3KI9A

Crystal structure of staphylococcus aureus metallopeptidase (sapep/dape) in the mn2+ bound form
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
470
structure length
467
Chain Sequence
SMWKEKVQQYEDQIINDLKGLLAIESVRDDAKASEDAPVGPGPRKALDYMYEIAHRDGFTTHDVDHIAGRIEAGKGNDVLGILCHVDVVPAGDGWDSNPFEPVVTEDAIIARGTLDDKGPTIAAYYAIKILEDMNVDWKKRIHMIIGTDEESDWKCTDRYFKTEEMPTLGFAPDAEFPCIHGEKGITTFDLVQNKLQDEPDYELITFKSGERYNMVPDHAEARVLVKENMTDVIQDFEYFLEQNHLQGDSTVDSGILVLTVEGKAVHGMDPSIGVNAGLYLLKFLASLNLDNNAQAFVAFSNRYLFNSDFGEKMGMKFHTDVMGDVTTNIGVITYDNENAGLFGINLRYPEGFEFEKAMDRFANEIQQYGFEVKLGKVQPPHYVDKNDPFVQKLVTAYRNQTNDMTEPYTIGGGTYARNLDKGVAFGAMFSDSEDLMHQKNEYITKKQLFNATSIYLEAIYSLCVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dipeptidase SACOL1801
publication title Crystal structure of Staphylococcus aureus metallopeptidase (Sapep) reveals large domain motions between the manganese-bound and apo-states
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 141
structure length 467
sequence length 470
ec nomenclature ec 3.4.13.-:
pdb deposition date 2009-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3ki9A01
1QQ9A 3D7HA 4MCQA 2AFUA 3PB4X 2AFXA 3GLJA 3CPAA 3PEIA 4B6ZA 4ZY1A 4R7MA 1LOKA 2HC9A 2ZEPA 3QNVA 5LRGA 4IHMA 8CPAA 2GLJA 4MCSA 1JQGA 4YU9A 4ZY0A 2NSMA 5K8PA 4MHZA 3FX6A 2GREA 3BHXA 1QMUA 1CBXA 5ELYA 1TKFA 2PJ2A 1TF8A 4OC0A 4P4BA 1Z8LA 5HVGA 3PB6X 3H8GA 4R8FA 3KQXA 1VHEA 5J1QA 1CP7A 2ZOGA 2HB6A 4A38A 1XBUA 4GM5A 3KQZA 3ISXA 2V8HA 2CTCA 1F2PA 4EMEA 2PJ5A 2PIZA 3K2KA 4UEFA 1FNOA 3CPXA 1Q7LA 1PCAA 4MHYA 3S9LA 2PJ7A 5HXDA 2XEGA 4MCPA 3PFEA 2JBKA 3TC8A 4P4IA 1UWYA 3KGQA 3NH8A 1LAPA 4FWUA 2F8HA 2IJZA 2ZEFA 1ZG7A 3WT4A 4FAIA 4OC3A 4UEEA 2PJBA 3IFEA 2C1CA 4DJLA 2PRQA 3HLPA 4P4EA 3NH4A 4A37A 2PJ3A 2DEAA 4OMEA 4MCRA 4CPAA 1LCPA 3SJFA 1Y0YA 4OIWA 5LRJA 2BCOA 3NFZA 2PJ9A 3ISZA 4MRIA 1PYTB 3KR4A 4EWTA 4PXEA 4A94A 2FVGA 3PB8X 2V8VA 1BLLE 3B3TA 2V8DA 3KHXA 3SJEA 3FH4A 2PJ0A 3MRUA 4IAVA 3VARA 2GU2A 1GYTA 3WC5A 3BXMA 2AFOA 3S9NA 4P4FA 4PPZA 5K8NA 1LFWA 1EE3P 5LYFA 2ZEEA 5JGFA 2PE3A 4K3NA 4FUUA 1KWMA 1ZLIA 4WJBA 1NSAA 5K8MA 4P6YA 1AYEA 4JYWA 3KR5A 4DYOA 4P4DA 4A39A 3RZAA 4BD9A 1Y0RA 3FEEA 1CG2A 1ZG9A 3B35A 3CT9A 3B3VA 2QYVA 2C6PA 4TNUA 3BI1A 4LQGA 2PIYA 2ZELA 4OC2A 3FF3A 3WABA 1RTQA 2ZOFA 3BI0A 4F9UA 2WYRA 1YMEA 2CTBA 2JBJA 2PJ6A 4F8ZA 1OBRA 1F2OA 2ZEMA 3DLJA 4F9VA 4H2KA 1ELLP 2Q51A 1ARMA 4NGPA 5LYLA 4OC4A 4MXUA 3NH5A 2C6CA 2V8GA 2PJ4A 1R43A 3GUXA 3D7DA 3PBEA 2PJ1A 3IO1A 2NYQA 1F57A 4NGTA 3D4UA 1Z5RA 4JZ0A 4O23A 2JEWA 3K9TA 7CPAA 3S9MA 3V7ZA 4R6TA 4ONWA 4P45A 3FVLA 1YSJA 3PRTA 3L2NA 2Q4ZA 4R76A 3KASA 2RB7A 4OP4A 2XEJA 3IWWA 1YW4A 3D7FA 4UIAA 3B7IA 3B2YA 4NGSA 5CBMA 4X2TA 4ZX9A 1ZG8A 3NA6A 5D29A 6CPAA 2AFSA 2EWBA 2OR4A 2PCUA 3PB7X 1TKJA 2WZNA 2I3CA 3IC1A 3LWUA 1XJOA 2ZEGA 2IMOA 2ANPA 4FBEA 5LYIA 2AFZA 3N5FA 2V77A 1YLOA 3SI1A 1HDQA 3D67A 4P10A 3KZWA 1HDUA 2RFHA 2PJAA 4X3RA 4OKOA 3KHZA 4PXBA 4DUKA 2Q43A 5LRKA 4EFDA 2QJ8A 4OIDA 3PBBA 3WC7A 3JRUA 1DTDA 3FECA 2ZEHA 3LMSA 4ZY2A 2GLFA 4YWYA 4Z65A 1BPNA 2PVWA 4UEZA 1M4LA 4AXVA 3IEHA 4NGNA 1VGYA 2C6GA 2G9DA 3TX8A 1TKHA 1IY7A 1XFOA 2AFWA 1XMBA 5DS0A 3SJXA 2AFMA 4RUHA 4ZI6A 1XRYA 4NJRA 3VH9A 4OC5A 4NGQA 4UIBA 3IJ3A 4PXDA 3FJUA 5THWA 1VHOA 2ZEOA 4W9YA 5I4MA 2CF4A 1YW6A 3SJGA 4IK2A 2CIJA 3H8EA 3PB9X 4X8IA 4ZYQA 1ARLA 2O4HA 2F7VA 5LYDA 3GB0A 1BPMA 3B3CA 4ZX8A 1FT7A 5JH9A 1LANA 3D68A 1CP6A 1HEEA 4G1PA 1H8LA 3FEDA 3D66A 4PXCA 4Q7AA 3HUVA 1TXRA 2ZEDA 2PVVA 3B3SA 1ELMP 2OOTA 3KL9A 4MMOA 1R3NA 2BOAA 3V38A 3D7GA 3PFOA 1AMPA 2PJCA 4NGRA 2IQ6A 3IIBA 3WC6A 5HVHA 4KSIA 1DE4C 3DGVA 3B3WA 3FMCA 4NJQA 1IGBA 4P4JA 1Z2LA 2QVPA 3RBUA 2XEFA 4TWEA 5K8OA 3VATA 5JM6A 5IB9A 4PQAA 3T8WA 2ABZA 3SI2A 2BO9A 4NGMA 3RAMA 3MN8A 4MHPA 1TF9A 3SI0A 1BAVA 5CPAA 3CDXA 1CPXA 4UF4A 4P44A 4MHNA 1LAMA 2ZENA 1ZLHA 1VIXA 3H8FA 4WWVA 1Y7EA 2O53A 5HVFA 2POKA 1CPSA 5D8NA 3KI9A 4NFRA 2PJ8A 2J9AA 3I1UA 2EK8A 2VL1A 2XEIA 5F09A 2EK9A 4OC1A 1CX8A
chains in the Genus database with same CATH superfamily
1CJWA 1QQ9A 3D7HA 4MCQA 2EO8A 2AFUA 4XPLA 3PB4X 2AFXA 3GLJA 3CPAA 3PEIA 4H6ZA 4B6ZA 3ZJ0A 4ZY1A 2FS5A 5G1ZA 4R7MA 1LOKA 2HC9A 2ZEPA 3QNVA 4JD6A 5LRGA 2HUZA 2G3AA 4IHMA 8CPAA 4UCPA 2BEIA 1XF8A 3JTKA 1MK4A 1Y7RA 2GLJA 2VI7A 2J8MA 1JQGA 4KVXA 4MCSA 2YNCC 1YREA 4YU9A 1Y9WA 4ZY0A 2NSMA 3CZXA 5K8PA 4MHZA 2QECA 2Z0ZA 3FX6A 4XPDB 2GREA 3BHXA 1QMUA 1CBXA 3N7ZA 5ELYA 5G20A 5FVJA 1TKFA 2G3TA 1Z4EA 2D4OA 2PJ2A 1TF8A 2EBJA 4OC0A 5E96A 2ZW5A 4BMHA 1U6MA 4P4BA 3DR8A 5ISVA 1Z8LA 2Z11A 4L89A 4CGMA 4ZGYB 5HVGA 4CAEA 3PB6X 3H8GA 3SXNA 1VKCA 4MY0A 4MFZA 2FXFA 3KQXA 4R8FA 1VHEA 4RS2A 3DDDA 5J1QA 1CP7A 4K30A 3IU1A 4I49A 2Z3MA 1XE4A 4KOTA 3T9YA 2ZOGA 3EO4A 3H5ZA 2GE3A 2CXAA 2HB6A 1MJAA 4A38A 1XBUA 4GM5A 3KQZA 3ISXA 4CAXA 1S7NA 2V8HA 4FD5A 4KLWA 2CTCA 2WPWA 1F2PA 2HV2A 3TOAA 2FT0A 4KVME 1R57A 4EMEA 4JWPA 2Y0MA 2PJ5A 1B87A 2PIZA 3K2KA 4UEFA 3EC4A 1FNOA 3CPXA 1M4DA 1Q7LA 3GY9A 4KOUA 1PCAA 4MHYA 3S9LA 2PJ7A 4NCZA 1QSMA 2BL1A 5CNPA 5HXDA 2CNTA 2XEGA 4UWJA 2JLMA 2VXKA 2QMLA 3P2HA 4KSAA 4MCPA 4B14A 3PFEA 2JBKA 3A9LA 1YX0A 2Z10A 4GXHA 3TC8A 4P4IA 1QSOA 1MJ9A 3ZZIA 1UWYA 3KGQA 3F5BA 3NH8A 4R87A 3V8IA 4MFKA 1LAPA 1QSRA 4FWUA 4A30A 1PUAA 2F8HA 2IJZA 2ZEFA 1ZG7A 3WT4A 4FAIA 2C27A 4OC3A 4UEEA 2ZW6A 2PJBA 4IUSA 4Q36A 3IFEA 3R95A 4CYOA 4ZI6A 5J8FA 2C1CA 4B12A 4BINA 4Y49C 4JLYA 4DJLA 2PRQA 3HLPA 4CRZB 3LD2A 4P4EA 3NH4A 4A37A 2PJ3A 2DEAA 4OAEA 1Q2DA 4KZTA 2J8NA 4M6IA 4MCRA 3BLNA 4OMEA 4R3KA 1LCPA 2VZYA 4CPAA 4MBUA 1M4GA 1Y0YA 3SJFA 1YQEA 1XEBA 4C2YA 4OIWA 4MFQA 5LRJA 2BCOA 2GIVA 2B5GB 3NFZA 1XOVA 4H6UA 4UFXA 2PJ9A 3ISZA 4MRIA 3S6FA 1PYTB 3UY5A 3KR4A 4KORA 4A2ZA 4EWTA 2EUIA 4PXEA 5EBVA 4F6AA 4MY3A 3E0KA 2R1IA 1UFHA 1NSLA 4A94A 4QBJA 4UWIA 2FVGA 3PB8X 2V8VA 2O28A 2Q4VA 2Q7BA 1BLLE 2EVNA 4YGOA 3B3TA 2V8DA 3KHXA 3SJEA 3PZJA 3FH4A 2PJ0A 3MRUA 1Q2YA 4IAVA 5AG5A 5HH1A 3VARA 3W91A 2GU2A 4CGLA 3BJ8A 5JH9A 1GYTA 1RXTA 4QB9A 3WC5A 3BXMA 4BBHA 2AFOA 1IICA 2NMTA 5EMIA 3S9NA 4P4FA 4PPZA 1N71A 3R1KA 4NXYA 3FBUA 5K8NA 1LFWA 4HNYB 1EE3P 3NE8A 2ZEEA 5LYFA 4MFPA 5JGFA 4KOSA 4B13A 2PE3A 4K3NA 3W6SA 4A95A 4UFVA 3WR7A 4FUUA 3FB3A 3EXNA 1GHEA 1KWMA 2A4NA 2P6FA 2OZGA 2WUUA 4AG9A 1ZLIA 2DPSA 3I9SA 4PSXA 4X8IA 4PK3A 3W6XA 3LODA 4WJBA 4HKFA 3G8WA 2R7HA 4M6GA 1NSAA 2OZUA 2ZXVA 1AYEA 4JYWA 3KR5A 4P6YA 5K8MA 3RO0A 2B3UA 4DYOA 4P4DA 4A39A 4C2XA 3RZAA 2ZW7A 1FY7A 4C7HA 4BD9A 1Y0RA 3FEEA 1CG2A 2Q04A 2WSAA 4ZYQA 1S3ZA 1Q2CA 4PSWA 1ZG9A 4YRHA 3B35A 3CT9A 1X12A 2OU2A 2QYVA 3B3VA 3JUWA 2C6PA 4TNUA 3TT2A 3BI1A 4II9A 3D3SA 2H5MA 4LQGA 3LACA 1K4JA 5A28A 1Z8WA 2PRBA 2YNCA 2F5IA 2PIYA 2ZELA 3CXPA 4OC2A 3FF3A 3WABA 4XPKA 4CYQA 1RTQA 2ZOFA 3BI0A 4A32A 4F9UA 2WYRA 1YMEA 1J4JA 2CTBA 2JBJA 2PJ6A 4F8ZA 4E2AA 1OBRA 1F2OA 2ZEMA 3DLJA 4F9VA 4H2KA 4JJXA 2DXQA 5H86A 2Z3NA 4HNXB 1ELLP 2Q51A 1ARMA 1Z4RA 1Z9UA 2BUEA 3EFAA 4ONUA 4NGPA 4OC4A 4A31A 5LYLA 4KOVA 2CNMA 1IYLA 4MXUA 3NH5A 5I0CA 2RC4A 1M4IA 2C6CA 4UFWA 5G22A 3B8GA 2V8GA 2QIRA 2G0BA 2FIAA 4FD4A 4YFJA 2HQYA 2PJ4A 2Q0YA 1JWQA 1R43A 4B5PB 3GUXA 3D7DA 3PBEA 3DNSA 2PJ1A 1KUXA 2BSWA 2NYQA 3FRMA 3IO1A 2ZPAA 4OLLA 1F57A 4NGTA 2P6EA 3D4UA 1Z5RA 4JZ0A 4O23A 4B5PA 5HMNA 2JEWA 3IU2A 3K9TA 2WPXA 3S9MA 3V7ZA 7CPAA 4R6TA 4ONWA 3PP9A 4P45A 3S6KA 4CAVA 3H4QA 4ORFA 3FVLA 3TE4A 1YSJA 4MHDA 4C68A 3PRTA 4PV6A 3L2NA 2B3VA 2YGWA 2ARHA 5IV0A 3TCVA 1I1DA 2Q4ZA 4R76A 5IB0A 4EVYA 3KASA 3R9FA 2GFQA 2RB7A 4OP4A 4XNHC 1PU9A 2XEJA 3IWWA 5BWAB 1YW4A 4CAWA 3D7FA 1S60A 3R96A 4UIAA 5A27A 3TOBA 3IGRA 3TO9A 3GYAA 3B7IA 4JXRA 3B2YA 4NGSA 2D4PA 5CBMA 3EY5A 1LRZA 1YGHA 4X2TA 4Y49B 5GCNA 2FIWA 4ZX9A 3F0AA 1ZG8A 3NA6A 5D29A 4FD7A 2Q44A 3VWEA 4C2ZA 6CPAA 3IWEA 2AFSA 3QAYA 4MFJA 4AG7A 2EWBA 5F49A 2OR4A 1KUYA 2PCUA 3PB7X 1S7KA 1TKJA 2WZNA 2I3CA 3C26A 1YVKA 3IC1A 3LWUA 3TO6A 5J8CA 1M44A 1XJOA 2ZEGA 2IMOA 4KS9A 2ANPA 3TFYA 2J8RA 2JDCA 4M6HA 4MI4A 2Z3LA 1IU8A 2IL4A 5H84A 1OZPA 1L0CA 2YNDA 4FBEA 1IOFA 5AG6A 4PK2A 1CM0A 1Z8XA 3PGPA 4QVTA 4B5OA 5LYIA 2AFZA 3N5FA 4DNCA 2V77A 1YLOA 3SI1A 1QSNA 1HDQA 3D67A 2GANA 3FNCA 2AJ6A 3KZWA 1HDUA 4P10A 2B4BA 5F46A 5C88A 2RFHA 2PJAA 4X3RA 4OKOA 2AE6A 2R98A 3KHZA 4R9MA 4PXBA 4DUKA 2PSWA 2Q43A 5LRKA 4LUAA 4EFDA 3KKWA 2QJ8A 4OIDA 3GKRA 4CYPA 3PBBA 2FSRA 1M1DA 2CNSA 3S6HA 3WC7A 5KTCA 3JRUA 1DTDA 3FECA 2P0WA 2PR8A 2ZEHA 3LMSA 2ATRA 2OZHA 1VHSA 2DF5A 2VBQA 4ZY2A 5AG7A 2GLFA 4YWYA 4Z65A 2FCKA 1BPNA 3IWGA 2VQYA 2PVWA 4UEZA 4XPDC 1M4LA 5AG4A 3FYNA 1S5KA 3IEHA 1S7LA 5F47A 4AXVA 4NGNA 5JPHA 1VGYA 2C6GA 4FD6A 3BJ7A 2PR1A 2G9DA 3NE7A 4MFLA 5DWNA 3TX8A 1TKHA 1IY7A 1NMTA 1XFOA 2AFWA 1XMBA 3CXQA 4E8OA 5DS0A 4RI1A 3SJXA 2AFMA 4RUHA 3K9UA 4IF5A 4JXQA 4AVBA 1WK4A 2Z3KA 3TO7A 1XRYA 1ZO0A 4CRYB 1P4NA 4NJRA 3VH9A 4OC5A 3MGDA 4NGQA 4KUBA 4R3LA 4B11A 4UIBA 3FXTA 1IB1E 3JVNA 2FE7A 3IJ3A 4PXDA 3FJUA 4KOXA 5THWA 1VHOA 1A2ZA 1KUVA 4U9YA 4AVCA 2ZEOA 3DSBA 4GS4A 4W9YA 5G21A 5F48A 3VWDA 4CYNA 3P2FA 2CF4A 5I4MA 1IIDA 1YW6A 4UCMA 3SJGA 4Q38A 4IK2A 2FL4A 4CGNA 2CIJA 3FIXA 3H8EA 1V0CA 1AUGA 1ARLA 1WWZA 1X10A 2O4HA 3PB9X 2F7VA 4KLVA 5LYDA 3OWCA 3GB0A 1BPMA 2R8VA 2YNEA 3B3CA 4L8AA 4ZX8A 1FT7A 3F8KA 1BOBA 1B6BA 1I12A 1LANA 3D68A 4U5YA 4A33A 1CP6A 5DWMA 1HEEA 4G1PA 4B10A 3G3SA 2Q7SA 4KOWA 2ZW4A 1H8LA 3FEDA 1Z8TA 3D66A 4PXCA 1IYKA 1YR0A 4ZBGA 4Q7AA 5JQ4A 3SXOA 3HUVA 4KSFA 1TXRA 2ZEDA 4M3SA 2PVVA 5KTAA 3B3SA 2REFA 2VEZA 1SQHA 2PC1A 2K5TA 2Q4YA 4LQ6A 1ELMP 4RN7A 3KL9A 2OOTA 4MMOA 4NEXA 4KUAA 4CAFA 2I79A 3SHPA 1R3NA 1IOIA 4CGPA 2BOAA 4UBRA 3V38A 5KTDA 3D7GA 3D2MA 3PFOA 1AMPA 2PJCA 4NF1A 4NGRA 4AB7A 1TIQA 4HPSA 2IQ6A 3IIBA 3R9GA 1S7FA 1YVOA 5AGEA 4J3GA 4OADA 3WC6A 5HVHA 1QSTA 1KZFA 4KSIA 1Y9KA 1DE4C 3DGVA 4U9ZA 1RO5A 4X5KA 1YLEA 2JDDA 2OH1A 3B3WA 4QUSA 4AVAA 2CY2A 2Z3OA 3FMCA 4NJQA 1IGBA 1ON0A 4KOYA 2OB0A 4H89A 4UA3A 4R57A 4P4JA 1Z2LA 2I00A 4CS0B 4QC6A 2QVPA 3RNZA 3RBUA 2PDOA 4XNHB 2REEA 3D8PA 2XEFA 4TWEA 4F0XA 5K8OA 3VATA 5JM6A 5IB9A 4PQAA 1MJBA 3T8WA 1NE9A 2ABZA 2Z3PA 3SI2A 2BO9A 3QB8A 2DPTA 4LX9A 4NGMA 1YK3A 3RAMA 3MN8A 4MHPA 4C7IA 1TF9A 5IX3A 3S6GA 3CXSA 2X7BA 2ODFA 3SI0A 1BAVA 2KCWA 5CPAA 3CDXA 2P6GA 1CPXA 4KVOE 4UF4A 4P44A 4MHNA 1LAMA 2ZENA 1ZLHA 1VIXA 3H8FA 3I3GA 4MJ8A 4NSQA 4WWVA 3D2PA 3R9EA 1Y7EA 1XMTA 2O53A 4HNWB 2B4DB 4F0YA 2JEVA 2B5GA 3RYOA 1BO4A 2B58A 2POKA 1CPSA 5D8NA 5HVFA 3KI9A 4M85A 4NFRA 1I21A 2PJ8A 2J9AA 2VZZA 3I1UA 2EK8A 2VL1A 2B4DA 2XEIA 1P0HA 5F09A 3DR6A 3GIUA 2EK9A 4CGOA 4OC1A 4UCNA 3T90A 2PQ8A 3QAHA 4E0AA 1XIXA 5EC4A 5C82A 1CX8A 3TTHA
chains in the Genus database with same CATH topology
1QQ9A 3D7HA 4MCQA 2AFUA 3PB4X 2AFXA 3GLJA 3CPAA 3PEIA 4B6ZA 4ZY1A 4R7MA 1LOKA 2HC9A 2ZEPA 3QNVA 5LRGA 4IHMA 8CPAA 2GLJA 4MCSA 1JQGA 4YU9A 4ZY0A 2NSMA 5K8PA 4MHZA 3FX6A 2GREA 3BHXA 1QMUA 1CBXA 5ELYA 1TKFA 2PJ2A 1TF8A 4OC0A 4P4BA 1Z8LA 5HVGA 3PB6X 3H8GA 4R8FA 3KQXA 1VHEA 5J1QA 1CP7A 2ZOGA 2HB6A 4A38A 1XBUA 4GM5A 3KQZA 3ISXA 2V8HA 2CTCA 1F2PA 4EMEA 2PJ5A 2PIZA 3K2KA 4UEFA 1FNOA 3CPXA 1Q7LA 1PCAA 4MHYA 3S9LA 2PJ7A 5HXDA 2XEGA 4MCPA 3PFEA 2JBKA 3TC8A 4P4IA 1UWYA 3KGQA 3NH8A 1LAPA 4FWUA 2F8HA 2IJZA 2ZEFA 1ZG7A 3WT4A 4FAIA 4OC3A 4UEEA 2PJBA 3IFEA 2C1CA 4DJLA 2PRQA 3HLPA 4P4EA 3NH4A 4A37A 2PJ3A 2DEAA 4OMEA 4MCRA 4CPAA 1LCPA 3SJFA 1Y0YA 4OIWA 5LRJA 2BCOA 3NFZA 2PJ9A 3ISZA 4MRIA 1PYTB 3KR4A 4EWTA 4PXEA 4A94A 2FVGA 3PB8X 2V8VA 1BLLE 3B3TA 2V8DA 3KHXA 3SJEA 3FH4A 2PJ0A 3MRUA 4IAVA 3VARA 2GU2A 1GYTA 3WC5A 3BXMA 2AFOA 3S9NA 4P4FA 4PPZA 5K8NA 1LFWA 1EE3P 5LYFA 2ZEEA 5JGFA 2PE3A 4K3NA 4FUUA 1KWMA 1ZLIA 4WJBA 1NSAA 5K8MA 4P6YA 1AYEA 4JYWA 3KR5A 4DYOA 4P4DA 4A39A 3RZAA 4BD9A 1Y0RA 3FEEA 1CG2A 1ZG9A 3B35A 3CT9A 3B3VA 2QYVA 2C6PA 4TNUA 3BI1A 4LQGA 2PIYA 2ZELA 4OC2A 3FF3A 3WABA 1RTQA 2ZOFA 3BI0A 4F9UA 2WYRA 1YMEA 2CTBA 2JBJA 2PJ6A 4F8ZA 1OBRA 1F2OA 2ZEMA 3DLJA 4F9VA 4H2KA 1ELLP 2Q51A 1ARMA 4NGPA 5LYLA 4OC4A 4MXUA 3NH5A 2C6CA 2V8GA 2PJ4A 1R43A 3GUXA 3D7DA 3PBEA 2PJ1A 3IO1A 2NYQA 1F57A 4NGTA 3D4UA 1Z5RA 4JZ0A 4O23A 2JEWA 3K9TA 7CPAA 3S9MA 3V7ZA 4R6TA 4ONWA 4P45A 3FVLA 1YSJA 3PRTA 3L2NA 2Q4ZA 4R76A 3KASA 2RB7A 4OP4A 2XEJA 3IWWA 1YW4A 3D7FA 4UIAA 3B7IA 3B2YA 4NGSA 5CBMA 4X2TA 4ZX9A 1ZG8A 3NA6A 5D29A 6CPAA 2AFSA 2EWBA 2OR4A 2PCUA 3PB7X 1TKJA 2WZNA 2I3CA 3IC1A 3LWUA 1XJOA 2ZEGA 2IMOA 2ANPA 4FBEA 5LYIA 2AFZA 3N5FA 2V77A 1YLOA 3SI1A 1HDQA 3D67A 4P10A 3KZWA 1HDUA 2RFHA 2PJAA 4X3RA 4OKOA 3KHZA 4PXBA 4DUKA 2Q43A 5LRKA 4EFDA 2QJ8A 4OIDA 3PBBA 3WC7A 3JRUA 1DTDA 3FECA 2ZEHA 3LMSA 4ZY2A 2GLFA 4YWYA 4Z65A 1BPNA 2PVWA 4UEZA 1M4LA 4AXVA 3IEHA 4NGNA 1VGYA 2C6GA 2G9DA 3TX8A 1TKHA 1IY7A 1XFOA 2AFWA 1XMBA 5DS0A 3SJXA 2AFMA 4RUHA 4ZI6A 1XRYA 4NJRA 3VH9A 4OC5A 4NGQA 4UIBA 3IJ3A 4PXDA 3FJUA 5THWA 1VHOA 2ZEOA 4W9YA 5I4MA 2CF4A 1YW6A 3SJGA 4IK2A 2CIJA 3H8EA 3PB9X 4X8IA 4ZYQA 1ARLA 2O4HA 2F7VA 5LYDA 3GB0A 1BPMA 3B3CA 4ZX8A 1FT7A 5JH9A 1LANA 3D68A 1CP6A 1HEEA 4G1PA 1H8LA 3FEDA 3D66A 4PXCA 4Q7AA 3HUVA 1TXRA 2ZEDA 2PVVA 3B3SA 1ELMP 2OOTA 3KL9A 4MMOA 1R3NA 2BOAA 3V38A 3D7GA 3PFOA 1AMPA 2PJCA 4NGRA 2IQ6A 3IIBA 3WC6A 5HVHA 4KSIA 1DE4C 3DGVA 3B3WA 3FMCA 4NJQA 1IGBA 4P4JA 1Z2LA 2QVPA 3RBUA 2XEFA 4TWEA 5K8OA 3VATA 5JM6A 5IB9A 4PQAA 3T8WA 2ABZA 3SI2A 2BO9A 4NGMA 3RAMA 3MN8A 4MHPA 1TF9A 3SI0A 1BAVA 5CPAA 3CDXA 1CPXA 4UF4A 4P44A 4MHNA 1LAMA 2ZENA 1ZLHA 1VIXA 3H8FA 4WWVA 1Y7EA 2O53A 5HVFA 2POKA 1CPSA 5D8NA 3KI9A 4NFRA 2PJ8A 2J9AA 3I1UA 2EK8A 2VL1A 2XEIA 5F09A 2EK9A 4OC1A 1CX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQ9 A;  3D7H A;  4MCQ A;  2AFU A;  3PB4 X;  2AFX A;  3GLJ A;  3CPA A;  3PEI A;  4B6Z A;  4ZY1 A;  4R7M A;  1LOK A;  2HC9 A;  2ZEP A;  3QNV A;  5LRG A;  4IHM A;  8CPA A;  2GLJ A;  4MCS A;  1JQG A;  4YU9 A;  4ZY0 A;  2NSM A;  5K8P A;  4MHZ A;  3FX6 A;  2GRE A;  3BHX A;  1QMU A;  1CBX A;  5ELY A;  1TKF A;  2PJ2 A;  1TF8 A;  4OC0 A;  4P4B A;  1Z8L A;  5HVG A;  3PB6 X;  3H8G A;  4R8F A;  3KQX A;  1VHE A;  5J1Q A;  1CP7 A;  2ZOG A;  2HB6 A;  4A38 A;  1XBU A;  4GM5 A;  3KQZ A;  3ISX A;  2V8H A;  2CTC A;  1F2P A;  4EME A;  2PJ5 A;  2PIZ A;  3K2K A;  4UEF A;  1FNO A;  3CPX A;  1Q7L A;  1PCA A;  4MHY A;  3S9L A;  2PJ7 A;  5HXD A;  2XEG A;  4MCP A;  3PFE A;  2JBK A;  3TC8 A;  4P4I A;  1UWY A;  3KGQ A;  3NH8 A;  1LAP A;  4FWU A;  2F8H A;  2IJZ A;  2ZEF A;  1ZG7 A;  3WT4 A;  4FAI A;  4OC3 A;  4UEE A;  2PJB A;  3IFE A;  2C1C A;  4DJL A;  2PRQ A;  3HLP A;  4P4E A;  3NH4 A;  4A37 A;  2PJ3 A;  2DEA A;  4OME A;  4MCR A;  4CPA A;  1LCP A;  3SJF A;  1Y0Y A;  4OIW A;  5LRJ A;  2BCO A;  3NFZ A;  2PJ9 A;  3ISZ A;  4MRI A;  1PYT B;  3KR4 A;  4EWT A;  4PXE A;  4A94 A;  2FVG A;  3PB8 X;  2V8V A;  1BLL E;  3B3T A;  2V8D A;  3KHX A;  3SJE A;  3FH4 A;  2PJ0 A;  3MRU A;  4IAV A;  3VAR A;  2GU2 A;  1GYT A;  3WC5 A;  3BXM A;  2AFO A;  3S9N A;  4P4F A;  4PPZ A;  5K8N A;  1LFW A;  1EE3 P;  5LYF A;  2ZEE A;  5JGF A;  2PE3 A;  4K3N A;  4FUU A;  1KWM A;  1ZLI A;  4WJB A;  1NSA A;  5K8M A;  4P6Y A;  1AYE A;  4JYW A;  3KR5 A;  4DYO A;  4P4D A;  4A39 A;  3RZA A;  4BD9 A;  1Y0R A;  3FEE A;  1CG2 A;  1ZG9 A;  3B35 A;  3CT9 A;  3B3V A;  2QYV A;  2C6P A;  4TNU A;  3BI1 A;  4LQG A;  2PIY A;  2ZEL A;  4OC2 A;  3FF3 A;  3WAB A;  1RTQ A;  2ZOF A;  3BI0 A;  4F9U A;  2WYR A;  1YME A;  2CTB A;  2JBJ A;  2PJ6 A;  4F8Z A;  1OBR A;  1F2O A;  2ZEM A;  3DLJ A;  4F9V A;  4H2K A;  1ELL P;  2Q51 A;  1ARM A;  4NGP A;  5LYL A;  4OC4 A;  4MXU A;  3NH5 A;  2C6C A;  2V8G A;  2PJ4 A;  1R43 A;  3GUX A;  3D7D A;  3PBE A;  2PJ1 A;  3IO1 A;  2NYQ A;  1F57 A;  4NGT A;  3D4U A;  1Z5R A;  4JZ0 A;  4O23 A;  2JEW A;  3K9T A;  7CPA A;  3S9M A;  3V7Z A;  4R6T A;  4ONW A;  4P45 A;  3FVL A;  1YSJ A;  3PRT A;  3L2N A;  2Q4Z A;  4R76 A;  3KAS A;  2RB7 A;  4OP4 A;  2XEJ A;  3IWW A;  1YW4 A;  3D7F A;  4UIA A;  3B7I A;  3B2Y A;  4NGS A;  5CBM A;  4X2T A;  4ZX9 A;  1ZG8 A;  3NA6 A;  5D29 A;  6CPA A;  2AFS A;  2EWB A;  2OR4 A;  2PCU A;  3PB7 X;  1TKJ A;  2WZN A;  2I3C A;  3IC1 A;  3LWU A;  1XJO A;  2ZEG A;  2IMO A;  2ANP A;  4FBE A;  5LYI A;  2AFZ A;  3N5F A;  2V77 A;  1YLO A;  3SI1 A;  1HDQ A;  3D67 A;  4P10 A;  3KZW A;  1HDU A;  2RFH A;  2PJA A;  4X3R A;  4OKO A;  3KHZ A;  4PXB A;  4DUK A;  2Q43 A;  5LRK A;  4EFD A;  2QJ8 A;  4OID A;  3PBB A;  3WC7 A;  3JRU A;  1DTD A;  3FEC A;  2ZEH A;  3LMS A;  4ZY2 A;  2GLF A;  4YWY A;  4Z65 A;  1BPN A;  2PVW A;  4UEZ A;  1M4L A;  4AXV A;  3IEH A;  4NGN A;  1VGY A;  2C6G A;  2G9D A;  3TX8 A;  1TKH A;  1IY7 A;  1XFO A;  2AFW A;  1XMB A;  5DS0 A;  3SJX A;  2AFM A;  4RUH A;  4ZI6 A;  1XRY A;  4NJR A;  3VH9 A;  4OC5 A;  4NGQ A;  4UIB A;  3IJ3 A;  4PXD A;  3FJU A;  5THW A;  1VHO A;  2ZEO A;  4W9Y A;  5I4M A;  2CF4 A;  1YW6 A;  3SJG A;  4IK2 A;  2CIJ A;  3H8E A;  3PB9 X;  4X8I A;  4ZYQ A;  1ARL A;  2O4H A;  2F7V A;  5LYD A;  3GB0 A;  1BPM A;  3B3C A;  4ZX8 A;  1FT7 A;  5JH9 A;  1LAN A;  3D68 A;  1CP6 A;  1HEE A;  4G1P A;  1H8L A;  3FED A;  3D66 A;  4PXC A;  4Q7A A;  3HUV A;  1TXR A;  2ZED A;  2PVV A;  3B3S A;  1ELM P;  2OOT A;  3KL9 A;  4MMO A;  1R3N A;  2BOA A;  3V38 A;  3D7G A;  3PFO A;  1AMP A;  2PJC A;  4NGR A;  2IQ6 A;  3IIB A;  3WC6 A;  5HVH A;  4KSI A;  1DE4 C;  3DGV A;  3B3W A;  3FMC A;  4NJQ A;  1IGB A;  4P4J A;  1Z2L A;  2QVP A;  3RBU A;  2XEF A;  4TWE A;  5K8O A;  3VAT A;  5JM6 A;  5IB9 A;  4PQA A;  3T8W A;  2ABZ A;  3SI2 A;  2BO9 A;  4NGM A;  3RAM A;  3MN8 A;  4MHP A;  1TF9 A;  3SI0 A;  1BAV A;  5CPA A;  3CDX A;  1CPX A;  4UF4 A;  4P44 A;  4MHN A;  1LAM A;  2ZEN A;  1ZLH A;  1VIX A;  3H8F A;  4WWV A;  1Y7E A;  2O53 A;  5HVF A;  2POK A;  1CPS A;  5D8N A;  3KI9 A;  4NFR A;  2PJ8 A;  2J9A A;  3I1U A;  2EK8 A;  2VL1 A;  2XEI A;  5F09 A;  2EK9 A;  4OC1 A;  1CX8 A; 
#chains in the Genus database with same CATH topology
 1CJW A;  1QQ9 A;  3D7H A;  4MCQ A;  2EO8 A;  2AFU A;  4XPL A;  3PB4 X;  2AFX A;  3GLJ A;  3CPA A;  3PEI A;  4H6Z A;  4B6Z A;  3ZJ0 A;  4ZY1 A;  2FS5 A;  5G1Z A;  4R7M A;  1LOK A;  2HC9 A;  2ZEP A;  3QNV A;  4JD6 A;  5LRG A;  2HUZ A;  2G3A A;  4IHM A;  8CPA A;  4UCP A;  2BEI A;  1XF8 A;  3JTK A;  1MK4 A;  1Y7R A;  2GLJ A;  2VI7 A;  2J8M A;  1JQG A;  4KVX A;  4MCS A;  2YNC C;  1YRE A;  4YU9 A;  1Y9W A;  4ZY0 A;  2NSM A;  3CZX A;  5K8P A;  4MHZ A;  2QEC A;  2Z0Z A;  3FX6 A;  4XPD B;  2GRE A;  3BHX A;  1QMU A;  1CBX A;  3N7Z A;  5ELY A;  5G20 A;  5FVJ A;  1TKF A;  2G3T A;  1Z4E A;  2D4O A;  2PJ2 A;  1TF8 A;  2EBJ A;  4OC0 A;  5E96 A;  2ZW5 A;  4BMH A;  1U6M A;  4P4B A;  3DR8 A;  5ISV A;  1Z8L A;  2Z11 A;  4L89 A;  4CGM A;  4ZGY B;  5HVG A;  4CAE A;  3PB6 X;  3H8G A;  3SXN A;  1VKC A;  4MY0 A;  4MFZ A;  2FXF A;  3KQX A;  4R8F A;  1VHE A;  4RS2 A;  3DDD A;  5J1Q A;  1CP7 A;  4K30 A;  3IU1 A;  4I49 A;  2Z3M A;  1XE4 A;  4KOT A;  3T9Y A;  2ZOG A;  3EO4 A;  3H5Z A;  2GE3 A;  2CXA A;  2HB6 A;  1MJA A;  4A38 A;  1XBU A;  4GM5 A;  3KQZ A;  3ISX A;  4CAX A;  1S7N A;  2V8H A;  4FD5 A;  4KLW A;  2CTC A;  2WPW A;  1F2P A;  2HV2 A;  3TOA A;  2FT0 A;  4KVM E;  1R57 A;  4EME A;  4JWP A;  2Y0M A;  2PJ5 A;  1B87 A;  2PIZ A;  3K2K A;  4UEF A;  3EC4 A;  1FNO A;  3CPX A;  1M4D A;  1Q7L A;  3GY9 A;  4KOU A;  1PCA A;  4MHY A;  3S9L A;  2PJ7 A;  4NCZ A;  1QSM A;  2BL1 A;  5CNP A;  5HXD A;  2CNT A;  2XEG A;  4UWJ A;  2JLM A;  2VXK A;  2QML A;  3P2H A;  4KSA A;  4MCP A;  4B14 A;  3PFE A;  2JBK A;  3A9L A;  1YX0 A;  2Z10 A;  4GXH A;  3TC8 A;  4P4I A;  1QSO A;  1MJ9 A;  3ZZI A;  1UWY A;  3KGQ A;  3F5B A;  3NH8 A;  4R87 A;  3V8I A;  4MFK A;  1LAP A;  1QSR A;  4FWU A;  4A30 A;  1PUA A;  2F8H A;  2IJZ A;  2ZEF A;  1ZG7 A;  3WT4 A;  4FAI A;  2C27 A;  4OC3 A;  4UEE A;  2ZW6 A;  2PJB A;  4IUS A;  4Q36 A;  3IFE A;  3R95 A;  4CYO A;  4ZI6 A;  5J8F A;  2C1C A;  4B12 A;  4BIN A;  4Y49 C;  4JLY A;  4DJL A;  2PRQ A;  3HLP A;  4CRZ B;  3LD2 A;  4P4E A;  3NH4 A;  4A37 A;  2PJ3 A;  2DEA A;  4OAE A;  1Q2D A;  4KZT A;  2J8N A;  4M6I A;  4MCR A;  3BLN A;  4OME A;  4R3K A;  1LCP A;  2VZY A;  4CPA A;  4MBU A;  1M4G A;  1Y0Y A;  3SJF A;  1YQE A;  1XEB A;  4C2Y A;  4OIW A;  4MFQ A;  5LRJ A;  2BCO A;  2GIV A;  2B5G B;  3NFZ A;  1XOV A;  4H6U A;  4UFX A;  2PJ9 A;  3ISZ A;  4MRI A;  3S6F A;  1PYT B;  3UY5 A;  3KR4 A;  4KOR A;  4A2Z A;  4EWT A;  2EUI A;  4PXE A;  5EBV A;  4F6A A;  4MY3 A;  3E0K A;  2R1I A;  1UFH A;  1NSL A;  4A94 A;  4QBJ A;  4UWI A;  2FVG A;  3PB8 X;  2V8V A;  2O28 A;  2Q4V A;  2Q7B A;  1BLL E;  2EVN A;  4YGO A;  3B3T A;  2V8D A;  3KHX A;  3SJE A;  3PZJ A;  3FH4 A;  2PJ0 A;  3MRU A;  1Q2Y A;  4IAV A;  5AG5 A;  5HH1 A;  3VAR A;  3W91 A;  2GU2 A;  4CGL A;  3BJ8 A;  5JH9 A;  1GYT A;  1RXT A;  4QB9 A;  3WC5 A;  3BXM A;  4BBH A;  2AFO A;  1IIC A;  2NMT A;  5EMI A;  3S9N A;  4P4F A;  4PPZ A;  1N71 A;  3R1K A;  4NXY A;  3FBU A;  5K8N A;  1LFW A;  4HNY B;  1EE3 P;  3NE8 A;  2ZEE A;  5LYF A;  4MFP A;  5JGF A;  4KOS A;  4B13 A;  2PE3 A;  4K3N A;  3W6S A;  4A95 A;  4UFV A;  3WR7 A;  4FUU A;  3FB3 A;  3EXN A;  1GHE A;  1KWM A;  2A4N A;  2P6F A;  2OZG A;  2WUU A;  4AG9 A;  1ZLI A;  2DPS A;  3I9S A;  4PSX A;  4X8I A;  4PK3 A;  3W6X A;  3LOD A;  4WJB A;  4HKF A;  3G8W A;  2R7H A;  4M6G A;  1NSA A;  2OZU A;  2ZXV A;  1AYE A;  4JYW A;  3KR5 A;  4P6Y A;  5K8M A;  3RO0 A;  2B3U A;  4DYO A;  4P4D A;  4A39 A;  4C2X A;  3RZA A;  2ZW7 A;  1FY7 A;  4C7H A;  4BD9 A;  1Y0R A;  3FEE A;  1CG2 A;  2Q04 A;  2WSA A;  4ZYQ A;  1S3Z A;  1Q2C A;  4PSW A;  1ZG9 A;  4YRH A;  3B35 A;  3CT9 A;  1X12 A;  2OU2 A;  2QYV A;  3B3V A;  3JUW A;  2C6P A;  4TNU A;  3TT2 A;  3BI1 A;  4II9 A;  3D3S A;  2H5M A;  4LQG A;  3LAC A;  1K4J A;  5A28 A;  1Z8W A;  2PRB A;  2YNC A;  2F5I A;  2PIY A;  2ZEL A;  3CXP A;  4OC2 A;  3FF3 A;  3WAB A;  4XPK A;  4CYQ A;  1RTQ A;  2ZOF A;  3BI0 A;  4A32 A;  4F9U A;  2WYR A;  1YME A;  1J4J A;  2CTB A;  2JBJ A;  2PJ6 A;  4F8Z A;  4E2A A;  1OBR A;  1F2O A;  2ZEM A;  3DLJ A;  4F9V A;  4H2K A;  4JJX A;  2DXQ A;  5H86 A;  2Z3N A;  4HNX B;  1ELL P;  2Q51 A;  1ARM A;  1Z4R A;  1Z9U A;  2BUE A;  3EFA A;  4ONU A;  4NGP A;  4OC4 A;  4A31 A;  5LYL A;  4KOV A;  2CNM A;  1IYL A;  4MXU A;  3NH5 A;  5I0C A;  2RC4 A;  1M4I A;  2C6C A;  4UFW A;  5G22 A;  3B8G A;  2V8G A;  2QIR A;  2G0B A;  2FIA A;  4FD4 A;  4YFJ A;  2HQY A;  2PJ4 A;  2Q0Y A;  1JWQ A;  1R43 A;  4B5P B;  3GUX A;  3D7D A;  3PBE A;  3DNS A;  2PJ1 A;  1KUX A;  2BSW A;  2NYQ A;  3FRM A;  3IO1 A;  2ZPA A;  4OLL A;  1F57 A;  4NGT A;  2P6E A;  3D4U A;  1Z5R A;  4JZ0 A;  4O23 A;  4B5P A;  5HMN A;  2JEW A;  3IU2 A;  3K9T A;  2WPX A;  3S9M A;  3V7Z A;  7CPA A;  4R6T A;  4ONW A;  3PP9 A;  4P45 A;  3S6K A;  4CAV A;  3H4Q A;  4ORF A;  3FVL A;  3TE4 A;  1YSJ A;  4MHD A;  4C68 A;  3PRT A;  4PV6 A;  3L2N A;  2B3V A;  2YGW A;  2ARH A;  5IV0 A;  3TCV A;  1I1D A;  2Q4Z A;  4R76 A;  5IB0 A;  4EVY A;  3KAS A;  3R9F A;  2GFQ A;  2RB7 A;  4OP4 A;  4XNH C;  1PU9 A;  2XEJ A;  3IWW A;  5BWA B;  1YW4 A;  4CAW A;  3D7F A;  1S60 A;  3R96 A;  4UIA A;  5A27 A;  3TOB A;  3IGR A;  3TO9 A;  3GYA A;  3B7I A;  4JXR A;  3B2Y A;  4NGS A;  2D4P A;  5CBM A;  3EY5 A;  1LRZ A;  1YGH A;  4X2T A;  4Y49 B;  5GCN A;  2FIW A;  4ZX9 A;  3F0A A;  1ZG8 A;  3NA6 A;  5D29 A;  4FD7 A;  2Q44 A;  3VWE A;  4C2Z A;  6CPA A;  3IWE A;  2AFS A;  3QAY A;  4MFJ A;  4AG7 A;  2EWB A;  5F49 A;  2OR4 A;  1KUY A;  2PCU A;  3PB7 X;  1S7K A;  1TKJ A;  2WZN A;  2I3C A;  3C26 A;  1YVK A;  3IC1 A;  3LWU A;  3TO6 A;  5J8C A;  1M44 A;  1XJO A;  2ZEG A;  2IMO A;  4KS9 A;  2ANP A;  3TFY A;  2J8R A;  2JDC A;  4M6H A;  4MI4 A;  2Z3L A;  1IU8 A;  2IL4 A;  5H84 A;  1OZP A;  1L0C A;  2YND A;  4FBE A;  1IOF A;  5AG6 A;  4PK2 A;  1CM0 A;  1Z8X A;  3PGP A;  4QVT A;  4B5O A;  5LYI A;  2AFZ A;  3N5F A;  4DNC A;  2V77 A;  1YLO A;  3SI1 A;  1QSN A;  1HDQ A;  3D67 A;  2GAN A;  3FNC A;  2AJ6 A;  3KZW A;  1HDU A;  4P10 A;  2B4B A;  5F46 A;  5C88 A;  2RFH A;  2PJA A;  4X3R A;  4OKO A;  2AE6 A;  2R98 A;  3KHZ A;  4R9M A;  4PXB A;  4DUK A;  2PSW A;  2Q43 A;  5LRK A;  4LUA A;  4EFD A;  3KKW A;  2QJ8 A;  4OID A;  3GKR A;  4CYP A;  3PBB A;  2FSR A;  1M1D A;  2CNS A;  3S6H A;  3WC7 A;  5KTC A;  3JRU A;  1DTD A;  3FEC A;  2P0W A;  2PR8 A;  2ZEH A;  3LMS A;  2ATR A;  2OZH A;  1VHS A;  2DF5 A;  2VBQ A;  4ZY2 A;  5AG7 A;  2GLF A;  4YWY A;  4Z65 A;  2FCK A;  1BPN A;  3IWG A;  2VQY A;  2PVW A;  4UEZ A;  4XPD C;  1M4L A;  5AG4 A;  3FYN A;  1S5K A;  3IEH A;  1S7L A;  5F47 A;  4AXV A;  4NGN A;  5JPH A;  1VGY A;  2C6G A;  4FD6 A;  3BJ7 A;  2PR1 A;  2G9D A;  3NE7 A;  4MFL A;  5DWN A;  3TX8 A;  1TKH A;  1IY7 A;  1NMT A;  1XFO A;  2AFW A;  1XMB A;  3CXQ A;  4E8O A;  5DS0 A;  4RI1 A;  3SJX A;  2AFM A;  4RUH A;  3K9U A;  4IF5 A;  4JXQ A;  4AVB A;  1WK4 A;  2Z3K A;  3TO7 A;  1XRY A;  1ZO0 A;  4CRY B;  1P4N A;  4NJR A;  3VH9 A;  4OC5 A;  3MGD A;  4NGQ A;  4KUB A;  4R3L A;  4B11 A;  4UIB A;  3FXT A;  1IB1 E;  3JVN A;  2FE7 A;  3IJ3 A;  4PXD A;  3FJU A;  4KOX A;  5THW A;  1VHO A;  1A2Z A;  1KUV A;  4U9Y A;  4AVC A;  2ZEO A;  3DSB A;  4GS4 A;  4W9Y A;  5G21 A;  5F48 A;  3VWD A;  4CYN A;  3P2F A;  2CF4 A;  5I4M A;  1IID A;  1YW6 A;  4UCM A;  3SJG A;  4Q38 A;  4IK2 A;  2FL4 A;  4CGN A;  2CIJ A;  3FIX A;  3H8E A;  1V0C A;  1AUG A;  1ARL A;  1WWZ A;  1X10 A;  2O4H A;  3PB9 X;  2F7V A;  4KLV A;  5LYD A;  3OWC A;  3GB0 A;  1BPM A;  2R8V A;  2YNE A;  3B3C A;  4L8A A;  4ZX8 A;  1FT7 A;  3F8K A;  1BOB A;  1B6B A;  1I12 A;  1LAN A;  3D68 A;  4U5Y A;  4A33 A;  1CP6 A;  5DWM A;  1HEE A;  4G1P A;  4B10 A;  3G3S A;  2Q7S A;  4KOW A;  2ZW4 A;  1H8L A;  3FED A;  1Z8T A;  3D66 A;  4PXC A;  1IYK A;  1YR0 A;  4ZBG A;  4Q7A A;  5JQ4 A;  3SXO A;  3HUV A;  4KSF A;  1TXR A;  2ZED A;  4M3S A;  2PVV A;  5KTA A;  3B3S A;  2REF A;  2VEZ A;  1SQH A;  2PC1 A;  2K5T A;  2Q4Y A;  4LQ6 A;  1ELM P;  4RN7 A;  3KL9 A;  2OOT A;  4MMO A;  4NEX A;  4KUA A;  4CAF A;  2I79 A;  3SHP A;  1R3N A;  1IOI A;  4CGP A;  2BOA A;  4UBR A;  3V38 A;  5KTD A;  3D7G A;  3D2M A;  3PFO A;  1AMP A;  2PJC A;  4NF1 A;  4NGR A;  4AB7 A;  1TIQ A;  4HPS A;  2IQ6 A;  3IIB A;  3R9G A;  1S7F A;  1YVO A;  5AGE A;  4J3G A;  4OAD A;  3WC6 A;  5HVH A;  1QST A;  1KZF A;  4KSI A;  1Y9K A;  1DE4 C;  3DGV A;  4U9Z A;  1RO5 A;  4X5K A;  1YLE A;  2JDD A;  2OH1 A;  3B3W A;  4QUS A;  4AVA A;  2CY2 A;  2Z3O A;  3FMC A;  4NJQ A;  1IGB A;  1ON0 A;  4KOY A;  2OB0 A;  4H89 A;  4UA3 A;  4R57 A;  4P4J A;  1Z2L A;  2I00 A;  4CS0 B;  4QC6 A;  2QVP A;  3RNZ A;  3RBU A;  2PDO A;  4XNH B;  2REE A;  3D8P A;  2XEF A;  4TWE A;  4F0X A;  5K8O A;  3VAT A;  5JM6 A;  5IB9 A;  4PQA A;  1MJB A;  3T8W A;  1NE9 A;  2ABZ A;  2Z3P A;  3SI2 A;  2BO9 A;  3QB8 A;  2DPT A;  4LX9 A;  4NGM A;  1YK3 A;  3RAM A;  3MN8 A;  4MHP A;  4C7I A;  1TF9 A;  5IX3 A;  3S6G A;  3CXS A;  2X7B A;  2ODF A;  3SI0 A;  1BAV A;  2KCW A;  5CPA A;  3CDX A;  2P6G A;  1CPX A;  4KVO E;  4UF4 A;  4P44 A;  4MHN A;  1LAM A;  2ZEN A;  1ZLH A;  1VIX A;  3H8F A;  3I3G A;  4MJ8 A;  4NSQ A;  4WWV A;  3D2P A;  3R9E A;  1Y7E A;  1XMT A;  2O53 A;  4HNW B;  2B4D B;  4F0Y A;  2JEV A;  2B5G A;  3RYO A;  1BO4 A;  2B58 A;  2POK A;  1CPS A;  5D8N A;  5HVF A;  3KI9 A;  4M85 A;  4NFR A;  1I21 A;  2PJ8 A;  2J9A A;  2VZZ A;  3I1U A;  2EK8 A;  2VL1 A;  2B4D A;  2XEI A;  1P0H A;  5F09 A;  3DR6 A;  3GIU A;  2EK9 A;  4CGO A;  4OC1 A;  4UCN A;  3T90 A;  2PQ8 A;  3QAH A;  4E0A A;  1XIX A;  5EC4 A;  5C82 A;  1CX8 A;  3TTH A; 
#chains in the Genus database with same CATH homology
 1QQ9 A;  3D7H A;  4MCQ A;  2AFU A;  3PB4 X;  2AFX A;  3GLJ A;  3CPA A;  3PEI A;  4B6Z A;  4ZY1 A;  4R7M A;  1LOK A;  2HC9 A;  2ZEP A;  3QNV A;  5LRG A;  4IHM A;  8CPA A;  2GLJ A;  4MCS A;  1JQG A;  4YU9 A;  4ZY0 A;  2NSM A;  5K8P A;  4MHZ A;  3FX6 A;  2GRE A;  3BHX A;  1QMU A;  1CBX A;  5ELY A;  1TKF A;  2PJ2 A;  1TF8 A;  4OC0 A;  4P4B A;  1Z8L A;  5HVG A;  3PB6 X;  3H8G A;  4R8F A;  3KQX A;  1VHE A;  5J1Q A;  1CP7 A;  2ZOG A;  2HB6 A;  4A38 A;  1XBU A;  4GM5 A;  3KQZ A;  3ISX A;  2V8H A;  2CTC A;  1F2P A;  4EME A;  2PJ5 A;  2PIZ A;  3K2K A;  4UEF A;  1FNO A;  3CPX A;  1Q7L A;  1PCA A;  4MHY A;  3S9L A;  2PJ7 A;  5HXD A;  2XEG A;  4MCP A;  3PFE A;  2JBK A;  3TC8 A;  4P4I A;  1UWY A;  3KGQ A;  3NH8 A;  1LAP A;  4FWU A;  2F8H A;  2IJZ A;  2ZEF A;  1ZG7 A;  3WT4 A;  4FAI A;  4OC3 A;  4UEE A;  2PJB A;  3IFE A;  2C1C A;  4DJL A;  2PRQ A;  3HLP A;  4P4E A;  3NH4 A;  4A37 A;  2PJ3 A;  2DEA A;  4OME A;  4MCR A;  4CPA A;  1LCP A;  3SJF A;  1Y0Y A;  4OIW A;  5LRJ A;  2BCO A;  3NFZ A;  2PJ9 A;  3ISZ A;  4MRI A;  1PYT B;  3KR4 A;  4EWT A;  4PXE A;  4A94 A;  2FVG A;  3PB8 X;  2V8V A;  1BLL E;  3B3T A;  2V8D A;  3KHX A;  3SJE A;  3FH4 A;  2PJ0 A;  3MRU A;  4IAV A;  3VAR A;  2GU2 A;  1GYT A;  3WC5 A;  3BXM A;  2AFO A;  3S9N A;  4P4F A;  4PPZ A;  5K8N A;  1LFW A;  1EE3 P;  5LYF A;  2ZEE A;  5JGF A;  2PE3 A;  4K3N A;  4FUU A;  1KWM A;  1ZLI A;  4WJB A;  1NSA A;  5K8M A;  4P6Y A;  1AYE A;  4JYW A;  3KR5 A;  4DYO A;  4P4D A;  4A39 A;  3RZA A;  4BD9 A;  1Y0R A;  3FEE A;  1CG2 A;  1ZG9 A;  3B35 A;  3CT9 A;  3B3V A;  2QYV A;  2C6P A;  4TNU A;  3BI1 A;  4LQG A;  2PIY A;  2ZEL A;  4OC2 A;  3FF3 A;  3WAB A;  1RTQ A;  2ZOF A;  3BI0 A;  4F9U A;  2WYR A;  1YME A;  2CTB A;  2JBJ A;  2PJ6 A;  4F8Z A;  1OBR A;  1F2O A;  2ZEM A;  3DLJ A;  4F9V A;  4H2K A;  1ELL P;  2Q51 A;  1ARM A;  4NGP A;  5LYL A;  4OC4 A;  4MXU A;  3NH5 A;  2C6C A;  2V8G A;  2PJ4 A;  1R43 A;  3GUX A;  3D7D A;  3PBE A;  2PJ1 A;  3IO1 A;  2NYQ A;  1F57 A;  4NGT A;  3D4U A;  1Z5R A;  4JZ0 A;  4O23 A;  2JEW A;  3K9T A;  7CPA A;  3S9M A;  3V7Z A;  4R6T A;  4ONW A;  4P45 A;  3FVL A;  1YSJ A;  3PRT A;  3L2N A;  2Q4Z A;  4R76 A;  3KAS A;  2RB7 A;  4OP4 A;  2XEJ A;  3IWW A;  1YW4 A;  3D7F A;  4UIA A;  3B7I A;  3B2Y A;  4NGS A;  5CBM A;  4X2T A;  4ZX9 A;  1ZG8 A;  3NA6 A;  5D29 A;  6CPA A;  2AFS A;  2EWB A;  2OR4 A;  2PCU A;  3PB7 X;  1TKJ A;  2WZN A;  2I3C A;  3IC1 A;  3LWU A;  1XJO A;  2ZEG A;  2IMO A;  2ANP A;  4FBE A;  5LYI A;  2AFZ A;  3N5F A;  2V77 A;  1YLO A;  3SI1 A;  1HDQ A;  3D67 A;  4P10 A;  3KZW A;  1HDU A;  2RFH A;  2PJA A;  4X3R A;  4OKO A;  3KHZ A;  4PXB A;  4DUK A;  2Q43 A;  5LRK A;  4EFD A;  2QJ8 A;  4OID A;  3PBB A;  3WC7 A;  3JRU A;  1DTD A;  3FEC A;  2ZEH A;  3LMS A;  4ZY2 A;  2GLF A;  4YWY A;  4Z65 A;  1BPN A;  2PVW A;  4UEZ A;  1M4L A;  4AXV A;  3IEH A;  4NGN A;  1VGY A;  2C6G A;  2G9D A;  3TX8 A;  1TKH A;  1IY7 A;  1XFO A;  2AFW A;  1XMB A;  5DS0 A;  3SJX A;  2AFM A;  4RUH A;  4ZI6 A;  1XRY A;  4NJR A;  3VH9 A;  4OC5 A;  4NGQ A;  4UIB A;  3IJ3 A;  4PXD A;  3FJU A;  5THW A;  1VHO A;  2ZEO A;  4W9Y A;  5I4M A;  2CF4 A;  1YW6 A;  3SJG A;  4IK2 A;  2CIJ A;  3H8E A;  3PB9 X;  4X8I A;  4ZYQ A;  1ARL A;  2O4H A;  2F7V A;  5LYD A;  3GB0 A;  1BPM A;  3B3C A;  4ZX8 A;  1FT7 A;  5JH9 A;  1LAN A;  3D68 A;  1CP6 A;  1HEE A;  4G1P A;  1H8L A;  3FED A;  3D66 A;  4PXC A;  4Q7A A;  3HUV A;  1TXR A;  2ZED A;  2PVV A;  3B3S A;  1ELM P;  2OOT A;  3KL9 A;  4MMO A;  1R3N A;  2BOA A;  3V38 A;  3D7G A;  3PFO A;  1AMP A;  2PJC A;  4NGR A;  2IQ6 A;  3IIB A;  3WC6 A;  5HVH A;  4KSI A;  1DE4 C;  3DGV A;  3B3W A;  3FMC A;  4NJQ A;  1IGB A;  4P4J A;  1Z2L A;  2QVP A;  3RBU A;  2XEF A;  4TWE A;  5K8O A;  3VAT A;  5JM6 A;  5IB9 A;  4PQA A;  3T8W A;  2ABZ A;  3SI2 A;  2BO9 A;  4NGM A;  3RAM A;  3MN8 A;  4MHP A;  1TF9 A;  3SI0 A;  1BAV A;  5CPA A;  3CDX A;  1CPX A;  4UF4 A;  4P44 A;  4MHN A;  1LAM A;  2ZEN A;  1ZLH A;  1VIX A;  3H8F A;  4WWV A;  1Y7E A;  2O53 A;  5HVF A;  2POK A;  1CPS A;  5D8N A;  3KI9 A;  4NFR A;  2PJ8 A;  2J9A A;  3I1U A;  2EK8 A;  2VL1 A;  2XEI A;  5F09 A;  2EK9 A;  4OC1 A;  1CX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...