3KHZA

Crystal structure of r350a mutant of staphylococcus aureus metallopeptidase (sapep/dape) in the apo-form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
468
structure length
433
Chain Sequence
SMWKEKVQQYEDQIINDLKGLLAIESVRDDAKASEDAPVGPGPRKALDYMYEIAHRDGFTTHDVDHIAGRIEAGKGNDVLGILCHVDVVPAGDGWDSNPFEPVVTEDAIIARGTLDDKGPTIAAYYAIKILEDMNVDWKKRIHMIIGTDEESDWKCTDRYFKTEEMPTLGFAPDAEFPCIHGEKGITTFDLVQNKLTEDQDEPDYELITFKSGERYNMVPDHAEARVLVKENMTDVIQDFEYFLEQNHLQGDSTVDSGILVLTVEGKAVHGMDPSIGVNAGLYLLKFLASLNLDNNAQAFVAFSNRYLFNSDFGEKMGMKFHTDVMGDVTTNIGVITYDNENAGLFGINLAYPEGFEFEKAMDRFANEIQQYGFEVKLGKVQPPHYVDKNDPFVQKLVTAYRNQTHQKNEYITKKQLFNATSIYLEAIYSLCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dipeptidase SACOL1801
publication title Crystal structure of Staphylococcus aureus metallopeptidase (Sapep) reveals large domain motions between the manganese-bound and apo-states
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 130
structure length 433
sequence length 468
chains with identical sequence B
ec nomenclature ec 3.4.13.-:
pdb deposition date 2009-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3khzA01
3D67A 2ZOFA 1VGYA 1VHEA 4DJLA 4UIBA 1IY7A 3FEEA 4F8ZA 3PB9X 3WC5A 1BAVA 3TC8A 2PJBA 3QNVA 3WC7A 2V77A 3B3VA 1BPMA 5HVFA 3BXMA 3PEIA 1QMUA 1ZLIA 4DUKA 3RZAA 2GLFA 2JBKA 4R6TA 1FT7A 1TKHA 4R76A 4FAIA 4X8IA 2IJZA 3V7ZA 3KQZA 2C6PA 4FUUA 2V8HA 4TNUA 3CPXA 1DE4C 2QVPA 3D7DA 5LYDA 3D66A 4OKOA 3DGVA 2PJ2A 3NH4A 3CDXA 1M4LA 2JBJA 3CT9A 3SI2A 2PCUA 4ZX9A 2V8VA 3FVLA 4CPAA 4UIAA 2ZEMA 2C6GA 4UEFA 4OMEA 2ZEDA 2C1CA 4EMEA 3K2KA 4P6YA 2EWBA 4IK2A 7CPAA 4OIWA 2EK8A 4ZX8A 4MCQA 2HB6A 5I4MA 1Y7EA 3VATA 4ZYQA 4FBEA 1ELLP 4NGNA 4NJRA 5CBMA 3HUVA 2PJAA 2F8HA 5JH9A 3PB6X 1JQGA 3KL9A 2OR4A 4ONWA 4ZI6A 2RFHA 3SI0A 2QYVA 3I1UA 2RB7A 4NGSA 4ZY2A 1H8LA 3B3SA 2XEIA 3RBUA 4IHMA 4MMOA 3WT4A 3PB8X 1TF9A 2PJ4A 2PJ6A 2PIZA 5HVHA 3BHXA 4JZ0A 1RTQA 5D8NA 4OC5A 4WWVA 2OOTA 4PXBA 4MXUA 2ZEGA 4BD9A 5JGFA 3LWUA 1Y0YA 4KSIA 2CTBA 6CPAA 4NGQA 3D68A 4P4EA 3CPAA 2IQ6A 3BI1A 3IJ3A 2PJ7A 5J1QA 4W9YA 3L2NA 3KHXA 3FEDA 2GREA 2NYQA 3S9LA 5HVGA 4RUHA 1LFWA 3BI0A 1F57A 4O23A 4H2KA 2FVGA 4OC1A 4F9UA 4DYOA 4UEZA 5CPAA 4EFDA 3ISZA 4X2TA 1BLLE 3SI1A 3SJEA 1BPNA 1YW4A 3JRUA 4PXCA 4NGTA 4X3RA 1CP6A 2GU2A 1ARLA 1YLOA 3B3WA 4P45A 2V8GA 2AFSA 3SJGA 1GYTA 1Z5RA 5D29A 3K9TA 1LANA 3N5FA 2AFOA 1XJOA 4NGRA 2GLJA 3VARA 3GLJA 3FECA 2PE3A 4MRIA 1LAPA 2ABZA 1CPSA 3PB7X 1XMBA 1Y0RA 4A94A 1YSJA 1LCPA 3IFEA 5HXDA 3NFZA 4PXDA 4PPZA 4EWTA 1ZG7A 4P4DA 1EE3P 4LQGA 2JEWA 1F2PA 4OC2A 3FJUA 3PB4X 3FH4A 2POKA 1IGBA 3NA6A 1CP7A 3PBEA 2I3CA 2AFZA 2O53A 2O4HA 1TKJA 4YU9A 2ZEFA 1HEEA 4OC0A 2Q43A 4MHZA 4MCSA 3PFEA 1ZG9A 2XEGA 3KQXA 1XBUA 4MCRA 1XFOA 1VIXA 4A38A 1DTDA 2AFMA 2ZEOA 5K8NA 4UEEA 1HDQA 3KHZA 2PJ5A 4MHYA 4P10A 3S9MA 5DS0A 3B35A 4FWUA 2ZOGA 2J9AA 3FMCA 1KWMA 2WZNA 4IAVA 3KR5A 2V8DA 2ANPA 1Q7LA 1F2OA 3D7FA 3WABA 2VL1A 3KI9A 3IIBA 4GM5A 1YW6A 2CTCA 2PJ1A 4B6ZA 2AFXA 5LYFA 3H8FA 1CG2A 2C6CA 2ZEPA 1TXRA 4TWEA 4PQAA 1PCAA 2AFWA 2XEFA 3PFOA 5LYLA 1PYTB 5JM6A 4NFRA 2ZELA 2IMOA 1TKFA 2ZENA 4P4FA 4MHPA 3IO1A 8CPAA 4ZY0A 2BO9A 1AMPA 4NGMA 1UWYA 1CX8A 5THWA 1ELMP 4OP4A 2WYRA 1R43A 2PIYA 2G9DA 1NSAA 2PVVA 1ARMA 2HC9A 1Z8LA 5LRKA 3IC1A 3ISXA 2EK9A 4OIDA 5ELYA 2PJ3A 4A37A 1AYEA 3B2YA 4Q7AA 1XRYA 4NGPA 2CF4A 3VH9A 2NSMA 4MHNA 3MRUA 4R7MA 3NH8A 3SJXA 4P4JA 3LMSA 2BCOA 4UF4A 4WJBA 5K8OA 2F7VA 3B7IA 3RAMA 4AXVA 2DEAA 3IEHA 1VHOA 2CIJA 2ZEEA 3T8WA 4G1PA 1CPXA 3D7HA 3DLJA 3IWWA 3KASA 1YMEA 2PJ8A 4YWYA 3FX6A 3D4UA 2AFUA 4K3NA 4MCPA 1TF8A 5LRJA 4OC4A 3SJFA 1OBRA 4R8FA 3KR4A 1ZLHA 2QJ8A 2PJ9A 3B3CA 4F9VA 5K8PA 2Q51A 3KGQA 2BOAA 3GUXA 5F09A 3FF3A 3V38A 3PBBA 3WC6A 1ZG8A 4P4IA 1QQ9A 3MN8A 3S9NA 1HDUA 2XEJA 1LAMA 3KZWA 1R3NA 3H8GA 1CBXA 3HLPA 5LYIA 2PVWA 2PJ0A 4PXEA 3TX8A 4NJQA 4ZY1A 5IB9A 2ZEHA 3NH5A 4Z65A 5K8MA 3D7GA 4A39A 3GB0A 5LRGA 1Z2LA 2PJCA 4P4BA 4OC3A 3PRTA 3B3TA 1FNOA 2PRQA 3H8EA 4P44A 4JYWA 2Q4ZA 1LOKA
chains in the Genus database with same CATH superfamily
3D67A 2ZOFA 4E2AA 1VGYA 5AG6A 1S7LA 3VWDA 1VHEA 4DJLA 4KOTA 2WUUA 2Z11A 3GKRA 5BWAB 4UIBA 1IY7A 5H84A 3FEEA 2I00A 3WR7A 3S6KA 4F8ZA 3PB9X 5I0CA 3WC5A 1BAVA 3H4QA 1PU9A 1YVOA 1B87A 3TC8A 2PJBA 2DPTA 3QNVA 2K5TA 3P2HA 3WC7A 2V77A 4CGOA 2PSWA 4CAFA 2B4DA 3B3VA 4CRZB 3I3GA 1BPMA 5HVFA 3BXMA 4KZTA 4OLLA 3PEIA 1QMUA 1ZLIA 4DUKA 2JDDA 3RZAA 2GLFA 2JBKA 2PC1A 2R8VA 4R6TA 4MFKA 4XPLA 3FRMA 4LX9A 3JVNA 1FT7A 1B6BA 4RI1A 1Z4RA 1TKHA 4MFJA 3W6XA 3QAHA 1WK4A 2ZPAA 4R76A 4MFPA 4FAIA 4X8IA 1V0CA 4MY3A 4HPSA 2IJZA 3V7ZA 3KQZA 4MFLA 2C6PA 3R96A 4FUUA 2V8HA 1XF8A 2FL4A 4TNUA 3CPXA 4M3SA 1I1DA 5DWNA 1DE4C 3EC4A 1PUAA 2QVPA 2FT0A 3D7DA 3PP9A 3R95A 3TOBA 1NMTA 4CAEA 3R1KA 5LYDA 3D66A 4B5PA 4XPDB 4OKOA 2EO8A 3DGVA 2PJ2A 2CY2A 2F5IA 3NH4A 1KZFA 3CDXA 1M4LA 2JBJA 4GS4A 4Y49B 3CT9A 2Q7BA 3TO9A 3SI2A 2PCUA 1CJWA 2Z10A 4ZX9A 2V8VA 3FVLA 5KTCA 4CPAA 2B3UA 2VZYA 2ZEMA 2C6GA 2JLMA 2GANA 4UFVA 4UIAA 4UEFA 4OMEA 2ZEDA 2VI7A 4B12A 2C1CA 3LD2A 2Z0ZA 1IU8A 4UFXA 4EMEA 1M4IA 4QVTA 5AG4A 3K2KA 4P6YA 1R57A 2EWBA 4IK2A 7CPAA 4OIWA 2EK8A 4R9MA 4ZX8A 4MCQA 1X12A 2B58A 2HB6A 5I4MA 1Y7EA 2HQYA 3VATA 4R57A 4ZYQA 1P4NA 4IUSA 4FBEA 1LRZA 2CNTA 1ELLP 5C88A 5H86A 4NGNA 1M4GA 4NJRA 5CBMA 3HUVA 4ZBGA 2DPSA 2F8HA 2PJAA 5JH9A 3PB6X 1CM0A 4RN7A 2BUEA 4K30A 1JQGA 4C2YA 4XPDC 3KL9A 2OR4A 4ONWA 4ZI6A 2RFHA 4OADA 3SI0A 4L8AA 5EMIA 4Y49C 2QYVA 3I1UA 4H6UA 2RB7A 4NGSA 1K4JA 4ZY2A 1IYKA 4CGPA 1H8LA 5HH1A 3FNCA 5AG5A 1ZO0A 3B3SA 2OB0A 2XEIA 2GFQA 3RBUA 3D8PA 4IHMA 4MMOA 3WT4A 1M1DA 3PB8X 4CAXA 1TF9A 2PJ4A 2PJ6A 2PIZA 5HVHA 3BHXA 1Q2YA 1RTQA 4JZ0A 4JWPA 4NSQA 5D8NA 4OC5A 3TCVA 4A95A 4WWVA 1Z8WA 2Q04A 2OOTA 2Z3LA 3NE8A 4A2ZA 4PXBA 4MXUA 3H5ZA 1IYLA 2ZEGA 3V8IA 4LUAA 4BD9A 2OZUA 3EFAA 1AUGA 2ZW5A 5IV0A 5JGFA 4BBHA 4U5YA 5G22A 2R7HA 3LWUA 1Y0YA 4KSIA 4M85A 5HMNA 1QSNA 2CTBA 6CPAA 4NGQA 1YLEA 4UA3A 3D68A 4MFZA 4E8OA 4P4EA 3CPAA 4HNXB 5KTAA 4R3LA 4BINA 3TT2A 3RNZA 2IQ6A 3BI1A 3IJ3A 3W91A 3FXTA 5IX3A 1ON0A 1YGHA 1S7KA 2PJ7A 3LACA 5J1QA 3GYAA 4CRYB 3CXSA 4W9YA 5AGEA 3L2NA 1Q2DA 4XPKA 3KHXA 3FEDA 2R98A 1Z9UA 4F6AA 2GREA 3FIXA 2NYQA 3S9LA 5HVGA 4RUHA 1MJ9A 1SQHA 1LFWA 2VQYA 2ZW4A 3P2FA 4JD6A 4PK3A 3DR6A 5AG7A 3BI0A 1X10A 2J8NA 1F57A 5EBVA 2FS5A 4O23A 4H2KA 3DSBA 1MJBA 2FXFA 2FVGA 3EY5A 2WPWA 4OC1A 1OZPA 5C82A 4A32A 5G1ZA 4F9UA 2FE7A 4H6ZA 3D3SA 2AJ6A 4DYOA 4UEZA 3IWGA 5CPAA 4HKFA 2JDCA 4B14A 1NE9A 4EFDA 1BOBA 5FVJA 4B13A 3ISZA 1LOKA 1BLLE 2ZXVA 4QUSA 4X2TA 3SI1A 4C68A 3SJEA 4PK2A 1BPNA 1YW4A 3JRUA 4PXCA 4NGTA 3G3SA 4KSAA 4X3RA 1CP6A 4C2ZA 2EVNA 2GU2A 3BJ7A 4A30A 3CXPA 1ARLA 1YLOA 3B3WA 2ZW6A 4JJXA 4P45A 1Z8XA 2V8GA 3EXNA 4I49A 1M44A 1QSOA 2AFSA 2B3VA 3IU1A 3SJGA 3TFYA 1GYTA 4KVXA 3S6HA 2Q4VA 1Z5RA 5D29A 3K9TA 1LANA 2REFA 4AB7A 3N5FA 2AFOA 1XJOA 1Z8TA 4QC6A 4YRHA 5J8CA 1IB1E 3CXQA 2GLJA 4NGRA 3GLJA 3VARA 3FECA 2PE3A 4MRIA 1LAPA 2HV2A 1Y9WA 2ATRA 2ABZA 2ARHA 2J8RA 4CYPA 5F46A 1CPSA 1IOFA 4MY0A 1M4DA 3PB7X 5GCNA 4ZGYB 4DNCA 1J4JA 4BMHA 1Q2CA 3G8WA 4CS0B 1XMBA 1Y0RA 3RYOA 4GXHA 4A94A 1YSJA 3N7ZA 1LCPA 3IFEA 2QMLA 1XMTA 2A4NA 3PGPA 3ZJ0A 2Z3KA 5HXDA 4AVCA 1YX0A 2R1IA 3NFZA 4PPZA 4PXDA 4MHDA 2JEVA 4NEXA 4EWTA 2Q4YA 1QSTA 1ZG7A 2G3TA 4P4DA 1XEBA 4KUBA 3W6SA 1EE3P 4KVME 4II9A 1TIQA 4B10A 3DR8A 4LQGA 2JEWA 2AE6A 1F2PA 4OC2A 3TE4A 4FD7A 3FJUA 3SHPA 3PB4X 4KOWA 3FH4A 2POKA 1IGBA 2ODFA 3MGDA 3NA6A 2YNCC 4MJ8A 4UFWA 3TTHA 1CP7A 2IL4A 3PBEA 2I3CA 2D4OA 2AFZA 2O53A 2PRBA 4KOYA 2Q44A 4OAEA 2O4HA 1GHEA 1TKJA 4YU9A 3SXOA 2O28A 2ZEFA 1HEEA 3T9YA 1QSRA 2GIVA 4OC0A 4CGLA 4KLVA 2Q43A 4ONUA 3FBUA 4MHZA 4MCSA 2QIRA 3PFEA 1ZG9A 2FIAA 3QAYA 2XEGA 3KQXA 4NF1A 4YFJA 1XBUA 4KOSA 4MCRA 1XFOA 1VIXA 4A38A 1DTDA 2AFMA 2ZEOA 3F8KA 4UEEA 5K8NA 1HDQA 3KHZA 2PJ5A 4QB9A 4X5KA 2FIWA 4MHYA 1VHSA 4P10A 5G21A 5DS0A 3S9MA 3TO7A 3B35A 4FWUA 2ZOGA 1NSLA 2Q0YA 2J9AA 2Y0MA 3FMCA 3GY9A 1L0CA 1KWMA 2WZNA 4IAVA 4Q38A 3KR5A 2WPXA 1YREA 5J8FA 3K9UA 2V8DA 3S6GA 2ANPA 5G20A 1Q7LA 4QBJA 2EBJA 1RO5A 1F2OA 3D7FA 3WABA 2VL1A 3KI9A 3IIBA 4AG7A 1XIXA 2NMTA 4GM5A 4CAVA 4AVAA 3D2MA 1S60A 1YW6A 2CTCA 2PJ1A 4M6IA 4B6ZA 2AFXA 3GIUA 5LYFA 3RO0A 1IICA 1KUVA 3VWEA 3H8FA 1CG2A 2KCWA 3I9SA 4U9YA 4MFQA 4IF5A 2C6CA 4J3GA 4UCMA 4KLWA 1S5KA 2CNMA 1KUYA 4NXYA 4XNHB 4KOVA 2ZEPA 1Y7RA 2B5GB 1RXTA 4FD5A 1TXRA 2X7BA 3R9GA 3KKWA 4KVOE 4TWEA 3E0KA 5E96A 4PQAA 1PCAA 4CYNA 4M6GA 1UFHA 2Z3NA 2AFWA 2XEFA 1QSMA 4CGMA 4YGOA 3JUWA 5ISVA 2H5MA 3TO6A 2PR8A 2VBQA 4JXRA 2RC4A 5F49A 1S7NA 3PFOA 1PYTB 2FCKA 4MBUA 5F48A 5JM6A 2GE3A 2B4DB 2OZHA 2ZELA 4NFRA 4E0AA 2QECA 3FYNA 5EC4A 2IMOA 3BJ8A 4C2XA 3FB3A 1TKFA 2ZENA 4P4FA 2Z3PA 4MHPA 3T90A 3IO1A 1KUXA 3IGRA 2WSAA 8CPAA 5LYLA 4ZY0A 4L89A 2BO9A 1AMPA 4NGMA 1UWYA 1CX8A 2D4PA 5THWA 1YK3A 1ELMP 4OP4A 2WYRA 1R43A 4CYOA 1YQEA 2I79A 2G9DA 2PIYA 1NSAA 2PVVA 2YNCA 1ARMA 2HC9A 2VZZA 4AG9A 4M6HA 4KUAA 1Z8LA 5LRKA 3IC1A 3ISXA 2EK9A 4OIDA 5ELYA 5JQ4A 2OZGA 2PJ3A 2YGWA 2P6GA 4XNHC 3F5BA 4HNYB 4A37A 2YNEA 1AYEA 3B2YA 4Q7AA 4B5PB 2YNDA 3JTKA 4A31A 1FY7A 1A2ZA 4FD6A 1XRYA 3R9EA 3TOAA 4KS9A 4NGPA 4NCZA 4JLYA 2CF4A 1S3ZA 2P6FA 3VH9A 3ZZIA 3EO4A 2DXQA 2NSMA 2J8MA 4MHNA 4C7IA 1N71A 3MRUA 4R7MA 3NE7A 3CZXA 4B5OA 4UCNA 3NH8A 3SJXA 1Z4EA 4P4JA 3LMSA 2BCOA 4H89A 4AVBA 4UF4A 3C26A 2OU2A 4WJBA 1BO4A 2DF5A 2ZW7A 2P0WA 2Z3MA 3A9LA 1YVKA 3BLNA 5K8OA 2F7VA 3B7IA 3RAMA 3S6FA 4AXVA 2BEIA 2DEAA 2B4BA 3IEHA 1VHOA 3D2PA 2CIJA 2ZEEA 3T8WA 1XE4A 2BSWA 2C27A 4G1PA 4ORFA 1CPXA 4PSXA 4UBRA 5A28A 3D7HA 1JWQA 3PZJA 3DLJA 4KSFA 3IWWA 5DWMA 4FD4A 4B11A 4R3KA 3KASA 4UWJA 1YMEA 4KORA 2PJ8A 4YWYA 3FX6A 4A33A 4Q36A 1I12A 3D4UA 2AFUA 4K3NA 4MCPA 3DNSA 4F0XA 1TF8A 5LRJA 4OC4A 3SJFA 1OBRA 4R8FA 5KTDA 1MJAA 3KR4A 3OWCA 1ZLHA 2QJ8A 1Y9KA 2REEA 2PJ9A 3B3CA 4F0YA 2BL1A 4F9VA 5K8PA 2Q51A 1XOVA 3B8GA 2PQ8A 3KGQA 2BOAA 4MI4A 3GUXA 3R9FA 2HUZA 5F09A 4JXQA 3FF3A 3V38A 3PBBA 3WC6A 1ZG8A 4P4IA 1IIDA 1QQ9A 3MN8A 4UCPA 3S9NA 4U9ZA 1HDUA 2XEJA 1U6MA 3UY5A 1LAMA 3KZWA 1R3NA 4EVYA 5CNPA 3LODA 3H8GA 5JPHA 2CXAA 1CBXA 4LQ6A 3HLPA 4RS2A 5LYIA 4KOUA 2VEZA 2PVWA 2PJ0A 1S7FA 4PXEA 3TX8A 2Q7SA 4NJQA 4ZY1A 4CGNA 1P0HA 2CNSA 3SXNA 1I21A 2G3AA 1WWZA 5IB9A 2ZEHA 1IOIA 3NH5A 1VKCA 2P6EA 2VXKA 4Z65A 5K8MA 4CAWA 4CYQA 2PR1A 2PDOA 4C7HA 3D7GA 4A39A 3GB0A 3IU2A 4UWIA 5F47A 5LRGA 1Z2LA 2PJCA 3DDDA 3F0AA 4P4BA 5A27A 4OC3A 3PRTA 1MK4A 2G0BA 2Z3OA 4HNWB 3B3TA 3QB8A 2EUIA 4PSWA 4R87A 1FNOA 1YR0A 2FSRA 2PRQA 3IWEA 3H8EA 5IB0A 4P44A 4JYWA 4KOXA 2Q4ZA 4PV6A 2OH1A 2B5GA
chains in the Genus database with same CATH topology
3D67A 2ZOFA 1VGYA 1VHEA 4DJLA 4UIBA 1IY7A 3FEEA 4F8ZA 3PB9X 3WC5A 1BAVA 3TC8A 2PJBA 3QNVA 3WC7A 2V77A 3B3VA 1BPMA 5HVFA 3BXMA 3PEIA 1QMUA 1ZLIA 4DUKA 3RZAA 2GLFA 2JBKA 4R6TA 1FT7A 1TKHA 4R76A 4FAIA 4X8IA 2IJZA 3V7ZA 3KQZA 2C6PA 4FUUA 2V8HA 4TNUA 3CPXA 1DE4C 2QVPA 3D7DA 5LYDA 3D66A 4OKOA 3DGVA 2PJ2A 3NH4A 3CDXA 1M4LA 2JBJA 3CT9A 3SI2A 2PCUA 4ZX9A 2V8VA 3FVLA 4CPAA 4UIAA 2ZEMA 2C6GA 4UEFA 4OMEA 2ZEDA 2C1CA 4EMEA 3K2KA 4P6YA 2EWBA 4IK2A 7CPAA 4OIWA 2EK8A 4ZX8A 4MCQA 2HB6A 5I4MA 1Y7EA 3VATA 4ZYQA 4FBEA 1ELLP 4NGNA 4NJRA 5CBMA 3HUVA 2PJAA 2F8HA 5JH9A 3PB6X 1JQGA 3KL9A 2OR4A 4ONWA 4ZI6A 2RFHA 3SI0A 2QYVA 3I1UA 2RB7A 4NGSA 4ZY2A 1H8LA 3B3SA 2XEIA 3RBUA 4IHMA 4MMOA 3WT4A 3PB8X 1TF9A 2PJ4A 2PJ6A 2PIZA 5HVHA 3BHXA 4JZ0A 1RTQA 5D8NA 4OC5A 4WWVA 2OOTA 4PXBA 4MXUA 2ZEGA 4BD9A 5JGFA 3LWUA 1Y0YA 4KSIA 2CTBA 6CPAA 4NGQA 3D68A 4P4EA 3CPAA 2IQ6A 3BI1A 3IJ3A 2PJ7A 5J1QA 4W9YA 3L2NA 3KHXA 3FEDA 2GREA 2NYQA 3S9LA 5HVGA 4RUHA 1LFWA 3BI0A 1F57A 4O23A 4H2KA 2FVGA 4OC1A 4F9UA 4DYOA 4UEZA 5CPAA 4EFDA 3ISZA 4X2TA 1BLLE 3SI1A 3SJEA 1BPNA 1YW4A 3JRUA 4PXCA 4NGTA 4X3RA 1CP6A 2GU2A 1ARLA 1YLOA 3B3WA 4P45A 2V8GA 2AFSA 3SJGA 1GYTA 1Z5RA 5D29A 3K9TA 1LANA 3N5FA 2AFOA 1XJOA 4NGRA 2GLJA 3VARA 3GLJA 3FECA 2PE3A 4MRIA 1LAPA 2ABZA 1CPSA 3PB7X 1XMBA 1Y0RA 4A94A 1YSJA 1LCPA 3IFEA 5HXDA 3NFZA 4PXDA 4PPZA 4EWTA 1ZG7A 4P4DA 1EE3P 4LQGA 2JEWA 1F2PA 4OC2A 3FJUA 3PB4X 3FH4A 2POKA 1IGBA 3NA6A 1CP7A 3PBEA 2I3CA 2AFZA 2O53A 2O4HA 1TKJA 4YU9A 2ZEFA 1HEEA 4OC0A 2Q43A 4MHZA 4MCSA 3PFEA 1ZG9A 2XEGA 3KQXA 1XBUA 4MCRA 1XFOA 1VIXA 4A38A 1DTDA 2AFMA 2ZEOA 5K8NA 4UEEA 1HDQA 3KHZA 2PJ5A 4MHYA 4P10A 3S9MA 5DS0A 3B35A 4FWUA 2ZOGA 2J9AA 3FMCA 1KWMA 2WZNA 4IAVA 3KR5A 2V8DA 2ANPA 1Q7LA 1F2OA 3D7FA 3WABA 2VL1A 3KI9A 3IIBA 4GM5A 1YW6A 2CTCA 2PJ1A 4B6ZA 2AFXA 5LYFA 3H8FA 1CG2A 2C6CA 2ZEPA 1TXRA 4TWEA 4PQAA 1PCAA 2AFWA 2XEFA 3PFOA 5LYLA 1PYTB 5JM6A 4NFRA 2ZELA 2IMOA 1TKFA 2ZENA 4P4FA 4MHPA 3IO1A 8CPAA 4ZY0A 2BO9A 1AMPA 4NGMA 1UWYA 1CX8A 5THWA 1ELMP 4OP4A 2WYRA 1R43A 2PIYA 2G9DA 1NSAA 2PVVA 1ARMA 2HC9A 1Z8LA 5LRKA 3IC1A 3ISXA 2EK9A 4OIDA 5ELYA 2PJ3A 4A37A 1AYEA 3B2YA 4Q7AA 1XRYA 4NGPA 2CF4A 3VH9A 2NSMA 4MHNA 3MRUA 4R7MA 3NH8A 3SJXA 4P4JA 3LMSA 2BCOA 4UF4A 4WJBA 5K8OA 2F7VA 3B7IA 3RAMA 4AXVA 2DEAA 3IEHA 1VHOA 2CIJA 2ZEEA 3T8WA 4G1PA 1CPXA 3D7HA 3DLJA 3IWWA 3KASA 1YMEA 2PJ8A 4YWYA 3FX6A 3D4UA 2AFUA 4K3NA 4MCPA 1TF8A 5LRJA 4OC4A 3SJFA 1OBRA 4R8FA 3KR4A 1ZLHA 2QJ8A 2PJ9A 3B3CA 4F9VA 5K8PA 2Q51A 3KGQA 2BOAA 3GUXA 5F09A 3FF3A 3V38A 3PBBA 3WC6A 1ZG8A 4P4IA 1QQ9A 3MN8A 3S9NA 1HDUA 2XEJA 1LAMA 3KZWA 1R3NA 3H8GA 1CBXA 3HLPA 5LYIA 2PVWA 2PJ0A 4PXEA 3TX8A 4NJQA 4ZY1A 5IB9A 2ZEHA 3NH5A 4Z65A 5K8MA 3D7GA 4A39A 3GB0A 5LRGA 1Z2LA 2PJCA 4P4BA 4OC3A 3PRTA 3B3TA 1FNOA 2PRQA 3H8EA 4P44A 4JYWA 2Q4ZA 1LOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D67 A;  2ZOF A;  1VGY A;  1VHE A;  4DJL A;  4UIB A;  1IY7 A;  3FEE A;  4F8Z A;  3PB9 X;  3WC5 A;  1BAV A;  3TC8 A;  2PJB A;  3QNV A;  3WC7 A;  2V77 A;  3B3V A;  1BPM A;  5HVF A;  3BXM A;  3PEI A;  1QMU A;  1ZLI A;  4DUK A;  3RZA A;  2GLF A;  2JBK A;  4R6T A;  1FT7 A;  1TKH A;  4R76 A;  4FAI A;  4X8I A;  2IJZ A;  3V7Z A;  3KQZ A;  2C6P A;  4FUU A;  2V8H A;  4TNU A;  3CPX A;  1DE4 C;  2QVP A;  3D7D A;  5LYD A;  3D66 A;  4OKO A;  3DGV A;  2PJ2 A;  3NH4 A;  3CDX A;  1M4L A;  2JBJ A;  3CT9 A;  3SI2 A;  2PCU A;  4ZX9 A;  2V8V A;  3FVL A;  4CPA A;  4UIA A;  2ZEM A;  2C6G A;  4UEF A;  4OME A;  2ZED A;  2C1C A;  4EME A;  3K2K A;  4P6Y A;  2EWB A;  4IK2 A;  7CPA A;  4OIW A;  2EK8 A;  4ZX8 A;  4MCQ A;  2HB6 A;  5I4M A;  1Y7E A;  3VAT A;  4ZYQ A;  4FBE A;  1ELL P;  4NGN A;  4NJR A;  5CBM A;  3HUV A;  2PJA A;  2F8H A;  5JH9 A;  3PB6 X;  1JQG A;  3KL9 A;  2OR4 A;  4ONW A;  4ZI6 A;  2RFH A;  3SI0 A;  2QYV A;  3I1U A;  2RB7 A;  4NGS A;  4ZY2 A;  1H8L A;  3B3S A;  2XEI A;  3RBU A;  4IHM A;  4MMO A;  3WT4 A;  3PB8 X;  1TF9 A;  2PJ4 A;  2PJ6 A;  2PIZ A;  5HVH A;  3BHX A;  4JZ0 A;  1RTQ A;  5D8N A;  4OC5 A;  4WWV A;  2OOT A;  4PXB A;  4MXU A;  2ZEG A;  4BD9 A;  5JGF A;  3LWU A;  1Y0Y A;  4KSI A;  2CTB A;  6CPA A;  4NGQ A;  3D68 A;  4P4E A;  3CPA A;  2IQ6 A;  3BI1 A;  3IJ3 A;  2PJ7 A;  5J1Q A;  4W9Y A;  3L2N A;  3KHX A;  3FED A;  2GRE A;  2NYQ A;  3S9L A;  5HVG A;  4RUH A;  1LFW A;  3BI0 A;  1F57 A;  4O23 A;  4H2K A;  2FVG A;  4OC1 A;  4F9U A;  4DYO A;  4UEZ A;  5CPA A;  4EFD A;  3ISZ A;  4X2T A;  1BLL E;  3SI1 A;  3SJE A;  1BPN A;  1YW4 A;  3JRU A;  4PXC A;  4NGT A;  4X3R A;  1CP6 A;  2GU2 A;  1ARL A;  1YLO A;  3B3W A;  4P45 A;  2V8G A;  2AFS A;  3SJG A;  1GYT A;  1Z5R A;  5D29 A;  3K9T A;  1LAN A;  3N5F A;  2AFO A;  1XJO A;  4NGR A;  2GLJ A;  3VAR A;  3GLJ A;  3FEC A;  2PE3 A;  4MRI A;  1LAP A;  2ABZ A;  1CPS A;  3PB7 X;  1XMB A;  1Y0R A;  4A94 A;  1YSJ A;  1LCP A;  3IFE A;  5HXD A;  3NFZ A;  4PXD A;  4PPZ A;  4EWT A;  1ZG7 A;  4P4D A;  1EE3 P;  4LQG A;  2JEW A;  1F2P A;  4OC2 A;  3FJU A;  3PB4 X;  3FH4 A;  2POK A;  1IGB A;  3NA6 A;  1CP7 A;  3PBE A;  2I3C A;  2AFZ A;  2O53 A;  2O4H A;  1TKJ A;  4YU9 A;  2ZEF A;  1HEE A;  4OC0 A;  2Q43 A;  4MHZ A;  4MCS A;  3PFE A;  1ZG9 A;  2XEG A;  3KQX A;  1XBU A;  4MCR A;  1XFO A;  1VIX A;  4A38 A;  1DTD A;  2AFM A;  2ZEO A;  5K8N A;  4UEE A;  1HDQ A;  3KHZ A;  2PJ5 A;  4MHY A;  4P10 A;  3S9M A;  5DS0 A;  3B35 A;  4FWU A;  2ZOG A;  2J9A A;  3FMC A;  1KWM A;  2WZN A;  4IAV A;  3KR5 A;  2V8D A;  2ANP A;  1Q7L A;  1F2O A;  3D7F A;  3WAB A;  2VL1 A;  3KI9 A;  3IIB A;  4GM5 A;  1YW6 A;  2CTC A;  2PJ1 A;  4B6Z A;  2AFX A;  5LYF A;  3H8F A;  1CG2 A;  2C6C A;  2ZEP A;  1TXR A;  4TWE A;  4PQA A;  1PCA A;  2AFW A;  2XEF A;  3PFO A;  5LYL A;  1PYT B;  5JM6 A;  4NFR A;  2ZEL A;  2IMO A;  1TKF A;  2ZEN A;  4P4F A;  4MHP A;  3IO1 A;  8CPA A;  4ZY0 A;  2BO9 A;  1AMP A;  4NGM A;  1UWY A;  1CX8 A;  5THW A;  1ELM P;  4OP4 A;  2WYR A;  1R43 A;  2PIY A;  2G9D A;  1NSA A;  2PVV A;  1ARM A;  2HC9 A;  1Z8L A;  5LRK A;  3IC1 A;  3ISX A;  2EK9 A;  4OID A;  5ELY A;  2PJ3 A;  4A37 A;  1AYE A;  3B2Y A;  4Q7A A;  1XRY A;  4NGP A;  2CF4 A;  3VH9 A;  2NSM A;  4MHN A;  3MRU A;  4R7M A;  3NH8 A;  3SJX A;  4P4J A;  3LMS A;  2BCO A;  4UF4 A;  4WJB A;  5K8O A;  2F7V A;  3B7I A;  3RAM A;  4AXV A;  2DEA A;  3IEH A;  1VHO A;  2CIJ A;  2ZEE A;  3T8W A;  4G1P A;  1CPX A;  3D7H A;  3DLJ A;  3IWW A;  3KAS A;  1YME A;  2PJ8 A;  4YWY A;  3FX6 A;  3D4U A;  2AFU A;  4K3N A;  4MCP A;  1TF8 A;  5LRJ A;  4OC4 A;  3SJF A;  1OBR A;  4R8F A;  3KR4 A;  1ZLH A;  2QJ8 A;  2PJ9 A;  3B3C A;  4F9V A;  5K8P A;  2Q51 A;  3KGQ A;  2BOA A;  3GUX A;  5F09 A;  3FF3 A;  3V38 A;  3PBB A;  3WC6 A;  1ZG8 A;  4P4I A;  1QQ9 A;  3MN8 A;  3S9N A;  1HDU A;  2XEJ A;  1LAM A;  3KZW A;  1R3N A;  3H8G A;  1CBX A;  3HLP A;  5LYI A;  2PVW A;  2PJ0 A;  4PXE A;  3TX8 A;  4NJQ A;  4ZY1 A;  5IB9 A;  2ZEH A;  3NH5 A;  4Z65 A;  5K8M A;  3D7G A;  4A39 A;  3GB0 A;  5LRG A;  1Z2L A;  2PJC A;  4P4B A;  4OC3 A;  3PRT A;  3B3T A;  1FNO A;  2PRQ A;  3H8E A;  4P44 A;  4JYW A;  2Q4Z A;  1LOK A; 
#chains in the Genus database with same CATH topology
 3D67 A;  2ZOF A;  4E2A A;  1VGY A;  5AG6 A;  1S7L A;  3VWD A;  1VHE A;  4DJL A;  4KOT A;  2WUU A;  2Z11 A;  3GKR A;  5BWA B;  4UIB A;  1IY7 A;  5H84 A;  3FEE A;  2I00 A;  3WR7 A;  3S6K A;  4F8Z A;  3PB9 X;  5I0C A;  3WC5 A;  1BAV A;  3H4Q A;  1PU9 A;  1YVO A;  1B87 A;  3TC8 A;  2PJB A;  2DPT A;  3QNV A;  2K5T A;  3P2H A;  3WC7 A;  2V77 A;  4CGO A;  2PSW A;  4CAF A;  2B4D A;  3B3V A;  4CRZ B;  3I3G A;  1BPM A;  5HVF A;  3BXM A;  4KZT A;  4OLL A;  3PEI A;  1QMU A;  1ZLI A;  4DUK A;  2JDD A;  3RZA A;  2GLF A;  2JBK A;  2PC1 A;  2R8V A;  4R6T A;  4MFK A;  4XPL A;  3FRM A;  4LX9 A;  3JVN A;  1FT7 A;  1B6B A;  4RI1 A;  1Z4R A;  1TKH A;  4MFJ A;  3W6X A;  3QAH A;  1WK4 A;  2ZPA A;  4R76 A;  4MFP A;  4FAI A;  4X8I A;  1V0C A;  4MY3 A;  4HPS A;  2IJZ A;  3V7Z A;  3KQZ A;  4MFL A;  2C6P A;  3R96 A;  4FUU A;  2V8H A;  1XF8 A;  2FL4 A;  4TNU A;  3CPX A;  4M3S A;  1I1D A;  5DWN A;  1DE4 C;  3EC4 A;  1PUA A;  2QVP A;  2FT0 A;  3D7D A;  3PP9 A;  3R95 A;  3TOB A;  1NMT A;  4CAE A;  3R1K A;  5LYD A;  3D66 A;  4B5P A;  4XPD B;  4OKO A;  2EO8 A;  3DGV A;  2PJ2 A;  2CY2 A;  2F5I A;  3NH4 A;  1KZF A;  3CDX A;  1M4L A;  2JBJ A;  4GS4 A;  4Y49 B;  3CT9 A;  2Q7B A;  3TO9 A;  3SI2 A;  2PCU A;  1CJW A;  2Z10 A;  4ZX9 A;  2V8V A;  3FVL A;  5KTC A;  4CPA A;  2B3U A;  2VZY A;  2ZEM A;  2C6G A;  2JLM A;  2GAN A;  4UFV A;  4UIA A;  4UEF A;  4OME A;  2ZED A;  2VI7 A;  4B12 A;  2C1C A;  3LD2 A;  2Z0Z A;  1IU8 A;  4UFX A;  4EME A;  1M4I A;  4QVT A;  5AG4 A;  3K2K A;  4P6Y A;  1R57 A;  2EWB A;  4IK2 A;  7CPA A;  4OIW A;  2EK8 A;  4R9M A;  4ZX8 A;  4MCQ A;  1X12 A;  2B58 A;  2HB6 A;  5I4M A;  1Y7E A;  2HQY A;  3VAT A;  4R57 A;  4ZYQ A;  1P4N A;  4IUS A;  4FBE A;  1LRZ A;  2CNT A;  1ELL P;  5C88 A;  5H86 A;  4NGN A;  1M4G A;  4NJR A;  5CBM A;  3HUV A;  4ZBG A;  2DPS A;  2F8H A;  2PJA A;  5JH9 A;  3PB6 X;  1CM0 A;  4RN7 A;  2BUE A;  4K30 A;  1JQG A;  4C2Y A;  4XPD C;  3KL9 A;  2OR4 A;  4ONW A;  4ZI6 A;  2RFH A;  4OAD A;  3SI0 A;  4L8A A;  5EMI A;  4Y49 C;  2QYV A;  3I1U A;  4H6U A;  2RB7 A;  4NGS A;  1K4J A;  4ZY2 A;  1IYK A;  4CGP A;  1H8L A;  5HH1 A;  3FNC A;  5AG5 A;  1ZO0 A;  3B3S A;  2OB0 A;  2XEI A;  2GFQ A;  3RBU A;  3D8P A;  4IHM A;  4MMO A;  3WT4 A;  1M1D A;  3PB8 X;  4CAX A;  1TF9 A;  2PJ4 A;  2PJ6 A;  2PIZ A;  5HVH A;  3BHX A;  1Q2Y A;  1RTQ A;  4JZ0 A;  4JWP A;  4NSQ A;  5D8N A;  4OC5 A;  3TCV A;  4A95 A;  4WWV A;  1Z8W A;  2Q04 A;  2OOT A;  2Z3L A;  3NE8 A;  4A2Z A;  4PXB A;  4MXU A;  3H5Z A;  1IYL A;  2ZEG A;  3V8I A;  4LUA A;  4BD9 A;  2OZU A;  3EFA A;  1AUG A;  2ZW5 A;  5IV0 A;  5JGF A;  4BBH A;  4U5Y A;  5G22 A;  2R7H A;  3LWU A;  1Y0Y A;  4KSI A;  4M85 A;  5HMN A;  1QSN A;  2CTB A;  6CPA A;  4NGQ A;  1YLE A;  4UA3 A;  3D68 A;  4MFZ A;  4E8O A;  4P4E A;  3CPA A;  4HNX B;  5KTA A;  4R3L A;  4BIN A;  3TT2 A;  3RNZ A;  2IQ6 A;  3BI1 A;  3IJ3 A;  3W91 A;  3FXT A;  5IX3 A;  1ON0 A;  1YGH A;  1S7K A;  2PJ7 A;  3LAC A;  5J1Q A;  3GYA A;  4CRY B;  3CXS A;  4W9Y A;  5AGE A;  3L2N A;  1Q2D A;  4XPK A;  3KHX A;  3FED A;  2R98 A;  1Z9U A;  4F6A A;  2GRE A;  3FIX A;  2NYQ A;  3S9L A;  5HVG A;  4RUH A;  1MJ9 A;  1SQH A;  1LFW A;  2VQY A;  2ZW4 A;  3P2F A;  4JD6 A;  4PK3 A;  3DR6 A;  5AG7 A;  3BI0 A;  1X10 A;  2J8N A;  1F57 A;  5EBV A;  2FS5 A;  4O23 A;  4H2K A;  3DSB A;  1MJB A;  2FXF A;  2FVG A;  3EY5 A;  2WPW A;  4OC1 A;  1OZP A;  5C82 A;  4A32 A;  5G1Z A;  4F9U A;  2FE7 A;  4H6Z A;  3D3S A;  2AJ6 A;  4DYO A;  4UEZ A;  3IWG A;  5CPA A;  4HKF A;  2JDC A;  4B14 A;  1NE9 A;  4EFD A;  1BOB A;  5FVJ A;  4B13 A;  3ISZ A;  1LOK A;  1BLL E;  2ZXV A;  4QUS A;  4X2T A;  3SI1 A;  4C68 A;  3SJE A;  4PK2 A;  1BPN A;  1YW4 A;  3JRU A;  4PXC A;  4NGT A;  3G3S A;  4KSA A;  4X3R A;  1CP6 A;  4C2Z A;  2EVN A;  2GU2 A;  3BJ7 A;  4A30 A;  3CXP A;  1ARL A;  1YLO A;  3B3W A;  2ZW6 A;  4JJX A;  4P45 A;  1Z8X A;  2V8G A;  3EXN A;  4I49 A;  1M44 A;  1QSO A;  2AFS A;  2B3V A;  3IU1 A;  3SJG A;  3TFY A;  1GYT A;  4KVX A;  3S6H A;  2Q4V A;  1Z5R A;  5D29 A;  3K9T A;  1LAN A;  2REF A;  4AB7 A;  3N5F A;  2AFO A;  1XJO A;  1Z8T A;  4QC6 A;  4YRH A;  5J8C A;  1IB1 E;  3CXQ A;  2GLJ A;  4NGR A;  3GLJ A;  3VAR A;  3FEC A;  2PE3 A;  4MRI A;  1LAP A;  2HV2 A;  1Y9W A;  2ATR A;  2ABZ A;  2ARH A;  2J8R A;  4CYP A;  5F46 A;  1CPS A;  1IOF A;  4MY0 A;  1M4D A;  3PB7 X;  5GCN A;  4ZGY B;  4DNC A;  1J4J A;  4BMH A;  1Q2C A;  3G8W A;  4CS0 B;  1XMB A;  1Y0R A;  3RYO A;  4GXH A;  4A94 A;  1YSJ A;  3N7Z A;  1LCP A;  3IFE A;  2QML A;  1XMT A;  2A4N A;  3PGP A;  3ZJ0 A;  2Z3K A;  5HXD A;  4AVC A;  1YX0 A;  2R1I A;  3NFZ A;  4PPZ A;  4PXD A;  4MHD A;  2JEV A;  4NEX A;  4EWT A;  2Q4Y A;  1QST A;  1ZG7 A;  2G3T A;  4P4D A;  1XEB A;  4KUB A;  3W6S A;  1EE3 P;  4KVM E;  4II9 A;  1TIQ A;  4B10 A;  3DR8 A;  4LQG A;  2JEW A;  2AE6 A;  1F2P A;  4OC2 A;  3TE4 A;  4FD7 A;  3FJU A;  3SHP A;  3PB4 X;  4KOW A;  3FH4 A;  2POK A;  1IGB A;  2ODF A;  3MGD A;  3NA6 A;  2YNC C;  4MJ8 A;  4UFW A;  3TTH A;  1CP7 A;  2IL4 A;  3PBE A;  2I3C A;  2D4O A;  2AFZ A;  2O53 A;  2PRB A;  4KOY A;  2Q44 A;  4OAE A;  2O4H A;  1GHE A;  1TKJ A;  4YU9 A;  3SXO A;  2O28 A;  2ZEF A;  1HEE A;  3T9Y A;  1QSR A;  2GIV A;  4OC0 A;  4CGL A;  4KLV A;  2Q43 A;  4ONU A;  3FBU A;  4MHZ A;  4MCS A;  2QIR A;  3PFE A;  1ZG9 A;  2FIA A;  3QAY A;  2XEG A;  3KQX A;  4NF1 A;  4YFJ A;  1XBU A;  4KOS A;  4MCR A;  1XFO A;  1VIX A;  4A38 A;  1DTD A;  2AFM A;  2ZEO A;  3F8K A;  4UEE A;  5K8N A;  1HDQ A;  3KHZ A;  2PJ5 A;  4QB9 A;  4X5K A;  2FIW A;  4MHY A;  1VHS A;  4P10 A;  5G21 A;  5DS0 A;  3S9M A;  3TO7 A;  3B35 A;  4FWU A;  2ZOG A;  1NSL A;  2Q0Y A;  2J9A A;  2Y0M A;  3FMC A;  3GY9 A;  1L0C A;  1KWM A;  2WZN A;  4IAV A;  4Q38 A;  3KR5 A;  2WPX A;  1YRE A;  5J8F A;  3K9U A;  2V8D A;  3S6G A;  2ANP A;  5G20 A;  1Q7L A;  4QBJ A;  2EBJ A;  1RO5 A;  1F2O A;  3D7F A;  3WAB A;  2VL1 A;  3KI9 A;  3IIB A;  4AG7 A;  1XIX A;  2NMT A;  4GM5 A;  4CAV A;  4AVA A;  3D2M A;  1S60 A;  1YW6 A;  2CTC A;  2PJ1 A;  4M6I A;  4B6Z A;  2AFX A;  3GIU A;  5LYF A;  3RO0 A;  1IIC A;  1KUV A;  3VWE A;  3H8F A;  1CG2 A;  2KCW A;  3I9S A;  4U9Y A;  4MFQ A;  4IF5 A;  2C6C A;  4J3G A;  4UCM A;  4KLW A;  1S5K A;  2CNM A;  1KUY A;  4NXY A;  4XNH B;  4KOV A;  2ZEP A;  1Y7R A;  2B5G B;  1RXT A;  4FD5 A;  1TXR A;  2X7B A;  3R9G A;  3KKW A;  4KVO E;  4TWE A;  3E0K A;  5E96 A;  4PQA A;  1PCA A;  4CYN A;  4M6G A;  1UFH A;  2Z3N A;  2AFW A;  2XEF A;  1QSM A;  4CGM A;  4YGO A;  3JUW A;  5ISV A;  2H5M A;  3TO6 A;  2PR8 A;  2VBQ A;  4JXR A;  2RC4 A;  5F49 A;  1S7N A;  3PFO A;  1PYT B;  2FCK A;  4MBU A;  5F48 A;  5JM6 A;  2GE3 A;  2B4D B;  2OZH A;  2ZEL A;  4NFR A;  4E0A A;  2QEC A;  3FYN A;  5EC4 A;  2IMO A;  3BJ8 A;  4C2X A;  3FB3 A;  1TKF A;  2ZEN A;  4P4F A;  2Z3P A;  4MHP A;  3T90 A;  3IO1 A;  1KUX A;  3IGR A;  2WSA A;  8CPA A;  5LYL A;  4ZY0 A;  4L89 A;  2BO9 A;  1AMP A;  4NGM A;  1UWY A;  1CX8 A;  2D4P A;  5THW A;  1YK3 A;  1ELM P;  4OP4 A;  2WYR A;  1R43 A;  4CYO A;  1YQE A;  2I79 A;  2G9D A;  2PIY A;  1NSA A;  2PVV A;  2YNC A;  1ARM A;  2HC9 A;  2VZZ A;  4AG9 A;  4M6H A;  4KUA A;  1Z8L A;  5LRK A;  3IC1 A;  3ISX A;  2EK9 A;  4OID A;  5ELY A;  5JQ4 A;  2OZG A;  2PJ3 A;  2YGW A;  2P6G A;  4XNH C;  3F5B A;  4HNY B;  4A37 A;  2YNE A;  1AYE A;  3B2Y A;  4Q7A A;  4B5P B;  2YND A;  3JTK A;  4A31 A;  1FY7 A;  1A2Z A;  4FD6 A;  1XRY A;  3R9E A;  3TOA A;  4KS9 A;  4NGP A;  4NCZ A;  4JLY A;  2CF4 A;  1S3Z A;  2P6F A;  3VH9 A;  3ZZI A;  3EO4 A;  2DXQ A;  2NSM A;  2J8M A;  4MHN A;  4C7I A;  1N71 A;  3MRU A;  4R7M A;  3NE7 A;  3CZX A;  4B5O A;  4UCN A;  3NH8 A;  3SJX A;  1Z4E A;  4P4J A;  3LMS A;  2BCO A;  4H89 A;  4AVB A;  4UF4 A;  3C26 A;  2OU2 A;  4WJB A;  1BO4 A;  2DF5 A;  2ZW7 A;  2P0W A;  2Z3M A;  3A9L A;  1YVK A;  3BLN A;  5K8O A;  2F7V A;  3B7I A;  3RAM A;  3S6F A;  4AXV A;  2BEI A;  2DEA A;  2B4B A;  3IEH A;  1VHO A;  3D2P A;  2CIJ A;  2ZEE A;  3T8W A;  1XE4 A;  2BSW A;  2C27 A;  4G1P A;  4ORF A;  1CPX A;  4PSX A;  4UBR A;  5A28 A;  3D7H A;  1JWQ A;  3PZJ A;  3DLJ A;  4KSF A;  3IWW A;  5DWM A;  4FD4 A;  4B11 A;  4R3K A;  3KAS A;  4UWJ A;  1YME A;  4KOR A;  2PJ8 A;  4YWY A;  3FX6 A;  4A33 A;  4Q36 A;  1I12 A;  3D4U A;  2AFU A;  4K3N A;  4MCP A;  3DNS A;  4F0X A;  1TF8 A;  5LRJ A;  4OC4 A;  3SJF A;  1OBR A;  4R8F A;  5KTD A;  1MJA A;  3KR4 A;  3OWC A;  1ZLH A;  2QJ8 A;  1Y9K A;  2REE A;  2PJ9 A;  3B3C A;  4F0Y A;  2BL1 A;  4F9V A;  5K8P A;  2Q51 A;  1XOV A;  3B8G A;  2PQ8 A;  3KGQ A;  2BOA A;  4MI4 A;  3GUX A;  3R9F A;  2HUZ A;  5F09 A;  4JXQ A;  3FF3 A;  3V38 A;  3PBB A;  3WC6 A;  1ZG8 A;  4P4I A;  1IID A;  1QQ9 A;  3MN8 A;  4UCP A;  3S9N A;  4U9Z A;  1HDU A;  2XEJ A;  1U6M A;  3UY5 A;  1LAM A;  3KZW A;  1R3N A;  4EVY A;  5CNP A;  3LOD A;  3H8G A;  5JPH A;  2CXA A;  1CBX A;  4LQ6 A;  3HLP A;  4RS2 A;  5LYI A;  4KOU A;  2VEZ A;  2PVW A;  2PJ0 A;  1S7F A;  4PXE A;  3TX8 A;  2Q7S A;  4NJQ A;  4ZY1 A;  4CGN A;  1P0H A;  2CNS A;  3SXN A;  1I21 A;  2G3A A;  1WWZ A;  5IB9 A;  2ZEH A;  1IOI A;  3NH5 A;  1VKC A;  2P6E A;  2VXK A;  4Z65 A;  5K8M A;  4CAW A;  4CYQ A;  2PR1 A;  2PDO A;  4C7H A;  3D7G A;  4A39 A;  3GB0 A;  3IU2 A;  4UWI A;  5F47 A;  5LRG A;  1Z2L A;  2PJC A;  3DDD A;  3F0A A;  4P4B A;  5A27 A;  4OC3 A;  3PRT A;  1MK4 A;  2G0B A;  2Z3O A;  4HNW B;  3B3T A;  3QB8 A;  2EUI A;  4PSW A;  4R87 A;  1FNO A;  1YR0 A;  2FSR A;  2PRQ A;  3IWE A;  3H8E A;  5IB0 A;  4P44 A;  4JYW A;  4KOX A;  2Q4Z A;  4PV6 A;  2OH1 A;  2B5G A; 
#chains in the Genus database with same CATH homology
 3D67 A;  2ZOF A;  1VGY A;  1VHE A;  4DJL A;  4UIB A;  1IY7 A;  3FEE A;  4F8Z A;  3PB9 X;  3WC5 A;  1BAV A;  3TC8 A;  2PJB A;  3QNV A;  3WC7 A;  2V77 A;  3B3V A;  1BPM A;  5HVF A;  3BXM A;  3PEI A;  1QMU A;  1ZLI A;  4DUK A;  3RZA A;  2GLF A;  2JBK A;  4R6T A;  1FT7 A;  1TKH A;  4R76 A;  4FAI A;  4X8I A;  2IJZ A;  3V7Z A;  3KQZ A;  2C6P A;  4FUU A;  2V8H A;  4TNU A;  3CPX A;  1DE4 C;  2QVP A;  3D7D A;  5LYD A;  3D66 A;  4OKO A;  3DGV A;  2PJ2 A;  3NH4 A;  3CDX A;  1M4L A;  2JBJ A;  3CT9 A;  3SI2 A;  2PCU A;  4ZX9 A;  2V8V A;  3FVL A;  4CPA A;  4UIA A;  2ZEM A;  2C6G A;  4UEF A;  4OME A;  2ZED A;  2C1C A;  4EME A;  3K2K A;  4P6Y A;  2EWB A;  4IK2 A;  7CPA A;  4OIW A;  2EK8 A;  4ZX8 A;  4MCQ A;  2HB6 A;  5I4M A;  1Y7E A;  3VAT A;  4ZYQ A;  4FBE A;  1ELL P;  4NGN A;  4NJR A;  5CBM A;  3HUV A;  2PJA A;  2F8H A;  5JH9 A;  3PB6 X;  1JQG A;  3KL9 A;  2OR4 A;  4ONW A;  4ZI6 A;  2RFH A;  3SI0 A;  2QYV A;  3I1U A;  2RB7 A;  4NGS A;  4ZY2 A;  1H8L A;  3B3S A;  2XEI A;  3RBU A;  4IHM A;  4MMO A;  3WT4 A;  3PB8 X;  1TF9 A;  2PJ4 A;  2PJ6 A;  2PIZ A;  5HVH A;  3BHX A;  4JZ0 A;  1RTQ A;  5D8N A;  4OC5 A;  4WWV A;  2OOT A;  4PXB A;  4MXU A;  2ZEG A;  4BD9 A;  5JGF A;  3LWU A;  1Y0Y A;  4KSI A;  2CTB A;  6CPA A;  4NGQ A;  3D68 A;  4P4E A;  3CPA A;  2IQ6 A;  3BI1 A;  3IJ3 A;  2PJ7 A;  5J1Q A;  4W9Y A;  3L2N A;  3KHX A;  3FED A;  2GRE A;  2NYQ A;  3S9L A;  5HVG A;  4RUH A;  1LFW A;  3BI0 A;  1F57 A;  4O23 A;  4H2K A;  2FVG A;  4OC1 A;  4F9U A;  4DYO A;  4UEZ A;  5CPA A;  4EFD A;  3ISZ A;  4X2T A;  1BLL E;  3SI1 A;  3SJE A;  1BPN A;  1YW4 A;  3JRU A;  4PXC A;  4NGT A;  4X3R A;  1CP6 A;  2GU2 A;  1ARL A;  1YLO A;  3B3W A;  4P45 A;  2V8G A;  2AFS A;  3SJG A;  1GYT A;  1Z5R A;  5D29 A;  3K9T A;  1LAN A;  3N5F A;  2AFO A;  1XJO A;  4NGR A;  2GLJ A;  3VAR A;  3GLJ A;  3FEC A;  2PE3 A;  4MRI A;  1LAP A;  2ABZ A;  1CPS A;  3PB7 X;  1XMB A;  1Y0R A;  4A94 A;  1YSJ A;  1LCP A;  3IFE A;  5HXD A;  3NFZ A;  4PXD A;  4PPZ A;  4EWT A;  1ZG7 A;  4P4D A;  1EE3 P;  4LQG A;  2JEW A;  1F2P A;  4OC2 A;  3FJU A;  3PB4 X;  3FH4 A;  2POK A;  1IGB A;  3NA6 A;  1CP7 A;  3PBE A;  2I3C A;  2AFZ A;  2O53 A;  2O4H A;  1TKJ A;  4YU9 A;  2ZEF A;  1HEE A;  4OC0 A;  2Q43 A;  4MHZ A;  4MCS A;  3PFE A;  1ZG9 A;  2XEG A;  3KQX A;  1XBU A;  4MCR A;  1XFO A;  1VIX A;  4A38 A;  1DTD A;  2AFM A;  2ZEO A;  5K8N A;  4UEE A;  1HDQ A;  3KHZ A;  2PJ5 A;  4MHY A;  4P10 A;  3S9M A;  5DS0 A;  3B35 A;  4FWU A;  2ZOG A;  2J9A A;  3FMC A;  1KWM A;  2WZN A;  4IAV A;  3KR5 A;  2V8D A;  2ANP A;  1Q7L A;  1F2O A;  3D7F A;  3WAB A;  2VL1 A;  3KI9 A;  3IIB A;  4GM5 A;  1YW6 A;  2CTC A;  2PJ1 A;  4B6Z A;  2AFX A;  5LYF A;  3H8F A;  1CG2 A;  2C6C A;  2ZEP A;  1TXR A;  4TWE A;  4PQA A;  1PCA A;  2AFW A;  2XEF A;  3PFO A;  5LYL A;  1PYT B;  5JM6 A;  4NFR A;  2ZEL A;  2IMO A;  1TKF A;  2ZEN A;  4P4F A;  4MHP A;  3IO1 A;  8CPA A;  4ZY0 A;  2BO9 A;  1AMP A;  4NGM A;  1UWY A;  1CX8 A;  5THW A;  1ELM P;  4OP4 A;  2WYR A;  1R43 A;  2PIY A;  2G9D A;  1NSA A;  2PVV A;  1ARM A;  2HC9 A;  1Z8L A;  5LRK A;  3IC1 A;  3ISX A;  2EK9 A;  4OID A;  5ELY A;  2PJ3 A;  4A37 A;  1AYE A;  3B2Y A;  4Q7A A;  1XRY A;  4NGP A;  2CF4 A;  3VH9 A;  2NSM A;  4MHN A;  3MRU A;  4R7M A;  3NH8 A;  3SJX A;  4P4J A;  3LMS A;  2BCO A;  4UF4 A;  4WJB A;  5K8O A;  2F7V A;  3B7I A;  3RAM A;  4AXV A;  2DEA A;  3IEH A;  1VHO A;  2CIJ A;  2ZEE A;  3T8W A;  4G1P A;  1CPX A;  3D7H A;  3DLJ A;  3IWW A;  3KAS A;  1YME A;  2PJ8 A;  4YWY A;  3FX6 A;  3D4U A;  2AFU A;  4K3N A;  4MCP A;  1TF8 A;  5LRJ A;  4OC4 A;  3SJF A;  1OBR A;  4R8F A;  3KR4 A;  1ZLH A;  2QJ8 A;  2PJ9 A;  3B3C A;  4F9V A;  5K8P A;  2Q51 A;  3KGQ A;  2BOA A;  3GUX A;  5F09 A;  3FF3 A;  3V38 A;  3PBB A;  3WC6 A;  1ZG8 A;  4P4I A;  1QQ9 A;  3MN8 A;  3S9N A;  1HDU A;  2XEJ A;  1LAM A;  3KZW A;  1R3N A;  3H8G A;  1CBX A;  3HLP A;  5LYI A;  2PVW A;  2PJ0 A;  4PXE A;  3TX8 A;  4NJQ A;  4ZY1 A;  5IB9 A;  2ZEH A;  3NH5 A;  4Z65 A;  5K8M A;  3D7G A;  4A39 A;  3GB0 A;  5LRG A;  1Z2L A;  2PJC A;  4P4B A;  4OC3 A;  3PRT A;  3B3T A;  1FNO A;  2PRQ A;  3H8E A;  4P44 A;  4JYW A;  2Q4Z A;  1LOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...