3KHVA

Crystal structures of urokinase-type plasminogen activator in complex with 4-(aminomethyl) benzoic acid and 4-(aminomethyl-phenyl)-methanol
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
246
structure length
239
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSAAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Urokinase-type Plasminogen Activator in Complex with 4-(Aminomethyl) Benzoic Acid and 4-(Aminomethyl-phenyl)-methanol
rcsb
molecule keywords Urokinase-type plasminogen activator
source organism Homo sapiens
molecule tags Hydrolase
total genus 55
structure length 239
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3khvA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3khvA01
1FAXA 1P03A 1GL1A 2GKVE 1SPJA 3B9FH 3BG8A 4GAWA 2TGPZ 2GZ8A 2F9UA 2HALA 1O2RA 1LTOA 1F7ZA 3TK9A 3MO9A 2V6NA 2A4OA 3Q76A 3ZZAA 4ESTE 3H7TA 1TIOA 1W14U 1J15A 4ZHMU 1QB6A 5DP3A 2Q6FA 5G4BA 1TMTH 1SLUB 5C3NA 2ZTXA 1FZZA 3U8OH 3M5MA 1GI3A 4K3JA 1LVMA 2F91A 1K1JA 5LPEA 1GGDB 2UUJB 2ZFPH 1A5GH 1ID5H 2H9TH 1C5LH 4F4OC 4AGJA 1T8MA 1EB1H 1CT2E 1O3JA 4IMQA 3BEFB 2QXGA 3ZVBA 2Y5HA 4Y6DA 3RXMA 1P09A 1C1RA 2PTCE 4SGBE 3RXFA 1MZDA 4IN2A 3O8CA 2J9NA 2AEIH 2TGAA 4GLYA 4JYUH 4K69A 3RC5A 2B7DH 3M3TA 1XXDA 3P8OA 1HJAC 2ZCHP 4XBBA 5DP9A 4FUDA 1SLXB 5FCRA 2ZQ2A 1LVBA 2STAE 2V3HH 5SGAE 1F0UA 1XMNB 2VINA 2OINA 5A8ZA 3OY5U 5EQSA 1TPSA 4Q7ZA 4CHAC 2AIPA 4AFZA 2STBE 2BDGA 1NFWA 3LC3A 1T8NA 3ATMA 1AIXH 5EODA 1LQEA 2JKHA 1ABJH 2ILNA 1MQ6A 3EA8A 3H7OA 3LIWA 1O2NA 2QV1A 1NN6A 1P2KA 2EI6A 2GCTB 5A8XA 3SU4A 3E8LA 3SUEA 1DFPA 4UDWH 3O8DA 3H5CB 1H4WA 1Z8RA 3GICB 4X1NU 3MU1A 6CHAC 4B1TA 4LXBH 1GJCB 1RGQA 1PQ8A 3RU4T 1BBRE 1KXDA 1GBCA 2ZTZA 1SFQB 1XX9A 5K7RA 2ZDMA 1S85A 3U8RH 1AKSB 5GDSH 1C1UH 1THSH 3R3GB 1EJMA 1SGCA 2FODA 1GBLA 1FIWA 2NU1E 3AW0A 1C2KA 2SNWA 1K2I1 3UWJH 3ZVGA 4ZHLU 3P8NA 2BYAX 2ZU2A 3PO1B 2ZU1A 2XYAA 3LGVA 4A5TS 4YZUA 5EQRA 1SL3A 1ETTH 2FWWA 5J4QA 3UWIA 1SOTA 2ODQA 1K9OE 3VXFH 1O3PB 1UVTH 1W2KH 1C1OA 1EUFA 4MTBA 2XC0A 1DUEA 4JZ1A 5E0GA 3G01A 1SGIB 4BAQB 3FP7E 3A7VA 4WXVA 7GCHF 1V2OT 1FY4A 1GJBB 2QN5T 3KHVA 1QURH 2ZHQH 3FVFB 4XE4A 2W7UA 3M7QA 1DDJA 4FUFA 1O3KA 1O31A 2QF3A 2CHAB 1C2EA 5HMAA 2ZIQH 1AFQC 2P95A 4YOGA 4NFFA 2BXUH 1AZZA 4ABAA 1XXFA 1O2OA 5T6FA 2CF8H 2ESTE 1NTPA 1TAWA 3SO3A 1BMMH 1EB2A 2Z9IA 3ZYDA 1TGTA 2UUYA 1TB6H 3PMBB 4K5ZA 3HGPA 2OXSA 3LOXA 3HPTB 5T3HA 3A86A 2WYGA 1AWHB 4NWKA 1HPGA 1LO6A 4ISNA 2FLRH 2FI5E 3FAOA 3SOSA 7KMEH 1TOMH 1PYTD 2BD5A 4O03A 4IS5A 1P05A 2ZG0H 1ELEE 2VGCB 1DLEA 1LHCH 4B71A 1XKAC 1Y59T 1MUEB 5AVDA 1ZPCA 4MNWA 1UTLM 3MI4A 3B8JA 2UUKB 1DWCH 4IW4E 2RA3A 1O32A 1ZGIA 3P6ZB 3EE0B 4ABGA 4NCYA 2OQUA 4Y0ZE 1EX3A 1AHTH 2RCEA 2TBSA 2ZFTA 2Z3DA 3LONA 2PKAB 1LMWB 2K1QA 2G4UA 1EASA 2GCHF 3M35A 1TBRH 5AFZH 4UONA 4IC6A 1YCPK 1C1VH 5FPTA 1EKBB 5LPRA 2F9BH 1N6XA 4E05H 4CR5A 3KQCA 4NSVA 3QX5H 4AOQA 1A0HB 3T62A 1YGCH 2R3YA 1CGHA 1LVOA 3ZZCA 1TX6A 5L30H 4NA8A 2H1UA 1O35A 5E2OA 1NFXA 4H6SB 3UR6A 3U69H 2NU2E 2GD4B 4BANB 3ODDA 3LJOA 1MTNC 3ZZ9A 1TGNA 2THFB 2XW9A 1GJ9B 1B5GH 1E36B 4UFGH 4LZ4B 1ZMJA 3OSYA 2HPQH 4B2CA 1TPAE 1JBUH 1BJVA 3KGPA 1NT1A 4UEHH 1T7CA 3SUDA 1WV7H 1DWEH 1P12E 4NGAH 3TITA 2BDHA 8KME2 1KIGH 2SNVA 2VJ1A 1TBZH 1JWTA 2P3TB 1X7AC 1S6FA 1Q31A 5GIBA 1N8OB 2VWLA 3GDUA 8GCHF 1QBOA 6LPRA 2VU8E 3PO1C 1E35B 3VGCC 1RJXB 1C1NA 3UPEA 1O2JA 4I31A 1O2SA 6GCHF 1G36A 3V3MA 1QL7A 4FUBA 2D26C 1O3DA 1C5RA 1QJ6B 2Y80A 3WY8A 2G55A 3TK5A 1GG6B 3FP8E 4D9QA 4NIWA 4FU8A 1O3EA 3N7OA 2FOAA 1FN8A 2M5TA 2W26A 2AFQB 3ZV8A 4Y71A 2Z6BD 2FO9A 3CP7A 2XXLA 4ABIA 1P0SH 1K1OA 1W13U 1A0LA 1GCTB 1AB9B 2PLXA 5GWZA 5IYTA 1UCYH 4Y10E 5C67A 2WPHS 1ELAA 2B0FA 3NKKA 1C2LA 3K2UA 1FY8E 1SB1H 3LJJA 3PLPA 2WINI 4GCHG 1ZHMA 3ZZ5A 3LGUA 5FBEA 4KTSA 2Z9JA 3V13A 3RXRA 4I8KA 5LGOA 2BDIA 1KTTB 1P10A 3MNCA 2EC9H 5GJ4B 2V35A 1E34B 1T4UH 5JBAS 3TIUA 4RKOB 3S69A 2FIRH 1HAGE 1KYNA 1BCUH 1BJUA 3OU0A 1QNJA 3LKWA 1MCVA 2ZGCA 4JZIA 3GISB 1E0FD 4UFFH 3ZZDA 2XBWA 3T28A 2ASUB 1OYQA 1BTHH 2O8TA 5DK1A 3A89A 1FI8A 1RXPA 1O3BA 1V2PT 1GJ6A 1SFIA 2LPRA 1W7GH 2TPIZ 5JBCS 2XBVA 1O2ZA 3SNAA 1L2EA 4YLUA 2FTMA 4THNH 1GHVH 4X8VH 1RTLA 4LOYH 1GJ4H 4Y11E 3FANA 3SJKA 1GDNA 2BTCE 5EOKA 3SQHE 1QY6A 1P57B 5PTPA 3TPIZ 3KQBA 1ANEA 2BD4A 4NWLA 1V2WT 3SJ9A 1HCGA 1GBHA 1UK4A 5EW1H 4X2XA 3OYPA 2FYQA 2J34A 2VIPA 5ESTE 2ZTYA 2B8OH 4O3UA 1J8AA 1UVUH 1JRSA 2WPLS 3ZVCA 1ESAA 1OOKB 3V12A 1V2JT 5GCHF 4NIYA 1TX8A 1TNHA 2CF9H 1HAVA 1CT0E 2H5CA 4GSOA 3A8CA 2XTTB 3A81A 4UE7H 1TYNA 2PSYA 4I8JA 3ZZ6A 1KLTA 5F8TA 4KKDA 1AD8H 1CQQA 1A2CH 1OWIA 5EQQA 5C5OA 2ZP0H 1IQIA 3RXJA 3BEIB 3T29A 2A31A 1VCPA 5HM2A 1BIOA 2GDEH 4ABDA 2PV9B 1Y3UA 1Z8GA 1G2LA 1O2WA 1J9CH 1BTWA 3ENSB 1OWKA 1TLDA 3EAJA 4IMZA 2BLVA 1IQFA 1HJAB 3MO6A 5A2MH 1MBQA 3MU4A 1GBMA 2BD7A 2PGQB 2ZU4A 4GHTA 3I29A 3S7HB 3RDZA 4CHAB 3GY5A 2O9QA 3EGKH 2KAIB 3FFGA 1P8VC 1GJ8B 1C2IA 1O30A 2ZZUH 1S0QA 3HGNA 1W11U 5ABWA 8ESTE 3UNRA 1XUFA 1FY5A 5I46H 1GI4A 3ZVDA 2BY5X 3RXLA 1AE8H 2WV5A 1TRMA 1TMUH 1SBWA 1BDAA 1QL9A 1QRWA 1ZTKA 1HAXB 1TGCA 1BZXE 2SGFE 5C1YA 1P3EA 4K1EA 4XFQA 1GJDB 4U01A 1ZGVA 6CHAB 3U8TH 4K1TA 1Z8IB 4XSKU 5A8YA 3CENA 1P02A 5HGGA 3BN9A 1FY3A 3U98H 3ITIA 1BTPA 2A4QA 2H6MA 5DP4A 1ZTLA 1SGRE 2ZECA 1AB9C 2OC0A 4JYTA 5JB8S 2PHBA 4CBOA 1G37A 3S7KB 4ABBA 4ISLA 2FTLE 3QK1A 1SQTA 3QUMP 3VXEH 1UVSH 4FUCA 4CRCA 4OS4A 3F9EA 4YO9A 4ABEA 1C4V2 1GMCF 3QGNB 1DLKB 1KXAA 1K1IA 3KF2A 5C1UA 3TH4H 1OS8A 1HAYB 1UTOA 1W7XH 1DITH 1QCPA 2EI8A 2G8TA 1W10U 1O39A 2AMQA 1RFNA 1GI1A 2GGVB 1PPCE 2G00A 3BG4B 4X1RU 1V2ST 1VGCB 1MTWA 3E0PB 3BTDE 2O8WA 2ZDVH 2C93B 3SJ8A 4BAOB 3OTJE 2D1JA 1LPGB 1VITG 4J1YA 2EI7A 2FLBH 1W0ZU 1UJ1A 4TWWA 2ZI2H 1C5VA 1C4Y2 1FQ3A 4AN7A 3KNXA 3LDXH 1IQLA 4NFEA 2BLWA 1TNGA 3SU5A 1DY9A 2BQ7B 1HNEE 1RD3B 1AFQB 3ELAH 3FZZA 4NZQA 1FV9A 3GY7A 3M5OA 2WPJS 1XUKA 3UUZA 2Z94A 3O8RA 3DUXH 1Y3XA 4CH2B 3IITA 4TYDA 4BXWA 2IOTA 1GHBG 1NRPH 3A8AA 4K8BA 1AVXA 1B7XB 2HWLB 4UFEH 2VIOA 4ZXXH 1FDPA 2BOHB 3PV4A 3KN2A 4K1SA 1AZ8A 1FNIA 1H9HE 1MTVA 2JETB 1GJ7B 5JB9S 1EAXA 5FBIA 3VPKA 2YOLA 1ZRKA 2Y6TA 4MPWA 1GMHG 1H8DH 1MKXH 2HNTE 5DP5A 3RXPA 3SORA 1E37B 5EU8A 1C2DA 1G9IE 2O8UA 4JZEH 3SV6A 1K1MA 1TRYA 2BB4A 2A32A 2XBXA 5EXNA 1V3XA 4AZ2B 4J2YB 1MD8A 3UQOA 4OS6A 1HXFH 1EPTA 5JYIA 3LH3A 3RMLH 1THPB 1Z1JA 4JZDH 1EP5A 4NZLA 2HGTH 2GP9B 2GDDA 2PFEA 2R9PA 4ZMAH 1YM0A 2H2ZA 1VJ9U 3A85A 1EZUC 2BQ6B 1U6QA 3PM3A 1V2NT 1UHBB 3S9AA 3SNDA 2PGBB 1PQ5A 2ZHWH 5FAHA 3VB4A 2F9VA 2QGRA 1WTGH 4VGCC 3SJIA 4DOQA 1T31A 1T8LA 1ZPZA 1F0RA 3PWCA 1SGTA 2BDCA 1MTSA 1O5GH 1WSSH 3NZIA 2Y82A 2A7CA 1GMCG 3TLOA 4E06H 1WTHD 2V3OH 1YPHC 4B2AA 1F2SE 2AGGX 2AYWA 1QIXB 2ZKSA 2A7JA 1EQ9A 1MTNB 2V0BA 4WVPE 1D6WA 1WUNH 3T27A 1HIAB 1MCTA 3MOCA 4BOHA 1O5CB 2ULLA 1VZQH 2QXJA 1SOZA 2FOMB 4GPGA 4FUHA 3RU4E 1BBRH 3MH6A 3Q3KA 1BRCE 2C8ZB 1T4VH 1GI9B 1QQUA 1J17T 4B74A 2VNTA 1C2JA 3LGWA 1C1QA 2VWNA 2QCYA 1XVOA 2OQ5A 1O3OA 5JBTA 3A8DA 3AVZA 1ETSH 1TWXB 3PWBA 1CSOE 3UREA 3SU1A 4QT8C 2ZNKH 3TGJE 1O2TA 1YPHE 3VGCB 4AG2A 3A88A 1AO5A 1LDTT 4OS1A 3TGIE 3M36A 1O2PA 1QL8A 1O2MA 2A4GA 4NA7A 4MNXA 3B23B 3KCGH 1G3DA 1C5NH 1HAHH 2FOEA 4Y79A 3BG4C 3T26A 4Y76A 1VGCC 3RC6A 1NS3A 4UD9H 1PPBH 4X2YA 2LNCA 1A0JA 1EOJA 1CE5A 3E6PH 2BMGB 3HK3B 1YPLH 5CHAC 1FJSA 2B5TB 5DP7A 5EPNA 4YLQH 2A2QH 1F0TA 2XWAA 4WWYA 1Q2WA 1FPHH 4M7GA 1BTYA 2TGTA 1SC8U 2P3FH 1OP8A 3S9CA 3Q3XA 3TH3H 1FY1A 3MU8A 1C5TA 2ZDNA 2FS9A 4B75A 4ISIH 2FI4E 4DVAU 1NRRH 4A92A 2CMYA 1LVYA 3RMOH 4Y0YE 3V7TA 3BTME 3MNBA 1MAXA 3EDXB 4D9RA 4JYVH 1WU1A 2BM2A 2ZFFH 2DUCA 4U2WA 4H4FA 3SV8A 2ZPRA 2FX6A 2JETC 3BTGE 1GBAA 1EJNA 1XUGA 2FYRA 3ZVEA 1XUHA 1YPKH 1CT4E 2C4FH 2P3UB 2W5EA 1EXFA 4DIIH 4TWYA 3QZRA 4WMEA 1UCYK 1AUJA 1TNIA 3RMMH 4DIHH 4LZ1H 1YCPM 1GBFA 2BLQA 4JZFH 2CGAA 3SNEA 2FDAA 2UUFB 1Y8TA 3U1IB 4X1SU 5F8ZA 2QIQA 3AAVA 1ELGA 3RXSA 1O2GH 4GCHF 5IDKA 1SR5C 3DHKH 2Q1JA 1IOEA 1TGSZ 3RXDA 2GVFA 2P59A 2J4IA 4I33A 1IQEA 1ZTJA 2A7HA 5AFYH 1GBIA 5JPMH 3QO6A 2AS9A 2AIQA 3SU3A 3STIA 4Q80A 1C5QA 1UTPA 4ZROA 1CHOG 1FUJA 1A5IA 3QZQA 4Y7BA 1EAIA 1IHSH 1GHXH 1GI0A 1FAKH 3BTTE 1HRTH 5CE1A 2QA9E 4MG3A 1LHGH 2H9EH 2BDAA 2A0QB 1V2VT 4Z0KA 5A0BA 2GX4A 1GJ5H 1W12U 4O9VA 5DG6A 4ABHA 2J95A 4HGCA 1BUIA 1KTSB 3RXKA 3TU7H 1MBMA 1ZLRA 3P17H 1GHYH 2QXIA 4XBCA 3AASA 2FESH 1V6DA 1D3DB 3L6PA 3VFEA 1NESE 1YF4A 3UOPA 2PKSB 3HATH 3ZZBA 3NCLA 2VIQA 4Y8ZA 1XM1A 3GCTG 2AGIX 4DT7B 4B2BA 2EA3A 1QR3E 5HXFA 2ZFRH 3CS0A 3RXQA 3F9HA 1BTZA 3RXTA 3GCHC 1O2LA 2FOGA 1FLEE 4Z6AH 3TGKE 1C2FA 2ZPQA 3LC5A 1OWEA 1SGYE 2PR3A 1NC6A 1ZSJA 1KDQA 3L3TA 1UO6A 1Z6EA 3RXIA 1OWJA 5DP8A 5GPIB 4WH8A 2CN0H 1PPHE 2GT7A 4ISOA 1RIWB 1IQHA 1O38A 2DE8A 3M5LA 4RN6A 5EG4A 1HB0B 2BQWB 3BTEE 1ZMLA 3A8BA 4H6TA 1TNLA 4X8UH 3E90B 2XBYA 3VEQB 3C27B 4H42U 2XC5A 3DT0H 1P01A 2QY0B 4NIVA 3MH4A 4X6NA 1C5UA 2C8XB 3F9GA 1NRSH 2IPHA 2ZDAH 2ANKH 4INKA 4BAMB 2BDBA 1OSSA 9LPRA 2WPMS 3ESTA 1JIMA 3STJA 4X6MA 1EPTC 2HRVA 1HJ9A 1KLIH 5EXLA 1HFDA 2BVRH 3BTHE 4BTUB 1LHFH 2Z3EA 1QGFA 3KEEA 1O2VA 3W95A 3RXBA 1XUJA 3EQ0H 2IN2A 1JRTA 1SGQE 1D3TB 1P2JA 3SJOA 1OP0A 1ELCA 1WAYB 3VB7A 4YOJA 4X8TH 1DXWA 4UFDH 1QTFA 3MU0A 3ZZ7A 2PTNA 4ASHA 1DPOA 1D3QB 1O3NA 3ATIA 4X1QU 3MHWU 1SHYA 1JOUB 3P70B 2I6QA 1F5LA 3BV9B 1G30B 4XOJA 3L33A 4AFUA 1K1LA 3EA7A 1TA6A 1ELVA 3P95A 1HYLA 4NG9H 5E8EH 3Q00A 1T32A 1SGEE 2CXVA 3K9XB 5TCAA 1V2LT 1A61H 2RG3A 1TMBH 1C5XB 1A7SA 2GZ9A 2OTVA 4ABJA 2BHGA 4DGJA 5FPSA 5EPYA 1PPEE 4DJZB 4WJG2 2A5KA 4CRGA 1C5PA 1NPMA 3Q77A 2ZF0H 4BTIB 1O3AA 1HDTH 3K65B 3SNCA 1OPHB 4A1TA 1VITF 1J16A 2JH6D 1NO9H 5BPEA 5DP6A 3PMAB 2WPIS 1SQOA 1N6YA 1WBGB 1AN1E 3MFJA 4TY6A 5A0AE 1K21H 4YOIA 3A87A 1L4ZA 3RXOA 2ZFQH 3HKJB 3E91A 5DGJA 1YLDA 1GHBF 1XVMA 2F83A 1YKTA 1C1PA 1NRNH 2B9LA 1A46H 1KLJH 2PKSC 4A1XA 1EJAA 1IQGA 1GWAA 1RTFB 2RDLA 1HV7A 4DURA 4A7IB 4HZHA 1ZSKA 1DUAA 3M37A 3PB1E 1HBTH 2UWPA 1GMHF 1O2QA 4TY7A 3UNQA 1IQMA 4K2YA 2HNTF 2BD2A 4CH8B 4VGCB 1WQSA 4KGAA 1QB1A 1P2OA 3E16B 2XCNA 3QTVH 2FI3E 3PROA 5HM9A 3ZZ3A 1EZSC 3V0XA 1DS2E 2PUQH 4FU9A 1SMFE 2AMPA 1SHHB 4Q7XA 3U9AH 3LGIA 1S5SA 3M3VA 1RIWC 4HI3A 1AVGH 1GHWH 1DWDH 3ATWA 2A5AA 1C2GA 2WUCA 4CR9A 2J94A 3M5NA 1MD7A 2BOKA 1O2UA 1UVOA 4AFSA 1GBBA 1AFEH 3ZVAA 4MNYA 1GI5A 1OXGA 3BIVH 1ANCA 5BRRE 4ZXYH 1OP2A 1F5KU 3SU0A 3ZVFA 4KTUA 1FIZA 3A80A 4CRAA 5F03A 1BMLA 1SGFA 2ZHEH 1UK2A 4AYVB 4INLA 1P06A 3QDZB 1ZHRA 1O3FA 3QWCH 1ARBA 4I8LA 4ZKOU 2VIWA 4O97A 1BMAA 3D23A 3S0NA 1C5OH 3GYMA 1O2HA 4XDEA 2QC2A 3SU6A 2XC4A 5C5NA 1BRBE 2FXRA 3T25A 3E3TA 3ZV9A 1O5AB 1P11E 1Y3WA 2C8YB 3MH5A 8LPRA 1FMGA 1GJAB 1O2IA 2ZCLP 4X1PU 2C8WB 3MH7A 1VR1H 3PMHB 1DX5M 1BBRK 2FS8A 4ZAEA 3TJNA 1C1TA 1VITH 4OS7A 3RUOA 5CHAB 2ZFSA 1HAVB 2BX4A 3NWUA 3UR9A 4BTTB 5A0CA 5K0HA 4JK6A 5AF9H 1NRQH 1Z1IA 3PYHA 2HNTC 1PPFE 3RXHA 1PPZA 2G5NA 4D7FA 1YBWA 3RLWH 1O2XA 1GHAG 1H1BA 5F6MA 3PTNA 2BY9X 1AKSA 1PFXC 3GCNA 2QXHA 1C5YB 1CA8B 2P94A 3TJOA 4NIXA 2ZGJA 5JDUB 1E38B 2BDYA 2AERH 1JMOH 3OX7U 1ESBA 2BVXH 1QQ4A 2ANYA 1EOLA 5HYOA 4ZKNU 1FXYA 3QGJA 1PPGE 1AVWA 3SGQE 1CO7E 1AUTC 3SQEE 3UTUH 2OBOA 4D76A 1D3PB 2ZCKP 1GVLA 1UTKA 1G3EA 1W0YH 2VH0A 2FP7B 2F9NA 4GVUA 1DVAH 5JBBS 1CBWC 1A4WH 1WYKA 1P2NA 1TX7A 2D8WA 3NPSA 1Z71A 3NXPA 3E1XB 2OP9A 5FHTA 1O2KA 2VVCA 1ELFA 1IAUA 2FOCA 2Y7ZA 2QAAA 3SHAH 3DFLA 1BHXF 1LHEH 1DT2A 3BTFE 3TJUA 4MPXA 2FX4A 3ZZ4A 2ZDKA 3RLYH 3F6UH 4DW2U 1H9IE 2OUAA 2G51A 4KTCA 2HLCA 3BSQA 5L2ZH 2P16A 1LCYA 1SVPA 2C3SA 2ZGBH 1TRNA 1C9PA 2Y5FA 4AFQA 3JZ1B 3GY3A 1UTNA 2W3IA 1EAWA 4AB9A 5C2ZA 3QTOH 2GMTC 4BNRA 4A6LA 1FONA 4SGAE 2ZPSA 3C1KA 3TJVA 3ATLA 1O3CA 1HLTH 4INHA 3F68H 3UY9A 2FEQH 1YLCA 1SGPE 1TFXA 3DFJA 1GDQA 1N1LA 1C1MA 2GT8A 5I25A 3KIDU 2IJOB 4Y7AA 5GXPA 1Z8JB 3NK8A 1BA8B 4YM9A 1AE5A 1NU9A 4NA9H 2PWXA 1SG8B 2VWOA 3TNSA 2ALPA 4MPUA 4LK4A 2ALVA 1WQVH 2H5DA 3A7TA 4YTAA 2R0KA 1ELBA 2VVUA 2JH5D 3CS7A 3BTKE 3K6YA 3MNSA 5FX6A 1CHOF 1G3BA 4OGXA 1JIRA 2R2WU 1HAZB 3GYLB 1SI5H 2PKAA 2A4RA 2OC1A 1GMDG 3GCHB 4AYYB 2Y81A 1FPCH 1O3LA 1P3CA 2A45B 1W8BH 1BOQA 1IHTH 2TIOA 3RXCA 1ZHPA 1IQKA 3DA9B 5EGMA 1Y3VA 4HTCH 3HK6B 3SI4H 2RA0A 4IN1A 1GI2A 1GHZA 4I7YH 1TA2A 2TRMA 2SGPE 4KP0A 1AGJA 2VVVA 1O33A 1O0DH 2BD8A 2OC7A 2R0LA 5ESBA 3RXAA 1BMNH 3RXVA 1C5SA 1MMJN 1G2MA 3BTQE 2O8MA 2XRCA 1INCA 1ETRH 1MKWH 1RTKA 1B0FA 3GCTF 2F9OA 5LPFA 2FOFA 1ARCA 2BZ6H 1YYY1 5EXMA 2BY8X 1KXBA 1TQ0B 3A83A 4I8HA 1A3EH 4WF8A 3GY4A 1Y5BT 2WPKS 3PMJA 3P8GA 4U32A 4WXIA 4ZKRU 2Q6DA 2FOBA 1DWBH 1CVWH 3AW1A 3VB6A 1BT7A 1QFKH 1HXEH 2GV7A 5E0HA 1NZQH 4FUEA 1EZXC 4E7RG 3ODFA 4FU7A 3MO3A 1H9LB 1TBQH 1EPTB 1JXPA 4JCNA 3SUFA 1BQYA 1M9UA 1CA0B 1S84A 2GTBA 2Z3CA 2XCFA 4X0WU 3O8BA 5FPYA 1K28D 2D2DA 1O5EH 3GY8A 5FX5A 2AGEX 1DOJA 2P8OB 1QRZA 4X8SH 3LU9B 1UVPA 5EW2H 1DXPA 1P9SA 2J38A 1TPOA 3I78A 3LH1A 4OS2A 2J2UA 5FXLA 5DPAA 5L2YH 4WMFA 5C20A 1Q3XA 1GBJA 2ZDLA 3SGBE 5H4IB 1HJ8A 1IQJA 1V2UT 2BY6X 3RXUA 2C90B 4I8GA 1QBVH 2ZU5A 2PSXA 4X2VA 3TNTA 1Y3YA 3ZZ8A 1BRAA 3F1SB 1GI7B 3GY2A 2ODYB 1O3MA 1EAUA 1UK3A 1GBTA 1P2QA 1EP6A 4B73A 4CRDA 1GL0E 4D7GA 5CMXH 1UTMA 1GGDC 4ZH8A 4WH6A 5E0JA 1QB9A 1Z6JH 2ZGXH 3D62A 2F9PA 1ZPBA 1TQ7B 2XWBI 3MTYA 4A1VA 1KXCA 1ZJKA 1G3CA 3T2NA 1IQNA 6ESTA 3SI3H 4CRBA 5T6GA 2SGEE 1K1NA 1O37A 3BF6H 1S6HA 4AG1A 1VJAU 1FN6A 1NM6A 2A1DB 2UWLA 1ANDA 2I6SA 5A09A 3D65E 1ANBA 5T6DA 3MMGA 1WCZA 1ZOMA 1TGBA 5ETXA 4E7NA 4BAHB 1THRH 1LPZB 2CV3A 1QJ7B 3SUGA 1QHRB 3PLBA 2NU4E 2OLGA 4YT7H 4R8TB 3RXEA 1BITA 4FUIA 2Z7FE 2ZWLH 1DM4B 1BTUA 1TONA 1LPKB 3LGTA 4GUXA 1YP9A 2GCTC 2VIDA 1YPGH 3M7UA 1OYTH 1UTJA 1ZMNA 3M3SA 3QN7A 1BTXA 2ZGHA 5TJXA 4CREA 5LH8A 1SGFG 2W7SA 3SV9A 1HAOH 2FOHA 1TE0A 3NUMA 3GY6A 1AMHA 3SGAE 2HPPH 7GCHG 1GVKB 1YPMH 1H8IH 1CGIE 1CU1A 1F5RA 2HVXA 1S81A 3TK6A 1P9UA 3EYDA 2ZO3H 3SHCH 3PTBA 4JMYA 1MH0A 2BXTH 1T8OA 1GI6A 3A7ZA 3U1JB 2ANWA 1SGNE 1C4U2 1S83A 2OD3B 1L0ZA 1MTUA 2YNBA 1GI8B 2G5VA 2ZQ1A 2GZ7A 3W94A 1D6RA 2BZAA 7ESTE 1K22H 1MU8B 4YESB 5J4SA 2AMDA 1ZYOA 1S82A 1AU8A 1QRXA 1A5HA 4U30A 4RSPA 3SU2A 1O3IA 3MU5A 3TVJB 3SW2B 3BEUA 2FZZA 1OWHA 2R2MB 1NU7B 1PQAA 1QA0A 2BX3A 1NY22 1C5ZB 2ZHDA 1C5MD 1EZQA 1RS0A 1DANH 2KAIA 4DG4A 4ISHH 5DJ7A 2TGDA 7LPRA 2WV4A 1A3BH 1CA0C 1UCYE 1Y5AT 3P8FA 1DSUA 4IGDA 5AHGH 3IWMA 2O8LA 1SGDE 2YNAA 1KXFA 1V2TT 1GBKA 2EEKA 2XNIA 3BTWE 2CHAC 3D49H 1O34A 3Q3YA 1C1WH 3A82A 2P8OC 1O36A 1QA7A 2J92A 3K6ZA 1QBNA 4Q2KA 1XKBC 2VIVA 2PW8H 3GCOA 1NROH 1S0RA 3URCA 3QLPH 1SSXA 1B0EA 2H9HA 1BB0B 3A84A 1KXEA 1TALA 3SN8A 2A5IA 4BAKB 1AQ7A 2GCHG 3ZYEA 3F9FA 1YCPH 3SV2H 4OGYA 1ZRBA 2OBQA 3HKIB 3FP6E 4Q7YA 4NSYA 4MNVA 3A7YA 4XBDA 2ZHFH 1AY6H 2VGCC 2SGAA 1D4PB 1GDUA 4K8YA 1O3GA 4X6OA 1O5BB 2QF0A 1LQDB 1TPPA 3DD2H 2Z9GA 1UTQA 3GDVA 3TH2H 1KSNA 4I32A 2Z9KA 3RU4D 2R3UA 2ZA5A 1DE7H 4DY7B 1YPEH 1DICA 1CBWB 3LGYA 4R0IA 1P2MA 5F8XA 3KQDA 4FUGA 2QYIA 3SV7A 1C5WB 1LHDH 4MLFB 5DO4H 3UOUA 3RXGA 3EA9A 1MU6B 3AAUA 1GHAF 1V2RT 1KDQB 1DSTA 2HOBA 4Y8YA 2FMJA 2BD9A 4FXGH 1ESTA 3PLKA 1SQAA 2GV6A 1O2YA 1GVZA 4F49A 1PYTC 2NU0E 1V2MT 1G32B 1O5FH 3T5FH 2BVSH 1F92A 3SZNA 2ANMH 4OS5A 1VCWA 8GCHG 2PUXB 4FUJA 1C2MA 3M61U 1ZZZA 4YT6H 4KELA 1L4DA 5DKMA 1UMAH 6GCHG 1W3CA 2JH0D 2NWNA 2GMTB 3BIUH 3RP2A 1MKXK 3RM0H 3RC4A 4D8NA 1HAPH 4RKJB 1P2IA 3VB3A 1A1RA 1TOCB 1L1NA 1NFUA 2FPZA 2CJIA 1VCQA 2G4TA 3RMNH 2ZEBA 2Y5GA 3URDA 1V2KT 3SNBA 4IBLH 3MWIU 2F3CE 4HFPB 4ZKSU 2VH6A 4PROA 2BY7X 5L6NH 3KQEA 4CRFA 1MQ5A 2UWOA 1ABIH 1OWDA 1ZR0A 4MDSA 5C1XA 1HGTH 2BD3A 1RRKA 1N8OC 4MPVA 1GPZA 1OX1A 3GDSA 1O5DH 1QJ1B 4AORA 2SFAA 1SLWB 3LPRA 9ESTA 2OCVB 4BXSA 3S9BA 2SGQE 1ZSLA 1C1SA 1NFYA 3MNXA 1PQ7A 3OY6U 2WYJA 3JZ2B 1DY8A 4MQAA 4FVBA 1TNJA 3UFAA 1L1JA 1Y5UT 2FM2A 1GG6C 1CGJE 1L1GA 4ABFA 1BRUP 1PJPA 1ZJDA 1LKBA 1GCDA 3ATKA 5B6OA 1HUTH 1C9TA 1ACBE 3GOVB 3M7TA 1ELTA 3R0FA 3UNSA 4WMDA 3A7WA 1BHXB 1UHBA 2SGDE 1XUIA 1ORFA 1GCTC 1Z7KA 3A7XA 3FZDA 4IC5A 1HAIH 1V2QT 1GBDA 3SBKA 4K60A 1ELDE 4AX9H 3RM2H 3UIRA 1F0SA 2AH4X 2NU3E 2ZC9H 2ZU3A 2ODPA 1KY9A 4ZHAA 1MAYA 2Z9LA 3I77A 1K1PA 2W3KA 1AWFH 1O3HA 3LT3A 4GHQA 1GMDF 5TCCA 1HIAA 4B76A 3E0NB 4CBNA 3P92A 4AB8A 1J14A 4X6PA 1TABE 4TPYA 1GBEA 2G52A 1EATA 5FCKA 1TNKA 4FVDA 4WY3A 2OC8A 1OKXA 2P93A 3IG6B 3VB5A 1AI8H 1LKAA 1SLVB 3MYWA 1CHGA 2G81E 2VB0A 2VWMA 1C2HA 5GCHG 2A2XH 4AGKA 1D9IA 2WUBA 2BLOA 1YPJH 4JK5A 3KL6A 5E2PA 4X2WA 4TPIZ 2Y7XA 3UQVA 1WOFA 2DE9A 2Q6GA 4O3TA 4ZUHA 4Y8XA 1P04A 1YC0A 1MZAA 4DCDA 1MKWK 4MVNA
chains in the Genus database with same CATH superfamily
1FAXA 1P03A 1GL1A 2GKVE 1SPJA 3B9FH 3BG8A 4GAWA 2TGPZ 2GZ8A 2F9UA 2HALA 1O2RA 1LTOA 1F7ZA 3TK9A 3MO9A 2V6NA 2A4OA 3Q76A 3ZZAA 2JDID 4ESTE 3H7TA 1TIOA 1W14U 1J15A 4ZHMU 1QB6A 5DP3A 2Q6FA 5G4BA 1TMTH 1SLUB 5C3NA 2ZTXA 1FZZA 3U8OH 3M5MA 1GI3A 1W0KD 4K3JA 1LVMA 2F91A 1K1JA 5LPEA 1GGDB 2UUJB 2ZFPH 1A5GH 1ID5H 2JJ1D 2H9TH 2WZQA 1C5LH 4F4OC 4AGJA 1T8MA 1EB1H 1CT2E 1O3JA 4IMQA 3BEFB 2QXGA 3ZVBA 2Y5HA 4Y6DA 3RXMA 1P09A 1C1RA 2PTCE 4SGBE 3RXFA 1MZDA 5EJ1A 4IN2A 3O8CA 2J9NA 2AEIH 2TGAA 4GLYA 4JYUH 4K69A 5GNDA 3RC5A 2B7DH 3M3TA 1XXDA 3P8OA 1HJAC 2ZCHP 4XBBA 5DP9A 4FUDA 1SLXB 5FCRA 1E1QD 2ZQ2A 1LVBA 2STAE 2V3HH 5SGAE 1F0UA 1XMNB 2VINA 2OINA 5A8ZA 3OY5U 5EQSA 1TPSA 4Q7ZA 4CHAC 2AIPA 4AFZA 2STBE 2BDGA 1NFWA 3LC3A 1T8NA 3ATMA 1AIXH 5EODA 1LQEA 2JKHA 1ABJH 2ILNA 3WW7A 1MQ6A 3EA8A 3H7OA 3LIWA 1O2NA 2QV1A 1NN6A 1P2KA 2EI6A 2GCTB 5A8XA 3SU4A 3E8LA 3SUEA 1DFPA 1W0JD 4UDWH 3O8DA 3H5CB 1H4WA 1Z8RA 3GICB 4X1NU 3MU1A 6CHAC 4B1TA 4LXBH 1GJCB 1RGQA 1PQ8A 3RU4T 1BBRE 1KXDA 1GBCA 2ZTZA 1SFQB 1XX9A 5K7RA 2ZDMA 1S85A 3U8RH 1AKSB 5GDSH 1H8HD 2K0QA 1C1UH 1THSH 3R3GB 1EJMA 1SGCA 2FODA 1GBLA 5C0TA 1FIWA 2NU1E 3AW0A 1C2KA 2SNWA 1K2I1 3UWJH 3ZVGA 4ZHLU 3P8NA 2BYAX 2ZU2A 3PO1B 2ZU1A 2XYAA 3LGVA 4A5TS 4YZUA 5EQRA 1SL3A 1ETTH 2KFWA 2FWWA 5J4QA 3UWIA 1SOTA 2ODQA 1QZ8A 1K9OE 3VXFH 1O3PB 1UVTH 1W2KH 5C0UA 1C1OA 1EUFA 5KECA 4MTBA 5F53A 2XC0A 1DUEA 4JZ1A 5E0GA 3G01A 1SGIB 4BAQB 3FP7E 3A7VA 4WXVA 7GCHF 1UW7A 1V2OT 1FY4A 1GJBB 2QN5T 3KHVA 1QURH 2ZHQH 3FVFB 4XE4A 2W7UA 3M7QA 1DDJA 4FUFA 1O3KA 1O31A 2QF3A 2CHAB 1C2EA 5HMAA 2ZIQH 1AFQC 2P95A 4YOGA 4NFFA 2BXUH 1AZZA 4ABAA 1XXFA 1O2OA 5T6FA 2CF8H 2ESTE 1NTPA 1TAWA 3SO3A 1BMMH 1EB2A 2Z9IA 3ZYDA 1TGTA 1BMFD 1TB6H 2UUYA 3PMBB 4K5ZA 3HGPA 2OXSA 3LOXA 3HPTB 5T3HA 3A86A 2WYGA 1AWHB 4NWKA 1HPGA 1LO6A 4ISNA 2FLRH 2FI5E 3FAOA 3SOSA 7KMEH 1TOMH 1PYTD 2BD5A 4O03A 4IS5A 1P05A 2ZG0H 2RFKC 1ELEE 2VGCB 1DLEA 2KCOA 1LHCH 4B71A 1XKAC 1Y59T 1MUEB 5AVDA 1ZPCA 4MNWA 1UTLM 3MI4A 3B8JA 2UUKB 1DWCH 3OEHD 4IW4E 2RA3A 1O32A 1ZGIA 2L6OA 3P6ZB 3EE0B 4ABGA 4NCYA 2OQUA 4Y0ZE 1EX3A 1AHTH 2RDEA 2RCEA 2TBSA 2ZFTA 2Z3DA 3LONA 2PKAB 1LMWB 2K1QA 2V3MA 2G4UA 1EASA 2GCHF 3M35A 1TBRH 5AFZH 4UONA 4IC6A 1YCPK 1C1VH 5FPTA 1EKBB 5LPRA 2F9BH 1N6XA 4E05H 4CR5A 3KQCA 4NSVA 3QX5H 4AOQA 1A0HB 3T62A 3DCLA 1YGCH 2R3YA 1CGHA 1LVOA 3ZZCA 1TX6A 5L30H 4NA8A 2H1UA 1O35A 5E2OA 1NFXA 4H6SB 3UR6A 3CNRA 3OFND 3U69H 2NU2E 2GD4B 4BANB 3ODDA 3LJOA 1MTNC 3ZZ9A 1TGNA 2THFB 2XW9A 1GJ9B 1B5GH 1E36B 3F0OA 4UFGH 4LZ4B 1ZMJA 3OSYA 2HPQH 4B2CA 1TPAE 1JBUH 1BJVA 3KGPA 1NT1A 4UEHH 1T7CA 3SUDA 2IJD1 1WV7H 1DWEH 1P12E 4NGAH 3TITA 2BDHA 8KME2 1KIGH 2SNVA 2VJ1A 1TBZH 1JWTA 1X7AC 2P3TB 1S6FA 1Q31A 5GIBA 1N8OB 2VWLA 3GDUA 8GCHF 1QBOA 6LPRA 2VU8E 3PO1C 1E35B 3VGCC 1RJXB 1C1NA 3UPEA 1O2JA 4I31A 1O2SA 6GCHF 1G36A 3V3MA 1QL7A 4FUBA 2D26C 1O3DA 1C5RA 1QJ6B 2Y80A 4RT1A 3WY8A 2G55A 3TK5A 1GG6B 3FP8E 4D9QA 4NIWA 4FU8A 1O3EA 3N7OA 2FOAA 1FN8A 2M5TA 2W26A 2AFQB 4OM9A 3ZV8A 4Y71A 2Z6BD 2FO9A 3CP7A 5CHBA 2XXLA 4ABIA 1P0SH 1K1OA 4ZCNA 1W13U 1A0LA 1GCTB 3OEED 2J5UA 5B6LA 1AB9B 2PLXA 5GWZA 5IYTA 1UCYH 4Y10E 3DSPA 5C67A 2WPHS 3GS9A 1ELAA 2B0FA 3NKKA 1C2LA 2LELA 5HKKD 3K2UA 1FY8E 1SB1H 3LJJA 3OTPA 3PLPA 2WINI 4GCHG 1ZHMA 3ZZ5A 3LGUA 5FBEA 4KTSA 2Z9JA 3V13A 3RXRA 2EQNA 4I8KA 5LGOA 2BDIA 1KTTB 1P10A 3MNCA 2EC9H 5GJ4B 2V35A 1E34B 1T4UH 5JBAS 3TIUA 4RKOB 5EJLA 3S69A 2FIRH 1HAGE 1KYNA 1BCUH 1BJUA 3OU0A 1QNJA 3LKWA 1MCVA 2ZGCA 4JZIA 3GISB 1E0FD 4UFFH 3ZZDA 2XBWA 3T28A 2ASUB 1OYQA 1BTHH 2O8TA 5DK1A 3A89A 1FI8A 1RXPA 1O3BA 1V2PT 1GJ6A 1SFIA 2LPRA 1W7GH 2TPIZ 5JBCS 2XBVA 1O2ZA 3SNAA 1L2EA 4YLUA 2FTMA 4THNH 2V7QD 1GHVH 4X8VH 1RTLA 4LOYH 1GJ4H 4Y11E 3FANA 3SJKA 1GDNA 2BTCE 5EOKA 3SQHE 1QY6A 3FN8A 1P57B 5PTPA 3TPIZ 3KQBA 1ANEA 2BD4A 4NWLA 1V2WT 3SJ9A 1HCGA 1GBHA 1UK4A 5EW1H 4X2XA 3OYPA 2FYQA 2J34A 2VIPA 2XNDD 5ESTE 2ZTYA 2B8OH 4O3UA 1J8AA 1UVUH 1JRSA 2WPLS 3ZVCA 1ESAA 1OOKB 3V12A 1V2JT 5GCHF 4NIYA 1TX8A 1TNHA 2CF9H 1HAVA 1CT0E 2H5CA 1MABB 4GSOA 3A8CA 2XTTB 3A81A 4UE7H 1TYNA 2PSYA 4I8JA 2KCYA 3ZZ6A 1KLTA 5F8TA 4KKDA 1AD8H 1CQQA 1A2CH 1OWIA 5EQQA 5C5OA 2ZP0H 1IQIA 3RXJA 3BEIB 3T29A 2A31A 1VCPA 5HM2A 1BIOA 2GDEH 4ABDA 2PV9B 1Y3UA 1Z8GA 1G2LA 1O2WA 1J9CH 1BTWA 3ENSB 1OWKA 1TLDA 3EAJA 4IMZA 3WWFA 1WXRA 2BLVA 1IQFA 1HJAB 3MO6A 5A2MH 1MBQA 3MU4A 1NBME 1GBMA 2BD7A 2PGQB 2ZU4A 4GHTA 3I29A 3S7HB 3RDZA 4CHAB 3GY5A 2O9QA 3EGKH 2KAIB 3FFGA 1P8VC 1GJ8B 1C2IA 1O30A 2ZZUH 1S0QA 3HGNA 4XRNA 1W11U 4P02A 5ABWA 8ESTE 3UNRA 1XUFA 1FY5A 5I46H 1GI4A 2J97A 3ZVDA 2BY5X 3RXLA 1AE8H 2WV5A 1TRMA 1TMUH 1SBWA 1BDAA 1QL9A 1QRWA 1ZTKA 3F0PA 1HAXB 4Q4LA 1TGCA 1BZXE 2SGFE 5C1YA 1P3EA 4K1EA 4XFQA 1GJDB 4U01A 1ZGVA 6CHAB 3KYFA 4XD7D 3U8TH 4K1TA 1Z8IB 4XSKU 5A8YA 3CENA 1P02A 5HGGA 3BN9A 1FY3A 3U98H 3ITIA 1BTPA 2A4QA 2H6MA 5DP4A 1ZTLA 1SGRE 2ZECA 1AB9C 2OC0A 4JYTA 5JB8S 2PHBA 4CBOA 1G37A 4M9FA 3S7KB 4ABBA 4ISLA 2FTLE 3QK1A 4TSFD 2HVYB 1SQTA 3QUMP 3VXEH 1UVSH 4FUCA 4CRCA 4OS4A 3F9EA 4YO9A 4ABEA 1C4V2 1GMCF 3QGNB 1DLKB 1KXAA 1K1IA 3KF2A 5C1UA 3TH4H 1OS8A 1HAYB 1UTOA 1W7XH 1K0HA 1DITH 1QCPA 2EI8A 2G8TA 1W10U 1O39A 2AMQA 1RFNA 1GI1A 2GGVB 1PPCE 2G00A 3BG4B 4X1RU 1V2ST 1VGCB 1MTWA 3PV5A 3E0PB 3BTDE 2O8WA 1H8ED 2ZDVH 2C93B 3SJ8A 4BAOB 3OTJE 2D1JA 1LPGB 1VITG 4J1YA 2EI7A 2FLBH 1W0ZU 1UJ1A 4TWWA 3FO8D 2ZI2H 1C5VA 1C4Y2 1FQ3A 4AN7A 3KNXA 3LDXH 1IQLA 4NFEA 2BLWA 1TNGA 3SU5A 1DY9A 2BQ7B 1HNEE 1RD3B 1AFQB 3ELAH 3FZZA 4NZQA 1FV9A 3GY7A 3M5OA 2WPJS 1XUKA 3UUZA 2Z94A 3O8RA 3DUXH 1Y3XA 4CH2B 2J98B 3IITA 4TYDA 4BXWA 2IOTA 1GHBG 1NRPH 3A8AA 4K8BA 1AVXA 1B7XB 2HWLB 4UFEH 2KCPA 2VIOA 4ZXXH 1FDPA 2BOHB 3PV4A 3N7DA 3KN2A 4K1SA 1AZ8A 1FNIA 1H9HE 1MTVA 2JETB 1GJ7B 5JB9S 1EAXA 5FBIA 3VPKA 2YOLA 1ZRKA 2Y6TA 4MPWA 1GMHG 1H8DH 1MKXH 2HNTE 5DP5A 3RXPA 3SORA 1E37B 5EU8A 1C2DA 1G9IE 2O8UA 4JZEH 4F48B 3SV6A 1K1MA 1TRYA 2BB4A 2A32A 2XBXA 2XOKD 1V3XA 5EXNA 4AZ2B 4J2YB 1MD8A 3UQOA 4OS6A 1HXFH 1EPTA 2F4LA 5JYIA 3LH3A 3RMLH 1THPB 1Z1JA 4JZDH 1EP5A 4NZLA 2HGTH 2GP9B 2GDDA 2PFEA 2R9PA 4ZMAH 1YM0A 2H2ZA 1VJ9U 3A85A 1EZUC 2BQ6B 1U6QA 3PM3A 1V2NT 1UHBB 3S9AA 4RI0A 3SNDA 2PGBB 1PQ5A 2ZHWH 5FAHA 3VB4A 2F9VA 2QGRA 1WTGH 4VGCC 3SJIA 4DOQA 1T31A 1T8LA 1ZPZA 1F0RA 3PWCA 1S6LA 1SKYE 1SGTA 2BDCA 1MTSA 1O5GH 1WSSH 3NZIA 2Y82A 2A7CA 1GMCG 3TLOA 4E06H 1WTHD 2V3OH 1YPHC 4B2AA 5KGOA 1F2SE 2AGGX 2AYWA 1QIXB 2ZKSA 2A7JA 2AHME 1EQ9A 1MTNB 2V0BA 4WVPE 1D6WA 1WUNH 3T27A 5CDFE 1HIAB 1MCTA 3MOCA 4BOHA 1O5CB 2ULLA 1VZQH 2QXJA 1SOZA 2FOMB 4GPGA 4FUHA 3RU4E 1BBRH 3MH6A 2OK5A 3Q3KA 1BRCE 2C8ZB 1T4VH 1GI9B 1QQUA 1J17T 2QE7D 4B74A 2VNTA 1C2JA 3LGWA 1C1QA 2VWNA 2QCYA 1XVOA 2OQ5A 5DN6D 1O3OA 5JBTA 3A8DA 3AVZA 1ETSH 1TWXB 3PWBA 1CSOE 3UREA 3FKSD 4QT8C 3SU1A 2ZNKH 4DT4A 3TGJE 1O2TA 1YPHE 3VGCB 4AG2A 3A88A 1AO5A 1LDTT 4OS1A 3PRBA 3VG8A 3TGIE 3M36A 1O2PA 1QL8A 1O2MA 2A4GA 4NA7A 4MNXA 3B23B 3KCGH 1G3DA 1C5NH 1HAHH 2FOEA 4Y79A 3BG4C 3T26A 4Y76A 1VGCC 3RC6A 1NS3A 4UD9H 1PPBH 4X2YA 2LNCA 1A0JA 1EOJA 1CE5A 3E6PH 2BMGB 3HK3B 1YPLH 5CHAC 1FJSA 2B5TB 5DP7A 5EPNA 4YLQH 2A2QH 1F0TA 2XWAA 4WWYA 1Q2WA 3MQKC 1FPHH 4M7GA 1BTYA 2TGTA 1SC8U 2P3FH 1OP8A 3S9CA 3Q3XA 3TH3H 1FY1A 3MU8A 1C5TA 2ZDNA 2FS9A 4B75A 4ISIH 2FI4E 4DVAU 1NRRH 4A92A 2CMYA 1LVYA 3RMOH 4Y0YE 3V7TA 3BTME 3MNBA 1MAXA 3EDXB 4D9RA 4JYVH 1WU1A 2BM2A 2ZFFH 2DUCA 4U2WA 4YXWD 4H4FA 3SV8A 2ZPRA 2FX6A 2JETC 3BTGE 1GBAA 1EJNA 1XUGA 2FYRA 3ZVEA 1XUHA 1YPKH 1CT4E 2C4FH 2P3UB 2W5EA 1EXFA 4DIIH 4TWYA 3QZRA 4WMEA 1UCYK 1AUJA 1TNIA 3RMMH 4DIHH 4LZ1H 1YCPM 1GBFA 2BLQA 4JZFH 2CGAA 3SNEA 2FDAA 2UUFB 1Y8TA 3U1IB 4X1SU 5F8ZA 2QIQA 3AAVA 2JIZD 1ELGA 3RXSA 1O2GH 4GCHF 5IDKA 1SR5C 3DHKH 2Q1JA 1IOEA 1TGSZ 3WWBA 3RXDA 2GVFA 2P59A 2J4IA 4I33A 1IQEA 1ZTJA 2A7HA 5AFYH 1GBIA 5JPMH 3QO6A 2AS9A 2AIQA 3SU3A 3STIA 4Q80A 1C5QA 1UTPA 4ZROA 1CHOG 1FUJA 3U28C 1A5IA 3QZQA 4Y7BA 1EAIA 1IHSH 1GHXH 1GI0A 3ZIAD 1FAKH 3BTTE 1HRTH 5CE1A 2QA9E 4MG3A 1LHGH 2H9EH 2BDAA 2A0QB 1V2VT 4Z0KA 5A0BA 3UAIC 2GX4A 1GJ5H 2KR7A 1W12U 4O9VA 5DG6A 4ABHA 2JJ2D 5C17A 2J95A 4HGCA 1BUIA 1KTSB 3RXKA 3TU7H 1MBMA 1ZLRA 3P17H 1GHYH 2QXIA 4XBCA 3AASA 2FESH 1V6DA 1D3DB 3L6PA 3VFEA 1NESE 1YF4A 3UOPA 2PKSB 3HATH 3ZZBA 3NCLA 2VIQA 4Y8ZA 1XM1A 3GCTG 2AGIX 4DT7B 4B2BA 2EA3A 1QR3E 5HXFA 2ZFRH 3CS0A 3RXQA 3F9HA 1BTZA 3RXTA 3GCHC 1O2LA 2FOGA 1FLEE 4Z6AH 3TGKE 1C2FA 2ZPQA 3LC5A 1OWEA 1SGYE 2PR3A 1NC6A 1ZSJA 1KDQA 3L3TA 1UO6A 1Z6EA 3RXIA 1OWJA 5DP8A 5GPIB 4WH8A 4B6EA 2CN0H 1PPHE 2GT7A 4ISOA 1RIWB 1IQHA 1O38A 2DE8A 3M5LA 4RN6A 5EG4A 1HB0B 2BQWB 3BTEE 1ZMLA 3A8BA 4H6TA 1TNLA 4TT3D 4X8UH 3E90B 2XBYA 3VEQB 3C27B 4H42U 5HIZA 2XC5A 3DT0H 1P01A 2QY0B 4NIVA 3MH4A 4X6NA 1C5UA 2C8XB 3F9GA 5DSFA 1NRSH 2IPHA 2ZDAH 2ANKH 4INKA 4BAMB 2BDBA 1OSSA 9LPRA 2WPMS 3ESTA 1JIMA 3STJA 4X6MA 1EPTC 2HRVA 1HJ9A 1KLIH 5EXLA 1HFDA 2BVRH 3BTHE 4BTUB 1LHFH 2YMSC 2Z3EA 1QGFA 3KEEA 1O2VA 3W95A 3RXBA 1XUJA 3EQ0H 2IN2A 1YY3A 1JRTA 1SGQE 1D3TB 1P2JA 3SJOA 1OP0A 1ELCA 1WAYB 3VB7A 4YOJA 4X8TH 1DXWA 4RT0A 4UFDH 1QTFA 3MU0A 3ZZ7A 2PTNA 4ASHA 1DPOA 1D3QB 1O3NA 3ATIA 4X1QU 3MHWU 1SHYA 1JOUB 3P70B 2I6QA 2LP6A 1F5LA 3BV9B 1G30B 4XOJA 3L33A 4AFUA 1K1LA 3EA7A 1TA6A 1ELVA 3P95A 1HYLA 4NG9H 5E8EH 3Q00A 1T32A 1SGEE 2CXVA 3K9XB 3EE7A 5TCAA 1V2LT 1A61H 2RG3A 1TMBH 1C5XB 1A7SA 2GZ9A 2OTVA 4ABJA 2BHGA 2VBCA 4DGJA 5FPSA 5EPYA 1PPEE 4DJZB 4WJG2 2A5KA 4CRGA 1C5PA 1NPMA 3Q77A 2ZF0H 4BTIB 1O3AA 1HDTH 3K65B 3SNCA 1OPHB 4A1TA 1VITF 1J16A 2JH6D 1NO9H 5BPEA 2W6ID 5DP6A 3PMAB 2WPIS 1SQOA 1N6YA 1WBGB 1AN1E 3MFJA 4TY6A 3H09A 5A0AE 1K21H 4YOIA 3A87A 1L4ZA 3RXOA 2ZFQH 3HKJB 3E91A 5DGJA 1YLDA 1GHBF 1XVMA 2F83A 1YKTA 2QF5A 1C1PA 1NRNH 2B9LA 1A46H 1KLJH 2PKSC 4A1XA 1EJAA 1IQGA 1GWAA 1RTFB 2RDLA 1HV7A 4DURA 4A7IB 4HZHA 1ZSKA 1DUAA 3M37A 3PB1E 1HBTH 2UWPA 1GMHF 1O2QA 4TY7A 3UNQA 1IQMA 4K2YA 2HNTF 2BD2A 4CH8B 4VGCB 1WQSA 4KGAA 1QB1A 1P2OA 3E16B 2XCNA 3QTVH 2FI3E 3PROA 5HM9A 1YLNA 3ZZ3A 4AC9A 1EZSC 3V0XA 1DS2E 2PUQH 4FU9A 1SMFE 2AMPA 1SHHB 4Q7XA 3U9AH 3LGIA 1S5SA 3M3VA 1RIWC 4HI3A 1AVGH 1GHWH 1DWDH 3ATWA 2A5AA 1C2GA 2WUCA 4CR9A 2J94A 3M5NA 1MD7A 2BOKA 1O2UA 1UVOA 4AFSA 1GBBA 1AFEH 3ZVAA 4MNYA 1GI5A 1OXGA 3BIVH 1ANCA 5BRRE 4ZXYH 1OP2A 1F5KU 3SU0A 3ZVFA 4KTUA 1FIZA 3A80A 4CRAA 5F03A 1BMLA 1SGFA 2ZHEH 1UK2A 4AYVB 4INLA 1P06A 3QDZB 1ZHRA 1O3FA 3QWCH 1ARBA 4I8LA 4ZKOU 2VIWA 4O97A 1BMAA 4Q63A 3FOAA 3D23A 3S0NA 1C5OH 3GYMA 1O2HA 4XDEA 2KZ4A 2QC2A 3SU6A 2XC4A 5C5NA 1BRBE 2FXRA 3T25A 3E3TA 3ZV9A 1O5AB 1P11E 1Y3WA 2C8YB 3MH5A 8LPRA 1FMGA 1GJAB 1O2IA 5EJZA 2ZCLP 4X1PU 2C8WB 3MH7A 1VR1H 3PMHB 4ACBA 1DX5M 1BBRK 2FS8A 4ZAEA 3TJNA 1C1TA 1VITH 4OS7A 3N7EA 3RUOA 5CHAB 2ZFSA 1HAVB 2BX4A 3NWUA 3UR9A 4BTTB 5A0CA 5K0HA 4JK6A 5AF9H 1NRQH 1Z1IA 3PYHA 3KQ5A 2HNTC 1PPFE 3RXHA 1PPZA 2G5NA 4D7FA 1YBWA 3RLWH 1O2XA 1GHAG 1H1BA 5F6MA 3PTNA 2BY9X 1AKSA 1PFXC 3GCNA 2QXHA 1C5YB 1CA8B 2P94A 3TJOA 4NIXA 2ZGJA 5JDUB 1E38B 2BDYA 2AERH 1JMOH 2QF4A 3OX7U 1ESBA 2BVXH 1QQ4A 2ANYA 1EOLA 5HYOA 4ZKNU 1FXYA 3QGJA 1PPGE 1AVWA 3SGQE 1CO7E 1AUTC 3SQEE 3UTUH 1E1RD 2OBOA 4D76A 1D3PB 2ZCKP 1GVLA 1UTKA 1G3EA 1W0YH 2VH0A 2FP7B 2F9NA 4GVUA 1DVAH 5JBBS 1CBWC 1A4WH 1WYKA 1P2NA 1TX7A 2D8WA 3NPSA 1Z71A 3NXPA 3E1XB 2OP9A 5FHTA 1O2KA 2VVCA 1ELFA 1IAUA 2FOCA 2Y7ZA 2QAAA 3SHAH 3DFLA 1BHXF 1LHEH 1DT2A 3BTFE 3TJUA 4MPXA 2FX4A 3ZZ4A 2ZDKA 3RLYH 3F6UH 4DW2U 1H9IE 2OUAA 2G51A 4KTCA 2HLCA 3BSQA 5L2ZH 2P16A 1LCYA 1SVPA 2C3SA 2ZGBH 1TRNA 1C9PA 2Y5FA 4AFQA 3JZ1B 3GY3A 3F2GA 1UTNA 2W3IA 1EAWA 4AB9A 5C2ZA 3QTOH 2GMTC 4BNRA 4A6LA 4ASUD 1FONA 4SGAE 2ZPSA 3C1KA 3TJVA 3ATLA 1O3CA 1HLTH 4INHA 3OE7D 3F68H 3UY9A 2FEQH 1YLCA 1SGPE 1TFXA 3DFJA 2KCAA 1GDQA 1N1LA 1C1MA 2GT8A 3OAAD 5I25A 2EY4C 3KIDU 2IJOB 3F2FA 4Y7AA 5GXPA 1Z8JB 3NK8A 1BA8B 4YM9A 1AE5A 1NU9A 4NA9H 2PWXA 1SG8B 2VWOA 3TNSA 2ALPA 4MPUA 4LK4A 2ALVA 1WQVH 2H5DA 3A7TA 4YTAA 2R0KA 1ELBA 4Z1MD 2VVUA 2JH5D 3CS7A 3BTKE 3K6YA 3MNSA 2WHXA 5FX6A 1CHOF 1G3BA 4OGXA 5HIYA 1JIRA 2R2WU 1HAZB 3GYLB 3UB0A 1SI5H 2PKAA 2A4RA 2OC1A 1GMDG 3GCHB 4AYYB 2Y81A 1FPCH 1O3LA 3SZEA 1P3CA 2A45B 1W8BH 1BOQA 1IHTH 2TIOA 3RXCA 1ZHPA 1IQKA 3DA9B 5EGMA 3PV2A 1Y3VA 4HTCH 3HK6B 3SI4H 2RA0A 4IN1A 2YMSD 1GI2A 1GHZA 4I7YH 1TA2A 2TRMA 2SGPE 4FOUC 4KP0A 1AGJA 2VVVA 1O33A 1O0DH 2BD8A 2OC7A 2R0LA 5ESBA 3RXAA 1BMNH 3RXVA 1C5SA 1MMJN 1G2MA 3BTQE 2O8MA 2XRCA 1INCA 1ETRH 1MKWH 2WV9A 1RTKA 1B0FA 3GCTF 2F9OA 5LPFA 3KYGA 2FOFA 1ARCA 2BZ6H 1EFRD 1YYY1 5EXMA 2BY8X 1KXBA 1TQ0B 3A83A 4I8HA 1A3EH 4WF8A 3GY4A 1Y5BT 2WPKS 3PMJA 3P8GA 4U32A 4WXIA 4ZKRU 2Q6DA 2FOBA 1DWBH 1CVWH 3AW1A 3VB6A 2IPQX 2WSSD 1BT7A 1QFKH 1HXEH 2GV7A 3DSOA 5E0HA 1NZQH 4FUEA 1EZXC 4E7RG 3ODFA 4FU7A 3MO3A 1H9LB 1TBQH 1EPTB 2M2AA 1JXPA 3W1EA 4JCNA 3SUFA 1BQYA 1M9UA 1CA0B 1S84A 2GTBA 2YMSB 2Z3CA 2XCFA 4X0WU 2W6JD 3O8BA 5FPYA 1K28D 2D2DA 1O5EH 3GY8A 5FX5A 2AGEX 1DOJA 2P8OB 1QRZA 4X8SH 3LU9B 1NBMD 1UVPA 5EW2H 1DXPA 1P9SA 5KEDA 2J38A 1TPOA 3I78A 3LH1A 4OS2A 2J2UA 5FXLA 5DPAA 5L2YH 4WMFA 5C20A 1Q3XA 1GBJA 2ZDLA 3SGBE 5H4IB 1HJ8A 1IQJA 3DSGA 1V2UT 2BY6X 3RXUA 2C90B 4I8GA 1QBVH 2ZU5A 2PSXA 3F2HA 4X2VA 3TNTA 1Y3YA 3ZZ8A 1BRAA 3F1SB 1GI7B 3GY2A 2ODYB 1O3MA 3SYJA 1EAUA 1UK3A 1GBTA 1P2QA 1EP6A 4B73A 3NRLA 4CRDA 1GL0E 4D7GA 5CMXH 1UTMA 1GGDC 4ZH8A 4WH6A 5E0JA 1QB9A 1Z6JH 2ZGXH 3D62A 2F9PA 1ZPBA 1TQ7B 2XWBI 3MTYA 4A1VA 1KXCA 1ZJKA 1G3CA 2GJGA 3T2NA 1IQNA 6ESTA 3SI3H 4CRBA 5T6GA 2SGEE 1K1NA 1O37A 3BF6H 1VKYA 1S6HA 4AG1A 1VJAU 4B6FA 1FN6A 1NM6A 2A1DB 2UWLA 1ANDA 2I6SA 5A09A 3D65E 1ANBA 5T6DA 3MMGA 1WCZA 1ZOMA 1TGBA 5ETXA 4E7NA 4BAHB 1THRH 1LPZB 2CV3A 1QJ7B 3SUGA 1QHRB 3PLBA 2NU4E 2OLGA 4YT7H 4R8TB 3RXEA 3PRDA 1BITA 4FUIA 2Z7FE 2ZWLH 1DM4B 1BTUA 1TONA 1LPKB 3LGTA 4GUXA 1YP9A 2GCTC 2VIDA 1YPGH 3M7UA 1OYTH 1UTJA 1ZMNA 3M3SA 2KX4A 2WPDD 3QN7A 1BTXA 2ZGHA 5TJXA 4CREA 5LH8A 1SGFG 2W7SA 3SV9A 1HAOH 2FOHA 1TE0A 3NUMA 3GY6A 1AMHA 4P00A 3SGAE 2HPPH 7GCHG 1GVKB 1YPMH 1H8IH 1CGIE 1CU1A 1F5RA 2HVXA 1S81A 3TK6A 1P9UA 3EYDA 2ZO3H 3SHCH 3PTBA 4JMYA 4ACAA 1MH0A 2BXTH 1T8OA 1GI6A 3A7ZA 3U1JB 2ANWA 1SGNE 1C4U2 1S83A 2OD3B 1L0ZA 1MTUA 2YNBA 1GI8B 2G5VA 2ZQ1A 2GZ7A 3W94A 1D6RA 2BZAA 7ESTE 1K22H 1MU8B 4YESB 5J4SA 2CK3D 2AMDA 1ZYOA 1S82A 1AU8A 1QRXA 1A5HA 4HG6A 4U30A 4RSPA 3SU2A 1O3IA 3MU5A 5EIYA 3TVJB 3SW2B 3BEUA 2FZZA 1OWHA 2R2MB 1NU7B 1PQAA 1QA0A 2BX3A 1NY22 1C5ZB 2ZHDA 2F43B 1C5MD 1EZQA 1RS0A 1DANH 2KAIA 4DG4A 4ISHH 5DJ7A 2TGDA 7LPRA 2WV4A 1A3BH 1CA0C 1UCYE 1Y5AT 3P8FA 1DSUA 4IGDA 5AHGH 3IWMA 2O8LA 1SGDE 2YNAA 1KXFA 1V2TT 1GBKA 2EEKA 2XNIA 3BTWE 2CHAC 3D49H 1O34A 3Q3YA 1C1WH 3A82A 2P8OC 1O36A 1QA7A 2J92A 3K6ZA 1QBNA 4Q2KA 1XKBC 2VIVA 2PW8H 3GCOA 1NROH 1S0RA 3URCA 3QLPH 1SSXA 1B0EA 2H9HA 1BB0B 3A84A 1KXEA 1TALA 3SN8A 2A5IA 4BAKB 1AQ7A 2GCHG 3ZYEA 3F9FA 1YCPH 3SV2H 4OGYA 1ZRBA 2OBQA 3HKIB 3FP6E 4Q7YA 4NSYA 4MNVA 3A7YA 4XBDA 2ZHFH 1AY6H 2VGCC 1SQRA 2SGAA 1D4PB 1GDUA 4K8YA 3N99A 1O3GA 4X6OA 1O5BB 2QF0A 1LQDB 1TPPA 3DD2H 2Z9GA 1UTQA 3GDVA 3TH2H 1KSNA 4I32A 2Z9KA 3RU4D 2K8IA 2R3UA 2ZA5A 1DE7H 5C94A 4I86A 4DY7B 1YPEH 1DICA 1CBWB 3LGYA 4R0IA 1P2MA 5F8XA 3KQDA 4FUGA 2QYIA 3SV7A 1C5WB 2KM0A 1LHDH 4MLFB 5DO4H 3UOUA 3RXGA 3EA9A 1MU6B 3AAUA 1GHAF 1V2RT 1KDQB 1DSTA 2HOBA 4Y8YA 2FMJA 2BD9A 4FXGH 1ESTA 3PLKA 1SQAA 2GV6A 1O2YA 1GVZA 4F49A 1PYTC 2NU0E 1V2MT 1G32B 1O5FH 3T5FH 2BVSH 1F92A 3SZNA 2ANMH 4OS5A 1VCWA 8GCHG 2PUXB 4FUJA 1C2MA 3M61U 1ZZZA 2J98A 4YT6H 4KELA 1L4DA 5DKMA 1UMAH 6GCHG 1W3CA 1FX0B 2JH0D 2NWNA 2GMTB 3BIUH 3RP2A 1MKXK 3RM0H 3RC4A 4D8NA 1HAPH 4RKJB 1P2IA 3VB3A 1A1RA 1TOCB 1L1NA 1NFUA 2FPZA 2CJIA 1VCQA 2G4TA 3RMNH 2ZEBA 2Y5GA 3URDA 1V2KT 3SNBA 4IBLH 3MWIU 2F3CE 4HFPB 4ZKSU 2VH6A 4PROA 2BY7X 5L6NH 3KQEA 1OHHD 4CRFA 1MQ5A 2UWOA 1ABIH 1OWDA 1ZR0A 4MDSA 5C1XA 1HGTH 5T1VA 2BD3A 1RRKA 1N8OC 4MPVA 1GPZA 1OX1A 3GDSA 1O5DH 1QJ1B 2L74A 4AORA 2SFAA 1SLWB 3LPRA 9ESTA 2OCVB 4BXSA 3S9BA 2SGQE 1ZSLA 1C1SA 1NFYA 3MNXA 1PQ7A 3OY6U 2WYJA 3JZ2B 1DY8A 1KMHB 4MQAA 4FVBA 1TNJA 3UFAA 1L1JA 1Y5UT 2FM2A 1GG6C 1CGJE 1L1GA 4ABFA 1BRUP 1PJPA 1ZJDA 1LKBA 1GCDA 3ATKA 5B6OA 1HUTH 1C9TA 1ACBE 3GOVB 3M7TA 1ELTA 3R0FA 3UNSA 4WMDA 3A7WA 1BHXB 1UHBA 1YWUA 2SGDE 1XUIA 1COWD 1ORFA 1GCTC 1Z7KA 3A7XA 3FZDA 4IC5A 1HAIH 5FL7D 1V2QT 3AK5A 1GBDA 3SBKA 4K60A 1ELDE 4AX9H 3RM2H 3UIRA 1F0SA 2AH4X 2NU3E 5IK2D 2ZC9H 2ZU3A 2ODPA 1KY9A 4ZHAA 1MAYA 2Z9LA 3F3BA 1WDIA 3I77A 1K1PA 2W3KA 1AWFH 1O3HA 3LT3A 4GHQA 1GMDF 5TCCA 1HIAA 4B76A 3E0NB 4CBNA 3P92A 4AB8A 1J14A 4X6PA 1TABE 4TPYA 1GBEA 2G52A 1EATA 5FCKA 1TNKA 4FVDA 4WY3A 2OC8A 1OKXA 2P93A 3IG6B 3VB5A 1AI8H 2HLDD 4F55A 1LKAA 1SLVB 3MYWA 4FETA 1CHGA 2G81E 2PP6A 2VB0A 2VWMA 1C2HA 5GCHG 2A2XH 4AGKA 1D9IA 2WUBA 2BLOA 1YPJH 4JK5A 3KL6A 5E2PA 4X2WA 4TPIZ 2Y7XA 3UQVA 1WOFA 2DE9A 2Q6GA 4O3TA 4ZUHA 4Y8XA 1P04A 1YC0A 1MZAA 1E79D 4DCDA 1MKWK 4MVNA
chains in the Genus database with same CATH topology
1FAXA 1P03A 1GL1A 2GKVE 1SPJA 3B9FH 3BG8A 4GAWA 2TGPZ 2GZ8A 2F9UA 2HALA 1O2RA 1LTOA 1F7ZA 3TK9A 3MO9A 2V6NA 2A4OA 3Q76A 3ZZAA 4ESTE 3H7TA 1TIOA 1W14U 1J15A 4ZHMU 1QB6A 5DP3A 2Q6FA 5G4BA 1TMTH 1SLUB 5C3NA 2ZTXA 1FZZA 3U8OH 3M5MA 1GI3A 4K3JA 1LVMA 2F91A 1K1JA 5LPEA 1GGDB 2UUJB 2ZFPH 1A5GH 1ID5H 2H9TH 1C5LH 4F4OC 4AGJA 1T8MA 1EB1H 1CT2E 1O3JA 4IMQA 3BEFB 2QXGA 3ZVBA 2Y5HA 4Y6DA 3RXMA 1P09A 1C1RA 2PTCE 4SGBE 3RXFA 1MZDA 4IN2A 3O8CA 2J9NA 2AEIH 2TGAA 4GLYA 4JYUH 4K69A 3RC5A 2B7DH 3M3TA 1XXDA 3P8OA 1HJAC 2ZCHP 4XBBA 5DP9A 4FUDA 1SLXB 5FCRA 2ZQ2A 1LVBA 2STAE 2V3HH 5SGAE 1F0UA 1XMNB 2VINA 2OINA 5A8ZA 3OY5U 5EQSA 1TPSA 4Q7ZA 4CHAC 2AIPA 4AFZA 2STBE 2BDGA 1NFWA 3LC3A 1T8NA 3ATMA 1AIXH 5EODA 1LQEA 2JKHA 1ABJH 2ILNA 1MQ6A 3EA8A 3H7OA 3LIWA 1O2NA 2QV1A 1NN6A 1P2KA 2EI6A 2GCTB 5A8XA 3SU4A 3E8LA 3SUEA 1DFPA 4UDWH 3O8DA 3H5CB 1H4WA 1Z8RA 3GICB 4X1NU 3MU1A 6CHAC 4B1TA 4LXBH 1GJCB 1RGQA 1PQ8A 3RU4T 1BBRE 1KXDA 1GBCA 2ZTZA 1SFQB 1XX9A 5K7RA 2ZDMA 1S85A 3U8RH 1AKSB 5GDSH 1C1UH 1THSH 3R3GB 1EJMA 1SGCA 2FODA 1GBLA 1FIWA 2NU1E 3AW0A 1C2KA 2SNWA 1K2I1 3UWJH 3ZVGA 4ZHLU 3P8NA 2BYAX 2ZU2A 3PO1B 2ZU1A 2XYAA 3LGVA 4A5TS 4YZUA 5EQRA 1SL3A 1ETTH 2FWWA 5J4QA 3UWIA 1SOTA 2ODQA 1K9OE 3VXFH 1O3PB 1UVTH 1W2KH 1C1OA 1EUFA 4MTBA 2XC0A 1DUEA 4JZ1A 5E0GA 3G01A 1SGIB 4BAQB 3FP7E 3A7VA 4WXVA 7GCHF 1V2OT 1FY4A 1GJBB 2QN5T 3KHVA 1QURH 2ZHQH 3FVFB 4XE4A 2W7UA 3M7QA 1DDJA 4FUFA 1O3KA 1O31A 2QF3A 2CHAB 1C2EA 5HMAA 2ZIQH 1AFQC 2P95A 4YOGA 4NFFA 2BXUH 1AZZA 4ABAA 1XXFA 1O2OA 5T6FA 2CF8H 2ESTE 1NTPA 1TAWA 3SO3A 1BMMH 1EB2A 2Z9IA 3ZYDA 1TGTA 2UUYA 1TB6H 3PMBB 4K5ZA 3HGPA 2OXSA 3LOXA 3HPTB 5T3HA 3A86A 2WYGA 1AWHB 4NWKA 1HPGA 1LO6A 4ISNA 2FLRH 2FI5E 3FAOA 3SOSA 7KMEH 1TOMH 1PYTD 2BD5A 4O03A 4IS5A 1P05A 2ZG0H 1ELEE 2VGCB 1DLEA 1LHCH 4B71A 1XKAC 1Y59T 1MUEB 5AVDA 1ZPCA 4MNWA 1UTLM 3MI4A 3B8JA 2UUKB 1DWCH 4IW4E 2RA3A 1O32A 1ZGIA 3P6ZB 3EE0B 4ABGA 4NCYA 2OQUA 4Y0ZE 1EX3A 1AHTH 2RCEA 2TBSA 2ZFTA 2Z3DA 3LONA 2PKAB 1LMWB 2K1QA 2G4UA 1EASA 2GCHF 3M35A 1TBRH 5AFZH 4UONA 4IC6A 1YCPK 1C1VH 5FPTA 1EKBB 5LPRA 2F9BH 1N6XA 4E05H 4CR5A 3KQCA 4NSVA 3QX5H 4AOQA 1A0HB 3T62A 1YGCH 2R3YA 1CGHA 1LVOA 3ZZCA 1TX6A 5L30H 4NA8A 2H1UA 1O35A 5E2OA 1NFXA 4H6SB 3UR6A 3U69H 2NU2E 2GD4B 4BANB 3ODDA 3LJOA 1MTNC 3ZZ9A 1TGNA 2THFB 2XW9A 1GJ9B 1B5GH 1E36B 4UFGH 4LZ4B 1ZMJA 3OSYA 2HPQH 4B2CA 1TPAE 1JBUH 1BJVA 3KGPA 1NT1A 4UEHH 1T7CA 3SUDA 1WV7H 1DWEH 1P12E 4NGAH 3TITA 2BDHA 8KME2 1KIGH 2SNVA 2VJ1A 1TBZH 1JWTA 2P3TB 1X7AC 1S6FA 1Q31A 5GIBA 1N8OB 2VWLA 3GDUA 8GCHF 1QBOA 6LPRA 2VU8E 3PO1C 1E35B 3VGCC 1RJXB 1C1NA 3UPEA 1O2JA 4I31A 1O2SA 6GCHF 1G36A 3V3MA 1QL7A 4FUBA 2D26C 1O3DA 1C5RA 1QJ6B 2Y80A 3WY8A 2G55A 3TK5A 1GG6B 3FP8E 4D9QA 4NIWA 4FU8A 1O3EA 3N7OA 2FOAA 1FN8A 2M5TA 2W26A 2AFQB 3ZV8A 4Y71A 2Z6BD 2FO9A 3CP7A 2XXLA 4ABIA 1P0SH 1K1OA 1W13U 1A0LA 1GCTB 1AB9B 2PLXA 5GWZA 5IYTA 1UCYH 4Y10E 5C67A 2WPHS 1ELAA 2B0FA 3NKKA 1C2LA 3K2UA 1FY8E 1SB1H 3LJJA 3PLPA 2WINI 4GCHG 1ZHMA 3ZZ5A 3LGUA 5FBEA 4KTSA 2Z9JA 3V13A 3RXRA 4I8KA 5LGOA 2BDIA 1KTTB 1P10A 3MNCA 2EC9H 5GJ4B 2V35A 1E34B 1T4UH 5JBAS 3TIUA 4RKOB 3S69A 2FIRH 1HAGE 1KYNA 1BCUH 1BJUA 3OU0A 1QNJA 3LKWA 1MCVA 2ZGCA 4JZIA 3GISB 1E0FD 4UFFH 3ZZDA 2XBWA 3T28A 2ASUB 1OYQA 1BTHH 2O8TA 5DK1A 3A89A 1FI8A 1RXPA 1O3BA 1V2PT 1GJ6A 1SFIA 2LPRA 1W7GH 2TPIZ 5JBCS 2XBVA 1O2ZA 3SNAA 1L2EA 4YLUA 2FTMA 4THNH 1GHVH 4X8VH 1RTLA 4LOYH 1GJ4H 4Y11E 3FANA 3SJKA 1GDNA 2BTCE 5EOKA 3SQHE 1QY6A 1P57B 5PTPA 3TPIZ 3KQBA 1ANEA 2BD4A 4NWLA 1V2WT 3SJ9A 1HCGA 1GBHA 1UK4A 5EW1H 4X2XA 3OYPA 2FYQA 2J34A 2VIPA 5ESTE 2ZTYA 2B8OH 4O3UA 1J8AA 1UVUH 1JRSA 2WPLS 3ZVCA 1ESAA 1OOKB 3V12A 1V2JT 5GCHF 4NIYA 1TX8A 1TNHA 2CF9H 1HAVA 1CT0E 2H5CA 4GSOA 3A8CA 2XTTB 3A81A 4UE7H 1TYNA 2PSYA 4I8JA 3ZZ6A 1KLTA 5F8TA 4KKDA 1AD8H 1CQQA 1A2CH 1OWIA 5EQQA 5C5OA 2ZP0H 1IQIA 3RXJA 3BEIB 3T29A 2A31A 1VCPA 5HM2A 1BIOA 2GDEH 4ABDA 2PV9B 1Y3UA 1Z8GA 1G2LA 1O2WA 1J9CH 1BTWA 3ENSB 1OWKA 1TLDA 3EAJA 4IMZA 2BLVA 1IQFA 1HJAB 3MO6A 5A2MH 1MBQA 3MU4A 1GBMA 2BD7A 2PGQB 2ZU4A 4GHTA 3I29A 3S7HB 3RDZA 4CHAB 3GY5A 2O9QA 3EGKH 2KAIB 3FFGA 1P8VC 1GJ8B 1C2IA 1O30A 2ZZUH 1S0QA 3HGNA 1W11U 5ABWA 8ESTE 3UNRA 1XUFA 1FY5A 5I46H 1GI4A 3ZVDA 2BY5X 3RXLA 1AE8H 2WV5A 1TRMA 1TMUH 1SBWA 1BDAA 1QL9A 1QRWA 1ZTKA 1HAXB 1TGCA 1BZXE 2SGFE 5C1YA 1P3EA 4K1EA 4XFQA 1GJDB 4U01A 1ZGVA 6CHAB 3U8TH 4K1TA 1Z8IB 4XSKU 5A8YA 3CENA 1P02A 5HGGA 3BN9A 1FY3A 3U98H 3ITIA 1BTPA 2A4QA 2H6MA 5DP4A 1ZTLA 1SGRE 2ZECA 1AB9C 2OC0A 4JYTA 5JB8S 2PHBA 4CBOA 1G37A 3S7KB 4ABBA 4ISLA 2FTLE 3QK1A 1SQTA 3QUMP 3VXEH 1UVSH 4FUCA 4CRCA 4OS4A 3F9EA 4YO9A 4ABEA 1C4V2 1GMCF 3QGNB 1DLKB 1KXAA 1K1IA 3KF2A 5C1UA 3TH4H 1OS8A 1HAYB 1UTOA 1W7XH 1DITH 1QCPA 2EI8A 2G8TA 1W10U 1O39A 2AMQA 1RFNA 1GI1A 2GGVB 1PPCE 2G00A 3BG4B 4X1RU 1V2ST 1VGCB 1MTWA 3E0PB 3BTDE 2O8WA 2ZDVH 2C93B 3SJ8A 4BAOB 3OTJE 2D1JA 1LPGB 1VITG 4J1YA 2EI7A 2FLBH 1W0ZU 1UJ1A 4TWWA 2ZI2H 1C5VA 1C4Y2 1FQ3A 4AN7A 3KNXA 3LDXH 1IQLA 4NFEA 2BLWA 1TNGA 3SU5A 1DY9A 2BQ7B 1HNEE 1RD3B 1AFQB 3ELAH 3FZZA 4NZQA 1FV9A 3GY7A 3M5OA 2WPJS 1XUKA 3UUZA 2Z94A 3O8RA 3DUXH 1Y3XA 4CH2B 3IITA 4TYDA 4BXWA 2IOTA 1GHBG 1NRPH 3A8AA 4K8BA 1AVXA 1B7XB 2HWLB 4UFEH 2VIOA 4ZXXH 1FDPA 2BOHB 3PV4A 3KN2A 4K1SA 1AZ8A 1FNIA 1H9HE 1MTVA 2JETB 1GJ7B 5JB9S 1EAXA 5FBIA 3VPKA 2YOLA 1ZRKA 2Y6TA 4MPWA 1GMHG 1H8DH 1MKXH 2HNTE 5DP5A 3RXPA 3SORA 1E37B 5EU8A 1C2DA 1G9IE 2O8UA 4JZEH 3SV6A 1K1MA 1TRYA 2BB4A 2A32A 2XBXA 5EXNA 1V3XA 4AZ2B 4J2YB 1MD8A 3UQOA 4OS6A 1HXFH 1EPTA 5JYIA 3LH3A 3RMLH 1THPB 1Z1JA 4JZDH 1EP5A 4NZLA 2HGTH 2GP9B 2GDDA 2PFEA 2R9PA 4ZMAH 1YM0A 2H2ZA 1VJ9U 3A85A 1EZUC 2BQ6B 1U6QA 3PM3A 1V2NT 1UHBB 3S9AA 3SNDA 2PGBB 1PQ5A 2ZHWH 5FAHA 3VB4A 2F9VA 2QGRA 1WTGH 4VGCC 3SJIA 4DOQA 1T31A 1T8LA 1ZPZA 1F0RA 3PWCA 1SGTA 2BDCA 1MTSA 1O5GH 1WSSH 3NZIA 2Y82A 2A7CA 1GMCG 3TLOA 4E06H 1WTHD 2V3OH 1YPHC 4B2AA 1F2SE 2AGGX 2AYWA 1QIXB 2ZKSA 2A7JA 1EQ9A 1MTNB 2V0BA 4WVPE 1D6WA 1WUNH 3T27A 1HIAB 1MCTA 3MOCA 4BOHA 1O5CB 2ULLA 1VZQH 2QXJA 1SOZA 2FOMB 4GPGA 4FUHA 3RU4E 1BBRH 3MH6A 3Q3KA 1BRCE 2C8ZB 1T4VH 1GI9B 1QQUA 1J17T 4B74A 2VNTA 1C2JA 3LGWA 1C1QA 2VWNA 2QCYA 1XVOA 2OQ5A 1O3OA 5JBTA 3A8DA 3AVZA 1ETSH 1TWXB 3PWBA 1CSOE 3UREA 3SU1A 4QT8C 2ZNKH 3TGJE 1O2TA 1YPHE 3VGCB 4AG2A 3A88A 1AO5A 1LDTT 4OS1A 3TGIE 3M36A 1O2PA 1QL8A 1O2MA 2A4GA 4NA7A 4MNXA 3B23B 3KCGH 1G3DA 1C5NH 1HAHH 2FOEA 4Y79A 3BG4C 3T26A 4Y76A 1VGCC 3RC6A 1NS3A 4UD9H 1PPBH 4X2YA 2LNCA 1A0JA 1EOJA 1CE5A 3E6PH 2BMGB 3HK3B 1YPLH 5CHAC 1FJSA 2B5TB 5DP7A 5EPNA 4YLQH 2A2QH 1F0TA 2XWAA 4WWYA 1Q2WA 1FPHH 4M7GA 1BTYA 2TGTA 1SC8U 2P3FH 1OP8A 3S9CA 3Q3XA 3TH3H 1FY1A 3MU8A 1C5TA 2ZDNA 2FS9A 4B75A 4ISIH 2FI4E 4DVAU 1NRRH 4A92A 2CMYA 1LVYA 3RMOH 4Y0YE 3V7TA 3BTME 3MNBA 1MAXA 3EDXB 4D9RA 4JYVH 1WU1A 2BM2A 2ZFFH 2DUCA 4U2WA 4H4FA 3SV8A 2ZPRA 2FX6A 2JETC 3BTGE 1GBAA 1EJNA 1XUGA 2FYRA 3ZVEA 1XUHA 1YPKH 1CT4E 2C4FH 2P3UB 2W5EA 1EXFA 4DIIH 4TWYA 3QZRA 4WMEA 1UCYK 1AUJA 1TNIA 3RMMH 4DIHH 4LZ1H 1YCPM 1GBFA 2BLQA 4JZFH 2CGAA 3SNEA 2FDAA 2UUFB 1Y8TA 3U1IB 4X1SU 5F8ZA 2QIQA 3AAVA 1ELGA 3RXSA 1O2GH 4GCHF 5IDKA 1SR5C 3DHKH 2Q1JA 1IOEA 1TGSZ 3RXDA 2GVFA 2P59A 2J4IA 4I33A 1IQEA 1ZTJA 2A7HA 5AFYH 1GBIA 5JPMH 3QO6A 2AS9A 2AIQA 3SU3A 3STIA 4Q80A 1C5QA 1UTPA 4ZROA 1CHOG 1FUJA 1A5IA 3QZQA 4Y7BA 1EAIA 1IHSH 1GHXH 1GI0A 1FAKH 3BTTE 1HRTH 5CE1A 2QA9E 4MG3A 1LHGH 2H9EH 2BDAA 2A0QB 1V2VT 4Z0KA 5A0BA 2GX4A 1GJ5H 1W12U 4O9VA 5DG6A 4ABHA 2J95A 4HGCA 1BUIA 1KTSB 3RXKA 3TU7H 1MBMA 1ZLRA 3P17H 1GHYH 2QXIA 4XBCA 3AASA 2FESH 1V6DA 1D3DB 3L6PA 3VFEA 1NESE 1YF4A 3UOPA 2PKSB 3HATH 3ZZBA 3NCLA 2VIQA 4Y8ZA 1XM1A 3GCTG 2AGIX 4DT7B 4B2BA 2EA3A 1QR3E 5HXFA 2ZFRH 3CS0A 3RXQA 3F9HA 1BTZA 3RXTA 3GCHC 1O2LA 2FOGA 1FLEE 4Z6AH 3TGKE 1C2FA 2ZPQA 3LC5A 1OWEA 1SGYE 2PR3A 1NC6A 1ZSJA 1KDQA 3L3TA 1UO6A 1Z6EA 3RXIA 1OWJA 5DP8A 5GPIB 4WH8A 2CN0H 1PPHE 2GT7A 4ISOA 1RIWB 1IQHA 1O38A 2DE8A 3M5LA 4RN6A 5EG4A 1HB0B 2BQWB 3BTEE 1ZMLA 3A8BA 4H6TA