3KHXA

Crystal structure of staphylococcus aureus metallopeptidase (sapep/dape) in the apo-form
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
470
structure length
422
Chain Sequence
SMWKEKVQQYEDQIINDLKGLLAIESVRDDAKASEDAPVGPGPRKALDYMYEIAHRDGFTTHDVDHIAGRIEAGKGNDVLGILCHVDVVPAGDGWDSNPFEPVVTEDAIIARGTLDDKGPTIAAYYAIKILEDMNVDWKKRIHMIIGTDEESDWKCTDRYFKTEEMPTLGFAPDAEFPCIHGEKGITTFDLVQNKLTEDQDEPDYELITFKSGERYNMVPDHAEARVLVKENMTDVIQDFEYFLEQNHLQGDSTVDSGILVLTVEGKAVHGVNAGLYLLKFLASLNLDNNAQAFVAFSNRYLFNSDFGEKMGMKDVTTNIGVITYDNENAGLFGINLRYPEGFEFEKAMDRFANEIQQYGFEVKLGKVQPPHYVDKNDPFVQKLVTAYRNQTNQKNEYITKKQLFNATSIYLEAIYSLCVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dipeptidase SACOL1801
publication title Crystal structure of Staphylococcus aureus metallopeptidase (Sapep) reveals large domain motions between the manganese-bound and apo-states
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 127
structure length 422
sequence length 470
chains with identical sequence B
ec nomenclature ec 3.4.13.-:
pdb deposition date 2009-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3khxA01
2RB7A 3CDXA 4WJBA 2OOTA 3D68A 4A94A 2HB6A 3HUVA 4PXDA 1YSJA 1QQ9A 2PJ4A 1F2PA 3D7HA 5K8MA 4R8FA 1RTQA 1R43A 4DYOA 1YW4A 1F57A 2AFSA 6CPAA 5K8PA 1TKFA 4NGRA 4RUHA 5LRJA 2GU2A 4A38A 1YMEA 1LAPA 2AFXA 1CP7A 3I1UA 2POKA 1ZG9A 4PXBA 3KI9A 2IJZA 3V38A 2WZNA 1LOKA 3DGVA 7CPAA 2ZOFA 4P10A 1VHOA 3PB9X 3N5FA 2ZEFA 4AXVA 4MMOA 3T8WA 2ZEEA 2PVWA 4OC1A 3PEIA 1BPNA 1XJOA 2BO9A 4W9YA 3KQZA 2XEFA 1ZLIA 5CBMA 3NFZA 3RZAA 3IWWA 1ZG7A 2NSMA 1LFWA 5JGFA 2PJAA 5HVFA 3FF3A 3IIBA 4FUUA 3GUXA 3WT4A 3FX6A 5LYFA 3ISXA 3KGQA 2AFZA 2HC9A 4R76A 3B7IA 3IFEA 4X8IA 4JYWA 1NSAA 3LMSA 4MHZA 3TX8A 4P6YA 4O23A 4UEEA 4A39A 2WYRA 3FH4A 1TF8A 3B35A 2ZEMA 2V77A 3QNVA 1Z8LA 4UIBA 3ISZA 4TWEA 2ANPA 2CIJA 2PJ9A 3D7FA 1HEEA 4H2KA 4GM5A 3V7ZA 4NJQA 2BCOA 2F7VA 4DUKA 4ONWA 3D4UA 1F2OA 2JBJA 1DTDA 3B3SA 3FEEA 4EFDA 5HVGA 1FNOA 2C6PA 1Z2LA 4NFRA 3VH9A 1QMUA 4UEZA 4NGQA 3KL9A 2QJ8A 2AFMA 4OC5A 2IMOA 1TF9A 3H8FA 4P4DA 5K8NA 2Q43A 4OIWA 4B6ZA 2JEWA 3CT9A 2V8GA 3D67A 4R6TA 2JBKA 4IK2A 4JZ0A 1Z5RA 3PBEA 2PE3A 2FVGA 3WC6A 4Z65A 3CPAA 2PJ6A 3S9NA 1TKHA 3KR4A 3SJGA 3PFEA 3PB6X 1PYTB 3GLJA 4NGTA 4PXEA 1LANA 2C6GA 2EK8A 5F09A 4PQAA 4UF4A 2PIZA 1TXRA 3B3TA 4LQGA 2PJ5A 1R3NA 2PJ8A 3WC5A 2I3CA 2GLJA 4OC3A 1ELLP 3PBBA 5LYLA 4BD9A 3IJ3A 1Y7EA 5I4MA 2EK9A 3FJUA 4G1PA 3B3VA 4F9VA 1EE3P 1LAMA 2AFWA 1M4LA 2PIYA 1ZLHA 2CTBA 3FVLA 5D8NA 1ELMP 1CPXA 2AFOA 3BI0A 5LYIA 3KHZA 2RFHA 1FT7A 3IO1A 1JQGA 3K9TA 5JM6A 4ZX8A 3HLPA 4X3RA 5HVHA 2VL1A 3D7DA 3IC1A 3VARA 4MCQA 1AMPA 4OKOA 3FECA 4CPAA 4ZX9A 1Y0YA 4UEFA 3WC7A 4WWVA 3RBUA 4NGMA 1BAVA 4OC4A 3MRUA 4NGSA 4P4EA 1YLOA 4F9UA 3H8EA 3S9LA 2ZEPA 3H8GA 2ZELA 3PFOA 4MXUA 2OR4A 3KQXA 3S9MA 3NH4A 3PRTA 1CX8A 3D66A 2CTCA 1CPSA 4KSIA 5LRKA 2XEIA 2V8VA 2EWBA 4IAVA 3DLJA 4UIAA 3RAMA 5HXDA 1VHEA 2V8HA 5LRGA 3L2NA 3BI1A 2ZEOA 2G9DA 4ZYQA 1ARLA 2GREA 5JH9A 3SJEA 5LYDA 2AFUA 3FMCA 2PJCA 2O53A 1UWYA 2Q51A 2GLFA 4NJRA 5CPAA 1XRYA 4A37A 4OC0A 3PB4X 3LWUA 2IQ6A 4OIDA 4Q7AA 2QYVA 1HDUA 5THWA 4ZY1A 4MRIA 3KZWA 2C1CA 2PJ3A 3BXMA 4MHNA 2C6CA 3NH5A 2QVPA 4P4JA 3B3CA 2PCUA 1XBUA 1XFOA 2Q4ZA 3NA6A 4NGNA 1KWMA 4ZI6A 1CG2A 3JRUA 3GB0A 3FEDA 1IY7A 1PCAA 5D29A 4P4FA 2ZEHA 1DE4C 1CBXA 2ZENA 3KR5A 3KHXA 2J9AA 4P44A 2PRQA 2XEGA 3K2KA 4MCSA 1CP6A 2ZEDA 1VGYA 4FBEA 4YU9A 3SJFA 3B2YA 5J1QA 4FAIA 1HDQA 4OC2A 4PXCA 1BPMA 1BLLE 4YWYA 3WABA 4MHYA 3IEHA 1AYEA 2F8HA 3PB7X 3VATA 4ZY2A 3KASA 4PPZA 3MN8A 4P45A 2V8DA 4P4BA 2PJ1A 2ZEGA 4K3NA 5DS0A 4NGPA 2XEJA 1H8LA 3BHXA 4MHPA 8CPAA 3D7GA 4X2TA 1VIXA 3SI0A 2O4HA 5K8OA 2NYQA 2CF4A 4IHMA 3CPXA 4OP4A 3B3WA 5IB9A 4EMEA 1Y0RA 1ZG8A 4MCRA 3TC8A 2ZOGA 2ABZA 1GYTA 3SI1A 4MCPA 4OMEA 1TKJA 4P4IA 3SI2A 3SJXA 3PB8X 1IGBA 2PJBA 4ZY0A 4FWUA 2DEAA 4F8ZA 4EWTA 2PVVA 1YW6A 4R7MA 2PJ2A 2BOAA 1XMBA 1Q7LA 2PJ0A 4DJLA 1ARMA 3NH8A 1OBRA 4TNUA 1LCPA 5ELYA 2PJ7A
chains in the Genus database with same CATH superfamily
4RI1A 2PRBA 2RB7A 5IX3A 3DSBA 3G8WA 3CDXA 1FY7A 2ZPAA 4WJBA 5H86A 2OOTA 3LODA 2J8RA 5F49A 3D68A 4UWJA 2K5TA 4A94A 4MBUA 1KUYA 2VQYA 2HB6A 3JVNA 2GANA 5AG5A 4J3GA 3HUVA 2GFQA 4PXDA 4CGLA 3R1KA 5EBVA 1YSJA 1QQ9A 2PJ4A 4XPDB 4CAXA 2HUZA 3IWEA 1F2PA 3D7HA 1I12A 5K8MA 5F48A 1XOVA 4L8AA 4R8FA 1RTQA 1R43A 4DYOA 1YW4A 4KVME 2YNCC 1S7NA 1YLEA 4M6IA 1F57A 2WSAA 1KUXA 3IU2A 2AFSA 4B5PA 6CPAA 5K8PA 1TKFA 2R8VA 4ZGYB 4NGRA 1NSLA 4RUHA 2GE3A 5LRJA 2ARHA 2EVNA 2P6FA 2GU2A 4MFLA 4MFZA 1YMEA 4A38A 2Q7BA 1Z9UA 1LAPA 4KSAA 1ZO0A 2AFXA 1V0CA 1CP7A 3I1UA 3FBUA 3PZJA 4R9MA 3BJ7A 2POKA 3JUWA 1ZG9A 4PXBA 3FYNA 3CXPA 2FIAA 2IJZA 2Z0ZA 3KI9A 4FD5A 4NF1A 4U9YA 4Q36A 3P2FA 3R9EA 3V38A 2B4DA 2WZNA 1LOKA 3F5BA 4RS2A 3D8PA 2CNMA 1MJAA 3DGVA 1YVOA 1WWZA 1X10A 3CZXA 4JJXA 4CGMA 7CPAA 2P6GA 2Z3OA 2ZOFA 5C88A 4P10A 1VHOA 1M4IA 3PB9X 1ON0A 4XPKA 3GIUA 3N5FA 1PUAA 4HPSA 2ZEFA 4AXVA 4MMOA 3T8WA 2ZEEA 2PVWA 4MY3A 4H6ZA 3VWEA 4OC1A 3PEIA 1BPNA 1XJOA 2BO9A 4W9YA 3KQZA 3ZJ0A 2DXQA 2G0BA 2ZW7A 2XEFA 1ZLIA 2BEIA 2F5IA 3NFZA 3RZAA 5CBMA 2B5GA 3IGRA 3IWWA 1ZG7A 3TOAA 2NSMA 1LFWA 2OZGA 2PJAA 1OZPA 3EO4A 3FF3A 3IIBA 4QVTA 5HVFA 5JGFA 4FUUA 2REFA 3GUXA 3WT4A 3FX6A 5LYFA 3ISXA 4E2AA 3KGQA 2AFZA 2VI7A 2HC9A 3D2MA 4R76A 3B7IA 3SXOA 3IFEA 4X8IA 3EFAA 2Z11A 4XNHC 4JYWA 1NSAA 3LMSA 3VWDA 1R57A 4MHZA 3TX8A 1YREA 1XMTA 4ZBGA 3A9LA 4P6YA 4PK2A 5G22A 2B3VA 4O23A 4ORFA 4H89A 4UEEA 1Z8TA 4A39A 2WYRA 1S3ZA 3FH4A 1TF8A 3B35A 2ZEMA 5AG4A 2V77A 5KTDA 1M4DA 2I00A 4AG7A 3QNVA 1Z8LA 1BO4A 4UIBA 1KZFA 4A2ZA 3ISZA 4TWEA 2ANPA 2CIJA 1QSNA 3BLNA 2PC1A 2PJ9A 3D7FA 1HEEA 1YVKA 2B3UA 4H2KA 4E0AA 4GM5A 4U9ZA 5KTCA 3V7ZA 4B5OA 4NJQA 2BCOA 3JTKA 2BUEA 2F7VA 4CGPA 4DUKA 1QSRA 2VXKA 4ONWA 3D4UA 5E96A 3NE8A 4ONUA 4A31A 1F2OA 1VHSA 2P0WA 1MJBA 2JBJA 1GHEA 3F8KA 2Q4VA 1DTDA 2JEVA 3B3SA 3FEEA 1JWQA 4Y49C 4EFDA 2YGWA 2ODFA 4UA3A 4UFXA 4CRZB 1FNOA 4PSWA 5HVGA 2C6PA 1Z2LA 4M85A 1K4JA 4NFRA 3VH9A 1QMUA 3EY5A 2Z10A 2P6EA 1Z4RA 5J8FA 3R9GA 4MY0A 4UEZA 4NGQA 1M44A 2PQ8A 1M4GA 3KL9A 4R3KA 1I1DA 2QJ8A 2AFMA 4OADA 4OC5A 1U6MA 4NSQA 2IMOA 1TF9A 3H8FA 3PP9A 1S60A 2Q43A 4OIWA 4P4DA 4KOXA 2RC4A 4B6ZA 2JEWA 2D4OA 3CT9A 4RN7A 4C2YA 1IIDA 2B58A 2V8GA 1Y9KA 2JBKA 3D67A 4IK2A 4R6TA 2VEZA 4II9A 2OB0A 2Z3NA 1A2ZA 2VZZA 1Z5RA 3PBEA 4JZ0A 5G1ZA 2PE3A 2FVGA 3RNZA 3WC6A 2WUUA 4CS0B 4UBRA 3CPAA 4Z65A 5J8CA 3RYOA 2Z3KA 2PJ6A 4F6AA 4HKFA 4LQ6A 1P4NA 2Q04A 1TKHA 3KR4A 3S9NA 2ATRA 5DWNA 3SJGA 4BMHA 2PR1A 4H6UA 1Q2YA 3QAHA 3PFEA 2FXFA 3PB6X 4X5KA 1PYTB 3GLJA 4NGTA 4PXEA 4F0YA 1LANA 5GCNA 2C6GA 2EK8A 3GY9A 2Z3MA 4MI4A 5G20A 5F09A 4UCMA 4PQAA 4UF4A 4CRYB 5KTAA 2PIZA 2Q0YA 1TXRA 3B3TA 4LQGA 2PJ5A 1R3NA 2VBQA 3S6KA 2PJ8A 3WC5A 2I79A 2I3CA 1X12A 2GLJA 4OC3A 3EC4A 1ELLP 3PBBA 5LYLA 1Y7RA 4BD9A 3IJ3A 4PV6A 4B14A 3TO6A 1LRZA 3K9UA 1Y7EA 5I4MA 2EK9A 3FJUA 1Z4EA 4G1PA 3B3VA 4QBJA 3OWCA 4F9VA 1B87A 1EE3P 2G3TA 1LAMA 2AFWA 3S6FA 4HNYB 1M4LA 2ZW6A 2PIYA 3BJ8A 1ZLHA 3V8IA 2CTBA 3FVLA 5D8NA 1ELMP 2G3AA 1CPXA 1Y9WA 2AFOA 2JDDA 2J8MA 3BI0A 4KOWA 5AG6A 3QAYA 4B10A 5C82A 4KOYA 2JLMA 5LYIA 3KHZA 2RFHA 4JLYA 1IYKA 1FT7A 3S6HA 4Q38A 4CAVA 3IO1A 1JQGA 3K9TA 5JM6A 4ZX8A 4CAWA 1RO5A 3HLPA 4QC6A 4X3RA 5HVHA 5HMNA 2VL1A 3D7DA 3IC1A 2CXAA 2PSWA 3VARA 5I0CA 4MCQA 4R87A 4EVYA 4UCNA 2WPXA 3LACA 1AMPA 4KS9A 4OKOA 4KVXA 3FECA 4CPAA 2AJ6A 2JDCA 1QSTA 4LX9A 2R98A 4ZX9A 1Y0YA 4K30A 4OLLA 4UEFA 3WC7A 4KOVA 2OH1A 3FB3A 4WWVA 4CYPA 4HNWB 4LUAA 4PK3A 4NGMA 3RBUA 5F46A 1BAVA 3H4QA 4OC4A 3MRUA 1WK4A 3CXQA 4NGSA 4P4EA 2QECA 1YLOA 2CY2A 3FXTA 4MFJA 2CNTA 3H8EA 4KOTA 4MJ8A 2ZEPA 3WR7A 4F9UA 3S9LA 2EBJA 3H8GA 2ZELA 1AUGA 3PFOA 4MXUA 4AVBA 2FIWA 3P2HA 3IWGA 2OR4A 3KQXA 3DNSA 4KUAA 4IF5A 4M6GA 1CJWA 4NCZA 4C2XA 3S9MA 3NH4A 2BSWA 2X7BA 3PRTA 1CX8A 3D66A 4FD7A 3TT2A 2CTCA 5IV0A 1XF8A 5AGEA 1CPSA 4KORA 4UFVA 2C27A 4B5PB 4KSIA 5JPHA 5JQ4A 5LRKA 3N7ZA 2Z3LA 2XEIA 2V8VA 4YRHA 2DPSA 1L0CA 2EWBA 2B4BA 2CNSA 4IAVA 5FVJA 3DLJA 4C7HA 4JXRA 3W6SA 3T90A 4B11A 1YQEA 3NE7A 4C7IA 2B4DB 4UIAA 4JXQA 3RAMA 1VHEA 2FSRA 5HXDA 4KOSA 4MFQA 3IU1A 2V8HA 5LRGA 3FRMA 2PR8A 1IB1E 1NMTA 2FS5A 4R3LA 4L89A 2OU2A 3L2NA 3BI1A 3R9FA 2ZEOA 2G9DA 4NEXA 4ZYQA 1ARLA 1N71A 2GREA 2REEA 4CYQA 5JH9A 3SJEA 2A4NA 3LD2A 2AFUA 3FMCA 5LYDA 4KZTA 2PJCA 4QB9A 1YX0A 1UWYA 2EO8A 2O53A 1Z8WA 2Q51A 3FNCA 2GLFA 3MGDA 4NJRA 4Y49B 5CPAA 1XRYA 4A37A 2FE7A 3UY5A 4OC0A 4NXYA 3F0AA 4AVCA 1S7KA 4U5YA 1VKCA 3PB4X 4CYOA 3LWUA 5CNPA 2IQ6A 4GS4A 3DDDA 3EXNA 4OIDA 4Q7AA 1I21A 2QYVA 2B5GB 1HDUA 4BBHA 4BINA 3D2PA 2Q4YA 2Z3PA 4C2ZA 1SQHA 1S7LA 5THWA 4ZY1A 4UWIA 4MRIA 4KLVA 1RXTA 4UFWA 4CAFA 2ZW4A 4KOUA 4OAEA 3KZWA 2C1CA 1KUVA 1QSOA 2PJ3A 1YK3A 3BXMA 3SXNA 4MHNA 2H5MA 4XPDC 1MK4A 3T9YA 2C6CA 3NH5A 2QVPA 4P4JA 4PSXA 3TTHA 3B3CA 4AB7A 3R96A 2O28A 2PCUA 1IICA 4M3SA 1XBUA 2HQYA 5IB0A 1XFOA 2Q4ZA 3NA6A 1YR0A 2VZYA 4NGNA 1KWMA 4ZI6A 1CG2A 3S6GA 3JRUA 1BOBA 1Q2DA 3GB0A 4KSFA 3FEDA 5H84A 1IY7A 1PCAA 5D29A 4P4FA 2QIRA 2ZEHA 1DE4C 5HH1A 1CBXA 5F47A 2ZENA 1IOIA 4FD6A 3KR5A 4YGOA 1IOFA 2FT0A 5AG7A 3B8GA 1YGHA 3KHXA 4A30A 2J9AA 1UFHA 2YNEA 4A95A 4AG9A 3D3SA 4P44A 2PRQA 1IU8A 2PDOA 4E8OA 4F0XA 4B12A 2XEGA 4B13A 4GXHA 3K2KA 4AVAA 2DPTA 2HV2A 4MCSA 3TCVA 1CP6A 4KUBA 2ZEDA 1VGYA 4FBEA 2Q7SA 4YU9A 3SJFA 3B2YA 4UCPA 4R57A 5J1QA 4KLWA 5DWMA 4CGNA 4FAIA 1HDQA 3R95A 5G21A 4OC2A 1CM0A 4MFPA 3TE4A 4PXCA 1BPMA 3RO0A 2FL4A 1BLLE 4YWYA 2FCKA 3KKWA 4JWPA 1PU9A 1TIQA 3WABA 3TOBA 2KCWA 4YFJA 4CGOA 3TFYA 4MHYA 3IEHA 4HNXB 5BWAB 2NMTA 4MFKA 1AYEA 3GKRA 2F8HA 3PB7X 2OZUA 3VATA 4ZY2A 2R7HA 1B6BA 1MJ9A 3KASA 4PPZA 3MN8A 4P45A 1Q2CA 2V8DA 4C68A 3GYAA 3PGPA 4P4BA 2PJ1A 4XNHB 2ZEGA 3I3GA 3E0KA 4K3NA 5DS0A 4NGPA 4DNCA 1NE9A 2XEJA 1H8LA 3BHXA 4MHPA 1S5KA 1Z8XA 4KVOE 1IYLA 3ZZIA 8CPAA 3D7GA 4MHDA 1VIXA 4X2TA 2YNDA 2O4HA 3SI0A 2YNCA 2ZW5A 5K8OA 2NYQA 2CF4A 4IHMA 3CPXA 4OP4A 2J8NA 3B3WA 3W6XA 1P0HA 4IUSA 3TO9A 2AE6A 4JD6A 4CYNA 5EMIA 5IB9A 4EMEA 1Y0RA 1ZG8A 3C26A 2Q44A 1XIXA 4MCRA 3CXSA 3TC8A 2R1IA 2ZOGA 2DF5A 4A33A 2ABZA 1GYTA 3SI1A 5A28A 4A32A 2ZXVA 4MCPA 5K8NA 4OMEA 1XEBA 1TKJA 4P4IA 3SI2A 1J4JA 3SJXA 3PB8X 3SHPA 1XE4A 5ISVA 3DR8A 1IGBA 3FIXA 2PJBA 3QB8A 2QMLA 4ZY0A 4FWUA 2DEAA 4F8ZA 4XPLA 4EWTA 4I49A 2PVVA 1M1DA 1YW6A 3I9SA 3W91A 4QUSA 1S7FA 5A27A 2D4PA 4CAEA 4R7MA 2EUIA 2BOAA 2PJ2A 1XMBA 1Q7LA 1QSMA 2PJ0A 4M6HA 4DJLA 2Y0MA 2WPWA 1ARMA 3NH8A 3DR6A 4FD4A 5EC4A 2BL1A 3TO7A 1OBRA 4TNUA 2GIVA 3H5ZA 1LCPA 3G3SA 2OZHA 5ELYA 2IL4A 2PJ7A
chains in the Genus database with same CATH topology
2RB7A 3CDXA 4WJBA 2OOTA 3D68A 4A94A 2HB6A 3HUVA 4PXDA 1YSJA 1QQ9A 2PJ4A 1F2PA 3D7HA 5K8MA 4R8FA 1RTQA 1R43A 4DYOA 1YW4A 1F57A 2AFSA 6CPAA 5K8PA 1TKFA 4NGRA 4RUHA 5LRJA 2GU2A 4A38A 1YMEA 1LAPA 2AFXA 1CP7A 3I1UA 2POKA 1ZG9A 4PXBA 3KI9A 2IJZA 3V38A 2WZNA 1LOKA 3DGVA 7CPAA 2ZOFA 4P10A 1VHOA 3PB9X 3N5FA 2ZEFA 4AXVA 4MMOA 3T8WA 2ZEEA 2PVWA 4OC1A 3PEIA 1BPNA 1XJOA 2BO9A 4W9YA 3KQZA 2XEFA 1ZLIA 5CBMA 3NFZA 3RZAA 3IWWA 1ZG7A 2NSMA 1LFWA 5JGFA 2PJAA 5HVFA 3FF3A 3IIBA 4FUUA 3GUXA 3WT4A 3FX6A 5LYFA 3ISXA 3KGQA 2AFZA 2HC9A 4R76A 3B7IA 3IFEA 4X8IA 4JYWA 1NSAA 3LMSA 4MHZA 3TX8A 4P6YA 4O23A 4UEEA 4A39A 2WYRA 3FH4A 1TF8A 3B35A 2ZEMA 2V77A 3QNVA 1Z8LA 4UIBA 3ISZA 4TWEA 2ANPA 2CIJA 2PJ9A 3D7FA 1HEEA 4H2KA 4GM5A 3V7ZA 4NJQA 2BCOA 2F7VA 4DUKA 4ONWA 3D4UA 1F2OA 2JBJA 1DTDA 3B3SA 3FEEA 4EFDA 5HVGA 1FNOA 2C6PA 1Z2LA 4NFRA 3VH9A 1QMUA 4UEZA 4NGQA 3KL9A 2QJ8A 2AFMA 4OC5A 2IMOA 1TF9A 3H8FA 4P4DA 5K8NA 2Q43A 4OIWA 4B6ZA 2JEWA 3CT9A 2V8GA 3D67A 4R6TA 2JBKA 4IK2A 4JZ0A 1Z5RA 3PBEA 2PE3A 2FVGA 3WC6A 4Z65A 3CPAA 2PJ6A 3S9NA 1TKHA 3KR4A 3SJGA 3PFEA 3PB6X 1PYTB 3GLJA 4NGTA 4PXEA 1LANA 2C6GA 2EK8A 5F09A 4PQAA 4UF4A 2PIZA 1TXRA 3B3TA 4LQGA 2PJ5A 1R3NA 2PJ8A 3WC5A 2I3CA 2GLJA 4OC3A 1ELLP 3PBBA 5LYLA 4BD9A 3IJ3A 1Y7EA 5I4MA 2EK9A 3FJUA 4G1PA 3B3VA 4F9VA 1EE3P 1LAMA 2AFWA 1M4LA 2PIYA 1ZLHA 2CTBA 3FVLA 5D8NA 1ELMP 1CPXA 2AFOA 3BI0A 5LYIA 3KHZA 2RFHA 1FT7A 3IO1A 1JQGA 3K9TA 5JM6A 4ZX8A 3HLPA 4X3RA 5HVHA 2VL1A 3D7DA 3IC1A 3VARA 4MCQA 1AMPA 4OKOA 3FECA 4CPAA 4ZX9A 1Y0YA 4UEFA 3WC7A 4WWVA 3RBUA 4NGMA 1BAVA 4OC4A 3MRUA 4NGSA 4P4EA 1YLOA 4F9UA 3H8EA 3S9LA 2ZEPA 3H8GA 2ZELA 3PFOA 4MXUA 2OR4A 3KQXA 3S9MA 3NH4A 3PRTA 1CX8A 3D66A 2CTCA 1CPSA 4KSIA 5LRKA 2XEIA 2V8VA 2EWBA 4IAVA 3DLJA 4UIAA 3RAMA 5HXDA 1VHEA 2V8HA 5LRGA 3L2NA 3BI1A 2ZEOA 2G9DA 4ZYQA 1ARLA 2GREA 5JH9A 3SJEA 5LYDA 2AFUA 3FMCA 2PJCA 2O53A 1UWYA 2Q51A 2GLFA 4NJRA 5CPAA 1XRYA 4A37A 4OC0A 3PB4X 3LWUA 2IQ6A 4OIDA 4Q7AA 2QYVA 1HDUA 5THWA 4ZY1A 4MRIA 3KZWA 2C1CA 2PJ3A 3BXMA 4MHNA 2C6CA 3NH5A 2QVPA 4P4JA 3B3CA 2PCUA 1XBUA 1XFOA 2Q4ZA 3NA6A 4NGNA 1KWMA 4ZI6A 1CG2A 3JRUA 3GB0A 3FEDA 1IY7A 1PCAA 5D29A 4P4FA 2ZEHA 1DE4C 1CBXA 2ZENA 3KR5A 3KHXA 2J9AA 4P44A 2PRQA 2XEGA 3K2KA 4MCSA 1CP6A 2ZEDA 1VGYA 4FBEA 4YU9A 3SJFA 3B2YA 5J1QA 4FAIA 1HDQA 4OC2A 4PXCA 1BPMA 1BLLE 4YWYA 3WABA 4MHYA 3IEHA 1AYEA 2F8HA 3PB7X 3VATA 4ZY2A 3KASA 4PPZA 3MN8A 4P45A 2V8DA 4P4BA 2PJ1A 2ZEGA 4K3NA 5DS0A 4NGPA 2XEJA 1H8LA 3BHXA 4MHPA 8CPAA 3D7GA 4X2TA 1VIXA 3SI0A 2O4HA 5K8OA 2NYQA 2CF4A 4IHMA 3CPXA 4OP4A 3B3WA 5IB9A 4EMEA 1Y0RA 1ZG8A 4MCRA 3TC8A 2ZOGA 2ABZA 1GYTA 3SI1A 4MCPA 4OMEA 1TKJA 4P4IA 3SI2A 3SJXA 3PB8X 1IGBA 2PJBA 4ZY0A 4FWUA 2DEAA 4F8ZA 4EWTA 2PVVA 1YW6A 4R7MA 2PJ2A 2BOAA 1XMBA 1Q7LA 2PJ0A 4DJLA 1ARMA 3NH8A 1OBRA 4TNUA 1LCPA 5ELYA 2PJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RB7 A;  3CDX A;  4WJB A;  2OOT A;  3D68 A;  4A94 A;  2HB6 A;  3HUV A;  4PXD A;  1YSJ A;  1QQ9 A;  2PJ4 A;  1F2P A;  3D7H A;  5K8M A;  4R8F A;  1RTQ A;  1R43 A;  4DYO A;  1YW4 A;  1F57 A;  2AFS A;  6CPA A;  5K8P A;  1TKF A;  4NGR A;  4RUH A;  5LRJ A;  2GU2 A;  4A38 A;  1YME A;  1LAP A;  2AFX A;  1CP7 A;  3I1U A;  2POK A;  1ZG9 A;  4PXB A;  3KI9 A;  2IJZ A;  3V38 A;  2WZN A;  1LOK A;  3DGV A;  7CPA A;  2ZOF A;  4P10 A;  1VHO A;  3PB9 X;  3N5F A;  2ZEF A;  4AXV A;  4MMO A;  3T8W A;  2ZEE A;  2PVW A;  4OC1 A;  3PEI A;  1BPN A;  1XJO A;  2BO9 A;  4W9Y A;  3KQZ A;  2XEF A;  1ZLI A;  5CBM A;  3NFZ A;  3RZA A;  3IWW A;  1ZG7 A;  2NSM A;  1LFW A;  5JGF A;  2PJA A;  5HVF A;  3FF3 A;  3IIB A;  4FUU A;  3GUX A;  3WT4 A;  3FX6 A;  5LYF A;  3ISX A;  3KGQ A;  2AFZ A;  2HC9 A;  4R76 A;  3B7I A;  3IFE A;  4X8I A;  4JYW A;  1NSA A;  3LMS A;  4MHZ A;  3TX8 A;  4P6Y A;  4O23 A;  4UEE A;  4A39 A;  2WYR A;  3FH4 A;  1TF8 A;  3B35 A;  2ZEM A;  2V77 A;  3QNV A;  1Z8L A;  4UIB A;  3ISZ A;  4TWE A;  2ANP A;  2CIJ A;  2PJ9 A;  3D7F A;  1HEE A;  4H2K A;  4GM5 A;  3V7Z A;  4NJQ A;  2BCO A;  2F7V A;  4DUK A;  4ONW A;  3D4U A;  1F2O A;  2JBJ A;  1DTD A;  3B3S A;  3FEE A;  4EFD A;  5HVG A;  1FNO A;  2C6P A;  1Z2L A;  4NFR A;  3VH9 A;  1QMU A;  4UEZ A;  4NGQ A;  3KL9 A;  2QJ8 A;  2AFM A;  4OC5 A;  2IMO A;  1TF9 A;  3H8F A;  4P4D A;  5K8N A;  2Q43 A;  4OIW A;  4B6Z A;  2JEW A;  3CT9 A;  2V8G A;  3D67 A;  4R6T A;  2JBK A;  4IK2 A;  4JZ0 A;  1Z5R A;  3PBE A;  2PE3 A;  2FVG A;  3WC6 A;  4Z65 A;  3CPA A;  2PJ6 A;  3S9N A;  1TKH A;  3KR4 A;  3SJG A;  3PFE A;  3PB6 X;  1PYT B;  3GLJ A;  4NGT A;  4PXE A;  1LAN A;  2C6G A;  2EK8 A;  5F09 A;  4PQA A;  4UF4 A;  2PIZ A;  1TXR A;  3B3T A;  4LQG A;  2PJ5 A;  1R3N A;  2PJ8 A;  3WC5 A;  2I3C A;  2GLJ A;  4OC3 A;  1ELL P;  3PBB A;  5LYL A;  4BD9 A;  3IJ3 A;  1Y7E A;  5I4M A;  2EK9 A;  3FJU A;  4G1P A;  3B3V A;  4F9V A;  1EE3 P;  1LAM A;  2AFW A;  1M4L A;  2PIY A;  1ZLH A;  2CTB A;  3FVL A;  5D8N A;  1ELM P;  1CPX A;  2AFO A;  3BI0 A;  5LYI A;  3KHZ A;  2RFH A;  1FT7 A;  3IO1 A;  1JQG A;  3K9T A;  5JM6 A;  4ZX8 A;  3HLP A;  4X3R A;  5HVH A;  2VL1 A;  3D7D A;  3IC1 A;  3VAR A;  4MCQ A;  1AMP A;  4OKO A;  3FEC A;  4CPA A;  4ZX9 A;  1Y0Y A;  4UEF A;  3WC7 A;  4WWV A;  3RBU A;  4NGM A;  1BAV A;  4OC4 A;  3MRU A;  4NGS A;  4P4E A;  1YLO A;  4F9U A;  3H8E A;  3S9L A;  2ZEP A;  3H8G A;  2ZEL A;  3PFO A;  4MXU A;  2OR4 A;  3KQX A;  3S9M A;  3NH4 A;  3PRT A;  1CX8 A;  3D66 A;  2CTC A;  1CPS A;  4KSI A;  5LRK A;  2XEI A;  2V8V A;  2EWB A;  4IAV A;  3DLJ A;  4UIA A;  3RAM A;  5HXD A;  1VHE A;  2V8H A;  5LRG A;  3L2N A;  3BI1 A;  2ZEO A;  2G9D A;  4ZYQ A;  1ARL A;  2GRE A;  5JH9 A;  3SJE A;  5LYD A;  2AFU A;  3FMC A;  2PJC A;  2O53 A;  1UWY A;  2Q51 A;  2GLF A;  4NJR A;  5CPA A;  1XRY A;  4A37 A;  4OC0 A;  3PB4 X;  3LWU A;  2IQ6 A;  4OID A;  4Q7A A;  2QYV A;  1HDU A;  5THW A;  4ZY1 A;  4MRI A;  3KZW A;  2C1C A;  2PJ3 A;  3BXM A;  4MHN A;  2C6C A;  3NH5 A;  2QVP A;  4P4J A;  3B3C A;  2PCU A;  1XBU A;  1XFO A;  2Q4Z A;  3NA6 A;  4NGN A;  1KWM A;  4ZI6 A;  1CG2 A;  3JRU A;  3GB0 A;  3FED A;  1IY7 A;  1PCA A;  5D29 A;  4P4F A;  2ZEH A;  1DE4 C;  1CBX A;  2ZEN A;  3KR5 A;  3KHX A;  2J9A A;  4P44 A;  2PRQ A;  2XEG A;  3K2K A;  4MCS A;  1CP6 A;  2ZED A;  1VGY A;  4FBE A;  4YU9 A;  3SJF A;  3B2Y A;  5J1Q A;  4FAI A;  1HDQ A;  4OC2 A;  4PXC A;  1BPM A;  1BLL E;  4YWY A;  3WAB A;  4MHY A;  3IEH A;  1AYE A;  2F8H A;  3PB7 X;  3VAT A;  4ZY2 A;  3KAS A;  4PPZ A;  3MN8 A;  4P45 A;  2V8D A;  4P4B A;  2PJ1 A;  2ZEG A;  4K3N A;  5DS0 A;  4NGP A;  2XEJ A;  1H8L A;  3BHX A;  4MHP A;  8CPA A;  3D7G A;  4X2T A;  1VIX A;  3SI0 A;  2O4H A;  5K8O A;  2NYQ A;  2CF4 A;  4IHM A;  3CPX A;  4OP4 A;  3B3W A;  5IB9 A;  4EME A;  1Y0R A;  1ZG8 A;  4MCR A;  3TC8 A;  2ZOG A;  2ABZ A;  1GYT A;  3SI1 A;  4MCP A;  4OME A;  1TKJ A;  4P4I A;  3SI2 A;  3SJX A;  3PB8 X;  1IGB A;  2PJB A;  4ZY0 A;  4FWU A;  2DEA A;  4F8Z A;  4EWT A;  2PVV A;  1YW6 A;  4R7M A;  2PJ2 A;  2BOA A;  1XMB A;  1Q7L A;  2PJ0 A;  4DJL A;  1ARM A;  3NH8 A;  1OBR A;  4TNU A;  1LCP A;  5ELY A;  2PJ7 A; 
#chains in the Genus database with same CATH topology
 4RI1 A;  2PRB A;  2RB7 A;  5IX3 A;  3DSB A;  3G8W A;  3CDX A;  1FY7 A;  2ZPA A;  4WJB A;  5H86 A;  2OOT A;  3LOD A;  2J8R A;  5F49 A;  3D68 A;  4UWJ A;  2K5T A;  4A94 A;  4MBU A;  1KUY A;  2VQY A;  2HB6 A;  3JVN A;  2GAN A;  5AG5 A;  4J3G A;  3HUV A;  2GFQ A;  4PXD A;  4CGL A;  3R1K A;  5EBV A;  1YSJ A;  1QQ9 A;  2PJ4 A;  4XPD B;  4CAX A;  2HUZ A;  3IWE A;  1F2P A;  3D7H A;  1I12 A;  5K8M A;  5F48 A;  1XOV A;  4L8A A;  4R8F A;  1RTQ A;  1R43 A;  4DYO A;  1YW4 A;  4KVM E;  2YNC C;  1S7N A;  1YLE A;  4M6I A;  1F57 A;  2WSA A;  1KUX A;  3IU2 A;  2AFS A;  4B5P A;  6CPA A;  5K8P A;  1TKF A;  2R8V A;  4ZGY B;  4NGR A;  1NSL A;  4RUH A;  2GE3 A;  5LRJ A;  2ARH A;  2EVN A;  2P6F A;  2GU2 A;  4MFL A;  4MFZ A;  1YME A;  4A38 A;  2Q7B A;  1Z9U A;  1LAP A;  4KSA A;  1ZO0 A;  2AFX A;  1V0C A;  1CP7 A;  3I1U A;  3FBU A;  3PZJ A;  4R9M A;  3BJ7 A;  2POK A;  3JUW A;  1ZG9 A;  4PXB A;  3FYN A;  3CXP A;  2FIA A;  2IJZ A;  2Z0Z A;  3KI9 A;  4FD5 A;  4NF1 A;  4U9Y A;  4Q36 A;  3P2F A;  3R9E A;  3V38 A;  2B4D A;  2WZN A;  1LOK A;  3F5B A;  4RS2 A;  3D8P A;  2CNM A;  1MJA A;  3DGV A;  1YVO A;  1WWZ A;  1X10 A;  3CZX A;  4JJX A;  4CGM A;  7CPA A;  2P6G A;  2Z3O A;  2ZOF A;  5C88 A;  4P10 A;  1VHO A;  1M4I A;  3PB9 X;  1ON0 A;  4XPK A;  3GIU A;  3N5F A;  1PUA A;  4HPS A;  2ZEF A;  4AXV A;  4MMO A;  3T8W A;  2ZEE A;  2PVW A;  4MY3 A;  4H6Z A;  3VWE A;  4OC1 A;  3PEI A;  1BPN A;  1XJO A;  2BO9 A;  4W9Y A;  3KQZ A;  3ZJ0 A;  2DXQ A;  2G0B A;  2ZW7 A;  2XEF A;  1ZLI A;  2BEI A;  2F5I A;  3NFZ A;  3RZA A;  5CBM A;  2B5G A;  3IGR A;  3IWW A;  1ZG7 A;  3TOA A;  2NSM A;  1LFW A;  2OZG A;  2PJA A;  1OZP A;  3EO4 A;  3FF3 A;  3IIB A;  4QVT A;  5HVF A;  5JGF A;  4FUU A;  2REF A;  3GUX A;  3WT4 A;  3FX6 A;  5LYF A;  3ISX A;  4E2A A;  3KGQ A;  2AFZ A;  2VI7 A;  2HC9 A;  3D2M A;  4R76 A;  3B7I A;  3SXO A;  3IFE A;  4X8I A;  3EFA A;  2Z11 A;  4XNH C;  4JYW A;  1NSA A;  3LMS A;  3VWD A;  1R57 A;  4MHZ A;  3TX8 A;  1YRE A;  1XMT A;  4ZBG A;  3A9L A;  4P6Y A;  4PK2 A;  5G22 A;  2B3V A;  4O23 A;  4ORF A;  4H89 A;  4UEE A;  1Z8T A;  4A39 A;  2WYR A;  1S3Z A;  3FH4 A;  1TF8 A;  3B35 A;  2ZEM A;  5AG4 A;  2V77 A;  5KTD A;  1M4D A;  2I00 A;  4AG7 A;  3QNV A;  1Z8L A;  1BO4 A;  4UIB A;  1KZF A;  4A2Z A;  3ISZ A;  4TWE A;  2ANP A;  2CIJ A;  1QSN A;  3BLN A;  2PC1 A;  2PJ9 A;  3D7F A;  1HEE A;  1YVK A;  2B3U A;  4H2K A;  4E0A A;  4GM5 A;  4U9Z A;  5KTC A;  3V7Z A;  4B5O A;  4NJQ A;  2BCO A;  3JTK A;  2BUE A;  2F7V A;  4CGP A;  4DUK A;  1QSR A;  2VXK A;  4ONW A;  3D4U A;  5E96 A;  3NE8 A;  4ONU A;  4A31 A;  1F2O A;  1VHS A;  2P0W A;  1MJB A;  2JBJ A;  1GHE A;  3F8K A;  2Q4V A;  1DTD A;  2JEV A;  3B3S A;  3FEE A;  1JWQ A;  4Y49 C;  4EFD A;  2YGW A;  2ODF A;  4UA3 A;  4UFX A;  4CRZ B;  1FNO A;  4PSW A;  5HVG A;  2C6P A;  1Z2L A;  4M85 A;  1K4J A;  4NFR A;  3VH9 A;  1QMU A;  3EY5 A;  2Z10 A;  2P6E A;  1Z4R A;  5J8F A;  3R9G A;  4MY0 A;  4UEZ A;  4NGQ A;  1M44 A;  2PQ8 A;  1M4G A;  3KL9 A;  4R3K A;  1I1D A;  2QJ8 A;  2AFM A;  4OAD A;  4OC5 A;  1U6M A;  4NSQ A;  2IMO A;  1TF9 A;  3H8F A;  3PP9 A;  1S60 A;  2Q43 A;  4OIW A;  4P4D A;  4KOX A;  2RC4 A;  4B6Z A;  2JEW A;  2D4O A;  3CT9 A;  4RN7 A;  4C2Y A;  1IID A;  2B58 A;  2V8G A;  1Y9K A;  2JBK A;  3D67 A;  4IK2 A;  4R6T A;  2VEZ A;  4II9 A;  2OB0 A;  2Z3N A;  1A2Z A;  2VZZ A;  1Z5R A;  3PBE A;  4JZ0 A;  5G1Z A;  2PE3 A;  2FVG A;  3RNZ A;  3WC6 A;  2WUU A;  4CS0 B;  4UBR A;  3CPA A;  4Z65 A;  5J8C A;  3RYO A;  2Z3K A;  2PJ6 A;  4F6A A;  4HKF A;  4LQ6 A;  1P4N A;  2Q04 A;  1TKH A;  3KR4 A;  3S9N A;  2ATR A;  5DWN A;  3SJG A;  4BMH A;  2PR1 A;  4H6U A;  1Q2Y A;  3QAH A;  3PFE A;  2FXF A;  3PB6 X;  4X5K A;  1PYT B;  3GLJ A;  4NGT A;  4PXE A;  4F0Y A;  1LAN A;  5GCN A;  2C6G A;  2EK8 A;  3GY9 A;  2Z3M A;  4MI4 A;  5G20 A;  5F09 A;  4UCM A;  4PQA A;  4UF4 A;  4CRY B;  5KTA A;  2PIZ A;  2Q0Y A;  1TXR A;  3B3T A;  4LQG A;  2PJ5 A;  1R3N A;  2VBQ A;  3S6K A;  2PJ8 A;  3WC5 A;  2I79 A;  2I3C A;  1X12 A;  2GLJ A;  4OC3 A;  3EC4 A;  1ELL P;  3PBB A;  5LYL A;  1Y7R A;  4BD9 A;  3IJ3 A;  4PV6 A;  4B14 A;  3TO6 A;  1LRZ A;  3K9U A;  1Y7E A;  5I4M A;  2EK9 A;  3FJU A;  1Z4E A;  4G1P A;  3B3V A;  4QBJ A;  3OWC A;  4F9V A;  1B87 A;  1EE3 P;  2G3T A;  1LAM A;  2AFW A;  3S6F A;  4HNY B;  1M4L A;  2ZW6 A;  2PIY A;  3BJ8 A;  1ZLH A;  3V8I A;  2CTB A;  3FVL A;  5D8N A;  1ELM P;  2G3A A;  1CPX A;  1Y9W A;  2AFO A;  2JDD A;  2J8M A;  3BI0 A;  4KOW A;  5AG6 A;  3QAY A;  4B10 A;  5C82 A;  4KOY A;  2JLM A;  5LYI A;  3KHZ A;  2RFH A;  4JLY A;  1IYK A;  1FT7 A;  3S6H A;  4Q38 A;  4CAV A;  3IO1 A;  1JQG A;  3K9T A;  5JM6 A;  4ZX8 A;  4CAW A;  1RO5 A;  3HLP A;  4QC6 A;  4X3R A;  5HVH A;  5HMN A;  2VL1 A;  3D7D A;  3IC1 A;  2CXA A;  2PSW A;  3VAR A;  5I0C A;  4MCQ A;  4R87 A;  4EVY A;  4UCN A;  2WPX A;  3LAC A;  1AMP A;  4KS9 A;  4OKO A;  4KVX A;  3FEC A;  4CPA A;  2AJ6 A;  2JDC A;  1QST A;  4LX9 A;  2R98 A;  4ZX9 A;  1Y0Y A;  4K30 A;  4OLL A;  4UEF A;  3WC7 A;  4KOV A;  2OH1 A;  3FB3 A;  4WWV A;  4CYP A;  4HNW B;  4LUA A;  4PK3 A;  4NGM A;  3RBU A;  5F46 A;  1BAV A;  3H4Q A;  4OC4 A;  3MRU A;  1WK4 A;  3CXQ A;  4NGS A;  4P4E A;  2QEC A;  1YLO A;  2CY2 A;  3FXT A;  4MFJ A;  2CNT A;  3H8E A;  4KOT A;  4MJ8 A;  2ZEP A;  3WR7 A;  4F9U A;  3S9L A;  2EBJ A;  3H8G A;  2ZEL A;  1AUG A;  3PFO A;  4MXU A;  4AVB A;  2FIW A;  3P2H A;  3IWG A;  2OR4 A;  3KQX A;  3DNS A;  4KUA A;  4IF5 A;  4M6G A;  1CJW A;  4NCZ A;  4C2X A;  3S9M A;  3NH4 A;  2BSW A;  2X7B A;  3PRT A;  1CX8 A;  3D66 A;  4FD7 A;  3TT2 A;  2CTC A;  5IV0 A;  1XF8 A;  5AGE A;  1CPS A;  4KOR A;  4UFV A;  2C27 A;  4B5P B;  4KSI A;  5JPH A;  5JQ4 A;  5LRK A;  3N7Z A;  2Z3L A;  2XEI A;  2V8V A;  4YRH A;  2DPS A;  1L0C A;  2EWB A;  2B4B A;  2CNS A;  4IAV A;  5FVJ A;  3DLJ A;  4C7H A;  4JXR A;  3W6S A;  3T90 A;  4B11 A;  1YQE A;  3NE7 A;  4C7I A;  2B4D B;  4UIA A;  4JXQ A;  3RAM A;  1VHE A;  2FSR A;  5HXD A;  4KOS A;  4MFQ A;  3IU1 A;  2V8H A;  5LRG A;  3FRM A;  2PR8 A;  1IB1 E;  1NMT A;  2FS5 A;  4R3L A;  4L89 A;  2OU2 A;  3L2N A;  3BI1 A;  3R9F A;  2ZEO A;  2G9D A;  4NEX A;  4ZYQ A;  1ARL A;  1N71 A;  2GRE A;  2REE A;  4CYQ A;  5JH9 A;  3SJE A;  2A4N A;  3LD2 A;  2AFU A;  3FMC A;  5LYD A;  4KZT A;  2PJC A;  4QB9 A;  1YX0 A;  1UWY A;  2EO8 A;  2O53 A;  1Z8W A;  2Q51 A;  3FNC A;  2GLF A;  3MGD A;  4NJR A;  4Y49 B;  5CPA A;  1XRY A;  4A37 A;  2FE7 A;  3UY5 A;  4OC0 A;  4NXY A;  3F0A A;  4AVC A;  1S7K A;  4U5Y A;  1VKC A;  3PB4 X;  4CYO A;  3LWU A;  5CNP A;  2IQ6 A;  4GS4 A;  3DDD A;  3EXN A;  4OID A;  4Q7A A;  1I21 A;  2QYV A;  2B5G B;  1HDU A;  4BBH A;  4BIN A;  3D2P A;  2Q4Y A;  2Z3P A;  4C2Z A;  1SQH A;  1S7L A;  5THW A;  4ZY1 A;  4UWI A;  4MRI A;  4KLV A;  1RXT A;  4UFW A;  4CAF A;  2ZW4 A;  4KOU A;  4OAE A;  3KZW A;  2C1C A;  1KUV A;  1QSO A;  2PJ3 A;  1YK3 A;  3BXM A;  3SXN A;  4MHN A;  2H5M A;  4XPD C;  1MK4 A;  3T9Y A;  2C6C A;  3NH5 A;  2QVP A;  4P4J A;  4PSX A;  3TTH A;  3B3C A;  4AB7 A;  3R96 A;  2O28 A;  2PCU A;  1IIC A;  4M3S A;  1XBU A;  2HQY A;  5IB0 A;  1XFO A;  2Q4Z A;  3NA6 A;  1YR0 A;  2VZY A;  4NGN A;  1KWM A;  4ZI6 A;  1CG2 A;  3S6G A;  3JRU A;  1BOB A;  1Q2D A;  3GB0 A;  4KSF A;  3FED A;  5H84 A;  1IY7 A;  1PCA A;  5D29 A;  4P4F A;  2QIR A;  2ZEH A;  1DE4 C;  5HH1 A;  1CBX A;  5F47 A;  2ZEN A;  1IOI A;  4FD6 A;  3KR5 A;  4YGO A;  1IOF A;  2FT0 A;  5AG7 A;  3B8G A;  1YGH A;  3KHX A;  4A30 A;  2J9A A;  1UFH A;  2YNE A;  4A95 A;  4AG9 A;  3D3S A;  4P44 A;  2PRQ A;  1IU8 A;  2PDO A;  4E8O A;  4F0X A;  4B12 A;  2XEG A;  4B13 A;  4GXH A;  3K2K A;  4AVA A;  2DPT A;  2HV2 A;  4MCS A;  3TCV A;  1CP6 A;  4KUB A;  2ZED A;  1VGY A;  4FBE A;  2Q7S A;  4YU9 A;  3SJF A;  3B2Y A;  4UCP A;  4R57 A;  5J1Q A;  4KLW A;  5DWM A;  4CGN A;  4FAI A;  1HDQ A;  3R95 A;  5G21 A;  4OC2 A;  1CM0 A;  4MFP A;  3TE4 A;  4PXC A;  1BPM A;  3RO0 A;  2FL4 A;  1BLL E;  4YWY A;  2FCK A;  3KKW A;  4JWP A;  1PU9 A;  1TIQ A;  3WAB A;  3TOB A;  2KCW A;  4YFJ A;  4CGO A;  3TFY A;  4MHY A;  3IEH A;  4HNX B;  5BWA B;  2NMT A;  4MFK A;  1AYE A;  3GKR A;  2F8H A;  3PB7 X;  2OZU A;  3VAT A;  4ZY2 A;  2R7H A;  1B6B A;  1MJ9 A;  3KAS A;  4PPZ A;  3MN8 A;  4P45 A;  1Q2C A;  2V8D A;  4C68 A;  3GYA A;  3PGP A;  4P4B A;  2PJ1 A;  4XNH B;  2ZEG A;  3I3G A;  3E0K A;  4K3N A;  5DS0 A;  4NGP A;  4DNC A;  1NE9 A;  2XEJ A;  1H8L A;  3BHX A;  4MHP A;  1S5K A;  1Z8X A;  4KVO E;  1IYL A;  3ZZI A;  8CPA A;  3D7G A;  4MHD A;  1VIX A;  4X2T A;  2YND A;  2O4H A;  3SI0 A;  2YNC A;  2ZW5 A;  5K8O A;  2NYQ A;  2CF4 A;  4IHM A;  3CPX A;  4OP4 A;  2J8N A;  3B3W A;  3W6X A;  1P0H A;  4IUS A;  3TO9 A;  2AE6 A;  4JD6 A;  4CYN A;  5EMI A;  5IB9 A;  4EME A;  1Y0R A;  1ZG8 A;  3C26 A;  2Q44 A;  1XIX A;  4MCR A;  3CXS A;  3TC8 A;  2R1I A;  2ZOG A;  2DF5 A;  4A33 A;  2ABZ A;  1GYT A;  3SI1 A;  5A28 A;  4A32 A;  2ZXV A;  4MCP A;  5K8N A;  4OME A;  1XEB A;  1TKJ A;  4P4I A;  3SI2 A;  1J4J A;  3SJX A;  3PB8 X;  3SHP A;  1XE4 A;  5ISV A;  3DR8 A;  1IGB A;  3FIX A;  2PJB A;  3QB8 A;  2QML A;  4ZY0 A;  4FWU A;  2DEA A;  4F8Z A;  4XPL A;  4EWT A;  4I49 A;  2PVV A;  1M1D A;  1YW6 A;  3I9S A;  3W91 A;  4QUS A;  1S7F A;  5A27 A;  2D4P A;  4CAE A;  4R7M A;  2EUI A;  2BOA A;  2PJ2 A;  1XMB A;  1Q7L A;  1QSM A;  2PJ0 A;  4M6H A;  4DJL A;  2Y0M A;  2WPW A;  1ARM A;  3NH8 A;  3DR6 A;  4FD4 A;  5EC4 A;  2BL1 A;  3TO7 A;  1OBR A;  4TNU A;  2GIV A;  3H5Z A;  1LCP A;  3G3S A;  2OZH A;  5ELY A;  2IL4 A;  2PJ7 A; 
#chains in the Genus database with same CATH homology
 2RB7 A;  3CDX A;  4WJB A;  2OOT A;  3D68 A;  4A94 A;  2HB6 A;  3HUV A;  4PXD A;  1YSJ A;  1QQ9 A;  2PJ4 A;  1F2P A;  3D7H A;  5K8M A;  4R8F A;  1RTQ A;  1R43 A;  4DYO A;  1YW4 A;  1F57 A;  2AFS A;  6CPA A;  5K8P A;  1TKF A;  4NGR A;  4RUH A;  5LRJ A;  2GU2 A;  4A38 A;  1YME A;  1LAP A;  2AFX A;  1CP7 A;  3I1U A;  2POK A;  1ZG9 A;  4PXB A;  3KI9 A;  2IJZ A;  3V38 A;  2WZN A;  1LOK A;  3DGV A;  7CPA A;  2ZOF A;  4P10 A;  1VHO A;  3PB9 X;  3N5F A;  2ZEF A;  4AXV A;  4MMO A;  3T8W A;  2ZEE A;  2PVW A;  4OC1 A;  3PEI A;  1BPN A;  1XJO A;  2BO9 A;  4W9Y A;  3KQZ A;  2XEF A;  1ZLI A;  5CBM A;  3NFZ A;  3RZA A;  3IWW A;  1ZG7 A;  2NSM A;  1LFW A;  5JGF A;  2PJA A;  5HVF A;  3FF3 A;  3IIB A;  4FUU A;  3GUX A;  3WT4 A;  3FX6 A;  5LYF A;  3ISX A;  3KGQ A;  2AFZ A;  2HC9 A;  4R76 A;  3B7I A;  3IFE A;  4X8I A;  4JYW A;  1NSA A;  3LMS A;  4MHZ A;  3TX8 A;  4P6Y A;  4O23 A;  4UEE A;  4A39 A;  2WYR A;  3FH4 A;  1TF8 A;  3B35 A;  2ZEM A;  2V77 A;  3QNV A;  1Z8L A;  4UIB A;  3ISZ A;  4TWE A;  2ANP A;  2CIJ A;  2PJ9 A;  3D7F A;  1HEE A;  4H2K A;  4GM5 A;  3V7Z A;  4NJQ A;  2BCO A;  2F7V A;  4DUK A;  4ONW A;  3D4U A;  1F2O A;  2JBJ A;  1DTD A;  3B3S A;  3FEE A;  4EFD A;  5HVG A;  1FNO A;  2C6P A;  1Z2L A;  4NFR A;  3VH9 A;  1QMU A;  4UEZ A;  4NGQ A;  3KL9 A;  2QJ8 A;  2AFM A;  4OC5 A;  2IMO A;  1TF9 A;  3H8F A;  4P4D A;  5K8N A;  2Q43 A;  4OIW A;  4B6Z A;  2JEW A;  3CT9 A;  2V8G A;  3D67 A;  4R6T A;  2JBK A;  4IK2 A;  4JZ0 A;  1Z5R A;  3PBE A;  2PE3 A;  2FVG A;  3WC6 A;  4Z65 A;  3CPA A;  2PJ6 A;  3S9N A;  1TKH A;  3KR4 A;  3SJG A;  3PFE A;  3PB6 X;  1PYT B;  3GLJ A;  4NGT A;  4PXE A;  1LAN A;  2C6G A;  2EK8 A;  5F09 A;  4PQA A;  4UF4 A;  2PIZ A;  1TXR A;  3B3T A;  4LQG A;  2PJ5 A;  1R3N A;  2PJ8 A;  3WC5 A;  2I3C A;  2GLJ A;  4OC3 A;  1ELL P;  3PBB A;  5LYL A;  4BD9 A;  3IJ3 A;  1Y7E A;  5I4M A;  2EK9 A;  3FJU A;  4G1P A;  3B3V A;  4F9V A;  1EE3 P;  1LAM A;  2AFW A;  1M4L A;  2PIY A;  1ZLH A;  2CTB A;  3FVL A;  5D8N A;  1ELM P;  1CPX A;  2AFO A;  3BI0 A;  5LYI A;  3KHZ A;  2RFH A;  1FT7 A;  3IO1 A;  1JQG A;  3K9T A;  5JM6 A;  4ZX8 A;  3HLP A;  4X3R A;  5HVH A;  2VL1 A;  3D7D A;  3IC1 A;  3VAR A;  4MCQ A;  1AMP A;  4OKO A;  3FEC A;  4CPA A;  4ZX9 A;  1Y0Y A;  4UEF A;  3WC7 A;  4WWV A;  3RBU A;  4NGM A;  1BAV A;  4OC4 A;  3MRU A;  4NGS A;  4P4E A;  1YLO A;  4F9U A;  3H8E A;  3S9L A;  2ZEP A;  3H8G A;  2ZEL A;  3PFO A;  4MXU A;  2OR4 A;  3KQX A;  3S9M A;  3NH4 A;  3PRT A;  1CX8 A;  3D66 A;  2CTC A;  1CPS A;  4KSI A;  5LRK A;  2XEI A;  2V8V A;  2EWB A;  4IAV A;  3DLJ A;  4UIA A;  3RAM A;  5HXD A;  1VHE A;  2V8H A;  5LRG A;  3L2N A;  3BI1 A;  2ZEO A;  2G9D A;  4ZYQ A;  1ARL A;  2GRE A;  5JH9 A;  3SJE A;  5LYD A;  2AFU A;  3FMC A;  2PJC A;  2O53 A;  1UWY A;  2Q51 A;  2GLF A;  4NJR A;  5CPA A;  1XRY A;  4A37 A;  4OC0 A;  3PB4 X;  3LWU A;  2IQ6 A;  4OID A;  4Q7A A;  2QYV A;  1HDU A;  5THW A;  4ZY1 A;  4MRI A;  3KZW A;  2C1C A;  2PJ3 A;  3BXM A;  4MHN A;  2C6C A;  3NH5 A;  2QVP A;  4P4J A;  3B3C A;  2PCU A;  1XBU A;  1XFO A;  2Q4Z A;  3NA6 A;  4NGN A;  1KWM A;  4ZI6 A;  1CG2 A;  3JRU A;  3GB0 A;  3FED A;  1IY7 A;  1PCA A;  5D29 A;  4P4F A;  2ZEH A;  1DE4 C;  1CBX A;  2ZEN A;  3KR5 A;  3KHX A;  2J9A A;  4P44 A;  2PRQ A;  2XEG A;  3K2K A;  4MCS A;  1CP6 A;  2ZED A;  1VGY A;  4FBE A;  4YU9 A;  3SJF A;  3B2Y A;  5J1Q A;  4FAI A;  1HDQ A;  4OC2 A;  4PXC A;  1BPM A;  1BLL E;  4YWY A;  3WAB A;  4MHY A;  3IEH A;  1AYE A;  2F8H A;  3PB7 X;  3VAT A;  4ZY2 A;  3KAS A;  4PPZ A;  3MN8 A;  4P45 A;  2V8D A;  4P4B A;  2PJ1 A;  2ZEG A;  4K3N A;  5DS0 A;  4NGP A;  2XEJ A;  1H8L A;  3BHX A;  4MHP A;  8CPA A;  3D7G A;  4X2T A;  1VIX A;  3SI0 A;  2O4H A;  5K8O A;  2NYQ A;  2CF4 A;  4IHM A;  3CPX A;  4OP4 A;  3B3W A;  5IB9 A;  4EME A;  1Y0R A;  1ZG8 A;  4MCR A;  3TC8 A;  2ZOG A;  2ABZ A;  1GYT A;  3SI1 A;  4MCP A;  4OME A;  1TKJ A;  4P4I A;  3SI2 A;  3SJX A;  3PB8 X;  1IGB A;  2PJB A;  4ZY0 A;  4FWU A;  2DEA A;  4F8Z A;  4EWT A;  2PVV A;  1YW6 A;  4R7M A;  2PJ2 A;  2BOA A;  1XMB A;  1Q7L A;  2PJ0 A;  4DJL A;  1ARM A;  3NH8 A;  1OBR A;  4TNU A;  1LCP A;  5ELY A;  2PJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...