3KHXA

Crystal structure of staphylococcus aureus metallopeptidase (sapep/dape) in the apo-form
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
470
structure length
422
Chain Sequence
SMWKEKVQQYEDQIINDLKGLLAIESVRDDAKASEDAPVGPGPRKALDYMYEIAHRDGFTTHDVDHIAGRIEAGKGNDVLGILCHVDVVPAGDGWDSNPFEPVVTEDAIIARGTLDDKGPTIAAYYAIKILEDMNVDWKKRIHMIIGTDEESDWKCTDRYFKTEEMPTLGFAPDAEFPCIHGEKGITTFDLVQNKLTEDQDEPDYELITFKSGERYNMVPDHAEARVLVKENMTDVIQDFEYFLEQNHLQGDSTVDSGILVLTVEGKAVHGVNAGLYLLKFLASLNLDNNAQAFVAFSNRYLFNSDFGEKMGMKDVTTNIGVITYDNENAGLFGINLRYPEGFEFEKAMDRFANEIQQYGFEVKLGKVQPPHYVDKNDPFVQKLVTAYRNQTNQKNEYITKKQLFNATSIYLEAIYSLCVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dipeptidase SACOL1801
publication title Crystal structure of Staphylococcus aureus metallopeptidase (Sapep) reveals large domain motions between the manganese-bound and apo-states
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 127
structure length 422
sequence length 470
chains with identical sequence B
ec nomenclature ec 3.4.13.-:
pdb deposition date 2009-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3khxA01
2RB7A 3QNVA 5THWA 2PJ2A 3HUVA 2PJ8A 4UF4A 4K3NA 2Q51A 2C1CA 2FVGA 2EWBA 3IFEA 2ZOFA 4PQAA 5HVGA 3WC6A 2XEGA 3BXMA 4PXCA 2WZNA 1HDUA 5I4MA 4OP4A 3IIBA 1BPMA 3KR4A 2PJ0A 3B2YA 4F9VA 2AFZA 3D7GA 2CIJA 4IK2A 3H8GA 3S9MA 3L2NA 5K8NA 4X3RA 1GYTA 4TNUA 3D7FA 4O23A 4X2TA 4P4JA 2GREA 3NH5A 4NJQA 3PRTA 1LANA 3BI1A 4R76A 4MHNA 2JEWA 3KASA 1YLOA 2CTCA 2PJ4A 5K8PA 2V8GA 4OC1A 3I1UA 3WC5A 3WC7A 3D66A 4B6ZA 2AFUA 2O53A 1RTQA 5DS0A 3SJFA 5LYIA 2Q43A 3D4UA 3FECA 1KWMA 2PE3A 4ZY2A 8CPAA 2PJBA 3B35A 1OBRA 2ZEEA 7CPAA 2V8HA 4OIDA 3KGQA 5LYLA 4NGNA 4UEZA 4W9YA 3FX6A 3PB7X 4MMOA 3T8WA 5K8MA 4MXUA 2ANPA 4DUKA 4EFDA 3FEDA 2PJ7A 4FUUA 4TWEA 4P4DA 5IB9A 4EWTA 3D7HA 3D67A 4GM5A 3SI2A 4R7MA 1AYEA 1YMEA 2ZEMA 4P4EA 3S9NA 1H8LA 1TKHA 4ONWA 1DTDA 1CP7A 1ARMA 3VH9A 3H8FA 4MHPA 3CPXA 3IWWA 4ZYQA 1PYTB 2PVVA 4OC5A 4OC3A 1ZLIA 1QQ9A 3HLPA 2ZELA 4PXDA 4MCQA 4ZY0A 1TKFA 3B3WA 3SI0A 4A39A 3SJGA 3CT9A 4OC4A 1VHEA 1YW4A 1CPXA 1ELMP 1XJOA 3PB9X 3IO1A 3TC8A 4ZX9A 2AFWA 2PJCA 2PJAA 4YWYA 2IJZA 1ARLA 1F2PA 1BPNA 3PB8X 2PVWA 3WABA 3RZAA 3FEEA 2O4HA 4F8ZA 3PFEA 3SJXA 5JH9A 3PBEA 3KZWA 1IY7A 3PFOA 2HB6A 1BAVA 4YU9A 1XRYA 2QYVA 3CPAA 4H2KA 3KHZA 2V8DA 2AFSA 3RBUA 2ZEPA 2QJ8A 3SI1A 1VHOA 1F57A 2NYQA 4UIAA 3BI0A 2AFMA 3NH8A 3FVLA 2ZEGA 1Y0RA 1HDQA 2HC9A 3DGVA 2C6CA 3IJ3A 4MCRA 4WWVA 1Y0YA 2BO9A 4MHZA 2Q4ZA 4OMEA 5CBMA 4LQGA 2POKA 2ZEFA 3KQZA 3B7IA 4UEEA 3ISXA 3MRUA 2J9AA 1M4LA 3SJEA 4A94A 3PBBA 4WJBA 1DE4C 1AMPA 3D68A 1Z8LA 5J1QA 1Y7EA 4OC0A 4IAVA 4P4IA 3K2KA 4MHYA 3TX8A 2ZEOA 3K9TA 3GB0A 1CBXA 4UIBA 3FJUA 2C6GA 2EK8A 4RUHA 3VARA 4CPAA 2ZEDA 4DJLA 2JBJA 4P44A 2PJ1A 4DYOA 4BD9A 5K8OA 5LYFA 4AXVA 1LOKA 1YSJA 2QVPA 2XEIA 5LRGA 3IC1A 3PEIA 3V7ZA 2RFHA 2PIYA 2ZOGA 4P10A 3GUXA 3FF3A 4MCPA 5HXDA 4FBEA 3WT4A 1Z2LA 1FT7A 3RAMA 1XMBA 3B3SA 5HVFA 4OKOA 1LFWA 3H8EA 1TF9A 2XEJA 3KHXA 1LCPA 2XEFA 5D8NA 1VGYA 5HVHA 4A38A 2PJ3A 4F9UA 4P4FA 1ZG9A 2DEAA 4P6YA 4JZ0A 4NJRA 4PPZA 3KR5A 5LRJA 3BHXA 1YW6A 3IEHA 4MCSA 1R3NA 2NSMA 4P4BA 1TF8A 1HEEA 2C6PA 2ZEHA 3DLJA 4NGSA 3NFZA 3S9LA 4R8FA 2CF4A 1BLLE 3FMCA 5CPAA 4ZY1A 4IHMA 4FAIA 2BCOA 3N5FA 1TKJA 2JBKA 2PJ6A 1UWYA 2PRQA 1TXRA 4PXEA 3VATA 1ZG7A 3D7DA 2GU2A 2F7VA 1PCAA 1LAMA 1JQGA 2ABZA 3LMSA 1CPSA 5F09A 4NFRA 2GLFA 1XFOA 2PJ9A 2V77A 2BOAA 2F8HA 4X8IA 1CX8A 4OC2A 1QMUA 1IGBA 1LAPA 3KI9A 2IQ6A 2OOTA 3PB4X 4Z65A 4ZI6A 3B3VA 4NGTA 3MN8A 3V38A 2CTBA 1ELLP 4ZX8A 5ELYA 2PJ5A 1F2OA 5JM6A 5JGFA 2PCUA 1EE3P 1ZG8A 4MRIA 3PB6X 4OIWA 2OR4A 3KQXA 4A37A 3NH4A 3GLJA 5LYDA 2ZENA 3JRUA 3LWUA 1CG2A 6CPAA 4FWUA 4G1PA 1Z5RA 3ISZA 4Q7AA 2EK9A 4EMEA 3B3TA 3CDXA 1CP6A 2AFXA 2GLJA 2IMOA 1R43A 4NGRA 1NSAA 4KSIA 1Q7LA 4JYWA 2I3CA 4NGPA 4PXBA 1VIXA 3NA6A 4NGQA 5D29A 5LRKA 2G9DA 4NGMA 2PIZA 1XBUA 4UEFA 1FNOA 2WYRA 2V8VA 2AFOA 3KL9A 3FH4A 4P45A 1ZLHA 2VL1A 3B3CA 4R6TA
chains in the Genus database with same CATH superfamily
4UFVA 1Y7RA 2RB7A 2HV2A 3QNVA 5THWA 4B12A 4BINA 2FCKA 2PJ2A 2REFA 3DR6A 4LX9A 4KOYA 3HUVA 2PJ8A 4GS4A 4UF4A 3EXNA 1I12A 3QAHA 4K3NA 2Q51A 2C1CA 2FVGA 2EWBA 4JWPA 3IFEA 3TO6A 2ZOFA 4PQAA 2ZW4A 5HVGA 2FIWA 3WC6A 4PK3A 2XEGA 2G3AA 3BXMA 4CAFA 4PXCA 3BJ8A 4H6UA 2P6GA 4H6ZA 4LUAA 2WZNA 4B10A 1HDUA 5I4MA 4OP4A 3IIBA 2F5IA 4UWJA 5J8FA 1BPMA 4II9A 4BMHA 4R87A 3KR4A 1Q2YA 2PJ0A 3B2YA 3D2PA 4KOXA 3R9GA 3T9YA 4F9VA 4AVCA 2AFZA 3D7GA 2CIJA 4IK2A 3H8GA 4MFLA 3S9MA 3L2NA 4CRZB 2JDCA 5K8NA 4E8OA 1TIQA 4X3RA 1GYTA 2PDOA 2G3TA 3C26A 4MFQA 4J3GA 3F0AA 5E96A 4AB7A 1M1DA 1XE4A 5AGEA 4TNUA 4KORA 1MJBA 3D7FA 4O23A 4X2TA 4P4JA 3GKRA 4GXHA 2GREA 3NH5A 4NJQA 3PRTA 1LANA 1PU9A 3BI1A 3CXSA 4UA3A 3EC4A 2J8RA 4B5OA 4CGOA 2CNSA 4R76A 4QVTA 1S60A 3R96A 4MHNA 2JEWA 4KVME 1S7NA 3EFAA 3KASA 1YLOA 2CTCA 2I79A 2PJ4A 1K4JA 5K8PA 2V8GA 4OC1A 3I1UA 4FD5A 2EUIA 1IYKA 5HH1A 3WC5A 3WC7A 3D66A 4AVBA 2B4BA 2Z3LA 4B6ZA 2PQ8A 2R8VA 1IOFA 2DPSA 2AFUA 3FRMA 4JJXA 2O53A 3TTHA 1XIXA 1RTQA 5DS0A 4L8AA 4IUSA 3SJFA 5LYIA 2Q43A 3IWGA 3D4UA 3DSBA 3FECA 1KWMA 2PE3A 4ZY2A 2Q4YA 4B5PB 1CJWA 1WWZA 1YREA 2Z10A 3SXOA 4KUAA 8CPAA 2PJBA 3B35A 1OBRA 2CXAA 2ZEEA 2ZW6A 7CPAA 2Q04A 2V8HA 4OIDA 4KOWA 3KGQA 1BO4A 2FL4A 4OLLA 5LYLA 4HNXB 4NGNA 4UEZA 3CZXA 3FX6A 3PB7X 4W9YA 4IF5A 2DXQA 4AG9A 5A28A 4MMOA 2G0BA 4CYQA 3T8WA 5K8MA 4MXUA 2ANPA 3NE8A 4XPLA 4DUKA 4EFDA 4AVAA 4C7IA 4C2YA 3FEDA 4KLWA 5JPHA 1GHEA 4H89A 2D4OA 2PJ7A 1AUGA 4Q36A 4FUUA 2B5GA 4P4DA 4R3LA 4TWEA 2YGWA 1Z8XA 2VZYA 3R1KA 5IB9A 4EWTA 3D7HA 2JEVA 4KS9A 4A30A 3D67A 3QB8A 4UCPA 1MK4A 3IU1A 4GM5A 3SI2A 2O28A 2ZPAA 4R7MA 1AYEA 4OAEA 2EVNA 4JLYA 1YMEA 2ZEMA 4P4EA 3S9NA 3DNSA 1Q2DA 3P2FA 3GYAA 4AG7A 1WK4A 2P6EA 4ORFA 5EC4A 5KTDA 4FD4A 1H8LA 1TKHA 4LQ6A 1A2ZA 1DTDA 1CP7A 3OWCA 4ONWA 4Y49C 1ARMA 2PSWA 1CM0A 3VH9A 3H8FA 4MHPA 3CPXA 3IWWA 5KTCA 2OH1A 4YRHA 4ZYQA 3TE4A 1PYTB 3K9UA 1LRZA 1Z8WA 2PVVA 3N7ZA 4OC5A 4C2ZA 3NE7A 4XPDC 1SQHA 2FS5A 3CXQA 4ZBGA 3D3SA 1Z4RA 2OU2A 1IICA 2FIAA 4XNHC 3UY5A 1JWQA 5IX3A 4OC3A 4UBRA 1ZLIA 2VBQA 1QSOA 2WSAA 1QQ9A 2HUZA 2ZELA 3HLPA 4PXDA 1IU8A 5AG7A 3TCVA 4MCQA 2Y0MA 3LACA 4ZY0A 1TKFA 3B3WA 2WPWA 3SI0A 4A39A 3SJGA 3CT9A 4U9YA 4OC4A 1VHEA 1J4JA 1Q2CA 1CPXA 1ELMP 1YW4A 2X7BA 3VWDA 3ZZIA 4C7HA 5DWMA 4CAWA 4CGMA 1XJOA 3PB9X 3IO1A 3TC8A 4ZX9A 1OZPA 2AFWA 4B14A 2PJCA 1M4DA 2PJAA 4MFPA 4YWYA 3I9SA 4EVYA 1L0CA 4KUBA 2IJZA 1ARLA 1F2PA 1N71A 1BPNA 3PB8X 2VEZA 1M44A 2PVWA 5G1ZA 3WABA 3RZAA 2B3VA 3FEEA 3GIUA 4B11A 2O4HA 1YK3A 5BWAB 2WUUA 2BSWA 4F8ZA 3PFEA 4C2XA 1IYLA 4MFZA 3SJXA 5JH9A 3RO0A 3W6XA 3PBEA 5KTAA 4FD7A 3EY5A 3RYOA 1P4NA 4UWIA 4QUSA 4E2AA 4RS2A 3TO7A 3KZWA 4QC6A 1IY7A 3PFOA 2HB6A 1BAVA 1XMTA 1XRYA 2QECA 4YU9A 2QYVA 3CPAA 1M4IA 3KHZA 4H2KA 4F0YA 3W6SA 2V8DA 2AFSA 4KVXA 3RBUA 3SHPA 3H4QA 2ZEPA 3JVNA 2QJ8A 3SI1A 1VHOA 1F57A 2NYQA 4UIAA 4R57A 3BI0A 4A95A 1X12A 2AFMA 3NH8A 3FVLA 3P2HA 2ZEGA 4KVOE 5C88A 4C68A 1Y0RA 1HDQA 1ON0A 2GANA 2FT0A 2VQYA 2HC9A 3DGVA 3IGRA 2C6CA 3IJ3A 3CXPA 3IWEA 1MJAA 4L89A 4MCRA 4UFWA 4WWVA 3MGDA 1Y0YA 2BO9A 1Y9WA 3S6FA 4MHZA 2Q4ZA 5IV0A 2RC4A 4OMEA 4A31A 5CBMA 4QB9A 4Y49B 4LQGA 2POKA 2Q4VA 3FBUA 2EBJA 2ZEFA 3KQZA 3B7IA 2Z11A 4UEEA 3PP9A 3ISXA 4RN7A 1P0HA 3TO9A 3MRUA 2J9AA 1M4LA 3SJEA 4A94A 3PBBA 4NSQA 3WR7A 2GE3A 3E0KA 4CYOA 3TT2A 1YGHA 4PV6A 4WJBA 4E0AA 3G3SA 3T90A 1IB1E 1DE4C 4RI1A 4UCNA 1AMPA 3D68A 1Z8LA 3IU2A 5J1QA 4K30A 1YVOA 2OB0A 1Y7EA 4OC0A 2CNTA 4IAVA 3FIXA 4P4IA 1YR0A 3EO4A 3K2KA 3QAYA 4MHYA 2NMTA 2IL4A 4CS0B 3GY9A 3TX8A 3TOBA 2ZEOA 1YLEA 4YFJA 3K9TA 3GB0A 1CBXA 3G8WA 4XPKA 4UIBA 3FJUA 3KKWA 4KOVA 2C6GA 5C82A 5G20A 2EK8A 2K5TA 4M85A 4CYPA 4RUHA 2P0WA 3VARA 4CPAA 4PSXA 2ZEDA 1X10A 4DJLA 1S7KA 2PR8A 2JBJA 4KOUA 4P44A 5DWNA 2PJ1A 2Q0YA 3BLNA 4JXRA 4BD9A 4DYOA 5K8OA 3H5ZA 5AG5A 5LYFA 4AXVA 1LOKA 2QIRA 1YSJA 2QVPA 2Z3NA 2Z3PA 2XEIA 1YQEA 4KOTA 1KUXA 5F48A 5LRGA 5GCNA 1XOVA 3D8PA 3IC1A 3PEIA 4KZTA 4DNCA 2VZZA 3V7ZA 2FSRA 3I3GA 2RFHA 3ZJ0A 1S3ZA 2PIYA 2JLMA 2ZOGA 1S7FA 4NF1A 2GFQA 2C27A 5JQ4A 4P10A 1QSRA 3R95A 3GUXA 3FF3A 4MCPA 2Q7BA 5HXDA 2PC1A 4FBEA 3WT4A 1Z2LA 1FT7A 2WPXA 3RAMA 1XMBA 3B3SA 5HVFA 3D2MA 4OKOA 1LFWA 2P6FA 3S6KA 2ZW7A 2J8NA 3H8EA 1TF9A 2XEJA 3KHXA 4M6IA 1LCPA 2BEIA 5G21A 4MY3A 2XEFA 5D8NA 2EO8A 2PRBA 4U9ZA 1VGYA 5HVHA 2D4PA 4A38A 2PJ3A 5F47A 1XEBA 4P4FA 4X5KA 4F9UA 1ZG9A 2B58A 2DEAA 4P6YA 4JZ0A 3FYNA 2AE6A 3LD2A 5F49A 4NJRA 4PPZA 2FE7A 4YGOA 4B13A 1QSNA 3KR5A 2Z3OA 4A32A 2ODFA 1VHSA 2ARHA 2R7HA 4HPSA 3BHXA 5LRJA 2OZUA 2B5GB 4MJ8A 3JUWA 3FNCA 5IB0A 1YW6A 4CGPA 4NCZA 1VKCA 1YVKA 3IEHA 3S6HA 4MCSA 1R3NA 4ZGYB 2NSMA 4P4BA 1TF8A 1HEEA 4A33A 2C6PA 1KUVA 2ZEHA 3DLJA 3PGPA 4NGSA 3TOAA 5ISVA 4UFXA 3NFZA 3S9LA 1Z8TA 2I00A 3TFYA 2KCWA 4B5PA 4R8FA 2CF4A 1BLLE 2OZGA 4MFJA 3FMCA 1B6BA 5CPAA 1U6MA 5FVJA 4ZY1A 4IHMA 4FAIA 2BCOA 1TKJA 3N5FA 2QMLA 2JBKA 2PJ6A 1UWYA 3A9LA 5EBVA 5EMIA 1KZFA 1S5KA 2PRQA 1TXRA 4KSAA 4PXEA 3VATA 1ZG7A 2H5MA 3D7DA 4CAVA 5I0CA 1B87A 4ONUA 2GU2A 2CNMA 2DF5A 1FY7A 1PCAA 1LAMA 1ZO0A 2F7VA 4CRYB 2VI7A 4I49A 1JQGA 1R57A 2ABZA 4NEXA 3LMSA 4MFKA 2YNEA 3R9EA 1CPSA 5F09A 4NFRA 2GLFA 1QSTA 1XFOA 2Q44A 4CAXA 4CAEA 2PJ9A 2V77A 3S6GA 2BOAA 2F8HA 4CGLA 4X8IA 4KLVA 5H86A 2R98A 1CX8A 4KOSA 4OC2A 1QMUA 4FD6A 4PK2A 1M4GA 1IGBA 1LAPA 3KI9A 3FXTA 2IQ6A 2OOTA 3W91A 3PB4X 4JXQA 4XPDB 3VWEA 4Z65A 5J8CA 4Q38A 1NMTA 2ZW5A 3B3VA 1I21A 4ZI6A 2BL1A 4NGTA 3MN8A 3V38A 2BUEA 4XNHB 4JD6A 2YNDA 4MY0A 2CTBA 1NE9A 2ATRA 3PZJA 1ELLP 4ZX8A 2JDDA 2B4DA 5ELYA 2PJ5A 4M3SA 2CY2A 5F46A 1F2OA 5JM6A 4HNWB 5JGFA 2PCUA 4MBUA 1EE3P 1V0CA 1ZG8A 3PB6X 4MRIA 4OIWA 2OR4A 2YNCC 4PSWA 3FB3A 3KQXA 4MHDA 4A37A 3NH4A 2PR1A 2J8MA 3GLJA 5LYDA 2ZENA 3JRUA 3LODA 3LWUA 1MJ9A 5G22A 4HNYB 2AJ6A 4R9MA 5CNPA 1CG2A 2Q7SA 6CPAA 1PUAA 1S7LA 4FWUA 1UFHA 4G1PA 3BJ7A 4CYNA 1Z5RA 1KUYA 2HQYA 3ISZA 2Z3KA 4Q7AA 1IOIA 3B8GA 2EK9A 4MI4A 3B3TA 3CDXA 3V8IA 4EMEA 5A27A 1CP6A 1Z4EA 1I1DA 1Y9KA 3DR8A 1QSMA 1IIDA 2ZXVA 4HKFA 2AFXA 1RXTA 2GLJA 2IMOA 1R43A 4NGRA 1NSAA 4KSIA 1Q7LA 3F5BA 1YX0A 2A4NA 4R3KA 2GIVA 2FXFA 2B3UA 4M6GA 4JYWA 2I3CA 4NGPA 4BBHA 3JTKA 1NSLA 4KSFA 4PXBA 5HMNA 2OZHA 4UCMA 2YNCA 1Z9UA 1VIXA 3R9FA 3NA6A 4NGQA 1BOBA 5D29A 5LRKA 1XF8A 2G9DA 4NGMA 2PIZA 4M6HA 3RNZA 2REEA 1XBUA 2DPTA 4UEFA 5AG6A 4NXYA 4OADA 4F0XA 4U5YA 1RO5A 3F8KA 1FNOA 2WYRA 2Z3MA 2V8VA 2AFOA 2VXKA 3DDDA 2B4DB 3SXNA 3KL9A 5H84A 3FH4A 4QBJA 4F6AA 5AG4A 2R1IA 4P45A 4A2ZA 1ZLHA 2VL1A 3B3CA 2Z0ZA 4CGNA 4R6TA
chains in the Genus database with same CATH topology
2RB7A 3QNVA 5THWA 2PJ2A 3HUVA 2PJ8A 4UF4A 4K3NA 2Q51A 2C1CA 2FVGA 2EWBA 3IFEA 2ZOFA 4PQAA 5HVGA 3WC6A 2XEGA 3BXMA 4PXCA 2WZNA 1HDUA 5I4MA 4OP4A 3IIBA 1BPMA 3KR4A 2PJ0A 3B2YA 4F9VA 2AFZA 3D7GA 2CIJA 4IK2A 3H8GA 3S9MA 3L2NA 5K8NA 4X3RA 1GYTA 4TNUA 3D7FA 4O23A 4X2TA 4P4JA 2GREA 3NH5A 4NJQA 3PRTA 1LANA 3BI1A 4R76A 4MHNA 2JEWA 3KASA 1YLOA 2CTCA 2PJ4A 5K8PA 2V8GA 4OC1A 3I1UA 3WC5A 3WC7A 3D66A 4B6ZA 2AFUA 2O53A 1RTQA 5DS0A 3SJFA 5LYIA 2Q43A 3D4UA 3FECA 1KWMA 2PE3A 4ZY2A 8CPAA 2PJBA 3B35A 1OBRA 2ZEEA 7CPAA 2V8HA 4OIDA 3KGQA 5LYLA 4NGNA 4UEZA 4W9YA 3FX6A 3PB7X 4MMOA 3T8WA 5K8MA 4MXUA 2ANPA 4DUKA 4EFDA 3FEDA 2PJ7A 4FUUA 4TWEA 4P4DA 5IB9A 4EWTA 3D7HA 3D67A 4GM5A 3SI2A 4R7MA 1AYEA 1YMEA 2ZEMA 4P4EA 3S9NA 1H8LA 1TKHA 4ONWA 1DTDA 1CP7A 1ARMA 3VH9A 3H8FA 4MHPA 3CPXA 3IWWA 4ZYQA 1PYTB 2PVVA 4OC5A 4OC3A 1ZLIA 1QQ9A 3HLPA 2ZELA 4PXDA 4MCQA 4ZY0A 1TKFA 3B3WA 3SI0A 4A39A 3SJGA 3CT9A 4OC4A 1VHEA 1YW4A 1CPXA 1ELMP 1XJOA 3PB9X 3IO1A 3TC8A 4ZX9A 2AFWA 2PJCA 2PJAA 4YWYA 2IJZA 1ARLA 1F2PA 1BPNA 3PB8X 2PVWA 3WABA 3RZAA 3FEEA 2O4HA 4F8ZA 3PFEA 3SJXA 5JH9A 3PBEA 3KZWA 1IY7A 3PFOA 2HB6A 1BAVA 4YU9A 1XRYA 2QYVA 3CPAA 4H2KA 3KHZA 2V8DA 2AFSA 3RBUA 2ZEPA 2QJ8A 3SI1A 1VHOA 1F57A 2NYQA 4UIAA 3BI0A 2AFMA 3NH8A 3FVLA 2ZEGA 1Y0RA 1HDQA 2HC9A 3DGVA 2C6CA 3IJ3A 4MCRA 4WWVA 1Y0YA 2BO9A 4MHZA 2Q4ZA 4OMEA 5CBMA 4LQGA 2POKA 2ZEFA 3KQZA 3B7IA 4UEEA 3ISXA 3MRUA 2J9AA 1M4LA 3SJEA 4A94A 3PBBA 4WJBA 1DE4C 1AMPA 3D68A 1Z8LA 5J1QA 1Y7EA 4OC0A 4IAVA 4P4IA 3K2KA 4MHYA 3TX8A 2ZEOA 3K9TA 3GB0A 1CBXA 4UIBA 3FJUA 2C6GA 2EK8A 4RUHA 3VARA 4CPAA 2ZEDA 4DJLA 2JBJA 4P44A 2PJ1A 4DYOA 4BD9A 5K8OA 5LYFA 4AXVA 1LOKA 1YSJA 2QVPA 2XEIA 5LRGA 3IC1A 3PEIA 3V7ZA 2RFHA 2PIYA 2ZOGA 4P10A 3GUXA 3FF3A 4MCPA 5HXDA 4FBEA 3WT4A 1Z2LA 1FT7A 3RAMA 1XMBA 3B3SA 5HVFA 4OKOA 1LFWA 3H8EA 1TF9A 2XEJA 3KHXA 1LCPA 2XEFA 5D8NA 1VGYA 5HVHA 4A38A 2PJ3A 4F9UA 4P4FA 1ZG9A 2DEAA 4P6YA 4JZ0A 4NJRA 4PPZA 3KR5A 5LRJA 3BHXA 1YW6A 3IEHA 4MCSA 1R3NA 2NSMA 4P4BA 1TF8A 1HEEA 2C6PA 2ZEHA 3DLJA 4NGSA 3NFZA 3S9LA 4R8FA 2CF4A 1BLLE 3FMCA 5CPAA 4ZY1A 4IHMA 4FAIA 2BCOA 3N5FA 1TKJA 2JBKA 2PJ6A 1UWYA 2PRQA 1TXRA 4PXEA 3VATA 1ZG7A 3D7DA 2GU2A 2F7VA 1PCAA 1LAMA 1JQGA 2ABZA 3LMSA 1CPSA 5F09A 4NFRA 2GLFA 1XFOA 2PJ9A 2V77A 2BOAA 2F8HA 4X8IA 1CX8A 4OC2A 1QMUA 1IGBA 1LAPA 3KI9A 2IQ6A 2OOTA 3PB4X 4Z65A 4ZI6A 3B3VA 4NGTA 3MN8A 3V38A 2CTBA 1ELLP 4ZX8A 5ELYA 2PJ5A 1F2OA 5JM6A 5JGFA 2PCUA 1EE3P 1ZG8A 4MRIA 3PB6X 4OIWA 2OR4A 3KQXA 4A37A 3NH4A 3GLJA 5LYDA 2ZENA 3JRUA 3LWUA 1CG2A 6CPAA 4FWUA 4G1PA 1Z5RA 3ISZA 4Q7AA 2EK9A 4EMEA 3B3TA 3CDXA 1CP6A 2AFXA 2GLJA 2IMOA 1R43A 4NGRA 1NSAA 4KSIA 1Q7LA 4JYWA 2I3CA 4NGPA 4PXBA 1VIXA 3NA6A 4NGQA 5D29A 5LRKA 2G9DA 4NGMA 2PIZA 1XBUA 4UEFA 1FNOA 2WYRA 2V8VA 2AFOA 3KL9A 3FH4A 4P45A 1ZLHA 2VL1A 3B3CA 4R6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RB7 A;  3QNV A;  5THW A;  2PJ2 A;  3HUV A;  2PJ8 A;  4UF4 A;  4K3N A;  2Q51 A;  2C1C A;  2FVG A;  2EWB A;  3IFE A;  2ZOF A;  4PQA A;  5HVG A;  3WC6 A;  2XEG A;  3BXM A;  4PXC A;  2WZN A;  1HDU A;  5I4M A;  4OP4 A;  3IIB A;  1BPM A;  3KR4 A;  2PJ0 A;  3B2Y A;  4F9V A;  2AFZ A;  3D7G A;  2CIJ A;  4IK2 A;  3H8G A;  3S9M A;  3L2N A;  5K8N A;  4X3R A;  1GYT A;  4TNU A;  3D7F A;  4O23 A;  4X2T A;  4P4J A;  2GRE A;  3NH5 A;  4NJQ A;  3PRT A;  1LAN A;  3BI1 A;  4R76 A;  4MHN A;  2JEW A;  3KAS A;  1YLO A;  2CTC A;  2PJ4 A;  5K8P A;  2V8G A;  4OC1 A;  3I1U A;  3WC5 A;  3WC7 A;  3D66 A;  4B6Z A;  2AFU A;  2O53 A;  1RTQ A;  5DS0 A;  3SJF A;  5LYI A;  2Q43 A;  3D4U A;  3FEC A;  1KWM A;  2PE3 A;  4ZY2 A;  8CPA A;  2PJB A;  3B35 A;  1OBR A;  2ZEE A;  7CPA A;  2V8H A;  4OID A;  3KGQ A;  5LYL A;  4NGN A;  4UEZ A;  4W9Y A;  3FX6 A;  3PB7 X;  4MMO A;  3T8W A;  5K8M A;  4MXU A;  2ANP A;  4DUK A;  4EFD A;  3FED A;  2PJ7 A;  4FUU A;  4TWE A;  4P4D A;  5IB9 A;  4EWT A;  3D7H A;  3D67 A;  4GM5 A;  3SI2 A;  4R7M A;  1AYE A;  1YME A;  2ZEM A;  4P4E A;  3S9N A;  1H8L A;  1TKH A;  4ONW A;  1DTD A;  1CP7 A;  1ARM A;  3VH9 A;  3H8F A;  4MHP A;  3CPX A;  3IWW A;  4ZYQ A;  1PYT B;  2PVV A;  4OC5 A;  4OC3 A;  1ZLI A;  1QQ9 A;  3HLP A;  2ZEL A;  4PXD A;  4MCQ A;  4ZY0 A;  1TKF A;  3B3W A;  3SI0 A;  4A39 A;  3SJG A;  3CT9 A;  4OC4 A;  1VHE A;  1YW4 A;  1CPX A;  1ELM P;  1XJO A;  3PB9 X;  3IO1 A;  3TC8 A;  4ZX9 A;  2AFW A;  2PJC A;  2PJA A;  4YWY A;  2IJZ A;  1ARL A;  1F2P A;  1BPN A;  3PB8 X;  2PVW A;  3WAB A;  3RZA A;  3FEE A;  2O4H A;  4F8Z A;  3PFE A;  3SJX A;  5JH9 A;  3PBE A;  3KZW A;  1IY7 A;  3PFO A;  2HB6 A;  1BAV A;  4YU9 A;  1XRY A;  2QYV A;  3CPA A;  4H2K A;  3KHZ A;  2V8D A;  2AFS A;  3RBU A;  2ZEP A;  2QJ8 A;  3SI1 A;  1VHO A;  1F57 A;  2NYQ A;  4UIA A;  3BI0 A;  2AFM A;  3NH8 A;  3FVL A;  2ZEG A;  1Y0R A;  1HDQ A;  2HC9 A;  3DGV A;  2C6C A;  3IJ3 A;  4MCR A;  4WWV A;  1Y0Y A;  2BO9 A;  4MHZ A;  2Q4Z A;  4OME A;  5CBM A;  4LQG A;  2POK A;  2ZEF A;  3KQZ A;  3B7I A;  4UEE A;  3ISX A;  3MRU A;  2J9A A;  1M4L A;  3SJE A;  4A94 A;  3PBB A;  4WJB A;  1DE4 C;  1AMP A;  3D68 A;  1Z8L A;  5J1Q A;  1Y7E A;  4OC0 A;  4IAV A;  4P4I A;  3K2K A;  4MHY A;  3TX8 A;  2ZEO A;  3K9T A;  3GB0 A;  1CBX A;  4UIB A;  3FJU A;  2C6G A;  2EK8 A;  4RUH A;  3VAR A;  4CPA A;  2ZED A;  4DJL A;  2JBJ A;  4P44 A;  2PJ1 A;  4DYO A;  4BD9 A;  5K8O A;  5LYF A;  4AXV A;  1LOK A;  1YSJ A;  2QVP A;  2XEI A;  5LRG A;  3IC1 A;  3PEI A;  3V7Z A;  2RFH A;  2PIY A;  2ZOG A;  4P10 A;  3GUX A;  3FF3 A;  4MCP A;  5HXD A;  4FBE A;  3WT4 A;  1Z2L A;  1FT7 A;  3RAM A;  1XMB A;  3B3S A;  5HVF A;  4OKO A;  1LFW A;  3H8E A;  1TF9 A;  2XEJ A;  3KHX A;  1LCP A;  2XEF A;  5D8N A;  1VGY A;  5HVH A;  4A38 A;  2PJ3 A;  4F9U A;  4P4F A;  1ZG9 A;  2DEA A;  4P6Y A;  4JZ0 A;  4NJR A;  4PPZ A;  3KR5 A;  5LRJ A;  3BHX A;  1YW6 A;  3IEH A;  4MCS A;  1R3N A;  2NSM A;  4P4B A;  1TF8 A;  1HEE A;  2C6P A;  2ZEH A;  3DLJ A;  4NGS A;  3NFZ A;  3S9L A;  4R8F A;  2CF4 A;  1BLL E;  3FMC A;  5CPA A;  4ZY1 A;  4IHM A;  4FAI A;  2BCO A;  3N5F A;  1TKJ A;  2JBK A;  2PJ6 A;  1UWY A;  2PRQ A;  1TXR A;  4PXE A;  3VAT A;  1ZG7 A;  3D7D A;  2GU2 A;  2F7V A;  1PCA A;  1LAM A;  1JQG A;  2ABZ A;  3LMS A;  1CPS A;  5F09 A;  4NFR A;  2GLF A;  1XFO A;  2PJ9 A;  2V77 A;  2BOA A;  2F8H A;  4X8I A;  1CX8 A;  4OC2 A;  1QMU A;  1IGB A;  1LAP A;  3KI9 A;  2IQ6 A;  2OOT A;  3PB4 X;  4Z65 A;  4ZI6 A;  3B3V A;  4NGT A;  3MN8 A;  3V38 A;  2CTB A;  1ELL P;  4ZX8 A;  5ELY A;  2PJ5 A;  1F2O A;  5JM6 A;  5JGF A;  2PCU A;  1EE3 P;  1ZG8 A;  4MRI A;  3PB6 X;  4OIW A;  2OR4 A;  3KQX A;  4A37 A;  3NH4 A;  3GLJ A;  5LYD A;  2ZEN A;  3JRU A;  3LWU A;  1CG2 A;  6CPA A;  4FWU A;  4G1P A;  1Z5R A;  3ISZ A;  4Q7A A;  2EK9 A;  4EME A;  3B3T A;  3CDX A;  1CP6 A;  2AFX A;  2GLJ A;  2IMO A;  1R43 A;  4NGR A;  1NSA A;  4KSI A;  1Q7L A;  4JYW A;  2I3C A;  4NGP A;  4PXB A;  1VIX A;  3NA6 A;  4NGQ A;  5D29 A;  5LRK A;  2G9D A;  4NGM A;  2PIZ A;  1XBU A;  4UEF A;  1FNO A;  2WYR A;  2V8V A;  2AFO A;  3KL9 A;  3FH4 A;  4P45 A;  1ZLH A;  2VL1 A;  3B3C A;  4R6T A; 
#chains in the Genus database with same CATH topology
 4UFV A;  1Y7R A;  2RB7 A;  2HV2 A;  3QNV A;  5THW A;  4B12 A;  4BIN A;  2FCK A;  2PJ2 A;  2REF A;  3DR6 A;  4LX9 A;  4KOY A;  3HUV A;  2PJ8 A;  4GS4 A;  4UF4 A;  3EXN A;  1I12 A;  3QAH A;  4K3N A;  2Q51 A;  2C1C A;  2FVG A;  2EWB A;  4JWP A;  3IFE A;  3TO6 A;  2ZOF A;  4PQA A;  2ZW4 A;  5HVG A;  2FIW A;  3WC6 A;  4PK3 A;  2XEG A;  2G3A A;  3BXM A;  4CAF A;  4PXC A;  3BJ8 A;  4H6U A;  2P6G A;  4H6Z A;  4LUA A;  2WZN A;  4B10 A;  1HDU A;  5I4M A;  4OP4 A;  3IIB A;  2F5I A;  4UWJ A;  5J8F A;  1BPM A;  4II9 A;  4BMH A;  4R87 A;  3KR4 A;  1Q2Y A;  2PJ0 A;  3B2Y A;  3D2P A;  4KOX A;  3R9G A;  3T9Y A;  4F9V A;  4AVC A;  2AFZ A;  3D7G A;  2CIJ A;  4IK2 A;  3H8G A;  4MFL A;  3S9M A;  3L2N A;  4CRZ B;  2JDC A;  5K8N A;  4E8O A;  1TIQ A;  4X3R A;  1GYT A;  2PDO A;  2G3T A;  3C26 A;  4MFQ A;  4J3G A;  3F0A A;  5E96 A;  4AB7 A;  1M1D A;  1XE4 A;  5AGE A;  4TNU A;  4KOR A;  1MJB A;  3D7F A;  4O23 A;  4X2T A;  4P4J A;  3GKR A;  4GXH A;  2GRE A;  3NH5 A;  4NJQ A;  3PRT A;  1LAN A;  1PU9 A;  3BI1 A;  3CXS A;  4UA3 A;  3EC4 A;  2J8R A;  4B5O A;  4CGO A;  2CNS A;  4R76 A;  4QVT A;  1S60 A;  3R96 A;  4MHN A;  2JEW A;  4KVM E;  1S7N A;  3EFA A;  3KAS A;  1YLO A;  2CTC A;  2I79 A;  2PJ4 A;  1K4J A;  5K8P A;  2V8G A;  4OC1 A;  3I1U A;  4FD5 A;  2EUI A;  1IYK A;  5HH1 A;  3WC5 A;  3WC7 A;  3D66 A;  4AVB A;  2B4B A;  2Z3L A;  4B6Z A;  2PQ8 A;  2R8V A;  1IOF A;  2DPS A;  2AFU A;  3FRM A;  4JJX A;  2O53 A;  3TTH A;  1XIX A;  1RTQ A;  5DS0 A;  4L8A A;  4IUS A;  3SJF A;  5LYI A;  2Q43 A;  3IWG A;  3D4U A;  3DSB A;  3FEC A;  1KWM A;  2PE3 A;  4ZY2 A;  2Q4Y A;  4B5P B;  1CJW A;  1WWZ A;  1YRE A;  2Z10 A;  3SXO A;  4KUA A;  8CPA A;  2PJB A;  3B35 A;  1OBR A;  2CXA A;  2ZEE A;  2ZW6 A;  7CPA A;  2Q04 A;  2V8H A;  4OID A;  4KOW A;  3KGQ A;  1BO4 A;  2FL4 A;  4OLL A;  5LYL A;  4HNX B;  4NGN A;  4UEZ A;  3CZX A;  3FX6 A;  3PB7 X;  4W9Y A;  4IF5 A;  2DXQ A;  4AG9 A;  5A28 A;  4MMO A;  2G0B A;  4CYQ A;  3T8W A;  5K8M A;  4MXU A;  2ANP A;  3NE8 A;  4XPL A;  4DUK A;  4EFD A;  4AVA A;  4C7I A;  4C2Y A;  3FED A;  4KLW A;  5JPH A;  1GHE A;  4H89 A;  2D4O A;  2PJ7 A;  1AUG A;  4Q36 A;  4FUU A;  2B5G A;  4P4D A;  4R3L A;  4TWE A;  2YGW A;  1Z8X A;  2VZY A;  3R1K A;  5IB9 A;  4EWT A;  3D7H A;  2JEV A;  4KS9 A;  4A30 A;  3D67 A;  3QB8 A;  4UCP A;  1MK4 A;  3IU1 A;  4GM5 A;  3SI2 A;  2O28 A;  2ZPA A;  4R7M A;  1AYE A;  4OAE A;  2EVN A;  4JLY A;  1YME A;  2ZEM A;  4P4E A;  3S9N A;  3DNS A;  1Q2D A;  3P2F A;  3GYA A;  4AG7 A;  1WK4 A;  2P6E A;  4ORF A;  5EC4 A;  5KTD A;  4FD4 A;  1H8L A;  1TKH A;  4LQ6 A;  1A2Z A;  1DTD A;  1CP7 A;  3OWC A;  4ONW A;  4Y49 C;  1ARM A;  2PSW A;  1CM0 A;  3VH9 A;  3H8F A;  4MHP A;  3CPX A;  3IWW A;  5KTC A;  2OH1 A;  4YRH A;  4ZYQ A;  3TE4 A;  1PYT B;  3K9U A;  1LRZ A;  1Z8W A;  2PVV A;  3N7Z A;  4OC5 A;  4C2Z A;  3NE7 A;  4XPD C;  1SQH A;  2FS5 A;  3CXQ A;  4ZBG A;  3D3S A;  1Z4R A;  2OU2 A;  1IIC A;  2FIA A;  4XNH C;  3UY5 A;  1JWQ A;  5IX3 A;  4OC3 A;  4UBR A;  1ZLI A;  2VBQ A;  1QSO A;  2WSA A;  1QQ9 A;  2HUZ A;  2ZEL A;  3HLP A;  4PXD A;  1IU8 A;  5AG7 A;  3TCV A;  4MCQ A;  2Y0M A;  3LAC A;  4ZY0 A;  1TKF A;  3B3W A;  2WPW A;  3SI0 A;  4A39 A;  3SJG A;  3CT9 A;  4U9Y A;  4OC4 A;  1VHE A;  1J4J A;  1Q2C A;  1CPX A;  1ELM P;  1YW4 A;  2X7B A;  3VWD A;  3ZZI A;  4C7H A;  5DWM A;  4CAW A;  4CGM A;  1XJO A;  3PB9 X;  3IO1 A;  3TC8 A;  4ZX9 A;  1OZP A;  2AFW A;  4B14 A;  2PJC A;  1M4D A;  2PJA A;  4MFP A;  4YWY A;  3I9S A;  4EVY A;  1L0C A;  4KUB A;  2IJZ A;  1ARL A;  1F2P A;  1N71 A;  1BPN A;  3PB8 X;  2VEZ A;  1M44 A;  2PVW A;  5G1Z A;  3WAB A;  3RZA A;  2B3V A;  3FEE A;  3GIU A;  4B11 A;  2O4H A;  1YK3 A;  5BWA B;  2WUU A;  2BSW A;  4F8Z A;  3PFE A;  4C2X A;  1IYL A;  4MFZ A;  3SJX A;  5JH9 A;  3RO0 A;  3W6X A;  3PBE A;  5KTA A;  4FD7 A;  3EY5 A;  3RYO A;  1P4N A;  4UWI A;  4QUS A;  4E2A A;  4RS2 A;  3TO7 A;  3KZW A;  4QC6 A;  1IY7 A;  3PFO A;  2HB6 A;  1BAV A;  1XMT A;  1XRY A;  2QEC A;  4YU9 A;  2QYV A;  3CPA A;  1M4I A;  3KHZ A;  4H2K A;  4F0Y A;  3W6S A;  2V8D A;  2AFS A;  4KVX A;  3RBU A;  3SHP A;  3H4Q A;  2ZEP A;  3JVN A;  2QJ8 A;  3SI1 A;  1VHO A;  1F57 A;  2NYQ A;  4UIA A;  4R57 A;  3BI0 A;  4A95 A;  1X12 A;  2AFM A;  3NH8 A;  3FVL A;  3P2H A;  2ZEG A;  4KVO E;  5C88 A;  4C68 A;  1Y0R A;  1HDQ A;  1ON0 A;  2GAN A;  2FT0 A;  2VQY A;  2HC9 A;  3DGV A;  3IGR A;  2C6C A;  3IJ3 A;  3CXP A;  3IWE A;  1MJA A;  4L89 A;  4MCR A;  4UFW A;  4WWV A;  3MGD A;  1Y0Y A;  2BO9 A;  1Y9W A;  3S6F A;  4MHZ A;  2Q4Z A;  5IV0 A;  2RC4 A;  4OME A;  4A31 A;  5CBM A;  4QB9 A;  4Y49 B;  4LQG A;  2POK A;  2Q4V A;  3FBU A;  2EBJ A;  2ZEF A;  3KQZ A;  3B7I A;  2Z11 A;  4UEE A;  3PP9 A;  3ISX A;  4RN7 A;  1P0H A;  3TO9 A;  3MRU A;  2J9A A;  1M4L A;  3SJE A;  4A94 A;  3PBB A;  4NSQ A;  3WR7 A;  2GE3 A;  3E0K A;  4CYO A;  3TT2 A;  1YGH A;  4PV6 A;  4WJB A;  4E0A A;  3G3S A;  3T90 A;  1IB1 E;  1DE4 C;  4RI1 A;  4UCN A;  1AMP A;  3D68 A;  1Z8L A;  3IU2 A;  5J1Q A;  4K30 A;  1YVO A;  2OB0 A;  1Y7E A;  4OC0 A;  2CNT A;  4IAV A;  3FIX A;  4P4I A;  1YR0 A;  3EO4 A;  3K2K A;  3QAY A;  4MHY A;  2NMT A;  2IL4 A;  4CS0 B;  3GY9 A;  3TX8 A;  3TOB A;  2ZEO A;  1YLE A;  4YFJ A;  3K9T A;  3GB0 A;  1CBX A;  3G8W A;  4XPK A;  4UIB A;  3FJU A;  3KKW A;  4KOV A;  2C6G A;  5C82 A;  5G20 A;  2EK8 A;  2K5T A;  4M85 A;  4CYP A;  4RUH A;  2P0W A;  3VAR A;  4CPA A;  4PSX A;  2ZED A;  1X10 A;  4DJL A;  1S7K A;  2PR8 A;  2JBJ A;  4KOU A;  4P44 A;  5DWN A;  2PJ1 A;  2Q0Y A;  3BLN A;  4JXR A;  4BD9 A;  4DYO A;  5K8O A;  3H5Z A;  5AG5 A;  5LYF A;  4AXV A;  1LOK A;  2QIR A;  1YSJ A;  2QVP A;  2Z3N A;  2Z3P A;  2XEI A;  1YQE A;  4KOT A;  1KUX A;  5F48 A;  5LRG A;  5GCN A;  1XOV A;  3D8P A;  3IC1 A;  3PEI A;  4KZT A;  4DNC A;  2VZZ A;  3V7Z A;  2FSR A;  3I3G A;  2RFH A;  3ZJ0 A;  1S3Z A;  2PIY A;  2JLM A;  2ZOG A;  1S7F A;  4NF1 A;  2GFQ A;  2C27 A;  5JQ4 A;  4P10 A;  1QSR A;  3R95 A;  3GUX A;  3FF3 A;  4MCP A;  2Q7B A;  5HXD A;  2PC1 A;  4FBE A;  3WT4 A;  1Z2L A;  1FT7 A;  2WPX A;  3RAM A;  1XMB A;  3B3S A;  5HVF A;  3D2M A;  4OKO A;  1LFW A;  2P6F A;  3S6K A;  2ZW7 A;  2J8N A;  3H8E A;  1TF9 A;  2XEJ A;  3KHX A;  4M6I A;  1LCP A;  2BEI A;  5G21 A;  4MY3 A;  2XEF A;  5D8N A;  2EO8 A;  2PRB A;  4U9Z A;  1VGY A;  5HVH A;  2D4P A;  4A38 A;  2PJ3 A;  5F47 A;  1XEB A;  4P4F A;  4X5K A;  4F9U A;  1ZG9 A;  2B58 A;  2DEA A;  4P6Y A;  4JZ0 A;  3FYN A;  2AE6 A;  3LD2 A;  5F49 A;  4NJR A;  4PPZ A;  2FE7 A;  4YGO A;  4B13 A;  1QSN A;  3KR5 A;  2Z3O A;  4A32 A;  2ODF A;  1VHS A;  2ARH A;  2R7H A;  4HPS A;  3BHX A;  5LRJ A;  2OZU A;  2B5G B;  4MJ8 A;  3JUW A;  3FNC A;  5IB0 A;  1YW6 A;  4CGP A;  4NCZ A;  1VKC A;  1YVK A;  3IEH A;  3S6H A;  4MCS A;  1R3N A;  4ZGY B;  2NSM A;  4P4B A;  1TF8 A;  1HEE A;  4A33 A;  2C6P A;  1KUV A;  2ZEH A;  3DLJ A;  3PGP A;  4NGS A;  3TOA A;  5ISV A;  4UFX A;  3NFZ A;  3S9L A;  1Z8T A;  2I00 A;  3TFY A;  2KCW A;  4B5P A;  4R8F A;  2CF4 A;  1BLL E;  2OZG A;  4MFJ A;  3FMC A;  1B6B A;  5CPA A;  1U6M A;  5FVJ A;  4ZY1 A;  4IHM A;  4FAI A;  2BCO A;  1TKJ A;  3N5F A;  2QML A;  2JBK A;  2PJ6 A;  1UWY A;  3A9L A;  5EBV A;  5EMI A;  1KZF A;  1S5K A;  2PRQ A;  1TXR A;  4KSA A;  4PXE A;  3VAT A;  1ZG7 A;  2H5M A;  3D7D A;  4CAV A;  5I0C A;  1B87 A;  4ONU A;  2GU2 A;  2CNM A;  2DF5 A;  1FY7 A;  1PCA A;  1LAM A;  1ZO0 A;  2F7V A;  4CRY B;  2VI7 A;  4I49 A;  1JQG A;  1R57 A;  2ABZ A;  4NEX A;  3LMS A;  4MFK A;  2YNE A;  3R9E A;  1CPS A;  5F09 A;  4NFR A;  2GLF A;  1QST A;  1XFO A;  2Q44 A;  4CAX A;  4CAE A;  2PJ9 A;  2V77 A;  3S6G A;  2BOA A;  2F8H A;  4CGL A;  4X8I A;  4KLV A;  5H86 A;  2R98 A;  1CX8 A;  4KOS A;  4OC2 A;  1QMU A;  4FD6 A;  4PK2 A;  1M4G A;  1IGB A;  1LAP A;  3KI9 A;  3FXT A;  2IQ6 A;  2OOT A;  3W91 A;  3PB4 X;  4JXQ A;  4XPD B;  3VWE A;  4Z65 A;  5J8C A;  4Q38 A;  1NMT A;  2ZW5 A;  3B3V A;  1I21 A;  4ZI6 A;  2BL1 A;  4NGT A;  3MN8 A;  3V38 A;  2BUE A;  4XNH B;  4JD6 A;  2YND A;  4MY0 A;  2CTB A;  1NE9 A;  2ATR A;  3PZJ A;  1ELL P;  4ZX8 A;  2JDD A;  2B4D A;  5ELY A;  2PJ5 A;  4M3S A;  2CY2 A;  5F46 A;  1F2O A;  5JM6 A;  4HNW B;  5JGF A;  2PCU A;  4MBU A;  1EE3 P;  1V0C A;  1ZG8 A;  3PB6 X;  4MRI A;  4OIW A;  2OR4 A;  2YNC C;  4PSW A;  3FB3 A;  3KQX A;  4MHD A;  4A37 A;  3NH4 A;  2PR1 A;  2J8M A;  3GLJ A;  5LYD A;  2ZEN A;  3JRU A;  3LOD A;  3LWU A;  1MJ9 A;  5G22 A;  4HNY B;  2AJ6 A;  4R9M A;  5CNP A;  1CG2 A;  2Q7S A;  6CPA A;  1PUA A;  1S7L A;  4FWU A;  1UFH A;  4G1P A;  3BJ7 A;  4CYN A;  1Z5R A;  1KUY A;  2HQY A;  3ISZ A;  2Z3K A;  4Q7A A;  1IOI A;  3B8G A;  2EK9 A;  4MI4 A;  3B3T A;  3CDX A;  3V8I A;  4EME A;  5A27 A;  1CP6 A;  1Z4E A;  1I1D A;  1Y9K A;  3DR8 A;  1QSM A;  1IID A;  2ZXV A;  4HKF A;  2AFX A;  1RXT A;  2GLJ A;  2IMO A;  1R43 A;  4NGR A;  1NSA A;  4KSI A;  1Q7L A;  3F5B A;  1YX0 A;  2A4N A;  4R3K A;  2GIV A;  2FXF A;  2B3U A;  4M6G A;  4JYW A;  2I3C A;  4NGP A;  4BBH A;  3JTK A;  1NSL A;  4KSF A;  4PXB A;  5HMN A;  2OZH A;  4UCM A;  2YNC A;  1Z9U A;  1VIX A;  3R9F A;  3NA6 A;  4NGQ A;  1BOB A;  5D29 A;  5LRK A;  1XF8 A;  2G9D A;  4NGM A;  2PIZ A;  4M6H A;  3RNZ A;  2REE A;  1XBU A;  2DPT A;  4UEF A;  5AG6 A;  4NXY A;  4OAD A;  4F0X A;  4U5Y A;  1RO5 A;  3F8K A;  1FNO A;  2WYR A;  2Z3M A;  2V8V A;  2AFO A;  2VXK A;  3DDD A;  2B4D B;  3SXN A;  3KL9 A;  5H84 A;  3FH4 A;  4QBJ A;  4F6A A;  5AG4 A;  2R1I A;  4P45 A;  4A2Z A;  1ZLH A;  2VL1 A;  3B3C A;  2Z0Z A;  4CGN A;  4R6T A; 
#chains in the Genus database with same CATH homology
 2RB7 A;  3QNV A;  5THW A;  2PJ2 A;  3HUV A;  2PJ8 A;  4UF4 A;  4K3N A;  2Q51 A;  2C1C A;  2FVG A;  2EWB A;  3IFE A;  2ZOF A;  4PQA A;  5HVG A;  3WC6 A;  2XEG A;  3BXM A;  4PXC A;  2WZN A;  1HDU A;  5I4M A;  4OP4 A;  3IIB A;  1BPM A;  3KR4 A;  2PJ0 A;  3B2Y A;  4F9V A;  2AFZ A;  3D7G A;  2CIJ A;  4IK2 A;  3H8G A;  3S9M A;  3L2N A;  5K8N A;  4X3R A;  1GYT A;  4TNU A;  3D7F A;  4O23 A;  4X2T A;  4P4J A;  2GRE A;  3NH5 A;  4NJQ A;  3PRT A;  1LAN A;  3BI1 A;  4R76 A;  4MHN A;  2JEW A;  3KAS A;  1YLO A;  2CTC A;  2PJ4 A;  5K8P A;  2V8G A;  4OC1 A;  3I1U A;  3WC5 A;  3WC7 A;  3D66 A;  4B6Z A;  2AFU A;  2O53 A;  1RTQ A;  5DS0 A;  3SJF A;  5LYI A;  2Q43 A;  3D4U A;  3FEC A;  1KWM A;  2PE3 A;  4ZY2 A;  8CPA A;  2PJB A;  3B35 A;  1OBR A;  2ZEE A;  7CPA A;  2V8H A;  4OID A;  3KGQ A;  5LYL A;  4NGN A;  4UEZ A;  4W9Y A;  3FX6 A;  3PB7 X;  4MMO A;  3T8W A;  5K8M A;  4MXU A;  2ANP A;  4DUK A;  4EFD A;  3FED A;  2PJ7 A;  4FUU A;  4TWE A;  4P4D A;  5IB9 A;  4EWT A;  3D7H A;  3D67 A;  4GM5 A;  3SI2 A;  4R7M A;  1AYE A;  1YME A;  2ZEM A;  4P4E A;  3S9N A;  1H8L A;  1TKH A;  4ONW A;  1DTD A;  1CP7 A;  1ARM A;  3VH9 A;  3H8F A;  4MHP A;  3CPX A;  3IWW A;  4ZYQ A;  1PYT B;  2PVV A;  4OC5 A;  4OC3 A;  1ZLI A;  1QQ9 A;  3HLP A;  2ZEL A;  4PXD A;  4MCQ A;  4ZY0 A;  1TKF A;  3B3W A;  3SI0 A;  4A39 A;  3SJG A;  3CT9 A;  4OC4 A;  1VHE A;  1YW4 A;  1CPX A;  1ELM P;  1XJO A;  3PB9 X;  3IO1 A;  3TC8 A;  4ZX9 A;  2AFW A;  2PJC A;  2PJA A;  4YWY A;  2IJZ A;  1ARL A;  1F2P A;  1BPN A;  3PB8 X;  2PVW A;  3WAB A;  3RZA A;  3FEE A;  2O4H A;  4F8Z A;  3PFE A;  3SJX A;  5JH9 A;  3PBE A;  3KZW A;  1IY7 A;  3PFO A;  2HB6 A;  1BAV A;  4YU9 A;  1XRY A;  2QYV A;  3CPA A;  4H2K A;  3KHZ A;  2V8D A;  2AFS A;  3RBU A;  2ZEP A;  2QJ8 A;  3SI1 A;  1VHO A;  1F57 A;  2NYQ A;  4UIA A;  3BI0 A;  2AFM A;  3NH8 A;  3FVL A;  2ZEG A;  1Y0R A;  1HDQ A;  2HC9 A;  3DGV A;  2C6C A;  3IJ3 A;  4MCR A;  4WWV A;  1Y0Y A;  2BO9 A;  4MHZ A;  2Q4Z A;  4OME A;  5CBM A;  4LQG A;  2POK A;  2ZEF A;  3KQZ A;  3B7I A;  4UEE A;  3ISX A;  3MRU A;  2J9A A;  1M4L A;  3SJE A;  4A94 A;  3PBB A;  4WJB A;  1DE4 C;  1AMP A;  3D68 A;  1Z8L A;  5J1Q A;  1Y7E A;  4OC0 A;  4IAV A;  4P4I A;  3K2K A;  4MHY A;  3TX8 A;  2ZEO A;  3K9T A;  3GB0 A;  1CBX A;  4UIB A;  3FJU A;  2C6G A;  2EK8 A;  4RUH A;  3VAR A;  4CPA A;  2ZED A;  4DJL A;  2JBJ A;  4P44 A;  2PJ1 A;  4DYO A;  4BD9 A;  5K8O A;  5LYF A;  4AXV A;  1LOK A;  1YSJ A;  2QVP A;  2XEI A;  5LRG A;  3IC1 A;  3PEI A;  3V7Z A;  2RFH A;  2PIY A;  2ZOG A;  4P10 A;  3GUX A;  3FF3 A;  4MCP A;  5HXD A;  4FBE A;  3WT4 A;  1Z2L A;  1FT7 A;  3RAM A;  1XMB A;  3B3S A;  5HVF A;  4OKO A;  1LFW A;  3H8E A;  1TF9 A;  2XEJ A;  3KHX A;  1LCP A;  2XEF A;  5D8N A;  1VGY A;  5HVH A;  4A38 A;  2PJ3 A;  4F9U A;  4P4F A;  1ZG9 A;  2DEA A;  4P6Y A;  4JZ0 A;  4NJR A;  4PPZ A;  3KR5 A;  5LRJ A;  3BHX A;  1YW6 A;  3IEH A;  4MCS A;  1R3N A;  2NSM A;  4P4B A;  1TF8 A;  1HEE A;  2C6P A;  2ZEH A;  3DLJ A;  4NGS A;  3NFZ A;  3S9L A;  4R8F A;  2CF4 A;  1BLL E;  3FMC A;  5CPA A;  4ZY1 A;  4IHM A;  4FAI A;  2BCO A;  3N5F A;  1TKJ A;  2JBK A;  2PJ6 A;  1UWY A;  2PRQ A;  1TXR A;  4PXE A;  3VAT A;  1ZG7 A;  3D7D A;  2GU2 A;  2F7V A;  1PCA A;  1LAM A;  1JQG A;  2ABZ A;  3LMS A;  1CPS A;  5F09 A;  4NFR A;  2GLF A;  1XFO A;  2PJ9 A;  2V77 A;  2BOA A;  2F8H A;  4X8I A;  1CX8 A;  4OC2 A;  1QMU A;  1IGB A;  1LAP A;  3KI9 A;  2IQ6 A;  2OOT A;  3PB4 X;  4Z65 A;  4ZI6 A;  3B3V A;  4NGT A;  3MN8 A;  3V38 A;  2CTB A;  1ELL P;  4ZX8 A;  5ELY A;  2PJ5 A;  1F2O A;  5JM6 A;  5JGF A;  2PCU A;  1EE3 P;  1ZG8 A;  4MRI A;  3PB6 X;  4OIW A;  2OR4 A;  3KQX A;  4A37 A;  3NH4 A;  3GLJ A;  5LYD A;  2ZEN A;  3JRU A;  3LWU A;  1CG2 A;  6CPA A;  4FWU A;  4G1P A;  1Z5R A;  3ISZ A;  4Q7A A;  2EK9 A;  4EME A;  3B3T A;  3CDX A;  1CP6 A;  2AFX A;  2GLJ A;  2IMO A;  1R43 A;  4NGR A;  1NSA A;  4KSI A;  1Q7L A;  4JYW A;  2I3C A;  4NGP A;  4PXB A;  1VIX A;  3NA6 A;  4NGQ A;  5D29 A;  5LRK A;  2G9D A;  4NGM A;  2PIZ A;  1XBU A;  4UEF A;  1FNO A;  2WYR A;  2V8V A;  2AFO A;  3KL9 A;  3FH4 A;  4P45 A;  1ZLH A;  2VL1 A;  3B3C A;  4R6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...