3KHVA

Crystal structures of urokinase-type plasminogen activator in complex with 4-(aminomethyl) benzoic acid and 4-(aminomethyl-phenyl)-methanol
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
246
structure length
239
Chain Sequence
IIGGEFTTIENQPWFAAIYRRSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSAAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Urokinase-type Plasminogen Activator in Complex with 4-(Aminomethyl) Benzoic Acid and 4-(Aminomethyl-phenyl)-methanol
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 55
structure length 239
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3khvA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3khvA01
1TALA 1Y3XA 2BDHA 1YC0A 3A7VA 4ZKSU 3LGIA 3PM3A 3DA9B 3LGUA 3I29A 5DP6A 1ZTKA 1KXDA 3RXCA 1P0SH 3U8TH 1OYTH 1HJ8A 3FAOA 3N7OA 1YPKH 1O36A 3SV6A 1SI5H 2FOBA 5JBAS 4ABGA 1CHOF 4MNVA 3DD2H 1MCTA 1S85A 1ETTH 4Y8ZA 1C2IA 2O8WA 1ZZZA 3BTDE 4DJZB 1LPKB 2O8TA 2QIQA 1LHFH 5EPNA 3V13A 1D3PB 3JZ1B 4K2YA 3CENA 2GT8A 3ZYDA 1C2EA 2PW8H 4BXWA 1OWDA 3MHWU 1P11E 1BA8B 1C2MA 1HJAB 3P8NA 3GISB 1P2IA 2BZAA 1FY5A 1TB6H 5C67A 4LZ1H 1TNIA 2GX4A 5CHAC 5A8ZA 3MO3A 3SU2A 2FXRA 1SLVB 2F9OA 1BUIA 1INCA 3RXSA 4NA7A 1GBAA 1JRSA 1B0FA 2CGAA 3MYWA 1HAZB 1YLCA 4JK6A 1NZQH 4XDEA 1EJAA 3A7YA 4I8JA 1LO6A 1PPBH 3BTHE 3Q00A 2FP7B 4Z0KA 1MTUA 1OWKA 3RXBA 2R2WU 5AF9H 2AGEX 5LPRA 4GHTA 5LGOA 2OBQA 1W2KH 4FUHA 2A5AA 2A7JA 2Q6GA 1C4U2 2PSXA 3ZVGA 1JIMA 1V2RT 2ZWLH 2XBWA 8GCHG 4UFFH 1PJPA 5EQQA 1YPHC 4I31A 4E7RG 1MD7A 4D9RA 1OP0A 3S9BA 3KF2A 1UMAH 4DURA 3DFJA 1GBHA 1OPHB 1AI8H 4A1TA 3NWUA 1MKWK 3ZV9A 1HUTH 1DWDH 1QCPA 1HAHH 5JB9S 3B23B 2WINI 2ZDVH 3EYDA 1GMDG 2F9VA 2A4QA 4I33A 4JYTA 1O33A 4MVNA 3M7QA 1NFXA 3LJJA 3F68H 5A09A 1MAXA 4TY6A 1GI1A 4A1XA 4SGAE 1EKBB 1WBGB 3UUZA 4YZUA 1ZMJA 3QGNB 5DKMA 3CS0A 3ZZ4A 1IQGA 3KCGH 3UWJH 1UHBA 5J4QA 3STIA 1GMCG 1XUIA 2BQWB 3IITA 1K1NA 1EAIA 2IN2A 3T25A 1SQOA 3TU7H 3URCA 2QN5T 3VFEA 1M9UA 5I46H 2FEQH 4ABJA 2JH0D 2VVVA 1V2MT 1C1NA 1FIWA 1OOKB 4Z6AH 4AB9A 1IQEA 4U2WA 2PGQB 2BYAX 1ZJDA 2B5TB 2CXVA 2XYAA 3Q3YA 5GDSH 4LOYH 2ODYB 1C1MA 4AYVB 1TOCB 3RLYH 1TPAE 1XVOA 3K2UA 3A8DA 4NFFA 3S9AA 3NCLA 1KXEA 1O2VA 1TBQH 3SOSA 3QTVH 3SQHE 1Y3VA 2ZU2A 1A5HA 2KAIA 2BQ7B 5GJ4B 1JRTA 2Z3EA 1RGQA 1BMMH 2BVRH 1T4UH 2NU4E 1ETSH 1SGYE 2Y7ZA 1ACBE 4AFUA 4ISNA 3RXLA 2G5NA 3SGAE 1P2NA 1PYTC 1GI7B 1A0HB 1SSXA 2VIQA 4YT6H 3NUMA 1O5EH 1Z1IA 3UTUH 2TGAA 5FCRA 1H9IE 4NFEA 6LPRA 4MPVA 5FBIA 1MQ6A 2OINA 2OXSA 1A46H 3EA9A 2ZU3A 2ZKSA 3F6UH 1ANCA 1WTGH 2HPPH 4R8TB 3M3VA 1H8DH 2ZPRA 2BD7A 3AW1A 4OS6A 2ZFRH 4MPUA 1P2QA 5L6NH 1K1MA 1GMDF 2GV6A 2TIOA 1EATA 3E91A 1HAVA 5C2ZA 3KHVA 1Z71A 5T6FA 1SC8U 1ZPCA 4I8LA 1AUJA 3RXRA 1D4PB 1C2FA 1YF4A 1B5GH 1L1JA 1UVUH 3QZRA 4I8HA 5G4BA 2O9QA 1BHXB 1T8LA 2OBOA 2XRCA 1OWEA 2IOTA 3RMLH 1F7ZA 2HWLB 7KMEH 1B7XB 2J2UA 1O3DA 2FYQA 1SG8B 1DY8A 3C27B 2P59A 4CRBA 1HJ9A 1O2PA 1QURH 5DPAA 3ZZBA 1HGTH 1NN6A 1GDQA 3A7TA 3MO9A 1Y3WA 3TK6A 3A8AA 2BXUH 1C1VH 1BTHH 4GPGA 3R3GB 3RU4D 4NWKA 5BPEA 2ZO3H 1MTWA 2ZTYA 4NGAH 1CT0E 1UVPA 3KEEA 2W7SA 5FAHA 1TPSA 2H9EH 1BCUH 1EXFA 1DM4B 1JIRA 5I25A 1EAWA 3ZVEA 2P94A 2SGEE 3AASA 1NRRH 3ATKA 3L6PA 4YOIA 1S81A 3BF6H 2Y7XA 4FU9A 4VGCB 2Z6BD 1UTJA 2AMPA 2AERH 1HAXB 4YLQH 1UVSH 2P93A 4MQAA 1KLJH 1AKSB 1BB0B 2W7UA 1XM1A 5T6GA 1GCDA 4OS2A 1XX9A 2BD8A 1SHHB 1DY9A 4DT7B 2FMJA 1O2HA 3SU3A 2Y6TA 5FX6A 3BTKE 4AOQA 4R0IA 2XWBI 1SGPE 1Z8IB 3RXTA 1E35B 3SQEE 1C5ZB 1GI3A 1ELCA 2FS8A 1TQ0B 3TJOA 3H7TA 4Y11E 5DG6A 3MMGA 4ABFA 1WQVH 5AVDA 9LPRA 5EPYA 1ABIH 2PSYA 1THSH 3HKJB 3MOCA 5JDUB 1EOLA 1TQ7B 1GBDA 3LC5A 2UUFB 3IG6B 1O5DH 1P8VC 1GHVH 2FZZA 2J4IA 3TPIZ 2VU8E 3ZZ7A 1O2YA 2H9HA 1GCTB 3BG4C 4HFPB 4UFGH 4X8VH 2ZU1A 3D62A 1MQ5A 4X2XA 3U98H 2ANMH 1HRTH 2QCYA 3O8DA 3RM2H 2VWNA 1Y3YA 4CRAA 3ZZ9A 1TNKA 2ANKH 2ZHQH 1QJ7B 1TMUH 4YO9A 3RU4E 2PKSC 4BANB 1IQNA 1G3EA 2EA3A 1EAXA 1C9TA 3SU0A 1O2TA 4XSKU 1TLDA 1V6DA 2D1JA 2VWOA 3EAJA 1KYNA 2WUBA 2XNIA 1Y8TA 3P70B 2ANYA 2TGDA 2QAAA 4AG1A 1SFIA 1PYTD 1J17T 2FYRA 1V2QT 5EODA 5T6DA 1C2HA 3RXMA 4JZDH 1SBWA 1BBRK 1LKAA 4WVPE 1W10U 1O34A 1QQUA 3ESTA 3BTME 5IYTA 2HRVA 2BX4A 1TX8A 2SFAA 1P9UA 3EQ0H 1ZGVA 4HGCA 2FOFA 1L4DA 5JBBS 3KNXA 1UK3A 3MH4A 3ZZDA 3ZYEA 4FU7A 2J95A 3K6YA 1T4VH 4B71A 1AFEH 3E16B 3STJA 2XCFA 1CBWB 4MNYA 3MU0A 1CVWH 1NS3A 5K0HA 2ZA5A 3PMHB 2VWMA 3SORA 3FFGA 1QL8A 4X8SH 2BY6X 2BZ6H 3PWBA 1DANH 2BM2A 4KGAA 3LC3A 4BAQB 1SOZA 2A2QH 3DT0H 3S9CA 2F91A 3GYLB 4KTSA 3PB1E 1HDTH 5JPMH 1PPCE 1QB9A 3BTEE 3TH4H 2AIQA 1G3DA 2BLQA 1GG6B 2Y5FA 1N1LA 2NU2E 2A7CA 3BTFE 2WV4A 1BBRE 1A0JA 3GYMA 2C8YB 3F9FA 4YOGA 3FP6E 3I77A 1L2EA 1P12E 1C1WH 1ESTA 2WPJS 1Q31A 2BDBA 4DIHH 2C8ZB 3VB3A 3K9XB 1BTUA 4TWYA 2ODQA 2BDCA 1SGTA 1HAOH 1IOEA 2CN0H 2QGRA 4M7GA 1ZHMA 1O2LA 2PGBB 4FUGA 4K1EA 1GBJA 2G4TA 2FPZA 2CHAC 2GDEH 1E37B 3JZ2B 3A82A 3UR6A 2VB0A 5DP9A 3M3TA 4Y76A 4ZHAA 5A0BA 2BVSH 1GJBB 2QXHA 1PQ8A 5F03A 3HK6B 4BTIB 1O5CB 3D65E 2P16A 3LU9B 2ODPA 1W12U 2A45B 5IDKA 1IQIA 3HKIB 1K1OA 1GHYH 1AVWA 1UTPA 1P3EA 2ZFSA 1AVGH 2XC5A 3SI4H 4GCHG 1C5QA 1X7AC 1IQKA 2QY0B 3GY8A 4WXIA 1OSSA 3HATH 3QUMP 1NRSH 1H4WA 1C5YB 2PWXA 5GIBA 4DY7B 2CHAB 3MU5A 3GOVB 3LT3A 2C8WB 3E3TA 4Q7ZA 4MDSA 1G9IE 2G8TA 1F0UA 2CJIA 1F5LA 1UK2A 2SGPE 1F0SA 1HYLA 2C8XB 1GBCA 1FPHH 1A4WH 5FHTA 3SHAH 3H7OA 2O8MA 3RP2A 3SN8A 1A61H 3F1SB 2RA0A 3F9HA 3MU1A 3DUXH 4JZFH 5A0AE 1O2IA 5L2YH 2VGCC 2WV5A 1GJ5H 3QLPH 1O3LA 2XBYA 1TBZH 1LDTT 1THPB 1O3OA 3M3SA 1MD8A 1EOJA 3OY5U 1SLXB 1ZHRA 1MAYA 2ZDKA 1B0EA 3SV2H 2H5DA 3TH2H 1ZSJA 1GBTA 3P8GA 4XFQA 3ZVBA 1IQMA 2QXIA 1NTPA 1CU1A 1ELBA 1HIAB 3P95A 4OGXA 4U30A 2Z3CA 4DIIH 1GGDB 1O37A 3UREA 4GVUA 1CGJE 3I78A 4JZEH 1WCZA 4HZHA 3LONA 1UTKA 1EPTA 2PUXB 2K1QA 2Z7FE 2HPQH 4X2WA 4AFQA 1ZGIA 1VCWA 1T8OA 4KP0A 1MTVA 1BQYA 3UIRA 1WAYB 2B0FA 3UR9A 1RTFB 4TPYA 2TGTA 6GCHG 1MBMA 1SGFG 4B2AA 3QX5H 3MU4A 1YKTA 2J34A 3OX7U 3VEQB 1GWAA 5E0JA 2ZHFH 4O3UA 4TPIZ 1YPJH 1DWEH 1TFXA 2A1DB 2EI7A 1NPMA 1EJNA 1PQ5A 1F2SE 1DITH 3VXFH 2QC2A 1C5PA 1K21H 4K1SA 3RXVA 5CE1A 5GWZA 1Y5UT 4B2CA 1IQHA 3LJOA 3TK9A 5C1UA 1KXBA 4WY3A 2XBXA 1P06A 2V35A 3PO1B 4AYYB 1A3EH 1A1RA 1MKXH 4I7YH 2GZ9A 1QRWA 1UTLM 2H9TH 2YOLA 1SGNE 1Q2WA 4BTTB 4D9QA 4X2YA 4YM9A 1GHZA 1O2QA 4CRFA 4GAWA 1ZSKA 1OP8A 1WSSH 1XXFA 2H6MA 3A7XA 3BN9A 1ELEE 2Q6DA 2CMYA 4VGCC 4U32A 4BOHA 4K1TA 1XMNB 4WH8A 4E7NA 4O03A 4IGDA 2NWNA 4GSOA 3SNCA 1FMGA 2FO9A 3QZQA 1SGIB 2HLCA 3GCTF 2PLXA 6CHAB 1K9OE 1L1NA 1DPOA 3BG8A 3PROA 1GL0E 1SGEE 1GHXH 4FUEA 1EPTB 3MH7A 1C5OH 1GMHG 2UUJB 1XKAC 1G36A 4ZH8A 1SQAA 5F8TA 1UCYE 5LPFA 3PLBA 1YCPK 3MNBA 2D8WA 4NIXA 5EG4A 4BAOB 1GBMA 1TMTH 4IC6A 2R0LA 1SL3A 1Y3UA 1Z7KA 3S69A 4RKJB 4FVDA 1MCVA 3T28A 1SHYA 1CT2E 1FPCH 4PROA 2A5IA 1QNJA 2WPLS 3EDXB 5EXLA 4B2BA 2KAIB 3UQVA 1HXFH 4ASHA 1BRUP 2ULLA 3QO6A 5LPEA 1QB6A 4H4FA 5EQSA 1C2JA 2IPHA 1K2I1 1ZTLA 4I32A 3BV9B 1G30B 3C1KA 1UHBB 4A1VA 6CHAC 4ISIH 1TGCA 1C2KA 2CV3A 5H4IB 1C4Y2 1O3NA 1QJ6B 2FWWA 2HVXA 3VGCC 1ZLRA 3EE0B 2W3IA 3A83A 1N8OB 1VITH 3A8CA 1JMOH 3GY6A 5DK1A 1ZSLA 4DVAU 3LOXA 4WMDA 3FZZA 1XXDA 3IWMA 2F9NA 2TPIZ 4ZAEA 3VB7A 3TNSA 2P3UB 1QFKH 3A86A 3HPTB 3O8BA 2G51A 3T29A 3BEIB 1V2NT 2JH6D 8KME2 1C2DA 1F92A 3RXQA 5F6MA 1O5BB 2FI3E 1O2UA 5JB8S 4MG3A 1TPOA 1TNLA 4ABIA 1YGCH 4I8GA 2BY7X 1GJ9B 5DJ7A 1J16A 3KIDU 2D26C 2DUCA 3ZVAA 1S6HA 3SU6A 2HOBA 1RTKA 1AE5A 1EASA 3PTNA 4JMYA 1SB1H 1T31A 3G01A 1Z8JB 3OU0A 1AO5A 2GT7A 1P57B 2GD4B 1FY3A 1AE8H 1WOFA 2QYIA 4RSPA 2FOCA 1UTMA 2Y81A 3M5MA 3LGTA 2EI6A 4KELA 3EA8A 2Z9GA 3MNCA 1O32A 1E36B 2FTLE 4FVBA 1GJ7B 3M35A 4DCDA 4DOQA 3E0NB 1BMNH 2XXLA 2W5EA 1C5VA 1EJMA 1AIXH 1IQFA 2ANWA 2RCEA 1W7XH 1GL1A 1SVPA 3SUFA 1RS0A 3MH6A 4U01A 1PPEE 1V2OT 2OLGA 3Q3KA 1LTOA 2PUQH 3K65B 3SJ8A 2LNCA 2ALPA 2J38A 3GY4A 1ZPBA 1O3AA 3TITA 3E90B 4BXSA 8GCHF 1PPGE 2XBVA 3T26A 4CR9A 2G00A 3A7WA 5FBEA 2OQUA 5E0GA 5HM2A 1H9LB 4O3TA 1K1LA 4UFDH 1CA0B 2ZEBA 2AMDA 2GCTB 1FY4A 2FIRH 2WYGA 3GCTG 4INLA 2ZIQH 1O3PB 1H8IH 4OS4A 1FN6A 2O8LA 2PTNA 2ZFTA 4UE7H 4INKA 1O3GA 3SU5A 5GCHF 1L0ZA 2ZCLP 1HB0B 3UY9A 3SO3A 1TMBH 2G4UA 1ARCA 4INHA 3UPEA 4F4OC 2VVUA 5C1XA 3E8LA 3UOPA 2VIPA 1N6YA 3PMBB 5GPIB 3M7UA 1ID5H 3FZDA 1GMCF 1SOTA 1LPGB 3SV9A 3ATMA 2XC0A 2AYWA 4THNH 2Z9JA 3D23A 1HPGA 3HGPA 5HM9A 3QTOH 1TRMA 1J8AA 3M5LA 1GBBA 4NCYA 2O8UA 3V7TA 2FOGA 1QA7A 2ZHWH 1YYY1 1HXEH 4AORA 3VB4A 1XUKA 3GDSA 4Q80A 2VJ1A 2ZGJA 3KQDA 2JKHA 3L3TA 3MNXA 4DG4A 3ATWA 4CRCA 1SLUB 3U9AH 2ZECA 4MPWA 1ZYOA 1GDNA 2A31A 4NIVA 4Y0ZE 4CH8B 3NXPA 1O31A 2GTBA 2Q1JA 1KTTB 2ZFFH 1FAXA 1EB2A 1C9PA 1DSUA 7GCHF 1XUHA 1C5SA 4A5TS 4KTCA 1FLEE 3OSYA 1MKWH 4ABHA 2VGCB 2GV7A 1HLTH 4X6MA 1RJXB 2A32A 4NIWA 2QF0A 5C3NA 8LPRA 2WPIS 1UTOA 3PLPA 3RXGA 5DP5A 2ZF0H 1GJCB 1AZ8A 4WJG2 2A4GA 4GUXA 3M61U 1AY6H 1DWBH 4AG2A 2YNBA 3ZVCA 1KXCA 2BLOA 2PHBA 5A2MH 4B75A 2C93B 2UWLA 3HGNA 3LGYA 1D9IA 4FUBA 2P3FH 4O97A 4OS1A 2NU0E 3VB5A 1UCYK 1Z6JH 3RC5A 1EQ9A 1VGCB 1GHWH 1O2XA 3NZIA 1A0LA 1F5RA 4XBCA 1GJAB 1ZJKA 3V0XA 1TA2A 4IW4E 3KGPA 3EGKH 1QR3E 1DSTA 2ZGXH 2PFEA 5J4SA 3MH5A 1AN1E 1C5TA 1ZOMA 4IC5A 4KKDA 1GBKA 1QQ4A 1QTFA 2UWPA 1GI5A 5FXLA 2D2DA 3GDUA 1MTSA 1V2LT 2G5VA 1SGFA 1NY22 1O3FA 1D3TB 5GCHG 3PMAB 3GCHB 5EGMA 5F8XA 1DVAH 1PPHE 1C1TA 2J94A 2PV9B 2WPKS 4AB8A 4AX9H 1F0TA 1UCYH 2BD4A 2ZDMA 1OKXA 3S7HB 4X1SU 5DP3A 1ZMNA 2FDAA 3RLWH 3T27A 1GI2A 1AU8A 4CHAB 2V3HH 1QRZA 1DUEA 2SGFE 2J92A 3RXAA 3H5CB 2VINA 5DGJA 1G3BA 3MU8A 3GCHC 2R9PA 1EZSC 1KLIH 3SZNA 1Z6EA 4X1RU 3CP7A 3NPSA 1GDUA 3MWIU 4IBLH 1CSOE 1EAUA 1FUJA 4ZROA 1IHTH 2TGPZ 1KTSB 1O3CA 3LH1A 1KIGH 4JYVH 1J14A 1NESE 1O2JA 4X1PU 1LVYA 3RDZA 1LPZB 1JWTA 3AVZA 1EB1H 2JH5D 4Y7BA 3RMMH 5TCAA 3FP7E 1A2CH 1O5FH 2BD5A 3S7KB 3LDXH 2THFB 3PV4A 5ESBA 1IQJA 1BTWA 3V12A 3RXKA 1CA8B 1C5WB 4FUCA 1MBQA 2Y80A 1TNJA 4K5ZA 1DICA 2PKAA 1AVXA 3LH3A 2ZCHP 1ZRBA 1P2JA 2STAE 2BXTH 1O2OA 1RRKA 1OX1A 1QRXA 3F9GA 3BTWE 4AN7A 1O3BA 1EZQA 1QIXB 4GLYA 3KL6A 1DDJA 2XCNA 4ABBA 3OY6U 3U1IB 3ZZAA 2ZQ2A 2HNTF 1BRBE 5EOKA 2ZU4A 3GCNA 1A5GH 1A7SA 1QB1A 1NROH 2VNTA 1SQTA 2SGAA 4X1NU 2OUAA 1VITG 1ELDE 1ESAA 2Z9KA 3LPRA 4CRDA 2ZU5A 2GCHG 1ARBA 2EI8A 3RMOH 3A87A 3TJVA 1MU6B 1TIOA 1SLWB 1DUAA 4UEHH 1QBNA 2A4OA 3UNSA 2F3CE 4CHAC 1WUNH 2BD9A 5CHAB 2GGVB 1WU1A 3SNAA 5HYOA 4OS7A 2P8OC 3NKKA 1GPZA 3PLKA 1DE7H 4XOJA 1HAIH 1SGQE 5EW2H 4LZ4B 4KTUA 4MTBA 1W14U 1UTQA 1FI8A 2BB4A 1OS8A 1BMAA 1O2SA 2P95A 2TRMA 4ISLA 4K8BA 1GBEA 2SGQE 4BNRA 1NRPH 2OP9A 5FPYA 3FVFB 1YP9A 2QXJA 2Y82A 4HI3A 2JETB 1GBLA 1AKSA 2Z9IA 4Q7XA 4OGYA 2W3KA 1FAKH 4Y79A 2GZ8A 1T8MA 3TJUA 2BD3A 1G3CA 1P2MA 1G2MA 4Y10E 1DLKB 4E06H 1J15A 2C4FH 3AAUA 1CE5A 1YPHE 1MZAA 3TGKE 1QY6A 3SW2B 1V3XA 2PKSB 3QK1A 4YESB 3SBKA 2EEKA 3SU1A 5JYIA 1UVOA 2ZPSA 5DP7A 1W3CA 1BTZA 1P04A 3ATLA 4QT8C 1O2WA 1SPJA 3D49H 2BHGA 3RC4A 1TGNA 1D3DB 2J9NA 3TH3H 3PYHA 4B1TA 1K1IA 2ZG0H 1S0QA 4XBDA 2PTCE 2VIVA 3SJKA 4WXVA 1KXFA 4ZKOU 4ZHLU 2LPRA 4Q2KA 2ESTE 3PMJA 1GBIA 1GI6A 4F49A 2BTCE 3RMNH 1TNGA 3SNDA 1OP2A 4Y71A 1CO7E 4JK5A 1BRAA 1BTPA 5FPSA 1EP6A 2RA3A 1T7CA 4X6OA 3RXIA 2AFQB 2ZHEH 4NWLA 2UWOA 1MUEB 3P8OA 1GJDB 1MTNC 4H6TA 2QV1A 2WPHS 1BMLA 2VIWA 3M5OA 1KY9A 4LK4A 2HALA 1BT7A 1S5SA 3TK5A 5F8ZA 3MTYA 4WMEA 5FCKA 4CBOA 2BOHB 1SGDE 1OXGA 2RDLA 3T2NA 3P17H 3PTBA 4TY7A 2PKAB 1PPZA 4DW2U 5JBTA 3DHKH 4UFEH 1SGCA 3VPKA 2BDGA 3BTTE 1BJVA 2G55A 2ZDLA 5BRRE 2VWLA 3A7ZA 2VIOA 4WF8A 3UNRA 1LQDB 2ZZUH 1RFNA 1U6QA 1C5MD 2BOKA 1RD3B 4IMZA 1T32A 1GVZA 2GCHF 3BEUA 3RXHA 1CHGA 4MPXA 3M7TA 1W0ZU 1DXPA 1EZUC 1MH0A 1HJAC 4UONA 2R2MB 1XUGA 1C1UH 1JOUB 2GMTB 3UFAA 4D8NA 5EXMA 2ZGHA 1N8OC 1MMJN 1WYKA 2ZGBH 2WPMS 3RXOA 3BTGE 3K6ZA 1VJ9U 2AIPA 1NT1A 1O3KA 5FPTA 1UK4A 1THRH 2XWAA 2RG3A 7ESTE 5E0HA 2AS9A 4NA9H 1NM6A 1GHAG 1D6RA 1LKBA 3MFJA 1TBRH 1C5RA 2P8OB 3RU4T 3T5FH 1TGSZ 1ZPZA 2AGIX 3SNBA 1VGCC 3WY8A 2QF3A 1SMFE 2FTMA 1ZTJA 3E6PH 1ZR0A 2FI5E 3FANA 1MTNB 2FS9A 5C5NA 2FX4A 5SGAE 2M5TA 1TGBA 4H42U 1BOQA 1ELGA 1ANEA 3TGJE 2V0BA 4IN1A 2BQ6B 3SUGA 1VCPA 4AZ2B 1AB9B 1AD8H 1GI9B 5TCCA 4YLUA 1TX6A 5B6OA 1NU9A 6GCHF 4B74A 3ELAH 2QA9E 1TYNA 4Q7YA 3SV7A 2BY9X 1TAWA 4NZQA 1WTHD 1K1PA 1BHXF 1E38B 1FDPA 2BY8X 4A92A 2I6SA 2A5KA 3RXJA 4NG9H 1P03A 1GGDC 4X1QU 3FP8E 1CGIE 2ZHDA 1V2UT 1AWHB 1BDAA 2OC0A 3Q3XA 2OC7A 2SNVA 2XW9A 3SI3H 1QL9A 2GP9B 2ZP0H 5AFZH 1AFQC 3TIUA 1FIZA 5K7RA 1AWFH 1W13U 4WWYA 3QGJA 2HGTH 2CF9H 2ZFQH 4MNWA 3SHCH 1JXPA 1K1JA 4LXBH 1LHCH 4Y8YA 3KQBA 3GCOA 1AMHA 1O3MA 4AGKA 3B8JA 3SJOA 4FUFA 1AZZA 2ZFPH 3ZZ3A 1L1GA 3O8CA 1P3CA 3M36A 4YTAA 2VH6A 3U69H 4BTUB 1GVKB 1GI0A 2ZNKH 3LIWA 1MU8B 3Q77A 1O5AB 1S6FA 3A80A 1YM0A 4JYUH 2H1UA 3TLOA 3UQOA 1LVBA 1C1RA 1O2RA 3M37A 3NK8A 1GHBF 1C1QA 3MI4A 3SNEA 2Y5GA 2ILNA 3TJNA 1CA0C 1JBUH 1ZMLA 2BLWA 2WUCA 4UDWH 3QN7A 2AMQA 3RXUA 1AHTH 1ANDA 3ODDA 2I6QA 4D76A 2EC9H 1DLEA 4WMFA 2R3YA 3ZVFA 1QHRB 1K28D 4J2YB 4X2VA 1V2JT 4TYDA 1F5KU 2NU1E 4K8YA 1BJUA 1C1SA 2HNTC 2BDAA 2C90B 1OYQA 2VH0A 5PTPA 1O2GH 3VXEH 1G37A 1O2ZA 3RUOA 1FNIA 1RXPA 2TBSA 4ZXYH 7GCHG 1KLTA 1PQAA 1CBWC 4A6LA 1FY8E 3ZZ8A 5C5OA 1SGRE 1HCGA 5ESTE 2P3TB 1TWXB 1DX5M 3QWCH 2Z9LA 5AHGH 1DS2E 1V2ST 1F0RA 4HTCH 4J1YA 5L30H 1HAGE 1W11U 2GKVE 1LVOA 1HAVB 3S0NA 1Y59T 3SV8A 1FV9A 1C5UA 2V6NA 5C1YA 2G52A 4NZLA 1FJSA 3L33A 1TA6A 5A8XA 1O3HA 1TGTA 2XTTB 1P9SA 4CBNA 1V2WT 2AH4X 1W7GH 2PR3A 2H5CA 4Y7AA 3ATIA 1TNHA 4ZHMU 3GY5A 1Y5AT 1C4V2 5T3HA 3A81A 3E1XB 3KQEA 3P92A 1ELVA 1SR5C 1G32B 4ISOA 3BIVH 5EQRA 1S83A 5DP4A 3UNQA 1LHGH 4Y8XA 4TWWA 2ZC9H 9ESTA 1Z8RA 4AGJA 4IN2A 3U1JB 1V2PT 4FUIA 2AEIH 1N6XA 4NA8A 1C5LH 5DP8A 2F9PA 3A8BA 1V2TT 1KSNA 2VVCA 3AW0A 2CF8H 4X8TH 1G2LA 1NO9H 1D6WA 1DFPA 2B9LA 2GCTC 3DFLA 1HBTH 2ZQ1A 3V3MA 1GJ8B 4YOJA 1UJ1A 4ABDA 5HXFA 2HNTE 4ESTE 5A8YA 2ZGCA 1IAUA 1PFXC 4ZKRU 1E0FD 3P6ZB 5E8EH 5JBCS 1UO6A 3U8RH 1BITA 3QDZB 1BRCE 3BIUH 1FQ3A 1PPFE 1WV7H 1GHAF 1BIOA 4DGJA 1AFQB 5E2OA 1S84A 1GJ4H 3W94A 1GCTC 2STBE 6ESTA 1QJ1B 2AGGX 4Y6DA 4FXGH 1O39A 3SUEA 1O2MA 3A89A 3SGBE 1C5NH 4UD9H 1P2OA 1FXYA 1LCYA 3E0PB 4OS5A 4NSYA 1O2KA 3BEFB 1TE0A 1GBFA 2A0QB 4JCNA 2NU3E 4K3JA 1O2NA 1A3BH 1TX7A 2B7DH 4FUDA 5C20A 1QBOA 1BZXE 1XUFA 1ZHPA 3MO6A 3R0FA 2OD3B 2XC4A 5EXNA 1TRNA 1EP5A 1AQ7A 1AB9C 3T62A 4AFSA 2FESH 1AUTC 1UVTH 1P10A 1O3JA 1NFUA 3BG4B 1HNEE 4XBBA 5AFYH 1HIAA 1QA0A 1ORFA 4GHQA 1P09A 4MNXA 1S82A 1O3IA 4NIYA 4ABAA 1PQ7A 2ZPQA 2OTVA 3OYPA 3KN2A 2ZI2H 1KDQA 1YCPM 1HAYB 3ZZCA 1QGFA 1W8BH 4D7GA 3P8FA 3SUDA 5CMXH 3OTJE 3A88A 3URDA 3AAVA 1E34B 3TNTA 2ZDNA 3RXFA 2ZTZA 4B76A 8ESTE 2DE9A 3RXDA 2F9UA 1H1BA 1BBRH 1Y5BT 1LMWB 2FODA 2IJOB 2R3UA 5DO4H 1O5GH 3Q76A 2FOHA 3ITIA 4D7FA 1H9HE 1NFYA 3HK3B 2SGDE 4SGBE 1J9CH 3RXEA 4FU8A 4BAKB 2B8OH 2FM2A 2FOEA 1EZXC 2QXGA 4CR5A 1ANBA 3RC6A 4A7IB 1LHDH 1BTYA 1GHBG 4ZKNU 3LKWA 1P2KA 1IHSH 1EX3A 1RIWB 2FOMB 3RXPA 1Z8GA 5FX5A 1VITF 1Z1JA 4CREA 1FZZA 3ENSB 2GMTC 2ALVA 1CGHA 2BX3A 1RTLA 2A4RA 1GI4A 5TJXA 4X0WU 3VB6A 1QBVH 1UTNA 1XVMA 1D3QB 1OWJA 1WQSA 3LGVA 3BTQE 3ZZ5A 1LVMA 4ZMAH 1O0DH 3BSQA 1RIWC 3ZV8A 3SJIA 4RKOB 1VZQH 1LHEH 1L4ZA 1OWHA 3M5NA 4BAHB 3TVJB 2BVXH 1TOMH 5ETXA 1C5XB 1AGJA 1P05A 2Q6FA 4ISHH 3ODFA 1FY1A 1NC6A 2FLRH 1MKXK 4CRGA 2FLBH 4XE4A 3GY7A 3TGIE 1OWIA 1VCQA 2BLVA 2Z3DA 1TONA 4X8UH 4FUJA 1O35A 5L2ZH 1SFQB 2ASUB 1CHOG 5E2PA 5A0CA 3KQCA 2C3SA 5ABWA 3SGQE 1GI8B 1T8NA 2OQ5A 4RN6A 1LQEA 4IMQA 1ELTA 4ABEA 5HGGA 4X6PA 1Q3XA 4IS5A 2H2ZA 3UOUA 1IQLA 2FI4E 3O8RA 1VR1H 2F83A 4K69A 1BTXA 2BMGB 3RM0H 4AFZA 3U8OH 1ETRH 1TPPA 1NU7B 1YPEH 5HMAA 1C2GA 3GY3A 4I8KA 1EUFA 1DWCH 1W0YH 3VGCB 1HAPH 4ZUHA 4Y0YE 4JZIA 2V3OH 1HV7A 2VIDA 1XUJA 1V2KT 1GG6C 4WH6A 1DT2A 3ZZ6A 2R0KA 1XKBC 3B9FH 2FX6A 1NRQH 1MZDA 2Y5HA 1YPMH 2OCVB 2YNAA 1ZRKA 1QL7A 3GY2A 2GDDA 2JETC 2ZTXA 1ELAA 1ESBA 3UWIA 1O30A 2F9BH 1FN8A 1GJ6A 2BDIA 1A5IA 2OC8A 1O38A 5EW1H 3LGWA 4JZ1A 2W26A 2WYJA 3A85A 1K22H 3EA7A 2UUYA 2SNWA 1O3EA 3SU4A 1YPGH 1DXWA 2ZDAH 2FOAA 1S0RA 4GCHF 1KXAA 1HFDA 1YCPH 2A7HA 1YPLH 1ELFA 3ZVDA 4BAMB 4CH2B 2BY5X 7LPRA 3A84A 1DOJA 1ABJH 3GDVA 2G81E 4ZXXH 4YT7H 1P02A 1KDQB 5GXPA 3GICB 2BDYA 1GMHF 1NFWA 3CS7A 2GZ7A 3W95A 2BD2A 4O9VA 2OC1A 1NRNH 1TRYA 1EPTC 1C1PA 2GVFA 1V2VT 3SJ9A 4NSVA 1CT4E 1C2LA 1P01A 1TABE 1YBWA 1YLDA 4B73A 4K60A 4H6SB 3PWCA 3MNSA 2ZCKP 1GVLA 1CQQA 2Z94A 1VJAU 4X6NA 3F9EA 2A2XH 3PO1C 5EU8A 2DE8A 5LH8A 4E05H 1C1OA 1FONA 2UUKB 4MLFB
chains in the Genus database with same CATH superfamily
1TALA 1Y3XA 2BDHA 1YC0A 3A7VA 4ZKSU 3LGIA 3PM3A 2J97A 3DA9B 3LGUA 3I29A 5DP6A 2EQNA 1ZTKA 1KXDA 3RXCA 1P0SH 3U8TH 1OYTH 1HJ8A 3FAOA 3N7OA 1YPKH 1O36A 3SV6A 2KCOA 3KYFA 1SI5H 2FOBA 5JBAS 4ABGA 1CHOF 4MNVA 3DD2H 2M2AA 1MCTA 1S85A 1ETTH 4Y8ZA 1C2IA 2O8WA 1ZZZA 3BTDE 4DJZB 1LPKB 2O8TA 2QIQA 1LHFH 5EPNA 3V13A 4Q4LA 1D3PB 3JZ1B 4K2YA 3CENA 2GT8A 3ZYDA 1C2EA 2PW8H 4BXWA 1OWDA 3MHWU 1P11E 1BA8B 1C2MA 1HJAB 3P8NA 3GISB 2HLDD 1P2IA 2BZAA 1FY5A 1TB6H 5C67A 4LZ1H 1TNIA 2GX4A 5CHAC 5A8ZA 3MO3A 3SU2A 2FXRA 1SLVB 2F9OA 1BUIA 1INCA 3RXSA 4NA7A 1GBAA 1JRSA 1B0FA 2CGAA 3MYWA 2W6JD 1HAZB 1YLCA 4JK6A 1NZQH 4XDEA 1EJAA 3A7YA 4I8JA 3AK5A 1LO6A 1PPBH 3BTHE 3Q00A 2FP7B 4Z0KA 1MTUA 1OWKA 3RXBA 2R2WU 5AF9H 2AGEX 5LPRA 4GHTA 5LGOA 2WHXA 2OBQA 1W2KH 4FUHA 2A5AA 2A7JA 2Q6GA 1C4U2 2PSXA 3ZVGA 1JIMA 1V2RT 2ZWLH 2XBWA 8GCHG 4UFFH 1PJPA 4XRNA 5EQQA 1WXRA 1YPHC 4I31A 4E7RG 1MD7A 4D9RA 1OP0A 3S9BA 3KF2A 1UMAH 4DURA 3DFJA 1GBHA 1OPHB 1AI8H 4A1TA 3NWUA 1MKWK 3ZV9A 1HUTH 1DWDH 1QCPA 1HAHH 5JB9S 3B23B 2WINI 2ZDVH 3EYDA 1GMDG 4B6FA 2F9VA 2A4QA 4I33A 4JYTA 1O33A 4MVNA 3M7QA 1NFXA 3LJJA 3F68H 5A09A 1MAXA 2XOKD 4TY6A 1GI1A 4A1XA 4SGAE 1EKBB 1WBGB 3UUZA 4YZUA 1ZMJA 3QGNB 5DKMA 3CS0A 3ZZ4A 1IQGA 3KCGH 3UWJH 1UHBA 5J4QA 3STIA 1GMCG 1XUIA 2BQWB 3IITA 1K1NA 1EAIA 2IN2A 3T25A 2RFKC 1SQOA 3TU7H 3URCA 2QN5T 3VFEA 1M9UA 5I46H 2FEQH 4ABJA 2JH0D 2VVVA 1V2MT 1C1NA 1FIWA 1OOKB 4Z6AH 4AB9A 1IQEA 4U2WA 2PGQB 2BYAX 1ZJDA 2B5TB 2CXVA 2XYAA 3GS9A 3Q3YA 2KZ4A 5GDSH 4LOYH 2ODYB 1C1MA 4AYVB 1TOCB 3RLYH 1TPAE 1XVOA 3K2UA 3A8DA 4NFFA 3S9AA 3NCLA 1KXEA 1O2VA 1TBQH 3SOSA 3QTVH 3SQHE 1Y3VA 2ZU2A 1A5HA 2KAIA 2BQ7B 5GJ4B 1JRTA 2Z3EA 1RGQA 1BMMH 2BVRH 1T4UH 2KM0A 2NU4E 1ETSH 1SGYE 2Y7ZA 1ACBE 2KR7A 4AFUA 4ISNA 3RXLA 2G5NA 3SGAE 1P2NA 1PYTC 1GI7B 2J5UA 1A0HB 1SSXA 2VIQA 4YT6H 3NUMA 4FOUC 1O5EH 1Z1IA 3UTUH 2TGAA 5FCRA 1H9IE 3OEED 4NFEA 6LPRA 4MPVA 5FBIA 4AC9A 1MQ6A 2OINA 2OXSA 1A46H 3EA9A 5CDFE 2ZU3A 3N7DA 2ZKSA 3F6UH 1ANCA 1WTGH 2HPPH 4R8TB 3M3VA 1H8DH 2ZPRA 2BD7A 3AW1A 4OS6A 2ZFRH 4MPUA 1P2QA 5L6NH 1K1MA 1GMDF 2GV6A 2TIOA 1EATA 2L74A 3E91A 1HAVA 5C2ZA 3KHVA 1Z71A 5T6FA 1SC8U 1ZPCA 4I8LA 1AUJA 3RXRA 1D4PB 1C2FA 1YF4A 1B5GH 1L1JA 1UVUH 3QZRA 4I8HA 5G4BA 2O9QA 1BHXB 1T8LA 3UB0A 2OBOA 2XRCA 1OWEA 2IOTA 4F48B 3RMLH 1F7ZA 2HWLB 1H8ED 1B7XB 2J2UA 7KMEH 1O3DA 1S6LA 2FYQA 1SG8B 1DY8A 3C27B 2P59A 4CRBA 1HJ9A 3FN8A 1O2PA 3F2GA 1QURH 5DPAA 3ZZBA 1HGTH 1NN6A 1GDQA 3A7TA 3MO9A 1Y3WA 3TK6A 3A8AA 2BXUH 1C1VH 5C0UA 1BTHH 4GPGA 3R3GB 3RU4D 4NWKA 3DSOA 5BPEA 2ZO3H 1MTWA 2ZTYA 4NGAH 1CT0E 1UVPA 3KEEA 2W7SA 5FAHA 1TPSA 2H9EH 1BCUH 1EXFA 1DM4B 1JIRA 5I25A 1EAWA 3ZVEA 2P94A 2SGEE 3AASA 2HVYB 1NRRH 2YMSC 3ATKA 3L6PA 4YOIA 1S81A 3BF6H 2Y7XA 4FU9A 4VGCB 2Z6BD 1UTJA 2AMPA 2AERH 1HAXB 4ACBA 4YLQH 1UVSH 2P93A 4MQAA 1KLJH 1AKSB 1BB0B 2W7UA 1XM1A 5T6GA 1GCDA 4OS2A 1XX9A 2BD8A 1SHHB 1DY9A 4DT7B 2FMJA 1O2HA 3SU3A 2Y6TA 5FX6A 3BTKE 4AOQA 4R0IA 1SGPE 2XWBI 5EJLA 1Z8IB 3RXTA 1E35B 3SQEE 1C5ZB 1GI3A 1ELCA 2FS8A 1TQ0B 3TJOA 3H7TA 4Y11E 5DG6A 3MMGA 4ABFA 1WQVH 5AVDA 9LPRA 5EPYA 1ABIH 2PSYA 1THSH 3HKJB 3MOCA 5JDUB 1EOLA 1TQ7B 4FETA 1GBDA 3LC5A 2UUFB 3IG6B 1O5DH 1P8VC 1GHVH 2FZZA 3DSGA 2J4IA 3TPIZ 2VU8E 3ZZ7A 1O2YA 2H9HA 1GCTB 3BG4C 4HFPB 4UFGH 4X8VH 2ZU1A 3D62A 1MQ5A 4X2XA 3U98H 2ANMH 1HRTH 2QCYA 3O8DA 3RM2H 2VWNA 5EJZA 1Y3YA 4CRAA 3ZZ9A 1TNKA 2ANKH 3F0OA 2ZHQH 1QJ7B 1TMUH 4YO9A 3RU4E 2PKSC 4BANB 1K0HA 1IQNA 1G3EA 2EA3A 1EAXA 1C9TA 3SU0A 1O2TA 4XSKU 1TLDA 1V6DA 2D1JA 2VWOA 3EAJA 1KYNA 2WUBA 2XNIA 1Y8TA 3P70B 2ANYA 2TGDA 2QAAA 4AG1A 1SFIA 1PYTD 1J17T 2FYRA 1V2QT 5EODA 5T6DA 1C2HA 3RXMA 4JZDH 1SBWA 1BBRK 1LKAA 2J98A 4WVPE 1W10U 1O34A 1QQUA 2IPQX 3ESTA 3BTME 5IYTA 2HRVA 2BX4A 1TX8A 2SFAA 1P9UA 3EQ0H 1ZGVA 4HGCA 2FOFA 1L4DA 5JBBS 3KNXA 1UK3A 3MH4A 3ZZDA 3KQ5A 3ZYEA 4FU7A 2J95A 3K6YA 1T4VH 4B71A 1AFEH 3E16B 3STJA 2XCFA 1CBWB 4MNYA 3MU0A 1CVWH 1NS3A 5K0HA 2ZA5A 3OTPA 3PMHB 2VWMA 3SORA 3FFGA 1QL8A 4X8SH 2BY6X 2BZ6H 3PWBA 1SQRA 1DANH 2BM2A 4KGAA 3LC3A 4BAQB 1SOZA 5HIZA 2A2QH 3DT0H 3S9CA 2F91A 3GYLB 3F2HA 4RT0A 4KTSA 3PB1E 1HDTH 5JPMH 1PPCE 1QB9A 3BTEE 3TH4H 2AIQA 1G3DA 2BLQA 1GG6B 2Y5FA 1N1LA 2NU2E 2A7CA 3BTFE 2WV4A 1BBRE 1A0JA 3GYMA 2C8YB 3F9FA 4YOGA 3W1EA 3FP6E 3I77A 1L2EA 1P12E 1C1WH 1ESTA 3PRDA 2WPJS 1Q31A 2BDBA 4DIHH 2C8ZB 3VB3A 3K9XB 1BTUA 4TWYA 2ODQA 2BDCA 1SGTA 1HAOH 1IOEA 2CN0H 2QGRA 4M7GA 1ZHMA 1O2LA 2PGBB 4FUGA 4K1EA 1GBJA 2G4TA 2FPZA 2CHAC 2GDEH 1E37B 3JZ2B 3A82A 3UR6A 2VB0A 5DP9A 3M3TA 4Y76A 4ZHAA 5A0BA 2BVSH 1GJBB 2QXHA 1PQ8A 5F03A 3HK6B 4BTIB 1O5CB 3D65E 2P16A 3LU9B 2ODPA 1W12U 2A45B 5IDKA 1IQIA 3HKIB 1K1OA 1GHYH 1AVWA 1UTPA 1P3EA 2ZFSA 1AVGH 2XC5A 3SI4H 4GCHG 1C5QA 1X7AC 1IQKA 2QY0B 3GY8A 4WXIA 1OSSA 3HATH 3QUMP 1NRSH 1H4WA 1C5YB 2PWXA 5GIBA 4DY7B 2CHAB 3MU5A 3GOVB 3LT3A 2C8WB 3E3TA 4Q7ZA 4MDSA 1G9IE 2G8TA 1F0UA 2CJIA 1F5LA 1UK2A 2SGPE 1F0SA 1HYLA 2C8XB 1GBCA 1FPHH 1A4WH 5FHTA 3SHAH 2XNDD 3H7OA 2O8MA 3RP2A 3SN8A 1A61H 3F1SB 2RA0A 3F9HA 3MU1A 3DUXH 4JZFH 5A0AE 1O2IA 5L2YH 2VGCC 2WV5A 1GJ5H 3QLPH 1O3LA 2XBYA 1TBZH 1LDTT 1THPB 1O3OA 3M3SA 1MD8A 1EOJA 3OY5U 1SLXB 1ZHRA 1MAYA 2ZDKA 1B0EA 3SV2H 2H5DA 1E1QD 3TH2H 5KEDA 1ZSJA 1GBTA 3N99A 3P8GA 4XFQA 3ZVBA 1IQMA 2QXIA 1NTPA 1CU1A 1ELBA 1HIAB 3P95A 4OGXA 4U30A 5T1VA 2Z3CA 4DIIH 1GGDB 1O37A 5F53A 3UREA 4GVUA 5FL7D 1CGJE 4ZCNA 3I78A 4JZEH 1WCZA 4HZHA 3LONA 1UTKA 1EPTA 2PUXB 2K1QA 2Z7FE 2HPQH 4X2WA 4AFQA 1ZGIA 1VCWA 1T8OA 5B6LA 4KP0A 1MTVA 1BQYA 3UIRA 1WAYB 2B0FA 3UR9A 1RTFB 4TPYA 2TGTA 6GCHG 1MBMA 1SGFG 4B2AA 3QX5H 3MU4A 1YKTA 2J34A 3OX7U 3VEQB 1GWAA 5E0JA 2ZHFH 4O3UA 4TPIZ 1YPJH 1DWEH 1E79D 1TFXA 2A1DB 2EI7A 1NPMA 1EJNA 1PQ5A 1F2SE 1DITH 3VXFH 2QC2A 1C5PA 1K21H 4K1SA 3RXVA 5CE1A 5GWZA 1Y5UT 4B2CA 1IQHA 3LJOA 3TK9A 5C1UA 1KXBA 4WY3A 2XBXA 1P06A 2V35A 3PO1B 4AYYB 1A3EH 1A1RA 1MKXH 4I7YH 2GZ9A 1QRWA 1UTLM 2H9TH 2YOLA 1SGNE 1Q2WA 4BTTB 4D9QA 4X2YA 2OK5A 4YM9A 1GHZA 1O2QA 4CRFA 4GAWA 1ZSKA 1OP8A 1WSSH 1XXFA 2H6MA 3A7XA 3BN9A 1ELEE 4M9FA 2Q6DA 3OAAD 1SKYE 2CMYA 4VGCC 4U32A 4BOHA 4K1TA 1XMNB 4WH8A 4E7NA 4O03A 4RT1A 4IGDA 3WWFA 2NWNA 4GSOA 3SNCA 1FMGA 2FO9A 3QZQA 1SGIB 2HLCA 3GCTF 2PLXA 6CHAB 1K9OE 1L1NA 1DPOA 3BG8A 3PROA 1GL0E 1SGEE 1GHXH 4FUEA 1EPTB 3MH7A 1C5OH 1GMHG 2UUJB 1XKAC 1G36A 4ZH8A 1SQAA 2JDID 5F8TA 1UCYE 5LPFA 3PLBA 1YCPK 3MNBA 2D8WA 4NIXA 5EG4A 4BAOB 1GBMA 1TMTH 4IC6A 2R0LA 1SL3A 1Y3UA 1Z7KA 3S69A 4RKJB 4FVDA 1MCVA 1YWUA 2EY4C 3T28A 1SHYA 1CT2E 1FPCH 4PROA 2A5IA 1QNJA 2WPLS 3EDXB 5EXLA 4B2BA 2KAIB 3UQVA 1HXFH 4ASHA 1BRUP 2ULLA 3QO6A 2WSSD 5LPEA 1QB6A 4H4FA 5EQSA 1C2JA 2IPHA 1K2I1 1ZTLA 4I32A 3BV9B 1G30B 3NRLA 3C1KA 1UHBB 4A1VA 6CHAC 4ISIH 1TGCA 1C2KA 2CV3A 5H4IB 1C4Y2 1O3NA 1QJ6B 2FWWA 2HVXA 3VGCC 1ZLRA 3EE0B 2W3IA 3A83A 1N8OB 1VITH 3A8CA 1JMOH 3GY6A 5DK1A 1ZSLA 4DVAU 3LOXA 4WMDA 3FZZA 1XXDA 3IWMA 2F9NA 2TPIZ 4ZAEA 3VB7A 3TNSA 2P3UB 1QFKH 3A86A 3HPTB 3O8BA 2G51A 3T29A 3BEIB 1V2NT 2JH6D 8KME2 1C2DA 2K0QA 1F92A 3RXQA 5F6MA 1O5BB 2FI3E 1O2UA 5JB8S 4MG3A 1TPOA 1TNLA 3OFND 4ABIA 1YGCH 4I8GA 2BY7X 1GJ9B 5DJ7A 1J16A 3KIDU 2D26C 2DUCA 3ZVAA 1S6HA 3SU6A 2HOBA 3F2FA 5C94A 1RTKA 1AE5A 1EASA 3PTNA 4JMYA 1SB1H 1T31A 3G01A 1Z8JB 3OU0A 1AO5A 4OM9A 2GT7A 1P57B 2GD4B 1FY3A 1AE8H 1WOFA 2QYIA 4RSPA 2FOCA 1UTMA 2Y81A 3UAIC 3M5MA 3LGTA 2EI6A 4KELA 3EA8A 2Z9GA 3MNCA 1O32A 1E36B 2KCAA 2FTLE 4FVBA 1GJ7B 3M35A 4DCDA 4DOQA 3E0NB 1BMNH 2XXLA 2W5EA 1C5VA 1EJMA 1AIXH 1IQFA 2ANWA 2RCEA 1W7XH 1GL1A 1E1RD 1SVPA 3SUFA 1RS0A 3MH6A 4U01A 1PPEE 1V2OT 2OLGA 3Q3KA 1LTOA 2PUQH 3K65B 3SJ8A 2LNCA 2ALPA 2J38A 3GY4A 1ZPBA 1O3AA 3TITA 3E90B 4BXSA 8GCHF 1PPGE 2XBVA 3T26A 4CR9A 2G00A 3A7WA 5FBEA 2OQUA 5E0GA 5HM2A 1H9LB 4O3TA 2KCPA 1K1LA 4UFDH 1CA0B 2ZEBA 2AMDA 2GCTB 1FY4A 2FIRH 2WYGA 3GCTG 3SYJA 4INLA 2ZIQH 1O3PB 1H8IH 4OS4A 1FN6A 2O8LA 2PTNA 2YMSD 2ZFTA 4UE7H 4INKA 1O3GA 2VBCA 3SU5A 5GCHF 1L0ZA 2ZCLP 5C17A 1HB0B 3UY9A 3SO3A 1TMBH 2G4UA 1ARCA 4INHA 3UPEA 4F4OC 2VVUA 5C1XA 3E8LA 3UOPA 2VIPA 1N6YA 3PMBB 5GPIB 3M7UA 1ID5H 3FZDA 3PRBA 1GMCF 1SOTA 1LPGB 3SV9A 3ATMA 2XC0A 2AYWA 4THNH 2Z9JA 3D23A 1HPGA 3HGPA 5EJ1A 5HM9A 3QTOH 1TRMA 1J8AA 3M5LA 1GBBA 4NCYA 2O8UA 3V7TA 2FOGA 1QA7A 2ZHWH 1YYY1 1HXEH 4AORA 3VB4A 1XUKA 3GDSA 4Q80A 2VJ1A 2JJ1D 2ZGJA 3KQDA 2JKHA 3L3TA 3MNXA 1W0KD 4DG4A 3ATWA 4CRCA 1SLUB 3U9AH 2ZECA 4MPWA 1ZYOA 1GDNA 2A31A 4NIVA 4Y0ZE 4CH8B 3NXPA 1O31A 2GTBA 2Q1JA 1KTTB 2ZFFH 4HG6A 1FAXA 1EB2A 1C9PA 1DSUA 7GCHF 1XUHA 1C5SA 4A5TS 4KTCA 1FLEE 3OSYA 1MKWH 4ABHA 2VGCB 1BMFD 2GV7A 1HLTH 4X6MA 1RJXB 2A32A 4NIWA 2QF0A 5C3NA 8LPRA 2WPIS 1COWD 1UTOA 3PLPA 3RXGA 5DP5A 2ZF0H 1GJCB 1AZ8A 4WJG2 2A4GA 3OEHD 4GUXA 3M61U 1AY6H 1DWBH 5IK2D 4AG2A 2YNBA 3ZVCA 1KXCA 2BLOA 2PHBA 5A2MH 4B75A 1YY3A 2C93B 2UWLA 3HGNA 3LGYA 1D9IA 4FUBA 2P3FH 4O97A 4OS1A 2NU0E 3VB5A 1UCYK 1Z6JH 3RC5A 1EQ9A 1VGCB 1GHWH 1O2XA 3NZIA 1A0LA 1F5RA 4XBCA 1GJAB 1ZJKA 3V0XA 2JIZD 1TA2A 4IW4E 3KGPA 3EGKH 1QR3E 1DSTA 2ZGXH 2PFEA 5J4SA 3MH5A 1AN1E 1C5TA 1ZOMA 4IC5A 5C0TA 4KKDA 1GBKA 1QQ4A 2V7QD 1QTFA 5KECA 2UWPA 1GI5A 5FXLA 2D2DA 3GDUA 1MTSA 1V2LT 2G5VA 1SGFA 1NY22 1O3FA 1D3TB 5GCHG 3PMAB 3GCHB 5EGMA 4I86A 5F8XA 4Q63A 1DVAH 1PPHE 1C1TA 2J94A 2PV9B 2V3MA 2WPKS 4AB8A 4AX9H 1F0TA 1UCYH 2BD4A 2ZDMA 1OKXA 3S7HB 4X1SU 5DP3A 1ZMNA 2FDAA 3RLWH 3T27A 1GI2A 1AU8A 4CHAB 2V3HH 1QRZA 1DUEA 2SGFE 2J92A 3RXAA 3H5CB 2VINA 5DGJA 1G3BA 3MU8A 3GCHC 1VKYA 2R9PA 1EZSC 4P00A 4YXWD 3CNRA 1KLIH 3SZNA 1Z6EA 4X1RU 3CP7A 3NPSA 1GDUA 3MWIU 4IBLH 1CSOE 1EAUA 1FUJA 4ZROA 2WZQA 1IHTH 2TGPZ 1KTSB 1O3CA 3LH1A 1KIGH 4JYVH 1J14A 1NESE 1O2JA 4X1PU 3FOAA 1LVYA 3RDZA 1LPZB 1JWTA 3H09A 3AVZA 1EB1H 2JH5D 4Y7BA 3RMMH 5TCAA 3FP7E 1A2CH 1O5FH 2BD5A 3S7KB 3LDXH 2THFB 3PV4A 5ESBA 1IQJA 1BTWA 3V12A 3RXKA 1CA8B 1C5WB 4FUCA 1MBQA 2Y80A 1TNJA 4K5ZA 1DICA 2PKAA 1AVXA 3LH3A 2ZCHP 1ZRBA 1P2JA 2STAE 2BXTH 1O2OA 1RRKA 1OX1A 1QRXA 3F9GA 3BTWE 4AN7A 1O3BA 1EZQA 1QIXB 4GLYA 3KL6A 1DDJA 2XCNA 4ABBA 3OY6U 3U1IB 3ZZAA 2ZQ2A 2HNTF 1BRBE 5EOKA 2ZU4A 3GCNA 1A5GH 1A7SA 1QB1A 1NROH 2VNTA 1SQTA 2SGAA 4X1NU 2OUAA 1VITG 1ELDE 1ESAA 2Z9KA 5DSFA 3LPRA 4CRDA 2ZU5A 2GCHG 1ARBA 2EI8A 3RMOH 3A87A 3TJVA 1MU6B 1TIOA 1SLWB 1DUAA 4UEHH 1QBNA 2A4OA 3UNSA 2F3CE 4CHAC 1WUNH 2BD9A 5CHAB 2GGVB 1WU1A 5HIYA 3SNAA 5HYOA 4OS7A 2P8OC 3NKKA 1GPZA 3PLKA 1DE7H 4XOJA 1HAIH 1SGQE 5EW2H 4LZ4B 4KTUA 4MTBA 1W14U 1UTQA 1FI8A 2BB4A 5DN6D 1OS8A 1BMAA 1O2SA 2P95A 2TRMA 4ISLA 4K8BA 1GBEA 2SGQE 4BNRA 1NRPH 2OP9A 5FPYA 3FVFB 1YP9A 2QXJA 2Y82A 4HI3A 2JETB 3SZEA 1GBLA 1AKSA 2Z9IA 4Q7XA 4OGYA 2W3KA 1FAKH 4Y79A 2GZ8A 1T8MA 3TJUA 2BD3A 1G3CA 1P2MA 1G2MA 4Y10E 1DLKB 4E06H 1J15A 2C4FH 3AAUA 1CE5A 1YPHE 1MZAA 3TGKE 1QY6A 3SW2B 1V3XA 2PKSB 3QK1A 4YESB 3SBKA 2EEKA 3SU1A 3WWBA 4Z1MD 5JYIA 2F43B 1UVOA 2ZPSA 5DP7A 1W3CA 1BTZA 1P04A 3ATLA 4QT8C 1O2WA 1SPJA 3D49H 2BHGA 3RC4A 1TGNA 1D3DB 2J9NA 3TH3H 3PYHA 4B1TA 1K1IA 4F55A 5HKKD 2ZG0H 1S0QA 4XBDA 2PTCE 2VIVA 3SJKA 4WXVA 1KXFA 4ZKOU 4ZHLU 2LPRA 4Q2KA 2ESTE 3PMJA 1GBIA 1GI6A 4F49A 2BTCE 3RMNH 1TNGA 3SNDA 1OP2A 2JJ2D 4Y71A 1NBMD 4ASUD 1CO7E 4JK5A 1BRAA 1BTPA 5FPSA 1EP6A 2RA3A 3U28C 1T7CA 4X6OA 3RXIA 2AFQB 2ZHEH 4NWLA 2UWOA 1MUEB 3P8OA 1GJDB 1MTNC 4H6TA 2QV1A 2WPHS 1BMLA 2VIWA 3M5OA 1KY9A 4LK4A 2HALA 1BT7A 1S5SA 3F3BA 3TK5A 5F8ZA 3MTYA 4WMEA 5FCKA 4CBOA 2BOHB 1SGDE 1OXGA 2RDLA 3T2NA 3P17H 3PTBA 4TY7A 2PKAB 2K8IA 1PPZA 4DW2U 5JBTA 3DHKH 4UFEH 1SGCA 1YLNA 3VPKA 2W6ID 2BDGA 3BTTE 1BJVA 2G55A 2ZDLA 5BRRE 2VWLA 3A7ZA 2VIOA 4WF8A 3UNRA 1LQDB 2ZZUH 1RFNA 1U6QA 1C5MD 2BOKA 1RD3B 4IMZA 1T32A 1FX0B 1GVZA 2GCHF 3BEUA 3RXHA 1CHGA 4MPXA 3M7TA 1W0ZU 1DXPA 1EZUC 1MH0A 1HJAC 4UONA 1W0JD 2R2MB 1XUGA 1C1UH 1JOUB 2GMTB 3UFAA 3EE7A 4D8NA 5EXMA 2ZGHA 1N8OC 1MMJN 1WYKA 2ZGBH 2WPMS 3RXOA 3BTGE 3K6ZA 1VJ9U 2AIPA 1NT1A 1O3KA 5FPTA 1UK4A 1THRH 2XWAA 2RG3A 7ESTE 3N7EA 5E0HA 2AS9A 4NA9H 1NM6A 1GHAG 1D6RA 1LKBA 3MFJA 1TBRH 2L6OA 1C5RA 2P8OB 3RU4T 3T5FH 3KYGA 1TGSZ 1ZPZA 2AGIX 3SNBA 1VGCC 3WY8A 2QF3A 3DSPA 1SMFE 2FTMA 1ZTJA 3E6PH 1ZR0A 2FI5E 3FANA 1MTNB 2FS9A 5C5NA 2FX4A 5SGAE 2M5TA 1TGBA 4H42U 1BOQA 1ELGA 1ANEA 3TGJE 2V0BA 4IN1A 2BQ6B 3SUGA 1VCPA 4AZ2B 1AB9B 1AD8H 1GI9B 5TCCA 4YLUA 1TX6A 5B6OA 1NU9A 6GCHF 4B74A 3ELAH 2QA9E 1TYNA 4Q7YA 3SV7A 3MQKC 2BY9X 1TAWA 4NZQA 1WTHD 1K1PA 2GJGA 2QE7D 1BHXF 1E38B 1FDPA 2BY8X 4A92A 2I6SA 2A5KA 3RXJA 1QZ8A 4NG9H 1P03A 1GGDC 4X1QU 3FP8E 1CGIE 2ZHDA 2LP6A 1V2UT 1AWHB 1BDAA 2OC0A 3Q3XA 2OC7A 2SNVA 2XW9A 3SI3H 1QL9A 2GP9B 2ZP0H 5AFZH 1AFQC 3TIUA 1FIZA 1H8HD 5K7RA 1AWFH 1W13U 4WWYA 3QGJA 2HGTH 2CF9H 2ZFQH 4MNWA 3SHCH 1JXPA 1K1JA 4LXBH 1LHCH 4Y8YA 3KQBA 3GCOA 1AMHA 1O3MA 4AGKA 3B8JA 3SJOA 4FUFA 1AZZA 2ZFPH 3ZZ3A 1L1GA 2F4LA 3O8CA 1P3CA 3M36A 4YTAA 2VH6A 3U69H 4BTUB 1GVKB 1GI0A 2ZNKH 3LIWA 1MU8B 3FKSD 3Q77A 1O5AB 1S6FA 2WPDD 3A80A 1YM0A 4JYUH 2H1UA 3TLOA 3UQOA 1LVBA 1C1RA 1O2RA 3M37A 3NK8A 1GHBF 2AHME 1C1QA 3MI4A 3SNEA 2Y5GA 2ILNA 3TJNA 1CA0C 1JBUH 1ZMLA 2BLWA 2WUCA 4UDWH 3QN7A 2AMQA 3RXUA 1AHTH 1ANDA 3ODDA 2I6QA 4D76A 2EC9H 1DLEA 4WMFA 2R3YA 3ZVFA 1QHRB 4DT4A 4ACAA 1K28D 4J2YB 4X2VA 1V2JT 4TYDA 1F5KU 2NU1E 4K8YA 1BJUA 1C1SA 2HNTC 2BDAA 2C90B 1OYQA 2VH0A 5PTPA 1O2GH 3VXEH 1G37A 1O2ZA 3RUOA 3WW7A 1FNIA 2J98B 1RXPA 2TBSA 4ZXYH 7GCHG 1KLTA 1PQAA 1CBWC 4A6LA 1FY8E 3ZZ8A 1WDIA 5C5OA 1SGRE 1HCGA 5ESTE 2P3TB 1TWXB 1DX5M 3QWCH 2Z9LA 5AHGH 4TSFD 1DS2E 1V2ST 1F0RA 4HTCH 4J1YA 5L30H 1HAGE 1W11U 2GKVE 1LVOA 1HAVB 3S0NA 1Y59T 3SV8A 1FV9A 1C5UA 2V6NA 5C1YA 2G52A 4NZLA 1FJSA 3L33A 1TA6A 5A8XA 1O3HA 1TGTA 2XTTB 1P9SA 4CBNA 1V2WT 2AH4X 1W7GH 2PR3A 2H5CA 4Y7AA 1OHHD 3ATIA 1TNHA 4ZHMU 3GY5A 1Y5AT 1C4V2 3F0PA 5T3HA 3A81A 3E1XB 3KQEA 3P92A 1ELVA 1SR5C 1G32B 4ISOA 3BIVH 5EQRA 1S83A 5DP4A 3UNQA 1LHGH 4Y8XA 4TWWA 2ZC9H 9ESTA 1Z8RA 4AGJA 4IN2A 3U1JB 1V2PT 4FUIA 2AEIH 1N6XA 4NA8A 1C5LH 5DP8A 2F9PA 3A8BA 1V2TT 1KSNA 2VVCA 3AW0A 2CF8H 4X8TH 1G2LA 1NO9H 4TT3D 1D6WA 1DFPA 2B9LA 2GCTC 3DFLA 1HBTH 2ZQ1A 3V3MA 1GJ8B 4YOJA 1UJ1A 4ABDA 5HXFA 1UW7A 2HNTE 4ESTE 5A8YA 3VG8A 2ZGCA 1IAUA 1PFXC 4ZKRU 1E0FD 3P6ZB 5E8EH 5JBCS 1UO6A 3U8RH 1BITA 3QDZB 1BRCE 3BIUH 1FQ3A 1PPFE 1WV7H 1GHAF 1BIOA 4DGJA 1AFQB 5E2OA 1S84A 1GJ4H 3W94A 1GCTC 2STBE 1EFRD 6ESTA 1QJ1B 2AGGX 3PV2A 4Y6DA 4FXGH 1O39A 3SUEA 1O2MA 3A89A 3SGBE 1C5NH 4UD9H 3OE7D 1P2OA 1FXYA 1LCYA 2WV9A 3E0PB 4OS5A 4NSYA 1O2KA 3BEFB 1TE0A 1GBFA 2A0QB 4JCNA 2NU3E 4K3JA 1O2NA 1A3BH 1TX7A 2B7DH 4FUDA 5C20A 1QBOA 1BZXE 1XUFA 1ZHPA 3MO6A 3R0FA 2OD3B 2XC4A 5EXNA 1TRNA 1EP5A 1NBME 1AQ7A 1MABB 1AB9C 2KFWA 3T62A 4AFSA 2FESH 1AUTC 1UVTH 1P10A 1O3JA 1NFUA 3BG4B 1HNEE 4XBBA 5AFYH 1HIAA 1QA0A 1ORFA 4GHQA 5CHBA 1P09A 4MNXA 1S82A 1O3IA 4NIYA 4ABAA 1PQ7A 2ZPQA 4RI0A 2OTVA 3OYPA 3KN2A 2ZI2H 1KDQA 1YCPM 1HAYB 3ZZCA 1QGFA 1W8BH 4D7GA 3P8FA 3SUDA 5CMXH 3OTJE 3A88A 3URDA 3AAVA 1E34B 3TNTA 2ZDNA 3RXFA 2ZTZA 4B76A 8ESTE 2DE9A 3RXDA 2F9UA 1H1BA 1BBRH 1Y5BT 1LMWB 2FODA 2IJOB 2KX4A 2R3UA 5DO4H 1O5GH 3Q76A 2FOHA 3ITIA 4D7FA 1H9HE 1NFYA 3HK3B 2SGDE 4SGBE 1J9CH 3RXEA 4FU8A 4BAKB 2B8OH 2FM2A 2FOEA 1EZXC 2QXGA 4P02A 4CR5A 1ANBA 3RC6A 4A7IB 1LHDH 1BTYA 1GHBG 4ZKNU 3LKWA 1P2KA 1IHSH 1EX3A 1RIWB 2FOMB 3RXPA 1Z8GA 5FX5A 1VITF 1Z1JA 4CREA 1FZZA 3ENSB 2GMTC 2ALVA 1CGHA 2BX3A 1RTLA 2A4RA 1GI4A 5TJXA 4X0WU 3VB6A 1QBVH 1UTNA 1XVMA 1D3QB 1OWJA 1WQSA 3LGVA 3BTQE 3ZZ5A 1LVMA 4ZMAH 5GNDA 1O0DH 3BSQA 1RIWC 3ZV8A 3SJIA 4RKOB 4B6EA 1VZQH 1LHEH 2YMSB 1L4ZA 1OWHA 3M5NA 2CK3D 4BAHB 3TVJB 2BVXH 1TOMH 2PP6A 5ETXA 1C5XB 1AGJA 1P05A 2Q6FA 4ISHH 3ODFA 3ZIAD 1FY1A 1NC6A 2FLRH 1MKXK 4CRGA 2FLBH 4XE4A 3GY7A 3TGIE 1OWIA 1VCQA 2BLVA 2Z3DA 1TONA 4X8UH 4FUJA 1O35A 5L2ZH 1SFQB 2ASUB 1CHOG 5E2PA 5A0CA 3KQCA 2C3SA 5ABWA 3SGQE 1GI8B 1KMHB 1T8NA 2OQ5A 4RN6A 1LQEA 5EIYA 4IMQA 1ELTA 4ABEA 5HGGA 4X6PA 1Q3XA 4IS5A 2H2ZA 3UOUA 1IQLA 2FI4E 3O8RA 1VR1H 2F83A 4K69A 1BTXA 2BMGB 3RM0H 4AFZA 3U8OH 1ETRH 1TPPA 2QF4A 1NU7B 1YPEH 5HMAA 1C2GA 3GY3A 4I8KA 1EUFA 1DWCH 1W0YH 3VGCB 1HAPH 4ZUHA 4Y0YE 4JZIA 2V3OH 1HV7A 2VIDA 1XUJA 1V2KT 1GG6C 4WH6A 1DT2A 3ZZ6A 2R0KA 1XKBC 3B9FH 2FX6A 1NRQH 1MZDA 2Y5HA 1YPMH 2OCVB 2YNAA 1ZRKA 1QL7A 3GY2A 2GDDA 2JETC 2ZTXA 1ELAA 1ESBA 3UWIA 1O30A 2F9BH 2LELA 1FN8A 1GJ6A 2BDIA 1A5IA 2OC8A 1O38A 5EW1H 3LGWA 4JZ1A 2W26A 2WYJA 3A85A 1K22H 3EA7A 2UUYA 2SNWA 1O3EA 3SU4A 1YPGH 1DXWA 2ZDAH 2FOAA 3PV5A 1S0RA 4GCHF 1KXAA 1HFDA 1YCPH 2A7HA 1YPLH 1ELFA 3ZVDA 4BAMB 4CH2B 2BY5X 7LPRA 2IJD1 3A84A 1DOJA 1ABJH 3GDVA 2G81E 4ZXXH 4YT7H 1P02A 1KDQB 5GXPA 3GICB 2BDYA 1GMHF 1NFWA 3FO8D 3CS7A 2GZ7A 3W95A 2BD2A 4O9VA 3DCLA 2OC1A 4XD7D 1NRNH 1TRYA 1EPTC 1C1PA 2GVFA 1V2VT 3SJ9A 4NSVA 1CT4E 1C2LA 1P01A 1TABE 1YBWA 1YLDA 4B73A 4K60A 4H6SB 2KCYA 3PWCA 3MNSA 2ZCKP 1GVLA 1CQQA 2Z94A 1VJAU 4X6NA 3F9EA 2A2XH 3PO1C 5EU8A 2DE8A 5LH8A 2RDEA 4E05H 5KGOA 1C1OA 1FONA 2QF5A 2UUKB 4MLFB
chains in the Genus database with same CATH topology
1TALA 1Y3XA 2BDHA 1YC0A 3A7VA 4ZKSU 3LGIA 3PM3A 3DA9B 3LGUA 3I29A 5DP6A 1ZTKA 1KXDA 3RXCA 1P0SH 3U8TH 1OYTH 1HJ8A 3FAOA 3N7OA 1YPKH 1O36A 3SV6A 1SI5H 2FOBA 5JBAS 4ABGA 1CHOF 4MNVA 3DD2H 1MCTA 1S85A 1ETTH 4Y8ZA 1C2IA 2O8WA 1ZZZA 3BTDE 4DJZB 1LPKB 2O8TA 2QIQA 1LHFH 5EPNA 3V13A 1D3PB 3JZ1B 4K2YA 3CENA 2GT8A 3ZYDA 1C2EA 2PW8H 4BXWA 1OWDA 3MHWU 1P11E 1BA8B 1C2MA 1HJAB 3P8NA 3GISB 1P2IA 2BZAA 1FY5A 1TB6H 5C67A 4LZ1H 1TNIA 2GX4A 5CHAC 5A8ZA 3MO3A 3SU2A 2FXRA 1SLVB 2F9OA 1BUIA 1INCA 3RXSA 4NA7A 1GBAA 1JRSA 1B0FA 2CGAA 3MYWA 1HAZB 1YLCA 4JK6A 1NZQH 4XDEA 1EJAA 3A7YA 4I8JA 1LO6A 1PPBH 3BTHE 3Q00A 2FP7B 4Z0KA 1MTUA 1OWKA 3RXBA 2R2WU 5AF9H 2AGEX 5LPRA 4GHTA 5LGOA 2OBQA 1W2KH 4FUHA 2A5AA 2A7JA 2Q6GA 1C4U2 2PSXA 3ZVGA 1JIMA 1V2RT 2ZWLH 2XBWA 8GCHG 4UFFH 1PJPA 5EQQA 1YPHC 4I31A 4E7RG 1MD7A 4D9RA 1OP0A 3S9BA 3KF2A 1UMAH 4DURA 3DFJA 1GBHA 1OPHB 1AI8H 4A1TA 3NWUA 1MKWK 3ZV9A 1HUTH 1DWDH 1QCPA 1HAHH 5JB9S 3B23B 2WINI 2ZDVH 3EYDA 1GMDG 2F9VA 2A4QA 4I33A 4JYTA 1O33A 4MVNA 3M7QA 1NFXA 3LJJA 3F68H 5A09A 1MAXA 4TY6A 1GI1A 4A1XA 4SGAE 1EKBB 1WBGB 3UUZA 4YZUA 1ZMJA 3QGNB 5DKMA 3CS0A 3ZZ4A 1IQGA 3KCGH 3UWJH 1UHBA 5J4QA 3STIA 1GMCG 1XUIA 2BQWB 3IITA 1K1NA 1EAIA 2IN2A 3T25A 1SQOA 3TU7H 3URCA 2QN5T 3VFEA 1M9UA 5I46H 2FEQH 4ABJA 2JH0D 2VVVA 1V2MT 1C1NA 1FIWA 1OOKB 4Z6AH 4AB9A 1IQEA 4U2WA 2PGQB 2BYAX 1ZJDA 2B5TB 2CXVA 2XYAA 3Q3YA 5GDSH 4LOYH 2ODYB 1C1MA 4AYVB 1TOCB 3RLYH 1TPAE 1XVOA 3K2UA 3A8DA 4NFFA 3S9AA 3NCLA 1KXEA 1O2VA 1TBQH 3SOSA 3QTVH 3SQHE 1Y3VA 2ZU2A 1A5HA 2KAIA 2BQ7B 5GJ4B 1JRTA 2Z3EA 1RGQA 1BMMH 2BVRH 1T4UH 2NU4E 1ETSH 1SGYE 2Y7ZA 1ACBE 4AFUA 4ISNA 3RXLA 2G5NA 3SGAE 1P2NA 1PYTC 1GI7B 1A0HB 1SSXA 2VIQA 4YT6H 3NUMA 1O5EH 1Z1IA 3UTUH 2TGAA 5FCRA 1H9IE 4NFEA 6LPRA 4MPVA 5FBIA 1MQ6A 2OINA 2OXSA 1A46H 3EA9A 2ZU3A 2ZKSA 3F6UH 1ANCA 1WTGH 2HPPH 4R8TB 3M3VA 1H8DH 2ZPRA 2BD7A 3AW1A 4OS6A 2ZFRH 4MPUA 1P2QA 5L6NH 1K1MA 1GMDF 2GV6A 2TIOA 1EATA 3E91A 1HAVA 5C2ZA 3KHVA 1Z71A 5T6FA 1SC8U 1ZPCA 4I8LA 1AUJA 3RXRA 1D4PB 1C2FA 1YF4A 1B5GH 1L1JA 1UVUH 3QZRA 4I8HA 5G4BA 2O9QA 1BHXB 1T8LA 2OBOA 2XRCA 1OWEA 2IOTA 3RMLH 1F7ZA 2HWLB 7KMEH 1B7XB 2J2UA 1O3DA 2FYQA 1SG8B 1DY8A 3C27B 2P59A 4CRBA 1HJ9A 1O2PA 1QURH 5DPAA 3ZZBA 1HGTH 1NN6A 1GDQA 3A7TA 3MO9A 1Y3WA 3TK6A 3A8AA 2BXUH 1C1VH 1BTHH 4GPGA 3R3GB 3RU4D 4NWKA 5BPEA 2ZO3H 1MTWA 2ZTYA 4NGAH 1CT0E 1UVPA 3KEEA 2W7SA 5FAHA 1TPSA 2H9EH 1BCUH 1EXFA 1DM4B 1JIRA 5I25A 1EAWA 3ZVEA 2P94A 2SGEE 3AASA 1NRRH 3ATKA 3L6PA 4YOIA 1S81A 3BF6H 2Y7XA 4FU9A 4VGCB 2Z6BD 1UTJA 2AMPA 2AERH 1HAXB 4YLQH 1UVSH 2P93A 4MQAA 1KLJH 1AKSB 1BB0B 2W7UA 1XM1A 5T6GA 1GCDA 4OS2A 1XX9A 2BD8A 1SHHB 1DY9A 4DT7B 2FMJA 1O2HA 3SU3A 2Y6TA 5FX6A 3BTKE 4AOQA 4R0IA 2XWBI 1SGPE 1Z8IB 3RXTA 1E35B 3SQEE 1C5ZB 1GI3A 1ELCA 2FS8A 1TQ0B 3TJOA 3H7TA 4Y11E 5DG6A 3MMGA 4ABFA 1WQVH 5AVDA 9LPRA 5EPYA 1ABIH 2PSYA 1THSH 3HKJB 3MOCA 5JDUB 1EOLA 1TQ7B 1GBDA 3LC5A 2UUFB 3IG6B 1O5DH 1P8VC 1GHVH 2FZZA 2J4IA 3TPIZ 2VU8E 3ZZ7A 1O2YA 2H9HA 1GCTB 3BG4C 4HFPB 4UFGH 4X8VH 2ZU1A 3D62A 1MQ5A 4X2XA 3U98H 2ANMH 1HRTH 2QCYA 3O8DA 3RM2H 2VWNA 1Y3YA 4CRAA 3ZZ9A 1TNKA 2ANKH 2ZHQH 1QJ7B 1TMUH 4YO9A 3RU4E 2PKSC 4BANB 1IQNA 1G3EA 2EA3A 1EAXA 1C9TA 3SU0A 1O2TA 4XSKU 1TLDA 1V6DA 2D1JA 2VWOA 3EAJA 1KYNA 2WUBA 2XNIA 1Y8TA 3P70B 2ANYA 2TGDA 2QAAA 4AG1A 1SFIA 1PYTD 1J17T 2FYRA 1V2QT 5EODA 5T6DA 1C2HA 3RXMA 4JZDH 1SBWA 1BBRK 1LKAA 4WVPE 1W10U 1O34A 1QQUA 3ESTA 3BTME 5IYTA 2HRVA 2BX4A 1TX8A 2SFAA 1P9UA 3EQ0H 1ZGVA 4HGCA 2FOFA 1L4DA 5JBBS 3KNXA 1UK3A 3MH4A 3ZZDA 3ZYEA 4FU7A 2J95A 3K6YA 1T4VH 4B71A 1AFEH 3E16B 3STJA 2XCFA 1CBWB 4MNYA 3MU0A 1CVWH 1NS3A 5K0HA 2ZA5A 3PMHB 2VWMA 3SORA 3FFGA 1QL8A 4X8SH 2BY6X 2BZ6H 3PWBA 1DANH 2BM2A 4KGAA 3LC3A 4BAQB 1SOZA 2A2QH 3DT0H 3S9CA 2F91A 3GYLB 4KTSA 3PB1E 1HDTH 5JPMH 1PPCE 1QB9A 3BTEE 3TH4H 2AIQA 1G3DA 2BLQA 1GG6B 2Y5FA 1N1LA 2NU2E 2A7CA 3BTFE 2WV4A 1BBRE 1A0JA 3GYMA 2C8YB 3F9FA 4YOGA 3FP6E 3I77A 1L2EA 1P12E 1C1WH 1ESTA 2WPJS 1Q31A 2BDBA 4DIHH 2C8ZB 3VB3A 3K9XB 1BTUA 4TWYA 2ODQA 2BDCA 1SGTA 1HAOH 1IOEA 2CN0H 2QGRA 4M7GA 1ZHMA 1O2LA 2PGBB 4FUGA 4K1EA 1GBJA 2G4TA 2FPZA 2CHAC 2GDEH 1E37B 3JZ2B 3A82A 3UR6A 2VB0A 5DP9A 3M3TA 4Y76A 4ZHAA 5A0BA 2BVSH 1GJBB 2QXHA 1PQ8A 5F03A 3HK6B 4BTIB 1O5CB 3D65E 2P16A 3LU9B 2ODPA 1W12U 2A45B 5IDKA 1IQIA 3HKIB 1K1OA 1GHYH 1AVWA 1UTPA 1P3EA 2ZFSA 1AVGH 2XC5A 3SI4H 4GCHG 1C5QA 1X7AC 1IQKA 2QY0B 3GY8A 4WXIA 1OSSA 3HATH 3QUMP 1NRSH 1H4WA 1C5YB 2PWXA 5GIBA 4DY7B 2CHAB 3MU5A 3GOVB 3LT3A 2C8WB 3E3TA 4Q7ZA 4MDSA 1G9IE 2G8TA 1F0UA 2CJIA 1F5LA 1UK2A 2SGPE 1F0SA 1HYLA 2C8XB 1GBCA 1FPHH 1A4WH 5FHTA 3SHAH 3H7OA 2O8MA 3RP2A 3SN8A 1A61H 3F1SB 2RA0A 3F9HA 3MU1A 3DUXH 4JZFH 5A0AE 1O2IA 5L2YH 2VGCC 2WV5A 1GJ5H 3QLPH 1O3LA 2XBYA 1TBZH 1LDTT 1THPB 1O3OA 3M3SA 1MD8A 1EOJA 3OY5U 1SLXB 1ZHRA 1MAYA 2ZDKA 1B0EA 3SV2H 2H5DA 3TH2H 1ZSJA 1GBTA 3P8GA 4XFQA 3ZVBA 1IQMA 2QXIA 1NTPA 1CU1A 1ELBA 1HIAB 3P95A 4OGXA 4U30A 2Z3CA 4DIIH 1GGDB 1O37A 3UREA 4GVUA 1CGJE 3I78A 4JZEH 1WCZA 4HZHA 3LONA 1UTKA 1EPTA 2PUXB 2K1QA 2Z7FE 2HPQH 4X2WA 4AFQA 1ZGIA 1VCWA 1T8OA 4KP0A 1MTVA 1BQYA 3UIRA 1WAYB 2B0FA 3UR9A 1RTFB 4TPYA 2TGTA 6GCHG 1MBMA 1SGFG 4B2AA 3QX5H 3MU4A 1YKTA 2J34A 3OX7U 3VEQB 1GWAA 5E0JA 2ZHFH 4O3UA 4TPIZ 1YPJH 1DWEH 1TFXA 2A1DB 2EI7A 1NPMA 1EJNA 1PQ5A 1F2SE 1DITH 3VXFH 2QC2A 1C5PA 1K21H 4K1SA 3RXVA 5CE1A 5GWZA 1Y5UT 4B2CA 1IQHA 3LJOA 3TK9A 5C1UA 1KXBA 4WY3A 2XBXA 1P06A 2V35A 3PO1B 4AYYB 1A3EH 1A1RA 1MKXH 4I7YH 2GZ9A 1QRWA 1UTLM 2H9TH 2YOLA 1SGNE 1Q2WA 4BTTB 4D9QA 4X2YA 4YM9A 1GHZA 1O2QA 4CRFA 4GAWA 1ZSKA 1OP8A 1WSSH 1XXFA 2H6MA 3A7XA 3BN9A 1ELEE 2Q6DA 2CMYA 4VGCC 4U32A 4BOHA 4K1TA 1XMNB 4WH8A 4E7NA 4O03A 4IGDA 2NWNA 4GSOA 3SNCA 1FMGA 2FO9A 3QZQA 1SGIB 2HLCA 3GCTF 2PLXA 6CHAB 1K9OE 1L1NA 1DPOA 3BG8A 3PROA 1GL0E 1SGEE 1GHXH 4FUEA 1EPTB 3MH7A 1C5OH 1GMHG 2UUJB 1XKAC 1G36A 4ZH8A 1SQAA 5F8TA 1UCYE 5LPFA 3PLBA 1YCPK 3MNBA 2D8WA 4NIXA 5EG4A 4BAOB 1GBMA 1TMTH 4IC6A 2R0LA 1SL3A 1Y3UA 1Z7KA 3S69A 4RKJB 4FVDA 1MCVA 3T28A 1SHYA 1CT2E 1FPCH 4PROA 2A5IA 1QNJA 2WPLS 3EDXB 5EXLA 4B2BA 2KAIB 3UQVA 1HXFH 4ASHA 1BRUP 2ULLA 3QO6A 5LPEA 1QB6A 4H4FA 5EQSA 1C2JA 2IPHA 1K2I1 1ZTLA 4I32A 3BV9B 1G30B 3C1KA 1UHBB 4A1VA 6CHAC 4ISIH 1TGCA 1C2KA 2CV3A 5H4IB 1C4Y2 1O3NA 1QJ6B 2FWWA 2HVXA 3VGCC 1ZLRA 3EE0B 2W3IA 3A83A 1N8OB 1VITH 3A8CA 1JMOH 3GY6A 5DK1A 1ZSLA 4DVAU 3LOXA 4WMDA 3FZZA 1XXDA 3IWMA 2F9NA 2TPIZ 4ZAEA 3VB7A 3TNSA 2P3UB 1QFKH 3A86A 3HPTB 3O8BA 2G51A 3T29A 3BEIB 1V2NT 2JH6D 8KME2 1C2DA 1F92A 3RXQA 5F6MA 1O5BB 2FI3E 1O2UA 5JB8S 4MG3A 1TPOA 1TNLA 4ABIA 1YGCH 4I8GA 2BY7X 1GJ9B 5DJ7A 1J16A 3KIDU 2D26C 2DUCA 3ZVAA 1S6HA 3SU6A 2HOBA 1RTKA 1AE5A 1EASA 3PTNA 4JMYA 1SB1H 1T31A 3G01A 1Z8JB 3OU0A 1AO5A 2GT7A 1P57B 2GD4B 1FY3A 1AE8H 1WOFA 2QYIA 4RSPA 2FOCA 1UTMA 2Y81A 3M5MA 3LGTA 2EI6A 4KELA 3EA8A 2Z9GA 3MNCA 1O32A 1E36B 2FTLE 4FVBA 1GJ7B 3M35A 4DCDA 4DOQA 3E0NB 1BMNH 2XXLA 2W5EA 1C5VA 1EJMA 1AIXH 1IQFA 2ANWA 2RCEA 1W7XH 1GL1A 1SVPA 3SUFA 1RS0A 3MH6A 4U01A 1PPEE 1V2OT 2OLGA 3Q3KA 1LTOA 2PUQH 3K65B 3SJ8A 2LNCA 2ALPA 2J38A 3GY4A 1ZPBA 1O3AA 3TITA 3E90B 4BXSA 8GCHF 1PPGE 2XBVA 3T26A 4CR9A 2G00A 3A7WA 5FBEA 2OQUA 5E0GA 5HM2A 1H9LB 4O3TA 1K1LA 4UFDH 1CA0B 2ZEBA 2AMDA 2GCTB 1FY4A 2FIRH 2WYGA 3GCTG 4INLA 2ZIQH 1O3PB 1H8IH 4OS4A 1FN6A 2O8LA 2PTNA 2ZFTA 4UE7H 4INKA 1O3GA 3SU5A 5GCHF 1L0ZA 2ZCLP 1HB0B 3UY9A 3SO3A 1TMBH 2G4UA 1ARCA 4INHA 3UPEA 4F4OC 2VVUA 5C1XA 3E8LA 3UOPA 2VIPA 1N6YA 3PMBB 5GPIB 3M7UA 1ID5H 3FZDA 1GMCF 1SOTA 1LPGB 3SV9A 3ATMA 2XC0A 2AYWA 4THNH 2Z9JA 3D23A 1HPGA 3HGPA 5HM9A 3QTOH 1TRMA 1J8AA 3M5LA 1GBBA 4NCYA 2O8UA 3V7TA 2FOGA 1QA7A 2ZHWH 1YYY1 1HXEH 4AORA 3VB4A 1XUKA 3GDSA 4Q80A 2VJ1A 2ZGJA 3KQDA 2JKHA 3L3TA 3MNXA 4DG4A 3ATWA 4CRCA 1SLUB 3U9AH 2ZECA 4MPWA 1ZYOA 1GDNA 2A31A 4NIVA 4Y0ZE 4CH8B 3NXPA 1O31A 2GTBA 2Q1JA 1KTTB 2ZFFH 1FAXA 1EB2A 1C9PA 1DSUA 7GCHF 1XUHA 1C5SA 4A5TS 4KTCA 1FLEE 3OSYA 1MKWH 4ABHA 2VGCB 2GV7A 1HLTH 4X6MA 1RJXB 2A32A 4NIWA