3KHVA

Crystal structures of urokinase-type plasminogen activator in complex with 4-(aminomethyl) benzoic acid and 4-(aminomethyl-phenyl)-methanol
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
246
structure length
239
Chain Sequence
IIGGEFTTIENQPWFAAIYRRSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSAAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structures of Urokinase-type Plasminogen Activator in Complex with 4-(Aminomethyl) Benzoic Acid and 4-(Aminomethyl-phenyl)-methanol
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 55
structure length 239
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3khvA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3khvA01
4I31A 1EPTC 2BB4A 2P3UB 1FPCH 1TA6A 2Z94A 2ZTYA 2BD3A 2G5NA 4X2XA 4X2YA 5J4SA 1P03A 1GDNA 2XC5A 4GCHF 1OWEA 2OQ5A 1WYKA 5E0GA 1ZGIA 1SGRE 1AE8H 3NXPA 1W0YH 3SI3H 4I8LA 1C5MD 1N6YA 3PMJA 2QYIA 5FCKA 3U9AH 1XM1A 1LHCH 1HJ8A 4ESTE 1Z7KA 1QB9A 1V2TT 4ZKNU 1CE5A 2W3IA 2ZHEH 5AFZH 3U98H 2A2XH 3U1JB 2P8OB 3ODFA 3MH4A 1ZMLA 3BEIB 5C3NA 1O3DA 1ARBA 3KNXA 2BYAX 1JWTA 2CHAC 1IQFA 2ZHWH 1FY8E 1OWKA 4OGXA 1FPHH 3ZZ4A 4CH2B 1BQYA 4IS5A 1NM6A 4B71A 3OX7U 2XRCA 1EP5A 2M5TA 1LHFH 5EOKA 5EU8A 2YNAA 5DP3A 2KAIA 2V3OH 3TGIE 2HRVA 2ALPA 3A7YA 2Y5GA 1WTHD 3ZZ3A 1UVUH 1ELBA 1RJXB 1YPMH 5ESTE 1G3DA 2G4TA 4INKA 1NTPA 1HJAC 3A84A 1O2QA 5T6DA 5EXLA 2ODQA 4B73A 5JBAS 2AERH 1YPEH 2BDGA 3ATWA 4AB8A 1MMJN 4O3UA 5F8ZA 1EXFA 3STJA 3OTJE 4WMFA 1O5AB 1SB1H 2GTBA 2XWAA 3VEQB 2V35A 2ANYA 5DJ7A 1EAUA 3FVFB 3PWCA 1FIWA 2PGQB 1O39A 2HALA 2R2WU 3D49H 3TH4H 1A4WH 3T2NA 4A92A 1PPCE 2FYQA 1SFIA 3MI4A 4Y8ZA 1ORFA 1DWCH 5FX5A 4BTUB 1WCZA 4I8KA 5PTPA 1EP6A 2BD8A 5I25A 4HGCA 4ABBA 3BEFB 3TNTA 1W2KH 3OU0A 1MTNC 1KLIH 3KF2A 1T8LA 2VWNA 4A1XA 1T4UH 3GY2A 3MOCA 4MNVA 3ZVAA 5DK1A 4AG1A 1XX9A 1IQJA 1AQ7A 1ZPCA 1Y3YA 3EYDA 2RA3A 2W26A 1UK3A 3VGCB 2FOGA 2UWLA 1VZQH 3GCNA 4UFEH 3KQEA 2GCHG 3ZYDA 1C5WB 1GBEA 1UVOA 4WY3A 1GI3A 1UTNA 3EA7A 1V2UT 2TRMA 2PW8H 2ZDLA 4JZ1A 4GSOA 3CS7A 1GMHG 1C4U2 1S82A 2GZ7A 2ZP0H 1O5BB 2NWNA 1ESAA 1HAZB 1Z8RA 5GWZA 2ZHQH 3PLPA 3RXAA 2UUYA 2DE8A 4X6NA 1ZMNA 3TK5A 1TPAE 1ANBA 1A0JA 4HFPB 1FI8A 1XVMA 4AZ2B 1V2ST 2UUFB 2Z9KA 2OD3B 3PMAB 3UQOA 2PKSB 1O30A 1MKXK 3BTGE 1MU6B 1JIRA 3GISB 1UK2A 1ZJKA 2PR3A 1C5UA 1J8AA 3JZ1B 3K65B 1J16A 4ZMAH 4AYVB 1ELTA 3TNSA 3HK6B 1HCGA 2IN2A 1BRBE 1TPOA 3G01A 3QGJA 1DXWA 3DHKH 4TWYA 1HB0B 2F9PA 1QR3E 4KKDA 1YCPH 1ABJH 5E2PA 3SI4H 3M7TA 2C8WB 3P70B 1P01A 1XUHA 2ZA5A 4D7FA 3EQ0H 1C1TA 2BDBA 3ZVFA 1IQIA 2ZGCA 5HM9A 2C90B 1O38A 2SGDE 4Z0KA 2I6QA 3T26A 1PFXC 1GMDG 2VIPA 4AYYB 1OWHA 2UWPA 3Q3KA 1TNIA 2BY6X 2AH4X 3Q3XA 2SGQE 2SNVA 2XWBI 3O8BA 3BN9A 4Y10E 4JZFH 1BMNH 4YOJA 3GCOA 1FXYA 3MU1A 4XSKU 4ZXYH 6ESTA 1Y5BT 1Y3UA 2NU1E 1SMFE 3PLKA 5C1XA 2NU2E 3MU4A 1K22H 1O5GH 1CA8B 4YLUA 2W7SA 1HBTH 1KLJH 2HPPH 1GI2A 3TGJE 4FUDA 2D8WA 4DCDA 4BNRA 2WV4A 2BOHB 5L6NH 1YBWA 5A0CA 1G9IE 2GV6A 4XOJA 4LK4A 2JH5D 1CT2E 4PROA 1C2JA 2J95A 4FU9A 3MO3A 1KXEA 4IN2A 4HZHA 2EI8A 1LKAA 3RMOH 2HWLB 1KXBA 5JPMH 1PPHE 3VPKA 3CP7A 2BD4A 2F9OA 4K60A 2AFQB 2BY9X 1C5NH 3TK6A 2AYWA 4B74A 1CGJE 1A2CH 3A7WA 1C2EA 1OP0A 1LVMA 1FMGA 1BJVA 1C5SA 1S83A 7GCHF 1ESTA 1NFYA 3PWBA 1VR1H 1GBTA 1O3AA 1Y3WA 1SL3A 2B8OH 1T31A 4YO9A 3RXQA 3TU7H 4CBOA 8LPRA 1GHZA 7LPRA 1MAXA 2ZIQH 3PTBA 3VFEA 1L2EA 1O5CB 2FOHA 1GI4A 1NY22 1MCTA 2GVFA 3RU4D 3Q3YA 3M5LA 1SQTA 1SGFG 4OGYA 1QBNA 5DP4A 1ZLRA 1O36A 1CA0B 3RXVA 1MD8A 1GHXH 5FX6A 3L33A 1OWDA 4U30A 1FONA 2OUAA 4K8BA 3IITA 1ZTJA 1O31A 1ZPBA 2JETB 2ZC9H 4RKJB 4KTSA 3BTHE 1KLTA 1O3BA 2Y7XA 1ZHMA 1O3CA 1PQ8A 2OC7A 3BG8A 2Z9LA 4WWYA 1FZZA 4UONA 2BX3A 1WSSH 4FU7A 3A7TA 3SU5A 2ESTE 1QB1A 1ZMJA 3GY7A 4O9VA 1GCDA 2O8WA 3F1SB 2WPKS 1TGSZ 3C27B 5F8TA 2Q6DA 3MNCA 4WH6A 1SGEE 3TGKE 2GZ8A 1XUJA 4I7YH 1XUIA 1E0FD 3H7TA 1K2I1 5SGAE 5EW1H 1FAKH 2BDIA 3GDSA 1O32A 4UFGH 1G2MA 2JH0D 3SO3A 2R3YA 1HLTH 1XVOA 1Y3VA 5AHGH 1S6HA 2ZU1A 1TNGA 2WUCA 1A5IA 2SNWA 2R9PA 3Q00A 1ETSH 3RM0H 1A0HB 1HGTH 3SU1A 1HAPH 1LQEA 2Z6BD 1KTSB 4R8TB 2H1UA 1C5QA 1V2JT 4ZHMU 5FHTA 3SU4A 5CMXH 2FYRA 1QJ1B 1CA0C 4Q80A 2BD7A 5AF9H 2FI5E 1WV7H 3PB1E 2H5CA 1DLKB 3T28A 2ZZUH 3ZZBA 1K1JA 1DSTA 2H2ZA 4O3TA 1A5GH 2BY5X 5L30H 1HAVB 4O03A 1VCPA 2BQ7B 1DWDH 1GL0E 1SLXB 1RD3B 3SNBA 2D26C 2GZ9A 1O2OA 1TB6H 2JH6D 1AWHB 2QA9E 2WPMS 3LGYA 2VGCC 2SGPE 4ZKSU 5FPSA 3GY8A 2BD5A 3HGPA 2WUBA 3ZZCA 1NFWA 4M7GA 3UIRA 3P8GA 2QC2A 1TALA 1XUFA 4F49A 1FV9A 1AE5A 1O34A 4ZHAA 3E6PH 1CGHA 1F5LA 1GI5A 4CRCA 2W5EA 1AD8H 2A7CA 2ZDVH 3GCHC 3U69H 4IBLH 3SQEE 1UTMA 2ASUB 1DT2A 1QGFA 4WMDA 3CS0A 2ZEBA 1DUEA 1GPZA 2BD9A 1EX3A 1NU7B 3HATH 3NKKA 1Y3XA 1GHWH 3A7ZA 1G3CA 1NRSH 3BF6H 2FI4E 1GI0A 1FY1A 6GCHF 1OP2A 1JRSA 2C3SA 3P6ZB 2SGFE 4X8SH 4XBBA 1DUAA 4NFFA 1KXFA 2F3CE 2CF8H 2LPRA 3BV9B 1YLDA 1KXCA 1GMHF 1ETTH 1GJ9B 3M3VA 4UE7H 1F92A 1NZQH 3O8CA 4NIYA 1AB9B 2Y82A 4INHA 2PLXA 4U01A 1RRKA 1P2KA 4OS7A 3D23A 3FZZA 3UWJH 4VGCC 6LPRA 1A5HA 4ABEA 2ZGBH 1TMTH 4FUIA 1AY6H 1ELGA 3AW1A 1L1JA 4AGKA 3RXJA 1TRYA 2ILNA 1BBRE 3ZZ5A 2ZCHP 4FU8A 4NA7A 1NESE 3EDXB 4NIXA 1L1NA 1AFQC 1DY9A 1O2TA 4H6TA 3U8TH 2BD2A 1BHXF 1BTXA 1YM0A 4MNXA 4AFZA 4U2WA 4ZXXH 2A4OA 3H5CB 1XXFA 1ZSLA 2XNIA 1TMBH 2OBOA 5E0JA 4AOQA 1K1PA 1M9UA 2FESH 1EPTB 1T32A 4Y7BA 1LVYA 3F68H 3ESTA 3U1IB 1OOKB 4ABHA 1SVPA 1DITH 4DW2U 2F83A 3QLPH 4AX9H 3SUDA 2FODA 4ISOA 1GMDF 4YESB 4MDSA 2P95A 1MZAA 1TNLA 4X8TH 2F9UA 2HLCA 1MKWH 4IC5A 2O8LA 4NA9H 4LOYH 1TABE 3W95A 2RDLA 3DFLA 2J38A 3A81A 4ZUHA 4YZUA 2TGDA 1GVLA 3WY8A 2NU4E 1Q3XA 5A0BA 3RXFA 4BTTB 1C4V2 4JMYA 1O3LA 1V2NT 4MPUA 1O3OA 3BTQE 1HUTH 1O3IA 1T8NA 1P2MA 3KEEA 7GCHG 4I33A 3QZQA 2KAIB 2PFEA 1SGYE 3SNCA 1C5OH 3L6PA 3ZV8A 2R2MB 2GGVB 3SNDA 2FX6A 1HAXB 2G51A 3GICB 4ZKRU 1YPJH 2CHAB 5EQRA 3SNAA 4H42U 5L2YH 1OX1A 1GL1A 3ATIA 4JCNA 1EASA 2BLQA 2VINA 5HGGA 1FY3A 4D7GA 5T6FA 2GT8A 4ABJA 1J9CH 5EXMA 2BDHA 1VGCC 1PPZA 3PYHA 4X1QU 1GBHA 1U6QA 2FLBH 1O5FH 3RXBA 4NZQA 1HAGE 4GPGA 4J1YA 1AU8A 1PPBH 2Z3CA 1SI5H 3ENSB 1C1PA 3EE0B 1LDTT 3FP6E 1HJAB 1VITF 5FAHA 1J15A 3LH3A 1O2GH 3FP8E 3A8DA 2ZDAH 1GMCG 1GBIA 2ZWLH 5A09A 2ZFPH 2ZPRA 2AIQA 4Y0YE 1EPTA 1TGCA 3LGUA 4TY6A 4Y11E 3RLWH 1GI8B 3TVJB 1CT0E 2J34A 1BT7A 4ABAA 1W14U 1RFNA 1S0QA 1JBUH 2ODPA 2ZECA 1TRNA 1VITH 1GHAG 3ATKA 5K7RA 3E91A 2SGEE 3SJIA 1O35A 1TQ0B 4H6SB 1GI7B 4OS4A 1MTSA 3T62A 5EODA 1CT4E 5C5OA 3M3SA 1WQVH 3E0PB 2K1QA 4O97A 1AO5A 2BLOA 3GYMA 1HAIH 3LGTA 1P02A 1IQNA 2G00A 2EA3A 2IJOB 2PV9B 2BVRH 1O2KA 3PMBB 4X6PA 1AZ8A 1MTNB 1P2IA 1BTZA 5EPNA 5EG4A 5HYOA 1IQLA 1C1SA 2ZU2A 1K28D 4OS2A 1N8OB 1SQOA 2FEQH 1H8DH 5DP9A 1JXPA 1KDQB 1JIMA 3SHCH 2GX4A 5A0AE 2WPLS 1O2WA 2H5DA 5DPAA 3BTWE 3LGIA 3ODDA 1K9OE 1GCTC 3HKIB 4X8VH 3V3MA 1NO9H 1EUFA 1IQKA 1TGTA 2GDDA 2ZFFH 5EXNA 3P95A 4ABIA 5L2ZH 2XTTB 4BXWA 1THSH 5JYIA 3LIWA 3N7OA 1E38B 3TJNA 2EI7A 1SOTA 1VJAU 1K1OA 2ZGJA 3K6YA 3MNSA 1C2DA 4AORA 4K5ZA 1EAWA 1V3XA 3A83A 4BANB 4IW4E 3SV6A 3MO6A 5FXLA 2A4GA 4LXBH 1C5RA 1K1IA 1ZJDA 3KQCA 2OXSA 2AMQA 5JDUB 1GBKA 3SUFA 2SGAA 1C1OA 2XCFA 1BJUA 4SGBE 1MCVA 1NU9A 4ISLA 4E7NA 1WU1A 3V0XA 2A32A 1BTHH 3SV9A 4IGDA 5FPYA 2A7HA 3K6ZA 1DS2E 4B76A 1A0LA 1PYTD 4XE4A 1QL8A 1N8OC 4WMEA 1HJ9A 4R0IA 6GCHG 1KSNA 3E1XB 3VB5A 3LT3A 1C2GA 3QK1A 4GLYA 3T29A 4A6LA 1SLUB 2G5VA 1BRUP 1EZUC 1O2PA 1UCYH 1O0DH 2XBYA 3GDVA 1PJPA 1TRMA 4NSYA 1CGIE 1W3CA 1B0EA 3PMHB 4BOHA 1AVXA 1YPHC 2VB0A 4BAQB 2BVSH 1D3QB 1GBLA 1EJAA 3SORA 1EAIA 5J4QA 3LGWA 1YPHE 1O2SA 1BOQA 1T4VH 4GAWA 4YTAA 1TA2A 2GMTC 5F03A 2VVUA 2PTNA 1P2QA 3A8BA 1KDQA 2XBWA 4B2BA 3QTOH 1XKAC 2Y7ZA 1O3GA 5ETXA 2PKAB 2QXIA 2XYAA 1EOLA 1TPPA 3FP7E 4YT6H 1GI9B 2ZPSA 5A8YA 1HDTH 3GOVB 4RKOB 1DICA 4XBCA 1DWEH 2ANKH 3HPTB 3UOUA 1C9PA 3GY6A 1DOJA 1T8MA 1ID5H 3RMLH 4Y7AA 4MVNA 1P09A 2ZHDA 1Q31A 5E0HA 3E3TA 4K8YA 1WAYB 2G8TA 3NZIA 2Y80A 2TBSA 1F2SE 2O8MA 4CH8B 1HYLA 2ANMH 2IPHA 5A8ZA 3A7VA 5DP5A 1ZSKA 4Q7XA 2EC9H 3K2UA 1E36B 1G30B 1P3EA 1WOFA 1LTOA 1GJ4H 4JYTA 1F5RA 4FUBA 3RXUA 5HM2A 3T27A 1C5YB 4QT8C 1IQHA 1L0ZA 3TLOA 1GBJA 2Z9JA 3E16B 4Y8XA 5I46H 2AEIH 3KL6A 1O3NA 1QBOA 3S69A 2D2DA 3BTDE 3A80A 2STBE 5DO4H 1YGCH 3A7XA 1YPGH 2QXHA 4AN7A 3RXLA 4TPYA 4DIHH 1KIGH 1SBWA 1O2YA 1MBMA 2AMDA 1K1LA 4UEHH 3BTKE 1O3MA 3FFGA 3R0FA 3LDXH 2CMYA 1AWFH 1AVWA 1MTWA 2PKAA 1TBZH 1BRCE 1GBBA 1T7CA 5C1UA 1ANDA 1F0TA 5AVDA 1BBRK 1OWIA 1QHRB 1TX8A 2EI6A 3E90B 3KHVA 2A2QH 2V3HH 1UTLM 1S6FA 1VITG 3BG4C 1IQEA 1TX7A 2FM2A 1TAWA 1QRXA 2A5KA 2QAAA 2RA0A 3LJJA 3S7KB 3O8RA 1S0RA 4NZLA 3AW0A 2TPIZ 4U32A 1C1NA 1C2MA 1GDQA 1ZPZA 2EEKA 3HK3B 4FVBA 1AVGH 2ZCLP 3A82A 1FUJA 1ESBA 2WYJA 1QURH 1TNHA 3HKJB 2AMPA 3UPEA 3SOSA 5FCRA 1ZRKA 2OP9A 5EW2H 4NWLA 3F9EA 1LKBA 2O8UA 3QX5H 3SUEA 4X2VA 3SGQE 2A4RA 1C5XB 2F91A 2R0LA 1A61H 1GMCF 1UVTH 3BIVH 1V2MT 1O2RA 5DKMA 2WV5A 2WPJS 1GJ5H 1SLWB 4FUJA 4MQAA 1O3KA 1V2LT 1O3FA 2BMGB 1THRH 4K1EA 1GHAF 1D9IA 2VGCB 3SBKA 3A8AA 4A1VA 5LGOA 2BY8X 2FOMB 1O2XA 4HTCH 1P11E 1HAHH 3UNSA 2PUQH 1RTLA 1HNEE 1F0SA 3RXDA 3AVZA 2PTCE 1NFXA 4CR5A 1BTWA 4I8JA 3P17H 2PWXA 2FPZA 1ZYOA 3GCHB 3P8NA 1NROH 2Z7FE 1P9SA 5F6MA 1FJSA 1QTFA 8GCHG 3SZNA 3DFJA 1KYNA 1N6XA 3UR9A 1CHGA 4JZEH 5LPRA 3SUGA 1GVKB 2OTVA 3UREA 1RGQA 1MQ6A 4LZ1H 1H1BA 3IG6B 4MG3A 1BITA 1HAOH 3TITA 4MPXA 1C2IA 2QY0B 3RP2A 4X1RU 1TIOA 2P93A 5BRRE 1SC8U 5GPIB 2NU0E 2Z9GA 3ZZ6A 1Z1IA 4FUEA 1TOMH 3NWUA 3JZ2B 3S9BA 4WXVA 2W7UA 4UFDH 2QF0A 2ZCKP 3RXOA 2TGAA 2Z3EA 5DP6A 4VGCB 4ABFA 2FS9A 2OC1A 5GXPA 3RUOA 1EZQA 2B0FA 1TPSA 1AFQB 3D65E 3RXCA 6CHAC 3A88A 5T3HA 3PLBA 1GI6A 4YLQH 2GKVE 1AHTH 1GGDC 3E8LA 1CVWH 1HPGA 1O2NA 1Z6JH 2A7JA 2B7DH 3TPIZ 1C1WH 3BIUH 4WXIA 4AFSA 1C1RA 3D62A 4RSPA 4E06H 4BAMB 1DX5M 1GBMA 1G37A 2WPIS 1PPEE 4AFQA 1QL7A 1DPOA 1OXGA 3MNBA 4GHQA 1W10U 2FX4A 1A7SA 1TQ7B 1UTQA 1SGTA 1V2RT 1FY5A 4K1TA 1ELEE 1MKXH 2W3KA 3VB6A 2FOFA 1MU8B 4KTUA 1JMOH 4JZIA 2BX4A 3RU4E 1YPKH 2ZQ1A 3KGPA 2ZGXH 1P9UA 2FXRA 3ZZ7A 4NFEA 2BQ6B 2FDAA 4Y76A 1MTVA 4NIVA 3RXRA 3ATLA 7ESTE 1GG6B 1ZHRA 5CHAC 3RXGA 1ELDE 1K1MA 1FNIA 3SU3A 3EA9A 2BQWB 1V2VT 4IC6A 3A89A 2VVCA 1C5VA 9LPRA 2HOBA 3F9HA 2HNTF 1QBVH 2VH6A 5EQQA 1Y5AT 4Q7ZA 2Y81A 5TCAA 7KMEH 1Z71A 2Q6FA 1A46H 4ISHH 2VIQA 4CRFA 1HXFH 2A5AA 1SGQE 4JK5A 3V7TA 1GJ8B 3EGKH 4K3JA 1MQ5A 3MFJA 4DURA 2B9LA 4AG2A 5E2OA 1VGCB 1H8IH 4Z6AH 5E8EH 1XMNB 3T5FH 1V2QT 1BRAA 4MPWA 3EAJA 3O8DA 3I77A 5G4BA 1ETRH 1LQDB 1SR5C 1FN6A 1O2ZA 1NN6A 4KP0A 3E0NB 1SSXA 1SQAA 1YCPK 1OYTH 2BDAA 4JYVH 1YCPM 2QXJA 1QA0A 3M35A 2IOTA 1YP9A 4GUXA 3ZVGA 3MH5A 1BDAA 3OY6U 1SOZA 1DXPA 4ISNA 1XUKA 1GG6C 2P94A 2O9QA 4A5TS 3VB3A 1N1LA 2CV3A 3V12A 3QGNB 1NPMA 1BTPA 3SU0A 3DT0H 2Q6GA 3U8RH 1A3BH 3TH3H 4FXGH 4CHAC 4CREA 2VH0A 1AUTC 5TJXA 1TGNA 2GT7A 1OSSA 5HMAA 1KY9A 3LJOA 4NIWA 1C2LA 5LPEA 1UK4A 1INCA 3F9GA 3MO9A 1O2IA 1LMWB 1O3JA 1GBDA 1UJ1A 5JBCS 1P12E 2VIDA 2FTLE 2J94A 1P2OA 2ALVA 3OY5U 5A2MH 5BPEA 2V6NA 4OS1A 1SLVB 1ZR0A 1IAUA 2Z9IA 3H7OA 2AGGX 2TGPZ 1SGFA 3M7UA 3P92A 1EKBB 1YF4A 3I78A 2OQUA 4NA8A 2ZU4A 1GCTB 4Y0ZE 1BUIA 4JK6A 1G36A 1OKXA 4MPVA 1L4ZA 1SGDE 1XXDA 1YPLH 1PPFE 2I6SA 1C2KA 2ANWA 1TLDA 1ZTKA 3VXFH 1KXDA 1C1VH 4DOQA 3RXEA 1C4Y2 1LCYA 1ANCA 4TWWA 4X2WA 3M61U 4I32A 4CRGA 4D76A 4ASHA 1DANH 4YOIA 1OYQA 4XFQA 1EJNA 3B9FH 1GJAB 1B5GH 3RC4A 3GCTG 2OBQA 3ZVEA 1MD7A 1QA7A 1ZHPA 1LPGB 1EZXC 1YLCA 2Z3DA 1IOEA 1ZOMA 1FLEE 2R3UA 4FUGA 1UTOA 2Y5HA 3AAVA 1TMUH 3RMMH 3SJ8A 3ZVDA 5LH8A 2AGEX 2BM2A 2HGTH 4FVDA 5GIBA 1E34B 2C8YB 1O2MA 1ZSJA 1TNJA 1AGJA 1QIXB 1P8VC 3PO1C 2BLVA 1TE0A 3UOPA 3LC3A 5DP7A 4F4OC 9ESTA 2VU8E 2THFB 1GI1A 2XBXA 3BEUA 2BDCA 2FTMA 1Z6EA 8KME2 4THNH 3M5NA 4CRBA 4BTIB 3VB7A 3RLYH 4ZHLU 1MAYA 3UR6A 1D3PB 2CJIA 2VWMA 1Q2WA 3EA8A 1SPJA 2UUJB 1F0UA 4GVUA 8GCHF 1H4WA 3GY4A 2TIOA 1HIAB 1QNJA 2GMTB 1MZDA 1UCYE 5T6GA 1TFXA 3S9AA 3R3GB 1C5TA 4Q7YA 3SU6A 3SHAH 3B8JA 1GDUA 3PTNA 1AN1E 1UTJA 1BA8B 1W0ZU 3RU4T 1EB2A 4AB9A 2ZFQH 1SG8B 3RXSA 3S9CA 3MNXA 2QGRA 1PPGE 1V2PT 3CENA 4INLA 3KQDA 3TK9A 3UWIA 4H4FA 3KN2A 4OS6A 4BAOB 1S84A 4A1TA 1UTPA 1YYY1 2QN5T 4RN6A 4Y79A 4DJZB 2ZG0H 3ATMA 4IMZA 3S7HB 4X1SU 3KIDU 2ZNKH 1DWBH 2GDEH 1EATA 3LPRA 4I8GA 2P8OC 1OPHB 1FIZA 2F9BH 1ANEA 1QB6A 1G3EA 1Z8IB 1H9IE 1VJ9U 2CN0H 3ZZDA 1LHDH 4Y6DA 4DVAU 4BXSA 5JB9S 2VIOA 2ZPQA 5GCHF 2ZFSA 2OLGA 2NU3E 1MTUA 1GJBB 2XXLA 4DGJA 4DT7B 1CU1A 2O8TA 3MU8A 3Q77A 1QFKH 4K69A 4D8NA 1CHOG 5EGMA 3M5OA 3BTEE 1OWJA 1HV7A 2HPQH 3SU2A 1PQAA 1MH0A 1EZSC 1D6WA 1TONA 1GBCA 4TY7A 5C20A 1KXAA 1W11U 2QCYA 2LNCA 4TYDA 1RTFB 1B0FA 1YKTA 1EQ9A 1F5KU 1GJ7B 5FBIA 1E35B 1NT1A 1P57B 4BAHB 1HIAA 1TOCB 1J14A 3DUXH 4AFUA 4CR9A 5IDKA 3I29A 2FP7B 3GY5A 3URDA 4BAKB 2FOBA 4NCYA 3W94A 5JB8S 1D3DB 1Z8GA 2F9NA 1FAXA 3MHWU 4IN1A 4ZROA 1CO7E 3RXMA 2BXUH 4X1PU 1BTYA 1J17T 1QQ4A 3T25A 3UQVA 1TNKA 3BTME 4MNWA 4DG4A 1S85A 1TWXB 1DFPA 3M3TA 1THPB 1V2OT 3BG4B 5EQSA 1AIXH 3TJVA 2AGIX 3LONA 3RM2H 1GHBF 3RXPA 5JBTA 3L3TA 4CRDA 5FPTA 1EB1H 4GHTA 2P16A 1V6DA 1G3BA 1BTUA 1K21H 2PSYA 3ELAH 2BOKA 3TJUA 1AKSB 2C93B 2CGAA 3UUZA 1AI8H 2ZU3A 1IHTH 3VGCC 1LVBA 3RMNH 2GV7A 1Y8TA 2A45B 3BSQA 1GWAA 1MUEB 2ZKSA 1LVOA 3M36A 3MU0A 3NCLA 1A3EH 3V13A 1ELFA 2G52A 5EPYA 2FIRH 1GVZA 2V0BA 1DY8A 3F9FA 2A1DB 3QUMP 2A31A 5C2ZA 1ABIH 1TBQH 2ZTXA 4KTCA 3BTFE 1QJ7B 1ARCA 3SGBE 2GCTB 2XC4A 2G55A 2BZ6H 1LHGH 2UWOA 3ZYEA 2ZTZA 5C1YA 4X8UH 1NRQH 2GD4B 1S5SA 1MKWK 1UHBB 2P59A 2PKSC 2ZU5A 1GHYH 1TBRH 3NUMA 1UVSH 3K9XB 1C5PA 3MH6A 4X1NU 2FOAA 4NGAH 2J2UA 1KTTB 3DD2H 1SGCA 2J92A 1Z1JA 2ZDMA 2QIQA 1S81A 4X6MA 1C1MA 2RCEA 1Z8JB 2G4UA 3A8CA 2C8XB 5C67A 1FN8A 2Y6TA 1NRNH 1RTKA 1PYTC 2OC8A 2XC0A 4KGAA 2VWOA 3LU9B 5K0HA 4ZH8A 3RC5A 3BTTE 4FUFA 4FUCA 2C8ZB 2ODYB 3SV7A 2FOCA 1F0RA 1C2FA 3GYLB 4A7IB 2BTCE 1ACBE 2A0QB 2BXTH 1C5LH 4GCHG 1H9LB 1V2WT 2FLRH 3SW2B 4TPIZ 3A87A 3ZVBA 1TX6A 4K2YA 1YC0A 2OINA 1NRRH 1BIOA 1VCQA 1VCWA 1C1QA 1SGIB 1SGNE 1P05A 2ULLA 1MBQA 3QTVH 8ESTE 3IWMA 1O3HA 1AKSA 3MYWA 2H6MA 1W7XH 4UD9H 1O37A 2GCTC 4LZ4B 3SQHE 1V2KT 1GBAA 2XBVA 1WBGB 2AS9A 2BY7X 1C2HA 1C9TA 3PM3A 1CQQA 6CHAB 3B23B 1O2VA 1P2NA 1BCUH 3OYPA 1B7XB 3GCTF 1CSOE 3SV8A 2BVXH 1DVAH 1AMHA 1GGDB 2WPHS 2J9NA 1QY6A 1QCPA 5TCCA 2J4IA 1SGPE 3TH2H 1AUJA 1WQSA 3P8OA 1UHBA 3UFAA 1UMAH 1QRWA 1QRZA 4XBDA 3UTUH 1OS8A 2ZDKA 4WF8A 4HI3A 5H4IB 4NG9H 3RXHA 1FDPA 4OS5A 2P3FH 2XW9A 3SV2H 4MLFB 4B75A 4NWKA 1BMLA 3HGNA 1W13U 3ZZ8A 1ELVA 1BHXB 1HXEH 1G32B 5C5NA 4K1SA 2STAE 2OCVB 5A8XA 2BZAA 1W8BH 4AGJA 2D1JA 4JYUH 3MWIU 3A86A 3KQBA 2A4QA 1RXPA 1QQUA 1HAYB 2VNTA 4WH8A 4Y71A 2H9HA 1P06A 2ZI2H 1LO6A 1SFQB 4DY7B 1IQMA 2BLWA 1DE7H 1O3PB 1BZXE 5CHAB 3FZDA 4ZKOU 1D6RA 1XUGA 4DIIH 1UTKA 4E05H 3LGVA 1NS3A 2DUCA 4UDWH 2F9VA 2A5IA 5ABWA 1SHHB 2HVXA 5JBBS 2H9TH 3QZRA 1O3EA 1ELCA 3DA9B 1GJ6A 2JETC 1XKBC 1X7AC 2ZF0H 3U8OH 3SN8A 4CBNA 2BDYA 1D3TB 1H9HE 2B5TB 1TYNA 2CF9H 2TGTA 2WYGA 3STIA 2SFAA 3SNEA 3ZZ9A 5GJ4B 1D4PB 5CE1A 1O2LA 1TGBA 5GCHG 3QN7A 3URCA 3RXTA 2R0KA 1QL9A 1CBWB 5F8XA 3UNRA 3NPSA 2DE9A 1WUNH 3QDZB 1EJMA 1RS0A 3UNQA 2VJ1A 1ZTLA 5ESBA 2ZGHA 2FI3E 2ZO3H 4B2AA 4D9QA 1DLEA 2HNTC 1O2JA 2CXVA 2FS8A 2FWWA 2H9EH 3PROA 1HFDA 1JOUB 1A1RA 1GHVH 2HNTE 2RG3A 2PSXA 3P8FA 3A85A 3SJ9A 5FBEA 1JRTA 1Y5UT 2BHGA 4WJG2 2QF3A 3ITIA 3MH7A 2FMJA 5B6OA 1LPZB 3VXEH 1PQ5A 4YOGA 1E37B 1O5EH 1GJCB 1UCYK 1CHOF 5AFYH 4YM9A 2Q1JA 1LPKB 4UFFH 1NFUA 3TJOA 1BB0B 4SGAE 4X6OA 4YT7H 2GCHF 3SGAE 1FQ3A 3ZVCA 1AZZA 1LHEH 3MU5A 1O2UA 3UY9A 4CHAB 3RDZA 2VVVA 1K1NA 1GHBG 3F6UH 5HXFA 2UUKB 2FZZA 1O33A 1BMAA 2YNBA 3M37A 3GDUA 5GDSH 1RIWB 5DGJA 1CBWC 3FANA 4ZAEA 2QXGA 4B1TA 3LOXA 3PV4A 5DG6A 3RXIA 2PGBB 3SJOA 1W12U 4MTBA 4Q2KA 1EAXA 1HAVA 2GP9B 3LH1A 2OC0A 2QV1A 1O5DH 2P3TB 2WINI 3KCGH 1ZZZA 1P0SH 4NSVA 1UVPA 1P04A 5DP8A 1DDJA 3LKWA 2VIVA 1G2LA 3C1KA 4JZDH 1IQGA 2PHBA 1ZGVA 1W7GH 1WTGH 2XCNA 4XDEA 1DM4B 4KELA 1L4DA 2ZFTA 5LPFA 4CRAA 1UO6A 3RXKA 2YOLA 1GJDB 3QWCH 3M7QA 3ZZAA 4D9RA 2ZQ2A 1L1GA 4I8HA 3SJKA 1QJ6B 3NK8A 4E7RG 4J2YB 4FUHA 1AFEH 3OSYA 2ZFRH 1F7ZA 4WVPE 1ELAA 1IHSH 4IMQA 3S0NA 1HRTH 3VB4A 1C5ZB 4MNYA 3QO6A 1DSUA 1NRPH 1BBRH 1P2JA 2FOEA 1PQ7A 1AB9C 1P10A 4X0WU 4ISIH 3M5MA 4B2CA 2JKHA 1P3CA 1OP8A 3Q76A 3PO1B 1RIWC 2C4FH 3ZV9A 1C1UH 1ZRBA 2FO9A 1NC6A 2ZDNA 3FAOA 3MTYA 1SHYA 1EOJA 2G81E 4ABDA 3LC5A 3RC6A 2ZHFH 1T8OA 3MMGA 1GBFA 3TIUA 3AAUA 1Y59T 3GY3A 1BMMH 4ABGA 1O2HA 2Y5FA 2VWLA 2VIWA 1FY4A 2AIPA 3AASA 5IYTA 4Y8YA 2PUXB
chains in the Genus database with same CATH superfamily
4I31A 1EPTC 2BB4A 2P3UB 1FPCH 1TA6A 2Z94A 2ZTYA 2BD3A 2G5NA 4X2XA 4B6EA 4X2YA 2IJD1 5J4SA 1P03A 1GDNA 2XC5A 4GCHF 1OWEA 4ACBA 2OQ5A 1WYKA 5E0GA 4YXWD 1ZGIA 1SGRE 1AE8H 3NXPA 1W0YH 3SI3H 4I8LA 1C5MD 1N6YA 3PMJA 5HIZA 2QYIA 5FCKA 3U9AH 1XM1A 1LHCH 1HJ8A 4ESTE 1Z7KA 1QB9A 1V2TT 4ZKNU 1CE5A 2W3IA 2ZHEH 5AFZH 3U98H 2A2XH 3U1JB 2P8OB 3ODFA 3MH4A 1ZMLA 2RDEA 3BEIB 5C3NA 1O3DA 1ARBA 1S6LA 3KNXA 2BYAX 1JWTA 2CHAC 1IQFA 2ZHWH 1FY8E 1OWKA 4OGXA 1FPHH 3ZZ4A 4CH2B 1BQYA 4IS5A 1NM6A 4B71A 3OX7U 2XRCA 1EP5A 2M5TA 1LHFH 5EOKA 5EU8A 2YNAA 5DP3A 2KAIA 2V3OH 3TGIE 2HRVA 2ALPA 3A7YA 2Y5GA 1WTHD 3ZZ3A 5EJZA 1UVUH 4F48B 1ELBA 1RJXB 1YPMH 5ESTE 1G3DA 2G4TA 3F2HA 4INKA 1NTPA 1HJAC 3A84A 1O2QA 5T6DA 5EXLA 2ODQA 4B73A 5JBAS 2AERH 1YPEH 2BDGA 3ATWA 4AB8A 1MMJN 4O3UA 5F8ZA 1EXFA 3STJA 3OTJE 4WMFA 1O5AB 1SB1H 2GTBA 2XWAA 1E1QD 3VEQB 5EIYA 2V35A 2JJ1D 2ANYA 5DJ7A 5CHBA 1EAUA 3FVFB 3PWCA 1FIWA 1E1RD 2PGQB 1O39A 3KYGA 2HALA 3WWFA 2R2WU 3D49H 3TH4H 1A4WH 3T2NA 4A92A 1PPCE 2FYQA 1SFIA 3MI4A 4Y8ZA 1ORFA 1DWCH 5FX5A 4BTUB 1WCZA 4I8KA 5PTPA 1EP6A 2BD8A 5I25A 4HGCA 4ABBA 3BEFB 3TNTA 1W2KH 3OU0A 1MTNC 1KLIH 3KF2A 1T8LA 2VWNA 4A1XA 1T4UH 3GY2A 3MOCA 4MNVA 3ZVAA 5DK1A 4AG1A 1XX9A 1IQJA 1AQ7A 1ZPCA 1Y3YA 3EYDA 2RA3A 2W26A 1UK3A 3VGCB 2FOGA 2UWLA 1VZQH 3GCNA 4UFEH 3KQEA 2GCHG 3ZYDA 1C5WB 1GBEA 1UVOA 4WY3A 1GI3A 1UTNA 3EA7A 1V2UT 2TRMA 2PW8H 2ZDLA 4JZ1A 4GSOA 3CS7A 1GMHG 1C4U2 1S82A 2GZ7A 2ZP0H 1O5BB 2NWNA 1ESAA 1HAZB 1Z8RA 5GWZA 2ZHQH 3PLPA 3RXAA 2UUYA 2DE8A 4X6NA 1ZMNA 3TK5A 1TPAE 1ANBA 1A0JA 4HFPB 1FI8A 1XVMA 4AZ2B 1V2ST 2UUFB 4XRNA 2Z9KA 2OD3B 3PMAB 2YMSC 3KQ5A 3UQOA 2PKSB 1O30A 1MKXK 3BTGE 1K0HA 1MU6B 1JIRA 3GISB 1UK2A 1ZJKA 2PR3A 1C5UA 1J8AA 3JZ1B 3K65B 1J16A 4ZMAH 4AYVB 1ELTA 3TNSA 3HK6B 1HCGA 2IN2A 1BRBE 1TPOA 3G01A 3QGJA 1DXWA 3DHKH 4TWYA 1HB0B 2F9PA 1QR3E 4KKDA 1YCPH 1ABJH 5E2PA 3SI4H 3M7TA 2C8WB 3P70B 1P01A 1XUHA 2ZA5A 4D7FA 3EQ0H 1C1TA 2BDBA 3ZVFA 1IQIA 2ZGCA 5HM9A 2C90B 1O38A 2SGDE 4Z0KA 2I6QA 3T26A 1PFXC 1GMDG 2VIPA 5EJLA 4AYYB 1OWHA 2UWPA 3Q3KA 1TNIA 2BY6X 2AH4X 3Q3XA 2SGQE 3WWBA 2SNVA 2XWBI 3O8BA 2LELA 3BN9A 4Y10E 3OAAD 4JZFH 1BMNH 4YOJA 3GCOA 1FXYA 3MU1A 4XSKU 4ZXYH 6ESTA 1Y5BT 1Y3UA 2NU1E 1SMFE 3PLKA 5C1XA 2NU2E 3MU4A 1K22H 1O5GH 1CA8B 4YLUA 2W7SA 1HBTH 1KLJH 2HPPH 1GI2A 3TGJE 4FUDA 2D8WA 4RT1A 4DCDA 4BNRA 2WV4A 2BOHB 5L6NH 1YBWA 5A0CA 1G9IE 2GV6A 4XOJA 4LK4A 2JH5D 1CT2E 4PROA 1C2JA 2J95A 4FU9A 3MO3A 1KXEA 1QZ8A 4IN2A 4HZHA 2EI8A 1LKAA 3RMOH 2HWLB 1KXBA 5JPMH 1PPHE 2KCPA 3VPKA 3CP7A 2BD4A 2F9OA 4K60A 2AFQB 4ZCNA 2BY9X 1C5NH 3TK6A 2AYWA 4B74A 1CGJE 1A2CH 3A7WA 1C2EA 1OP0A 1LVMA 1FMGA 1BJVA 1C5SA 1S83A 7GCHF 1ESTA 1NFYA 3PWBA 1VR1H 1GBTA 1O3AA 1Y3WA 1SL3A 2B8OH 1T31A 4YO9A 3RXQA 3TU7H 4CBOA 8LPRA 1GHZA 7LPRA 1MAXA 2ZIQH 3PTBA 3VFEA 1L2EA 3F0OA 1O5CB 2FOHA 1GI4A 1NY22 1MCTA 2GVFA 3RU4D 3Q3YA 2EY4C 3DSOA 3M5LA 1SQTA 1SGFG 4OGYA 1QBNA 5DP4A 1ZLRA 1O36A 1CA0B 3RXVA 1MD8A 1GHXH 5FX6A 3L33A 1OWDA 4U30A 5F53A 1FONA 2OUAA 4K8BA 3IITA 1ZTJA 2W6JD 1O31A 1ZPBA 2JETB 2ZC9H 4RKJB 4KTSA 3BTHE 1KLTA 1O3BA 4I86A 2Y7XA 1ZHMA 1O3CA 1PQ8A 2OC7A 3BG8A 2Z9LA 4WWYA 1FZZA 4UONA 2WHXA 2BX3A 1WSSH 4FU7A 3A7TA 3SU5A 2ESTE 1QB1A 1ZMJA 3GY7A 4O9VA 1GCDA 2O8WA 3F1SB 2WPKS 1TGSZ 3C27B 5F8TA 2Q6DA 3MNCA 4WH6A 1SGEE 1SKYE 5HIYA 3TGKE 2GZ8A 1XUJA 4I7YH 1XUIA 1E0FD 3H7TA 1K2I1 5SGAE 5EW1H 1FAKH 2BDIA 3GDSA 1O32A 2QE7D 4UFGH 1G2MA 2JH0D 3SO3A 2R3YA 2KCOA 1HLTH 1XVOA 1Y3VA 5AHGH 1S6HA 2ZU1A 1TNGA 2WUCA 1A5IA 2SNWA 2R9PA 3Q00A 1ETSH 5FL7D 3RM0H 1A0HB 1HGTH 3SU1A 1HAPH 1LQEA 2Z6BD 1KTSB 4R8TB 2H1UA 1C5QA 1V2JT 4ZHMU 5FHTA 3SU4A 5CMXH 2FYRA 1QJ1B 3GS9A 1CA0C 4Q80A 2BD7A 5AF9H 2FI5E 1WV7H 3PB1E 2H5CA 1DLKB 3T28A 2ZZUH 3ZZBA 1K1JA 1DSTA 2H2ZA 4O3TA 1A5GH 2BY5X 5L30H 1HAVB 4O03A 1VCPA 2BQ7B 1DWDH 1GL0E 1SLXB 1RD3B 3SNBA 2D26C 2GZ9A 1O2OA 1TB6H 2JH6D 1AWHB 2QA9E 2WPMS 3LGYA 3SYJA 2VGCC 2SGPE 4ZKSU 5FPSA 3GY8A 2RFKC 2BD5A 3HGPA 2WUBA 3ZZCA 1NFWA 4M7GA 3UIRA 3P8GA 2QC2A 1TALA 1XUFA 4F49A 1FV9A 1AE5A 2W6ID 1O34A 4ZHAA 3E6PH 3FO8D 1CGHA 1F5LA 4B6FA 2J98A 1GI5A 4M9FA 4CRCA 2W5EA 1AD8H 2A7CA 2ZDVH 3GCHC 3U69H 4IBLH 3SQEE 1UTMA 2ASUB 1DT2A 1QGFA 4WMDA 3CS0A 2ZEBA 1DUEA 1GPZA 2BD9A 1EX3A 1NU7B 3HATH 1VKYA 3NKKA 1Y3XA 1GHWH 3A7ZA 1G3CA 1NRSH 3BF6H 2FI4E 1GI0A 1FY1A 6GCHF 1W0JD 1OP2A 1JRSA 3WW7A 2C3SA 3P6ZB 2SGFE 4X8SH 4XBBA 1DUAA 4NFFA 1KXFA 2F3CE 2CF8H 2LPRA 3BV9B 1YLDA 1KXCA 1GMHF 1ETTH 4Q63A 1GJ9B 3M3VA 4UE7H 1F92A 1NZQH 3O8CA 4NIYA 1AB9B 2Y82A 4INHA 2PLXA 4U01A 1RRKA 1P2KA 4OS7A 4P00A 3D23A 3FZZA 2JIZD 4VGCC 3UWJH 1A5HA 4ABEA 6LPRA 2ZGBH 1TMTH 4FUIA 3PV2A 4DT4A 1AY6H 1ELGA 3AW1A 1L1JA 4AGKA 3RXJA 1TRYA 2ILNA 1BBRE 3ZZ5A 2ZCHP 4FU8A 4NA7A 1NESE 3EDXB 4NIXA 4ACAA 1L1NA 1AFQC 1DY9A 1O2TA 4H6TA 3U8TH 2BD2A 1BHXF 1BTXA 1YM0A 4MNXA 4AFZA 3OEED 4U2WA 4ZXXH 2A4OA 3H5CB 1XXFA 1ZSLA 2XNIA 1TMBH 2OBOA 5E0JA 4AOQA 1K1PA 1M9UA 2FESH 1EPTB 1T32A 4Y7BA 1LVYA 3F68H 3ESTA 3U1IB 1OOKB 4ABHA 1SVPA 1DITH 4DW2U 2F83A 3QLPH 4AX9H 3SUDA 2FODA 4ISOA 1GMDF 4YESB 4MDSA 1MZAA 2P95A 1TNLA 4X8TH 2F9UA 2HLCA 1MKWH 4IC5A 5GNDA 2O8LA 4NA9H 4LOYH 1TABE 3W95A 2RDLA 3DFLA 2J38A 3A81A 4ZUHA 4YZUA 2TGDA 1GVLA 3WY8A 2NU4E 1YY3A 1Q3XA 5A0BA 4RT0A 3RXFA 4BTTB 1C4V2 2L6OA 4JMYA 1O3LA 1V2NT 4MPUA 1O3OA 3BTQE 1HUTH 1O3IA 1T8NA 1P2MA 3KEEA 7GCHG 4I33A 5T1VA 3QZQA 2KAIB 2PFEA 1SGYE 3SNCA 1C5OH 3L6PA 3ZV8A 2R2MB 2GGVB 3SNDA 2FX6A 1HAXB 2G51A 3GICB 4ZKRU 1YPJH 2CHAB 5EQRA 3SNAA 4H42U 5L2YH 1OX1A 1GL1A 3ATIA 4JCNA 1EASA 2BLQA 2VINA 5HGGA 1FY3A 4D7GA 5T6FA 2GT8A 4ABJA 1J9CH 5EXMA 2BDHA 1VGCC 1PPZA 3PYHA 4X1QU 1GBHA 1U6QA 2FLBH 1O5FH 3RXBA 4NZQA 1HAGE 2KZ4A 4GPGA 4J1YA 1AU8A 1PPBH 2Z3CA 1SI5H 3ENSB 1C1PA 3EE0B 1LDTT 3FP6E 1HJAB 1VITF 5FAHA 1J15A 3LH3A 1O2GH 3FP8E 3A8DA 2ZDAH 3PRBA 1GMCG 5KECA 1GBIA 2ZWLH 5A09A 2ZFPH 2ZPRA 2AIQA 4Y0YE 1EPTA 1TGCA 3LGUA 4TY6A 4Y11E 3RLWH 1GI8B 3TVJB 1CT0E 2J34A 1BT7A 4ABAA 1W14U 1RFNA 1S0QA 1JBUH 2ODPA 2ZECA 1TRNA 1VITH 1GHAG 3ATKA 5K7RA 3E91A 2SGEE 3SJIA 1O35A 1TQ0B 4H6SB 1GI7B 4OS4A 2HVYB 1MTSA 3T62A 3VG8A 5EODA 1CT4E 5C5OA 3M3SA 1WQVH 3E0PB 2K1QA 4O97A 1AO5A 2BLOA 3GYMA 1HAIH 3LGTA 1P02A 1IQNA 2G00A 2EA3A 2IJOB 2PV9B 2BVRH 1O2KA 3PMBB 4X6PA 1AZ8A 2KR7A 1MTNB 1P2IA 1BTZA 5EPNA 5EG4A 5HYOA 3PV5A 1IQLA 1C1SA 2ZU2A 1K28D 4OS2A 4P02A 1N8OB 1SQOA 2WSSD 2FEQH 4ASUD 1H8DH 5DP9A 1JXPA 1KDQB 1JIMA 3SHCH 2GX4A 5A0AE 2WPLS 1O2WA 2H5DA 5DPAA 3BTWE 3LGIA 3ODDA 1K9OE 1GCTC 3HKIB 4X8VH 3V3MA 1NO9H 1EUFA 1IQKA 1TGTA 2GDDA 2ZFFH 5EXNA 3P95A 4ABIA 5L2ZH 2XTTB 4BXWA 1THSH 5JYIA 3LIWA 3N7OA 1E38B 3TJNA 2EI7A 1SOTA 1VJAU 1K1OA 2ZGJA 3K6YA 3MNSA 1C2DA 4AORA 4K5ZA 1EAWA 1V3XA 3A83A 4BANB 2YMSB 4IW4E 3SV6A 3MO6A 5FXLA 2A4GA 4LXBH 1C5RA 1K1IA 1NBME 1ZJDA 3KQCA 2OXSA 2AMQA 5JDUB 1GBKA 3SUFA 2SGAA 1C1OA 2XCFA 1BJUA 4SGBE 1MCVA 1NU9A 4ISLA 4E7NA 1WU1A 3V0XA 2A32A 1BTHH 3SV9A 4IGDA 5FPYA 2A7HA 3K6ZA 1DS2E 4B76A 5B6LA 1A0LA 1PYTD 4XE4A 1QL8A 1N8OC 4WMEA 1HJ9A 4R0IA 6GCHG 1KSNA 3E1XB 3VB5A 5C0TA 3LT3A 1C2GA 3QK1A 4GLYA 3T29A 3DCLA 4A6LA 1SLUB 2G5VA 3OE7D 1BRUP 1EZUC 1O2PA 1UCYH 5DN6D 2PP6A 1O0DH 2XBYA 3GDVA 1PJPA 1TRMA 4NSYA 1CGIE 1W3CA 1B0EA 3PMHB 4BOHA 1AVXA 1YPHC 2VB0A 4BAQB 2BVSH 1D3QB 1GBLA 1EJAA 3SORA 1EAIA 5J4QA 3LGWA 1YPHE 1O2SA 1BOQA 1T4VH 4GAWA 4YTAA 1TA2A 2GMTC 5KEDA 5F03A 2VVUA 2PTNA 1P2QA 3A8BA 1KDQA 2XBWA 4B2BA 3QTOH 1XKAC 2Y7ZA 1O3GA 5ETXA 2PKAB 4Q4LA 2QXIA 3F0PA 3N7DA 2XYAA 1EOLA 1TPPA 3FP7E 4YT6H 1GI9B 2ZPSA 2JJ2D 5A8YA 1HDTH 5DSFA 3GOVB 4RKOB 3W1EA 1DICA 4XBCA 1DWEH 2ANKH 3HPTB 3UOUA 1C9PA 3GY6A 1DOJA 5KGOA 1T8MA 1ID5H 3RMLH 4Y7AA 4MVNA 1P09A 2ZHDA 1Q31A 5E0HA 3E3TA 4K8YA 1WAYB 2G8TA 3NZIA 2Y80A 2TBSA 1F2SE 2O8MA 4CH8B 1HYLA 2ANMH 2IPHA 5A8ZA 3A7VA 5DP5A 1ZSKA 4Q7XA 5IK2D 2EC9H 3K2UA 1E36B 1G30B 1P3EA 1WOFA 1LTOA 1GJ4H 4JYTA 1F5RA 4FUBA 3RXUA 5HM2A 3FKSD 3T27A 1C5YB 4QT8C 4TSFD 1IQHA 1L0ZA 3TLOA 1GBJA 2Z9JA 3E16B 4Y8XA 3OTPA 5I46H 2AEIH 3KL6A 1O3NA 1KMHB 1QBOA 3S69A 2D2DA 3BTDE 3A80A 2STBE 5DO4H 1YGCH 3A7XA 1OHHD 1YPGH 2QXHA 4AN7A 3RXLA 4TPYA 4DIHH 1KIGH 1SBWA 1O2YA 1MBMA 2AMDA 1K1LA 4UEHH 3BTKE 1O3MA 3FFGA 3R0FA 3LDXH 2CMYA 1AWFH 1AVWA 1MTWA 2PKAA 1TBZH 1BRCE 1GBBA 1T7CA 5C1UA 1ANDA 1F0TA 2JDID 5AVDA 1BBRK 1OWIA 1QHRB 1TX8A 2EI6A 3E90B 3KHVA 2A2QH 2V3HH 1UTLM 1S6FA 1VITG 3BG4C 1IQEA 1TX7A 2FM2A 1TAWA 1QRXA 2A5KA 2QAAA 2RA0A 3LJJA 3S7KB 3O8RA 1S0RA 4NZLA 3AW0A 2TPIZ 4U32A 1C1NA 1C2MA 1GDQA 1ZPZA 2EEKA 3HK3B 4FVBA 1AVGH 2ZCLP 3A82A 1FUJA 1ESBA 2WYJA 1QURH 1TNHA 3HKJB 2AMPA 3UPEA 3SOSA 5FCRA 1ZRKA 2CK3D 2OP9A 5EW2H 4NWLA 3F9EA 1LKBA 2O8UA 3QX5H 3SUEA 4X2VA 3SGQE 2A4RA 1C5XB 2F91A 2R0LA 1A61H 1GMCF 1UVTH 3BIVH 1V2MT 1O2RA 5DKMA 2WV5A 2WPJS 1GJ5H 1SLWB 4FUJA 4MQAA 2J98B 1O3KA 1V2LT 1EFRD 1O3FA 2BMGB 1THRH 4K1EA 1GHAF 1D9IA 2VGCB 3SBKA 3A8AA 4A1VA 5LGOA 2BY8X 2FOMB 4XD7D 1O2XA 4HTCH 1P11E 1HAHH 3UNSA 2PUQH 1RTLA 1HNEE 1F0SA 3RXDA 3AVZA 2PTCE 1NFXA 4CR5A 1BTWA 4I8JA 3P17H 2PWXA 2FPZA 1ZYOA 3GCHB 3P8NA 1NROH 2Z7FE 1P9SA 5F6MA 1FJSA 1QTFA 5C94A 8GCHG 3SZNA 3DFJA 1KYNA 1N6XA 3UR9A 2GJGA 1CHGA 4JZEH 5LPRA 2IPQX 3SUGA 1GVKB 2OTVA 3UREA 1RGQA 3SZEA 1MQ6A 4LZ1H 1H1BA 3IG6B 4MG3A 1BITA 1HAOH 3TITA 4MPXA 1C2IA 2QY0B 3RP2A 4X1RU 1TIOA 2P93A 5BRRE 1SC8U 4HG6A 5GPIB 2NU0E 2Z9GA 3ZZ6A 3N7EA 1Z1IA 4FUEA 1TOMH 3NWUA 3JZ2B 3S9BA 4WXVA 2W7UA 4UFDH 2QF0A 2ZCKP 3RXOA 2TGAA 2Z3EA 5DP6A 4VGCB 4ABFA 4RI0A 2FS9A 2OC1A 5GXPA 3RUOA 1EZQA 2B0FA 1TPSA 1AFQB 3D65E 3RXCA 6CHAC 3A88A 5T3HA 3PLBA 1GI6A 4YLQH 2GKVE 1AHTH 1GGDC 3E8LA 1CVWH 1HPGA 1O2NA 1Z6JH 2A7JA 2B7DH 3TPIZ 1C1WH 3BIUH 4WXIA 4AFSA 1C1RA 4FETA 3D62A 4RSPA 4E06H 4BAMB 1DX5M 1GBMA 1G37A 2WPIS 1PPEE 4AFQA 1QL7A 1DPOA 1OXGA 3MNBA 4GHQA 1W10U 2FX4A 1A7SA 1TQ7B 1UTQA 1SGTA 1V2RT 1FY5A 4K1TA 1ELEE 1MKXH 2W3KA 3VB6A 2FOFA 1MU8B 4KTUA 1JMOH 4JZIA 2BX4A 3RU4E 1YPKH 2ZQ1A 3KGPA 2ZGXH 1P9UA 1MABB 2FXRA 3ZZ7A 3KYFA 4NFEA 2BQ6B 2FDAA 4Y76A 1MTVA 4NIVA 3RXRA 3ATLA 7ESTE 1GG6B 1ZHRA 5CHAC 3RXGA 1ELDE 1K1MA 1FNIA 3SU3A 3EA9A 2BQWB 1V2VT 4IC6A 4OM9A 3A89A 2VVCA 1C5VA 9LPRA 2HOBA 3F9HA 2HNTF 1QBVH 2VH6A 5EQQA 1Y5AT 4Q7ZA 2Y81A 5TCAA 7KMEH 1Z71A 2HLDD 2Q6FA 1A46H 4ISHH 2VIQA 4CRFA 1H8HD 1HXFH 2A5AA 1SGQE 4JK5A 3V7TA 1GJ8B 3EGKH 4K3JA 1MQ5A 3MFJA 4DURA 2B9LA 4AG2A 5E2OA 1VGCB 1H8IH 4Z6AH 5E8EH 1XMNB 3T5FH 1V2QT 1BRAA 4MPWA 2F43B 3EAJA 3O8DA 3I77A 5G4BA 1ETRH 1LQDB 1SR5C 1FN6A 1UW7A 1O2ZA 1NN6A 4KP0A 3E0NB 1SSXA 1SQAA 1YCPK 1OYTH 2BDAA 4JYVH 1YCPM 2QXJA 1QA0A 3M35A 2IOTA 1YP9A 2XNDD 4GUXA 3ZVGA 3MH5A 1BDAA 3OY6U 1SOZA 1DXPA 4ISNA 1XUKA 1GG6C 2P94A 2O9QA 4A5TS 3VB3A 5C17A 1N1LA 2CV3A 3V12A 3QGNB 1NPMA 1BTPA 3SU0A 3DT0H 2Q6GA 3U8RH 1A3BH 3TH3H 3ZIAD 4FXGH 4CHAC 4CREA 2VH0A 1AUTC 4Z1MD 5TJXA 1TGNA 2F4LA 2GT7A 1OSSA 5HMAA 1KY9A 3LJOA 4NIWA 1C2LA 5LPEA 1UK4A 1INCA 3F9GA 3MO9A 1O2IA 1LMWB 1O3JA 1GBDA 1UJ1A 5JBCS 1P12E 2VIDA 2FTLE 2J94A 1P2OA 2ALVA 3OY5U 5A2MH 5BPEA 2V6NA 4OS1A 1SLVB 1ZR0A 1WXRA 1IAUA 2Z9IA 3H7OA 2AGGX 2TGPZ 1SGFA 3M7UA 3P92A 1EKBB 1YF4A 3I78A 2OQUA 4NA8A 2ZU4A 1GCTB 4Y0ZE 1BUIA 4JK6A 1G36A 1OKXA 4MPVA 1L4ZA 1SGDE 1XXDA 1YPLH 1PPFE 2I6SA 1C2KA 2ANWA 1TLDA 1ZTKA 3VXFH 1KXDA 1C1VH 4DOQA 3RXEA 1C4Y2 1LCYA 1ANCA 4TWWA 4X2WA 3M61U 1H8ED 4I32A 4CRGA 4D76A 4ASHA 1DANH 4YOIA 1OYQA 4XFQA 1EJNA 3B9FH 1GJAB 1B5GH 3RC4A 3GCTG 2OBQA 3ZVEA 1MD7A 1QA7A 1ZHPA 1LPGB 1EZXC 1YLCA 2YMSD 2Z3DA 1IOEA 1ZOMA 1FLEE 2R3UA 4FUGA 1UTOA 2Y5HA 3AAVA 1TMUH 3RMMH 3SJ8A 3ZVDA 5LH8A 2AGEX 2BM2A 2HGTH 4FVDA 5GIBA 1E34B 2C8YB 1O2MA 1ZSJA 1TNJA 1AGJA 1QIXB 1P8VC 3PO1C 2BLVA 1TE0A 3UOPA 3LC3A 5DP7A 4F4OC 9ESTA 2VU8E 3FN8A 2THFB 1GI1A 2XBXA 3BEUA 3F2GA 2BDCA 2FTMA 2J97A 1Z6EA 8KME2 4THNH 1FX0B 3M5NA 4CRBA 4BTIB 3VB7A 3RLYH 4ZHLU 1MAYA 3UR6A 1D3PB 2CJIA 2VWMA 1Q2WA 3EA8A 1SPJA 2UUJB 5EJ1A 1F0UA 4GVUA 8GCHF 1H4WA 3GY4A 2TIOA 1HIAB 1QNJA 2GMTB 1MZDA 1UCYE 5T6GA 1TFXA 3S9AA 1E79D 3R3GB 1C5TA 4Q7YA 3SU6A 3SHAH 3B8JA 1GDUA 3PTNA 1AN1E 1UTJA 1BA8B 1W0ZU 3RU4T 1EB2A 4AB9A 2ZFQH 1SG8B 3RXSA 3S9CA 3MNXA 2QGRA 1PPGE 1V2PT 3CENA 4INLA 3KQDA 3TK9A 3UWIA 4H4FA 3KN2A 4OS6A 4BAOB 1S84A 4A1TA 1UTPA 1YYY1 2QN5T 4RN6A 4Y79A 4DJZB 2ZG0H 3ATMA 4IMZA 2WV9A 3S7HB 2KX4A 4X1SU 3KIDU 2ZNKH 4F55A 1DWBH 2GDEH 3DSPA 1EATA 3LPRA 4I8GA 2P8OC 1OPHB 1FIZA 2F9BH 1ANEA 1QB6A 1G3EA 1Z8IB 1H9IE 1VJ9U 2CN0H 3ZZDA 1LHDH 4Y6DA 4DVAU 4BXSA 5JB9S 2VIOA 2ZPQA 5GCHF 2ZFSA 2OLGA 2KFWA 2NU3E 3DSGA 1MTUA 1GJBB 2XXLA 4DGJA 3NRLA 4DT7B 1CU1A 2O8TA 3MU8A 3Q77A 1QFKH 4K69A 4D8NA 1CHOG 5EGMA 3M5OA 3BTEE 1OWJA 1HV7A 2HPQH 3SU2A 1PQAA 1MH0A 1EZSC 1D6WA 1TONA 1GBCA 2KCAA 4TY7A 5C20A 1KXAA 1W11U 2QCYA 2LNCA 4TYDA 1RTFB 1B0FA 1YKTA 3N99A 1EQ9A 1F5KU 1GJ7B 5FBIA 1E35B 1NT1A 1P57B 4BAHB 1HIAA 1TOCB 1J14A 2EQNA 3DUXH 3F3BA 4AFUA 4CR9A 5IDKA 3I29A 2FP7B 3GY5A 3URDA 4BAKB 2FOBA 4NCYA 3W94A 5JB8S 1D3DB 1Z8GA 2F9NA 1FAXA 2J5UA 3MHWU 4IN1A 1CO7E 4ZROA 1SQRA 3RXMA 2BXUH 4X1PU 1BTYA 1J17T 1QQ4A 3T25A 3UQVA 1TNKA 3BTME 4MNWA 2AHME 4DG4A 1S85A 1TWXB 1DFPA 3M3TA 1BMFD 1THPB 1V2OT 3BG4B 3OFND 5EQSA 1AIXH 3TJVA 2AGIX 3LONA 3RM2H 1GHBF 3RXPA 5JBTA 3L3TA 4CRDA 5FPTA 1EB1H 4GHTA 2P16A 1V6DA 1G3BA 1BTUA 1K21H 2PSYA 3ELAH 2BOKA 3TJUA 1AKSB 2C93B 2CGAA 3UUZA 1AI8H 2ZU3A 1IHTH 3VGCC 1LVBA 3RMNH 2GV7A 2K8IA 1Y8TA 2A45B 3BSQA 1GWAA 1MUEB 2ZKSA 1LVOA 3M36A 3MU0A 3NCLA 1A3EH 3V13A 1ELFA 2G52A 2KM0A 5EPYA 2FIRH 1GVZA 2V0BA 1DY8A 3F9FA 2A1DB 3QUMP 2A31A 5C2ZA 1ABIH 1TBQH 2ZTXA 4KTCA 3BTFE 1QJ7B 1ARCA 2XOKD 3SGBE 2GCTB 2XC4A 2V7QD 2G55A 2BZ6H 1LHGH 2UWOA 3ZYEA 2ZTZA 5C1YA 4X8UH 1NRQH 2GD4B 1S5SA 1MKWK 1UHBB 2P59A 2PKSC 2ZU5A 1GHYH 1TBRH 3NUMA 1UVSH 3K9XB 1C5PA 3MH6A 4X1NU 2FOAA 4NGAH 2J2UA 1KTTB 3DD2H 1SGCA 2J92A 3PRDA 1Z1JA 2ZDMA 2QIQA 1S81A 4X6MA 1C1MA 2RCEA 1Z8JB 2G4UA 3A8CA 2C8XB 5C67A 1FN8A 2Y6TA 1NRNH 1RTKA 1PYTC 2OC8A 2XC0A 4KGAA 2VWOA 3LU9B 5K0HA 4ZH8A 3RC5A 3BTTE 4FUFA 4FUCA 2C8ZB 2ODYB 3SV7A 2FOCA 2M2AA 1F0RA 1C2FA 3GYLB 4A7IB 2BTCE 1ACBE 2A0QB 2BXTH 1C5LH 4GCHG 1H9LB 1V2WT 2FLRH 3SW2B 4TPIZ 3A87A 3ZVBA 1TX6A 4K2YA 1YC0A 2OINA 1NRRH 1BIOA 1VCQA 1VCWA 1C1QA 1SGIB 1SGNE 1P05A 2ULLA 3FOAA 1MBQA 3QTVH 2K0QA 8ESTE 3IWMA 1O3HA 1AKSA 3MYWA 5CDFE 2H6MA 1W7XH 4UD9H 1O37A 2GCTC 4LZ4B 3SQHE 1V2KT 1GBAA 2XBVA 1WBGB 2AS9A 2BY7X 1C2HA 1C9TA 3PM3A 1CQQA 6CHAB 3B23B 1O2VA 1P2NA 1BCUH 3OYPA 1B7XB 3GCTF 1CSOE 3SV8A 2BVXH 1DVAH 1AMHA 1GGDB 2WPHS 2J9NA 1QY6A 1QCPA 5TCCA 2J4IA 1SGPE 3TH2H 1AUJA 1WQSA 3P8OA 1UHBA 2KCYA 3UFAA 3AK5A 1UMAH 2QF4A 1QRWA 1QRZA 4XBDA 3UTUH 1OS8A 2ZDKA 4WF8A 4HI3A 5H4IB 4NG9H 3RXHA 1FDPA 4OS5A 2P3FH 2XW9A 3SV2H 4MLFB 4B75A 4NWKA 1BMLA 3HGNA 1W13U 2L74A 3ZZ8A 1ELVA 1BHXB 1HXEH 1G32B 5C5NA 4K1SA 2STAE 2OCVB 5A8XA 2BZAA 1W8BH 4AGJA 2D1JA 4JYUH 3MWIU 3A86A 3KQBA 2A4QA 1RXPA 1QQUA 1HAYB 2VNTA 4WH8A 4Y71A 2H9HA 1P06A 2ZI2H 1LO6A 1SFQB 4DY7B 1IQMA 2BLWA 1DE7H 1O3PB 1BZXE 5CHAB 3FZDA 4ZKOU 1D6RA 1XUGA 3UAIC 4DIIH 1UTKA 4E05H 3LGVA 1NS3A 2DUCA 4UDWH 2F9VA 2A5IA 5ABWA 1SHHB 2HVXA 2OK5A 5JBBS 2H9TH 3QZRA 1O3EA 1ELCA 3DA9B 1GJ6A 2JETC 1XKBC 1X7AC 2ZF0H 3U8OH 3SN8A 4CBNA 2BDYA 1D3TB 1H9HE 2B5TB 1TYNA 2CF9H 2TGTA 2WYGA 4AC9A 3STIA 2SFAA 3SNEA 3ZZ9A 5GJ4B 1D4PB 5CE1A 1O2LA 1TGBA 5GCHG 3QN7A 3URCA 3RXTA 2R0KA 1QL9A 1CBWB 5F8XA 3UNRA 3NPSA 2DE9A 1WUNH 3OEHD 1EJMA 1RS0A 3QDZB 3UNQA 2VJ1A 1ZTLA 5ESBA 2ZGHA 2FI3E 2ZO3H 4B2AA 4D9QA 1DLEA 2HNTC 1O2JA 2CXVA 5C0UA 2FS8A 3CNRA 2FWWA 2H9EH 3PROA 1HFDA 1JOUB 1A1RA 1GHVH 2HNTE 2RG3A 2PSXA 3P8FA 3A85A 3SJ9A 5FBEA 1JRTA 2VBCA 1Y5UT 2BHGA 4WJG2 2QF3A 3ITIA 3MH7A 2FMJA 2V3MA 5B6OA 1LPZB 3VXEH 1PQ5A 4YOGA 1E37B 1O5EH 1GJCB 1UCYK 1CHOF 5AFYH 2QF5A 2Q1JA 1LPKB 4UFFH 1NFUA 3TJOA 4YM9A 1BB0B 4SGAE 4X6OA 4YT7H 2GCHF 3SGAE 1YWUA 1FQ3A 3ZVCA 1AZZA 1LHEH 3MU5A 1O2UA 3UY9A 4CHAB 3RDZA 2VVVA 1WDIA 1K1NA 1COWD 1GHBG 3F6UH 5HXFA 2UUKB 2FZZA 1O33A 1BMAA 2YNBA 3M37A 3GDUA 5GDSH 1RIWB 5DGJA 1CBWC 3FANA 3MQKC 4ZAEA 2QXGA 4B1TA 3LOXA 3PV4A 5DG6A 3RXIA 2PGBB 1YLNA 4TT3D 1W12U 4MTBA 3SJOA 4Q2KA 2WZQA 1EAXA 1HAVA 2GP9B 3LH1A 2OC0A 2WPDD 2QV1A 1O5DH 2P3TB 2WINI 3EE7A 3KCGH 1ZZZA 1P0SH 4NSVA 1UVPA 1P04A 5DP8A 1DDJA 3LKWA 2VIVA 1G2LA 3U28C 3C1KA 4JZDH 1IQGA 2PHBA 1ZGVA 1W7GH 1WTGH 2XCNA 4XDEA 1DM4B 2LP6A 4KELA 5HKKD 1L4DA 2ZFTA 5LPFA 4CRAA 1UO6A 3RXKA 2YOLA 1GJDB 3QWCH 3M7QA 3ZZAA 4D9RA 2ZQ2A 1L1GA 4I8HA 3SJKA 1QJ6B 3NK8A 4E7RG 4J2YB 3F2FA 4FUHA 1AFEH 3OSYA 2ZFRH 1F7ZA 4WVPE 1ELAA 1IHSH 4IMQA 3S0NA 1HRTH 3VB4A 1C5ZB 4MNYA 3QO6A 1W0KD 1DSUA 1NRPH 1BBRH 1NBMD 1P2JA 2FOEA 1PQ7A 3H09A 1AB9C 1P10A 4X0WU 4ISIH 3M5MA 4FOUC 4B2CA 2JKHA 1P3CA 1OP8A 3Q76A 3PO1B 1RIWC 2C4FH 3ZV9A 1C1UH 1ZRBA 2FO9A 1NC6A 2ZDNA 3FAOA 3MTYA 1SHYA 1EOJA 2G81E 4ABDA 3LC5A 3RC6A 2ZHFH 1T8OA 3MMGA 1GBFA 3TIUA 3AAUA 1Y59T 3GY3A 1BMMH 3UB0A 4ABGA 1O2HA 2Y5FA 2VWLA 2VIWA 1FY4A 2AIPA 3AASA 5IYTA 4Y8YA 2PUXB
chains in the Genus database with same CATH topology
4I31A 1EPTC 2BB4A 2P3UB 1FPCH 1TA6A 2Z94A 2ZTYA 2BD3A 2G5NA 4X2XA 4X2YA 5J4SA 1P03A 1GDNA 2XC5A 4GCHF 1OWEA 2OQ5A 1WYKA 5E0GA 1ZGIA 1SGRE 1AE8H 3NXPA 1W0YH 3SI3H 4I8LA 1C5MD 1N6YA 3PMJA 2QYIA 5FCKA 3U9AH 1XM1A 1LHCH 1HJ8A 4ESTE 1Z7KA 1QB9A 1V2TT 4ZKNU 1CE5A 2W3IA 2ZHEH 5AFZH 3U98H 2A2XH 3U1JB 2P8OB 3ODFA 3MH4A 1ZMLA 3BEIB 5C3NA 1O3DA 1ARBA 3KNXA 2BYAX 1JWTA 2CHAC 1IQFA 2ZHWH 1FY8E 1OWKA 4OGXA 1FPHH 3ZZ4A 4CH2B 1BQYA 4IS5A 1NM6A 4B71A 3OX7U 2XRCA 1EP5A 2M5TA 1LHFH 5EOKA 5EU8A 2YNAA 5DP3A 2KAIA 2V3OH 3TGIE 2HRVA 2ALPA 3A7YA 2Y5GA 1WTHD 3ZZ3A 1UVUH 1ELBA 1RJXB 1YPMH 5ESTE 1G3DA 2G4TA 4INKA 1NTPA 1HJAC 3A84A 1O2QA 5T6DA 5EXLA 2ODQA 4B73A 5JBAS 2AERH 1YPEH 2BDGA 3ATWA 4AB8A 1MMJN 4O3UA 5F8ZA 1EXFA 3STJA 3OTJE 4WMFA 1O5AB 1SB1H 2GTBA 2XWAA 3VEQB 2V35A 2ANYA 5DJ7A 1EAUA 3FVFB 3PWCA 1FIWA 2PGQB 1O39A 2HALA 2R2WU 3D49H 3TH4H 1A4WH 3T2NA 4A92A 1PPCE 2FYQA 1SFIA 3MI4A 4Y8ZA 1ORFA 1DWCH 5FX5A 4BTUB 1WCZA 4I8KA 5PTPA 1EP6A 2BD8A 5I25A 4HGCA 4ABBA 3BEFB 3TNTA 1W2KH 3OU0A 1MTNC 1KLIH 3KF2A 1T8LA 2VWNA 4A1XA 1T4UH 3GY2A 3MOCA 4MNVA 3ZVAA 5DK1A 4AG1A 1XX9A 1IQJA 1AQ7A 1ZPCA 1Y3YA 3EYDA 2RA3A 2W26A 1UK3A 3VGCB 2FOGA 2UWLA 1VZQH 3GCNA 4UFEH 3KQEA 2GCHG 3ZYDA 1C5WB 1GBEA 1UVOA 4WY3A 1GI3A 1UTNA 3EA7A 1V2UT 2TRMA 2PW8H 2ZDLA 4JZ1A 4GSOA 3CS7A 1GMHG 1C4U2 1S82A 2GZ7A 2ZP0H 1O5BB 2NWNA 1ESAA 1HAZB 1Z8RA 5GWZA 2ZHQH 3PLPA 3RXAA 2UUYA 2DE8A 4X6NA 1ZMNA 3TK5A 1TPAE 1ANBA 1A0JA 4HFPB 1FI8A 1XVMA 4AZ2B 1V2ST 2UUFB 2Z9KA 2OD3B 3PMAB 3UQOA 2PKSB 1O30A 1MKXK 3BTGE 1MU6B 1JIRA 3GISB 1UK2A 1ZJKA 2PR3A 1C5UA 1J8AA 3JZ1B 3K65B 1J16A 4ZMAH 4AYVB 1ELTA 3TNSA 3HK6B 1HCGA 2IN2A 1BRBE 1TPOA 3G01A 3QGJA 1DXWA 3DHKH 4TWYA 1HB0B 2F9PA 1QR3E 4KKDA 1YCPH 1ABJH 5E2PA 3SI4H 3M7TA 2C8WB 3P70B 1P01A 1XUHA 2ZA5A 4D7FA 3EQ0H 1C1TA 2BDBA 3ZVFA 1IQIA 2ZGCA 5HM9A 2C90B 1O38A 2SGDE 4Z0KA 2I6QA 3T26A 1PFXC 1GMDG 2VIPA 4AYYB 1OWHA 2UWPA 3Q3KA 1TNIA 2BY6X 2AH4X 3Q3XA 2SGQE 2SNVA 2XWBI 3O8BA 3BN9A 4Y10E 4JZFH 1BMNH 4YOJA 3GCOA 1FXYA 3MU1A 4XSKU 4ZXYH 6ESTA 1Y5BT 1Y3UA 2NU1E 1SMFE 3PLKA 5C1XA 2NU2E 3MU4A 1K22H 1O5GH 1CA8B 4YLUA 2W7SA 1HBTH 1KLJH 2HPPH 1GI2A 3TGJE 4FUDA 2D8WA 4DCDA 4BNRA 2WV4A 2BOHB 5L6NH 1YBWA 5A0CA 1G9IE 2GV6A 4XOJA 4LK4A 2JH5D 1CT2E 4PROA 1C2JA 2J95A 4FU9A 3MO3A 1KXEA 4IN2A 4HZHA 2EI8A 1LKAA 3RMOH 2HWLB 1KXBA 5JPMH 1PPHE 3VPKA 3CP7A 2BD4A 2F9OA 4K60A 2AFQB 2BY9X 1C5NH 3TK6A 2AYWA 4B74A 1CGJE 1A2CH 3A7WA 1C2EA 1OP0A 1LVMA 1FMGA 1BJVA 1C5SA 1S83A 7GCHF 1ESTA 1NFYA 3PWBA 1VR1H 1GBTA 1O3AA 1Y3WA 1SL3A 2B8OH 1T31A 4YO9A 3RXQA 3TU7H 4CBOA 8LPRA 1GHZA 7LPRA 1MAXA 2ZIQH 3PTBA 3VFEA 1L2EA 1O5CB 2FOHA 1GI4A 1NY22 1MCTA 2GVFA 3RU4D 3Q3YA 3M5LA 1SQTA 1SGFG 4OGYA 1QBNA 5DP4A 1ZLRA 1O36A 1CA0B 3RXVA 1MD8A 1GHXH 5FX6A 3L33A 1OWDA 4U30A 1FONA 2OUAA 4K8BA 3IITA 1ZTJA 1O31A 1ZPBA 2JETB 2ZC9H 4RKJB 4KTSA 3BTHE 1KLTA 1O3BA 2Y7XA 1ZHMA 1O3CA 1PQ8A 2OC7A 3BG8A 2Z9LA 4WWYA 1FZZA 4UONA 2BX3A 1WSSH 4FU7A 3A7TA 3SU5A 2ESTE 1QB1A 1ZMJA 3GY7A 4O9VA 1GCDA 2O8WA 3F1SB 2WPKS 1TGSZ 3C27B 5F8TA 2Q6DA 3MNCA 4WH6A 1SGEE 3TGKE 2GZ8A 1XUJA 4I7YH 1XUIA 1E0FD 3H7TA 1K2I1 5SGAE 5EW1H 1FAKH 2BDIA 3GDSA 1O32A 4UFGH 1G2MA 2JH0D 3SO3A 2R3YA 1HLTH 1XVOA 1Y3VA 5AHGH 1S6HA 2ZU1A 1TNGA 2WUCA 1A5IA 2SNWA 2R9PA 3Q00A 1ETSH 3RM0H 1A0HB 1HGTH 3SU1A 1HAPH 1LQEA 2Z6BD 1KTSB 4R8TB 2H1UA 1C5QA 1V2JT 4ZHMU 5FHTA 3SU4A 5CMXH 2FYRA 1QJ1B 1CA0C 4Q80A 2BD7A 5AF9H 2FI5E 1WV7H 3PB1E 2H5CA 1DLKB 3T28A 2ZZUH 3ZZBA 1K1JA 1DSTA 2H2ZA 4O3TA 1A5GH 2BY5X 5L30H 1HAVB 4O03A 1VCPA 2BQ7B 1DWDH 1GL0E 1SLXB 1RD3B 3SNBA 2D26C 2GZ9A 1O2OA 1TB6H 2JH6D 1AWHB 2QA9E 2WPMS 3LGYA 2VGCC 2SGPE 4ZKSU 5FPSA 3GY8A 2BD5A 3HGPA 2WUBA 3ZZCA 1NFWA 4M7GA 3UIRA 3P8GA 2QC2A 1TALA 1XUFA 4F49A 1FV9A 1AE5A 1O34A 4ZHAA 3E6PH 1CGHA 1F5LA 1GI5A 4CRCA 2W5EA 1AD8H 2A7CA 2ZDVH 3GCHC 3U69H 4IBLH 3SQEE 1UTMA 2ASUB 1DT2A 1QGFA 4WMDA 3CS0A 2ZEBA 1DUEA 1GPZA 2BD9A 1EX3A 1NU7B 3HATH 3NKKA 1Y3XA 1GHWH 3A7ZA 1G3CA 1NRSH 3BF6H 2FI4E 1GI0A 1FY1A 6GCHF 1OP2A 1JRSA 2C3SA 3P6ZB 2SGFE 4X8SH 4XBBA 1DUAA 4NFFA 1KXFA 2F3CE 2CF8H 2LPRA 3BV9B 1YLDA 1KXCA 1GMHF 1ETTH 1GJ9B 3M3VA 4UE7H 1F92A 1NZQH 3O8CA 4NIYA 1AB9B 2Y82A 4INHA 2PLXA 4U01A 1RRKA 1P2KA 4OS7A 3D23A 3FZZA 3UWJH 4VGCC 6LPRA 1A5HA 4ABEA 2ZGBH 1TMTH 4FUIA 1AY6H 1ELGA 3AW1A 1L1JA 4AGKA 3RXJA 1TRYA 2ILNA 1BBRE 3ZZ5A 2ZCHP 4FU8A 4NA7A 1NESE 3EDXB 4NIXA 1L1NA 1AFQC 1DY9A 1O2TA 4H6TA 3U8TH 2BD2A 1BHXF 1BTXA 1YM0A 4MNXA 4AFZA 4U2WA 4ZXXH 2A4OA 3H5CB 1XXFA 1ZSLA 2XNIA 1TMBH 2OBOA 5E0JA 4AOQA 1K1PA 1M9UA 2FESH 1EPTB 1T32A 4Y7BA 1LVYA 3F68H 3ESTA 3U1IB 1OOKB 4ABHA 1SVPA 1DITH 4DW2U 2F83A 3QLPH 4AX9H 3SUDA 2FODA 4ISOA 1GMDF 4YESB 4MDSA 2P95A 1MZAA 1TNLA 4X8TH 2F9UA 2HLCA 1MKWH 4IC5A 2O8LA 4NA9H 4LOYH 1TABE 3W95A 2RDLA 3DFLA 2J38A 3A81A 4ZUHA 4YZUA 2TGDA 1GVLA 3WY8A 2NU4E 1Q3XA 5A0BA 3RXFA 4BTTB 1C4V2 4JMYA 1O3LA 1V2NT 4MPUA 1O3OA 3BTQE 1HUTH 1O3IA 1T8NA 1P2MA 3KEEA 7GCHG 4I33A 3QZQA 2KAIB 2PFEA 1SGYE 3SNCA 1C5OH 3L6PA 3ZV8A 2R2MB 2GGVB 3SNDA 2FX6A 1HAXB 2G51A 3GICB 4ZKRU 1YPJH 2CHAB 5EQRA 3SNAA 4H42U 5L2YH 1OX1A 1GL1A 3ATIA 4JCNA 1EASA 2BLQA 2VINA 5HGGA 1FY3A 4D7GA 5T6FA 2GT8A 4ABJA 1J9CH 5EXMA 2BDHA 1VGCC 1PPZA 3PYHA 4X1QU 1GBHA 1U6QA 2FLBH 1O5FH 3RXBA 4NZQA 1HAGE 4GPGA 4J1YA 1AU8A 1PPBH 2Z3CA 1SI5H 3ENSB 1C1PA 3EE0B 1LDTT 3FP6E 1HJAB 1VITF 5FAHA 1J15A 3LH3A 1O2GH 3FP8E 3A8DA 2ZDAH 1GMCG 1GBIA 2ZWLH 5A09A 2ZFPH 2ZPRA 2AIQA 4Y0YE 1EPTA 1TGCA 3LGUA 4TY6A 4Y11E 3RLWH 1GI8B 3TVJB 1CT0E 2J34A 1BT7A 4ABAA 1W14U 1RFNA 1S0QA 1JBUH 2ODPA 2ZECA 1TRNA 1VITH 1GHAG 3ATKA 5K7RA 3E91A 2SGEE 3SJIA 1O35A 1TQ0B 4H6SB 1GI7B 4OS4A 1MTSA 3T62A 5EODA 1CT4E 5C5OA 3M3SA 1WQVH 3E0PB 2K1QA 4O97A 1AO5A 2BLOA 3GYMA 1HAIH 3LGTA 1P02A 1IQNA 2G00A 2EA3A 2IJOB 2PV9B 2BVRH 1O2KA 3PMBB 4X6PA 1AZ8A 1MTNB 1P2IA 1BTZA 5EPNA 5EG4A 5HYOA 1IQLA 1C1SA 2ZU2A 1K28D 4OS2A 1N8OB 1SQOA 2FEQH 1H8DH 5DP9A 1JXPA 1KDQB 1JIMA 3SHCH 2GX4A 5A0AE 2WPLS 1O2WA 2H5DA 5DPAA 3BTWE 3LGIA 3ODDA 1K9OE 1GCTC 3HKIB 4X8VH 3V3MA 1NO9H 1EUFA 1IQKA 1TGTA 2GDDA 2ZFFH 5EXNA 3P95A 4ABIA 5L2ZH 2XTTB 4BXWA 1THSH 5JYIA 3LIWA 3N7OA 1E38B 3TJNA 2EI7A 1SOTA 1VJAU 1K1OA 2ZGJA 3K6YA 3MNSA 1C2DA 4AORA 4K5ZA 1EAWA 1V3XA 3A83A 4BANB 4IW4E 3SV6A 3MO6A 5FXLA 2A4GA 4LXBH 1C5RA 1K1IA 1ZJDA 3KQCA 2OXSA 2AMQA 5JDUB 1GBKA 3SUFA 2SGAA 1C1OA 2XCFA 1BJUA 4SGBE 1MCVA 1NU9A 4ISLA 4E7NA 1WU1A 3V0XA 2A32A 1BTHH 3SV9A 4IGDA 5FPYA 2A7HA 3K6ZA 1DS2E 4B76A 1A0LA 1PYTD 4XE4A 1QL8A 1N8OC 4WMEA 1HJ9A 4R0IA 6GCHG 1KSNA 3E1XB 3VB5A 3LT3A 1C2GA 3QK1A 4GLYA 3T29A 4A6LA 1SLUB 2G5VA 1BRUP 1EZUC 1O2PA 1UCYH 1O0DH 2XBYA 3GDVA 1PJPA 1TRMA 4NSYA 1CGIE 1W3CA 1B0EA 3PMHB 4BOHA 1AVXA 1YPHC 2VB0A 4BAQB 2BVSH 1D3QB 1GBLA 1EJAA 3SORA 1EAIA 5J4QA 3LGWA 1YPHE 1O2SA 1BOQA 1T4VH 4GAWA 4YTAA 1TA2A 2GMTC 5F03A 2VVUA 2PTNA 1P2QA 3A8BA 1KDQA 2XBWA 4B2BA 3QTOH 1XKAC 2Y7ZA 1O3GA 5ETXA 2PKAB 2QXIA 2XYAA 1EOLA 1TPPA 3FP7E 4YT6H 1GI9B 2ZPSA 5A8YA 1HDTH 3GOVB 4RKOB 1DICA 4XBCA 1DWEH 2ANKH 3HPTB 3UOUA 1C9PA 3GY6A 1DOJA 1T8MA 1ID5H 3RMLH 4Y7AA 4MVNA 1P09A 2ZHDA 1Q31A 5E0HA 3E3TA 4K8YA 1WAYB 2G8TA 3NZIA 2Y80A 2TBSA 1F2SE 2O8MA 4CH8B 1HYLA 2ANMH 2IPHA 5A8ZA 3A7VA 5DP5A 1ZSKA 4Q7XA 2EC9H 3K2UA 1E36B 1G30B 1P3EA 1WOFA 1LTOA 1GJ4H 4JYTA 1F5RA 4FUBA 3RXUA 5HM2A 3T27A 1C5YB 4QT8C 1IQHA 1L0ZA 3TLOA 1GBJA 2Z9JA 3E16B 4Y8XA 5I46H 2AEIH 3KL6A 1O3NA 1QBOA 3S69A 2D2DA 3BTDE 3A80A 2STBE 5DO4H 1YGCH 3A7XA 1YPGH 2QXHA 4AN7A 3RXLA 4TPYA 4DIHH 1KIGH 1SBWA 1O2YA 1MBMA 2AMDA 1K1LA 4UEHH 3BTKE 1O3MA 3FFGA 3R0FA 3LDXH 2CMYA 1AWFH 1AVWA 1MTWA 2PKAA 1TBZH 1BRCE 1GBBA 1T7CA 5C1UA 1ANDA 1F0TA 5AVDA 1BBRK 1OWIA 1QHRB 1TX8A 2EI6A 3E90B 3KHVA 2A2QH 2V3HH 1UTLM 1S6FA 1VITG 3BG4C 1IQEA 1TX7A 2FM2A 1TAWA 1QRXA 2A5KA 2QAAA 2RA0A 3LJJA 3S7KB 3O8RA 1S0RA 4NZLA 3AW0A 2TPIZ 4U32A 1C1NA 1C2MA 1GDQA 1ZPZA 2EEKA 3HK3B 4FVBA 1AVGH 2ZCLP 3A82A 1FUJA 1ESBA 2WYJA 1QURH 1TNHA 3HKJB 2AMPA 3UPEA 3SOSA 5FCRA 1ZRKA 2OP9A 5EW2H 4NWLA 3F9EA 1LKBA 2O8UA