4GA 4E11A 2WPDD 3KKEA 3KWMA 4MA4A 2P79A 1X7YA 4WGGA 1B8PA 4BNGA 2CK3A 3AEYA 1FJXA 4DLPA 4HWOA 2PX5A 1HG1A 4IHJA 1UMCB 1SVNA 1MPTA 1E9DA 2I1QA 2FFAA 4D0SA 1XZ8A 3C15C 2VT2A 2F3TA 3CZQA 1F2VA 5JNWA 5JJLA 1TKBA 3S5JA 4EY7A 1X7WB 1J5XA 3ME5A 3G0GA 4H59A 2ZZNA 3DEYX 4F3NA 3ZY4A 4ZZ1A 3L8MA 3T0IA 4JI3B 1EA7A 3KJXA 3IEKA 3ZHVA 4JXXA 2FEKA 3OPYI 4PG7A 1LWOA 2QTGA 1Z16A 3PRHA 4PHTA 1H6AA 4LHVA 2Y2VA 4N49A 1EFDN 2WT8A 1QMPA 4KN5A 3AEKA 3PXCX 4A0QA 5BSHA 4N9WA 1OHHD 2VPZA 2HRZA 4BGVA 3KT0A 3J81k 2QV0A 4O4IF 4C3ZA 1HR0B 3CWCA 4R4JA 3B7PA 4E14A 3VYVA 2YJ4A 3L92A 5B36A 2Q45A 4LK3A 2VJMB 3MB5A 2AZXA 3UK6A 3IB6A 1T26A 4RJJA 2QN1A 3TZ6A 2DJ5A 1HYBA 5KCMA 3GO4A 2SHKA 4BDTA 2W22A 4B7AA 1JG4A 1GSOA 1VOTA 3K9HA 4EX7A 5B55A 4N5LA 3ELWA 1DADA 1M1YB 2W6ZA 2A1TR 1N8KA 2H4WA 4AG3A 3DF7A 1YU6A 2W5UA 2XUFA 1GP2A 1D4AA 5A0TA 3RAGA 3ZHQA 4NRDA 3SXUA 1CS0A 2WU1A 1Q0QA 3IVCA 4K5QA 3EPPA 2JGJA 2Y0BA 5FL7D 4IKOA 1Z83A 1JMVA 4ACAA 3BTUA 3IA7A 4DV2B 2ZPTX 2CXQA 2Q1YA 4I2VA 4JN6B 4R69A 1PS9A 4V0RA 1TM4E 2KSQA 1NBEA 4B8ZA 5DM60 2H63A 4NWIA 3BSFA 3MWKA 3EXAA 3R20A 5KKAA 1OXSC 3EA4A 4R31A 1FP4A 5CHYA 5LBIA 3RVJA 3EBLA 1EVLA 3EGCA 3L4EA 4N5HX 3JQAA 3C1UA 3KKQA 4DQXA 5J4KA 1FRNA 3RIHA 4OCZA 3F6YA 4DCSA 1F5SA 3VPAA 2PANA 3GFGA 4JSRA 1D4FA 5T64A 4D56A 3D3EA 3R0QA 1N2XA 2Y27A 3UJPA 4CTJA 2PMCA 1JXQA 3NHPA 1Y3AA 3I12A 3EOBI 3GT3A 3ZCRA 3VUFA 1XVUA 2H92A 5BSMA 2H2FA 1H2ZA 4KUEA 1NZDA 1T2FA 3G0IA 1EGVB 4DB2A 4TTSA 3R7SA 1GA1A 4AZ0B 3IT2A 3UKOA 3SC4A 3WYEA 4CMJA 3G2JA 1JJAA 1ZMOA 1O95D 4G4SP 4O59O 4I5DA 1KWGA 1EFLA 1UBTS 1OB5A 1K6MA 3BGSA 3CRW1 3PQ4A 5EJEA 3PWZA 4QDXA 5B37A 4GKVA 2AE2A 3DDOA 3HNPA 5AHRA 2CD9A 5U4QA 2LD4A 4A23A 4EY6A 4TLMB 3GLIB 4V2IA 1TRHA 3OT1A 2ZDQA 1ENPA 1AT1A 3ZZMA 1VM6A 2X4IA 3E9YA 2VOEA 4RA6A 2WWHA 2HOQA 4ESHA 721PA 1J0DA 4IFBA 3EFEA 5THKA 1L5HA 1BZYA 1YOBA 2Z2JA 4MARA 5H0IA 2AKEA 1XLVA 2Q0XA 5IF9A 1X1CA 4WCVA 5F2NA 1ZGZA 3V42A 4C76A 2WSMA 3OM8A 4JODA 5DHTA 5U4XA 3UMVA 3WLMA 2IOQA 1OF1A 2H2GA 2QTNA 1DKMA 4ECEA 1E98A 2E89A 3H1EA 3DBHA 1V95A 1ISGA 3AFNA 2FQQA 2WAXA 2JGIA 2P4HX 5BMVF 3OZCA 1J39A 4ID9A 2ZB4A 1Z5WA 4PAWA 3H3FA 4R1OA 4WXEA 4KZPA 3UXMA 1UOEA 2Z56A 2UVDA 2ZJ8A 2EU8A 3NPAA 2QRVB 3S1LA 3V7WA 5DT2A 4C1BA 1Q19A 5AW8A 5FO1A 3R7DA 5ALIA 4NV3A 2C7GA 1T4BA 1Q7BA 3EULA 3KFXA 1SCKA 2B2CA 4ZPJA 4IWYA 2N1MA 1MQAA 4OJYA 4TT3A 1ZXBA 2FSPA 2GAOA 4AMYA 3DE6X 2ZBQA 4BKPA 2LR0A 4LCBA 4P9NA 1GU7A 4EB6A 4FOOA 1DHTA 4QJ3A 3IQEA 3FYUC 5KYWB 2YJGA 3HCWA 1E79A 1HEUA 2NO7A 1GQQA 2WTAA 4LY0A 4N9QA 4RABA 2FUEA 3KJFA 4J0GA 5E6RB 3X1MA 4ZCQA 4ETIA 4RULA 2FRXA 3D2LA 1C8LA 3DHNA 1C0EA 2R68A 3TEJA 2GN0A 3V4ZA 5L7WA 4MGHA 3MS2A 3O73A 3RWMB 4JP5A 3I05A 4OH7A 1N0HA 2RC5A 4FHFA 1DAFA 1NW7A 2LKDA 2WJ6A 5IC5A 4C6RA 3I92A 1I1HA 3OQIB 4LJAA 2AJDA 3GUYA 3JD1A 4FT2A 4D3FA 2AEJA 4Q4CA 3PJDA 3MUFA 2XXAB 1PTJC 5K4HA 4DY6A 5FJJA 2WJZB 1DBPA 4OSEA 3KU1A 2XZLA 4MUKA 2QN2A 5B5SA 5A0VA 4YI5A 1T8TA 1CWUA 4ZOQI 1L5MA 4JBYA 4TN5A 3ZY5A 1JEEA 5CD1A 3IV6A 4TOIA 3WB0A 3VKGA 2V98A 3ER9A 4I1VA 3PSAA 2QRGA 1J1IA 1K1EA 4NSNA 4ZYLA 1TPZA 4LBZA 2A8YA 3CEHA 3OC0A 5IVDA 3IVXA 3NAGA 1P9OA 4L4ZA 3A3NA 3DAGA 2BEWB 1Z8FA 1EX1A 1II9A 3EVNA 1Z6PA 3B2NA 3JASB 3DFKA 4RMJA 1T36B 3N2NA 1RR6A 5HS6A 4EEXA 1GTSA 1GGHA 3SG0A 1XDUA 4LXHA 1JAIA 1UM9A 2YXLA 1QHHA 3SHWA 4L50A 1SBYA 1I2CA 1R4MA 3VSCA 3F67A 3NHWA 4V0ME 1M5RA 2XMRA 3LQ4A 4GIBA 4TL9A 3SPXA 4DDMA 3U60B 2I1LA 4C08A 1B8UA 3PPXA 1RKQA 3GGPA 3MHPA 3V8NA 1RI2A 2GR9A 1J70A 2P2NA 3AXTA 4O4IA 5KC9A 3ETDA 4BQPA 3V2UA 2C4MA 4FGSA 3A70A 1SBZA 1JHYA 1E3QA 1MGPA 3U1VA 4C89A 2H9IA 2LCIA 4D2IA 4DA8A 3L46A 2R4TA 3R41A 5TS2A 4EKIA 5CLFA 2JD1A 5KNLA 4RD4A 4YJKA 3EJ6A 2V58A 1MZPA 2HF7A 2QNIA 4H7EA 5CVVA 4RZIA 2G08A 4LRWA 4GU5A 1PLLA 2ST1A 2Q41A 2HRDA 3NH6A 4AXBA 1TO2E 2DKOA 4HWRA 1P3JA 1E9RA 2Q28A 3MRTA 4FKZA 1Y5LA 4PQRA 3T1YB 2AFIB 2BUCA 1RLJA 1Z2AA 2H8KA 1XD8A 3E5HA 4HX5A 1A3CA 5JAUA 5K6AA 1BN7A 1Z47A 2FN4A 3OQMA 1GILA 3E23A 3FBTA 3LC7O 3OF3A 3OEHD 4MDYA 3TTVA 4AWAA 3W5CA 1F0PA 4ETWA 2P75A 3PUJA 4LDJA 2G1JA 1A2KC 1YR2A 4UHHA 4ZCSA 5GTDA 3UHOA 2WHRA 3UG6A 4QVKA 4B5LA 1T9ZA 5D1NA 1ECGA 2Q5LA 3KQKA 4DW8A 1BH6A 3G8AA 3O21A 1HC7A 1VSQA 1QPGA 4YC7A 3FWYA 5K3BA 5C4IA 3IIJA 1NTOA 1BW9B 5FNVF 2YN4A 3HP4A 3NT5A 2P4QA 5KU7A 3H42B 5D5QA 2QBYA 5BRAA 1RI1A 1PFWA 13PKA 4A6PA 3RAJA 2HDOA 4EFLA 3PJFA 1WDWB 2E1PA 1MABA 2DX7A 2JHGA 3AKEA 4FDTA 4S1NA 4BMXA 2HMVA 3M5CA 1OKKA 2PQMA 4BRZA 3IUMA 1MIOA 3LPLA 1TPYA 5EIBC 5E38A 3AVPA 1J25A 3RVDA 1QHNA 1QZTA 4EOGA 1A7KA 1H6DA 4ZKEA 1RBQA 2O2DA 1QIGA 1ORRA 3BOSA 4IQ8A 4WXPA 3ND5A 2OEPA 5A4IS 4Z4IA 1QP8A 2HBZA 3QXJA 1JF8A 2G77B 2WV9A 1KEWA 3ZQUA 2PS0A 4JS0A 4QUKA 1LBTA 1R5NA 1X13A 3MXOA 3VZQA 4BMSA 4F5WA 5HKKD 3RSHA 1GXSA 3WLNA 3T12A 2Q4BA 1RCUA 2I99A 2H1IA 3HB4X 1IPHA 1KAEA 1LS6A 2WU4A 3U37A 5DBGA 1H0SA 3OKPA 2YHUA 1J8MF 2XUHA 4BO5A 5K6TA 2B36A 2IEYA 3EK2A 1RKVA 1OVGA 3LY9A 3B20A 1UDCA 3H6GA 3QEMA 4BFWA 2ZZKA 2H48A 3GA5A 1DEOA 2BM0A 2CL6X 2DU8A 3JQCA 2ZM6B 4MUBA 1ZY2A 3A2NA 3W5SA 2G9UA 3F7OA 3LUPA 2LUOA 2WM8A 1ZK0A 3KZKA 4LQDA 4TMKA 3GLHA 3LYLA 5BMVA 4BX8A 5FH9A 1DJMA 3CKKA 1EI9A 3ONVA 1GGFA 2FVXA 2PXAA 1ZWKA 4UBIA 4IZIA 1P5FA 1J07A 5A4JA 2MU1A 1TF7A 4R68A 4JVNA 3JQ8B 1IVNA 4TLEA 4WCFA 3RRNA 3NMUF 3LCCA 4L72A 5D6OA 4FHCA 4DJAA 5BWNA 1MX5A 1SJ9A 2Y6UA 2Z2YA 4ALIA 4U2DA 3LHFA 2IYOA 4D9KA 2JC3A 2R6GA 1B42A 4C0HA 4FNAA 2WY2D 2WI8A 3ONWA 3B9QA 1Z33A 2MSDB 4KBYA 1WNFA 1AY0A 5FTKA 2AYXA 3ZLUA 4OJNA 2NTYC 1TF5A 3AIKA 4M3NA 3AC0A 4OL9A 3GEHA 2X6RA 3U0VA 4RANA 4Q05A 5CDTA 4OYYA 2ZI4A 1OLUA 2HT6A 2PZBA 2R60A 2BFCB 1Y9DA 3Q6NA 4Z9YA 1CQJB 5EJGA 2HREA 3ZR4B 4IX9A 2G4CA 2DGDA 1EDBA 4BCBA 4D25A 2G06A 4G5FA 2AC2A 1PX2A 2WWIA 5E6SA 1A8PA 4PC3A 3X2SA 3ZNQA 1LLUA 1AKYA 1V5GA 3UWDA 2R7LA 2CY0A 4LMPA 4H16A 1J8VA 2PX0A 3BX1A 2H1SA 3EDOA 3O4IA 1YR6A 2QDXA 4OGKA 1M2WA 4ZVMA 1C3EA 3WK9A 3HK2A 2ZJBA 4FYPA 4PRZA 1DQRA 3CKLA 1EFVB 2FW9A 1VJTA 3AW8A 5HXAA 5DB4A 3ONNA 3KQSA 1R7RA 4CM3A 3ZWWA 4X65B 4M7RA 1CXZA 1DPGA 1AHPA 2GRJA 3RHSA 4OP3A 4A91A 4X1IB 5BV2P 3F3MA 2QF7A 1SC3A 1FMTA 2XOEA 4YJGB 1RZRD 1EEXB 5C7LO 3DWGA 3K92A 1KKMA 2ZRCA 3NIWA 1U2EA 3R9KA 3AY3A 3HU3A 4LI3X 1USVA 3CMCO 3KJNA 1W8IA 1Q3HA 1BEZA 1J42A 1HDIA 1PG0A 2P9QA 2CCGA 2VJPA 5L3RA 5INTA 3BERA 1CFZA 4P33A 2XNCA 5TNXA 5AOAA 5LMZA 2OV4A 3THOA 5C3UA 4F38A 4HFJA 4UKDA 3K1AB 4GGOA 4LS3A 4XB6B 2HTEA 5DOZA 1PNTA 4KX3A 5EZ6B 3T35A 4DIUA 4JLKA 2UVPA 5AJXA 2CVOA 2RH9B 1NC3A 2WJPA 1P1RA 3OMXA 1YH3A 4LV8B 4PZCA 5AP9A 4DBLC 3DKPA 1YONA 5HQTA 3ZUGA 1QSGA 3GEMA 4AIIA 1XEAA 3QEJA 4AKSA 4B6FA 3EUFA 4C87A 4ZJPA 4MGYR 1WXFA 2QK4A 1ZEJA 5EHGA 1F8UA 3N0XA 1NOJA 4DDKA 4DCUA 2NXWA 3DQZA 5K3EA 3LD9A 1JEQA 3FDIA 1ECPA 3SICE 1B0ZA 4B87A 5JXJA 2JPDA 3M3PA 3NTXA 4RE5A 1K4YA 5H1YA 1AQNA 3WRYC 2WICA 1JKIA 1ZRMA 5F3WB 3LC2O 4HAZA 4JSTA 1VQ1A 1O08A 1Q57A 2FW8A 2LE0A 4N8EA 4UOQA 3RHFA 4II7A 1LBEA 4PU0A 2Q5EA 5KNBH 2KM1A 4YWJA 1AKVA 4DE5A 3RG2A 5IAEA 2C3MA 5E7QA 3GAMA 2GTIA 3UY4A 4D9FA 1N2HA 4JLVA 4UCXA 2FZVA 3L4SO 1WKBA 3DLTA 16PKA 2J3HA 3HN6A 4XGNA 1SC4A 3BB1A 4JCCA 3CA8A 2QAJA 2O1WA 3VU8A 1RXVA 4ZVKA 2POQX 1NR7A 1A9XA 3LL7A 5K45A 2WG2A 1E4EB 5FORA 1Z5UA 1FSFA 2CL7X 2ODNA 2XVMA 4DLWA 4DOMA 3HB1A 4P4SB 1G6OA 3ZZNA 4MP6A 2NU9A 4YAIA 1PR0A 1PJCA 2Z2IA 3PNVA 1P2FA 1E1QD 3I5AA 3MGGA 4HG2A 4CIXA 3Q8XB 3BBPA 2CVFA 1GUAA 2VJNA 3JSAA 1UXOA 4MKXA 3EB9A 2GMWA 1M6EX 3AHEA 2QE7D 3ZZUA 4Z8XA 4RADA 1JIXA 1XQYA 4N54A 4AP9A 4RPGA 2BJVA 4NEHB 5GJCA 2GF9A 5F33A 1V6AA 1Z6YA 4JH0A 5JNSA 2SKEA 3SYTA 1O6BA 2VT7A 5BP7A 4OB7A 3SE0A 4PO8A 1U3WA 5B4UA 3E05A 1C1DB 4TUYB 3RLFA 1FUIA 3NOVA 1I0LA 3R6TA 4CKBB 2HJWA 1AZLA 4WOBA 3K09C 4HS4A 5EERA 4D45A 3J80A 2X0RA 2Q5HA 3KOXA 4G56A 1D09A 2FPUA 5KSYA 1O0BA 2CUNA 1Y8CA 1T0BA 3FDXA 3H75A 3JD2A 4UXJA 3U9LA 4DUYB 2I4RA 2XNDD 9ABPA 2O19A 1LDGA 3WICA 3RT7A 1ZU5A 3BRCA 4OLJA 1VSVA 2VJYA 2QYSA 1WKVA 2ONKA 1EAMA 1G20A 3JAKA 3K0CA 3L7JA 4G24A 1E20A 4TMXA 4DIKA 3EZYA 1DFIA 1SVWA 3K35A 3L41A 5KJ6A 4YN3A 1XDZA 4P3XA 3UANA 3ANMA 4ENTA 1ZXXA 4B76A 2CDBA 2J0VA 2JAOA 4GXNA 2R6DA 4WKCA 5J4VA 4OA5A 1MV5A 1EUYA 3L0BA 1ZC4A 4C4PA 3TX6A 2C7OA 5D3QA 4DVJA 1THZA 3EVCA 1BFUA 4L0MA 2F67A 4Q1VA 4A5OA 5B6PA 1HM5A 2QY6A 2RGCA 2P0YA 2HDHA 5HIKA 2IE8A 4CBVA 1R6VA 2F3QA 4WNAA 1FK8A 1BXRA 2BFFA 4I14A 2O3JA 4KO2S 5MF6A 2I55A 5HRUA 1GL9B 3SVZA 1R2QA 1RPTA 2G36A 1VRVA 3A6ZA 2EOAA 3IYLW 3KHSA 4LYJA 5MN4A 1SZPA 2RHTA 4P92A 2VPXA 5CFMA 5KOJB 1HO3A 1YZGA 4XX0A 1L5SA 4WK6A 2PUBA 2JD2A 1AUVA 4NZYA 4XCQA 2WYWA 3KJEA 3KHKA 2CV1A 5LLSA 4PRKA 2AXNA 3M6VA 2RE8A 1EUCB 3L84A 1EFPB 4BWVA 4PG4A 4YCSA 3TRIA 4KPEC 4JP8A 3UXEA 1B16A 4AF6A 2JI9A 3RVQA 2IYEA 3AT1A 5B3AA 2CNNA 5KTYA 1CT9A 3O8BA 2XQJA 3QVMA 4EZBA 3TLGB 2FMTA 2HHHB 3GFTA 4RHFA 3EUWA 2PGXA 2WWGA 3ENZA 4RMHA 2WSSD 2JAQA 4A6XA 1MNAA 1LK5A 1U7OA 2X4LA 1SBQA 4MWEA 2ADFA 3TSOA 3ZI4A 5BNZA 2C07A 5JCPA 2JEYA 1LFDB 3D2BA 1N5DA 1T3HA 2FV8A 3AU8A 3U4DA 1TD1A 3EQ9A 2GBPA 4ZI3A 1N1EA 3UFXB 2VBIA 5AW7A 5IRCD 4R1SA 2O2IA 2HBQA 4HK4A 4LTMA 3WLLA 4BX0A 1WXIA 2ZIXB 1AMUA 3ZEIA 1J06A 4IHKA 2D7DA 1J0XO 1M6VB 1CY7A 4HGNA 4TZTA 3H99A 5FTWA 2NO4A 3K70B 1Z4MA 1NSYA 3FWNA 3PI6A 2VDPB 3U9TA 4MR8B 4BVBA 4MJXA 4KV7A 4UEKA 4DMLA 5D7NA 2QZSA 1LJ8A 3QPVA 5JTTA 4C01A 1T43A 2GD2A 3IOYA 5BW4A 4RAOA 2AR0A 3CR3C 1WW2A 4HAWA 3EQZA 3B52X 2MSCB 5DSZA 3HKCA 1UMDA 3JD0A 4BFXA 3SJZA 3KUKA 3NETA 5H4GA 3DB2A 4FFPA 2M32A 4FB4A 3PPVA 4B82A 3JRWA 2I7XA 2GM3A 3ODPA 5E0KB 1SQFA 2W4IA 3BWXA 4IQFA 5GMOA 4P84A 3U3OA 5C8ZA 5JTUA 2FJUA 2E1RA 4RLQA 6AT1A 2DHCA 3THXA 3LLUA 5LN1A 1YFLA 3W5AA 1H6CA 1NMSA 3DJFA 2XYQA 4WGFA 3OQNA 1I36A 1YL7A 5LMUB 3NTOA 3FDZB 3R3UA 2ID7A 1IM5A 3HDTA 1W1IA 5AVRA 2RHRA 1S96A 3M4JA 5CFOA 1USKA 3WBJA 5C2JB 1RZUA 2Y76A 5EQJB 4HMPA 1OA0A 5C8YF 1GZVA 1N5JA 4Y9DA 1F12A 5CVCA 3RIMA 3UB3A 4DPLA 2A9VA 2VRNA 2HYIC 5M3BA 4YXWA 4L74A 4XR9A 3BD9A 2N3ZA 4J75A 1H69A 2AOWA 3WKBA 1PFQA 3MWYW 3KVVA 4GWKA 4JCOA 1TQ4A 2B5WA 1ECJA 4O4HB 4F91B 2JGAA 2IBTA 2UXBB 3EVGA 5ALFA 3FNIA 4UEJA 2D0OB 4RTRA 1V8ZA 3MMXA 1O0SA 1CVLA 4ZDWA 2WKWA 1GLGA 1VMDA 1LNQA 3U3RA 3DOIA 4UE6A 3RC7A 3UK0A 2AR7A 1MAWA 4RZUA 1DEKA 4I1UA 1ZCBA 3K30A 2O8BA 1Q5PA 2PUTA 2NVOA 5IK2A 2NU7B 2OXFA 2Y1FA 3VOSA 3GLRA 7GPBA 2BFBA 2OZLB 3M81A 4NKRA 1CR6A 5IZCC 3B1ZA 4U7GA 4D8WA 2GYVA 4EVSA 3PQFA 3ZDCA 2YV4A 1D1PA 4IGAA 3MT8A 4HO1X 4C0WA 4YDHB 2VPQA 1IQUA 1BTOA 4MS4A 4YBRA 1OX4A 5BR8B 1Y6RA 2O07A 2V7TA 4F5YA 3DBOB 1I5OA 2Z98A 1N2BA 1SHJA 4YY3B 1LFAA 5CGZA 3D3QA 5D01A 4PE5B 2VYVA 4E5MA 3UAOA 1WB6A 3L93A 5ERXA 1V8DA 5E2IA 4QTXA 2E5WA 2XKAA 1BHO1 5JCJD 2DFVA 3NATA 1XMXA 1N77A 1XRNA 2H8GA 4AVYA 4UEQA 5L3ZA 3FCUB 3OZWA 2DETA 2ZCJA 2LIVA 4AJ2A 1DQSA 3WYBA 1CUZA 2G1KA 5DHSA 5HKLA 5ALSA 2H5JA 3N70A 1RWMA 3VISA 1NDUA 3ZN2A 1LA2A 1KQFA 1X42A 3DE3X 4OLBA 4LDAA 5DW0A 2GCOA 2AKYA 2O1EA 4M0EA 1L7DA 2H54A 1P6XA 2IKQA 2VXOA 3CSSA 5G0VA 1RBYA 2P9TA 4BP8A 4DLKA 5L7TA 3E9ZA 2Y1GA 1VIDA 2F17A 4X84A 1NJ2A 1GGMA 4RV5A 3TZKA 1O77A 5AQ1A 3KSUA 5BQ5A 1JU9A 5JZSA 2C9BA 1U2TA 4UU7A 2WYIA 1C0KA 4NC9A 5CDFE 5IUJC 2OM2A 4MV3A 1SC9A 2DFTA 3GJXC 5DTRA 4ENWA 2XE8A 1KQNA 4UCWA 3G1WA 5JI2E 3T8YA 3BE8A 1KEPA 4X64B 5BUSA 1OIWA 2OORA 2Q49A 3CKYA 3KV3O 1Z68A 3LFUA 4Q7EA 1U0FA 4EQ6B 1QRTA 2ZIGA 4QSMA 3N74A 2XA1A 4P34A 3S6JA 3UHFA 3LTEA 1YRQA 2OLJA 3TD2A 4DCTA 5ADVA 1Z2EA 3I9KA 4B31A 2FEWB 3BCRA 3OQOA 4R1UA 2SCUA 2OESA 3B60A 3FOZA 3QW4B 3I5XA 2V03A 4NZ9A 6Q21A 3ZV5A 2IDKA 4OHKA 3VSAA 2KWIA 5J2UF 2MYNA 3IEIA 4FQ5A 1IZYA 2AX3A 2I29A 2JFVA 5BV0A 2VP4A 4BNZA 1Z6ZA 5J40A 1YTUA 1N2CA 3K9BA 2AD5A 4R84A 4IJKA 1O4WA 4UARA 3BWEA 4U8HA 5CT5A 1PZMA 4G1EB 1IN7A 2H4YA 1BQ4A 2QD3A 3SNHA 5ESRA 1QHFA 5JAHA 5BSVA 1U7WA 2WEKA 2ZWIA 3A06A 4YPOA 5K3CA 2OD7A 3BMQB 1DWQA 3MT0A 2HXYA 2P4UA 3L05A 4XPIB 5BNFA 1ZLYA 2JGMA 2XCUA 3E6AA 3CT4A 3HDJA 3JSXA 4BQQA 1WZ2A 4N82A 3MCZA 4GX2A 4C7MA 3TINA 1Q2UA 3QU9A 2EDCA 1SMKA 2PBRA 4MP3A 4BEWA 4ER6A 3B89A 4I1IA 2JLXA 1SXJA 2BSAA 2QXYA 4BLRA 2ZIEA 3AUSA 3FNQA 2HBRA 3SZMA 2ZYAA 3PGMA 3D3KA 3BWVA 3IAHA 2FWBA 1VE7A 5KWEA 4C04A 1FE8A 4A8PA 4H4EA 2ZULA 4H3VA 2JHFA 3RRMA 1ZK4A 4EUHA 1VBKA 5F77A 1NR1A 4OGWA 3WGOA 3OF5A 4GLFA 4KGZA 3BEOA 1SN7A 2QJTA 3DOJA 3M6MD 5BWLA 2JGRA 1YJBA 4IGFA 4WZZA 1KZHA 2FRDA 4DNPA 4N5MA 4MRRA 2PVCA 2GN2A 2QRQA 4PHGA 1GPBA 2CVQA 2RGEA 2IODA 1OU4A 5TC4A 3LRTA 3NDBB 2GPYA 2QA5A 3GN2A 1SK8A 4I1SA 2PYZA 2PSHA 2FK7A 1ZISA 4N4AA 1QYWA 4KXVA 3WNDA 2QLTA 3LW7A 4Q3KA 4ERNA 2PZGA 2ROQA 2C7VA 3O1IC 4LOJA 4NBSA 5HIMA 1V45E 5LR6A 4I1PA 1XTTA 2YBDA 3CR8A 4OEHA 2FJPA 1LX7A 1X3SA 4OLAA 2WTEA 4HLCA 1JHQA 1VRWA 2QRMA 2Y1KA 1VZ3A 5ALEA 4AZSA 3P8ZA 2FUNB 2QVBA 2UZ3A 3ORRA 2PKXA 3PE6A 4YECA 2WIJA 2DBVO 1RWXA 2ERXA 4BNWA 2WM2A 1C7QA 4K9KA 3VA7A 4GVPA 1WSDA 3TLBA 1ZWLA 3HDVA 4YXWD 4JT4A 5HK8A 4QASA 2GUGA 1WB9A 5F4BA 3LKDA 4QBKA 4DNFA 3ZZ1A 2YJNA 3KQTA 2O06A 3C0KA 3ICOA 4EY4A 5IXJA 4I8IA 1AO0A 3IUQA 5C8YA 1KS9A 1NY5A 2WJJA 3U7GA 3O2SB 4UBLA 2FHSA 2QZ4A 2HQSA 4R9UC 2ECPA 3DXFA 4ZT4A 1V1RB 4MS1A 3M3HA 3QA3E 1ORWA 1Y1TA 2GF0A 2HJVA 3NIBA 1DC4A 2R1TB 1E99A 1HF3A 2GN1A 3AESA 3VYUB 4DV5B 5AVWA 2F8LA 3FRHA 1KTVA 4AJEA 2W6JD 3LCMA 1U6JA 3T3EA 4F1WA 3EZ2A 2ONJA 4Z99A 4WEOA 3HR8A 1CCWA 3OZFA 2NU8A 1QJCA 3R5HA 4EAQA 3E3LA 1JDNA 1MOPA 2IVFA 1Q14A 4P81A 4NARA 4KVGA 2GJSA 3AGQA 3PQ6A 3UPUA 2XKJE 4EFMA 2QRJA 5AXAA 6LDHA 4BX2A 4QU8A 5CVEA 5AXDA 5JMOA 4OLHA 3IPLA 2AD1A 1A88A 1ZZGA 3N8IA 3H1BA 1T4GA 1YDFA 4IO0A 4WKPA 5HCUA 5PGMA 1E3LA 4KVFA 2X5OA 1NVDA 1M0SA 1NMYA 1XNGA 1T3ZA 1U99A 3O82A 3ZQ4A 2XCOA 4N0MA 1YULA 1ML4A 3LC0A 2QJRA 1M2VB 1ZGBA 3A6FA 3FSRA 4RFSA 1ONSA 4YLYA 4I50F 1YZKA 3QKRB 1RRFA 2I1VB 4GPD1 2J5QA 2RHCA 4M87A 4U7WA 2C29D 1DDOA 3OF2A 4KNWA 1DIOB 2IK8A 2WMYA 3G7UA 2Q1SA 4OP2A 3K7EA 3BVPA 3OU7A 1QFMA 4GSYA 4NOMA 4IIJB 2IYSA 3N2KA 3QTBA 4QOJA 5A7HA 4A10A 1E3WB 3A4NA 2V0GA 1A95A 3E7PA 3U40A 2P6RA 5AI0A 4OKIA 1XZBA 2CK3D 2WM3A 2X6TA 3D6HA 4WERA 1U0NA 3DKVA 3RANA 1MGOA 2I9PA 3TS1A 5BV7A 4CF7A 2DWOA 2O3QA 3BB3A 4HHEA 4LHWA 1TEVA 4HLNA 1FNNA 4D9BA 1N34B 1ONPA 2RBKA 1TIBA 1GQRA 1P5ZB 1F2TA 3BHJA 4MICA 5FO0A 5KNBA 1CF9A 1RAIA 1KVTA 3AERB 3G8DA 3HEMA 4MQ4A 4M21A 1YFJA 5TMBA 1JGTA 3GG9A 4M99A 1VE6A 2EKQA 1K98A 3M1YA 3DTTA 3HZOA 5DX8A 1P7VA 2VF2A 3D3JA 1Y6GA 2MYPA 2JIQA 1PAUA 4AZTA 2EVWX 1H2BA 2WSIA 4J2OA 3EUEA 4U8GA 2V6JA 4B4OA 4D92A 5ES4B 3C3JA 3U81A 5FBHA 1XEXA 4DTIA 2BKEA 4RF2A 1FLDA 2ES4A 4PXAA 3CZRA 2Q9BA 2EGUA 1MRSA 2WAOA 3PC7A 5CBKA 4NMMA 4LYGA 2V7UA 2WA2A 1J22A 1KAHA 4X1OA 3INTA 3V2GA 3OIYA 3WG9A 2PSJA 3PE3A 5JJBA 5JYEA 1MAHA 2AMJA 1XZKA 2C7BA 4GFDA 4PTLA 3VZRA 3W5BA 4YPVA 2QB5A 5J2UA 2AN5A 4YB8A 4FYWA 1BDMA 1V3TA 3DEFA 1WQ1R 2D4AA 4ZVLA 2PQ2A 4L16A 1IHUA 3WP1B 1U2QA 2G9RA 3EZFA 4JP1A 2QL9A 4R0VA 5IJ0A 5JZ9A 5KINB 1ISMA 3JZIA 1TLTA 2B20A 1OBFO 5KNDA 4OHOA 4PAGA 1GPMA 2IYUA 3D6AA 2B92A 3ZWCA 1CEXA 5D7BA 2H4JA 3RLIA 1F0KA 3GJ4A 4K9RA 2CLKB 2P9JA 5AVQA 2OSVA 2OZKA 3EODA 3ES9A 1RHUA 4JI1B 5EHQA 3HWWA 4BVAA 1E7MA 5EI5A 1TEZA 2ZJ1A 1FFSA 1HTBA 1QX3A 1VI5A 2IIBA 1JAHA 4JLOA 4ODIA 1RXCA 1Q0UA 4YRQA 5AK4A 4EI9A 1HDYA 2XTMA 1WZUA 5H4HA 4TTAA 5AK5A 3CY6A 5CGQB 4EHFA 3X2FA 1XZDA 3O90A 4FI3C 4QKQA 1JIUA 4XIIA 3M5PA 1OZ0A 5TMEA 1ZMBA 4G1BA 4C7OA 1ATIA