3KHZA

Crystal structure of r350a mutant of staphylococcus aureus metallopeptidase (sapep/dape) in the apo-form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
468
structure length
433
Chain Sequence
SMWKEKVQQYEDQIINDLKGLLAIESVRDDAKASEDAPVGPGPRKALDYMYEIAHRDGFTTHDVDHIAGRIEAGKGNDVLGILCHVDVVPAGDGWDSNPFEPVVTEDAIIARGTLDDKGPTIAAYYAIKILEDMNVDWKKRIHMIIGTDEESDWKCTDRYFKTEEMPTLGFAPDAEFPCIHGEKGITTFDLVQNKLTEDQDEPDYELITFKSGERYNMVPDHAEARVLVKENMTDVIQDFEYFLEQNHLQGDSTVDSGILVLTVEGKAVHGMDPSIGVNAGLYLLKFLASLNLDNNAQAFVAFSNRYLFNSDFGEKMGMKFHTDVMGDVTTNIGVITYDNENAGLFGINLAYPEGFEFEKAMDRFANEIQQYGFEVKLGKVQPPHYVDKNDPFVQKLVTAYRNQTHQKNEYITKKQLFNATSIYLEAIYSLCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dipeptidase SACOL1801
publication title Crystal structure of Staphylococcus aureus metallopeptidase (Sapep) reveals large domain motions between the manganese-bound and apo-states
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 130
structure length 433
sequence length 468
chains with identical sequence B
ec nomenclature ec 3.4.13.-:
pdb deposition date 2009-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3khzA01
1YW4A 1LOKA 3D67A 4F9UA 4X8IA 3KQXA 1CPXA 5ELYA 4NFRA 1YSJA 2ZOGA 4OC1A 4OC4A 3FEDA 4P4JA 2V8HA 4OC3A 3BI0A 3IIBA 2PJCA 5LYIA 4YU9A 2PIZA 1NSAA 1CX8A 2PJ5A 1XFOA 3D66A 4R7MA 1TKFA 4B6ZA 1YW6A 3QNVA 1BAVA 4MMOA 2GLJA 5K8NA 4ZI6A 2Q4ZA 3IC1A 3IFEA 2O4HA 2JBJA 3SI0A 4MCPA 1KWMA 4IAVA 3SJXA 2ZEDA 3GUXA 2GLFA 3BI1A 1TF9A 4FUUA 2PIYA 1CG2A 5I4MA 2PJ2A 3ISXA 4JYWA 2AFUA 2AFZA 2IQ6A 3GLJA 3LMSA 2POKA 2EWBA 1F57A 4OKOA 4TNUA 1UWYA 2JEWA 2PJ6A 1XBUA 2XEIA 4IK2A 4K3NA 4F8ZA 2WZNA 3TX8A 2CF4A 2PJ3A 1OBRA 2Q51A 3D7HA 3KR5A 3CT9A 4OC2A 2AFSA 5LYFA 5HVFA 3CPXA 3KZWA 1XMBA 3V38A 4NGNA 4MHPA 4P4EA 1R43A 1IGBA 3B35A 2ZEEA 2G9DA 1XJOA 2FVGA 1H8LA 1ZG7A 3IJ3A 3KHZA 2C1CA 4UIBA 2CTBA 4MXUA 3PFEA 2J9AA 5K8MA 4AXVA 3D7DA 1AYEA 4P44A 2V8VA 4O23A 2WYRA 3KL9A 3B3TA 2XEGA 2HC9A 2XEJA 4NGRA 4NGSA 1F2PA 1TF8A 4X2TA 1F2OA 4R6TA 4JZ0A 3D7GA 4NGTA 3H8GA 4KSIA 4PXCA 1TKHA 4LQGA 4UEFA 3KR4A 3PB8X 3KASA 4R8FA 2V77A 2ZEPA 5HVHA 2V8DA 1DE4C 2OOTA 3H8FA 4YWYA 4FAIA 1QQ9A 2NSMA 5D8NA 3B3VA 4RUHA 2PJ8A 1ARLA 1Q7LA 3GB0A 4A39A 1BPMA 3NH8A 1PYTB 4UF4A 3PB4X 3KGQA 4Q7AA 4H2KA 3B3CA 4ONWA 1TXRA 1FT7A 2BCOA 3WC7A 3NFZA 2DEAA 3SJFA 2Q43A 4DJLA 3T8WA 1HDUA 2ANPA 1CP7A 2F8HA 4NJRA 1LAMA 2O53A 5F09A 1XRYA 3FX6A 1ELLP 4P10A 3FH4A 1BLLE 3CPAA 3B7IA 2HB6A 3V7ZA 1AMPA 4MCRA 1DTDA 1M4LA 3N5FA 2ZEFA 3ISZA 1HEEA 3KI9A 4MHZA 3VARA 4EWTA 3PB9X 2F7VA 4DUKA 4OP4A 1Y7EA 2PJ1A 4WWVA 3WC5A 4MCQA 4MCSA 2PJAA 3FECA 5HXDA 2PJ7A 5CPAA 2BO9A 2V8GA 3D7FA 5JH9A 1Z2LA 2VL1A 2PJ0A 4ZX9A 5D29A 4OMEA 4EFDA 4CPAA 1ZLHA 2PRQA 3DGVA 4PXDA 1Y0RA 2XEFA 5LYLA 2PJ4A 2QVPA 4WJBA 3IEHA 3WT4A 3MRUA 1LANA 3BXMA 3SI2A 2C6CA 4ZX8A 1LCPA 2IMOA 2ZELA 5THWA 2CTCA 2PE3A 1BPNA 3SI1A 1ZLIA 5IB9A 3K9TA 5DS0A 3PBBA 5LRKA 3IO1A 4PXBA 4TWEA 4W9YA 3LWUA 3RAMA 5J1QA 1ZG9A 1QMUA 2I3CA 4G1PA 4MHNA 3B2YA 2GU2A 3D4UA 3B3SA 4P45A 3CDXA 1CP6A 3FJUA 5LYDA 1VHEA 4P4FA 1Y0YA 1FNOA 2GREA 3KQZA 4NGPA 5HVGA 4NGQA 4P4BA 2ZENA 4GM5A 3PEIA 2PVVA 3WC6A 4FWUA 4ZY0A 3B3WA 1LFWA 1R3NA 1IY7A 5JM6A 3TC8A 1LAPA 5CBMA 2QJ8A 1TKJA 1YLOA 4FBEA 4PXEA 3L2NA 4Z65A 4UIAA 2CIJA 5LRJA 4OIWA 4MHYA 4DYOA 2NYQA 3NH5A 2PJBA 2ZEGA 2AFWA 5LRGA 2ZEHA 2RFHA 1CPSA 3PFOA 2JBKA 7CPAA 1HDQA 4A94A 3NH4A 3S9MA 1VGYA 4UEEA 1RTQA 2OR4A 3BHXA 4PPZA 1CBXA 4OIDA 4A37A 3K2KA 4P6YA 4IHMA 4F9VA 3HLPA 1VHOA 2AFOA 3PB7X 3SJEA 4ZYQA 3WABA 1JQGA 5JGFA 3S9NA 3FMCA 2PVWA 1Z5RA 6CPAA 1VIXA 3IWWA 2BOAA 4MRIA 2IJZA 1ARMA 3D68A 3PBEA 3S9LA 2EK8A 3HUVA 1PCAA 1YMEA 4ZY1A 4X3RA 4ZY2A 8CPAA 3VATA 1Z8LA 4R76A 4OC0A 2ZOFA 2C6GA 4OC5A 2ABZA 2PJ9A 3FEEA 1ZG8A 4EMEA 2AFMA 3I1UA 5K8PA 4BD9A 4A38A 2PCUA 2QYVA 3DLJA 5K8OA 3H8EA 2EK9A 3PRTA 3RBUA 3MN8A 2ZEOA 3PB6X 1EE3P 2AFXA 4PQAA 1ELMP 3RZAA 4P4DA 3FVLA 4P4IA 3KHXA 3FF3A 4UEZA 3NA6A 3JRUA 2ZEMA 4NJQA 2C6PA 1GYTA 2RB7A 3VH9A 4NGMA 3SJGA
chains in the Genus database with same CATH superfamily
2CNMA 3FB3A 1YW4A 4KOYA 1LOKA 3D67A 4AVCA 4F9UA 1J4JA 3KQXA 4X8IA 1CPXA 4B5OA 4C2YA 2K5TA 5ELYA 1QSRA 1YSJA 2JLMA 4NFRA 4RS2A 2ZOGA 4OC1A 4OC4A 1MK4A 2FIAA 3FEDA 4P4JA 4ORFA 2V8HA 4OC3A 3BI0A 1OZPA 1YVKA 4R9MA 5F48A 3VWEA 3VWDA 3IIBA 2PJCA 5LYIA 4AG9A 2ODFA 5F49A 4YU9A 4CRZB 1Z8TA 1LRZA 2Z10A 3KKWA 2P6FA 2PIZA 1NSAA 1CX8A 2PJ5A 4L89A 1VHSA 2KCWA 4ZGYB 4E8OA 1XFOA 3D66A 1NSLA 4R7MA 2PQ8A 1YREA 1TKFA 4B6ZA 4BINA 1YW6A 3DR8A 3QNVA 4RI1A 1BAVA 4MMOA 2GLJA 2Z3NA 5K8NA 3FBUA 4MY0A 4ZI6A 4QB9A 2Q4ZA 2OU2A 3IC1A 4CRYB 4M6IA 3W91A 3IFEA 5IB0A 1N71A 2O4HA 2VXKA 2JBJA 3SI0A 2CNSA 4MCPA 1KWMA 4IAVA 1S7LA 3CXSA 4LUAA 3SJXA 2YGWA 2ZEDA 3GUXA 2JDCA 2GLFA 3BI1A 1M4IA 1TF9A 4FUUA 2PIYA 4CYOA 1CG2A 5I4MA 2PJ2A 2OH1A 3TE4A 5IX3A 2D4OA 3ISXA 3EC4A 2REEA 1FY7A 4JYWA 5GCNA 2AFUA 2QMLA 3G3SA 1IOIA 2EO8A 4MFZA 2AFZA 3TFYA 2IQ6A 3GLJA 3LMSA 4MI4A 3TO9A 2POKA 3PZJA 3CZXA 2EWBA 1F57A 1IU8A 1VKCA 4OKOA 1UWYA 2JEWA 2PJ6A 3JVNA 4TNUA 4A30A 4E2AA 1XBUA 2XEIA 4IK2A 4K3NA 4F8ZA 2WZNA 4L8AA 1MJBA 4YGOA 3TX8A 2CF4A 4A31A 2PJ3A 1OBRA 2Q51A 3D7HA 3KR5A 2OZHA 3CT9A 4KLWA 2AFSA 4OC2A 5HVFA 5LYFA 3CPXA 3LODA 3BLNA 3KZWA 2VI7A 1XMBA 3EY5A 4H89A 4FD7A 3V38A 4NGNA 4R3KA 1YK3A 1M44A 2DPSA 3FRMA 3DNSA 5A28A 4MHPA 3SXNA 4P4EA 1R43A 4C7IA 4FD4A 1I12A 1IGBA 3B35A 4GS4A 4LX9A 3GIUA 2ZEEA 1Z8WA 1P0HA 2G9DA 1XJOA 2FVGA 1BO4A 1H8LA 1ZG7A 3IJ3A 3KHZA 3TO6A 2C1CA 2BEIA 2B5GB 4UIBA 2CTBA 4MXUA 3PFEA 4H6UA 5KTDA 2EBJA 3EXNA 3TT2A 2D4PA 2DXQA 2ZW5A 2J9AA 1SQHA 5K8MA 4AXVA 3D7DA 1AYEA 4P44A 2V8VA 4O23A 4UWJA 2WYRA 4CGMA 4RN7A 3KL9A 1YX0A 1S5KA 3B3TA 2XEGA 2HC9A 1Z8XA 2HUZA 5AG4A 1M4GA 3QAHA 2REFA 2XEJA 2ATRA 4CGOA 4QC6A 1A2ZA 1X12A 4NGRA 4NGSA 4AG7A 1F2PA 5DWNA 3D2MA 3F5BA 4M6HA 2P6GA 1TF8A 4X2TA 1F2OA 1B6BA 4R6TA 2Q0YA 4JZ0A 3D7GA 4NGTA 1Y9WA 4DNCA 2YNEA 4MFPA 1CJWA 3H8GA 4KSIA 4PXCA 1TKHA 3P2FA 4LQGA 3ZJ0A 4M6GA 4KZTA 2Z3PA 4QUSA 4UEFA 3DSBA 3KR4A 1Q2CA 1QSMA 4PSXA 3PB8X 3KASA 4R8FA 2V77A 2WSAA 1JWQA 5DWMA 4JWPA 2P6EA 2ZEPA 2WUUA 4OLLA 3R9FA 1QSTA 1YLEA 3QB8A 5HVHA 1ON0A 2O28A 4XNHC 3R9EA 4BBHA 4BMHA 3OWCA 2ARHA 3DDDA 2X7BA 2V8DA 3RYOA 2B3UA 1DE4C 4A33A 2OOTA 3IWGA 4HNWB 3F8KA 3H8FA 4F6AA 4YWYA 4B14A 4FAIA 1QQ9A 4ZBGA 1IB1E 2NSMA 2R8VA 5D8NA 3B3VA 4OADA 4RUHA 2OB0A 2PJ8A 1ARLA 1Q7LA 1RO5A 2IL4A 3GB0A 1BPMA 3NH8A 3N7ZA 4A39A 4Q36A 3ZZIA 4KVME 1PYTB 4A32A 4UF4A 2P0WA 2FIWA 3PB4X 3KGQA 5C88A 3QAYA 4AB7A 2Z3MA 4Q7AA 1K4JA 4II9A 5I0CA 4H2KA 2Q44A 3B3CA 4KOXA 4ONWA 5AGEA 4UCNA 4C7HA 1TXRA 1FT7A 4XPDC 1YVOA 2BCOA 3IU1A 3WC7A 2PR1A 2WPXA 3NFZA 2DEAA 3SJFA 2Q43A 4DJLA 1KZFA 1MJAA 3T8WA 1HDUA 2ANPA 4FD6A 1I21A 1CP7A 2F5IA 2BSWA 2F8HA 4KOUA 4NJRA 1LAMA 2O53A 4U9YA 4CYQA 5F09A 1XRYA 4HNYB 5F47A 3FX6A 5G20A 4PV6A 1ELLP 2ZW6A 4KSFA 4P10A 5JPHA 3GKRA 3H4QA 4R3LA 2FE7A 3FH4A 1BLLE 3CPAA 4F0YA 1Q2DA 1XMTA 3B7IA 4XNHB 2HB6A 3V7ZA 1TIQA 1AMPA 1AUGA 4LQ6A 3EFAA 4CAVA 1IIDA 4MCRA 1DTDA 1M4LA 2CXAA 3CXQA 2FL4A 3N5FA 2ZEFA 3ISZA 1HEEA 3KI9A 4B12A 4MBUA 4MHZA 3VARA 1XF8A 4KUBA 4MFLA 4EWTA 3PB9X 2ZPAA 4Y49C 2F7VA 5EC4A 4DUKA 4UFVA 4OP4A 1Y7EA 1S3ZA 2ZW7A 2JDDA 2OZUA 2PJ1A 4WWVA 1X10A 3WC5A 1BOBA 2B4DA 2R98A 3GYAA 4MCQA 2FXFA 4NSQA 3FYNA 2VZYA 4KOTA 4MCSA 5G21A 2PJAA 3FECA 5HH1A 5FVJA 5HXDA 4IF5A 1Z9UA 2PJ7A 1M1DA 2I79A 4JXRA 5CPAA 4JJXA 2QIRA 3LD2A 2CNTA 3RNZA 2BO9A 4U9ZA 2HQYA 2V8GA 3D7FA 3W6XA 4CGNA 5JH9A 1Z2LA 2VL1A 2PJ0A 4MFJA 4ZX9A 1YR0A 3IGRA 4OMEA 5D29A 3V8IA 4EFDA 4AVAA 4CPAA 1ZLHA 2PRQA 2B3VA 1RXTA 2Z0ZA 3DGVA 4FD5A 4PXDA 5H84A 1Y0RA 4OAEA 2XEFA 3C26A 4UFWA 5LYLA 1IICA 3D2PA 4A95A 2Y0MA 2PJ4A 2QVPA 3LACA 4WJBA 3IEHA 4I49A 3WT4A 3MRUA 2DPTA 1LANA 4B13A 3BXMA 3FIXA 4HPSA 3SI2A 4AVBA 4B5PA 2C6CA 2A4NA 4ZX8A 4M85A 4CAXA 1LCPA 2IMOA 2ZELA 3CXPA 5THWA 5HMNA 2CTCA 4CYNA 1V0CA 3TOBA 2PE3A 1WWZA 5EBVA 2CY2A 1BPNA 4H6ZA 2B5GA 4IUSA 3SI1A 2B58A 4KORA 3TOAA 3W6SA 3WR7A 3S6FA 1ZLIA 5IB9A 3S6KA 3S6HA 3K9TA 5DS0A 2PC1A 2EUIA 3PBBA 1IOFA 2GIVA 1S60A 5LRKA 3IO1A 4B11A 4PXBA 1R57A 4TWEA 5G22A 2J8RA 1Z4RA 3H5ZA 4U5YA 4W9YA 3T90A 1P4NA 5JQ4A 4XPKA 3LWUA 3RAMA 1S7NA 3F0AA 4PSWA 5J1QA 1ZG9A 5KTAA 3MGDA 2Z3KA 1QMUA 2I3CA 4C68A 3A9LA 4G1PA 4MHNA 3BJ8A 3B2YA 2GU2A 4K30A 3D4UA 5AG6A 3B3SA 1PUAA 4MFKA 4P45A 4A2ZA 3CDXA 1CP6A 3FJUA 5LYDA 1VHEA 4B10A 2VQYA 4P4FA 2YNCA 2BUEA 1GHEA 2ZW4A 1Y0YA 4QVTA 4NF1A 1FNOA 2GREA 2NMTA 3KQZA 3I3GA 4NGPA 5HVGA 2I00A 4ONUA 5H86A 3TCVA 5IV0A 1U6MA 3I9SA 5A27A 4NGQA 4P4BA 1CM0A 2ZENA 4CS0B 4GM5A 2DF5A 3PEIA 2AE6A 2PVVA 5E96A 3WC6A 4FWUA 4J3GA 4ZY0A 3B3WA 1LFWA 1YQEA 1R3NA 3SXOA 1IY7A 5JM6A 3TC8A 1LAPA 1Q2YA 5CBMA 3IU2A 2QJ8A 3GY9A 4C2ZA 4C2XA 1TKJA 1YLOA 4FBEA 1L0CA 2OZGA 2PR8A 3K9UA 5CNPA 4PXEA 4CGPA 5C82A 2VEZA 3L2NA 4Z65A 2G3AA 1Z4EA 4UIAA 1XE4A 2CIJA 3PP9A 4OIWA 5LRJA 3NE8A 3PGPA 4MHYA 2J8NA 2Q04A 4DYOA 2NYQA 3NH5A 2PJBA 2ZEGA 2AFWA 3D8PA 4CAEA 4CAFA 3P2HA 5LRGA 5KTCA 2ZEHA 3DR6A 4R87A 2RFHA 1CPSA 1QSOA 3PFOA 2Q7SA 2JBKA 7CPAA 1HDQA 4A94A 5BWAB 3NH4A 2RC4A 3FXTA 3E0KA 3S9MA 4PK2A 3TTHA 4EVYA 1VGYA 1NE9A 1XIXA 1QSNA 4UA3A 4UEEA 4E0AA 5ISVA 1RTQA 4PK3A 2OR4A 1B87A 5J8CA 3BHXA 4PPZA 2VBQA 5J8FA 1CBXA 3BJ7A 2GANA 2Z3OA 4OIDA 3UY5A 4A37A 1ZO0A 3K2KA 4P6YA 4IHMA 4F9VA 1XEBA 2B4BA 3HLPA 3FNCA 1VHOA 1Y9KA 2AFOA 2B4DB 3PB7X 4YRHA 3SJEA 4XPLA 4ZYQA 3WABA 1JQGA 5JGFA 3S9NA 1S7KA 2PDOA 2YNDA 2GE3A 4UWIA 4CYPA 3FMCA 1IYKA 1Y7RA 2PVWA 1Z5RA 4XPDB 2EVNA 2VZZA 5F46A 3JUWA 2ZXVA 6CPAA 1UFHA 1VIXA 2BOAA 3IWWA 4MRIA 2IJZA 1ARMA 3D68A 3PBEA 4KS9A 3SHPA 3S9LA 1M4DA 2EK8A 3HUVA 2GFQA 1PCAA 1YMEA 4UCMA 2FS5A 1I1DA 3B8GA 4ZY1A 4X3RA 3R95A 4Q38A 4JD6A 4ZY2A 8CPAA 1XOVA 3JTKA 2YNCC 2Z11A 3VATA 2PSWA 1KUXA 1Z8LA 4B5PB 4R76A 4UBRA 5EMIA 4JLYA 4OC0A 2ZOFA 4YFJA 2BL1A 2C6GA 2J8MA 2ABZA 4OC5A 2PJ9A 2PRBA 3FEEA 2QECA 2R7HA 4X5KA 1ZG8A 4EMEA 5G1ZA 3IWEA 2WPWA 2AFMA 3I1UA 3RO0A 5K8PA 2HV2A 4MFQA 3G8WA 4Y49B 4BD9A 4JXQA 4KOSA 4NCZA 4KVXA 1IYLA 4NEXA 3R9GA 4A38A 1KUYA 2C27A 4QBJA 2FCKA 1KUVA 2PCUA 2QYVA 3DLJA 4F0XA 5K8OA 3H8EA 4KLVA 4UFXA 2EK9A 4MY3A 3PRTA 3RBUA 3T9YA 3MN8A 4NXYA 4MJ8A 1NMTA 3NE7A 4R57A 2ZEOA 4KUAA 2FT0A 1YGHA 2R1IA 1S7FA 3PB6X 4HNXB 1EE3P 2AFXA 1MJ9A 2H5MA 1ELMP 4PQAA 3RZAA 2Q4VA 4P4DA 3FVLA 4P4IA 3KHXA 3FF3A 4CAWA 3S6GA 3R1KA 4CGLA 3EO4A 5AG5A 4UEZA 2G0BA 4GXHA 4M3SA 3NA6A 3TO7A 2G3TA 2Z3LA 2AJ6A 3JRUA 4KVOE 4KSAA 2Q7BA 4KOWA 2FSRA 4UCPA 2ZEMA 4NJQA 1WK4A 2C6PA 1GYTA 3D3SA 2RB7A 4KOVA 2Q4YA 2JEVA 4MHDA 3VH9A 4HKFA 4NGMA 3R96A 3SJGA 1PU9A 5AG7A
chains in the Genus database with same CATH topology
1YW4A 1LOKA 3D67A 4F9UA 4X8IA 3KQXA 1CPXA 5ELYA 4NFRA 1YSJA 2ZOGA 4OC1A 4OC4A 3FEDA 4P4JA 2V8HA 4OC3A 3BI0A 3IIBA 2PJCA 5LYIA 4YU9A 2PIZA 1NSAA 1CX8A 2PJ5A 1XFOA 3D66A 4R7MA 1TKFA 4B6ZA 1YW6A 3QNVA 1BAVA 4MMOA 2GLJA 5K8NA 4ZI6A 2Q4ZA 3IC1A 3IFEA 2O4HA 2JBJA 3SI0A 4MCPA 1KWMA 4IAVA 3SJXA 2ZEDA 3GUXA 2GLFA 3BI1A 1TF9A 4FUUA 2PIYA 1CG2A 5I4MA 2PJ2A 3ISXA 4JYWA 2AFUA 2AFZA 2IQ6A 3GLJA 3LMSA 2POKA 2EWBA 1F57A 4OKOA 4TNUA 1UWYA 2JEWA 2PJ6A 1XBUA 2XEIA 4IK2A 4K3NA 4F8ZA 2WZNA 3TX8A 2CF4A 2PJ3A 1OBRA 2Q51A 3D7HA 3KR5A 3CT9A 4OC2A 2AFSA 5LYFA 5HVFA 3CPXA 3KZWA 1XMBA 3V38A 4NGNA 4MHPA 4P4EA 1R43A 1IGBA 3B35A 2ZEEA 2G9DA 1XJOA 2FVGA 1H8LA 1ZG7A 3IJ3A 3KHZA 2C1CA 4UIBA 2CTBA 4MXUA 3PFEA 2J9AA 5K8MA 4AXVA 3D7DA 1AYEA 4P44A 2V8VA 4O23A 2WYRA 3KL9A 3B3TA 2XEGA 2HC9A 2XEJA 4NGRA 4NGSA 1F2PA 1TF8A 4X2TA 1F2OA 4R6TA 4JZ0A 3D7GA 4NGTA 3H8GA 4KSIA 4PXCA 1TKHA 4LQGA 4UEFA 3KR4A 3PB8X 3KASA 4R8FA 2V77A 2ZEPA 5HVHA 2V8DA 1DE4C 2OOTA 3H8FA 4YWYA 4FAIA 1QQ9A 2NSMA 5D8NA 3B3VA 4RUHA 2PJ8A 1ARLA 1Q7LA 3GB0A 4A39A 1BPMA 3NH8A 1PYTB 4UF4A 3PB4X 3KGQA 4Q7AA 4H2KA 3B3CA 4ONWA 1TXRA 1FT7A 2BCOA 3WC7A 3NFZA 2DEAA 3SJFA 2Q43A 4DJLA 3T8WA 1HDUA 2ANPA 1CP7A 2F8HA 4NJRA 1LAMA 2O53A 5F09A 1XRYA 3FX6A 1ELLP 4P10A 3FH4A 1BLLE 3CPAA 3B7IA 2HB6A 3V7ZA 1AMPA 4MCRA 1DTDA 1M4LA 3N5FA 2ZEFA 3ISZA 1HEEA 3KI9A 4MHZA 3VARA 4EWTA 3PB9X 2F7VA 4DUKA 4OP4A 1Y7EA 2PJ1A 4WWVA 3WC5A 4MCQA 4MCSA 2PJAA 3FECA 5HXDA 2PJ7A 5CPAA 2BO9A 2V8GA 3D7FA 5JH9A 1Z2LA 2VL1A 2PJ0A 4ZX9A 5D29A 4OMEA 4EFDA 4CPAA 1ZLHA 2PRQA 3DGVA 4PXDA 1Y0RA 2XEFA 5LYLA 2PJ4A 2QVPA 4WJBA 3IEHA 3WT4A 3MRUA 1LANA 3BXMA 3SI2A 2C6CA 4ZX8A 1LCPA 2IMOA 2ZELA 5THWA 2CTCA 2PE3A 1BPNA 3SI1A 1ZLIA 5IB9A 3K9TA 5DS0A 3PBBA 5LRKA 3IO1A 4PXBA 4TWEA 4W9YA 3LWUA 3RAMA 5J1QA 1ZG9A 1QMUA 2I3CA 4G1PA 4MHNA 3B2YA 2GU2A 3D4UA 3B3SA 4P45A 3CDXA 1CP6A 3FJUA 5LYDA 1VHEA 4P4FA 1Y0YA 1FNOA 2GREA 3KQZA 4NGPA 5HVGA 4NGQA 4P4BA 2ZENA 4GM5A 3PEIA 2PVVA 3WC6A 4FWUA 4ZY0A 3B3WA 1LFWA 1R3NA 1IY7A 5JM6A 3TC8A 1LAPA 5CBMA 2QJ8A 1TKJA 1YLOA 4FBEA 4PXEA 3L2NA 4Z65A 4UIAA 2CIJA 5LRJA 4OIWA 4MHYA 4DYOA 2NYQA 3NH5A 2PJBA 2ZEGA 2AFWA 5LRGA 2ZEHA 2RFHA 1CPSA 3PFOA 2JBKA 7CPAA 1HDQA 4A94A 3NH4A 3S9MA 1VGYA 4UEEA 1RTQA 2OR4A 3BHXA 4PPZA 1CBXA 4OIDA 4A37A 3K2KA 4P6YA 4IHMA 4F9VA 3HLPA 1VHOA 2AFOA 3PB7X 3SJEA 4ZYQA 3WABA 1JQGA 5JGFA 3S9NA 3FMCA 2PVWA 1Z5RA 6CPAA 1VIXA 3IWWA 2BOAA 4MRIA 2IJZA 1ARMA 3D68A 3PBEA 3S9LA 2EK8A 3HUVA 1PCAA 1YMEA 4ZY1A 4X3RA 4ZY2A 8CPAA 3VATA 1Z8LA 4R76A 4OC0A 2ZOFA 2C6GA 4OC5A 2ABZA 2PJ9A 3FEEA 1ZG8A 4EMEA 2AFMA 3I1UA 5K8PA 4BD9A 4A38A 2PCUA 2QYVA 3DLJA 5K8OA 3H8EA 2EK9A 3PRTA 3RBUA 3MN8A 2ZEOA 3PB6X 1EE3P 2AFXA 4PQAA 1ELMP 3RZAA 4P4DA 3FVLA 4P4IA 3KHXA 3FF3A 4UEZA 3NA6A 3JRUA 2ZEMA 4NJQA 2C6PA 1GYTA 2RB7A 3VH9A 4NGMA 3SJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW4 A;  1LOK A;  3D67 A;  4F9U A;  4X8I A;  3KQX A;  1CPX A;  5ELY A;  4NFR A;  1YSJ A;  2ZOG A;  4OC1 A;  4OC4 A;  3FED A;  4P4J A;  2V8H A;  4OC3 A;  3BI0 A;  3IIB A;  2PJC A;  5LYI A;  4YU9 A;  2PIZ A;  1NSA A;  1CX8 A;  2PJ5 A;  1XFO A;  3D66 A;  4R7M A;  1TKF A;  4B6Z A;  1YW6 A;  3QNV A;  1BAV A;  4MMO A;  2GLJ A;  5K8N A;  4ZI6 A;  2Q4Z A;  3IC1 A;  3IFE A;  2O4H A;  2JBJ A;  3SI0 A;  4MCP A;  1KWM A;  4IAV A;  3SJX A;  2ZED A;  3GUX A;  2GLF A;  3BI1 A;  1TF9 A;  4FUU A;  2PIY A;  1CG2 A;  5I4M A;  2PJ2 A;  3ISX A;  4JYW A;  2AFU A;  2AFZ A;  2IQ6 A;  3GLJ A;  3LMS A;  2POK A;  2EWB A;  1F57 A;  4OKO A;  4TNU A;  1UWY A;  2JEW A;  2PJ6 A;  1XBU A;  2XEI A;  4IK2 A;  4K3N A;  4F8Z A;  2WZN A;  3TX8 A;  2CF4 A;  2PJ3 A;  1OBR A;  2Q51 A;  3D7H A;  3KR5 A;  3CT9 A;  4OC2 A;  2AFS A;  5LYF A;  5HVF A;  3CPX A;  3KZW A;  1XMB A;  3V38 A;  4NGN A;  4MHP A;  4P4E A;  1R43 A;  1IGB A;  3B35 A;  2ZEE A;  2G9D A;  1XJO A;  2FVG A;  1H8L A;  1ZG7 A;  3IJ3 A;  3KHZ A;  2C1C A;  4UIB A;  2CTB A;  4MXU A;  3PFE A;  2J9A A;  5K8M A;  4AXV A;  3D7D A;  1AYE A;  4P44 A;  2V8V A;  4O23 A;  2WYR A;  3KL9 A;  3B3T A;  2XEG A;  2HC9 A;  2XEJ A;  4NGR A;  4NGS A;  1F2P A;  1TF8 A;  4X2T A;  1F2O A;  4R6T A;  4JZ0 A;  3D7G A;  4NGT A;  3H8G A;  4KSI A;  4PXC A;  1TKH A;  4LQG A;  4UEF A;  3KR4 A;  3PB8 X;  3KAS A;  4R8F A;  2V77 A;  2ZEP A;  5HVH A;  2V8D A;  1DE4 C;  2OOT A;  3H8F A;  4YWY A;  4FAI A;  1QQ9 A;  2NSM A;  5D8N A;  3B3V A;  4RUH A;  2PJ8 A;  1ARL A;  1Q7L A;  3GB0 A;  4A39 A;  1BPM A;  3NH8 A;  1PYT B;  4UF4 A;  3PB4 X;  3KGQ A;  4Q7A A;  4H2K A;  3B3C A;  4ONW A;  1TXR A;  1FT7 A;  2BCO A;  3WC7 A;  3NFZ A;  2DEA A;  3SJF A;  2Q43 A;  4DJL A;  3T8W A;  1HDU A;  2ANP A;  1CP7 A;  2F8H A;  4NJR A;  1LAM A;  2O53 A;  5F09 A;  1XRY A;  3FX6 A;  1ELL P;  4P10 A;  3FH4 A;  1BLL E;  3CPA A;  3B7I A;  2HB6 A;  3V7Z A;  1AMP A;  4MCR A;  1DTD A;  1M4L A;  3N5F A;  2ZEF A;  3ISZ A;  1HEE A;  3KI9 A;  4MHZ A;  3VAR A;  4EWT A;  3PB9 X;  2F7V A;  4DUK A;  4OP4 A;  1Y7E A;  2PJ1 A;  4WWV A;  3WC5 A;  4MCQ A;  4MCS A;  2PJA A;  3FEC A;  5HXD A;  2PJ7 A;  5CPA A;  2BO9 A;  2V8G A;  3D7F A;  5JH9 A;  1Z2L A;  2VL1 A;  2PJ0 A;  4ZX9 A;  5D29 A;  4OME A;  4EFD A;  4CPA A;  1ZLH A;  2PRQ A;  3DGV A;  4PXD A;  1Y0R A;  2XEF A;  5LYL A;  2PJ4 A;  2QVP A;  4WJB A;  3IEH A;  3WT4 A;  3MRU A;  1LAN A;  3BXM A;  3SI2 A;  2C6C A;  4ZX8 A;  1LCP A;  2IMO A;  2ZEL A;  5THW A;  2CTC A;  2PE3 A;  1BPN A;  3SI1 A;  1ZLI A;  5IB9 A;  3K9T A;  5DS0 A;  3PBB A;  5LRK A;  3IO1 A;  4PXB A;  4TWE A;  4W9Y A;  3LWU A;  3RAM A;  5J1Q A;  1ZG9 A;  1QMU A;  2I3C A;  4G1P A;  4MHN A;  3B2Y A;  2GU2 A;  3D4U A;  3B3S A;  4P45 A;  3CDX A;  1CP6 A;  3FJU A;  5LYD A;  1VHE A;  4P4F A;  1Y0Y A;  1FNO A;  2GRE A;  3KQZ A;  4NGP A;  5HVG A;  4NGQ A;  4P4B A;  2ZEN A;  4GM5 A;  3PEI A;  2PVV A;  3WC6 A;  4FWU A;  4ZY0 A;  3B3W A;  1LFW A;  1R3N A;  1IY7 A;  5JM6 A;  3TC8 A;  1LAP A;  5CBM A;  2QJ8 A;  1TKJ A;  1YLO A;  4FBE A;  4PXE A;  3L2N A;  4Z65 A;  4UIA A;  2CIJ A;  5LRJ A;  4OIW A;  4MHY A;  4DYO A;  2NYQ A;  3NH5 A;  2PJB A;  2ZEG A;  2AFW A;  5LRG A;  2ZEH A;  2RFH A;  1CPS A;  3PFO A;  2JBK A;  7CPA A;  1HDQ A;  4A94 A;  3NH4 A;  3S9M A;  1VGY A;  4UEE A;  1RTQ A;  2OR4 A;  3BHX A;  4PPZ A;  1CBX A;  4OID A;  4A37 A;  3K2K A;  4P6Y A;  4IHM A;  4F9V A;  3HLP A;  1VHO A;  2AFO A;  3PB7 X;  3SJE A;  4ZYQ A;  3WAB A;  1JQG A;  5JGF A;  3S9N A;  3FMC A;  2PVW A;  1Z5R A;  6CPA A;  1VIX A;  3IWW A;  2BOA A;  4MRI A;  2IJZ A;  1ARM A;  3D68 A;  3PBE A;  3S9L A;  2EK8 A;  3HUV A;  1PCA A;  1YME A;  4ZY1 A;  4X3R A;  4ZY2 A;  8CPA A;  3VAT A;  1Z8L A;  4R76 A;  4OC0 A;  2ZOF A;  2C6G A;  4OC5 A;  2ABZ A;  2PJ9 A;  3FEE A;  1ZG8 A;  4EME A;  2AFM A;  3I1U A;  5K8P A;  4BD9 A;  4A38 A;  2PCU A;  2QYV A;  3DLJ A;  5K8O A;  3H8E A;  2EK9 A;  3PRT A;  3RBU A;  3MN8 A;  2ZEO A;  3PB6 X;  1EE3 P;  2AFX A;  4PQA A;  1ELM P;  3RZA A;  4P4D A;  3FVL A;  4P4I A;  3KHX A;  3FF3 A;  4UEZ A;  3NA6 A;  3JRU A;  2ZEM A;  4NJQ A;  2C6P A;  1GYT A;  2RB7 A;  3VH9 A;  4NGM A;  3SJG A; 
#chains in the Genus database with same CATH topology
 2CNM A;  3FB3 A;  1YW4 A;  4KOY A;  1LOK A;  3D67 A;  4AVC A;  4F9U A;  1J4J A;  3KQX A;  4X8I A;  1CPX A;  4B5O A;  4C2Y A;  2K5T A;  5ELY A;  1QSR A;  1YSJ A;  2JLM A;  4NFR A;  4RS2 A;  2ZOG A;  4OC1 A;  4OC4 A;  1MK4 A;  2FIA A;  3FED A;  4P4J A;  4ORF A;  2V8H A;  4OC3 A;  3BI0 A;  1OZP A;  1YVK A;  4R9M A;  5F48 A;  3VWE A;  3VWD A;  3IIB A;  2PJC A;  5LYI A;  4AG9 A;  2ODF A;  5F49 A;  4YU9 A;  4CRZ B;  1Z8T A;  1LRZ A;  2Z10 A;  3KKW A;  2P6F A;  2PIZ A;  1NSA A;  1CX8 A;  2PJ5 A;  4L89 A;  1VHS A;  2KCW A;  4ZGY B;  4E8O A;  1XFO A;  3D66 A;  1NSL A;  4R7M A;  2PQ8 A;  1YRE A;  1TKF A;  4B6Z A;  4BIN A;  1YW6 A;  3DR8 A;  3QNV A;  4RI1 A;  1BAV A;  4MMO A;  2GLJ A;  2Z3N A;  5K8N A;  3FBU A;  4MY0 A;  4ZI6 A;  4QB9 A;  2Q4Z A;  2OU2 A;  3IC1 A;  4CRY B;  4M6I A;  3W91 A;  3IFE A;  5IB0 A;  1N71 A;  2O4H A;  2VXK A;  2JBJ A;  3SI0 A;  2CNS A;  4MCP A;  1KWM A;  4IAV A;  1S7L A;  3CXS A;  4LUA A;  3SJX A;  2YGW A;  2ZED A;  3GUX A;  2JDC A;  2GLF A;  3BI1 A;  1M4I A;  1TF9 A;  4FUU A;  2PIY A;  4CYO A;  1CG2 A;  5I4M A;  2PJ2 A;  2OH1 A;  3TE4 A;  5IX3 A;  2D4O A;  3ISX A;  3EC4 A;  2REE A;  1FY7 A;  4JYW A;  5GCN A;  2AFU A;  2QML A;  3G3S A;  1IOI A;  2EO8 A;  4MFZ A;  2AFZ A;  3TFY A;  2IQ6 A;  3GLJ A;  3LMS A;  4MI4 A;  3TO9 A;  2POK A;  3PZJ A;  3CZX A;  2EWB A;  1F57 A;  1IU8 A;  1VKC A;  4OKO A;  1UWY A;  2JEW A;  2PJ6 A;  3JVN A;  4TNU A;  4A30 A;  4E2A A;  1XBU A;  2XEI A;  4IK2 A;  4K3N A;  4F8Z A;  2WZN A;  4L8A A;  1MJB A;  4YGO A;  3TX8 A;  2CF4 A;  4A31 A;  2PJ3 A;  1OBR A;  2Q51 A;  3D7H A;  3KR5 A;  2OZH A;  3CT9 A;  4KLW A;  2AFS A;  4OC2 A;  5HVF A;  5LYF A;  3CPX A;  3LOD A;  3BLN A;  3KZW A;  2VI7 A;  1XMB A;  3EY5 A;  4H89 A;  4FD7 A;  3V38 A;  4NGN A;  4R3K A;  1YK3 A;  1M44 A;  2DPS A;  3FRM A;  3DNS A;  5A28 A;  4MHP A;  3SXN A;  4P4E A;  1R43 A;  4C7I A;  4FD4 A;  1I12 A;  1IGB A;  3B35 A;  4GS4 A;  4LX9 A;  3GIU A;  2ZEE A;  1Z8W A;  1P0H A;  2G9D A;  1XJO A;  2FVG A;  1BO4 A;  1H8L A;  1ZG7 A;  3IJ3 A;  3KHZ A;  3TO6 A;  2C1C A;  2BEI A;  2B5G B;  4UIB A;  2CTB A;  4MXU A;  3PFE A;  4H6U A;  5KTD A;  2EBJ A;  3EXN A;  3TT2 A;  2D4P A;  2DXQ A;  2ZW5 A;  2J9A A;  1SQH A;  5K8M A;  4AXV A;  3D7D A;  1AYE A;  4P44 A;  2V8V A;  4O23 A;  4UWJ A;  2WYR A;  4CGM A;  4RN7 A;  3KL9 A;  1YX0 A;  1S5K A;  3B3T A;  2XEG A;  2HC9 A;  1Z8X A;  2HUZ A;  5AG4 A;  1M4G A;  3QAH A;  2REF A;  2XEJ A;  2ATR A;  4CGO A;  4QC6 A;  1A2Z A;  1X12 A;  4NGR A;  4NGS A;  4AG7 A;  1F2P A;  5DWN A;  3D2M A;  3F5B A;  4M6H A;  2P6G A;  1TF8 A;  4X2T A;  1F2O A;  1B6B A;  4R6T A;  2Q0Y A;  4JZ0 A;  3D7G A;  4NGT A;  1Y9W A;  4DNC A;  2YNE A;  4MFP A;  1CJW A;  3H8G A;  4KSI A;  4PXC A;  1TKH A;  3P2F A;  4LQG A;  3ZJ0 A;  4M6G A;  4KZT A;  2Z3P A;  4QUS A;  4UEF A;  3DSB A;  3KR4 A;  1Q2C A;  1QSM A;  4PSX A;  3PB8 X;  3KAS A;  4R8F A;  2V77 A;  2WSA A;  1JWQ A;  5DWM A;  4JWP A;  2P6E A;  2ZEP A;  2WUU A;  4OLL A;  3R9F A;  1QST A;  1YLE A;  3QB8 A;  5HVH A;  1ON0 A;  2O28 A;  4XNH C;  3R9E A;  4BBH A;  4BMH A;  3OWC A;  2ARH A;  3DDD A;  2X7B A;  2V8D A;  3RYO A;  2B3U A;  1DE4 C;  4A33 A;  2OOT A;  3IWG A;  4HNW B;  3F8K A;  3H8F A;  4F6A A;  4YWY A;  4B14 A;  4FAI A;  1QQ9 A;  4ZBG A;  1IB1 E;  2NSM A;  2R8V A;  5D8N A;  3B3V A;  4OAD A;  4RUH A;  2OB0 A;  2PJ8 A;  1ARL A;  1Q7L A;  1RO5 A;  2IL4 A;  3GB0 A;  1BPM A;  3NH8 A;  3N7Z A;  4A39 A;  4Q36 A;  3ZZI A;  4KVM E;  1PYT B;  4A32 A;  4UF4 A;  2P0W A;  2FIW A;  3PB4 X;  3KGQ A;  5C88 A;  3QAY A;  4AB7 A;  2Z3M A;  4Q7A A;  1K4J A;  4II9 A;  5I0C A;  4H2K A;  2Q44 A;  3B3C A;  4KOX A;  4ONW A;  5AGE A;  4UCN A;  4C7H A;  1TXR A;  1FT7 A;  4XPD C;  1YVO A;  2BCO A;  3IU1 A;  3WC7 A;  2PR1 A;  2WPX A;  3NFZ A;  2DEA A;  3SJF A;  2Q43 A;  4DJL A;  1KZF A;  1MJA A;  3T8W A;  1HDU A;  2ANP A;  4FD6 A;  1I21 A;  1CP7 A;  2F5I A;  2BSW A;  2F8H A;  4KOU A;  4NJR A;  1LAM A;  2O53 A;  4U9Y A;  4CYQ A;  5F09 A;  1XRY A;  4HNY B;  5F47 A;  3FX6 A;  5G20 A;  4PV6 A;  1ELL P;  2ZW6 A;  4KSF A;  4P10 A;  5JPH A;  3GKR A;  3H4Q A;  4R3L A;  2FE7 A;  3FH4 A;  1BLL E;  3CPA A;  4F0Y A;  1Q2D A;  1XMT A;  3B7I A;  4XNH B;  2HB6 A;  3V7Z A;  1TIQ A;  1AMP A;  1AUG A;  4LQ6 A;  3EFA A;  4CAV A;  1IID A;  4MCR A;  1DTD A;  1M4L A;  2CXA A;  3CXQ A;  2FL4 A;  3N5F A;  2ZEF A;  3ISZ A;  1HEE A;  3KI9 A;  4B12 A;  4MBU A;  4MHZ A;  3VAR A;  1XF8 A;  4KUB A;  4MFL A;  4EWT A;  3PB9 X;  2ZPA A;  4Y49 C;  2F7V A;  5EC4 A;  4DUK A;  4UFV A;  4OP4 A;  1Y7E A;  1S3Z A;  2ZW7 A;  2JDD A;  2OZU A;  2PJ1 A;  4WWV A;  1X10 A;  3WC5 A;  1BOB A;  2B4D A;  2R98 A;  3GYA A;  4MCQ A;  2FXF A;  4NSQ A;  3FYN A;  2VZY A;  4KOT A;  4MCS A;  5G21 A;  2PJA A;  3FEC A;  5HH1 A;  5FVJ A;  5HXD A;  4IF5 A;  1Z9U A;  2PJ7 A;  1M1D A;  2I79 A;  4JXR A;  5CPA A;  4JJX A;  2QIR A;  3LD2 A;  2CNT A;  3RNZ A;  2BO9 A;  4U9Z A;  2HQY A;  2V8G A;  3D7F A;  3W6X A;  4CGN A;  5JH9 A;  1Z2L A;  2VL1 A;  2PJ0 A;  4MFJ A;  4ZX9 A;  1YR0 A;  3IGR A;  4OME A;  5D29 A;  3V8I A;  4EFD A;  4AVA A;  4CPA A;  1ZLH A;  2PRQ A;  2B3V A;  1RXT A;  2Z0Z A;  3DGV A;  4FD5 A;  4PXD A;  5H84 A;  1Y0R A;  4OAE A;  2XEF A;  3C26 A;  4UFW A;  5LYL A;  1IIC A;  3D2P A;  4A95 A;  2Y0M A;  2PJ4 A;  2QVP A;  3LAC A;  4WJB A;  3IEH A;  4I49 A;  3WT4 A;  3MRU A;  2DPT A;  1LAN A;  4B13 A;  3BXM A;  3FIX A;  4HPS A;  3SI2 A;  4AVB A;  4B5P A;  2C6C A;  2A4N A;  4ZX8 A;  4M85 A;  4CAX A;  1LCP A;  2IMO A;  2ZEL A;  3CXP A;  5THW A;  5HMN A;  2CTC A;  4CYN A;  1V0C A;  3TOB A;  2PE3 A;  1WWZ A;  5EBV A;  2CY2 A;  1BPN A;  4H6Z A;  2B5G A;  4IUS A;  3SI1 A;  2B58 A;  4KOR A;  3TOA A;  3W6S A;  3WR7 A;  3S6F A;  1ZLI A;  5IB9 A;  3S6K A;  3S6H A;  3K9T A;  5DS0 A;  2PC1 A;  2EUI A;  3PBB A;  1IOF A;  2GIV A;  1S60 A;  5LRK A;  3IO1 A;  4B11 A;  4PXB A;  1R57 A;  4TWE A;  5G22 A;  2J8R A;  1Z4R A;  3H5Z A;  4U5Y A;  4W9Y A;  3T90 A;  1P4N A;  5JQ4 A;  4XPK A;  3LWU A;  3RAM A;  1S7N A;  3F0A A;  4PSW A;  5J1Q A;  1ZG9 A;  5KTA A;  3MGD A;  2Z3K A;  1QMU A;  2I3C A;  4C68 A;  3A9L A;  4G1P A;  4MHN A;  3BJ8 A;  3B2Y A;  2GU2 A;  4K30 A;  3D4U A;  5AG6 A;  3B3S A;  1PUA A;  4MFK A;  4P45 A;  4A2Z A;  3CDX A;  1CP6 A;  3FJU A;  5LYD A;  1VHE A;  4B10 A;  2VQY A;  4P4F A;  2YNC A;  2BUE A;  1GHE A;  2ZW4 A;  1Y0Y A;  4QVT A;  4NF1 A;  1FNO A;  2GRE A;  2NMT A;  3KQZ A;  3I3G A;  4NGP A;  5HVG A;  2I00 A;  4ONU A;  5H86 A;  3TCV A;  5IV0 A;  1U6M A;  3I9S A;  5A27 A;  4NGQ A;  4P4B A;  1CM0 A;  2ZEN A;  4CS0 B;  4GM5 A;  2DF5 A;  3PEI A;  2AE6 A;  2PVV A;  5E96 A;  3WC6 A;  4FWU A;  4J3G A;  4ZY0 A;  3B3W A;  1LFW A;  1YQE A;  1R3N A;  3SXO A;  1IY7 A;  5JM6 A;  3TC8 A;  1LAP A;  1Q2Y A;  5CBM A;  3IU2 A;  2QJ8 A;  3GY9 A;  4C2Z A;  4C2X A;  1TKJ A;  1YLO A;  4FBE A;  1L0C A;  2OZG A;  2PR8 A;  3K9U A;  5CNP A;  4PXE A;  4CGP A;  5C82 A;  2VEZ A;  3L2N A;  4Z65 A;  2G3A A;  1Z4E A;  4UIA A;  1XE4 A;  2CIJ A;  3PP9 A;  4OIW A;  5LRJ A;  3NE8 A;  3PGP A;  4MHY A;  2J8N A;  2Q04 A;  4DYO A;  2NYQ A;  3NH5 A;  2PJB A;  2ZEG A;  2AFW A;  3D8P A;  4CAE A;  4CAF A;  3P2H A;  5LRG A;  5KTC A;  2ZEH A;  3DR6 A;  4R87 A;  2RFH A;  1CPS A;  1QSO A;  3PFO A;  2Q7S A;  2JBK A;  7CPA A;  1HDQ A;  4A94 A;  5BWA B;  3NH4 A;  2RC4 A;  3FXT A;  3E0K A;  3S9M A;  4PK2 A;  3TTH A;  4EVY A;  1VGY A;  1NE9 A;  1XIX A;  1QSN A;  4UA3 A;  4UEE A;  4E0A A;  5ISV A;  1RTQ A;  4PK3 A;  2OR4 A;  1B87 A;  5J8C A;  3BHX A;  4PPZ A;  2VBQ A;  5J8F A;  1CBX A;  3BJ7 A;  2GAN A;  2Z3O A;  4OID A;  3UY5 A;  4A37 A;  1ZO0 A;  3K2K A;  4P6Y A;  4IHM A;  4F9V A;  1XEB A;  2B4B A;  3HLP A;  3FNC A;  1VHO A;  1Y9K A;  2AFO A;  2B4D B;  3PB7 X;  4YRH A;  3SJE A;  4XPL A;  4ZYQ A;  3WAB A;  1JQG A;  5JGF A;  3S9N A;  1S7K A;  2PDO A;  2YND A;  2GE3 A;  4UWI A;  4CYP A;  3FMC A;  1IYK A;  1Y7R A;  2PVW A;  1Z5R A;  4XPD B;  2EVN A;  2VZZ A;  5F46 A;  3JUW A;  2ZXV A;  6CPA A;  1UFH A;  1VIX A;  2BOA A;  3IWW A;  4MRI A;  2IJZ A;  1ARM A;  3D68 A;  3PBE A;  4KS9 A;  3SHP A;  3S9L A;  1M4D A;  2EK8 A;  3HUV A;  2GFQ A;  1PCA A;  1YME A;  4UCM A;  2FS5 A;  1I1D A;  3B8G A;  4ZY1 A;  4X3R A;  3R95 A;  4Q38 A;  4JD6 A;  4ZY2 A;  8CPA A;  1XOV A;  3JTK A;  2YNC C;  2Z11 A;  3VAT A;  2PSW A;  1KUX A;  1Z8L A;  4B5P B;  4R76 A;  4UBR A;  5EMI A;  4JLY A;  4OC0 A;  2ZOF A;  4YFJ A;  2BL1 A;  2C6G A;  2J8M A;  2ABZ A;  4OC5 A;  2PJ9 A;  2PRB A;  3FEE A;  2QEC A;  2R7H A;  4X5K A;  1ZG8 A;  4EME A;  5G1Z A;  3IWE A;  2WPW A;  2AFM A;  3I1U A;  3RO0 A;  5K8P A;  2HV2 A;  4MFQ A;  3G8W A;  4Y49 B;  4BD9 A;  4JXQ A;  4KOS A;  4NCZ A;  4KVX A;  1IYL A;  4NEX A;  3R9G A;  4A38 A;  1KUY A;  2C27 A;  4QBJ A;  2FCK A;  1KUV A;  2PCU A;  2QYV A;  3DLJ A;  4F0X A;  5K8O A;  3H8E A;  4KLV A;  4UFX A;  2EK9 A;  4MY3 A;  3PRT A;  3RBU A;  3T9Y A;  3MN8 A;  4NXY A;  4MJ8 A;  1NMT A;  3NE7 A;  4R57 A;  2ZEO A;  4KUA A;  2FT0 A;  1YGH A;  2R1I A;  1S7F A;  3PB6 X;  4HNX B;  1EE3 P;  2AFX A;  1MJ9 A;  2H5M A;  1ELM P;  4PQA A;  3RZA A;  2Q4V A;  4P4D A;  3FVL A;  4P4I A;  3KHX A;  3FF3 A;  4CAW A;  3S6G A;  3R1K A;  4CGL A;  3EO4 A;  5AG5 A;  4UEZ A;  2G0B A;  4GXH A;  4M3S A;  3NA6 A;  3TO7 A;  2G3T A;  2Z3L A;  2AJ6 A;  3JRU A;  4KVO E;  4KSA A;  2Q7B A;  4KOW A;  2FSR A;  4UCP A;  2ZEM A;  4NJQ A;  1WK4 A;  2C6P A;  1GYT A;  3D3S A;  2RB7 A;  4KOV A;  2Q4Y A;  2JEV A;  4MHD A;  3VH9 A;  4HKF A;  4NGM A;  3R96 A;  3SJG A;  1PU9 A;  5AG7 A; 
#chains in the Genus database with same CATH homology
 1YW4 A;  1LOK A;  3D67 A;  4F9U A;  4X8I A;  3KQX A;  1CPX A;  5ELY A;  4NFR A;  1YSJ A;  2ZOG A;  4OC1 A;  4OC4 A;  3FED A;  4P4J A;  2V8H A;  4OC3 A;  3BI0 A;  3IIB A;  2PJC A;  5LYI A;  4YU9 A;  2PIZ A;  1NSA A;  1CX8 A;  2PJ5 A;  1XFO A;  3D66 A;  4R7M A;  1TKF A;  4B6Z A;  1YW6 A;  3QNV A;  1BAV A;  4MMO A;  2GLJ A;  5K8N A;  4ZI6 A;  2Q4Z A;  3IC1 A;  3IFE A;  2O4H A;  2JBJ A;  3SI0 A;  4MCP A;  1KWM A;  4IAV A;  3SJX A;  2ZED A;  3GUX A;  2GLF A;  3BI1 A;  1TF9 A;  4FUU A;  2PIY A;  1CG2 A;  5I4M A;  2PJ2 A;  3ISX A;  4JYW A;  2AFU A;  2AFZ A;  2IQ6 A;  3GLJ A;  3LMS A;  2POK A;  2EWB A;  1F57 A;  4OKO A;  4TNU A;  1UWY A;  2JEW A;  2PJ6 A;  1XBU A;  2XEI A;  4IK2 A;  4K3N A;  4F8Z A;  2WZN A;  3TX8 A;  2CF4 A;  2PJ3 A;  1OBR A;  2Q51 A;  3D7H A;  3KR5 A;  3CT9 A;  4OC2 A;  2AFS A;  5LYF A;  5HVF A;  3CPX A;  3KZW A;  1XMB A;  3V38 A;  4NGN A;  4MHP A;  4P4E A;  1R43 A;  1IGB A;  3B35 A;  2ZEE A;  2G9D A;  1XJO A;  2FVG A;  1H8L A;  1ZG7 A;  3IJ3 A;  3KHZ A;  2C1C A;  4UIB A;  2CTB A;  4MXU A;  3PFE A;  2J9A A;  5K8M A;  4AXV A;  3D7D A;  1AYE A;  4P44 A;  2V8V A;  4O23 A;  2WYR A;  3KL9 A;  3B3T A;  2XEG A;  2HC9 A;  2XEJ A;  4NGR A;  4NGS A;  1F2P A;  1TF8 A;  4X2T A;  1F2O A;  4R6T A;  4JZ0 A;  3D7G A;  4NGT A;  3H8G A;  4KSI A;  4PXC A;  1TKH A;  4LQG A;  4UEF A;  3KR4 A;  3PB8 X;  3KAS A;  4R8F A;  2V77 A;  2ZEP A;  5HVH A;  2V8D A;  1DE4 C;  2OOT A;  3H8F A;  4YWY A;  4FAI A;  1QQ9 A;  2NSM A;  5D8N A;  3B3V A;  4RUH A;  2PJ8 A;  1ARL A;  1Q7L A;  3GB0 A;  4A39 A;  1BPM A;  3NH8 A;  1PYT B;  4UF4 A;  3PB4 X;  3KGQ A;  4Q7A A;  4H2K A;  3B3C A;  4ONW A;  1TXR A;  1FT7 A;  2BCO A;  3WC7 A;  3NFZ A;  2DEA A;  3SJF A;  2Q43 A;  4DJL A;  3T8W A;  1HDU A;  2ANP A;  1CP7 A;  2F8H A;  4NJR A;  1LAM A;  2O53 A;  5F09 A;  1XRY A;  3FX6 A;  1ELL P;  4P10 A;  3FH4 A;  1BLL E;  3CPA A;  3B7I A;  2HB6 A;  3V7Z A;  1AMP A;  4MCR A;  1DTD A;  1M4L A;  3N5F A;  2ZEF A;  3ISZ A;  1HEE A;  3KI9 A;  4MHZ A;  3VAR A;  4EWT A;  3PB9 X;  2F7V A;  4DUK A;  4OP4 A;  1Y7E A;  2PJ1 A;  4WWV A;  3WC5 A;  4MCQ A;  4MCS A;  2PJA A;  3FEC A;  5HXD A;  2PJ7 A;  5CPA A;  2BO9 A;  2V8G A;  3D7F A;  5JH9 A;  1Z2L A;  2VL1 A;  2PJ0 A;  4ZX9 A;  5D29 A;  4OME A;  4EFD A;  4CPA A;  1ZLH A;  2PRQ A;  3DGV A;  4PXD A;  1Y0R A;  2XEF A;  5LYL A;  2PJ4 A;  2QVP A;  4WJB A;  3IEH A;  3WT4 A;  3MRU A;  1LAN A;  3BXM A;  3SI2 A;  2C6C A;  4ZX8 A;  1LCP A;  2IMO A;  2ZEL A;  5THW A;  2CTC A;  2PE3 A;  1BPN A;  3SI1 A;  1ZLI A;  5IB9 A;  3K9T A;  5DS0 A;  3PBB A;  5LRK A;  3IO1 A;  4PXB A;  4TWE A;  4W9Y A;  3LWU A;  3RAM A;  5J1Q A;  1ZG9 A;  1QMU A;  2I3C A;  4G1P A;  4MHN A;  3B2Y A;  2GU2 A;  3D4U A;  3B3S A;  4P45 A;  3CDX A;  1CP6 A;  3FJU A;  5LYD A;  1VHE A;  4P4F A;  1Y0Y A;  1FNO A;  2GRE A;  3KQZ A;  4NGP A;  5HVG A;  4NGQ A;  4P4B A;  2ZEN A;  4GM5 A;  3PEI A;  2PVV A;  3WC6 A;  4FWU A;  4ZY0 A;  3B3W A;  1LFW A;  1R3N A;  1IY7 A;  5JM6 A;  3TC8 A;  1LAP A;  5CBM A;  2QJ8 A;  1TKJ A;  1YLO A;  4FBE A;  4PXE A;  3L2N A;  4Z65 A;  4UIA A;  2CIJ A;  5LRJ A;  4OIW A;  4MHY A;  4DYO A;  2NYQ A;  3NH5 A;  2PJB A;  2ZEG A;  2AFW A;  5LRG A;  2ZEH A;  2RFH A;  1CPS A;  3PFO A;  2JBK A;  7CPA A;  1HDQ A;  4A94 A;  3NH4 A;  3S9M A;  1VGY A;  4UEE A;  1RTQ A;  2OR4 A;  3BHX A;  4PPZ A;  1CBX A;  4OID A;  4A37 A;  3K2K A;  4P6Y A;  4IHM A;  4F9V A;  3HLP A;  1VHO A;  2AFO A;  3PB7 X;  3SJE A;  4ZYQ A;  3WAB A;  1JQG A;  5JGF A;  3S9N A;  3FMC A;  2PVW A;  1Z5R A;  6CPA A;  1VIX A;  3IWW A;  2BOA A;  4MRI A;  2IJZ A;  1ARM A;  3D68 A;  3PBE A;  3S9L A;  2EK8 A;  3HUV A;  1PCA A;  1YME A;  4ZY1 A;  4X3R A;  4ZY2 A;  8CPA A;  3VAT A;  1Z8L A;  4R76 A;  4OC0 A;  2ZOF A;  2C6G A;  4OC5 A;  2ABZ A;  2PJ9 A;  3FEE A;  1ZG8 A;  4EME A;  2AFM A;  3I1U A;  5K8P A;  4BD9 A;  4A38 A;  2PCU A;  2QYV A;  3DLJ A;  5K8O A;  3H8E A;  2EK9 A;  3PRT A;  3RBU A;  3MN8 A;  2ZEO A;  3PB6 X;  1EE3 P;  2AFX A;  4PQA A;  1ELM P;  3RZA A;  4P4D A;  3FVL A;  4P4I A;  3KHX A;  3FF3 A;  4UEZ A;  3NA6 A;  3JRU A;  2ZEM A;  4NJQ A;  2C6P A;  1GYT A;  2RB7 A;  3VH9 A;  4NGM A;  3SJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...