3KHZA

Crystal structure of r350a mutant of staphylococcus aureus metallopeptidase (sapep/dape) in the apo-form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
468
structure length
433
Chain Sequence
b'SMWKEKVQQYEDQIINDLKGLLAIESVRDDAKASEDAPVGPGPRKALDYMYEIAHRDGFTTHDVDHIAGRIEAGKGNDVLGILCHVDVVPAGDGWDSNPFEPVVTEDAIIARGTLDDKGPTIAAYYAIKILEDMNVDWKKRIHMIIGTDEESDWKCTDRYFKTEEMPTLGFAPDAEFPCIHGEKGITTFDLVQNKLTEDQDEPDYELITFKSGERYNMVPDHAEARVLVKENMTDVIQDFEYFLEQNHLQGDSTVDSGILVLTVEGKAVHGMDPSIGVNAGLYLLKFLASLNLDNNAQAFVAFSNRYLFNSDFGEKMGMKFHTDVMGDVTTNIGVITYDNENAGLFGINLAYPEGFEFEKAMDRFANEIQQYGFEVKLGKVQPPHYVDKNDPFVQKLVTAYRNQTHQKNEYITKKQLFNATSIYLEAIYSLCV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dipeptidase SACOL1801
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Crystal structure of Staphylococcus aureus metallopeptidase (Sapep) reveals large domain motions between the manganese-bound and apo-states
pubmed doi rcsb
total genus 130
structure length 433
sequence length 468
chains with identical sequence B
ec nomenclature ec 3.4.13.-:
pdb deposition date 2009-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3khzA01
3HUVA 3KQXA 2PCUA 2O4HA 2EK9A 4NFRA 3WC5A 4F9VA 4NGNA 4OKOA 3NFZA 2PJ3A 4NGTA 3FX6A 2PVVA 2RFHA 1H8LA 1TKJA 4OC5A 4LQGA 1TF9A 3SJGA 3KHXA 3K2KA 3KASA 1YW4A 3K9TA 4MHPA 4NGMA 2CIJA 4MXUA 3TC8A 2WYRA 2V77A 3L2NA 3IIBA 1ZG8A 4G1PA 2C6PA 4KSIA 2ZEMA 4OIWA 4OC3A 4DYOA 1BAVA 2ABZA 3V7ZA 1LFWA 4P6YA 3LMSA 3WC6A 3S9MA 4NGPA 5HXDA 3GB0A 1XBUA 1HEEA 1F2OA 4A94A 1VHEA 4IAVA 2NSMA 5LYLA 4P4EA 4UIAA 1ARMA 4PXEA 5K8NA 8CPAA 1DTDA 3B3CA 1NSAA 2ZEHA 3KGQA 4RUHA 4MHYA 2GU2A 2VL1A 2DEAA 4P4BA 4PXCA 1XFOA 3VH9A 2IQ6A 2IJZA 3KR4A 4UIBA 1AYEA 1PCAA 1CPXA 4UF4A 5HVFA 2JBKA 4MHZA 4NGRA 2CTBA 1GYTA 3FVLA 3GLJA 3DGVA 2QYVA 4P45A 4PQAA 4JZ0A 2O53A 4ONWA 2ANPA 4YU9A 3VARA 1UWYA 1LCPA 3NH5A 1ZLHA 2QVPA 3FEEA 3BI0A 1XJOA 1R43A 4FUUA 4X8IA 1F57A 4P44A 4F9UA 3D7DA 3KI9A 4P4JA 3VATA 2ZEFA 2PJ6A 4MRIA 2Q51A 1ELMP 4UEZA 3S9LA 3B35A 4OC2A 3CT9A 2PJ9A 4P4IA 1LOKA 1M4LA 1IGBA 1RTQA 1DE4C 2QJ8A 2PE3A 4NJQA 1JQGA 2EWBA 3ISZA 3PB7X 4DUKA 5D29A 2AFMA 3ISXA 1HDQA 4AXVA 3WC7A 4EWTA 3JRUA 1ZLIA 3SJXA 2ZOFA 3KR5A 3T8WA 2HC9A 2J9AA 3FEDA 2F7VA 4PPZA 2PVWA 2F8HA 2IMOA 3IFEA 5LYIA 1YSJA 4O23A 3KL9A 3NH8A 1ARLA 4A37A 4Q7AA 2XEIA 1LAPA 1F2PA 3TX8A 2GREA 3FECA 1CP6A 3FMCA 3D67A 3D7GA 1TF8A 2PIYA 2PJ8A 2OOTA 4Z65A 3B3WA 2CF4A 3CDXA 4A39A 4ZY2A 3DLJA 5DS0A 4A38A 6CPAA 4FBEA 1BLLE 1CBXA 4MCQA 3RZAA 2PJAA 3SJEA 1PYTB 4MMOA 4OC1A 1Y0YA 4JYWA 1VIXA 3KHZA 5D8NA 2I3CA 3BHXA 2ZOGA 3PBBA 3PFEA 2PJ4A 3D68A 5HVHA 4ZYQA 2BOAA 2PIZA 2XEGA 3FF3A 3IWWA 1Z2LA 3CPAA 3WABA 3GUXA 3IO1A 3CPXA 3HLPA 3PEIA 4GM5A 4K3NA 5K8MA 4PXBA 4TNUA 1TXRA 2XEJA 4F8ZA 3MRUA 2Q43A 3IJ3A 1TKHA 2NYQA 2ZEOA 2ZEGA 5I4MA 2G9DA 5HVGA 7CPAA 4MCSA 4P4DA 4R7MA 5LYFA 2HB6A 4R6TA 4R76A 3MN8A 1XRYA 4UEFA 4UEEA 4P10A 3LWUA 5F09A 3KQZA 3FJUA 2AFUA 1YLOA 3PB8X 5JGFA 4MCRA 2PJ1A 2EK8A 3PB4X 2CTCA 4ZY0A 1VGYA 2AFOA 1OBRA 3FH4A 2C1CA 5LRJA 2WZNA 3D7HA 5CBMA 1Y0RA 4W9YA 2BO9A 1CX8A 3IC1A 3KZWA 2OR4A 2V8HA 1Z8LA 1EE3P 2GLJA 1R3NA 3D7FA 2PRQA 4B6ZA 4R8FA 2AFZA 3SI1A 4ZY1A 1HDUA 2RB7A 3D66A 1XMBA 1BPNA 5THWA 3V38A 2PJ5A 1TKFA 4FAIA 2AFWA 3PB6X 4ZX8A 4OC4A 3S9NA 4TWEA 4X3RA 4DJLA 3SJFA 4CPAA 2XEFA 4FWUA 4MHNA 3PB9X 5J1QA 5LRGA 3IEHA 3B3SA 4YWYA 4OC0A 1QMUA 1Z5RA 4EMEA 2AFSA 3BXMA 5K8PA 2ZEDA 2ZEEA 3NA6A 4IHMA 5JM6A 1VHOA 1AMPA 5JH9A 1CP7A 2PJCA 3B7IA 1Y7EA 4EFDA 1FT7A 1ELLP 3I1UA 3B2YA 3N5FA 2JBJA 3H8GA 5IB9A 1BPMA 3H8EA 2Q4ZA 4OP4A 1ZG9A 5ELYA 2PJBA 1IY7A 1LANA 4X2TA 2V8GA 4WWVA 4IK2A 4H2KA 4OMEA 4NJRA 3B3VA 4MCPA 2V8VA 2ZEPA 2BCOA 2ZELA 3PRTA 2GLFA 2C6CA 4WJBA 4NGSA 2JEWA 3D4UA 3PBEA 1CG2A 1FNOA 3SI0A 4NGQA 2PJ2A 2PJ7A 1Q7LA 2PJ0A 2C6GA 1YW6A 3H8FA 3WT4A 2FVGA 4P4FA 3BI1A 3NH4A 3RBUA 5CPAA 1YMEA 5LRKA 4ZX9A 2POKA 3SI2A 5LYDA 4BD9A 2V8DA 2AFXA 3PFOA 3RAMA 2ZENA 1QQ9A 4ZI6A 3QNVA 1ZG7A 1CPSA 5K8OA 4OIDA 1LAMA 4PXDA 3B3TA 1KWMA
chains in the Genus database with same CATH superfamily
4Y49B 2I00A 2VQYA 3HUVA 3KQXA 4FD6A 2PCUA 2O4HA 2EK9A 4NFRA 3QAYA 3WC5A 4F9VA 4NGNA 4OKOA 5ISVA 4QVTA 4U9ZA 3NFZA 5EMIA 2PJ3A 4NGTA 2JDDA 3FX6A 3R9GA 4XNHB 1YK3A 4H6ZA 4QUSA 4KOVA 2PVVA 2RFHA 1H8LA 4C7IA 2CNMA 1TKJA 4OC5A 3T90A 3I9SA 4LQGA 5EBVA 1TF9A 3SJGA 2B3VA 5G1ZA 3KHXA 2R1IA 3K2KA 5F47A 3KASA 1YW4A 3CXPA 4B12A 4KVXA 2J8MA 3K9TA 4MHPA 4NGMA 2B4DB 3D2MA 5J8FA 4R87A 5KTCA 2CIJA 2P6GA 4MXUA 3TC8A 1MJAA 2WYRA 4B5PB 2FSRA 4OAEA 2V77A 4ZBGA 3L2NA 3IIBA 1ZG8A 4G1PA 2PDOA 2C6PA 2Q4VA 2R98A 5KTAA 4KSIA 5KTDA 2ZEMA 1YR0A 3S6FA 3R9FA 2CNTA 2ZPAA 4OIWA 2B5GA 4OC3A 3CXSA 4DYOA 1XE4A 3DR8A 5JQ4A 1Z9UA 1BAVA 2CY2A 3F5BA 2ABZA 2ATRA 3V7ZA 3S6HA 3TOAA 1LFWA 4P6YA 3LMSA 3WC6A 4CYNA 1VHSA 3R1KA 1S7LA 3S9MA 4FD5A 2DXQA 4NGPA 5HXDA 3GB0A 1XBUA 1HEEA 3FBUA 1F2OA 1I12A 4PSWA 4A94A 1VHEA 2Q44A 2ZW7A 2NSMA 4IAVA 3TTHA 5LYLA 4C2ZA 3K9UA 4P4EA 2VXKA 4UIAA 1ARMA 4PXEA 2DF5A 5K8NA 2BEIA 2I79A 1M44A 4NXYA 5F49A 4K30A 8CPAA 1DTDA 3W91A 4CAWA 3B3CA 3UY5A 1FY7A 1NSAA 2ZEHA 2OH1A 4QC6A 4GXHA 2WSAA 3KGQA 4LUAA 4MJ8A 4RI1A 4CGNA 4C7HA 4RUHA 4MHYA 4MFPA 4M3SA 2GU2A 3MGDA 2PSWA 2VL1A 4PK2A 4CRZB 4KS9A 4F0YA 2DEAA 4P4BA 4HNWB 2VZYA 2NMTA 4PXCA 4PSXA 2B4DA 1XFOA 3QAHA 3VH9A 1CJWA 2IQ6A 4E0AA 1XIXA 2B58A 2IJZA 3KR4A 4A31A 4UIBA 1AYEA 3IWEA 4M6IA 3TOBA 1PCAA 2Q04A 3KKWA 1CPXA 4UF4A 5HVFA 4KOUA 2JBKA 2REEA 3WR7A 4MHZA 4NGRA 2CTBA 1OZPA 1S5KA 3BJ8A 1X10A 1GYTA 3IU1A 3FVLA 2JEVA 3GLJA 3DGVA 2QYVA 4MFQA 4P45A 3SHPA 5AG4A 2KCWA 3NE7A 1QSRA 4JZ0A 4PQAA 2FE7A 2O53A 4F6AA 2ANPA 4ONWA 4YU9A 2FS5A 3D8PA 3VARA 2Z3OA 1UWYA 4PK3A 1LCPA 3NH5A 1ZLHA 2QVPA 4CGPA 2F5IA 3BI0A 2FIAA 1XJOA 3FEEA 5G20A 5C88A 2X7BA 1R43A 4FUUA 4CS0B 4X8IA 1F57A 4P44A 3R96A 4XNHC 4MBUA 3D7DA 4F9UA 4CYQA 3GIUA 2QIRA 2EBJA 3KI9A 1IOFA 4P4JA 4RS2A 3RYOA 2FL4A 3VATA 2ZEFA 2PJ6A 1Y9KA 4MRIA 1P0HA 2DPTA 2Q51A 1ELMP 4UEZA 3S9LA 2ZW6A 3B35A 4OC2A 4U9YA 1GHEA 3CT9A 1LAMA 2PJ9A 4P4IA 2YNDA 1LOKA 1YVKA 1M4LA 4A32A 1JWQA 1IGBA 1RTQA 1YGHA 2VZZA 1DE4C 5AG5A 2QJ8A 2PE3A 3DSBA 2JDCA 4JXQA 1S7FA 4NJQA 1JQGA 3P2FA 2EWBA 3ISZA 3PB7X 1CM0A 4M85A 4MI4A 4DUKA 1Z8WA 2AFMA 4KUAA 5D29A 2WPWA 4E2AA 4PV6A 4CYOA 3ISXA 4QBJA 1HDQA 4AXVA 3WC7A 4EWTA 4B5PA 3T9YA 3JRUA 4R9MA 1ZLIA 2VEZA 1K4JA 3SJXA 1A2ZA 3H5ZA 2ZOFA 4MFKA 1KUYA 1Q2DA 2G3TA 3KR5A 2EVNA 4UA3A 2HC9A 5GCNA 3T8WA 4AVAA 3VWEA 4FD7A 2J9AA 1Y9WA 3F8KA 1XOVA 4NSQA 4UBRA 1MK4A 4KZTA 3DR6A 3BLNA 3FRMA 4KSFA 1U6MA 3FEDA 2A4NA 2F7VA 1WK4A 4NEXA 2Z3KA 4PPZA 2PVWA 5C82A 2F8HA 2P6FA 2IMOA 4KVOE 1ON0A 3IFEA 5LYIA 1YSJA 4MHDA 4O23A 3W6XA 2HQYA 3KL9A 3NH8A 3PGPA 4UWIA 4X5KA 4A30A 1ARLA 4A37A 5IB0A 4Q7AA 1B6BA 2XEIA 3FNCA 2J8RA 2HV2A 4H89A 1LAPA 1F2PA 2Q7BA 3TX8A 2GREA 3RO0A 3FECA 1CP6A 4KOXA 3FMCA 3D67A 3D7GA 1TF8A 1N71A 2PIYA 4ORFA 2PJ8A 2OOTA 1KZFA 4B11A 4Z65A 4GS4A 5G21A 3B3WA 2CF4A 2OB0A 4Q38A 4I49A 5HMNA 3CDXA 1NSLA 4A39A 4R3LA 3D2PA 2P6EA 1PU9A 1TIQA 3DLJA 5DS0A 1KUVA 4OLLA 4ZY2A 3B8GA 4A38A 1IB1E 4FBEA 6CPAA 1BLLE 2Z3LA 1CBXA 4MCQA 2B4BA 4KVME 2PJAA 3RZAA 2FT0A 1PYTB 3I3GA 1Z8XA 4MMOA 3SJEA 4OC1A 1Y0YA 4MY3A 2B3UA 4JYWA 2Z3NA 1VIXA 4UFWA 3KHZA 2YGWA 5D8NA 1AUGA 2I3CA 2BSWA 3BHXA 5AG7A 2ZOGA 5DWMA 1IIDA 1QSMA 3PBBA 3PFEA 2PJ4A 4KOSA 3D68A 4UCNA 4A95A 4JXRA 3EC4A 1RXTA 2Q7SA 5HVHA 1J4JA 4QB9A 1RO5A 4AB7A 2IL4A 4ZYQA 2BOAA 1Q2YA 2PIZA 2XEGA 3QB8A 1QSNA 3FF3A 3IWWA 4MFJA 1XF8A 4HKFA 1Z2LA 2Q0YA 4JJXA 2QECA 3V8IA 3LACA 2ZXVA 4NF1A 3LODA 3CPAA 1S60A 2OZGA 3GUXA 3WABA 4CAFA 3IO1A 4L89A 2RC4A 3CPXA 4IUSA 3HLPA 3PEIA 4GM5A 5F46A 4LQ6A 2YNEA 1QSOA 4K3NA 2OZHA 4PXBA 3VWDA 5K8MA 1VKCA 3TO9A 2Q4YA 4TNUA 1TXRA 2XEJA 4F8ZA 3MRUA 3S6GA 2EO8A 2YNCA 2Q43A 3IJ3A 4C2XA 1TKHA 2NYQA 2ZEOA 3EFAA 2ZEGA 4A2ZA 2FCKA 5I4MA 4HNYB 2G9DA 1NMTA 3C26A 1LRZA 2PR8A 5HVGA 7CPAA 3NE8A 2GANA 2P0WA 4CGLA 4U5YA 2R7HA 1M4IA 1IYLA 3FIXA 1B87A 4MCSA 3A9LA 4P4DA 4R7MA 5AGEA 5H84A 5LYFA 2HB6A 2BL1A 4R6TA 1XEBA 3F0AA 4HPSA 3MN8A 4R76A 2ZW5A 2AE6A 1YVOA 1XRYA 4L8AA 4UEFA 1BOBA 3E0KA 4Q36A 4UEEA 3FYNA 1YREA 1YX0A 4P10A 4B5OA 3LWUA 1ZO0A 5IV0A 1PUAA 2D4OA 3KQZA 1XMTA 1Z8TA 5F09A 2O28A 4KORA 1V0CA 3CZXA 3FJUA 2OZUA 2AFUA 1YLOA 3PB8X 4M6HA 5JGFA 1Q2CA 4HNXB 1WWZA 4MCRA 3PP9A 2PJ1A 2EK8A 3PB4X 3TT2A 2CTCA 4YFJA 2Z3PA 1VGYA 4ZY0A 1SQHA 4XPKA 2AFOA 1OBRA 3FH4A 4RN7A 2C1CA 4KUBA 4MFZA 1YLEA 5LRJA 2WZNA 3D7HA 2HUZA 5BWAB 5I0CA 5CBMA 1Y0RA 1Z4EA 2VBQA 4W9YA 3N7ZA 2Z3MA 2BO9A 1CX8A 4J3GA 3IC1A 3KZWA 4A33A 1IYKA 2OR4A 2VI7A 2V8HA 1Z8LA 1EE3P 2GLJA 1R3NA 2C27A 3D7FA 1NE9A 5DWNA 2PRQA 4B6ZA 1M1DA 2AJ6A 3LD2A 4R8FA 4OADA 2AFZA 4UWJA 4CAXA 5J8CA 3SI1A 4ZY1A 1HDUA 2RB7A 4M6GA 4FD4A 2DPSA 3D66A 3DDDA 1XMBA 3ZZIA 1BPNA 5EC4A 5THWA 2ODFA 3V38A 3TFYA 4UCMA 4ZGYB 2K5TA 2PJ5A 3TE4A 2Z11A 1TKFA 4AVBA 4FAIA 2AFWA 4B13A 3PB6X 4ZX8A 4OC4A 1QSTA 4UCPA 4TWEA 4XPDB 4X3RA 4DJLA 2QMLA 3DNSA 3P2HA 3SJFA 4CPAA 2PR1A 4Y49C 3W6SA 2XEFA 1S7KA 4E8OA 2REFA 2WUUA 4FWUA 4JWPA 2WPXA 4MHNA 3PB9X 2PC1A 5J1QA 4CGMA 1UFHA 5LRGA 3IEHA 1BO4A 4YWYA 2JLMA 3JUWA 4OC0A 1QMUA 4KLVA 4AG9A 1M4GA 5AG6A 1Z5RA 2FIWA 4EMEA 2AFSA 5E96A 2YNCC 3BXMA 3H4QA 3S6KA 5IX3A 4YRHA 1L0CA 1S3ZA 2GFQA 5K8PA 3G8WA 2ZEDA 4BMHA 5A27A 2ZEEA 4H6UA 3NA6A 4IHMA 4KSAA 1VHOA 5JM6A 1AMPA 3EO4A 5JH9A 1CP7A 5F48A 1I1DA 2PJCA 3B7IA 4XPLA 4CRYB 1Y7EA 4EFDA 1FT7A 3S9NA 1ELLP 3I1UA 3TO7A 2Y0MA 2R8VA 3B2YA 3N5FA 2GIVA 2JBJA 4DNCA 5FVJA 3H8GA 2CNSA 3G3SA 3IU2A 2Z10A 1BPMA 2H5MA 3H8EA 4JD6A 5IB9A 2Q4ZA 4OP4A 1ZG9A 3GYAA 4KLWA 3FB3A 3IWGA 2Z0ZA 4LX9A 5ELYA 3CXQA 2PRBA 3BJ7A 2PJBA 1YQEA 2OU2A 4AG7A 3R95A 1X12A 3SXNA 1IY7A 4CAEA 1LANA 2B5GB 4X2TA 4KOYA 1IOIA 1I21A 4CYPA 2V8GA 4WWVA 4IK2A 4XPDC 4PXDA 4H2KA 3EY5A 5HH1A 1Y7RA 4UFVA 1M4DA 5A28A 3SXOA 4R57A 3PZJA 4OMEA 4NJRA 3D3SA 4CAVA 4C68A 3B3VA 4MCPA 5CNPA 2V8VA 2ZEPA 2BCOA 2ZELA 4MFLA 4BBHA 3PRTA 1MJBA 3JTKA 1KUXA 4UFXA 2GLFA 3JVNA 3TO6A 2FXFA 2BUEA 4R3KA 1P4NA 2C6CA 2G3AA 4B14A 3IGRA 2ARHA 4WJBA 1R57A 2PQ8A 4YGOA 3GKRA 4NGSA 4KOTA 2JEWA 3D4UA 3PBEA 3R9EA 1CG2A 1FNOA 2J8NA 3RNZA 2G0BA 3SI0A 1MJ9A 4NGQA 3B3TA 2PJ2A 2EUIA 2PJ7A 2PJ0A 1Q7LA 2GE3A 2C6GA 1YW6A 3H8FA 3GY9A 4B10A 3WT4A 5JPHA 1IICA 2FVGA 4CGOA 2ZW4A 4P4FA 3BI1A 4JLYA 3NH4A 3RBUA 5CPAA 1YMEA 5LRKA 4ZX9A 2POKA 3SI2A 5LYDA 4F0XA 4BD9A 4IF5A 4MY0A 3TCVA 4KOWA 2V8DA 2AFXA 5H86A 3EXNA 3PFOA 1S7NA 2D4PA 4ONUA 3RAMA 2ZENA 4BINA 4II9A 1QQ9A 4NCZA 4ZI6A 3OWCA 2CXAA 3QNVA 1ZG7A 5G22A 1CPSA 3FXTA 4C2YA 3ZJ0A 5K8OA 4AVCA 4EVYA 4OIDA 1IU8A 3B3SA 1Z4RA 1KWMA
chains in the Genus database with same CATH topology
3HUVA 3KQXA 2PCUA 2O4HA 2EK9A 4NFRA 3WC5A 4F9VA 4NGNA 4OKOA 3NFZA 2PJ3A 4NGTA 3FX6A 2PVVA 2RFHA 1H8LA 1TKJA 4OC5A 4LQGA 1TF9A 3SJGA 3KHXA 3K2KA 3KASA 1YW4A 3K9TA 4MHPA 4NGMA 2CIJA 4MXUA 3TC8A 2WYRA 2V77A 3L2NA 3IIBA 1ZG8A 4G1PA 2C6PA 4KSIA 2ZEMA 4OIWA 4OC3A 4DYOA 1BAVA 2ABZA 3V7ZA 1LFWA 4P6YA 3LMSA 3WC6A 3S9MA 4NGPA 5HXDA 3GB0A 1XBUA 1HEEA 1F2OA 4A94A 1VHEA 4IAVA 2NSMA 5LYLA 4P4EA 4UIAA 1ARMA 4PXEA 5K8NA 8CPAA 1DTDA 3B3CA 1NSAA 2ZEHA 3KGQA 4RUHA 4MHYA 2GU2A 2VL1A 2DEAA 4P4BA 4PXCA 1XFOA 3VH9A 2IQ6A 2IJZA 3KR4A 4UIBA 1AYEA 1PCAA 1CPXA 4UF4A 5HVFA 2JBKA 4MHZA 4NGRA 2CTBA 1GYTA 3FVLA 3GLJA 3DGVA 2QYVA 4P45A 4PQAA 4JZ0A 2O53A 4ONWA 2ANPA 4YU9A 3VARA 1UWYA 1LCPA 3NH5A 1ZLHA 2QVPA 3FEEA 3BI0A 1XJOA 1R43A 4FUUA 4X8IA 1F57A 4P44A 4F9UA 3D7DA 3KI9A 4P4JA 3VATA 2ZEFA 2PJ6A 4MRIA 2Q51A 1ELMP 4UEZA 3S9LA 3B35A 4OC2A 3CT9A 2PJ9A 4P4IA 1LOKA 1M4LA 1IGBA 1RTQA 1DE4C 2QJ8A 2PE3A 4NJQA 1JQGA 2EWBA 3ISZA 3PB7X 4DUKA 5D29A 2AFMA 3ISXA 1HDQA 4AXVA 3WC7A 4EWTA 3JRUA 1ZLIA 3SJXA 2ZOFA 3KR5A 3T8WA 2HC9A 2J9AA 3FEDA 2F7VA 4PPZA 2PVWA 2F8HA 2IMOA 3IFEA 5LYIA 1YSJA 4O23A 3KL9A 3NH8A 1ARLA 4A37A 4Q7AA 2XEIA 1LAPA 1F2PA 3TX8A 2GREA 3FECA 1CP6A 3FMCA 3D67A 3D7GA 1TF8A 2PIYA 2PJ8A 2OOTA 4Z65A 3B3WA 2CF4A 3CDXA 4A39A 4ZY2A 3DLJA 5DS0A 4A38A 6CPAA 4FBEA 1BLLE 1CBXA 4MCQA 3RZAA 2PJAA 3SJEA 1PYTB 4MMOA 4OC1A 1Y0YA 4JYWA 1VIXA 3KHZA 5D8NA 2I3CA 3BHXA 2ZOGA 3PBBA 3PFEA 2PJ4A 3D68A 5HVHA 4ZYQA 2BOAA 2PIZA 2XEGA 3FF3A 3IWWA 1Z2LA 3CPAA 3WABA 3GUXA 3IO1A 3CPXA 3HLPA 3PEIA 4GM5A 4K3NA 5K8MA 4PXBA 4TNUA 1TXRA 2XEJA 4F8ZA 3MRUA 2Q43A 3IJ3A 1TKHA 2NYQA 2ZEOA 2ZEGA 5I4MA 2G9DA 5HVGA 7CPAA 4MCSA 4P4DA 4R7MA 5LYFA 2HB6A 4R6TA 4R76A 3MN8A 1XRYA 4UEFA 4UEEA 4P10A 3LWUA 5F09A 3KQZA 3FJUA 2AFUA 1YLOA 3PB8X 5JGFA 4MCRA 2PJ1A 2EK8A 3PB4X 2CTCA 4ZY0A 1VGYA 2AFOA 1OBRA 3FH4A 2C1CA 5LRJA 2WZNA 3D7HA 5CBMA 1Y0RA 4W9YA 2BO9A 1CX8A 3IC1A 3KZWA 2OR4A 2V8HA 1Z8LA 1EE3P 2GLJA 1R3NA 3D7FA 2PRQA 4B6ZA 4R8FA 2AFZA 3SI1A 4ZY1A 1HDUA 2RB7A 3D66A 1XMBA 1BPNA 5THWA 3V38A 2PJ5A 1TKFA 4FAIA 2AFWA 3PB6X 4ZX8A 4OC4A 3S9NA 4TWEA 4X3RA 4DJLA 3SJFA 4CPAA 2XEFA 4FWUA 4MHNA 3PB9X 5J1QA 5LRGA 3IEHA 3B3SA 4YWYA 4OC0A 1QMUA 1Z5RA 4EMEA 2AFSA 3BXMA 5K8PA 2ZEDA 2ZEEA 3NA6A 4IHMA 5JM6A 1VHOA 1AMPA 5JH9A 1CP7A 2PJCA 3B7IA 1Y7EA 4EFDA 1FT7A 1ELLP 3I1UA 3B2YA 3N5FA 2JBJA 3H8GA 5IB9A 1BPMA 3H8EA 2Q4ZA 4OP4A 1ZG9A 5ELYA 2PJBA 1IY7A 1LANA 4X2TA 2V8GA 4WWVA 4IK2A 4H2KA 4OMEA 4NJRA 3B3VA 4MCPA 2V8VA 2ZEPA 2BCOA 2ZELA 3PRTA 2GLFA 2C6CA 4WJBA 4NGSA 2JEWA 3D4UA 3PBEA 1CG2A 1FNOA 3SI0A 4NGQA 2PJ2A 2PJ7A 1Q7LA 2PJ0A 2C6GA 1YW6A 3H8FA 3WT4A 2FVGA 4P4FA 3BI1A 3NH4A 3RBUA 5CPAA 1YMEA 5LRKA 4ZX9A 2POKA 3SI2A 5LYDA 4BD9A 2V8DA 2AFXA 3PFOA 3RAMA 2ZENA 1QQ9A 4ZI6A 3QNVA 1ZG7A 1CPSA 5K8OA 4OIDA 1LAMA 4PXDA 3B3TA 1KWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUV A;  3KQX A;  2PCU A;  2O4H A;  2EK9 A;  4NFR A;  3WC5 A;  4F9V A;  4NGN A;  4OKO A;  3NFZ A;  2PJ3 A;  4NGT A;  3FX6 A;  2PVV A;  2RFH A;  1H8L A;  1TKJ A;  4OC5 A;  4LQG A;  1TF9 A;  3SJG A;  3KHX A;  3K2K A;  3KAS A;  1YW4 A;  3K9T A;  4MHP A;  4NGM A;  2CIJ A;  4MXU A;  3TC8 A;  2WYR A;  2V77 A;  3L2N A;  3IIB A;  1ZG8 A;  4G1P A;  2C6P A;  4KSI A;  2ZEM A;  4OIW A;  4OC3 A;  4DYO A;  1BAV A;  2ABZ A;  3V7Z A;  1LFW A;  4P6Y A;  3LMS A;  3WC6 A;  3S9M A;  4NGP A;  5HXD A;  3GB0 A;  1XBU A;  1HEE A;  1F2O A;  4A94 A;  1VHE A;  4IAV A;  2NSM A;  5LYL A;  4P4E A;  4UIA A;  1ARM A;  4PXE A;  5K8N A;  8CPA A;  1DTD A;  3B3C A;  1NSA A;  2ZEH A;  3KGQ A;  4RUH A;  4MHY A;  2GU2 A;  2VL1 A;  2DEA A;  4P4B A;  4PXC A;  1XFO A;  3VH9 A;  2IQ6 A;  2IJZ A;  3KR4 A;  4UIB A;  1AYE A;  1PCA A;  1CPX A;  4UF4 A;  5HVF A;  2JBK A;  4MHZ A;  4NGR A;  2CTB A;  1GYT A;  3FVL A;  3GLJ A;  3DGV A;  2QYV A;  4P45 A;  4PQA A;  4JZ0 A;  2O53 A;  4ONW A;  2ANP A;  4YU9 A;  3VAR A;  1UWY A;  1LCP A;  3NH5 A;  1ZLH A;  2QVP A;  3FEE A;  3BI0 A;  1XJO A;  1R43 A;  4FUU A;  4X8I A;  1F57 A;  4P44 A;  4F9U A;  3D7D A;  3KI9 A;  4P4J A;  3VAT A;  2ZEF A;  2PJ6 A;  4MRI A;  2Q51 A;  1ELM P;  4UEZ A;  3S9L A;  3B35 A;  4OC2 A;  3CT9 A;  2PJ9 A;  4P4I A;  1LOK A;  1M4L A;  1IGB A;  1RTQ A;  1DE4 C;  2QJ8 A;  2PE3 A;  4NJQ A;  1JQG A;  2EWB A;  3ISZ A;  3PB7 X;  4DUK A;  5D29 A;  2AFM A;  3ISX A;  1HDQ A;  4AXV A;  3WC7 A;  4EWT A;  3JRU A;  1ZLI A;  3SJX A;  2ZOF A;  3KR5 A;  3T8W A;  2HC9 A;  2J9A A;  3FED A;  2F7V A;  4PPZ A;  2PVW A;  2F8H A;  2IMO A;  3IFE A;  5LYI A;  1YSJ A;  4O23 A;  3KL9 A;  3NH8 A;  1ARL A;  4A37 A;  4Q7A A;  2XEI A;  1LAP A;  1F2P A;  3TX8 A;  2GRE A;  3FEC A;  1CP6 A;  3FMC A;  3D67 A;  3D7G A;  1TF8 A;  2PIY A;  2PJ8 A;  2OOT A;  4Z65 A;  3B3W A;  2CF4 A;  3CDX A;  4A39 A;  4ZY2 A;  3DLJ A;  5DS0 A;  4A38 A;  6CPA A;  4FBE A;  1BLL E;  1CBX A;  4MCQ A;  3RZA A;  2PJA A;  3SJE A;  1PYT B;  4MMO A;  4OC1 A;  1Y0Y A;  4JYW A;  1VIX A;  3KHZ A;  5D8N A;  2I3C A;  3BHX A;  2ZOG A;  3PBB A;  3PFE A;  2PJ4 A;  3D68 A;  5HVH A;  4ZYQ A;  2BOA A;  2PIZ A;  2XEG A;  3FF3 A;  3IWW A;  1Z2L A;  3CPA A;  3WAB A;  3GUX A;  3IO1 A;  3CPX A;  3HLP A;  3PEI A;  4GM5 A;  4K3N A;  5K8M A;  4PXB A;  4TNU A;  1TXR A;  2XEJ A;  4F8Z A;  3MRU A;  2Q43 A;  3IJ3 A;  1TKH A;  2NYQ A;  2ZEO A;  2ZEG A;  5I4M A;  2G9D A;  5HVG A;  7CPA A;  4MCS A;  4P4D A;  4R7M A;  5LYF A;  2HB6 A;  4R6T A;  4R76 A;  3MN8 A;  1XRY A;  4UEF A;  4UEE A;  4P10 A;  3LWU A;  5F09 A;  3KQZ A;  3FJU A;  2AFU A;  1YLO A;  3PB8 X;  5JGF A;  4MCR A;  2PJ1 A;  2EK8 A;  3PB4 X;  2CTC A;  4ZY0 A;  1VGY A;  2AFO A;  1OBR A;  3FH4 A;  2C1C A;  5LRJ A;  2WZN A;  3D7H A;  5CBM A;  1Y0R A;  4W9Y A;  2BO9 A;  1CX8 A;  3IC1 A;  3KZW A;  2OR4 A;  2V8H A;  1Z8L A;  1EE3 P;  2GLJ A;  1R3N A;  3D7F A;  2PRQ A;  4B6Z A;  4R8F A;  2AFZ A;  3SI1 A;  4ZY1 A;  1HDU A;  2RB7 A;  3D66 A;  1XMB A;  1BPN A;  5THW A;  3V38 A;  2PJ5 A;  1TKF A;  4FAI A;  2AFW A;  3PB6 X;  4ZX8 A;  4OC4 A;  3S9N A;  4TWE A;  4X3R A;  4DJL A;  3SJF A;  4CPA A;  2XEF A;  4FWU A;  4MHN A;  3PB9 X;  5J1Q A;  5LRG A;  3IEH A;  3B3S A;  4YWY A;  4OC0 A;  1QMU A;  1Z5R A;  4EME A;  2AFS A;  3BXM A;  5K8P A;  2ZED A;  2ZEE A;  3NA6 A;  4IHM A;  5JM6 A;  1VHO A;  1AMP A;  5JH9 A;  1CP7 A;  2PJC A;  3B7I A;  1Y7E A;  4EFD A;  1FT7 A;  1ELL P;  3I1U A;  3B2Y A;  3N5F A;  2JBJ A;  3H8G A;  5IB9 A;  1BPM A;  3H8E A;  2Q4Z A;  4OP4 A;  1ZG9 A;  5ELY A;  2PJB A;  1IY7 A;  1LAN A;  4X2T A;  2V8G A;  4WWV A;  4IK2 A;  4H2K A;  4OME A;  4NJR A;  3B3V A;  4MCP A;  2V8V A;  2ZEP A;  2BCO A;  2ZEL A;  3PRT A;  2GLF A;  2C6C A;  4WJB A;  4NGS A;  2JEW A;  3D4U A;  3PBE A;  1CG2 A;  1FNO A;  3SI0 A;  4NGQ A;  2PJ2 A;  2PJ7 A;  1Q7L A;  2PJ0 A;  2C6G A;  1YW6 A;  3H8F A;  3WT4 A;  2FVG A;  4P4F A;  3BI1 A;  3NH4 A;  3RBU A;  5CPA A;  1YME A;  5LRK A;  4ZX9 A;  2POK A;  3SI2 A;  5LYD A;  4BD9 A;  2V8D A;  2AFX A;  3PFO A;  3RAM A;  2ZEN A;  1QQ9 A;  4ZI6 A;  3QNV A;  1ZG7 A;  1CPS A;  5K8O A;  4OID A;  1LAM A;  4PXD A;  3B3T A;  1KWM A; 
#chains in the Genus database with same CATH topology
 4Y49 B;  2I00 A;  2VQY A;  3HUV A;  3KQX A;  4FD6 A;  2PCU A;  2O4H A;  2EK9 A;  4NFR A;  3QAY A;  3WC5 A;  4F9V A;  4NGN A;  4OKO A;  5ISV A;  4QVT A;  4U9Z A;  3NFZ A;  5EMI A;  2PJ3 A;  4NGT A;  2JDD A;  3FX6 A;  3R9G A;  4XNH B;  1YK3 A;  4H6Z A;  4QUS A;  4KOV A;  2PVV A;  2RFH A;  1H8L A;  4C7I A;  2CNM A;  1TKJ A;  4OC5 A;  3T90 A;  3I9S A;  4LQG A;  5EBV A;  1TF9 A;  3SJG A;  2B3V A;  5G1Z A;  3KHX A;  2R1I A;  3K2K A;  5F47 A;  3KAS A;  1YW4 A;  3CXP A;  4B12 A;  4KVX A;  2J8M A;  3K9T A;  4MHP A;  4NGM A;  2B4D B;  3D2M A;  5J8F A;  4R87 A;  5KTC A;  2CIJ A;  2P6G A;  4MXU A;  3TC8 A;  1MJA A;  2WYR A;  4B5P B;  2FSR A;  4OAE A;  2V77 A;  4ZBG A;  3L2N A;  3IIB A;  1ZG8 A;  4G1P A;  2PDO A;  2C6P A;  2Q4V A;  2R98 A;  5KTA A;  4KSI A;  5KTD A;  2ZEM A;  1YR0 A;  3S6F A;  3R9F A;  2CNT A;  2ZPA A;  4OIW A;  2B5G A;  4OC3 A;  3CXS A;  4DYO A;  1XE4 A;  3DR8 A;  5JQ4 A;  1Z9U A;  1BAV A;  2CY2 A;  3F5B A;  2ABZ A;  2ATR A;  3V7Z A;  3S6H A;  3TOA A;  1LFW A;  4P6Y A;  3LMS A;  3WC6 A;  4CYN A;  1VHS A;  3R1K A;  1S7L A;  3S9M A;  4FD5 A;  2DXQ A;  4NGP A;  5HXD A;  3GB0 A;  1XBU A;  1HEE A;  3FBU A;  1F2O A;  1I12 A;  4PSW A;  4A94 A;  1VHE A;  2Q44 A;  2ZW7 A;  2NSM A;  4IAV A;  3TTH A;  5LYL A;  4C2Z A;  3K9U A;  4P4E A;  2VXK A;  4UIA A;  1ARM A;  4PXE A;  2DF5 A;  5K8N A;  2BEI A;  2I79 A;  1M44 A;  4NXY A;  5F49 A;  4K30 A;  8CPA A;  1DTD A;  3W91 A;  4CAW A;  3B3C A;  3UY5 A;  1FY7 A;  1NSA A;  2ZEH A;  2OH1 A;  4QC6 A;  4GXH A;  2WSA A;  3KGQ A;  4LUA A;  4MJ8 A;  4RI1 A;  4CGN A;  4C7H A;  4RUH A;  4MHY A;  4MFP A;  4M3S A;  2GU2 A;  3MGD A;  2PSW A;  2VL1 A;  4PK2 A;  4CRZ B;  4KS9 A;  4F0Y A;  2DEA A;  4P4B A;  4HNW B;  2VZY A;  2NMT A;  4PXC A;  4PSX A;  2B4D A;  1XFO A;  3QAH A;  3VH9 A;  1CJW A;  2IQ6 A;  4E0A A;  1XIX A;  2B58 A;  2IJZ A;  3KR4 A;  4A31 A;  4UIB A;  1AYE A;  3IWE A;  4M6I A;  3TOB A;  1PCA A;  2Q04 A;  3KKW A;  1CPX A;  4UF4 A;  5HVF A;  4KOU A;  2JBK A;  2REE A;  3WR7 A;  4MHZ A;  4NGR A;  2CTB A;  1OZP A;  1S5K A;  3BJ8 A;  1X10 A;  1GYT A;  3IU1 A;  3FVL A;  2JEV A;  3GLJ A;  3DGV A;  2QYV A;  4MFQ A;  4P45 A;  3SHP A;  5AG4 A;  2KCW A;  3NE7 A;  1QSR A;  4JZ0 A;  4PQA A;  2FE7 A;  2O53 A;  4F6A A;  2ANP A;  4ONW A;  4YU9 A;  2FS5 A;  3D8P A;  3VAR A;  2Z3O A;  1UWY A;  4PK3 A;  1LCP A;  3NH5 A;  1ZLH A;  2QVP A;  4CGP A;  2F5I A;  3BI0 A;  2FIA A;  1XJO A;  3FEE A;  5G20 A;  5C88 A;  2X7B A;  1R43 A;  4FUU A;  4CS0 B;  4X8I A;  1F57 A;  4P44 A;  3R96 A;  4XNH C;  4MBU A;  3D7D A;  4F9U A;  4CYQ A;  3GIU A;  2QIR A;  2EBJ A;  3KI9 A;  1IOF A;  4P4J A;  4RS2 A;  3RYO A;  2FL4 A;  3VAT A;  2ZEF A;  2PJ6 A;  1Y9K A;  4MRI A;  1P0H A;  2DPT A;  2Q51 A;  1ELM P;  4UEZ A;  3S9L A;  2ZW6 A;  3B35 A;  4OC2 A;  4U9Y A;  1GHE A;  3CT9 A;  1LAM A;  2PJ9 A;  4P4I A;  2YND A;  1LOK A;  1YVK A;  1M4L A;  4A32 A;  1JWQ A;  1IGB A;  1RTQ A;  1YGH A;  2VZZ A;  1DE4 C;  5AG5 A;  2QJ8 A;  2PE3 A;  3DSB A;  2JDC A;  4JXQ A;  1S7F A;  4NJQ A;  1JQG A;  3P2F A;  2EWB A;  3ISZ A;  3PB7 X;  1CM0 A;  4M85 A;  4MI4 A;  4DUK A;  1Z8W A;  2AFM A;  4KUA A;  5D29 A;  2WPW A;  4E2A A;  4PV6 A;  4CYO A;  3ISX A;  4QBJ A;  1HDQ A;  4AXV A;  3WC7 A;  4EWT A;  4B5P A;  3T9Y A;  3JRU A;  4R9M A;  1ZLI A;  2VEZ A;  1K4J A;  3SJX A;  1A2Z A;  3H5Z A;  2ZOF A;  4MFK A;  1KUY A;  1Q2D A;  2G3T A;  3KR5 A;  2EVN A;  4UA3 A;  2HC9 A;  5GCN A;  3T8W A;  4AVA A;  3VWE A;  4FD7 A;  2J9A A;  1Y9W A;  3F8K A;  1XOV A;  4NSQ A;  4UBR A;  1MK4 A;  4KZT A;  3DR6 A;  3BLN A;  3FRM A;  4KSF A;  1U6M A;  3FED A;  2A4N A;  2F7V A;  1WK4 A;  4NEX A;  2Z3K A;  4PPZ A;  2PVW A;  5C82 A;  2F8H A;  2P6F A;  2IMO A;  4KVO E;  1ON0 A;  3IFE A;  5LYI A;  1YSJ A;  4MHD A;  4O23 A;  3W6X A;  2HQY A;  3KL9 A;  3NH8 A;  3PGP A;  4UWI A;  4X5K A;  4A30 A;  1ARL A;  4A37 A;  5IB0 A;  4Q7A A;  1B6B A;  2XEI A;  3FNC A;  2J8R A;  2HV2 A;  4H89 A;  1LAP A;  1F2P A;  2Q7B A;  3TX8 A;  2GRE A;  3RO0 A;  3FEC A;  1CP6 A;  4KOX A;  3FMC A;  3D67 A;  3D7G A;  1TF8 A;  1N71 A;  2PIY A;  4ORF A;  2PJ8 A;  2OOT A;  1KZF A;  4B11 A;  4Z65 A;  4GS4 A;  5G21 A;  3B3W A;  2CF4 A;  2OB0 A;  4Q38 A;  4I49 A;  5HMN A;  3CDX A;  1NSL A;  4A39 A;  4R3L A;  3D2P A;  2P6E A;  1PU9 A;  1TIQ A;  3DLJ A;  5DS0 A;  1KUV A;  4OLL A;  4ZY2 A;  3B8G A;  4A38 A;  1IB1 E;  4FBE A;  6CPA A;  1BLL E;  2Z3L A;  1CBX A;  4MCQ A;  2B4B A;  4KVM E;  2PJA A;  3RZA A;  2FT0 A;  1PYT B;  3I3G A;  1Z8X A;  4MMO A;  3SJE A;  4OC1 A;  1Y0Y A;  4MY3 A;  2B3U A;  4JYW A;  2Z3N A;  1VIX A;  4UFW A;  3KHZ A;  2YGW A;  5D8N A;  1AUG A;  2I3C A;  2BSW A;  3BHX A;  5AG7 A;  2ZOG A;  5DWM A;  1IID A;  1QSM A;  3PBB A;  3PFE A;  2PJ4 A;  4KOS A;  3D68 A;  4UCN A;  4A95 A;  4JXR A;  3EC4 A;  1RXT A;  2Q7S A;  5HVH A;  1J4J A;  4QB9 A;  1RO5 A;  4AB7 A;  2IL4 A;  4ZYQ A;  2BOA A;  1Q2Y A;  2PIZ A;  2XEG A;  3QB8 A;  1QSN A;  3FF3 A;  3IWW A;  4MFJ A;  1XF8 A;  4HKF A;  1Z2L A;  2Q0Y A;  4JJX A;  2QEC A;  3V8I A;  3LAC A;  2ZXV A;  4NF1 A;  3LOD A;  3CPA A;  1S60 A;  2OZG A;  3GUX A;  3WAB A;  4CAF A;  3IO1 A;  4L89 A;  2RC4 A;  3CPX A;  4IUS A;  3HLP A;  3PEI A;  4GM5 A;  5F46 A;  4LQ6 A;  2YNE A;  1QSO A;  4K3N A;  2OZH A;  4PXB A;  3VWD A;  5K8M A;  1VKC A;  3TO9 A;  2Q4Y A;  4TNU A;  1TXR A;  2XEJ A;  4F8Z A;  3MRU A;  3S6G A;  2EO8 A;  2YNC A;  2Q43 A;  3IJ3 A;  4C2X A;  1TKH A;  2NYQ A;  2ZEO A;  3EFA A;  2ZEG A;  4A2Z A;  2FCK A;  5I4M A;  4HNY B;  2G9D A;  1NMT A;  3C26 A;  1LRZ A;  2PR8 A;  5HVG A;  7CPA A;  3NE8 A;  2GAN A;  2P0W A;  4CGL A;  4U5Y A;  2R7H A;  1M4I A;  1IYL A;  3FIX A;  1B87 A;  4MCS A;  3A9L A;  4P4D A;  4R7M A;  5AGE A;  5H84 A;  5LYF A;  2HB6 A;  2BL1 A;  4R6T A;  1XEB A;  3F0A A;  4HPS A;  3MN8 A;  4R76 A;  2ZW5 A;  2AE6 A;  1YVO A;  1XRY A;  4L8A A;  4UEF A;  1BOB A;  3E0K A;  4Q36 A;  4UEE A;  3FYN A;  1YRE A;  1YX0 A;  4P10 A;  4B5O A;  3LWU A;  1ZO0 A;  5IV0 A;  1PUA A;  2D4O A;  3KQZ A;  1XMT A;  1Z8T A;  5F09 A;  2O28 A;  4KOR A;  1V0C A;  3CZX A;  3FJU A;  2OZU A;  2AFU A;  1YLO A;  3PB8 X;  4M6H A;  5JGF A;  1Q2C A;  4HNX B;  1WWZ A;  4MCR A;  3PP9 A;  2PJ1 A;  2EK8 A;  3PB4 X;  3TT2 A;  2CTC A;  4YFJ A;  2Z3P A;  1VGY A;  4ZY0 A;  1SQH A;  4XPK A;  2AFO A;  1OBR A;  3FH4 A;  4RN7 A;  2C1C A;  4KUB A;  4MFZ A;  1YLE A;  5LRJ A;  2WZN A;  3D7H A;  2HUZ A;  5BWA B;  5I0C A;  5CBM A;  1Y0R A;  1Z4E A;  2VBQ A;  4W9Y A;  3N7Z A;  2Z3M A;  2BO9 A;  1CX8 A;  4J3G A;  3IC1 A;  3KZW A;  4A33 A;  1IYK A;  2OR4 A;  2VI7 A;  2V8H A;  1Z8L A;  1EE3 P;  2GLJ A;  1R3N A;  2C27 A;  3D7F A;  1NE9 A;  5DWN A;  2PRQ A;  4B6Z A;  1M1D A;  2AJ6 A;  3LD2 A;  4R8F A;  4OAD A;  2AFZ A;  4UWJ A;  4CAX A;  5J8C A;  3SI1 A;  4ZY1 A;  1HDU A;  2RB7 A;  4M6G A;  4FD4 A;  2DPS A;  3D66 A;  3DDD A;  1XMB A;  3ZZI A;  1BPN A;  5EC4 A;  5THW A;  2ODF A;  3V38 A;  3TFY A;  4UCM A;  4ZGY B;  2K5T A;  2PJ5 A;  3TE4 A;  2Z11 A;  1TKF A;  4AVB A;  4FAI A;  2AFW A;  4B13 A;  3PB6 X;  4ZX8 A;  4OC4 A;  1QST A;  4UCP A;  4TWE A;  4XPD B;  4X3R A;  4DJL A;  2QML A;  3DNS A;  3P2H A;  3SJF A;  4CPA A;  2PR1 A;  4Y49 C;  3W6S A;  2XEF A;  1S7K A;  4E8O A;  2REF A;  2WUU A;  4FWU A;  4JWP A;  2WPX A;  4MHN A;  3PB9 X;  2PC1 A;  5J1Q A;  4CGM A;  1UFH A;  5LRG A;  3IEH A;  1BO4 A;  4YWY A;  2JLM A;  3JUW A;  4OC0 A;  1QMU A;  4KLV A;  4AG9 A;  1M4G A;  5AG6 A;  1Z5R A;  2FIW A;  4EME A;  2AFS A;  5E96 A;  2YNC C;  3BXM A;  3H4Q A;  3S6K A;  5IX3 A;  4YRH A;  1L0C A;  1S3Z A;  2GFQ A;  5K8P A;  3G8W A;  2ZED A;  4BMH A;  5A27 A;  2ZEE A;  4H6U A;  3NA6 A;  4IHM A;  4KSA A;  1VHO A;  5JM6 A;  1AMP A;  3EO4 A;  5JH9 A;  1CP7 A;  5F48 A;  1I1D A;  2PJC A;  3B7I A;  4XPL A;  4CRY B;  1Y7E A;  4EFD A;  1FT7 A;  3S9N A;  1ELL P;  3I1U A;  3TO7 A;  2Y0M A;  2R8V A;  3B2Y A;  3N5F A;  2GIV A;  2JBJ A;  4DNC A;  5FVJ A;  3H8G A;  2CNS A;  3G3S A;  3IU2 A;  2Z10 A;  1BPM A;  2H5M A;  3H8E A;  4JD6 A;  5IB9 A;  2Q4Z A;  4OP4 A;  1ZG9 A;  3GYA A;  4KLW A;  3FB3 A;  3IWG A;  2Z0Z A;  4LX9 A;  5ELY A;  3CXQ A;  2PRB A;  3BJ7 A;  2PJB A;  1YQE A;  2OU2 A;  4AG7 A;  3R95 A;  1X12 A;  3SXN A;  1IY7 A;  4CAE A;  1LAN A;  2B5G B;  4X2T A;  4KOY A;  1IOI A;  1I21 A;  4CYP A;  2V8G A;  4WWV A;  4IK2 A;  4XPD C;  4PXD A;  4H2K A;  3EY5 A;  5HH1 A;  1Y7R A;  4UFV A;  1M4D A;  5A28 A;  3SXO A;  4R57 A;  3PZJ A;  4OME A;  4NJR A;  3D3S A;  4CAV A;  4C68 A;  3B3V A;  4MCP A;  5CNP A;  2V8V A;  2ZEP A;  2BCO A;  2ZEL A;  4MFL A;  4BBH A;  3PRT A;  1MJB A;  3JTK A;  1KUX A;  4UFX A;  2GLF A;  3JVN A;  3TO6 A;  2FXF A;  2BUE A;  4R3K A;  1P4N A;  2C6C A;  2G3A A;  4B14 A;  3IGR A;  2ARH A;  4WJB A;  1R57 A;  2PQ8 A;  4YGO A;  3GKR A;  4NGS A;  4KOT A;  2JEW A;  3D4U A;  3PBE A;  3R9E A;  1CG2 A;  1FNO A;  2J8N A;  3RNZ A;  2G0B A;  3SI0 A;  1MJ9 A;  4NGQ A;  3B3T A;  2PJ2 A;  2EUI A;  2PJ7 A;  2PJ0 A;  1Q7L A;  2GE3 A;  2C6G A;  1YW6 A;  3H8F A;  3GY9 A;  4B10 A;  3WT4 A;  5JPH A;  1IIC A;  2FVG A;  4CGO A;  2ZW4 A;  4P4F A;  3BI1 A;  4JLY A;  3NH4 A;  3RBU A;  5CPA A;  1YME A;  5LRK A;  4ZX9 A;  2POK A;  3SI2 A;  5LYD A;  4F0X A;  4BD9 A;  4IF5 A;  4MY0 A;  3TCV A;  4KOW A;  2V8D A;  2AFX A;  5H86 A;  3EXN A;  3PFO A;  1S7N A;  2D4P A;  4ONU A;  3RAM A;  2ZEN A;  4BIN A;  4II9 A;  1QQ9 A;  4NCZ A;  4ZI6 A;  3OWC A;  2CXA A;  3QNV A;  1ZG7 A;  5G22 A;  1CPS A;  3FXT A;  4C2Y A;  3ZJ0 A;  5K8O A;  4AVC A;  4EVY A;  4OID A;  1IU8 A;  3B3S A;  1Z4R A;  1KWM A; 
#chains in the Genus database with same CATH homology
 3HUV A;  3KQX A;  2PCU A;  2O4H A;  2EK9 A;  4NFR A;  3WC5 A;  4F9V A;  4NGN A;  4OKO A;  3NFZ A;  2PJ3 A;  4NGT A;  3FX6 A;  2PVV A;  2RFH A;  1H8L A;  1TKJ A;  4OC5 A;  4LQG A;  1TF9 A;  3SJG A;  3KHX A;  3K2K A;  3KAS A;  1YW4 A;  3K9T A;  4MHP A;  4NGM A;  2CIJ A;  4MXU A;  3TC8 A;  2WYR A;  2V77 A;  3L2N A;  3IIB A;  1ZG8 A;  4G1P A;  2C6P A;  4KSI A;  2ZEM A;  4OIW A;  4OC3 A;  4DYO A;  1BAV A;  2ABZ A;  3V7Z A;  1LFW A;  4P6Y A;  3LMS A;  3WC6 A;  3S9M A;  4NGP A;  5HXD A;  3GB0 A;  1XBU A;  1HEE A;  1F2O A;  4A94 A;  1VHE A;  4IAV A;  2NSM A;  5LYL A;  4P4E A;  4UIA A;  1ARM A;  4PXE A;  5K8N A;  8CPA A;  1DTD A;  3B3C A;  1NSA A;  2ZEH A;  3KGQ A;  4RUH A;  4MHY A;  2GU2 A;  2VL1 A;  2DEA A;  4P4B A;  4PXC A;  1XFO A;  3VH9 A;  2IQ6 A;  2IJZ A;  3KR4 A;  4UIB A;  1AYE A;  1PCA A;  1CPX A;  4UF4 A;  5HVF A;  2JBK A;  4MHZ A;  4NGR A;  2CTB A;  1GYT A;  3FVL A;  3GLJ A;  3DGV A;  2QYV A;  4P45 A;  4PQA A;  4JZ0 A;  2O53 A;  4ONW A;  2ANP A;  4YU9 A;  3VAR A;  1UWY A;  1LCP A;  3NH5 A;  1ZLH A;  2QVP A;  3FEE A;  3BI0 A;  1XJO A;  1R43 A;  4FUU A;  4X8I A;  1F57 A;  4P44 A;  4F9U A;  3D7D A;  3KI9 A;  4P4J A;  3VAT A;  2ZEF A;  2PJ6 A;  4MRI A;  2Q51 A;  1ELM P;  4UEZ A;  3S9L A;  3B35 A;  4OC2 A;  3CT9 A;  2PJ9 A;  4P4I A;  1LOK A;  1M4L A;  1IGB A;  1RTQ A;  1DE4 C;  2QJ8 A;  2PE3 A;  4NJQ A;  1JQG A;  2EWB A;  3ISZ A;  3PB7 X;  4DUK A;  5D29 A;  2AFM A;  3ISX A;  1HDQ A;  4AXV A;  3WC7 A;  4EWT A;  3JRU A;  1ZLI A;  3SJX A;  2ZOF A;  3KR5 A;  3T8W A;  2HC9 A;  2J9A A;  3FED A;  2F7V A;  4PPZ A;  2PVW A;  2F8H A;  2IMO A;  3IFE A;  5LYI A;  1YSJ A;  4O23 A;  3KL9 A;  3NH8 A;  1ARL A;  4A37 A;  4Q7A A;  2XEI A;  1LAP A;  1F2P A;  3TX8 A;  2GRE A;  3FEC A;  1CP6 A;  3FMC A;  3D67 A;  3D7G A;  1TF8 A;  2PIY A;  2PJ8 A;  2OOT A;  4Z65 A;  3B3W A;  2CF4 A;  3CDX A;  4A39 A;  4ZY2 A;  3DLJ A;  5DS0 A;  4A38 A;  6CPA A;  4FBE A;  1BLL E;  1CBX A;  4MCQ A;  3RZA A;  2PJA A;  3SJE A;  1PYT B;  4MMO A;  4OC1 A;  1Y0Y A;  4JYW A;  1VIX A;  3KHZ A;  5D8N A;  2I3C A;  3BHX A;  2ZOG A;  3PBB A;  3PFE A;  2PJ4 A;  3D68 A;  5HVH A;  4ZYQ A;  2BOA A;  2PIZ A;  2XEG A;  3FF3 A;  3IWW A;  1Z2L A;  3CPA A;  3WAB A;  3GUX A;  3IO1 A;  3CPX A;  3HLP A;  3PEI A;  4GM5 A;  4K3N A;  5K8M A;  4PXB A;  4TNU A;  1TXR A;  2XEJ A;  4F8Z A;  3MRU A;  2Q43 A;  3IJ3 A;  1TKH A;  2NYQ A;  2ZEO A;  2ZEG A;  5I4M A;  2G9D A;  5HVG A;  7CPA A;  4MCS A;  4P4D A;  4R7M A;  5LYF A;  2HB6 A;  4R6T A;  4R76 A;  3MN8 A;  1XRY A;  4UEF A;  4UEE A;  4P10 A;  3LWU A;  5F09 A;  3KQZ A;  3FJU A;  2AFU A;  1YLO A;  3PB8 X;  5JGF A;  4MCR A;  2PJ1 A;  2EK8 A;  3PB4 X;  2CTC A;  4ZY0 A;  1VGY A;  2AFO A;  1OBR A;  3FH4 A;  2C1C A;  5LRJ A;  2WZN A;  3D7H A;  5CBM A;  1Y0R A;  4W9Y A;  2BO9 A;  1CX8 A;  3IC1 A;  3KZW A;  2OR4 A;  2V8H A;  1Z8L A;  1EE3 P;  2GLJ A;  1R3N A;  3D7F A;  2PRQ A;  4B6Z A;  4R8F A;  2AFZ A;  3SI1 A;  4ZY1 A;  1HDU A;  2RB7 A;  3D66 A;  1XMB A;  1BPN A;  5THW A;  3V38 A;  2PJ5 A;  1TKF A;  4FAI A;  2AFW A;  3PB6 X;  4ZX8 A;  4OC4 A;  3S9N A;  4TWE A;  4X3R A;  4DJL A;  3SJF A;  4CPA A;  2XEF A;  4FWU A;  4MHN A;  3PB9 X;  5J1Q A;  5LRG A;  3IEH A;  3B3S A;  4YWY A;  4OC0 A;  1QMU A;  1Z5R A;  4EME A;  2AFS A;  3BXM A;  5K8P A;  2ZED A;  2ZEE A;  3NA6 A;  4IHM A;  5JM6 A;  1VHO A;  1AMP A;  5JH9 A;  1CP7 A;  2PJC A;  3B7I A;  1Y7E A;  4EFD A;  1FT7 A;  1ELL P;  3I1U A;  3B2Y A;  3N5F A;  2JBJ A;  3H8G A;  5IB9 A;  1BPM A;  3H8E A;  2Q4Z A;  4OP4 A;  1ZG9 A;  5ELY A;  2PJB A;  1IY7 A;  1LAN A;  4X2T A;  2V8G A;  4WWV A;  4IK2 A;  4H2K A;  4OME A;  4NJR A;  3B3V A;  4MCP A;  2V8V A;  2ZEP A;  2BCO A;  2ZEL A;  3PRT A;  2GLF A;  2C6C A;  4WJB A;  4NGS A;  2JEW A;  3D4U A;  3PBE A;  1CG2 A;  1FNO A;  3SI0 A;  4NGQ A;  2PJ2 A;  2PJ7 A;  1Q7L A;  2PJ0 A;  2C6G A;  1YW6 A;  3H8F A;  3WT4 A;  2FVG A;  4P4F A;  3BI1 A;  3NH4 A;  3RBU A;  5CPA A;  1YME A;  5LRK A;  4ZX9 A;  2POK A;  3SI2 A;  5LYD A;  4BD9 A;  2V8D A;  2AFX A;  3PFO A;  3RAM A;  2ZEN A;  1QQ9 A;  4ZI6 A;  3QNV A;  1ZG7 A;  1CPS A;  5K8O A;  4OID A;  1LAM A;  4PXD A;  3B3T A;  1KWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...