3KIDU

The crystal structures of 2-aminobenzothiazole-based inhibitors in complexes with urokinase-type plasminogen activator
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
246
structure length
238
Chain Sequence
IIGGEFTTIENQPWFAAIYRRVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSAAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of 2-Aminobenzothiazole-based Inhibitors in Complexes with Urokinase-type Plasminogen Activator
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 49
structure length 238
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2009-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3kidU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3kidU01
3NPSA 3MWIU 4GCHF 2V3HH 1MTUA 3ZZ5A 1NU7B 2H6MA 1MU8B 3SBKA 2TPIZ 1V2MT 1NESE 1GBMA 1EASA 1UVTH 1C4V2 2C8ZB 4ZXXH 3DUXH 1JIMA 1KXEA 3ENSB 3PWBA 4CH8B 2J4IA 1GMCG 2QXIA 3A83A 5A8ZA 1AZZA 1MBQA 2XBWA 1MTNB 3OX7U 4NIVA 1E35B 2BVRH 3BG4B 1GJ9B 2SGFE 1O5CB 3P8FA 4AN7A 4ABGA 2V0BA 1F5KU 4LOYH 2AERH 4ISLA 1AVWA 1KXAA 2ESTE 1QA0A 4X1PU 4MVNA 1O3EA 2IPHA 1TALA 2FLBH 3RU4T 1O2IA 1BJUA 4NSYA 1FDPA 1C1QA 2LPRA 3KEEA 3ATLA 1QFKH 5CE1A 1THRH 3F9EA 1WTGH 1ZRBA 1GI1A 1ZOMA 5GIBA 4Y76A 5EPYA 2QV1A 3NKKA 1DY8A 1SGCA 1BB0B 4KTCA 1FI8A 3V13A 1XUFA 1E34B 1S82A 4DIIH 1NFWA 1TOMH 2I6QA 1ETSH 4UDWH 5FCRA 2VH6A 4JYVH 1DLKB 1O34A 1NU9A 1P2OA 2Y80A 4ZROA 1YCPH 2BD8A 1AB9C 1MCVA 1W11U 4UONA 5C67A 4X2YA 1EZUC 1BIOA 2Z9GA 1GHBG 2A7JA 5C20A 1XUGA 1LVOA 2GKVE 1LPGB 1JOUB 1Q31A 1O2WA 2PUXB 1ZR0A 3ITIA 1FAXA 1MTWA 1DANH 4X1RU 1H8DH 3M3VA 4YT6H 2TBSA 1P8VC 3OU0A 5L2ZH 1NY22 1MKXK 2UWOA 1SGNE 3A8BA 1G3BA 2VIQA 1O38A 4ZKSU 4B74A 2XC5A 1GBDA 1NC6A 1TYNA 2ZHEH 3S69A 1UCYE 4JZDH 1W12U 2V6NA 1YPHC 1S83A 8ESTE 1Z8IB 4ABJA 1RJXB 3RLWH 1FIZA 1T4VH 1F5RA 3ZV9A 3SORA 5GCHG 2ZG0H 1ELVA 1LKBA 1B7XB 1FY3A 1SB1H 2ZCLP 1QBNA 3E6PH 1C5SA 1GJCB 4K1EA 3BSQA 3LGVA 1TGSZ 2M5TA 4I8JA 1WQVH 1BTXA 4X1QU 2FWWA 1P2IA 1ANDA 1IQEA 2B9LA 1MTNC 4NWLA 1QB1A 2KAIB 3CENA 4RN6A 3SUGA 2GVFA 1GMHF 1HXEH 1MQ6A 2ALPA 4A1XA 3ATMA 3QZQA 2JH0D 1AY6H 4OS7A 4XE4A 2RA0A 2ODYB 5AVDA 4OS2A 1O5AB 1GJ8B 3TJUA 3S0NA 4GVUA 5DP6A 1EJNA 1OKXA 1O3AA 1SGIB 1ESBA 1V2ST 1AO5A 4JZFH 3EGKH 2F9VA 4BXSA 3BTFE 4Q2KA 1O5GH 2B8OH 1TA2A 3A80A 2ZCKP 3ZVEA 2UUKB 3BF6H 3ATWA 3O8RA 4U32A 1C5UA 1NFYA 4GHQA 2P59A 3ELAH 2OC8A 5B6OA 4A1TA 3UWJH 2GV7A 2ZEBA 1P01A 3K6YA 1GI6A 1SMFE 3ODDA 1J17T 4BTIB 3M35A 1NRNH 1GI7B 2GD4B 2BD9A 3Q3YA 1TRMA 3T27A 3AAUA 1YM0A 4CRCA 1HAIH 5A0CA 1Y59T 4JYTA 5DO4H 1F0RA 2ODQA 3FVFB 5AHGH 1AZ8A 2BY5X 1OP2A 1XXDA 4TPIZ 1O3BA 1DSTA 1A1RA 1GBHA 1OSSA 3M37A 3RXAA 1GJ4H 2XC4A 4NIXA 3LGTA 3KN2A 1RTLA 2ZDAH 2K1QA 9LPRA 5GPIB 1P03A 1SFQB 4ABFA 2A4GA 1S6HA 1W14U 2P95A 3MI4A 1V2QT 2FOMB 4CHAB 2V35A 4GHTA 4UE7H 2FOBA 2GDEH 1O3GA 3SU0A 1GCTB 1NZQH 1DSUA 2AIPA 2FOGA 4MPVA 1BBRH 3N7OA 5C1UA 5C3NA 3ZVDA 1A3BH 3W94A 1BTUA 5JB9S 2FIRH 2CXVA 4CH2B 3ZZ8A 1QTFA 1VJAU 4JMYA 3ZVBA 3BIVH 1UMAH 1YF4A 2Y7ZA 1FY4A 2PW8H 4D7FA 3MNBA 2PWXA 3ZZ9A 4WJG2 2BQ7B 4ZXYH 3V12A 1O2GH 2A4RA 3BTDE 1CGJE 4ABEA 1O2SA 1T4UH 4YTAA 2A2QH 1HIAB 3QX5H 3V0XA 4WWYA 3U69H 1O2VA 4ABHA 4Z0KA 2UWPA 1IOEA 4CRAA 3I77A 4WH8A 3SJ9A 2QGRA 4X2VA 1SLXB 2Q1JA 1ZPBA 1LPKB 3HGNA 4SGAE 3ZZ7A 1SGTA 3ZVGA 1C4U2 1J15A 4XBDA 3O8DA 4XFQA 1HPGA 1NN6A 4JZ1A 1UVSH 4TWWA 1V2OT 2NWNA 2AMDA 1IQKA 4FVBA 3PM3A 1EAUA 2BY7X 1K1NA 3ZV8A 2PSYA 1P3CA 1O3NA 1FXYA 1IQFA 1BRUP 3RXJA 1O5EH 3RXFA 4CBOA 3BIUH 1L1NA 4X8UH 3PB1E 1FMGA 5JYIA 1IAUA 2P3UB 4J2YB 3MH7A 1GL0E 1GWAA 2ZZUH 3K9XB 1UTMA 1DT2A 1T32A 2HGTH 3PLBA 1FLEE 1KLTA 4JCNA 4B75A 3VGCB 4KTSA 1G30B 1C5YB 1C1OA 2GZ8A 1ZPCA 3E90B 5FX6A 1TE0A 3RXQA 1VITG 3MHWU 2FXRA 3DFJA 4ZHAA 2ZHWH 1CHOG 2BOHB 3PO1C 1DXWA 1EOJA 4FUGA 2PGBB 3IWMA 2SGEE 2FPZA 3A87A 4TY7A 1TNGA 3VXFH 1ELAA 5T6DA 3DHKH 3KNXA 4ISIH 1OPHB 2FM2A 1GBIA 1VJ9U 2FS9A 1OP8A 4Y0ZE 2BQ6B 2VU8E 2ZPRA 3S7KB 3SV8A 2GCHF 3GY4A 2F9NA 1GBCA 1HAXB 3ZZDA 2TRMA 3MH6A 3VB5A 2Y82A 1SHHB 1Y5BT 1OX1A 1JRTA 3P17H 1ELGA 1P2QA 1SGDE 4Y10E 1BRBE 5DP4A 2FOCA 1V2RT 2GZ7A 3JZ2B 2UUFB 1C5MD 1WCZA 4Q7YA 1HDTH 2QN5T 4MNVA 4CHAC 4I7YH 1TNHA 5DP7A 1V6DA 1L4DA 1MAXA 3MNCA 1GDQA 2R3UA 4I8LA 3RXEA 2RA3A 3URDA 4QT8C 5DP8A 5JBAS 5JPMH 1C1MA 4DIHH 4YLUA 2VWNA 1SFIA 4RKJB 2QC2A 3SV2H 1SG8B 1TABE 3PMAB 2XC0A 1SLWB 3DFLA 2HRVA 4NWKA 3TH3H 5F8XA 1O2RA 2GT7A 1TAWA 3RMLH 3P70B 3TVJB 2KAIA 3PMBB 4MLFB 1PPHE 1GCDA 1MBMA 1O2JA 5TJXA 1THSH 3SGAE 1SGFG 3LC3A 1GG6C 1UCYK 2VIVA 4MPUA 6LPRA 3UR9A 2BLVA 2RCEA 2WPKS 2F83A 1O2XA 2OQUA 1K9OE 2A7HA 3GYMA 3U9AH 4THNH 4IW4E 3SU4A 1EX3A 1ZTLA 2SGQE 2Z3EA 3RMOH 5HGGA 5DP9A 1TNIA 3UPEA 3HATH 1G36A 1SGFA 3SUEA 1O3KA 2NU4E 3U1JB 1PPFE 2BXUH 2OC1A 1UK2A 5FCKA 1XUHA 1GBKA 1SI5H 2ZTYA 4YO9A 1HAPH 3QTOH 2G5NA 1LTOA 1O3PB 1YPHE 2ZC9H 2Z9IA 1QR3E 3M5MA 1WYKA 1E38B 3SJ8A 1ZGVA 3I29A 1ZTJA 2ZIQH 3GCHB 3P8OA 1A5IA 3UQVA 4WMFA 4IBLH 2GV6A 2BX4A 3M7QA 4IMQA 1KY9A 2A4QA 3A89A 1JRSA 1O33A 4AGKA 5A8XA 4NA9H 4AYYB 2BY6X 1W2KH 5HMAA 3MO6A 3BTTE 4AZ2B 1GVKB 2A0QB 1DWEH 5JB8S 2FOAA 7GCHF 3KGPA 4I31A 3A7WA 4ISOA 3T25A 3AW0A 1ELFA 2C90B 1QQUA 1QIXB 4NGAH 1O3LA 2BD4A 2I6SA 4H6SB 1RIWC 1AVGH 1O39A 2PGQB 4X6OA 2H9EH 2OUAA 1OWJA 1Y3YA 4Y6DA 2V3OH 1MZDA 4JK5A 5FAHA 2ZFSA 1WSSH 5DG6A 1KDQA 2PKAA 3RXCA 1O3IA 1RS0A 4Y0YE 2GT8A 1BMNH 3MOCA 1K2I1 1LHGH 2ZFTA 2O8LA 1TGTA 2Z7FE 2ANMH 3PLPA 4INHA 4FUJA 2CJIA 3H7OA 2BXTH 3BEUA 1O2OA 1ABJH 1IQHA 1SGPE 1TBQH 4MNXA 1TPPA 1RTKA 4ISNA 2EI7A 1YPMH 5DP3A 2WV5A 4AGJA 1GVZA 3KF2A 3ZVAA 2ZCHP 2GMTB 4ISHH 3P8GA 4JK6A 4VGCC 3LJOA 4UFEH 1RIWB 1THPB 3FZZA 1D6RA 5GJ4B 4D76A 1LMWB 1AHTH 1ZMNA 1ELTA 3TGIE 3QN7A 1UTLM 2GTBA 3NK8A 1LPZB 3S9CA 2VGCB 1ELDE 6ESTA 2BB4A 1LHEH 3SO3A 1EAIA 4WXVA 1HAVB 1N8OB 2ZU3A 2SGAA 4I8GA 3LU9B 3LPRA 1QL7A 1C1RA 1EXFA 2BDHA 2Z6BD 3LH1A 1ABIH 2Y5HA 1LDTT 1V2TT 3NZIA 3SV7A 5C1XA 2H2ZA 1RD3B 4BAOB 3V3MA 1DWCH 5FPSA 1XMNB 2Z9JA 1YCPK 4X2XA 4A7IB 4BTTB 5JBTA 1EKBB 1FJSA 1OWDA 2B5TB 1UCYH 2BDCA 1O2MA 2BVSH 2A7CA 3UNRA 3A85A 2Z3CA 1AFEH 5DK1A 4CRFA 2YNBA 1TNJA 5GCHF 3F1SB 2ZTXA 3MU4A 4MTBA 1NFXA 5E0GA 1EZQA 2XBYA 3MNSA 2GDDA 1BCUH 1TNKA 2QIQA 3VEQB 1DITH 2ZKSA 1GI4A 1VITF 5LGOA 3ZYDA 2G00A 1NRPH 2UUYA 3PLKA 5FX5A 2P93A 2C93B 3M3TA 2AIQA 4IC5A 3RXKA 1NRQH 1TB6H 2AEIH 2ZTZA 1FZZA 2H5DA 1EPTC 2NU0E 3EDXB 3R3GB 3PMHB 4J1YA 1L0ZA 1G3EA 1P2JA 1CHOF 4ZHLU 1PPZA 1C5RA 3LH3A 2FZZA 1SGEE 3TU7H 3VXEH 3MO3A 5HYOA 3RLYH 4D9RA 4K3JA 4TPYA 2UWLA 2HPPH 1MU6B 3SN8A 1XVOA 3VGCC 4GAWA 1ZSJA 3HK6B 3HPTB 1PYTD 6CHAB 4X0WU 2WUCA 1BTWA 3M7TA 1C2JA 4A1VA 2BD2A 4DT7B 1V2NT 1AWFH 4IGDA 1HBTH 2GMTC 5F8ZA 1W0YH 3SNEA 2B7DH 1N6YA 3LGUA 5ETXA 1O2UA 1F0UA 1QJ7B 3U1IB 4ZUHA 3STIA 4CREA 4H42U 5C5OA 2VINA 5CHAC 4KELA 1SL3A 1W13U 5C1YA 1E36B 3GCOA 1S84A 3DD2H 1H9HE 3A8AA 1VZQH 2O8WA 1GI3A 1F7ZA 2FOEA 4LK4A 1A61H 1BZXE 1P2MA 2ZFFH 4A92A 3T29A 3OYPA 2WUBA 2HNTF 4AG1A 2ZGBH 2JKHA 2A5KA 1EB2A 1GPZA 1MKWH 3ZVCA 3MTYA 4VGCB 3DT0H 5EW1H 1P3EA 1DICA 3T2NA 4DCDA 4Y8YA 4FUHA 1MTVA 1ZHMA 3H5CB 2ZDKA 4AYVB 2SNWA 2ANWA 4YOGA 1D3DB 1EAXA 1HAYB 1SGYE 3IITA 5FPYA 1EB1H 1EOLA 3PTBA 2O9QA 1C1PA 2PKSC 1P57B 2Y6TA 4WH6A 1YPKH 2O8MA 1FIWA 4A5TS 5TCAA 4HI3A 4XDEA 3SZNA 4NA8A 1AIXH 5IYTA 3A8DA 1DWBH 1H9LB 1F0TA 1MKWK 2AMQA 5E0HA 3L6PA 5EXMA 4MNYA 1O37A 1SQAA 1H8IH 1F0SA 4KGAA 2EI8A 3RMNH 1GDUA 2PFEA 5BPEA 1AU8A 1C1VH 1C1SA 4DG4A 1AKSB 1ZSLA 5E8EH 2Z3DA 1ZMLA 1P10A 3FZDA 3P8NA 4IN1A 3T62A 3WY8A 2BOKA 1YGCH 1HJAC 2WV4A 4IS5A 3A88A 4U2WA 1Z6EA 1C1TA 4FU7A 4Y11E 4Y8ZA 1TQ0B 2P8OC 3NUMA 4UFFH 1UVOA 1QURH 3ZZBA 1GI0A 4B2AA 2OC7A 2OQ5A 3D62A 3QGNB 3MH4A 3SJOA 2F9OA 1YC0A 3UQOA 4ZKNU 4O9VA 2R0LA 4E05H 1G9IE 2FTMA 5L30H 3TIUA 1GI2A 2QY0B 3RXBA 1FV9A 4B2BA 1SPJA 1C5ZB 3LDXH 1GHVH 1JXPA 5A09A 1P9UA 4I8KA 3RUOA 3TNSA 2J9NA 2YOLA 2WYGA 1VGCB 1PQ7A 2BDIA 1GBFA 3VB3A 1BTHH 1QY6A 1Q2WA 1UJ1A 3FAOA 1UTKA 3GY2A 1FNIA 1PYTC 1UK3A 3F9FA 4NCYA 1EJMA 1ELEE 2XXLA 4K8YA 4MG3A 3SNCA 2P8OB 3QWCH 1J9CH 1KLIH 4UFDH 1GI8B 2NU2E 1O2KA 3DA9B 4OGYA 1EJAA 3UTUH 3M5OA 1DXPA 2AGIX 1BJVA 2ZDNA 1AMHA 1K1OA 1GHXH 5F8TA 1Y3XA 3MNXA 1CT4E 3Q77A 2VH0A 3ATKA 1V2WT 1QHRB 4WMEA 4ZKOU 1HUTH 1VGCC 3LONA 2FO9A 2ZFQH 1GHWH 3Q00A 2H1UA 2ZGHA 2XYAA 2Z9KA 4K69A 5LPRA 2JH6D 2XBVA 2BZ6H 1B0EA 1TONA 5EU8A 1F2SE 2G81E 1GJ7B 5ABWA 1A7SA 4X6MA 5FBEA 1TIOA 2J94A 2JH5D 3E1XB 5EW2H 3EE0B 1A0JA 3K2UA 2PKSB 2F91A 4H6TA 3VFEA 1HJAB 4WMDA 1D9IA 4LZ4B 4CR5A 1BITA 1HIAA 2ZI2H 2EI6A 2G5VA 1P04A 3MFJA 1Z6JH 3BTWE 5H4IB 6GCHG 5PTPA 1P9SA 2ZDMA 1RRKA 3QO6A 3GCTG 2THFB 1LKAA 3GOVB 5AFYH 3LC5A 1V2PT 3TNTA 1O2NA 5I46H 1O2TA 1DE7H 1W0ZU 2R3YA 1V2LT 1YP9A 4BOHA 3SGBE 2GZ9A 3E0NB 1EQ9A 1MD8A 1PPBH 3TK5A 1CE5A 3A82A 4MNWA 4NG9H 1CQQA 3EYDA 3KQCA 4FUIA 2J92A 3D65E 2ZQ1A 2BYAX 3SQEE 2O8TA 3STJA 3TGKE 1H1BA 4B1TA 4WY3A 3UREA 3QGJA 1TGCA 2OTVA 3RXPA 1O2LA 3B9FH 1AQ7A 2CHAC 2HVXA 2ZHQH 2HPQH 3RXOA 4HFPB 2TGAA 1TPSA 2BLOA 2WINI 3H7TA 5LPEA 1TPOA 2VB0A 3U98H 1LHFH 3PV4A 1GHAF 1C5WB 3RXUA 2Y7XA 4HTCH 1Z71A 1UVUH 2FOHA 2XCFA 3HK3B 5F03A 3VPKA 7GCHG 1TNLA 5FBIA 2VWOA 2FODA 4TWYA 3UR6A 1NPMA 3ZZ3A 1F92A 4MDSA 3ESTA 1S0QA 4U01A 3U8OH 4ABAA 1P0SH 1CA8B 4XSKU 1P2NA 3IG6B 1PFXC 1O35A 1SHYA 2HNTC 4OGXA 4JZIA 2OXSA 3SJIA 3QDZB 4DY7B 1X7AC 5JDUB 4OS6A 1G2MA 1W3CA 1HYLA 5T3HA 1P11E 1XM1A 3OSYA 2XNIA 1LVMA 2FX4A 4X6NA 3ODFA 2GX4A 1TLDA 1BA8B 3SU3A 1T8OA 3NXPA 2A31A 2W26A 3R0FA 2FS8A 3A7XA 1QBOA 2ANKH 4FUCA 1L1GA 2Q6FA 1ZHPA 1YPEH 1KXFA 1O2ZA 1GG6B 1JBUH 1ESTA 1O31A 3A81A 1C5PA 3QTVH 1DUEA 3RC5A 1SGQE 1D6WA 2FLRH 1M9UA 1RFNA 2P94A 4K8BA 2NU1E 5EG4A 4K1TA 3M7UA 4TY6A 1D3QB 2Y5GA 2HLCA 1YKTA 1GMDF 7ESTE 1N1LA 2FOFA 1NROH 2ZECA 1RXPA 3GY3A 2D8WA 4ZAEA 4O97A 2Q6GA 3TPIZ 5DPAA 4BANB 3O8BA 3FP8E 3BG4C 4MQAA 3O8CA 1SSXA 2VVCA 4BTUB 1VCPA 3SNAA 3B23B 1GBAA 1WAYB 1ETTH 4B2CA 7LPRA 2HOBA 4NFEA 1ZRKA 1GI5A 1GMDG 1KTTB 2F9PA 1IQJA 3BG8A 3CP7A 4WVPE 3B8JA 4ZKRU 3LOXA 2H5CA 3VB6A 3RXRA 1Y3UA 1KXBA 3URCA 2HNTE 3SOSA 1T8LA 3ZZ4A 5A0BA 3HKJB 3ZYEA 2VWMA 5K0HA 4RKOB 4NZQA 1PQ8A 3RXLA 5LH8A 1C5XB 1WTHD 2G4TA 3SNDA 1O0DH 1K1IA 1AD8H 1QNJA 4BAHB 1L1JA 5HM9A 1ZHRA 1FY8E 4U30A 3KL6A 1SVPA 2WPIS 5EQRA 2QF3A 1C2LA 1LCYA 2ZWLH 2P16A 1SQTA 3M61U 3TITA 2F9UA 1P02A 1PPGE 1NTPA 1GBLA 1VCWA 2Q6DA 5E2PA 3SU1A 4PROA 1BBRK 5K7RA 1KYNA 1WQSA 5EODA 4CRDA 1HJ9A 1K22H 1QCPA 5EQSA 1C5NH 3UUZA 3AAVA 4YM9A 1QL9A 1YPGH 1C2FA 4K1SA 1ZMJA 3FP6E 2FMJA 1ZGIA 1OS8A 1SOTA 1TGNA 3F9GA 3M36A 3S7HB 1C5TA 1C5OH 2BQWB 1BTZA 2BD7A 3PO1B 4Y7BA 3EA7A 1YLDA 2Z94A 1EATA 1UHBA 4FXGH 4JZEH 4Z6AH 2SGPE 5EXNA 1C9TA 4I8HA 1QRWA 4K2YA 1TQ7B 1K1JA 3OTJE 1AFQC 4BAQB 1QJ6B 2YNAA 4ESTE 1O2PA 1T8NA 1C2EA 1Y3VA 1KTSB 4ZHMU 1YPLH 2QAAA 1O36A 1FONA 4NFFA 1GL1A 2BHGA 1CA0C 1CVWH 1IQLA 4R0IA 1GHAG 2TGDA 4F4OC 2H9TH 1N8OC 2A2XH 2ZGJA 3P6ZB 4X1NU 2ZHFH 1IQNA 2C8YB 1FN6A 1YLCA 2CF9H 2FI3E 1HFDA 1UTNA 1W10U 1C2GA 1FN8A 2BDYA 1HV7A 3RXHA 3MU1A 2ZU5A 2ZU4A 3QUMP 4NSVA 5HXFA 1V2KT 4ZH8A 3SUDA 2QA9E 1GJBB 2NU3E 1K21H 4F49A 5EQQA 2OLGA 1WOFA 1AI8H 1C2HA 2VWLA 2ZU1A 3RMMH 1SC8U 3TLOA 3AVZA 3SUFA 5T6GA 3RXTA 4DOQA 1SLVB 3Q76A 2GGVB 3RXDA 3RU4E 3PWCA 1XUKA 1V3XA 1RGQA 1ID5H 1GCTC 1CT0E 4MPWA 1ACBE 1A3EH 1B5GH 2A5IA 2OCVB 3QK1A 3ZZAA 3KQEA 4BXWA 3SHAH 2QYIA 4AFZA 1ZYOA 2W7UA 1XVMA 3U8RH 6GCHF 1O3CA 1K1PA 1EP5A 1OWKA 4YOIA 2OINA 4GSOA 2QXHA 2ZGXH 1HAHH 3EA8A 1DUAA 1ORFA 2WPHS 4AFQA 1ZTKA 1BTYA 3G01A 4CRGA 4AB9A 1CO7E 4FU9A 2PKAB 5SGAE 1NRSH 3S9BA 5DGJA 1A0HB 1P05A 1S5SA 2ZA5A 3A7TA 2W5EA 3NWUA 1O5BB 1O5FH 1XKBC 2OBOA 5JBCS 2ZDVH 3E0PB 4DW2U 2OD3B 2PTNA 2D1JA 1DM4B 1AUJA 1JMOH 3UY9A 3BTHE 4YOJA 4X8SH 1YYY1 1UTOA 2EC9H 3MMGA 1UTJA 3GISB 3GCHC 1ELCA 3RXIA 4RSPA 4X6PA 2CHAB 2ILNA 1HNEE 3KHVA 5DP5A 3MU5A 4O03A 1MZAA 3M5LA 5BRRE 1TX7A 4O3TA 1GVLA 4LZ1H 1ANBA 2QXJA 1MH0A 2W7SA 2BZAA 2AFQB 3BEFB 3TJNA 1Z8GA 3MU8A 2JETB 2BY9X 1S0RA 3A84A 4HZHA 1IHSH 5E0JA 4GPGA 4KP0A 2AMPA 4FUEA 1AFQB 2G8TA 1TBRH 2XCNA 1BQYA 2ZO3H 2IOTA 5GXPA 5TCCA 1ELBA 1TMBH 4AG2A 4INLA 3TJVA 4NIWA 4DGJA 1CA0B 2R9PA 3F9HA 3TK6A 2P3FH 2WYJA 1FAKH 4FUFA 4ABBA 8GCHG 1PJPA 3RM2H 4B76A 1L4ZA 1LVBA 2Y81A 5C2ZA 1C2KA 1HAOH 3TH4H 1T7CA 1EAWA 2C4FH 2C8XB 2VIDA 3TGJE 1A5GH 1O3FA 4GCHG 1C4Y2 4BAMB 3UIRA 4IC6A 1LVYA 2J34A 2JETC 1ARCA 2BD3A 2C8WB 1SGRE 3SGQE 4I32A 4M7GA 5J4SA 2F9BH 4AOQA 3FFGA 1Z8RA 1INCA 1K28D 2ZDLA 3SW2B 2BDBA 1GJAB 2H9HA 2DE8A 5ESBA 1D3TB 3UFAA 4JYUH 2XWAA 1UK4A 1MAYA 1P2KA 2ZNKH 3SV6A 1NRRH 2AS9A 2FP7B 4FUDA 5A2MH 2PV9B 4IN2A 3MH5A 4ABIA 1NM6A 1GHBF 1HB0B 1KIGH 1HGTH 1QBVH 2UUJB 1W7XH 1MTSA 1E37B 3TK9A 1FQ3A 2STAE 2GCTB 3F68H 2XW9A 1EP6A 4I33A 4UD9H 2J95A 3A7YA 4NIYA 5IDKA 1QA7A 2VIWA 1TOCB 1L2EA 3TH2H 1E0FD 2R0KA 2W3KA 4GUXA 1LHDH 3RXGA 4OS1A 4K5ZA 5HM2A 1A0LA 3UOUA 1IQIA 1A5HA 1SLUB 1T31A 1O2HA 1C1UH 1VCQA 2VVUA 5EXLA 2OC0A 1XKAC 1PPCE 2FYRA 1AN1E 1AGJA 1OWEA 1KXDA 1MMJN 1BMAA 3RXMA 2A1DB 2CN0H 3BTKE 8KME2 1RTFB 4AFUA 3P92A 1O5DH 1C1NA 2XWBI 3E91A 1UHBB 3F6UH 1DY9A 2ODPA 1HAVA 1QB9A 1C5QA 2RDLA 3A86A 4IMZA 4ABDA 2IJOB 1EUFA 4YLQH 1GGDC 2EEKA 3SU2A 4H4FA 4DURA 2J2UA 1JIRA 1GMCF 1AVXA 3D49H 3QLPH 1J14A 3E16B 2PUQH 2PLXA 1TA6A 1PPEE 2ZU2A 2VNTA 1OWHA 2AGGX 1V2JT 2A32A 1DX5M 1S85A 2TIOA 3A8CA 3EAJA 3ZVFA 4AORA 5J4QA 3MYWA 4TYDA 1LQEA 1HAZB 3L33A 5A8YA 2ULLA 2DE9A 1QGFA 2XTTB 1GBJA 1HXFH 1H4WA 1WV7H 1WU1A 5GDSH 4LXBH 3FANA 1U6QA 4CR9A 3KCGH 5EGMA 1OXGA 1QRZA 2WPJS 1AWHB 1C2MA 1Z7KA 1CGIE 3EA9A 1O3HA 2QF0A 1K1LA 1TRNA 4OS5A 1W8BH 2AGEX 1V2UT 3K65B 2HWLB 1PQAA 1Y5AT 2G51A 3LGIA 4XBCA 2XBXA 8GCHF 3OY5U 3VB7A 3SJKA 2BM2A 1C5VA 4X2WA 3K6ZA 1GHZA 1TFXA 2AH4X 4YT7H 3T28A 3PYHA 2BLWA 3EQ0H 1J8AA 2BTCE 2XRCA 4Q7ZA 5FPTA 1GJ6A 3BTQE 1DPOA 1BHXB 1NS3A 2FESH 3OY6U 2Y5FA 1QL8A 1QRXA 5E2OA 1ZSKA 5AF9H 2Z9LA 1WBGB 1OP0A 3UNQA 1GHYH 2TGTA 2ZQ2A 1GMHG 3TJOA 1QJ1B 3HGPA 1GBTA 3GCNA 4ASHA 3V7TA 3A7VA 1AE5A 1MUEB 3LGYA 1WUNH 2GCTC 2SFAA 1HLTH 1P06A 2OBQA 1JWTA 1N6XA 2HALA 3T26A 1BHXF 3KQBA 1D3PB 4D7GA 1EPTA 4X8VH 4MPXA 3LT3A 3PROA 1DWDH 4FU8A 2FYQA 1DS2E 1P09A 1QB6A 2ZF0H 4DJZB 2A4OA 8LPRA 2CF8H 1ZZZA 3SNBA 2QCYA 3QZRA 3GDVA 1O3OA 1BUIA 3BTGE 1TMUH 5G4BA 1O30A 4BNRA 4ZMAH 3W95A 1AB9B 1P12E 3M3SA 3ZZ6A 1MQ5A 3C1KA 1PQ5A 5A0AE 1FPHH 1S6FA 1TWXB 1Z1IA 1BT7A 2OP9A 1A2CH 2W3IA 4A6LA 4E7RG 5L2YH 3RC6A 1GGDB 1GBEA 4Y79A 1ZJDA 1C1WH 1A46H 3C27B 1BOQA 2TGPZ 1EPTB 1LQDB 3LIWA 3CS7A 1MD7A 1OWIA 5ESTE 4SGBE 1UTQA 1Y8TA 1ZLRA 3GDUA 2ZP0H 1DVAH 1TRYA 2GP9B 4E7NA 5FHTA 1G3DA 2PTCE 3SU6A 1O2YA 1OYQA 2FDAA 4O3UA 4OS4A 3LGWA 4B71A 5T6FA 2DUCA 1UVPA 1HRTH 1ZJKA 4UFGH 3UNSA 2F3CE 2A45B 4X1SU 1AE8H 1DOJA 5L6NH 1IHTH 1OYTH 1ANEA 1MKXH 5F6MA 5FXLA 2STBE 1LO6A 2B0FA 1C5LH 1A4WH 1AUTC 1NFUA 2VJ1A 1SQOA 2QXGA 1B0FA 1DLEA 4D8NA 3SU5A 1IQMA 2VGCC 1G37A 1G2LA 2ZPSA 3GCTF 3KQDA 2J38A 5CHAB 4YESB 2PSXA 1TGBA 3GICB 5LPFA 1EZSC 4WF8A 1EZXC 2WPLS 1CU1A 1CT2E 1V2VT 3M5NA 1YCPM 2O8UA 3GYLB 1XUIA 1CSOE 3FP7E 1CBWC 4KTUA 4NZLA 3P95A 4D9QA 3NCLA 3UOPA 1BTPA 1ESAA 1FY5A 2G4UA 1CHGA 3I78A 4XOJA 1LHCH 2BLQA 3CS0A 4HGCA 1HJ8A 1NT1A 4DVAU 3U8TH 1GI9B 2CGAA 4Y71A 1KXCA 2G52A 3Q3XA 3UWIA 3D23A 4R8TB 3RM0H 5C5NA 1QQ4A 3PMJA 1C2DA 4AB8A 3SI4H 1TBZH 3RC4A 3BN9A 1TPAE 3BTME 7KMEH 4Y8XA 1SOZA 4FVDA 4AX9H 1Z8JB 1W7GH 1VITH 2ANYA 3PTNA 1C2IA 1BDAA 2VVVA 5CMXH 1ETRH 1XUJA 1O2QA 2C3SA 1J16A 1DFPA 1GJDB 2ALVA 1S81A 2BY8X 2R2MB 2G55A 5DKMA 3SI3H 2D26C 5EPNA 2BDAA 1UO6A 3GY7A 1YBWA 2BX3A 2EA3A 3GY5A 1FY1A 1HAGE 1Y5UT 1T8MA 2SNVA 4CBNA 1YPJH 1ZPZA 3AW1A 4AFSA 5I25A 4Y7AA 2CMYA 1C9PA 1GDNA 1BMMH 1G32B 1FPCH 1TX6A 3L3TA 1IQGA 3T5FH 5DJ7A 5GWZA 1DDJA 1BRCE 3MO9A 4YZUA 1H9IE 2RG3A 1HCGA 1Y3WA 4WXIA 1Z1JA 6CHAC 2BMGB 2A5AA 3VB4A 9ESTA 5EOKA 2SGDE 1F5LA 1G3CA 5AFZH 1FUJA 1XXFA 2BDGA 1GBBA 2D2DA 2ZFRH 3BTEE 3Q3KA 3E3TA 1BMLA 3ZZCA 2CV3A 2FTLE 4X8TH 1XX9A 1AKSA 3E8LA 2AYWA 3KIDU 3LKWA 1D4PB 3RXSA 3GDSA 2ZHDA 4FUBA 3BEIB 3RU4D 3HKIB 2LNCA 4B73A 1MCTA 1O3JA 1KSNA 2GCHG 2FI4E 1K1MA 3SQHE 2R2WU 2ZGCA 2WPMS 2PHBA 3JZ1B 1SR5C 3BV9B 1TMTH 3RP2A 3GY8A 1KLJH 5JBBS 4KKDA 4NA7A 1GJ5H 2PR3A 2FX6A 1ARBA 4XBBA 3ATIA 2VIOA 3S9AA 1OOKB 3RDZA 2BVXH 2P3TB 4INKA 1KDQB 2FI5E 3LJJA 1CBWB 3GY6A 4BAKB 3A7ZA 2BD5A 1O3MA 4Q80A 1O3DA 1UTPA 4Q7XA 3AASA 4CRBA 1BBRE 2ZFPH 1BRAA 4UEHH 1VR1H 4GLYA 1CGHA 2FEQH 1SBWA 1ANCA 2IN2A 1TX8A 4E06H 2VIPA 2ASUB 3MU0A 3SHCH 1Q3XA 2ZPQA 1NO9H 3SV9A 1O32A 4K60A 3RXVA
chains in the Genus database with same CATH superfamily
3NPSA 3MWIU 4GCHF 2V3HH 1MTUA 2YMSB 3ZZ5A 1NU7B 3W1EA 2H6MA 1MU8B 3SBKA 2TPIZ 1V2MT 1NESE 1GBMA 1EASA 1UVTH 1C4V2 2C8ZB 4ZXXH 3DUXH 1JIMA 1KXEA 3ENSB 3PWBA 4CH8B 2J4IA 1GMCG 2QXIA 3A83A 5A8ZA 1AZZA 1MBQA 2XBWA 2J5UA 1MTNB 3OX7U 4NIVA 1E35B 2BVRH 3BG4B 1GJ9B 2SGFE 1O5CB 3P8FA 4AN7A 4ABGA 2V0BA 1F5KU 4LOYH 2AERH 4ISLA 1AVWA 4F55A 1KXAA 2ESTE 1QA0A 4X1PU 4MVNA 1O3EA 2IPHA 1TALA 2FLBH 3RU4T 3VG8A 1O2IA 1BJUA 4NSYA 1FDPA 4TSFD 1C1QA 2LPRA 3KEEA 3ATLA 1SKYE 1QFKH 5CE1A 1THRH 3F9EA 4XRNA 1WTGH 1ZRBA 1GI1A 1ZOMA 5GIBA 4Y76A 5EPYA 2QV1A 3NKKA 1DY8A 1SGCA 1BB0B 4KTCA 1FI8A 3V13A 1XUFA 1E34B 1S82A 4DIIH 1NFWA 1TOMH 2I6QA 1ETSH 4UDWH 5FCRA 2VH6A 4JYVH 1DLKB 1O34A 1NU9A 1P2OA 2Y80A 4ZROA 1YCPH 2BD8A 1AB9C 1MCVA 1W11U 4UONA 5C67A 4X2YA 1EZUC 1BIOA 2Z9GA 1GHBG 2A7JA 5C20A 1XUGA 1LVOA 2GKVE 1BMFD 1LPGB 1JOUB 1Q31A 1O2WA 4RT1A 2PUXB 1ZR0A 3ITIA 1FAXA 1MTWA 1DANH 4X1RU 1H8DH 3M3VA 4YT6H 2TBSA 1P8VC 3OU0A 5L2ZH 1NY22 1MKXK 2UWOA 1SGNE 3A8BA 1G3BA 1OHHD 2VIQA 1O38A 4ZKSU 4B74A 2XC5A 1GBDA 3F0PA 2RDEA 1NC6A 1TYNA 2ZHEH 3S69A 1UCYE 4JZDH 1W12U 2V6NA 1YPHC 1S83A 8ESTE 1Z8IB 4ABJA 1RJXB 3RLWH 1FIZA 1T4VH 1F5RA 3ZV9A 3SORA 5GCHG 2ZG0H 1ELVA 1LKBA 1B7XB 1FY3A 1SB1H 2ZCLP 1QBNA 3E6PH 1C5SA 1GJCB 4K1EA 3BSQA 3LGVA 1TGSZ 2M5TA 4I8JA 1WQVH 1BTXA 4X1QU 2FWWA 1P2IA 1ANDA 1IQEA 2B9LA 1MTNC 3PRBA 4NWLA 1QB1A 2KAIB 3CENA 4Q63A 4RN6A 3SUGA 2GVFA 3PRDA 1GMHF 1HXEH 1MQ6A 2ALPA 2F43B 4A1XA 3ATMA 1H8HD 3QZQA 2JH0D 1AY6H 4OS7A 4XE4A 2RA0A 2ODYB 5AVDA 4OS2A 1O5AB 1GJ8B 3TJUA 3S0NA 4GVUA 5DP6A 1EJNA 1OKXA 1O3AA 1SGIB 1ESBA 1V2ST 1AO5A 4JZFH 3EGKH 2F9VA 4BXSA 3BTFE 4Q2KA 1O5GH 2B8OH 1TA2A 3A80A 2ZCKP 3ZVEA 5KECA 2RFKC 2UUKB 3BF6H 3ATWA 3O8RA 4U32A 1C5UA 1NFYA 4GHQA 2P59A 3ELAH 2OC8A 5T1VA 3OTPA 4AC9A 5B6OA 4A1TA 3UWJH 3FN8A 2GV7A 2ZEBA 1P01A 3K6YA 1GI6A 1SMFE 3ODDA 4DT4A 1J17T 4BTIB 3M35A 1NRNH 1GI7B 2GD4B 2BD9A 3Q3YA 1TRMA 3T27A 3AAUA 1YM0A 4CRCA 1HAIH 5A0CA 1Y59T 4JYTA 5DO4H 1F0RA 2ODQA 3FVFB 5AHGH 1AZ8A 2BY5X 1OP2A 1XXDA 4TPIZ 1O3BA 1DSTA 1A1RA 1GBHA 1OSSA 3M37A 3RXAA 4B6EA 1GJ4H 2XC4A 4NIXA 3LGTA 3KN2A 1RTLA 2ZDAH 2K1QA 9LPRA 5GPIB 1P03A 1SFQB 4ABFA 2A4GA 3WW7A 1S6HA 1W14U 2P95A 3MI4A 1V2QT 2FOMB 4CHAB 2V35A 4GHTA 4UE7H 3NRLA 2FOBA 2GDEH 1O3GA 3SU0A 1GCTB 1NZQH 1DSUA 2AIPA 2FOGA 4MPVA 1BBRH 3N7OA 5C1UA 5C3NA 3ZVDA 1A3BH 3W94A 1BTUA 1VKYA 2FIRH 2CXVA 4CH2B 5JB9S 3ZZ8A 1QTFA 1VJAU 4JMYA 3ZVBA 3BIVH 1UMAH 1YF4A 2Y7ZA 1FY4A 2PW8H 4D7FA 3MNBA 2PWXA 3ZZ9A 4WJG2 2BQ7B 4ZXYH 3V12A 1O2GH 2A4RA 3BTDE 1CGJE 4ABEA 1O2SA 1T4UH 4YTAA 2A2QH 1HIAB 3QX5H 3V0XA 4WWYA 3U69H 1O2VA 1QZ8A 4ABHA 4Z0KA 2UWPA 1IOEA 4CRAA 3I77A 4WH8A 3SJ9A 2QGRA 4X2VA 1SLXB 2Q1JA 1ZPBA 1LPKB 3HGNA 4SGAE 3ZZ7A 1SGTA 1YY3A 3ZVGA 1C4U2 1J15A 4XBDA 3O8DA 4XFQA 1HPGA 1NN6A 4JZ1A 1UVSH 4TWWA 1V2OT 2NWNA 2AMDA 1IQKA 4FVBA 3PM3A 1EAUA 2BY7X 1K1NA 3ZV8A 2PSYA 1P3CA 1O3NA 1FXYA 1IQFA 1BRUP 3RXJA 1O5EH 3RXFA 4CBOA 3BIUH 1L1NA 4X8UH 3PB1E 1FMGA 1FX0B 5JYIA 1IAUA 2P3UB 4J2YB 3MH7A 1GL0E 1GWAA 2ZZUH 3K9XB 1UTMA 1DT2A 1T32A 2HGTH 3OAAD 3PLBA 3MQKC 1FLEE 1KLTA 2KR7A 4JCNA 4B75A 3VGCB 3OE7D 4KTSA 1G30B 1C5YB 1C1OA 2GZ8A 1ZPCA 3E90B 3F2HA 5FX6A 1TE0A 2WPDD 3RXQA 1VITG 3MHWU 2FXRA 3DFJA 4ZHAA 2ZHWH 1CHOG 2BOHB 3PO1C 1DXWA 1EOJA 4FUGA 2PGBB 3IWMA 5GNDA 2JJ1D 2SGEE 2FPZA 3A87A 4TY7A 1TNGA 1YLNA 3VXFH 1ELAA 4Z1MD 5T6DA 3DHKH 3KNXA 4ISIH 1OPHB 2FM2A 1GBIA 1VJ9U 2FS9A 1OP8A 4Y0ZE 2BQ6B 2VU8E 2ZPRA 3S7KB 3SV8A 2GCHF 3GY4A 3OFND 2F9NA 1GBCA 1HAXB 3ZZDA 2TRMA 3MH6A 3VB5A 2Y82A 1E1QD 1SHHB 1Y5BT 1WDIA 1OX1A 1JRTA 3DSOA 3P17H 3KQ5A 1ELGA 1P2QA 1SGDE 4Y10E 1BRBE 5DP4A 2FOCA 1V2RT 2GZ7A 3JZ2B 2UUFB 1C5MD 1WCZA 4Q7YA 1HDTH 2QN5T 4MNVA 4CHAC 4I7YH 1TNHA 5DP7A 1V6DA 1L4DA 1MAXA 3MNCA 1GDQA 2R3UA 4I8LA 3RXEA 2RA3A 3URDA 4QT8C 5DP8A 5KGOA 5JBAS 5JPMH 1C1MA 4DIHH 4YLUA 2VWNA 1SFIA 4RKJB 2QC2A 3SV2H 1SG8B 1TABE 3PMAB 2XC0A 1SLWB 3DFLA 2HRVA 4NWKA 3TH3H 5HKKD 5F8XA 1O2RA 2GT7A 1TAWA 3RMLH 3P70B 3TVJB 2KAIA 3PMBB 4MLFB 1PPHE 1GCDA 1MBMA 1O2JA 5TJXA 1THSH 3SGAE 3KYGA 1SGFG 3LC3A 1GG6C 1UCYK 2VIVA 4MPUA 6LPRA 3UR9A 2BLVA 2RCEA 2WPKS 2F83A 1O2XA 2OQUA 1K9OE 2A7HA 3GYMA 3U9AH 4THNH 4IW4E 3SU4A 1EX3A 1ZTLA 2SGQE 2Z3EA 3RMOH 5HGGA 5DP9A 1TNIA 3UPEA 3HATH 1G36A 1SGFA 3SUEA 1O3KA 2NU4E 5KEDA 3U1JB 1PPFE 2BXUH 2OC1A 1UK2A 5FCKA 1XUHA 1GBKA 1SI5H 2ZTYA 4YO9A 1HAPH 3QTOH 2G5NA 1LTOA 1O3PB 1YPHE 2ZC9H 2Z9IA 1QR3E 3M5MA 1WYKA 1E38B 3SJ8A 1ZGVA 3I29A 1ZTJA 2ZIQH 3GCHB 3P8OA 1A5IA 2KCYA 3UQVA 4WMFA 4IBLH 2GV6A 1W0KD 2BX4A 3M7QA 4IMQA 1KY9A 2A4QA 3A89A 1JRSA 1O33A 4AGKA 5A8XA 4NA9H 4AYYB 2BY6X 3F0OA 1W2KH 5HMAA 3MO6A 3BTTE 4AZ2B 1GVKB 2A0QB 1DWEH 5JB8S 1WXRA 2FOAA 7GCHF 3KGPA 4I31A 3A7WA 4ISOA 3T25A 3AW0A 1ELFA 2C90B 1QQUA 1QIXB 4NGAH 1O3LA 2BD4A 2I6SA 4H6SB 1RIWC 1AVGH 1O39A 2PGQB 4X6OA 2H9EH 2OUAA 1OWJA 1Y3YA 5C0TA 4Y6DA 2V3OH 1MZDA 4JK5A 3GS9A 5FAHA 2ZFSA 1WSSH 5DG6A 1KDQA 2PKAA 3RXCA 1O3IA 1RS0A 4Y0YE 2GT8A 1BMNH 3MOCA 1K2I1 2W6JD 1LHGH 2ZFTA 2O8LA 1TGTA 2Z7FE 2ANMH 3PLPA 4INHA 4FUJA 2CJIA 3H7OA 2BXTH 3BEUA 1O2OA 1ABJH 1IQHA 1SGPE 1TBQH 4MNXA 1TPPA 2XOKD 1RTKA 4ISNA 2EI7A 1YPMH 5DP3A 2WV5A 4AGJA 3WWBA 1GVZA 3KF2A 3ZVAA 2ZCHP 2GMTB 4ISHH 3P8GA 4JK6A 4VGCC 3LJOA 4UFEH 3F2GA 1RIWB 1THPB 3FZZA 1D6RA 5GJ4B 4D76A 1LMWB 1AHTH 1ZMNA 1ELTA 3TGIE 3QN7A 1UTLM 2GTBA 3NK8A 1LPZB 3S9CA 2VGCB 1ELDE 6ESTA 2BB4A 1LHEH 3SO3A 1EAIA 4WXVA 1HAVB 1N8OB 2ZU3A 2SGAA 4I8GA 3LU9B 3LPRA 2QF4A 1QL7A 1C1RA 1EXFA 2BDHA 2Z6BD 3LH1A 1ABIH 2Y5HA 1LDTT 1V2TT 3NZIA 3SV7A 5C1XA 2H2ZA 1RD3B 4BAOB 3V3MA 1DWCH 5FPSA 1XMNB 2Z9JA 1YCPK 4X2XA 5DSFA 4A7IB 4BTTB 5JBTA 1EKBB 1FJSA 1OWDA 2B5TB 1UCYH 2BDCA 1O2MA 2BVSH 2A7CA 3UNRA 3A85A 2Z3CA 4B6FA 1AFEH 5DK1A 4CRFA 2YNBA 1TNJA 5GCHF 3F1SB 2ZTXA 3MU4A 4MTBA 1NFXA 5E0GA 1EZQA 2XBYA 3MNSA 2GDDA 1BCUH 1TNKA 2QIQA 3VEQB 1DITH 2ZKSA 1GI4A 1VITF 5LGOA 3ZYDA 2G00A 1NRPH 2UUYA 3PLKA 5FX5A 2P93A 2C93B 3M3TA 2AIQA 4IC5A 3RXKA 1NRQH 1TB6H 2AEIH 2ZTZA 1FZZA 2H5DA 1EPTC 2NU0E 3EDXB 3R3GB 3PMHB 4J1YA 1L0ZA 1G3EA 1P2JA 1CHOF 1SQRA 4ZHLU 1PPZA 3SYJA 1C5RA 3LH3A 2FZZA 2YMSD 1SGEE 3FOAA 3AK5A 3TU7H 3VXEH 3MO3A 5HYOA 1EFRD 3RLYH 4D9RA 4K3JA 4TPYA 3EE7A 2K8IA 2UWLA 2HPPH 1MU6B 3SN8A 1XVOA 3VGCC 1E1RD 4GAWA 1ZSJA 3HK6B 3HPTB 2M2AA 1PYTD 6CHAB 4YXWD 4X0WU 2WUCA 1BTWA 3M7TA 1C2JA 2WZQA 4A1VA 2BD2A 2V3MA 4DT7B 1V2NT 1AWFH 4IGDA 1HBTH 2GMTC 2WHXA 5F8ZA 1W0YH 3SNEA 2B7DH 1N6YA 3LGUA 5ETXA 1O2UA 1F0UA 1QJ7B 3U1IB 4ZUHA 3STIA 4CREA 4H42U 5C5OA 4HG6A 2VINA 5CHAC 4KELA 1SL3A 1W13U 2WV9A 5C1YA 1E36B 3GCOA 1S84A 3DD2H 1H9HE 3A8AA 1VZQH 1NBME 2O8WA 1GI3A 1F7ZA 2FOEA 4I86A 4LK4A 1A61H 1BZXE 3F3BA 1P2MA 2CK3D 2J97A 2ZFFH 4A92A 3T29A 3OYPA 2WUBA 2HNTF 4AG1A 2ZGBH 2JKHA 2A5KA 1EB2A 1GPZA 1MKWH 3ZVCA 3MTYA 4VGCB 3DT0H 5EW1H 1P3EA 1DICA 3T2NA 4DCDA 4Y8YA 4FUHA 1MTVA 1ZHMA 3H5CB 5CHBA 2ZDKA 4AYVB 2SNWA 2ANWA 4YOGA 1D3DB 1EAXA 1HAYB 1SGYE 3IITA 5FPYA 1EB1H 1EOLA 3PTBA 2O9QA 1C1PA 2PKSC 1P57B 2Y6TA 4WH6A 1YPKH 2O8MA 1FIWA 4A5TS 5TCAA 4HI3A 4XDEA 3SZNA 4NA8A 1AIXH 5IYTA 3A8DA 1DWBH 1H9LB 4P02A 1F0TA 1MKWK 2AMQA 5E0HA 3L6PA 5EXMA 4MNYA 1O37A 5HIZA 1SQAA 1H8IH 1F0SA 4KGAA 2EI8A 3RMNH 1GDUA 2PFEA 5BPEA 1AU8A 1C1VH 1C1SA 4DG4A 1AKSB 1ZSLA 5E8EH 2Z3DA 1ZMLA 1P10A 3FZDA 3P8NA 4IN1A 3T62A 3WY8A 2BOKA 1YGCH 1HJAC 2WV4A 4IS5A 3A88A 4U2WA 1Z6EA 1C1TA 4FU7A 4Y11E 4Y8ZA 3PV2A 1TQ0B 2P8OC 3NUMA 4UFFH 1UVOA 1QURH 3ZZBA 1GI0A 4B2AA 2OC7A 2OQ5A 2YMSC 3D62A 3QGNB 3MH4A 3SJOA 2F9OA 1YC0A 3UQOA 4ZKNU 4O9VA 2R0LA 4E05H 1YWUA 1G9IE 2FTMA 5L30H 3TIUA 1GI2A 2QY0B 3RXBA 1FV9A 4B2BA 1SPJA 1C5ZB 3LDXH 1GHVH 1JXPA 5A09A 1P9UA 4I8KA 2GJGA 3RUOA 4ACBA 3TNSA 2J9NA 2YOLA 2WYGA 1VGCB 1PQ7A 2BDIA 5DN6D 1GBFA 3VB3A 1BTHH 1QY6A 1Q2WA 1UJ1A 2JIZD 3FAOA 1UTKA 3GY2A 1FNIA 1PYTC 1UK3A 3F9FA 4NCYA 1EJMA 1ELEE 2XXLA 4K8YA 4MG3A 3SNCA 2P8OB 3QWCH 1J9CH 1KLIH 4UFDH 1GI8B 2NU2E 1O2KA 3DA9B 4OGYA 2IJD1 1EJAA 3UTUH 3M5OA 2KCAA 1DXPA 2AGIX 1BJVA 2ZDNA 1AMHA 1K1OA 1GHXH 5F8TA 1Y3XA 3MNXA 1CT4E 3Q77A 2VH0A 3ATKA 1V2WT 1QHRB 4WMEA 4ZKOU 1HUTH 1VGCC 3LONA 2FO9A 2ZFQH 1GHWH 3Q00A 2H1UA 2ZGHA 2XYAA 2Z9KA 4K69A 5LPRA 2JH6D 2XBVA 2BZ6H 1B0EA 1TONA 5EU8A 1F2SE 2G81E 1GJ7B 5ABWA 1A7SA 4X6MA 5FBEA 1TIOA 2J94A 2JH5D 3E1XB 5EW2H 3EE0B 1A0JA 3K2UA 2PKSB 2F91A 4H6TA 3VFEA 1HJAB 4WMDA 1D9IA 4LZ4B 4CR5A 1BITA 1HIAA 2ZI2H 2EI6A 2G5VA 1P04A 3MFJA 1Z6JH 3BTWE 5H4IB 6GCHG 5PTPA 1P9SA 2ZDMA 1RRKA 3QO6A 3GCTG 2THFB 1LKAA 2L6OA 3GOVB 5AFYH 3LC5A 1V2PT 3TNTA 1O2NA 5I46H 1O2TA 1DE7H 1W0ZU 2R3YA 3H09A 1V2LT 1YP9A 4BOHA 3SGBE 2GZ9A 3E0NB 1EQ9A 1MD8A 1PPBH 3TK5A 1CE5A 3A82A 4MNWA 4NG9H 1CQQA 3EYDA 3KQCA 4FUIA 2J92A 3D65E 2ZQ1A 2BYAX 3SQEE 2O8TA 3STJA 3FO8D 3TGKE 1H1BA 4B1TA 4WY3A 3UREA 3QGJA 1TGCA 2OTVA 3RXPA 1O2LA 3B9FH 1AQ7A 2CHAC 2HVXA 2ZHQH 2HPQH 3RXOA 4HFPB 2TGAA 1TPSA 2BLOA 2WINI 3H7TA 5LPEA 1TPOA 2VB0A 3KYFA 3U98H 1LHFH 3PV4A 1GHAF 1C5WB 3RXUA 2Y7XA 4HTCH 1Z71A 1UVUH 2FOHA 2XCFA 3HK3B 5F03A 5C17A 3VPKA 7GCHG 1TNLA 5FBIA 2VWOA 2FODA 4TWYA 3UR6A 1NPMA 3ZZ3A 1F92A 4MDSA 3ESTA 1S0QA 4U01A 3U8OH 4ABAA 1P0SH 1CA8B 4XSKU 1P2NA 3IG6B 1PFXC 1O35A 1SHYA 2HNTC 4OGXA 4JZIA 2OXSA 3SJIA 3QDZB 2OK5A 4DY7B 1X7AC 5JDUB 4OS6A 1G2MA 1W3CA 1HYLA 5T3HA 1P11E 1XM1A 3OSYA 2XNIA 1LVMA 2FX4A 4X6NA 3ODFA 2GX4A 1TLDA 1BA8B 3SU3A 1T8OA 3NXPA 2A31A 2W26A 3R0FA 2FS8A 3A7XA 1QBOA 2ANKH 4FUCA 1L1GA 2Q6FA 1ZHPA 1YPEH 1KXFA 1O2ZA 1GG6B 1JBUH 1ESTA 1O31A 3A81A 1C5PA 3QTVH 1DUEA 3RC5A 1SGQE 1D6WA 2FLRH 1M9UA 1RFNA 2P94A 4K8BA 2NU1E 5EG4A 4K1TA 2PP6A 3M7UA 4TY6A 1D3QB 2Y5GA 2HLCA 1YKTA 1GMDF 2J98A 7ESTE 1N1LA 2FOFA 1NROH 3CNRA 2ZECA 1RXPA 3GY3A 2D8WA 4ZAEA 4O97A 2Q6GA 3TPIZ 5DPAA 4BANB 3O8BA 3FP8E 3BG4C 4MQAA 3O8CA 1SSXA 2VVCA 4BTUB 1VCPA 3SNAA 3B23B 1GBAA 1WAYB 1ETTH 4B2CA 7LPRA 2HOBA 4NFEA 1ZRKA 1GI5A 1GMDG 1KTTB 2F9PA 1IQJA 3BG8A 3CP7A 4WVPE 3B8JA 4ZKRU 3LOXA 2H5CA 3VB6A 3RXRA 1Y3UA 1KXBA 3URCA 2HNTE 4Q4LA 3SOSA 1T8LA 3ZZ4A 5A0BA 3HKJB 3ZYEA 2VWMA 5K0HA 4RKOB 4NZQA 1PQ8A 3RXLA 5FL7D 5LH8A 1C5XB 1WTHD 2G4TA 3SNDA 1O0DH 1K1IA 1AD8H 1QNJA 4BAHB 1L1JA 5HM9A 1MABB 1FY8E 1ZHRA 4U30A 3KL6A 1SVPA 2WPIS 5EQRA 2QF3A 1C2LA 1LCYA 2ZWLH 2P16A 1SQTA 3M61U 3TITA 2F9UA 1P02A 1PPGE 1NTPA 1GBLA 1VCWA 2Q6DA 5E2PA 3SU1A 4PROA 1BBRK 5C0UA 5K7RA 1KYNA 1WQSA 5EODA 4CRDA 1HJ9A 1K22H 1QCPA 2KX4A 1C5NH 5EQSA 3AAVA 3UUZA 4YM9A 1QL9A 5C94A 1YPGH 1C2FA 4K1SA 1ZMJA 3FP6E 2FMJA 1ZGIA 1OS8A 1SOTA 1TGNA 3F9GA 3M36A 3S7HB 1C5TA 1C5OH 2BQWB 1BTZA 2BD7A 3PO1B 4Y7BA 3EA7A 1YLDA 2Z94A 1EATA 1UHBA 4FXGH 4JZEH 4Z6AH 2SGPE 5EXNA 1C9TA 4I8HA 1QRWA 4K2YA 1TQ7B 1K1JA 3OTJE 1AFQC 4BAQB 1QJ6B 2YNAA 4ESTE 1O2PA 1T8NA 1C2EA 1Y3VA 1KTSB 4ZHMU 1YPLH 2QAAA 5EJZA 1O36A 1FONA 4NFFA 1GL1A 2BHGA 1CA0C 1CVWH 1IQLA 4R0IA 1GHAG 2TGDA 4F4OC 2H9TH 1N8OC 2A2XH 2ZGJA 3P6ZB 4X1NU 2JJ2D 1IQNA 2C8YB 2ZHFH 1FN6A 1YLCA 2CF9H 2FI3E 3WWFA 4TT3D 1HFDA 1UTNA 1W10U 1C2GA 5F53A 1FN8A 2BDYA 1HV7A 3RXHA 3MU1A 2ZU5A 2ZU4A 3QUMP 4NSVA 5HXFA 2L74A 1V2KT 4ZH8A 3SUDA 2QA9E 2HVYB 1GJBB 2NU3E 1W0JD 1K21H 4F49A 5EQQA 2OLGA 1WOFA 1AI8H 1C2HA 2VWLA 2ZU1A 3RMMH 1SC8U 3TLOA 3AVZA 3SUFA 5T6GA 3RXTA 4DOQA 1SLVB 3Q76A 2GGVB 3RXDA 3RU4E 3PWCA 1XUKA 1V3XA 1RGQA 1ID5H 1GCTC 1CT0E 4MPWA 1ACBE 1A3EH 2VBCA 1B5GH 2A5IA 2OCVB 3QK1A 3ZZAA 3KQEA 4BXWA 3U28C 3SHAH 2QYIA 4AFZA 1ZYOA 2W7UA 1XVMA 3U8RH 6GCHF 1O3CA 1K1PA 1EP5A 1OWKA 4YOIA 2OINA 4GSOA 2QXHA 2ZGXH 1HAHH 3EA8A 1DUAA 1ORFA 2WPHS 4AFQA 1ZTKA 1BTYA 3G01A 4CRGA 4AB9A 1CO7E 3DSPA 4FU9A 2PKAB 5SGAE 1NRSH 3S9BA 5DGJA 1A0HB 1P05A 2KM0A 1S5SA 2ZA5A 3A7TA 2W5EA 3NWUA 1O5BB 1O5FH 1XKBC 2OBOA 5JBCS 2ZDVH 3E0PB 5B6LA 4DW2U 2OD3B 2PTNA 2D1JA 1DM4B 1AUJA 1JMOH 3UY9A 3BTHE 3UB0A 4YOJA 4X8SH 1YYY1 1UTOA 2EC9H 3MMGA 1UTJA 3GISB 2W6ID 3GCHC 2IPQX 1ELCA 1UW7A 3RXIA 4RSPA 5CDFE 4X6PA 3DSGA 2CHAB 2ILNA 1HNEE 3KHVA 5DP5A 3MU5A 4O03A 1MZAA 3M5LA 5BRRE 1TX7A 4O3TA 1GVLA 4LZ1H 1ANBA 2QXJA 1MH0A 2W7SA 2BZAA 2AFQB 3BEFB 3TJNA 1Z8GA 3MU8A 2JETB 2BY9X 1S0RA 3A84A 4HZHA 1IHSH 5E0JA 4GPGA 3PV5A 4KP0A 2AMPA 4FUEA 1AFQB 2G8TA 1TBRH 2XCNA 1BQYA 2ZO3H 2IOTA 5GXPA 5TCCA 1ELBA 1TMBH 4AG2A 4INLA 3TJVA 4NIWA 4DGJA 1CA0B 2R9PA 3F9HA 4FETA 3TK6A 2KFWA 2P3FH 2WYJA 1FAKH 4FUFA 4ABBA 8GCHG 1PJPA 3RM2H 4B76A 3FKSD 1L4ZA 1LVBA 2Y81A 5C2ZA 1C2KA 1HAOH 3TH4H 1T7CA 1EAWA 2C4FH 2C8XB 2VIDA 3TGJE 1A5GH 1O3FA 4GCHG 1C4Y2 4BAMB 3UIRA 4IC6A 1LVYA 2J34A 2JETC 1ARCA 2BD3A 2C8WB 1SGRE 3SGQE 4I32A 4M7GA 5J4SA 2F9BH 4AOQA 3FFGA 1Z8RA 1INCA 1K28D 2ZDLA 3SW2B 2BDBA 1GJAB 2H9HA 2DE8A 5ESBA 1D3TB 3UFAA 4JYUH 2XWAA 1UK4A 1MAYA 1P2KA 2ZNKH 3SV6A 1NRRH 2AS9A 2FP7B 4FUDA 5A2MH 2PV9B 4IN2A 3MH5A 4ABIA 1NM6A 1GHBF 1HB0B 1KIGH 1HGTH 1QBVH 2UUJB 1W7XH 1MTSA 1E37B 3TK9A 1FQ3A 2STAE 2GCTB 3F68H 2XW9A 1EP6A 4I33A 4UD9H 2J95A 3A7YA 4NIYA 5IDKA 1QA7A 2VIWA 1TOCB 1L2EA 3TH2H 1E0FD 2R0KA 2W3KA 4GUXA 1LHDH 3RXGA 4OS1A 4K5ZA 5HM2A 1A0LA 3UOUA 1IQIA 1A5HA 1SLUB 1T31A 1O2HA 1C1UH 1VCQA 2VVUA 5EXLA 2OC0A 1XKAC 2KCPA 1PPCE 2FYRA 1AN1E 1AGJA 1OWEA 1KXDA 1MMJN 1BMAA 3RXMA 2A1DB 2CN0H 3BTKE 8KME2 1RTFB 4AFUA 3P92A 1O5DH 1C1NA 2XWBI 3E91A 5EJLA 3UAIC 1H8ED 1UHBB 3F6UH 1DY9A 2ODPA 1HAVA 1QB9A 1C5QA 2RDLA 3A86A 4IMZA 4ABDA 2IJOB 1EUFA 4YLQH 1GGDC 2EEKA 3OEHD 3SU2A 4H4FA 4DURA 2J2UA 1JIRA 1GMCF 2F4LA 4P00A 1AVXA 3D49H 3QLPH 1J14A 3E16B 2PUQH 2PLXA 1TA6A 1PPEE 2ZU2A 1OWHA 2VNTA 2AGGX 1V2JT 2A32A 1DX5M 1S85A 2TIOA 3A8CA 3EAJA 3ZVFA 4AORA 5J4QA 3MYWA 4TYDA 1LQEA 1HAZB 3L33A 5A8YA 2ULLA 2DE9A 1QGFA 2XTTB 1GBJA 1HXFH 1H4WA 1WV7H 1WU1A 5GDSH 4LXBH 3FANA 1U6QA 4ACAA 4CR9A 3KCGH 5EGMA 1OXGA 1QRZA 2WPJS 1AWHB 1C2MA 1Z7KA 1CGIE 2QF5A 1O3HA 2QF0A 3EA9A 1K1LA 1TRNA 4OS5A 1S6LA 1W8BH 2AGEX 1V2UT 1K0HA 3K65B 2HWLB 1PQAA 1Y5AT 2G51A 3LGIA 4XBCA 2XBXA 8GCHF 3OY5U 3VB7A 3SJKA 2BM2A 1C5VA 4X2WA 2XNDD 3K6ZA 1GHZA 1TFXA 2AH4X 4YT7H 3T28A 3PYHA 2KZ4A 2BLWA 3EQ0H 1J8AA 2BTCE 2XRCA 4Q7ZA 5FPTA 1GJ6A 3BTQE 1DPOA 1BHXB 1NS3A 2FESH 3OY6U 2Y5FA 1QL8A 1KMHB 1QRXA 5E2OA 1ZSKA 5AF9H 2Z9LA 1WBGB 1OP0A 3UNQA 1GHYH 2TGTA 2ZQ2A 1GMHG 3TJOA 1QJ1B 2HLDD 1GBTA 2J98B 3HGPA 3GCNA 4ASHA 3V7TA 3A7VA 1AE5A 1MUEB 3LGYA 1WUNH 2GCTC 2SFAA 1HLTH 1P06A 2OBQA 3N7DA 1JWTA 1N6XA 2HALA 3T26A 1BHXF 3KQBA 1D3PB 4D7GA 1EPTA 4X8VH 4MPXA 3LT3A 3PROA 4F48B 1DWDH 4FU8A 2FYQA 1DS2E 1P09A 1QB6A 2ZF0H 3ZIAD 4DJZB 2A4OA 8LPRA 2CF8H 1ZZZA 3SNBA 2QCYA 3QZRA 3GDVA 1O3OA 1BUIA 2JDID 3BTGE 1TMUH 5G4BA 1O30A 4BNRA 4ZMAH 3W95A 3DCLA 1AB9B 1P12E 3M3SA 3ZZ6A 2AHME 2K0QA 5EJ1A 1MQ5A 3C1KA 4RI0A 1PQ5A 5A0AE 1NBMD 1FPHH 1S6FA 1TWXB 1Z1IA 1BT7A 2OP9A 1A2CH 2W3IA 4RT0A 4A6LA 4E7RG 1COWD 5L2YH 2EQNA 3RC6A 1GGDB 1GBEA 4Y79A 1ZJDA 4M9FA 1C1WH 1A46H 3C27B 1BOQA 2TGPZ 4ASUD 1EPTB 1LQDB 3LIWA 3CS7A 1MD7A 1OWIA 5ESTE 4SGBE 1UTQA 1Y8TA 1ZLRA 3GDUA 5HIYA 2ZP0H 3N7EA 1DVAH 1TRYA 2GP9B 4E7NA 5FHTA 1G3DA 2PTCE 3SU6A 1O2YA 1OYQA 2FDAA 4O3UA 4OS4A 3LGWA 4B71A 5T6FA 2DUCA 1UVPA 1HRTH 1ZJKA 2EY4C 4UFGH 3UNSA 2QE7D 2F3CE 2A45B 4X1SU 1AE8H 1DOJA 5L6NH 1IHTH 1OYTH 1ANEA 1MKXH 5F6MA 5FXLA 2STBE 1LO6A 2LP6A 2B0FA 1C5LH 1A4WH 1AUTC 1NFUA 2VJ1A 1SQOA 2QXGA 1B0FA 1DLEA 4D8NA 3OEED 3SU5A 1IQMA 4ZCNA 2VGCC 1G37A 1G2LA 2ZPSA 3N99A 3GCTF 3KQDA 2J38A 5CHAB 4YESB 2PSXA 1TGBA 3GICB 5LPFA 1EZSC 4WF8A 1EZXC 2WPLS 1CU1A 1CT2E 1V2VT 3M5NA 1YCPM 2O8UA 3GYLB 1XUIA 1CSOE 3FP7E 2KCOA 1CBWC 4KTUA 4NZLA 2WSSD 3P95A 4D9QA 3NCLA 3UOPA 1BTPA 1ESAA 1FY5A 2G4UA 1CHGA 3I78A 4XOJA 1LHCH 2BLQA 3CS0A 4HGCA 1HJ8A 1NT1A 3F2FA 4DVAU 3U8TH 1GI9B 2CGAA 4Y71A 1KXCA 2G52A 3Q3XA 3UWIA 3D23A 2V7QD 4R8TB 3RM0H 5C5NA 4XD7D 1QQ4A 3PMJA 1C2DA 4AB8A 3SI4H 1TBZH 3RC4A 3BN9A 1TPAE 3BTME 7KMEH 4Y8XA 1SOZA 4FVDA 4AX9H 1Z8JB 1W7GH 1VITH 2LELA 2ANYA 3PTNA 1C2IA 1BDAA 4FOUC 2VVVA 5CMXH 1ETRH 1XUJA 1O2QA 5EIYA 2C3SA 1J16A 1DFPA 1GJDB 2ALVA 1S81A 2BY8X 2R2MB 2G55A 5DKMA 3SI3H 2D26C 5EPNA 2BDAA 1UO6A 3GY7A 1YBWA 2BX3A 2EA3A 3GY5A 1FY1A 1HAGE 1Y5UT 1E79D 2SNVA 1T8MA 4CBNA 1YPJH 1ZPZA 3AW1A 4AFSA 5I25A 4Y7AA 2CMYA 1C9PA 1GDNA 1BMMH 1G32B 1FPCH 1TX6A 3L3TA 1IQGA 3T5FH 5DJ7A 5GWZA 1DDJA 1BRCE 3MO9A 4YZUA 1H9IE 2RG3A 1HCGA 1Y3WA 4WXIA 1Z1JA 6CHAC 2BMGB 2A5AA 3VB4A 9ESTA 5EOKA 2SGDE 1F5LA 1G3CA 5AFZH 1FUJA 1XXFA 2BDGA 1GBBA 2D2DA 2ZFRH 3BTEE 3Q3KA 3E3TA 1BMLA 3ZZCA 2CV3A 2FTLE 4X8TH 1XX9A 1AKSA 3E8LA 2AYWA 3KIDU 3LKWA 1D4PB 3RXSA 3GDSA 2ZHDA 4FUBA 3BEIB 3RU4D 3HKIB 2LNCA 4B73A 1MCTA 1O3JA 1KSNA 2GCHG 2FI4E 1K1MA 3SQHE 2R2WU 2ZGCA 2WPMS 2PHBA 3JZ1B 1SR5C 3BV9B 1TMTH 3RP2A 3GY8A 1KLJH 5JBBS 4KKDA 4NA7A 3SZEA 1GJ5H 2PR3A 2FX6A 5IK2D 1ARBA 4XBBA 3ATIA 2VIOA 3S9AA 1OOKB 3RDZA 2BVXH 2P3TB 4INKA 1KDQB 2FI5E 3LJJA 1CBWB 3GY6A 4BAKB 3A7ZA 2BD5A 1O3MA 4Q80A 1O3DA 1UTPA 4Q7XA 3AASA 4CRBA 1BBRE 2ZFPH 1BRAA 4UEHH 1VR1H 4GLYA 1CGHA 2FEQH 1SBWA 1ANCA 2IN2A 1TX8A 4E06H 2VIPA 2ASUB 3MU0A 3SHCH 1Q3XA 2ZPQA 1NO9H 3SV9A 1O32A 4K60A 4OM9A 3RXVA
chains in the Genus database with same CATH topology
3NPSA 3MWIU 4GCHF 2V3HH 1MTUA 3ZZ5A 1NU7B 2H6MA 1MU8B 3SBKA 2TPIZ 1V2MT 1NESE 1GBMA 1EASA 1UVTH 1C4V2 2C8ZB 4ZXXH 3DUXH 1JIMA 1KXEA 3ENSB 3PWBA 4CH8B 2J4IA 1GMCG 2QXIA 3A83A 5A8ZA 1AZZA 1MBQA 2XBWA 1MTNB 3OX7U 4NIVA 1E35B 2BVRH 3BG4B 1GJ9B 2SGFE 1O5CB 3P8FA 4AN7A 4ABGA 2V0BA 1F5KU 4LOYH 2AERH 4ISLA 1AVWA 1KXAA 2ESTE 1QA0A 4X1PU 4MVNA 1O3EA 2IPHA 1TALA 2FLBH 3RU4T 1O2IA 1BJUA 4NSYA 1FDPA 1C1QA 2LPRA 3KEEA 3ATLA 1QFKH 5CE1A 1THRH 3F9EA 1WTGH 1ZRBA 1GI1A 1ZOMA 5GIBA 4Y76A 5EPYA 2QV1A 3NKKA 1DY8A 1SGCA 1BB0B 4KTCA 1FI8A 3V13A 1XUFA 1E34B 1S82A 4DIIH 1NFWA 1TOMH 2I6QA 1ETSH 4UDWH 5FCRA 2VH6A 4JYVH 1DLKB 1O34A 1NU9A 1P2OA 2Y80A 4ZROA 1YCPH 2BD8A 1AB9C 1MCVA 1W11U 4UONA 5C67A 4X2YA 1EZUC 1BIOA 2Z9GA 1GHBG 2A7JA 5C20A 1XUGA 1LVOA 2GKVE 1LPGB 1JOUB 1Q31A 1O2WA 2PUXB 1ZR0A 3ITIA 1FAXA 1MTWA 1DANH 4X1RU 1H8DH 3M3VA 4YT6H 2TBSA 1P8VC 3OU0A 5L2ZH 1NY22 1MKXK 2UWOA 1SGNE 3A8BA 1G3BA 2VIQA 1O38A 4ZKSU 4B74A 2XC5A 1GBDA 1NC6A 1TYNA 2ZHEH 3S69A 1UCYE 4JZDH 1W12U 2V6NA 1YPHC 1S83A 8ESTE 1Z8IB 4ABJA 1RJXB 3RLWH 1FIZA 1T4VH 1F5RA 3ZV9A 3SORA 5GCHG 2ZG0H 1ELVA 1LKBA 1B7XB 1FY3A 1SB1H 2ZCLP 1QBNA 3E6PH 1C5SA 1GJCB 4K1EA 3BSQA 3LGVA 1TGSZ 2M5TA 4I8JA 1WQVH 1BTXA 4X1QU 2FWWA 1P2IA 1ANDA 1IQEA 2B9LA 1MTNC 4NWLA 1QB1A 2KAIB 3CENA 4RN6A 3SUGA 2GVFA 1GMHF 1HXEH 1MQ6A 2ALPA 4A1XA 3ATMA 3QZQA 2JH0D 1AY6H 4OS7A 4XE4A 2RA0A 2ODYB 5AVDA 4OS2A 1O5AB 1GJ8B 3TJUA 3S0NA 4GVUA 5DP6A 1EJNA 1OKXA 1O3AA 1SGIB 1ESBA 1V2ST 1AO5A 4JZFH 3EGKH 2F9VA 4BXSA 3BTFE 4Q2KA 1O5GH 2B8OH 1TA2A 3A80A 2ZCKP 3ZVEA 2UUKB 3BF6H 3ATWA 3O8RA 4U32A 1C5UA 1NFYA 4GHQA 2P59A 3ELAH 2OC8A 5B6OA 4A1TA 3UWJH 2GV7A 2ZEBA 1P01A 3K6YA 1GI6A 1SMFE 3ODDA 1J17T 4BTIB 3M35A 1NRNH 1GI7B 2GD4B 2BD9A 3Q3YA 1TRMA 3T27A 3AAUA 1YM0A 4CRCA 1HAIH 5A0CA 1Y59T 4JYTA 5DO4H 1F0RA 2ODQA 3FVFB 5AHGH 1AZ8A 2BY5X 1OP2A 1XXDA 4TPIZ 1O3BA 1DSTA 1A1RA 1GBHA 1OSSA 3M37A 3RXAA 1GJ4H 2XC4A 4NIXA 3LGTA 3KN2A 1RTLA 2ZDAH 2K1QA 9LPRA 5GPIB 1P03A 1SFQB 4ABFA 2A4GA 1S6HA 1W14U 2P95A 3MI4A 1V2QT 2FOMB 4CHAB 2V35A 4GHTA 4UE7H 2FOBA 2GDEH 1O3GA 3SU0A 1GCTB 1NZQH 1DSUA 2AIPA 2FOGA 4MPVA 1BBRH 3N7OA 5C1UA 5C3NA 3ZVDA 1A3BH 3W94A 1BTUA 5JB9S 2FIRH 2CXVA 4CH2B 3ZZ8A 1QTFA 1VJAU 4JMYA 3ZVBA 3BIVH 1UMAH 1YF4A 2Y7ZA 1FY4A 2PW8H 4D7FA 3MNBA 2PWXA 3ZZ9A 4WJG2 2BQ7B 4ZXYH 3V12A 1O2GH 2A4RA 3BTDE 1CGJE 4ABEA 1O2SA 1T4UH 4YTAA 2A2QH 1HIAB 3QX5H 3V0XA 4WWYA 3U69H 1O2VA 4ABHA 4Z0KA 2UWPA 1IOEA 4CRAA 3I77A 4WH8A 3SJ9A 2QGRA 4X2VA 1SLXB 2Q1JA 1ZPBA 1LPKB 3HGNA 4SGAE 3ZZ7A 1SGTA 3ZVGA 1C4U2 1J15A 4XBDA 3O8DA 4XFQA 1HPGA 1NN6A 4JZ1A 1UVSH 4TWWA 1V2OT 2NWNA 2AMDA 1IQKA 4FVBA 3PM3A 1EAUA 2BY7X 1K1NA 3ZV8A 2PSYA 1P3CA 1O3NA 1FXYA 1IQFA 1BRUP 3RXJA 1O5EH 3RXFA 4CBOA 3BIUH 1L1NA 4X8UH 3PB1E 1FMGA 5JYIA 1IAUA 2P3UB 4J2YB 3MH7A 1GL0E 1GWAA 2ZZUH 3K9XB 1UTMA 1DT2A 1T32A 2HGTH 3PLBA 1FLEE 1KLTA 4JCNA 4B75A 3VGCB 4KTSA 1G30B 1C5YB 1C1OA 2GZ8A 1ZPCA 3E90B 5FX6A 1TE0A 3RXQA 1VITG 3MHWU 2FXRA 3DFJA 4ZHAA 2ZHWH 1CHOG 2BOHB 3PO1C 1DXWA 1EOJA 4FUGA 2PGBB 3IWMA 2SGEE 2FPZA 3A87A 4TY7A 1TNGA 3VXFH 1ELAA 5T6DA 3DHKH 3KNXA 4ISIH 1OPHB 2FM2A 1GBIA 1VJ9U 2FS9A 1OP8A 4Y0ZE 2BQ6B 2VU8E 2ZPRA 3S7KB 3SV8A 2GCHF 3GY4A 2F9NA 1GBCA 1HAXB 3ZZDA 2TRMA 3MH6A 3VB5A 2Y82A 1SHHB 1Y5BT 1OX1A 1JRTA 3P17H 1ELGA 1P2QA 1SGDE 4Y10E 1BRBE 5DP4A 2FOCA 1V2RT 2GZ7A 3JZ2B 2UUFB 1C5MD 1WCZA 4Q7YA 1HDTH 2QN5T 4MNVA 4CHAC 4I7YH 1TNHA 5DP7A 1V6DA 1L4DA 1MAXA 3MNCA 1GDQA 2R3UA 4I8LA 3RXEA 2RA3A 3URDA 4QT8C 5DP8A 5JBAS 5JPMH 1C1MA 4DIHH 4YLUA 2VWNA 1SFIA 4RKJB 2QC2A 3SV2H 1SG8B 1TABE 3PMAB 2XC0A 1SLWB 3DFLA 2HRVA 4NWKA 3TH3H 5F8XA 1O2RA 2GT7A 1TAWA 3RMLH 3P70B 3TVJB 2KAIA 3PMBB 4MLFB 1PPHE 1GCDA 1MBMA 1O2JA 5TJXA 1THSH 3SGAE 1SGFG 3LC3A 1GG6C 1UCYK 2VIVA 4MPUA 6LPRA 3UR9A 2BLVA 2RCEA 2WPKS 2F83A 1O2XA 2OQUA 1K9OE 2A7HA 3GYMA 3U9AH 4THNH 4IW4E 3SU4A 1EX3A 1ZTLA 2SGQE 2Z3EA 3RMOH 5HGGA 5DP9A 1TNIA 3UPEA 3HATH 1G36A 1SGFA 3SUEA 1O3KA 2NU4E 3U1JB 1PPFE 2BXUH 2OC1A 1UK2A 5FCKA 1XUHA 1GBKA 1SI5H 2ZTYA 4YO9A 1HAPH 3QTOH 2G5NA 1LTOA 1O3PB 1YPHE 2ZC9H 2Z9IA 1QR3E 3M5MA 1WYKA 1E38B 3SJ8A 1ZGVA 3I29A 1ZTJA 2ZIQH 3GCHB 3P8OA 1A5IA 3UQVA 4WMFA 4IBLH 2GV6A 2BX4A 3M7QA 4IMQA 1KY9A 2A4QA 3A89A 1JRSA 1O33A 4AGKA 5A8XA 4NA9H 4AYYB 2BY6X 1W2KH 5HMAA 3MO6A 3BTTE 4AZ2B 1GVKB 2A0QB 1DWEH 5JB8S 2FOAA 7GCHF 3KGPA 4I31A 3A7WA 4ISOA 3T25A 3AW0A 1ELFA 2C90B 1QQUA 1QIXB 4NGAH 1O3LA 2BD4A 2I6SA 4H6SB 1RIWC 1AVGH 1O39A 2PGQB 4X6OA 2H9EH 2OUAA 1OWJA 1Y3YA 4Y6DA 2V3OH 1MZDA 4JK5A 5FAHA 2ZFSA 1WSSH 5DG6A 1KDQA 2PKAA 3RXCA 1O3IA 1RS0A 4Y0YE 2GT8A 1BMNH 3MOCA 1K2I1 1LHGH 2ZFTA 2O8LA 1TGTA 2Z7FE 2ANMH 3PLPA 4INHA 4FUJA 2CJIA 3H7OA 2BXTH 3BEUA 1O2OA 1ABJH 1IQHA 1SGPE 1TBQH 4MNXA 1TPPA 1RTKA 4ISNA 2EI7A 1YPMH 5DP3A 2WV5A 4AGJA 1GVZA 3KF2A 3ZVAA 2ZCHP 2GMTB 4ISHH 3P8GA 4JK6A 4VGCC 3LJOA 4UFEH 1RIWB 1THPB 3FZZA 1D6RA 5GJ4B 4D76A 1LMWB 1AHTH 1ZMNA 1ELTA 3TGIE 3QN7A 1UTLM 2GTBA 3NK8A 1LPZB 3S9CA 2VGCB 1ELDE 6ESTA 2BB4A 1LHEH 3SO3A 1EAIA 4WXVA 1HAVB 1N8OB 2ZU3A 2SGAA 4I8GA 3LU9B 3LPRA 1QL7A 1C1RA 1EXFA 2BDHA 2Z6BD 3LH1A 1ABIH 2Y5HA 1LDTT 1V2TT 3NZIA 3SV7A 5C1XA 2H2ZA 1RD3B 4BAOB 3V3MA 1DWCH 5FPSA 1XMNB 2Z9JA 1YCPK 4X2XA 4A7IB 4BTTB 5JBTA 1EKBB 1FJSA 1OWDA 2B5TB 1UCYH 2BDCA 1O2MA 2BVSH 2A7CA 3UNRA 3A85A 2Z3CA 1AFEH 5DK1A 4CRFA 2YNBA 1TNJA 5GCHF 3F1SB 2ZTXA 3MU4A 4MTBA 1NFXA 5E0GA 1EZQA 2XBYA 3MNSA 2GDDA 1BCUH 1TNKA 2QIQA 3VEQB 1DITH 2ZKSA 1GI4A 1VITF 5LGOA 3ZYDA 2G00A 1NRPH 2UUYA 3PLKA 5FX5A 2P93A 2C93B 3M3TA 2AIQA 4IC5A 3RXKA 1NRQH 1TB6H 2AEIH 2ZTZA 1FZZA 2H5DA 1EPTC 2NU0E 3EDXB 3R3GB 3PMHB 4J1YA 1L0ZA 1G3EA 1P2JA 1CHOF 4ZHLU 1PPZA 1C5RA 3LH3A 2FZZA 1SGEE 3TU7H 3VXEH 3MO3A 5HYOA 3RLYH 4D9RA 4K3JA 4TPYA 2UWLA 2HPPH 1MU6B 3SN8A 1XVOA 3VGCC 4GAWA 1ZSJA 3HK6B 3HPTB 1PYTD 6CHAB 4X0WU 2WUCA 1BTWA 3M7TA 1C2JA 4A1VA 2BD2A 4DT7B 1V2NT 1AWFH 4IGDA 1HBTH 2GMTC 5F8ZA 1W0YH 3SNEA 2B7DH 1N6YA 3LGUA 5ETXA 1O2UA 1F0UA 1QJ7B 3U1IB 4ZUHA 3STIA 4CREA 4H42U 5C5OA 2VINA 5CHAC 4KELA 1SL3A 1W13U 5C1YA 1E36B 3GCOA 1S84A 3DD2H 1H9HE 3A8AA 1VZQH 2O8WA 1GI3A 1F7ZA 2FOEA 4LK4A 1A61H 1BZXE 1P2MA 2ZFFH 4A92A 3T29A 3OYPA 2WUBA 2HNTF 4AG1A 2ZGBH 2JKHA 2A5KA 1EB2A 1GPZA 1MKWH 3ZVCA 3MTYA 4VGCB 3DT0H 5EW1H 1P3EA 1DICA 3T2NA 4DCDA 4Y8YA 4FUHA 1MTVA 1ZHMA 3H5CB 2ZDKA 4AYVB 2SNWA 2ANWA 4YOGA 1D3DB 1EAXA 1HAYB 1SGYE 3IITA 5FPYA 1EB1H 1EOLA 3PTBA 2O9QA 1C1PA 2PKSC 1P57B 2Y6TA 4WH6A 1YPKH 2O8MA 1FIWA 4A5TS 5TCAA 4HI3A 4XDEA 3SZNA 4NA8A 1AIXH 5IYTA 3A8DA 1DWBH 1H9LB 1F0TA 1MKWK 2AMQA 5E0HA 3L6PA 5EXMA 4MNYA 1O37A 1SQAA 1H8IH 1F0SA 4KGAA 2EI8A 3RMNH 1GDUA 2PFEA 5BPEA 1AU8A 1C1VH 1C1SA 4DG4A 1AKSB 1ZSLA 5E8EH 2Z3DA 1ZMLA 1P10A 3FZDA 3P8NA 4IN1A 3T62A 3WY8A 2BOKA 1YGCH 1HJAC 2WV4A 4IS5A 3A88A 4U2WA 1Z6EA 1C1TA 4FU7A 4Y11E 4Y8ZA 1TQ0B 2P8OC 3NUMA 4UFFH 1UVOA 1QURH 3ZZBA 1GI0A 4B2AA 2OC7A 2OQ5A 3D62A 3QGNB 3MH4A 3SJOA 2F9OA 1YC0A 3UQOA 4ZKNU 4O9VA 2R0LA 4E05H 1G9IE 2FTMA 5L30H 3TIUA 1GI2A 2QY0B 3RXBA 1FV9A 4B2BA 1SPJA 1C5ZB 3LDXH 1GHVH 1JXPA 5A09A 1P9UA 4I8KA 3RUOA 3TNSA 2J9NA 2YOLA 2WYGA 1VGCB 1PQ7A 2BDIA 1GBFA 3VB3A 1BTHH 1QY6A 1Q2WA 1UJ1A 3FAOA 1UTKA 3GY2A 1FNIA 1PYTC 1UK3A 3F9FA 4NCYA 1EJMA 1ELEE 2XXLA 4K8YA 4MG3A 3SNCA 2P8OB 3QWCH 1J9CH 1KLIH 4UFDH 1GI8B 2NU2E 1O2KA 3DA9B 4OGYA 1EJAA 3UTUH 3M5OA 1DXPA 2AGIX 1BJVA 2ZDNA 1AMHA 1K1OA 1GHXH 5F8TA 1Y3XA 3MNXA 1CT4E 3Q77A 2VH0A 3ATKA 1V2WT 1QHRB 4WMEA 4ZKOU 1HUTH 1VGCC 3LONA 2FO9A 2ZFQH 1GHWH 3Q00A 2H1UA 2ZGHA 2XYAA 2Z9KA 4K69A 5LPRA 2JH6D 2XBVA 2BZ6H 1B0EA 1TONA 5EU8A 1F2SE 2G81E 1GJ7B 5ABWA 1A7SA 4X6MA 5FBEA 1TIOA 2J94A 2JH5D 3E1XB 5EW2H 3EE0B 1A0JA 3K2UA 2PKSB 2F91A 4H6TA 3VFEA 1HJAB 4WMDA 1D9IA 4LZ4B 4CR5A 1BITA 1HIAA 2ZI2H 2EI6A 2G5VA 1P04A 3MFJA 1Z6JH 3BTWE 5H4IB 6GCHG 5PTPA 1P9SA 2ZDMA 1RRKA 3QO6A 3GCTG 2THFB 1LKAA 3GOVB 5AFYH 3LC5A 1V2PT 3TNTA 1O2NA 5I46H 1O2TA 1DE7H 1W0ZU 2R3YA 1V2LT 1YP9A 4BOHA 3SGBE 2GZ9A 3E0NB 1EQ9A 1MD8A 1PPBH 3TK5A 1CE5A 3A82A 4MNWA 4NG9H 1CQQA