3KIDU

The crystal structures of 2-aminobenzothiazole-based inhibitors in complexes with urokinase-type plasminogen activator
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
246
structure length
238
Chain Sequence
IIGGEFTTIENQPWFAAIYRRVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSAAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structures of 2-Aminobenzothiazole-based Inhibitors in Complexes with Urokinase-type Plasminogen Activator
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 238
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2009-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3kidU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3kidU01
1XXDA 4H42U 1SGFG 1D9IA 1GMCG 3LGWA 1MQ6A 5IYTA 1TNKA 2BDIA 1Z71A 3VXEH 1HJ8A 2TPIZ 4K8YA 3P8FA 1Y5BT 2QXHA 5TCAA 2VIDA 1E34B 1P09A 4NWKA 4Y8YA 4GLYA 3VGCB 1O3DA 1AD8H 4OS4A 2GVFA 1QB1A 1CO7E 1FY3A 5BRRE 1CA0C 4THNH 3UNSA 1VZQH 1HAXB 3SQEE 5DP5A 2OQ5A 3T25A 4KGAA 1C5OH 2BDBA 1W0YH 3GICB 4VGCC 1LVBA 1XUFA 3ODFA 4RN6A 1EAXA 1QBNA 3LJOA 5LH8A 1DFPA 5CHAB 3M37A 2GTBA 5FBIA 3HK6B 4AG2A 3HKIB 1ABIH 3BG4C 4JYVH 3IITA 1ZPZA 2C3SA 2W7SA 1CHOG 3RXCA 1MH0A 4ZHMU 1C5SA 3UREA 3LGYA 2XCFA 4Q80A 3P8GA 1O30A 2PWXA 2BD8A 1OPHB 1AFQC 1M9UA 1UK4A 4ASHA 2YOLA 4OS2A 1C1QA 1O2TA 2BLVA 4QT8C 2BVXH 1W7GH 1GBCA 1GBKA 4CBOA 1MU8B 2XWBI 2A5AA 5EPYA 1V2VT 1GBEA 1LVOA 1NFWA 3QUMP 2Z94A 2ALPA 1CU1A 5C1YA 3TK6A 1Q2WA 4UE7H 2LPRA 4ISHH 1QRZA 2PSYA 1SL3A 1OP2A 2QIQA 2ZU5A 3CS7A 3QO6A 1VJAU 2FX6A 4X8TH 3SN8A 1AB9C 4DCDA 1BTYA 2AIPA 3SUEA 1O37A 1C2GA 1DE7H 4U30A 2Y7ZA 3LC5A 1Y3VA 3KL6A 3SNAA 4NWLA 1AWFH 1LVYA 1Y3WA 3KF2A 2ZP0H 4X6MA 3BTME 4UFFH 1QCPA 1Y3YA 2TGAA 1QRWA 3MU5A 5JB8S 1YPHE 3Q77A 5F6MA 4B75A 1XUGA 1HAVB 1AGJA 3PM3A 2HNTF 1D4PB 3V13A 1O2KA 4BXSA 3U98H 1BTHH 3PLKA 1LMWB 4DURA 1HLTH 2BVRH 2PKSB 3OTJE 2ZGCA 4M7GA 1O3BA 2Z3DA 1IQIA 1NFXA 2EC9H 2VJ1A 2ZQ2A 4AG1A 5GDSH 4HGCA 1N6YA 2P3TB 1YC0A 2FWWA 3QWCH 4X6PA 4WJG2 4Z6AH 3EGKH 4GCHF 5HM2A 2FOMB 2VIOA 1BBRH 1YPJH 2IOTA 3QX5H 3PMAB 3TITA 4ZMAH 2HPPH 1CT0E 1IQEA 4IW4E 2F91A 1GI1A 2ZU4A 1P01A 2FLBH 2BX4A 3KQCA 1ACBE 1S0RA 1S6HA 3KHVA 3RXJA 5E2PA 3QGNB 2WPIS 2A4OA 1GDUA 2BQ7B 3BEUA 2V0BA 4E7RG 1WOFA 1YCPH 2XBVA 2ZFRH 1O3EA 1ZHRA 1T7CA 1P2OA 4MPXA 3M3TA 2BM2A 1ZSJA 1KLTA 1PFXC 3QN7A 3FFGA 2J2UA 1XXFA 2J9NA 3ATWA 2R0KA 3M5MA 4X8VH 5C20A 3U69H 1JIRA 1A5GH 1GVLA 3TNTA 2UWPA 1SMFE 2CHAB 3TIUA 2GP9B 3ZYDA 2J4IA 3T2NA 2FOBA 3UOUA 4WH8A 1T8LA 1LKAA 1C2KA 4OS5A 4A1TA 3F6UH 2QF3A 2ANKH 4DJZB 3DFLA 1A5IA 2VWMA 3GISB 4CRBA 3MU0A 4WVPE 2WUCA 4K1EA 1GCDA 1QA7A 5J4QA 1BMNH 1H4WA 4DIHH 1ZOMA 2AYWA 3I78A 1T4VH 4ISLA 5AF9H 2ZDNA 3SQHE 1ZPCA 1FIWA 1L1NA 1C5XB 3QLPH 1TGBA 1QB9A 3U8TH 2V6NA 2XYAA 1ESTA 1K1LA 1S6FA 4OGXA 3P6ZB 3ATIA 5E2OA 1V2OT 1A61H 1ZHMA 3SJOA 5DGJA 3Q76A 1BITA 1E38B 5JYIA 2UUFB 1K2I1 3MTYA 1Z1JA 3E91A 1BZXE 1OS8A 1SGCA 3K2UA 1BJUA 3RLYH 2P95A 1SLVB 1EZXC 2ANWA 3S0NA 1LPGB 3RXOA 1UTOA 2ULLA 3SJKA 1YLDA 3QTVH 2BXTH 4WWYA 2WPMS 3KIDU 4DGJA 1V2RT 1C1UH 1D6RA 1BMMH 1XKAC 3AAVA 1SGNE 1EASA 1FAKH 1GJ9B 1FI8A 1ANCA 1GMDG 2Y82A 2Z9GA 1TRNA 2ZPSA 1O36A 3M5LA 4YOIA 3BTGE 1BUIA 3CS0A 1DVAH 1E37B 1TGSZ 3SGQE 4LZ1H 1H9IE 1SGEE 3HATH 1QQUA 3ESTA 2ZPQA 5E0GA 1MTWA 1LPZB 3OSYA 1NTPA 3BF6H 4CREA 1THSH 2HNTC 1S85A 3A83A 4D7GA 1TYNA 4B71A 3A7YA 1WTHD 2THFB 5L2ZH 1HBTH 3ODDA 5H4IB 2PR3A 1WTGH 3GY3A 4Q7XA 3TU7H 1TWXB 3UR9A 1QJ1B 5DP9A 4MNYA 1UCYE 1YP9A 3RMMH 1V2ST 1FZZA 1D6WA 2B7DH 1F2SE 4HFPB 4AGJA 5DP7A 5FBEA 5LGOA 1TNGA 4ZKNU 1W8BH 2XNIA 3SU3A 3DT0H 1GJ5H 1PQ7A 1GGDB 3ZVBA 1MTNB 1EP5A 3PLBA 1NRSH 2R3YA 2M5TA 4UONA 3PWBA 1C2IA 1NN6A 2D1JA 4ZH8A 3S9AA 4YZUA 3RXAA 2FM2A 1EJMA 1UVPA 2PKSC 1UVOA 3KGPA 5EQQA 3W95A 4K60A 4YT7H 5A2MH 3SV6A 1AQ7A 2BDGA 1RIWB 1FY1A 2UUYA 2ZPRA 4WH6A 1O34A 4I7YH 1AZ8A 1SGQE 1P8VC 2H9TH 3RXLA 1ARBA 3E90B 1TQ7B 2HALA 4FU8A 1AIXH 4B1TA 2P94A 3FP8E 1GVZA 1W11U 4I8LA 1OWHA 1L1GA 1UK2A 3UWJH 4LK4A 2BLQA 2ZQ1A 1ESBA 3PWCA 3SJ9A 2ZU2A 4R8TB 1F5KU 5GIBA 2ZCHP 1KYNA 2PLXA 2AGIX 2SGPE 2J95A 1TALA 3OYPA 2ZDMA 5I46H 3DFJA 2STBE 4X1RU 2R2WU 3MH4A 1XM1A 2A4GA 4TY7A 3P8NA 3L3TA 1WAYB 4FUEA 3DD2H 1EP6A 3RXSA 1O5DH 2VGCB 1GI4A 2A0QB 1UHBB 2ZFTA 2ZCKP 1IQNA 4I32A 2WPLS 1BB0B 4NFEA 1B5GH 1O5GH 1Z8IB 2ASUB 8GCHG 2BLWA 2GZ9A 4SGBE 3GY6A 2CGAA 1P3CA 3GDUA 3A8DA 2BB4A 2EEKA 2O8LA 4JK5A 1AMHA 4LOYH 1DSUA 5C1XA 2SGAA 4MPUA 2ODYB 4XE4A 1E35B 1ZYOA 8KME2 5EQSA 3UOPA 1TE0A 4AYVB 3GYMA 2ESTE 1P02A 3A7TA 3S69A 1C2LA 1T8NA 4K5ZA 1CGHA 5TCCA 1YPHC 3RDZA 4MNWA 2O8MA 4ABJA 2ZU3A 4BAOB 1SB1H 3BTEE 2P8OB 1PPHE 1LHCH 3KQBA 1YGCH 2AS9A 1F5LA 1C5LH 1GBMA 1MKWH 1QBVH 2P3UB 1UVSH 1DICA 3GCTF 4J1YA 1SFIA 2BDYA 2CN0H 5EXNA 4CHAB 1VITF 1G3CA 2W26A 2BZAA 1IOEA 3ZV9A 2NU1E 1O2SA 3GY7A 2IN2A 1IQKA 1MBQA 1CT4E 1O5AB 2BQWB 4IC6A 1XUIA 1C5WB 1GHVH 1GBLA 4UD9H 1OYQA 1AN1E 1B7XB 4E05H 1FN8A 1IQGA 1ZPBA 2ZTZA 3LGIA 2FTLE 1J17T 2QY0B 1ELVA 4IN2A 4IBLH 2KAIA 1GI6A 1WU1A 5A8ZA 1GCTC 1BT7A 1ZTKA 3BIVH 1CQQA 1MTVA 3BSQA 1AI8H 1EX3A 1MMJN 1RFNA 1TRYA 1C1VH 1KDQA 1C9PA 2ZFPH 1VGCB 1TX6A 1FLEE 9LPRA 1XUKA 3SJ8A 1P10A 2A45B 3O8BA 3A7XA 2A2QH 2SGEE 4YLQH 4TWYA 5L6NH 1PPEE 1OSSA 6ESTA 4GUXA 1F7ZA 1CBWC 2BYAX 2FDAA 4Y6DA 3LKWA 1GHAF 1SOZA 1UTKA 1ZGIA 1DX5M 1A4WH 5L2YH 1UTMA 1O5EH 1UO6A 3ENSB 5FPSA 2W3KA 1DY8A 2VIQA 4B2CA 1DANH 3SBKA 3BTKE 2NU2E 3C1KA 4JZFH 4X2VA 1GMCF 3M5OA 1IQHA 4ZHAA 1ARCA 3AAUA 1MTNC 3KNXA 1SSXA 2BD4A 4I8JA 3MYWA 3M7TA 8ESTE 1YPEH 1O2VA 3RXQA 1MAXA 1QL8A 1FY5A 2GZ8A 4NA7A 3ZZ9A 1S83A 3NZIA 3LIWA 4YO9A 1H8DH 2PUQH 1ZRBA 5EG4A 4ABAA 1NM6A 1RIWC 1NZQH 1FQ3A 3STIA 1RTFB 3MO6A 1BBRK 1P2QA 2C90B 3RM0H 3EYDA 1BA8B 2I6QA 1C1WH 1O2MA 3ZZAA 2QF0A 4BAHB 1YPKH 3QDZB 3MO9A 4JZEH 1C1TA 2AH4X 1EOJA 2ZWLH 1TGCA 4CBNA 1MZAA 1AUTC 1J9CH 3ZZ3A 1C4Y2 3PLPA 4JZIA 1TPPA 1GJDB 2ZG0H 3F9HA 4WMFA 1CHOF 4I8HA 5FAHA 1UTQA 1JWTA 2QN5T 1YCPK 2OC1A 4D76A 1C1MA 3UTUH 3EA9A 1W14U 3SW2B 4BXWA 3SNDA 3SU4A 2GMTB 2FX4A 4Y0YE 1V3XA 3VB3A 1TX8A 1TGNA 4XOJA 3P70B 3VXFH 1ZMNA 2JH6D 3LGVA 1O35A 1KIGH 1XVOA 2QAAA 1ELCA 1ZSLA 2ZHFH 1VR1H 4MG3A 2OC8A 1RXPA 2QGRA 3T28A 2Z9IA 1XKBC 2O8TA 1TB6H 1XMNB 5F8ZA 4DOQA 2A7CA 3SU0A 1O38A 1NO9H 2XBWA 1GBFA 4CRAA 1FPCH 3A7WA 1ZRKA 1OOKB 2XCNA 1PPBH 1HRTH 2Y6TA 3W94A 3SNEA 6CHAB 5T6GA 1KXAA 3RC5A 4OGYA 1BTUA 5DP3A 4ESTE 3MH5A 2ZGBH 3TH2H 4WF8A 4ABGA 1GHBG 2B9LA 3PYHA 3PTBA 1MQ5A 4ZAEA 4YT6H 1C1RA 1C2HA 3Q3YA 4BTUB 2TGDA 1C5PA 1NT1A 1AY6H 1C5RA 4UEHH 1HDTH 4Y79A 1H8IH 4U2WA 1EZUC 2ZZUH 4ZKRU 3SNCA 3D62A 4O3UA 1V6DA 2FI4E 1K1MA 1EKBB 1QRXA 2BDCA 1QURH 1DXPA 2ZHEH 5LPEA 3RMLH 4AFZA 1PYTD 2BD5A 1PQ5A 3B23B 2P8OC 1EB2A 1LCYA 1P04A 3N7OA 3Q00A 3M36A 1BCUH 1C1PA 4INHA 1OXGA 1FMGA 2VH0A 2ZC9H 4AORA 1V2NT 3E0PB 4BANB 3GDSA 1ABJH 1TBZH 1LQEA 3OY5U 1NROH 2BXUH 4Q7YA 4UFGH 1UTJA 3BEFB 3ATMA 2WYGA 4ABBA 5A0BA 1O3CA 2Y5HA 1JOUB 2FEQH 1GBAA 5ABWA 3A86A 1FONA 4ZXXH 2HWLB 2XWAA 5EXMA 4FU7A 4K3JA 1EPTC 1VCWA 2WPHS 3IWMA 3P17H 4ISIH 2A7HA 4IMZA 1S5SA 1O2RA 2QXGA 2WYJA 1P2JA 1EAUA 2ZDVH 3LU9B 4A5TS 3S7HB 3JZ2B 5A8XA 3RU4T 4F4OC 2FS8A 1QB6A 2ZGJA 4AB9A 2C4FH 1ORFA 2GV7A 1XVMA 4KTCA 1W0ZU 1C5NH 1D3DB 2PGBB 1DLEA 2A4QA 4ABEA 3O8CA 4Y76A 2UUJB 2FTMA 1W3CA 2ZI2H 2F3CE 4HZHA 3RXIA 2QA9E 3U8RH 4ZUHA 1A0JA 1TMTH 5C67A 4ZKOU 1YLCA 3MO3A 3T27A 1BRUP 1O5FH 4XDEA 5TJXA 1DOJA 1KXCA 5DP6A 1GJAB 3S9BA 4Z0KA 2JH0D 4AN7A 1ZJKA 5EU8A 3GDVA 1AKSB 4FVDA 1J14A 4IS5A 1EPTA 3BTFE 1G37A 7GCHF 1GL1A 4INKA 3UNQA 1C2FA 1AE8H 4XFQA 1UMAH 3FP7E 3RC4A 1O3OA 3F1SB 2OINA 4KP0A 2FLRH 2YNAA 3M35A 1GI7B 2BX3A 2PUXB 3RXRA 4JYUH 1NU7B 2PKAA 2BDAA 4CH8B 2FO9A 2ZCLP 3LONA 1O3JA 1OP0A 2QC2A 2R0LA 4RSPA 1N8OB 1GHZA 1SOTA 4A92A 3GCHB 3L6PA 4MDSA 2G8TA 2C93B 2XW9A 3RP2A 1JMOH 2SNWA 5IDKA 2VH6A 3NUMA 1QJ7B 3NKKA 3U1JB 3MH6A 1JXPA 1C5ZB 1Q3XA 4AZ2B 4B74A 1F0RA 2VINA 4U01A 3V12A 4BAKB 1O3MA 2F9BH 1TFXA 1ZZZA 2XRCA 1VJ9U 2GMTC 1SVPA 4XBDA 3HPTB 2Z7FE 2OUAA 1GI0A 1GMDF 4ABIA 1TA6A 1ZMLA 3RXTA 1EAIA 2CF8H 3T29A 1VCQA 2B5TB 3ZYEA 1F0TA 1AO5A 1TONA 1DWEH 1SGIB 5BPEA 4D7FA 1RJXB 1O2XA 1EB1H 1YYY1 2GV6A 1GJBB 3VGCC 4X1QU 6GCHG 1P06A 1SQAA 3A8BA 5ESBA 1G36A 1P2MA 4XBCA 1JRTA 2NU3E 1HNEE 1VITH 1O3PB 3TLOA 1TQ0B 6CHAC 4NG9H 1D3QB 3ZZ6A 1HXEH 4Y11E 1TPAE 1UCYH 1LTOA 4H4FA 1LHFH 1QNJA 3H7OA 4DG4A 3Q3XA 5ETXA 5CHAC 1EUFA 2QYIA 5I25A 3RXEA 3VB7A 1PYTC 5GJ4B 4AGKA 4Y7BA 1MCTA 2F83A 2ZDAH 4KKDA 4MPWA 1MKWK 1XUJA 2NWNA 1ZHPA 1EOLA 3UFAA 2BD7A 3M3VA 5T6FA 1ELEE 1A3EH 1A5HA 1MKXH 1W7XH 1PPCE 2FESH 1ZMJA 1Z8GA 1FDPA 1QFKH 2ZU1A 2F9UA 1QHRB 1CT2E 2W5EA 5SGAE 4TPIZ 1O2OA 1SGPE 2A1DB 2ZKSA 2XBXA 1CSOE 2ZIQH 4MNXA 1PPGE 3URCA 3NCLA 1H9LB 3RC6A 2BZ6H 2I6SA 3SU5A 1YKTA 2AMPA 1HGTH 1TIOA 5L30H 1GMHG 1O2QA 2GKVE 1O3HA 2GX4A 2BD2A 1OYTH 2GT8A 1BRBE 3OX7U 1BOQA 4Y71A 1TOMH 5FPTA 1UTPA 1ID5H 1BJVA 1HCGA 1GHXH 2PTNA 4ZXYH 1K21H 1P2IA 3AW0A 1SQOA 2ZFQH 1F0SA 1AZZA 1A2CH 1C2MA 1GG6B 2STAE 3GY2A 5GCHG 7LPRA 1NRNH 1MCVA 1P03A 1DITH 1LDTT 1NFYA 1YCPM 5EODA 4J2YB 4OS1A 1TMBH 2FIRH 1OKXA 3E6PH 4MTBA 3A81A 4E7NA 1GI3A 4IMQA 4IGDA 1U6QA 1HJAB 2Z6BD 4K69A 3SGAE 3A7ZA 3RU4E 2NU4E 8GCHF 1HJ9A 4IN1A 5A8YA 2GZ7A 3H7TA 3SU2A 1BMAA 3BTDE 2R9PA 3E8LA 5DO4H 1HXFH 1Z1IA 2ZHQH 3LC3A 1MAYA 1L4DA 1S84A 4FUHA 2A2XH 2BY9X 4RKJB 3FVFB 1EZSC 3FP6E 1GJ8B 5C5OA 3M7UA 3NPSA 3I29A 1RD3B 4TPYA 4FUFA 1A0HB 3SU6A 1SGYE 1DXWA 4UDWH 3F9FA 1QGFA 3PO1B 2BY8X 4A1XA 4Y8ZA 1P9UA 3MI4A 1C4U2 1OWDA 1C5QA 4JMYA 1P2NA 1O5CB 1UVUH 1J16A 1C1OA 1HAVA 1O2LA 3GCHC 4YOGA 3UQVA 2AFQB 2D2DA 2V35A 3G01A 3MMGA 2OTVA 3A82A 2Q6GA 1RS0A 1DS2E 1YPLH 1N6XA 2QXJA 1E36B 5B6OA 4ZROA 1EJNA 2VVUA 3RXMA 1BRCE 1ELTA 2YNBA 5C1UA 2P93A 4FUJA 5HYOA 3EDXB 2CHAC 1O3NA 3I77A 2P16A 1WBGB 4B2AA 4ABDA 3GY4A 2Z3EA 4AYYB 1G30B 1KXEA 1SLXB 3O8RA 1C5MD 1OX1A 3M5NA 3TK5A 3QTOH 3ZVEA 1W12U 4X8SH 2C8XB 3ZZ8A 4JZ1A 1K1PA 2EI6A 2SGDE 3D65E 1Z7KA 2F9NA 2NU0E 2D8WA 3H5CB 1CA0B 1IAUA 5AVDA 1VCPA 3A87A 1V2QT 4WMEA 3UR6A 1HUTH 2BDHA 2Z9LA 3MNCA 2RG3A 2Y7XA 1UJ1A 2V3HH 1G9IE 2BD9A 3LJJA 1O2PA 4VGCB 4OS6A 2JKHA 1FV9A 3NXPA 4DVAU 4NIXA 1L4ZA 1NRPH 3RMOH 2BOHB 2OC7A 3TGKE 3FZZA 4E06H 3BG4B 3TJNA 1WV7H 1FN6A 1ZLRA 4X0WU 1O2JA 5F8TA 3EE0B 3SV8A 2Q6FA 1WUNH 1HYLA 1KTSB 1ZGVA 4YM9A 3A85A 1L2EA 1TA2A 1MD7A 4BOHA 3RU4D 1SQTA 1AFQB 3M3SA 4FUCA 1EATA 1FUJA 3K6YA 2OBQA 2Y81A 5EQRA 3RXDA 2JH5D 4GPGA 3RXUA 2GCHG 3SU1A 1TRMA 1W13U 1TGTA 1V2KT 3RMNH 3ZZBA 3MNBA 3D23A 1S81A 3MFJA 3LDXH 2O8WA 1K1NA 5HGGA 5DK1A 2ILNA 2EA3A 3F9EA 1NY22 1V2TT 3SUGA 2G52A 1INCA 1F0UA 1O2UA 1MUEB 2BOKA 1TABE 4NSVA 3U8OH 2PW8H 4O9VA 2AMDA 1AB9B 4WMDA 1YM0A 3RXGA 5FX6A 1O3AA 3T5FH 1CA8B 2H9HA 3QGJA 4O3TA 2K1QA 5C5NA 1KY9A 3LGUA 2J34A 2A32A 1TBQH 2VVVA 2UUKB 5DJ7A 1GGDC 2ZECA 1RGQA 1BTZA 2C8ZB 2CJIA 1O0DH 3PMJA 2SGQE 2FI5E 5EPNA 2AIQA 4NIWA 1Y5AT 3ZVDA 2ZDKA 2ODQA 1C5TA 5C2ZA 2ZFSA 3QK1A 2FOEA 4NCYA 1SLWB 1ANDA 1AHTH 4B76A 2RA3A 2ZHWH 2ZHDA 1NC6A 1HJAC 4ZHLU 1ESAA 2PSXA 5EGMA 2CMYA 1BTPA 2FOHA 2WV4A 1NESE 6LPRA 1DUEA 1EJAA 1KXDA 3SV9A 1Y3XA 1UVTH 5GWZA 2Q1JA 1K1IA 1EZQA 1A7SA 1KTTB 1THRH 2BVSH 2Z9JA 4BTTB 3GCNA 1Z8RA 2BY6X 4AFQA 1G3DA 3BTHE 1WQVH 4R0IA 5FX5A 4SGAE 2AGEX 4AFUA 1ELDE 3QZRA 1SGDE 1GDNA 3P92A 3BEIB 4FXGH 1PQ8A 3GOVB 1P2KA 1P0SH 1TOCB 1QA0A 3S7KB 3VB6A 1UTNA 1GBJA 2VIVA 5JBBS 4CRCA 1GHAG 1SHYA 5E0HA 2F9VA 1GPZA 2VB0A 2LNCA 1CGIE 3UUZA 5A09A 1O3KA 2VGCC 2TRMA 3FAOA 5EW2H 2FYQA 3KCGH 9ESTA 4BTIB 1KLJH 3E1XB 3VPKA 2ZGXH 3A89A 2GDDA 3RLWH 1V2MT 1WCZA 3BIUH 4INLA 1LHGH 2R2MB 2SGFE 3SV2H 3MU1A 2PTCE 4AOQA 1UK3A 2HOBA 3A7VA 1S0QA 3ZZ7A 1LHEH 5LPFA 2ZFFH 4ABFA 1WQSA 3Q3KA 2J38A 3TJVA 3LH3A 3TGIE 1HAZB 1SI5H 3M7QA 1MD8A 3E0NB 1LO6A 5AHGH 2PHBA 1IHSH 1UCYK 4HTCH 1GI8B 3RUOA 5PTPA 1SR5C 3F68H 3SZNA 2BLOA 4O97A 1K9OE 3E16B 3ATLA 2G00A 1UHBA 2H5CA 1E0FD 1FY8E 1V2PT 5CMXH 1T8OA 4CHAC 4KELA 4WY3A 4UFDH 3P95A 1V2WT 2VIWA 3TK9A 1B0FA 2ALVA 1C1NA 1LKBA 1TNHA 3BV9B 3B8JA 2FOGA 1YF4A 2A4RA 2JETB 1P3EA 1TNLA 5T6DA 3STJA 4GSOA 1AVWA 1MKXK 4BAMB 2CV3A 5E0JA 2F9OA 1DM4B 1BTWA 1MBMA 2CF9H 2D26C 3KQEA 2OCVB 1Q31A 1S82A 4BNRA 1HAHH 1W10U 4DIIH 2OLGA 1X7AC 2OQUA 1MTUA 4NIYA 2OD3B 4CRGA 1O2GH 1O2WA 2H6MA 1VGCC 1SBWA 1EQ9A 4BAQB 1O3FA 2Y5FA 2ZNKH 3ZZ5A 1HAGE 3OU0A 1G32B 5F03A 1OWKA 1FJSA 2GT7A 2OC0A 3D49H 1PPFE 3U9AH 1T4UH 1DY9A 5DKMA 4NIVA 1ELBA 2Y80A 3HKJB 1LVMA 5EOKA 3VEQB 2XC0A 1NRRH 1TPOA 1ZR0A 2A5KA 1AFEH 2BY5X 2AERH 2H1UA 4K1TA 3MU4A 3TVJB 4I8GA 2XXLA 1SGFA 3SHAH 1ELAA 1D3PB 1LHDH 1FY4A 4ABHA 2VWNA 1JIMA 2VIPA 1ELFA 1NS3A 2W3IA 5G4BA 3F9GA 3TPIZ 1SC8U 3EQ0H 4UFEH 2Z9KA 4O03A 6GCHF 2FOFA 1GJ4H 1GVKB 1T8MA 1O33A 2XC4A 3TNSA 1GBBA 3BTTE 3LPRA 1GI2A 2AMQA 1KLIH 2HRVA 4NSYA 3CP7A 1W2KH 4X1PU 5HM9A 2ZGHA 1AUJA 3SHCH 1HB0B 1WYKA 1GHWH 1ETTH 2RCEA 1ELGA 4ISOA 5DPAA 5FHTA 4Y7AA 1PPZA 3SOSA 1GBIA 2IPHA 3A80A 3GCOA 1F5RA 2BTCE 2G4UA 4CRDA 4A6LA 1A0LA 4Q7ZA 3ZVGA 5JBCS 2WPKS 1AU8A 2GD4B 4I31A 2SFAA 3LH1A 2BHGA 3HK3B 3EA7A 1KXBA 2DE9A 1FPHH 4OS7A 1RTKA 4F49A 1JBUH 1SFQB 3A84A 1O2HA 2IJOB 1O32A 4FUGA 2XTTB 1DDJA 4MVNA 1EXFA 3SO3A 4XSKU 1C4V2 3MU8A 2ZTXA 1FXYA 1GI5A 1SG8B 4X1NU 2H5DA 3MNSA 4GCHG 1ZSKA 4TYDA 3QZQA 1TNJA 7GCHG 1BBRE 3K65B 3BTWE 5FCKA 3RXFA 1B0EA 1BHXB 4FUBA 1K1JA 3HGPA 3SGBE 3RXPA 1OWJA 2ANMH 1V2LT 1Z6EA 1IQMA 2GCTB 2FP7B 2ANYA 1WSSH 3T62A 1GMHF 4X8UH 1TAWA 1LPKB 1HIAB 2KAIB 2HGTH 3ITIA 2HPQH 3BG8A 1GI9B 1O2NA 1G3BA 1KSNA 1K22H 2HLCA 3PMHB 2VVCA 3TJUA 1KDQB 1L1JA 1RRKA 3SJIA 1T31A 1K28D 5JB9S 1GBDA 2ZF0H 1T32A 3KQDA 4MNVA 1QL9A 3TJOA 5GCHF 4JCNA 1DWCH 3PROA 2TGTA 1IQJA 1NRQH 1IHTH 1ANBA 1THPB 4I33A 3RXHA 2ZEBA 3RXVA 1D3TB 1ETRH 2V3OH 1BMLA 1HAYB 1DSTA 5K7RA 1BHXF 1ZJDA 1ANEA 1C9TA 2XC5A 4Y10E 4NA9H 3K6ZA 4NFFA 2XBYA 2EI8A 4X2WA 3EA8A 4HI3A 2JETC 2FS9A 2WINI 1QJ6B 1BTXA 3GY8A 2DUCA 3ZVFA 3ZVAA 1ZTLA 2TGPZ 3LT3A 2VNTA 1GCTB 4CR9A 1J8AA 1BDAA 1BIOA 1H1BA 2CXVA 3AW1A 1O2IA 4AB8A 5CE1A 4TWWA 4H6TA 4K2YA 2GGVB 5AFZH 2RA0A 1CBWB 1QBOA 1IQFA 2BMGB 1C5YB 2WV5A 5A0AE 3V7TA 3GYLB 2PV9B 1V2UT 3LOXA 3V0XA 2Q6DA 1AVXA 1L0ZA 3SI4H 3S9CA 3A8CA 5HXFA 4X6OA 3SUFA 1XX9A 1GWAA 1FNIA 1HAOH 2UWLA 2BQ6B 1O5BB 5LPRA 4AFSA 1NFUA 3NWUA 4NGAH 5DP8A 4CRFA 1QL7A 2B8OH 1A1RA 3P8OA 3MWIU 1BRAA 1CE5A 1H9HE 3LGTA 1DUAA 5GPIB 2DE8A 3M61U 1P57B 5C3NA 4XBBA 1MU6B 2BY7X 3DA9B 3KN2A 1O31A 1OWEA 2FMJA 4H6SB 5A0CA 2A7JA 3OY6U 3IG6B 3CENA 1NPMA 1FAXA 4WXVA 4NZQA 1SHHB 4B2BA 4X6NA 1GHYH 5ESTE 1N8OC 2FOCA 2G5VA 1C2JA 1C5UA 1TLDA 1A3BH 2G5NA 1NU9A 3TGJE 4ISNA 3T26A 3A8AA 1HAPH 1EAWA 1O3LA 1O39A 1YPGH 3RXBA 5EW1H 5DG6A 2WUBA 5JBAS 1PJPA 4DY7B 4A1VA 4X2YA 3URDA 1AKSA 1HAIH 2BD3A 2FOAA 2FYRA 3V3MA 5DP4A 1P9SA 3AVZA 4CH2B 3SUDA 4AX9H 1TX7A 3ZVCA 1QY6A 1C2EA 1GL0E 1SGRE 1J15A 4K1SA 2H9EH 4MPVA 3A88A 3GY5A 4FVBA 4U32A 2OXSA 2GCHF 1K1OA 3B9FH 2A5IA 1DLKB 2UWOA 5AFYH 1AVGH 5K0HA 2TIOA 1F92A 3AASA 3PB1E 4FUIA 3JZ1B 1O3GA 1C1SA 2GDEH 3E3TA 3TH3H 3HGNA 4DW2U 4B73A 1TNIA 3NK8A 4WXIA 1O3IA 2P3FH 5F8XA 3PMBB 2GCTC 1QTFA 1SGTA 5E8EH 4GVUA 3ZZDA 2P59A 5FPYA 1GBHA 1YBWA 4D9QA 2QV1A 3MH7A 4JYTA 4RKOB 1HPGA 1OWIA 2ZTYA 2EI7A 2G4TA 1V2JT 4K8BA 2TBSA 1O2YA 2W7UA 1G2MA 3ATKA 2FI3E 4X2XA 3RXKA 3VFEA 2HVXA 3FZDA 3L33A 1GJ7B 1XUHA 3VB4A 2G81E 1A46H 4NA8A 3UWIA 1QIXB 2ZA5A 1RTLA 1MZDA 2OBOA 1IQLA 1TMUH 4LXBH 1DPOA 4MQAA 2PFEA 1P05A 1C5VA 1LQDB 4MLFB 3C27B 4YLUA 2O9QA 1GJ6A 4FUDA 1UTLM 5FCRA 1SLUB 2VWOA 3UIRA 1EPTB 5GXPA 1C2DA 4A7IB 4DT7B 3FANA 1Y3UA 2H2ZA 1MTSA 1YPMH 1HIAA 3PV4A 2VU8E 5HMAA 1QQ4A 3K9XB 2PGQB 1G2LA 2Z3CA 4YESB 3R3GB 2A31A 4TY6A 1QR3E 2WPJS 4D9RA 2B0FA 2PKAB 5JBTA 2ZO3H 3MOCA 4FU9A 1Z6JH 1P11E 1CVWH 4CR5A 4GAWA 2AEIH 2QCYA 1GG6C 3U1IB 3O8DA 3GCTG 3R0FA 1GJCB 2O8UA 3SORA 3SI3H 1N1LA 3MHWU 2R3UA 2QXIA 1Y5UT 1O2ZA 1VITG 2OP9A 3MNXA 4ZKSU 3ZZCA 3BN9A 3RM2H 2Y5GA 5JPMH 1AE5A 1CGJE 1Z8JB 1P12E 3VB5A 2AGGX 4Y8XA 1FIZA 1KXFA 3EAJA 3UNRA 1GBTA 3DHKH 5JDUB 2C8WB 3BTQE 1AWHB 4NZLA 1DWDH 2FODA 2VWLA 4GHTA 5J4SA 4JK6A 1PQAA 4KTUA 1HV7A 3UY9A 1GHBF 2J92A 3TH4H 1TPSA 7KMEH 4I8KA 2RDLA 3PTNA 3UPEA 1ETSH 2FXRA 4Y0ZE 3DUXH 3SNBA 1SPJA 4YTAA 3PO1C 2FPZA 2HNTE 1JRSA 1OP8A 1BQYA 5FXLA 1DWBH 1HFDA 4JZDH 7ESTE 3ELAH 4X1SU 3SV7A 2G51A 2ODPA 2SNVA 4LZ4B 2C8YB 2ZDLA 5T3HA 1G3EA 5EXLA 1DT2A 3ZV8A 2FZZA 1CHGA 4GHQA 2J94A 1ZTJA 4D8NA 2G55A 3WY8A 4PROA 4IC5A 3ZZ4A 1GDQA 4YOJA 3KEEA 4Q2KA 1Y59T 4KTSA 1TBRH 2F9PA 3UQOA 8LPRA 1Y8TA
chains in the Genus database with same CATH superfamily
1XXDA 4H42U 1SGFG 1D9IA 1GMCG 3LGWA 3OEED 1MQ6A 5IYTA 1TNKA 2BDIA 1E1RD 1Z71A 3VXEH 1HJ8A 2TPIZ 4K8YA 3P8FA 1Y5BT 2QXHA 5TCAA 2VIDA 1E34B 1P09A 4NWKA 4Y8YA 3DSOA 4GLYA 2WZQA 3VGCB 1O3DA 1AD8H 4OS4A 2GVFA 1QB1A 1CO7E 1FY3A 5BRRE 1CA0C 4THNH 3UNSA 1VZQH 2LELA 2HLDD 1HAXB 3SQEE 5DP5A 2OQ5A 3T25A 4KGAA 1C5OH 2BDBA 1W0YH 3GICB 4VGCC 1LVBA 1XUFA 5EJLA 3ODFA 4RN6A 1EAXA 2YMSD 2F43B 1QBNA 3LJOA 2KZ4A 1DFPA 5CHAB 5LH8A 2K0QA 3M37A 2GTBA 5FBIA 3HK6B 4AG2A 3HKIB 1ABIH 3BG4C 4JYVH 3IITA 1ZPZA 2C3SA 2W7SA 1CHOG 3RXCA 1MH0A 5KGOA 4ZHMU 1C5SA 3UREA 3DSPA 3LGYA 2XCFA 4Q80A 3P8GA 1O30A 2PWXA 2BD8A 1OPHB 1AFQC 1M9UA 4DT4A 1UK4A 3WWFA 4ASHA 2YOLA 4OS2A 1C1QA 1O2TA 2BLVA 4QT8C 2BVXH 3N7EA 1W7GH 1GBCA 1GBKA 4CBOA 1MU8B 2XWBI 2A5AA 5EPYA 1V2VT 1GBEA 1LVOA 1NFWA 3QUMP 2L74A 2Z94A 2J98B 2ALPA 1CU1A 5C1YA 3TK6A 1Q2WA 4UE7H 2LPRA 4ISHH 1QRZA 2PSYA 1SL3A 1OP2A 2QIQA 2ZU5A 3CS7A 3QO6A 2V7QD 1VJAU 2FX6A 4X8TH 3SN8A 1AB9C 4DCDA 1BTYA 2AIPA 3SUEA 1O37A 1C2GA 1DE7H 4U30A 2Y7ZA 3LC5A 1Y3VA 3KL6A 3SNAA 4NWLA 1AWFH 1LVYA 1Y3WA 3KF2A 2ZP0H 4X6MA 3BTME 4UFFH 1QCPA 1Y3YA 2TGAA 1QRWA 3MU5A 5JB8S 1YPHE 3Q77A 5F6MA 4B75A 1XUGA 1HAVB 1AGJA 3PM3A 2HNTF 1D4PB 3V13A 4ACBA 1O2KA 4BXSA 3U98H 1BTHH 3PLKA 1LMWB 4DURA 5C0TA 1HLTH 2BVRH 2PKSB 3OTJE 2ZGCA 4M7GA 1O3BA 2Z3DA 1IQIA 1NFXA 2EC9H 2VJ1A 2ZQ2A 4AG1A 5GDSH 4HGCA 1N6YA 2P3TB 1YC0A 2FWWA 3QWCH 4X6PA 4WJG2 4Z6AH 3EGKH 4GCHF 3F3BA 5HM2A 2FOMB 2VIOA 1BBRH 1YPJH 2IOTA 3QX5H 3PMAB 3TITA 4ZMAH 2HPPH 1CT0E 1S6LA 1IQEA 4IW4E 2F91A 1GI1A 2ZU4A 1P01A 2FLBH 2BX4A 3KQCA 1ACBE 1S0RA 1S6HA 3KHVA 3RXJA 5E2PA 3QGNB 2WPIS 2A4OA 1GDUA 2BQ7B 3BEUA 2V0BA 4E7RG 1WOFA 1YCPH 2XBVA 2ZFRH 1O3EA 1ZHRA 1T7CA 1P2OA 4MPXA 3M3TA 2BM2A 1ZSJA 1KLTA 1PFXC 3QN7A 1BMFD 3FFGA 2J2UA 1XXFA 2J9NA 3ATWA 2R0KA 5GNDA 3M5MA 4X8VH 5C20A 3U69H 1JIRA 1A5GH 1GVLA 3TNTA 2UWPA 1SMFE 2CHAB 3TIUA 2GP9B 3ZYDA 2J4IA 3T2NA 2FOBA 3UOUA 4WH8A 1T8LA 1LKAA 1C2KA 4OS5A 4A1TA 3F6UH 2QF3A 2ANKH 4DJZB 3DFLA 1A5IA 2VWMA 3GISB 4CRBA 3MU0A 4WVPE 2WUCA 4K1EA 1GCDA 1QA7A 5J4QA 4TSFD 1BMNH 1H4WA 4DIHH 1ZOMA 2AYWA 3I78A 1T4VH 4ISLA 5AF9H 2ZDNA 3SQHE 1ZPCA 1FIWA 1L1NA 1C5XB 3QLPH 1TGBA 1QB9A 3U8TH 2V6NA 2XYAA 1ESTA 1K1LA 1S6FA 4OGXA 3P6ZB 3ATIA 5E2OA 3F2GA 1V2OT 1A61H 1ZHMA 4M9FA 3SJOA 5DGJA 2YMSC 3Q76A 1BITA 1E38B 5JYIA 2UUFB 1K2I1 3MTYA 1Z1JA 3E91A 1BZXE 1OS8A 1SGCA 3K2UA 1BJUA 3RLYH 2P95A 1SLVB 1EZXC 2ANWA 3S0NA 4P02A 1LPGB 3RXOA 1UTOA 2ULLA 3SJKA 1YLDA 3QTVH 2BXTH 4WWYA 2WPMS 2KX4A 3KIDU 4DGJA 1V2RT 1C1UH 1D6RA 1BMMH 1XKAC 3AAVA 1SGNE 1EASA 1FAKH 1GJ9B 1FI8A 1ANCA 3F2FA 1GMDG 2Y82A 2Z9GA 1TRNA 2ZPSA 1O36A 3M5LA 4YOIA 3BTGE 1BUIA 3CS0A 1DVAH 1E37B 1TGSZ 2GJGA 3SGQE 4LZ1H 1H9IE 1SGEE 3EE7A 3HATH 1QQUA 3ESTA 2ZPQA 5E0GA 1MTWA 1LPZB 3OSYA 1NTPA 3BF6H 4CREA 4RT1A 1THSH 2HNTC 1S85A 3A83A 4D7GA 1TYNA 4B71A 3A7YA 1WTHD 2THFB 5L2ZH 1HBTH 3F2HA 3ODDA 5H4IB 2PR3A 1WTGH 3GY3A 3PV2A 4Q7XA 3TU7H 1TWXB 3UR9A 1QJ1B 4RT0A 5DP9A 4MNYA 1UCYE 1YP9A 3RMMH 1V2ST 1FZZA 1D6WA 2B7DH 1F2SE 4HFPB 4AGJA 5DP7A 5FBEA 5LGOA 1TNGA 4ZKNU 1W8BH 2XNIA 3SU3A 3DT0H 2RFKC 1GJ5H 1PQ7A 1GGDB 3ZVBA 1MTNB 1EP5A 3PLBA 1NRSH 2R3YA 2M5TA 4UONA 3PWBA 1C2IA 3SYJA 1NN6A 4XRNA 2D1JA 4ZH8A 3S9AA 4YZUA 3RXAA 2FM2A 1EJMA 1UVPA 2PKSC 1UVOA 3KGPA 5EQQA 3W95A 4K60A 4YT7H 5A2MH 3SV6A 1AQ7A 3DSGA 2BDGA 1RIWB 1FY1A 2UUYA 2ZPRA 4WH6A 1O34A 4I7YH 1AZ8A 1SGQE 1P8VC 2H9TH 3RXLA 1ARBA 3E90B 1TQ7B 2HALA 4FU8A 1AIXH 4B1TA 2P94A 3FP8E 1GVZA 1W11U 2VBCA 4I8LA 1OWHA 1L1GA 1UK2A 3UWJH 1WDIA 4LK4A 2BLQA 2ZQ1A 1ESBA 3PWCA 3SJ9A 2ZU2A 4R8TB 1F5KU 5GIBA 2ZCHP 1KYNA 2PLXA 2AGIX 2SGPE 2J95A 1TALA 3OYPA 2ZDMA 3PV5A 5I46H 3DFJA 2STBE 4X1RU 2R2WU 3MH4A 2J97A 1XM1A 2A4GA 4TY7A 3P8NA 3L3TA 1WAYB 4FUEA 3DD2H 1EP6A 2W6ID 3RXSA 1O5DH 2VGCB 1GI4A 2A0QB 3OE7D 1UHBB 2ZFTA 2ZCKP 1IQNA 4I32A 2WPLS 1BB0B 4NFEA 1B5GH 1O5GH 1H8HD 1Z8IB 2ASUB 8GCHG 2BLWA 2GZ9A 4SGBE 3GY6A 2CGAA 1P3CA 3GDUA 2JDID 3A8DA 2BB4A 2EEKA 2O8LA 4JK5A 1AMHA 2WHXA 4LOYH 1DSUA 2QF4A 5C1XA 2SGAA 4MPUA 2ODYB 4XE4A 1E35B 1ZYOA 8KME2 5EQSA 3UOPA 1TE0A 4AYVB 3GYMA 2ESTE 1E1QD 1P02A 3A7TA 3S69A 1C2LA 1T8NA 4K5ZA 2W6JD 1CGHA 5TCCA 1YPHC 3RDZA 4MNWA 2O8MA 4ABJA 2ZU3A 4BAOB 1SB1H 3BTEE 2P8OB 1PPHE 1LHCH 3KQBA 1YGCH 2AS9A 1F5LA 1C5LH 1GBMA 1MKWH 1QBVH 2P3UB 1UVSH 1DICA 3GCTF 4J1YA 2KCPA 3MQKC 1SFIA 2BDYA 2CN0H 5EXNA 4CHAB 1VITF 1G3CA 2W26A 5CDFE 2BZAA 1IOEA 3ZV9A 2NU1E 1O2SA 3GY7A 2IN2A 1IQKA 1MBQA 1CT4E 1O5AB 2BQWB 4IC6A 1XUIA 1C5WB 1GHVH 1GBLA 4UD9H 1OYQA 1AN1E 1B7XB 1EFRD 4E05H 1FN8A 1IQGA 1ZPBA 2ZTZA 3LGIA 2FTLE 3PRBA 2HVYB 1J17T 2QY0B 1ELVA 4IN2A 4IBLH 2KAIA 1GI6A 1WU1A 5A8ZA 1GCTC 1BT7A 1ZTKA 3BIVH 1CQQA 1MTVA 3BSQA 1AI8H 1EX3A 1MMJN 1RFNA 1TRYA 1C1VH 1KDQA 1C9PA 3FN8A 2ZFPH 1VGCB 1TX6A 1FLEE 9LPRA 1XUKA 1YWUA 3SJ8A 1P10A 3FKSD 1E79D 2A45B 3O8BA 3A7XA 2A2QH 2SGEE 4YLQH 4TWYA 5L6NH 1PPEE 1OSSA 6ESTA 4GUXA 1F7ZA 1CBWC 2BYAX 2FDAA 4Y6DA 3LKWA 1GHAF 1SOZA 1UTKA 1ZGIA 1DX5M 1A4WH 5L2YH 1UTMA 1O5EH 2J5UA 1UO6A 3ENSB 5FPSA 2W3KA 1DY8A 2VIQA 4B2CA 1DANH 3SBKA 3BTKE 2NU2E 3C1KA 4JZFH 4X2VA 1GMCF 3M5OA 1IQHA 4FETA 4ZHAA 1ARCA 3AAUA 1MTNC 3KNXA 1SSXA 2BD4A 4I8JA 3MYWA 3M7TA 8ESTE 1YPEH 1O2VA 3RXQA 1MAXA 1QL8A 1FY5A 2GZ8A 4NA7A 3ZZ9A 1S83A 3NZIA 5EJZA 3LIWA 4YO9A 1H8DH 2PUQH 1ZRBA 5EG4A 4ABAA 1NM6A 1RIWC 1NZQH 1FQ3A 3STIA 1RTFB 3MO6A 1BBRK 1P2QA 2C90B 3RM0H 3EYDA 1BA8B 2I6QA 1UW7A 1C1WH 1O2MA 3ZZAA 2QF0A 4BAHB 3OTPA 1YPKH 3QDZB 3MO9A 4JZEH 1C1TA 2AH4X 1EOJA 2ZWLH 1TGCA 4CBNA 1MZAA 1AUTC 1J9CH 3ZZ3A 1C4Y2 3H09A 3PLPA 4JZIA 1TPPA 1GJDB 2ZG0H 3F9HA 4WMFA 2JJ1D 1CHOF 4I8HA 5FAHA 1UTQA 1JWTA 2QN5T 1YCPK 2OC1A 4D76A 1C1MA 3UTUH 3EA9A 1W14U 3SW2B 4BXWA 3SNDA 3SU4A 2GMTB 2FX4A 4Y0YE 1V3XA 3VB3A 1TX8A 3KYFA 3DCLA 1TGNA 4XOJA 3VG8A 3P70B 3VXFH 1ZMNA 2JH6D 3LGVA 1O35A 1KIGH 1XVOA 2QAAA 3OFND 4HG6A 1ELCA 1ZSLA 2ZHFH 1VR1H 4MG3A 2OC8A 1RXPA 2QGRA 3T28A 2Z9IA 1XKBC 2O8TA 1TB6H 1XMNB 5F8ZA 4DOQA 2A7CA 3SU0A 1O38A 4FOUC 1NO9H 2XBWA 1GBFA 4CRAA 1FPCH 3A7WA 1ZRKA 1OOKB 2XCNA 1PPBH 1HRTH 2Y6TA 3W94A 3SNEA 6CHAB 5T6GA 1KXAA 3RC5A 4OGYA 1BTUA 5DP3A 4ESTE 3MH5A 2ZGBH 3TH2H 4WF8A 4ABGA 1GHBG 2B9LA 3PYHA 3PTBA 1MQ5A 4ZAEA 4YT6H 1C1RA 1C2HA 3Q3YA 4BTUB 2TGDA 1C5PA 1NT1A 1AY6H 1C5RA 4UEHH 1HDTH 4Y79A 1H8IH 4U2WA 1EZUC 2ZZUH 4ZKRU 3SNCA 3D62A 4O3UA 1V6DA 2FI4E 1K1MA 1EKBB 1QRXA 2BDCA 1QURH 1DXPA 2ZHEH 5LPEA 3RMLH 4AFZA 1PYTD 2BD5A 1PQ5A 3B23B 2P8OC 1EB2A 1LCYA 1P04A 3N7OA 3Q00A 3M36A 1BCUH 1C1PA 4INHA 1OXGA 1FMGA 2VH0A 2ZC9H 4AORA 1V2NT 3E0PB 4BANB 3GDSA 1ABJH 1TBZH 1LQEA 3OY5U 1NROH 2BXUH 4Q7YA 4UFGH 1UTJA 3BEFB 3ATMA 2WYGA 4ABBA 5A0BA 1O3CA 2Y5HA 1JOUB 2FEQH 1GBAA 5ABWA 3A86A 1FONA 4ZXXH 2HWLB 2XWAA 5EXMA 4FU7A 4K3JA 1EPTC 1VCWA 2WPHS 3IWMA 3P17H 4ISIH 2A7HA 4IMZA 1S5SA 1O2RA 2QXGA 2WYJA 1P2JA 1EAUA 2ZDVH 3LU9B 4A5TS 3S7HB 3JZ2B 5A8XA 3RU4T 4F4OC 2FS8A 1QB6A 2ZGJA 4AB9A 2C4FH 1ORFA 2GV7A 1XVMA 4KTCA 1W0ZU 1C5NH 1D3DB 2PGBB 1DLEA 2A4QA 4ABEA 3O8CA 4Y76A 2UUJB 2FTMA 1W3CA 5DN6D 2ZI2H 2F3CE 4HZHA 3RXIA 2QA9E 3U8RH 4ZUHA 1A0JA 1TMTH 5C67A 4ZKOU 1YLCA 3MO3A 3T27A 1BRUP 2XOKD 1O5FH 4XDEA 5TJXA 1DOJA 1KXCA 5DP6A 1GJAB 2F4LA 3S9BA 4Z0KA 2JH0D 4AN7A 1ZJKA 5EU8A 3GDVA 1AKSB 4FVDA 1J14A 4IS5A 1EPTA 3BTFE 1G37A 7GCHF 1GL1A 4INKA 3UNQA 1C2FA 2LP6A 1AE8H 4XFQA 1UMAH 3FP7E 3RC4A 1O3OA 3F1SB 2OINA 4KP0A 2FLRH 2YNAA 3M35A 1GI7B 2BX3A 2PUXB 3RXRA 4JYUH 1NU7B 2PKAA 2BDAA 4CH8B 2FO9A 2V3MA 2ZCLP 1O3JA 3LONA 1OP0A 2QC2A 2R0LA 4RSPA 1N8OB 1GHZA 1SOTA 4A92A 3GCHB 3W1EA 3L6PA 4MDSA 2G8TA 2C93B 2XW9A 3RP2A 1JMOH 2SNWA 5IDKA 2VH6A 3NUMA 1QJ7B 3NKKA 3U1JB 3MH6A 1JXPA 1C5ZB 1Q3XA 3FOAA 4AZ2B 4B74A 1F0RA 2VINA 4U01A 3V12A 4BAKB 1O3MA 2F9BH 1WXRA 1TFXA 1ZZZA 2XRCA 1VJ9U 2GMTC 1SVPA 4XBDA 3HPTB 2Z7FE 2OUAA 1GI0A 1GMDF 4ABIA 1TA6A 1ZMLA 3RXTA 1EAIA 2CF8H 3T29A 1VCQA 2B5TB 3AK5A 3ZYEA 1F0TA 1AO5A 1TONA 1DWEH 1SGIB 5BPEA 4D7FA 1RJXB 1O2XA 1EB1H 1YYY1 2GV6A 1GJBB 3VGCC 4X1QU 6GCHG 1P06A 1SQAA 3A8BA 5ESBA 1KMHB 1G36A 1P2MA 4XBCA 1JRTA 3WW7A 2NU3E 1HNEE 1VITH 1O3PB 3TLOA 1TQ0B 6CHAC 4NG9H 1D3QB 3ZZ6A 1HXEH 4Y11E 1TPAE 1UCYH 1LTOA 4H4FA 1LHFH 1QNJA 3H7OA 4DG4A 3Q3XA 5ETXA 5CHAC 1EUFA 4B6EA 2QYIA 5I25A 3RXEA 3VB7A 1PYTC 5GJ4B 4AGKA 4Y7BA 1MCTA 2F83A 2ZDAH 4KKDA 4MPWA 1MKWK 1XUJA 2XNDD 2NWNA 1ZHPA 1EOLA 3UFAA 2BD7A 3M3VA 5T6FA 1ELEE 1A3EH 1A5HA 1MKXH 1W7XH 1PPCE 2FESH 1ZMJA 1Z8GA 1FDPA 1QFKH 2ZU1A 2F9UA 1QHRB 1CT2E 2W5EA 5SGAE 1OHHD 4TPIZ 1O2OA 1SGPE 2A1DB 2ZKSA 2XBXA 1CSOE 2ZIQH 4MNXA 1PPGE 3URCA 3NCLA 4F48B 1H9LB 3RC6A 2BZ6H 2I6SA 3SU5A 1YKTA 2AMPA 1HGTH 1TIOA 5L30H 1GMHG 1O2QA 2GKVE 4TT3D 1O3HA 2GX4A 2BD2A 1OYTH 2GT8A 2QE7D 1BRBE 2JIZD 3OX7U 1BOQA 4Y71A 1TOMH 5FPTA 1UTPA 1ID5H 1VKYA 1BJVA 1COWD 1HCGA 1GHXH 2PTNA 4ZXYH 5HIYA 1K21H 1P2IA 3AW0A 4ACAA 1SQOA 2ZFQH 1F0SA 1AZZA 1A2CH 1C2MA 1GG6B 2STAE 3GY2A 5GCHG 7LPRA 1NRNH 1MCVA 1P03A 4YXWD 1DITH 1LDTT 1NFYA 1YCPM 5EODA 4J2YB 4OS1A 1TMBH 2FIRH 1OKXA 3E6PH 4MTBA 3A81A 4E7NA 4Q4LA 1GI3A 4IMQA 4IGDA 1U6QA 1HJAB 2Z6BD 4K69A 3SGAE 3A7ZA 3RU4E 5KEDA 2NU4E 8GCHF 1HJ9A 2J98A 4IN1A 5A8YA 2GZ7A 3H7TA 3SU2A 1BMAA 3BTDE 2R9PA 3E8LA 5DO4H 1HXFH 1Z1IA 2ZHQH 3LC3A 1MAYA 1L4DA 1S84A 4FUHA 2A2XH 2BY9X 3KYGA 5KECA 4RKJB 3FVFB 1EZSC 3FP6E 4F55A 1GJ8B 2PP6A 5C5OA 3M7UA 3NPSA 3I29A 1RD3B 4TPYA 4FUFA 1A0HB 3SU6A 1SGYE 1DXWA 4UDWH 3F9FA 1QGFA 3PO1B 2BY8X 4A1XA 4Y8ZA 1P9UA 3MI4A 1C4U2 1OWDA 1C5QA 4JMYA 1P2NA 1O5CB 1UVUH 1J16A 3WWBA 1C1OA 1HAVA 1O2LA 3GCHC 4YOGA 3UQVA 2AFQB 2D2DA 2V35A 3G01A 3MMGA 2OTVA 3A82A 2Q6GA 1RS0A 1DS2E 1YPLH 1N6XA 5T1VA 2QXJA 1E36B 5B6OA 4ZROA 1EJNA 2VVUA 3RXMA 1BRCE 1ELTA 2YNBA 5C1UA 2P93A 1SQRA 4FUJA 5HYOA 3EDXB 2CHAC 1O3NA 3I77A 2P16A 1WBGB 4B2AA 4ABDA 5B6LA 3GY4A 2Z3EA 4AYYB 1G30B 1KXEA 1SLXB 5EJ1A 3O8RA 2IPQX 1C5MD 1OX1A 3M5NA 3TK5A 3QTOH 3ZVEA 1W12U 4X8SH 2C8XB 3ZZ8A 4JZ1A 1K1PA 2EI6A 2SGDE 3D65E 1Z7KA 2F9NA 2NU0E 2D8WA 3H5CB 1CA0B 1IAUA 5AVDA 1VCPA 3A87A 1V2QT 4WMEA 3UR6A 1HUTH 2BDHA 2Z9LA 3MNCA 2RG3A 2Y7XA 1UJ1A 2V3HH 1H8ED 1G9IE 2BD9A 3LJJA 1O2PA 4VGCB 4OS6A 2JKHA 1FV9A 3NXPA 4DVAU 4NIXA 2M2AA 1L4ZA 1W0KD 1NRPH 3RMOH 2BOHB 2OC7A 3TGKE 3FZZA 4E06H 3BG4B 3TJNA 1WV7H 1FN6A 1ZLRA 4X0WU 1O2JA 4B6FA 5F8TA 3EE0B 3SV8A 2Q6FA 1WUNH 1HYLA 1KTSB 1ZGVA 4YM9A 3A85A 1L2EA 1TA2A 1MD7A 4BOHA 5F53A 3RU4D 1SQTA 1AFQB 3M3SA 4FUCA 1EATA 1FUJA 3K6YA 2OBQA 2Y81A 5EQRA 3RXDA 2JH5D 4GPGA 3RXUA 2GCHG 3SU1A 1TRMA 1W13U 1TGTA 1V2KT 3RMNH 3ZZBA 3MNBA 3D23A 1S81A 3MFJA 3LDXH 2O8WA 1K1NA 3CNRA 5HGGA 3F0OA 5DK1A 2ILNA 2EA3A 3F9EA 1NY22 1V2TT 3SUGA 2G52A 1INCA 1F0UA 1O2UA 1MUEB 2BOKA 1TABE 4NSVA 3U8OH 2PW8H 4O9VA 3ZIAD 2AMDA 1AB9B 4WMDA 1YM0A 3RXGA 5FX6A 1O3AA 3T5FH 1CA8B 2H9HA 3QGJA 4O3TA 2K1QA 5C5NA 1YLNA 1KY9A 3LGUA 2J34A 3PRDA 2A32A 1TBQH 2VVVA 2UUKB 5DJ7A 1GGDC 2ZECA 1RGQA 1BTZA 2C8ZB 2CJIA 1O0DH 3PMJA 2SGQE 2FI5E 5EPNA 2AIQA 4NIWA 4RI0A 1Y5AT 3ZVDA 2ZDKA 2ODQA 1C5TA 5C2ZA 4ASUD 2ZFSA 3QK1A 2FOEA 4NCYA 2EY4C 1SLWB 1ANDA 1AHTH 4B76A 2RA3A 2ZHWH 2ZHDA 1NC6A 1HJAC 4ZHLU 1ESAA 2PSXA 5EGMA 2CMYA 1BTPA 2WPDD 2FOHA 2WV4A 1NESE 6LPRA 1DUEA 1EJAA 1KXDA 3SV9A 1Y3XA 1UVTH 5GWZA 2Q1JA 1K1IA 1EZQA 1A7SA 1KTTB 1THRH 2BVSH 2Z9JA 4BTTB 4OM9A 3GCNA 2KCAA 1Z8RA 2BY6X 4AFQA 1G3DA 3BTHE 1WQVH 4R0IA 5FX5A 4SGAE 2AGEX 4AFUA 1ELDE 3QZRA 1SGDE 1GDNA 3P92A 2K8IA 3BEIB 4FXGH 1PQ8A 3GOVB 1P2KA 1P0SH 1TOCB 1QA0A 3S7KB 3VB6A 1UTNA 1GBJA 2VIVA 5JBBS 4CRCA 1GHAG 1SHYA 5E0HA 2F9VA 1GPZA 2VB0A 2LNCA 1CGIE 3UUZA 1K0HA 5A09A 1O3KA 2VGCC 2TRMA 3FAOA 5EW2H 2FYQA 3KCGH 9ESTA 3N7DA 4BTIB 1KLJH 3E1XB 3VPKA 5C94A 2ZGXH 3A89A 2GDDA 3RLWH 1V2MT 1WCZA 3BIUH 2KCOA 4INLA 1LHGH 2R2MB 2SGFE 3SV2H 3MU1A 2PTCE 4AOQA 1UK3A 2HOBA 3A7VA 1S0QA 3ZZ7A 1LHEH 5LPFA 2ZFFH 4ABFA 4ZCNA 1WQSA 3Q3KA 2J38A 3TJVA 3LH3A 3TGIE 1HAZB 4AC9A 1SI5H 3M7QA 1MD8A 3E0NB 4XD7D 3NRLA 2YMSB 1LO6A 5AHGH 2PHBA 1IHSH 1UCYK 4HTCH 1GI8B 3RUOA 5PTPA 1SR5C 3F68H 3SZNA 2BLOA 4O97A 1K9OE 3E16B 3ATLA 2G00A 1UHBA 2H5CA 1E0FD 1FY8E 1V2PT 5CMXH 1T8OA 4CHAC 4KELA 4WY3A 4UFDH 3P95A 1V2WT 2VIWA 2KFWA 3TK9A 1B0FA 2ALVA 1C1NA 3FO8D 1LKBA 1TNHA 3BV9B 3B8JA 2FOGA 1YF4A 2A4RA 2JETB 1P3EA 1W0JD 1TNLA 5T6DA 3STJA 4GSOA 1AVWA 1MKXK 4BAMB 2CV3A 5E0JA 2F9OA 1DM4B 2WV9A 1BTWA 1MBMA 2CF9H 2D26C 3KQEA 2OCVB 1Q31A 1SKYE 4P00A 1S82A 4BNRA 1HAHH 1W10U 4DIIH 2OLGA 1X7AC 2OQUA 1MTUA 4NIYA 2OD3B 4CRGA 1O2GH 1O2WA 2H6MA 1VGCC 1SBWA 1EQ9A 4BAQB 1O3FA 2Y5FA 2ZNKH 3ZZ5A 1HAGE 3OU0A 1G32B 5F03A 2AHME 1OWKA 1FJSA 2GT7A 2OC0A 3D49H 1PPFE 3U9AH 1T4UH 1DY9A 1MABB 5DKMA 4NIVA 1ELBA 2Y80A 3HKJB 1LVMA 5EOKA 3VEQB 2XC0A 1NRRH 1TPOA 1ZR0A 2A5KA 1AFEH 2BY5X 2AERH 2H1UA 4K1TA 3MU4A 3TVJB 4I8GA 2XXLA 1SGFA 3SHAH 1ELAA 1D3PB 1LHDH 1FY4A 4ABHA 2VWNA 1JIMA 2VIPA 1ELFA 1NS3A 2W3IA 5G4BA 3F9GA 3TPIZ 1SC8U 3EQ0H 4UFEH 2Z9KA 4O03A 6GCHF 2FOFA 2L6OA 1GJ4H 1GVKB 1T8MA 1O33A 2XC4A 3TNSA 1GBBA 3BTTE 3LPRA 1GI2A 2AMQA 1KLIH 2HRVA 4NSYA 3CP7A 3SZEA 1W2KH 1QZ8A 4X1PU 5HM9A 2ZGHA 1AUJA 3UAIC 3SHCH 1HB0B 3UB0A 1WYKA 1GHWH 1ETTH 2RCEA 1ELGA 4ISOA 5DPAA 5FHTA 4Y7AA 1PPZA 3SOSA 1GBIA 2IPHA 3A80A 3GCOA 1F5RA 2BTCE 2G4UA 4Q63A 4A6LA 1A0LA 4Q7ZA 4CRDA 3ZVGA 5JBCS 2WPKS 1AU8A 2GD4B 4I31A 2SFAA 3LH1A 2BHGA 3HK3B 3EA7A 1KXBA 2DE9A 1FPHH 4OS7A 1RTKA 4F49A 1JBUH 1SFQB 3A84A 1O2HA 2IJOB 1O32A 4FUGA 2XTTB 1DDJA 4MVNA 1EXFA 3SO3A 4XSKU 1C4V2 3MU8A 2ZTXA 1FXYA 1GI5A 1SG8B 4I86A 4X1NU 2H5DA 3MNSA 4GCHG 1ZSKA 4TYDA 3QZQA 1TNJA 3F0PA 7GCHG 1BBRE 3K65B 3BTWE 5C0UA 5FCKA 3RXFA 1B0EA 1BHXB 4FUBA 1K1JA 3HGPA 3SGBE 3RXPA 1NBME 1OWJA 2ANMH 1V2LT 1Z6EA 1IQMA 2GCTB 2FP7B 2ANYA 1WSSH 3T62A 1GMHF 4X8UH 1TAWA 1LPKB 1HIAB 2KAIB 2HGTH 3ITIA 2HPQH 3BG8A 1GI9B 1O2NA 1G3BA 1KSNA 1K22H 2HLCA 3PMHB 2VVCA 3TJUA 2WSSD 1KDQB 1L1JA 1RRKA 3SJIA 1T31A 1K28D 5JB9S 1GBDA 2ZF0H 1T32A 3KQDA 4MNVA 1QL9A 3TJOA 5GCHF 4JCNA 1DWCH 3PROA 2TGTA 1IQJA 3GS9A 1NRQH 1IHTH 1ANBA 1THPB 4I33A 3RXHA 2ZEBA 3RXVA 1D3TB 1ETRH 2V3OH 1BMLA 1HAYB 1DSTA 5K7RA 1BHXF 1ZJDA 1ANEA 1C9TA 2XC5A 4Y10E 4NA9H 3K6ZA 4NFFA 2XBYA 2EI8A 4X2WA 3EA8A 4HI3A 2JETC 2FS9A 2WINI 1QJ6B 1BTXA 3GY8A 2DUCA 3ZVFA 3ZVAA 1ZTLA 2TGPZ 3LT3A 2OK5A 2VNTA 1GCTB 4CR9A 1J8AA 1BDAA 1BIOA 1H1BA 2CXVA 3AW1A 1O2IA 4AB8A 5CE1A 4TWWA 2EQNA 4H6TA 4K2YA 2GGVB 5AFZH 2RA0A 1CBWB 1QBOA 1IQFA 2BMGB 1C5YB 2WV5A 5A0AE 3V7TA 2KM0A 3GYLB 2PV9B 1V2UT 3LOXA 3V0XA 2Q6DA 1AVXA 1L0ZA 3SI4H 3S9CA 3A8CA 5DSFA 5HXFA 4X6OA 3SUFA 1XX9A 5HKKD 1GWAA 1FNIA 1HAOH 2UWLA 2BQ6B 1O5BB 5LPRA 4AFSA 1NFUA 3NWUA 4NGAH 5DP8A 4CRFA 1QL7A 2B8OH 1A1RA 3P8OA 3MWIU 1BRAA 1CE5A 1H9HE 3LGTA 1DUAA 5GPIB 2DE8A 3M61U 1P57B 5C3NA 4XBBA 1MU6B 2BY7X 3DA9B 3KN2A 1NBMD 1O31A 1OWEA 2FMJA 4H6SB 5A0CA 2A7JA 3OY6U 3IG6B 3CENA 1NPMA 1FAXA 4WXVA 4NZQA 5FL7D 1SHHB 4B2BA 4X6NA 1GHYH 5ESTE 1N8OC 2FOCA 2G5VA 1C2JA 1C5UA 1TLDA 1A3BH 2G5NA 1NU9A 3TGJE 4ISNA 3T26A 3A8AA 3OEHD 1HAPH 1EAWA 1O3LA 1O39A 1YPGH 3RXBA 5EW1H 5DG6A 4Z1MD 2WUBA 1FX0B 5JBAS 1PJPA 4DY7B 4A1VA 4X2YA 3URDA 1AKSA 1HAIH 2CK3D 2BD3A 2FOAA 2FYRA 3V3MA 5DP4A 1P9SA 3AVZA 4CH2B 3SUDA 4AX9H 1TX7A 3ZVCA 1QY6A 1C2EA 1GL0E 1SGRE 1J15A 4K1SA 2H9EH 4MPVA 3A88A 3GY5A 4FVBA 4U32A 2OXSA 2GCHF 1K1OA 2QF5A 3B9FH 2A5IA 1DLKB 2UWOA 5AFYH 5EIYA 1AVGH 5K0HA 2TIOA 1F92A 3AASA 3PB1E 4FUIA 3JZ1B 1O3GA 1C1SA 2GDEH 5CHBA 3E3TA 3TH3H 3HGNA 4DW2U 4B73A 1TNIA 3NK8A 4WXIA 1O3IA 5C17A 3N99A 2P3FH 5F8XA 3PMBB 5HIZA 2GCTC 1QTFA 1SGTA 5E8EH 4GVUA 3ZZDA 2P59A 5FPYA 1GBHA 1YBWA 4D9QA 2QV1A 3MH7A 4JYTA 4RKOB 1HPGA 1OWIA 2ZTYA 2EI7A 2G4TA 1V2JT 4K8BA 5IK2D 2TBSA 1O2YA 2W7UA 1G2MA 3ATKA 2FI3E 4X2XA 3RXKA 3VFEA 2HVXA 3FZDA 3L33A 1GJ7B 1XUHA 3VB4A 2G81E 1A46H 3KQ5A 2RDEA 4NA8A 3UWIA 1QIXB 2ZA5A 1RTLA 1MZDA 2OBOA 1IQLA 1TMUH 4LXBH 1DPOA 4MQAA 2PFEA 1P05A 1C5VA 1LQDB 4MLFB 2IJD1 3C27B 4YLUA 2O9QA 1GJ6A 4FUDA 1UTLM 5FCRA 1SLUB 2VWOA 3UIRA 1EPTB 5GXPA 1C2DA 4A7IB 4DT7B 3FANA 1Y3UA 2H2ZA 1MTSA 3OAAD 1YPMH 1HIAA 3PV4A 2VU8E 2KR7A 5HMAA 1QQ4A 3K9XB 2PGQB 1G2LA 2Z3CA 4YESB 3R3GB 2A31A 4TY6A 1QR3E 2WPJS 4D9RA 1YY3A 2B0FA 2PKAB 5JBTA 2ZO3H 3MOCA 4FU9A 2KCYA 1Z6JH 1P11E 1CVWH 4CR5A 4GAWA 2AEIH 2QCYA 1GG6C 3U1IB 3O8DA 3GCTG 3R0FA 1GJCB 2O8UA 3SORA 3SI3H 1N1LA 3MHWU 2R3UA 2QXIA 1Y5UT 1O2ZA 1VITG 2OP9A 3MNXA 4ZKSU 3ZZCA 3BN9A 3RM2H 2Y5GA 5JPMH 1AE5A 1CGJE 1Z8JB 1P12E 3VB5A 2AGGX 4Y8XA 1FIZA 1KXFA 3EAJA 3UNRA 1GBTA 3DHKH 5JDUB 2C8WB 3BTQE 1AWHB 4NZLA 1DWDH 2FODA 2VWLA 4GHTA 5J4SA 4JK6A 1PQAA 4KTUA 1HV7A 3UY9A 1GHBF 2J92A 3TH4H 1TPSA 7KMEH 4I8KA 2RDLA 3PTNA 3UPEA 1ETSH 2FXRA 4Y0ZE 3DUXH 3SNBA 1SPJA 4YTAA 3PO1C 2FPZA 2HNTE 1JRSA 1OP8A 1BQYA 5FXLA 1DWBH 1HFDA 3U28C 2JJ2D 4JZDH 7ESTE 3ELAH 4X1SU 3SV7A 2G51A 2ODPA 2SNVA 4LZ4B 2C8YB 2ZDLA 5T3HA 1G3EA 5EXLA 1DT2A 3ZV8A 2FZZA 1CHGA 4GHQA 2J94A 1ZTJA 4D8NA 2G55A 3WY8A 4PROA 4IC5A 3ZZ4A 1GDQA 4YOJA 3KEEA 4Q2KA 1Y59T 4KTSA 1TBRH 2F9PA 3UQOA 8LPRA 1Y8TA
chains in the Genus database with same CATH topology
1XXDA 4H42U 1SGFG 1D9IA 1GMCG 3LGWA 1MQ6A 5IYTA 1TNKA 2BDIA 1Z71A 3VXEH 1HJ8A 2TPIZ 4K8YA 3P8FA 1Y5BT 2QXHA 5TCAA 2VIDA 1E34B 1P09A 4NWKA 4Y8YA 4GLYA 3VGCB 1O3DA 1AD8H 4OS4A 2GVFA 1QB1A 1CO7E 1FY3A 5BRRE 1CA0C 4THNH 3UNSA 1VZQH 1HAXB 3SQEE 5DP5A 2OQ5A 3T25A 4KGAA 1C5OH 2BDBA 1W0YH 3GICB 4VGCC 1LVBA 1XUFA 3ODFA 4RN6A 1EAXA 1QBNA 3LJOA 5LH8A 1DFPA 5CHAB 3M37A 2GTBA 5FBIA 3HK6B 4AG2A 3HKIB 1ABIH 3BG4C 4JYVH 3IITA 1ZPZA 2C3SA 2W7SA 1CHOG 3RXCA 1MH0A 4ZHMU 1C5SA 3UREA 3LGYA 2XCFA 4Q80A 3P8GA 1O30A 2PWXA 2BD8A 1OPHB 1AFQC 1M9UA 1UK4A 4ASHA 2YOLA 4OS2A 1C1QA 1O2TA 2BLVA 4QT8C 2BVXH 1W7GH 1GBCA 1GBKA 4CBOA 1MU8B 2XWBI 2A5AA 5EPYA 1V2VT 1GBEA 1LVOA 1NFWA 3QUMP 2Z94A 2ALPA 1CU1A 5C1YA 3TK6A 1Q2WA 4UE7H 2LPRA 4ISHH 1QRZA 2PSYA 1SL3A 1OP2A 2QIQA 2ZU5A 3CS7A 3QO6A 1VJAU 2FX6A 4X8TH 3SN8A 1AB9C 4DCDA 1BTYA 2AIPA 3SUEA 1O37A 1C2GA 1DE7H 4U30A 2Y7ZA 3LC5A 1Y3VA 3KL6A 3SNAA 4NWLA 1AWFH 1LVYA 1Y3WA 3KF2A 2ZP0H 4X6MA 3BTME 4UFFH 1QCPA 1Y3YA 2TGAA 1QRWA 3MU5A 5JB8S 1YPHE 3Q77A 5F6MA 4B75A 1XUGA 1HAVB 1AGJA 3PM3A 2HNTF 1D4PB 3V13A 1O2KA 4BXSA 3U98H 1BTHH 3PLKA 1LMWB 4DURA 1HLTH 2BVRH 2PKSB 3OTJE 2ZGCA 4M7GA 1O3BA 2Z3DA 1IQIA 1NFXA 2EC9H 2VJ1A 2ZQ2A 4AG1A 5GDSH 4HGCA 1N6YA 2P3TB 1YC0A 2FWWA 3QWCH 4X6PA 4WJG2 4Z6AH 3EGKH 4GCHF 5HM2A 2FOMB 2VIOA 1BBRH 1YPJH 2IOTA 3QX5H 3PMAB 3TITA 4ZMAH 2HPPH 1CT0E 1IQEA 4IW4E 2F91A 1GI1A 2ZU4A 1P01A 2FLBH 2BX4A 3KQCA 1ACBE 1S0RA 1S6HA 3KHVA 3RXJA 5E2PA 3QGNB 2WPIS 2A4OA 1GDUA 2BQ7B 3BEUA 2V0BA 4E7RG 1WOFA 1YCPH 2XBVA 2ZFRH 1O3EA 1ZHRA 1T7CA 1P2OA 4MPXA 3M3TA 2BM2A 1ZSJA 1KLTA 1PFXC 3QN7A 3FFGA 2J2UA 1XXFA 2J9NA 3ATWA 2R0KA 3M5MA 4X8VH 5C20A 3U69H 1JIRA 1A5GH 1GVLA 3TNTA 2UWPA 1SMFE 2CHAB 3TIUA 2GP9B 3ZYDA 2J4IA 3T2NA 2FOBA 3UOUA 4WH8A 1T8LA 1LKAA 1C2KA 4OS5A 4A1TA 3F6UH 2QF3A 2ANKH 4DJZB 3DFLA 1A5IA 2VWMA 3GISB 4CRBA 3MU0A 4WVPE 2WUCA 4K1EA 1GCDA 1QA7A 5J4QA 1BMNH 1H4WA 4DIHH 1ZOMA 2AYWA 3I78A 1T4VH 4ISLA 5AF9H 2ZDNA 3SQHE 1ZPCA 1FIWA 1L1NA 1C5XB 3QLPH 1TGBA 1QB9A 3U8TH 2V6NA 2XYAA 1ESTA 1K1LA 1S6FA 4OGXA 3P6ZB 3ATIA 5E2OA 1V2OT 1A61H 1ZHMA 3SJOA 5DGJA 3Q76A 1BITA 1E38B 5JYIA 2UUFB 1K2I1 3MTYA 1Z1JA 3E91A 1BZXE 1OS8A 1SGCA 3K2UA 1BJUA 3RLYH 2P95A 1SLVB 1EZXC 2ANWA 3S0NA 1LPGB 3RXOA 1UTOA 2ULLA 3SJKA 1YLDA 3QTVH 2BXTH 4WWYA 2WPMS 3KIDU 4DGJA 1V2RT 1C1UH 1D6RA 1BMMH 1XKAC 3AAVA 1SGNE 1EASA 1FAKH 1GJ9B 1FI8A 1ANCA 1GMDG 2Y82A 2Z9GA 1TRNA 2ZPSA 1O36A 3M5LA 4YOIA 3BTGE 1BUIA 3CS0A 1DVAH 1E37B 1TGSZ 3SGQE 4LZ1H 1H9IE 1SGEE 3HATH 1QQUA 3ESTA 2ZPQA 5E0GA 1MTWA 1LPZB 3OSYA 1NTPA 3BF6H 4CREA 1THSH 2HNTC 1S85A 3A83A 4D7GA 1TYNA 4B71A 3A7YA 1WTHD 2THFB 5L2ZH 1HBTH 3ODDA 5H4IB 2PR3A 1WTGH 3GY3A 4Q7XA 3TU7H 1TWXB 3UR9A 1QJ1B 5DP9A 4MNYA 1UCYE 1YP9A 3RMMH 1V2ST 1FZZA 1D6WA 2B7DH 1F2SE 4HFPB 4AGJA 5DP7A 5FBEA 5LGOA 1TNGA 4ZKNU 1W8BH 2XNIA 3SU3A 3DT0H 1GJ5H 1PQ7A 1GGDB 3ZVBA 1MTNB 1EP5A 3PLBA 1NRSH 2R3YA 2M5TA 4UONA 3PWBA 1C2IA 1NN6A 2D1JA 4ZH8A 3S9AA 4YZUA 3RXAA 2FM2A 1EJMA 1UVPA 2PKSC 1UVOA 3KGPA 5EQQA 3W95A 4K60A 4YT7H 5A2MH 3SV6A 1AQ7A 2BDGA 1RIWB 1FY1A 2UUYA 2ZPRA 4WH6A 1O34A 4I7YH 1AZ8A 1SGQE 1P8VC 2H9TH 3RXLA 1ARBA 3E90B 1TQ7B 2HALA 4FU8A 1AIXH 4B1TA 2P94A 3FP8E 1GVZA 1W11U 4I8LA 1OWHA 1L1GA 1UK2A 3UWJH 4LK4A 2BLQA 2ZQ1A 1ESBA 3PWCA 3SJ9A 2ZU2A 4R8TB 1F5KU 5GIBA 2ZCHP 1KYNA 2PLXA 2AGIX 2SGPE 2J95A 1TALA 3OYPA 2ZDMA 5I46H 3DFJA 2STBE 4X1RU 2R2WU 3MH4A 1XM1A 2A4GA 4TY7A 3P8NA 3L3TA 1WAYB 4FUEA 3DD2H 1EP6A 3RXSA 1O5DH 2VGCB 1GI4A 2A0QB 1UHBB 2ZFTA 2ZCKP 1IQNA 4I32A 2WPLS 1BB0B 4NFEA 1B5GH 1O5GH 1Z8IB 2ASUB 8GCHG 2BLWA 2GZ9A 4SGBE 3GY6A 2CGAA 1P3CA 3GDUA 3A8DA 2BB4A 2EEKA 2O8LA 4JK5A 1AMHA 4LOYH 1DSUA 5C1XA 2SGAA 4MPUA 2ODYB 4XE4A 1E35B 1ZYOA 8KME2 5EQSA 3UOPA 1TE0A 4AYVB 3GYMA 2ESTE 1P02A 3A7TA 3S69A 1C2LA 1T8NA 4K5ZA 1CGHA 5TCCA 1YPHC 3RDZA 4MNWA 2O8MA 4ABJA 2ZU3A 4BAOB 1SB1H 3BTEE 2P8OB 1PPHE 1LHCH 3KQBA 1YGCH 2AS9A 1F5LA 1C5LH 1GBMA 1MKWH 1QBVH 2P3UB 1UVSH 1DICA 3GCTF 4J1YA 1SFIA 2BDYA 2CN0H 5EXNA 4CHAB 1VITF 1G3CA 2W26A 2BZAA 1IOEA 3ZV9A 2NU1E 1O2SA 3GY7A 2IN2A 1IQKA 1MBQA 1CT4E 1O5AB 2BQWB 4IC6A 1XUIA 1C5WB 1GHVH 1GBLA 4UD9H 1OYQA 1AN1E 1B7XB 4E05H 1FN8A 1IQGA 1ZPBA 2ZTZA 3LGIA 2FTLE 1J17T 2QY0B 1ELVA 4IN2A 4IBLH 2KAIA 1GI6A 1WU1A 5A8ZA 1GCTC 1BT7A 1ZTKA 3BIVH 1CQQA 1MTVA 3BSQA 1AI8H 1EX3A 1MMJN 1RFNA 1TRYA 1C1VH 1KDQA 1C9PA 2ZFPH 1VGCB 1TX6A 1FLEE 9LPRA 1XUKA 3SJ8A 1P10A 2A45B 3O8BA 3A7XA 2A2QH 2SGEE 4YLQH 4TWYA 5L6NH 1PPEE 1OSSA 6ESTA 4GUXA 1F7ZA 1CBWC 2BYAX 2FDAA 4Y6DA 3LKWA 1GHAF 1SOZA 1UTKA 1ZGIA 1DX5M 1A4WH 5L2YH 1UTMA 1O5EH 1UO6A 3ENSB 5FPSA 2W3KA 1DY8A 2VIQA 4B2CA 1DANH 3SBKA 3BTKE 2NU2E 3C1KA 4JZFH 4X2VA 1GMCF 3M5OA 1IQHA 4ZHAA 1ARCA 3AAUA 1MTNC 3KNXA 1SSXA 2BD4A 4I8JA 3MYWA 3M7TA 8ESTE 1YPEH 1O2VA 3RXQA 1MAXA 1QL8A 1FY5A 2GZ8A 4NA7A 3ZZ9A 1S83A 3NZIA 3LIWA 4YO9A 1H8DH 2PUQH 1ZRBA 5EG4A 4ABAA 1NM6A 1RIWC 1NZQH 1FQ3A 3STIA 1RTFB 3MO6A 1BBRK 1P2QA 2C90B 3RM0H 3EYDA 1BA8B 2I6QA 1C1WH 1O2MA 3ZZAA 2QF0A 4BAHB 1YPKH 3QDZB 3MO9A 4JZEH 1C1TA 2AH4X 1EOJA 2ZWLH 1TGCA 4CBNA 1MZAA 1AUTC 1J9CH 3ZZ3A 1C4Y2 3PLPA 4JZIA 1TPPA 1GJDB 2ZG0H 3F9HA 4WMFA 1CHOF 4I8HA 5FAHA 1UTQA 1JWTA 2QN5T 1YCPK 2OC1A 4D76A 1C1MA 3UTUH 3EA9A 1W14U 3SW2B 4BXWA 3SNDA 3SU4A 2GMTB 2FX4A 4Y0YE 1V3XA 3VB3A 1TX8A 1TGNA 4XOJA 3P70B 3VXFH 1ZMNA 2JH6D 3LGVA 1O35A 1KIGH 1XVOA 2QAAA 1ELCA 1ZSLA 2ZHFH 1VR1H 4MG3A 2OC8A 1RXPA 2QGRA 3T28A 2Z9IA 1XKBC 2O8TA 1TB6H 1XMNB 5F8ZA 4DOQA 2A7CA 3SU0A 1O38A 1NO9H 2XBWA 1GBFA 4CRAA 1FPCH 3A7WA 1ZRKA 1OOKB 2XCNA 1PPBH 1HRTH 2Y6TA 3W94A 3SNEA 6CHAB 5T6GA 1KXAA 3RC5A 4OGYA 1BTUA 5DP3A 4ESTE 3MH5A 2ZGBH 3TH2H 4WF8A 4ABGA 1GHBG 2B9LA 3PYHA 3PTBA 1MQ5A 4ZAEA 4YT6H 1C1RA 1C2HA 3Q3YA 4BTUB 2TGDA 1C5PA 1NT1A 1AY6H 1C5RA 4UEHH 1HDTH 4Y79A 1H8IH 4U2WA 1EZUC 2ZZUH 4ZKRU 3SNCA 3D62A 4O3UA 1V6DA 2FI4E 1K1MA 1EKBB 1QRXA 2BDCA 1QURH 1DXPA 2ZHEH 5LPEA 3RMLH 4AFZA 1PYTD 2BD5A 1PQ5A 3B23B 2P8OC 1EB2A 1LCYA 1P04A 3N7OA 3Q00A 3M36A 1BCUH 1C1PA 4INHA 1OXGA 1FMGA 2VH0A 2ZC9H 4AORA 1V2NT 3E0PB 4BANB 3GDSA 1ABJH 1TBZH 1LQEA 3OY5U 1NROH 2BXUH 4Q7YA 4UFGH 1UTJA 3BEFB 3ATMA 2WYGA 4ABBA 5A0BA 1O3CA 2Y5HA 1JOUB 2FEQH 1GBAA 5ABWA 3A86A 1FONA 4ZXXH 2HWLB 2XWAA 5EXMA 4FU7A 4K3JA 1EPTC 1VCWA 2WPHS 3IWMA 3P17H 4ISIH 2A7HA 4IMZA 1S5SA 1O2RA 2QXGA 2WYJA 1P2JA 1EAUA 2ZDVH 3LU9B 4A5TS 3S7HB 3JZ2B 5A8XA 3RU4T 4F4OC 2FS8A 1QB6A 2ZGJA 4AB9A 2C4FH 1ORFA 2GV7A 1XVMA 4KTCA 1W0ZU 1C5NH 1D3DB 2PGBB 1DLEA 2A4QA 4ABEA 3O8CA 4Y76A 2UUJB 2FTMA 1W3CA 2ZI2H 2F3CE 4HZHA 3RXIA 2QA9E 3U8RH 4ZUHA 1A0JA 1TMTH 5C67A 4ZKOU 1YLCA 3MO3A 3T27A 1BRUP 1O5FH 4XDEA 5TJXA 1DOJA 1KXCA 5DP6A 1GJAB 3S9BA 4Z0KA 2JH0D 4AN7A 1ZJKA 5EU8A 3GDVA 1AKSB 4FVDA 1J14A 4IS5A 1EPTA 3BTFE 1G37A 7GCHF 1GL1A 4INKA 3UNQA 1C2FA 1AE8H 4XFQA 1UMAH 3FP7E 3RC4A 1O3OA 3F1SB 2OINA 4KP0A 2FLRH 2YNAA 3M35A 1GI7B 2BX3A 2PUXB 3RXRA 4JYUH 1NU7B 2PKAA 2BDAA 4CH8B 2FO9A 2ZCLP 3LONA 1O3JA 1OP0A 2QC2A 2R0LA 4RSPA 1N8OB 1GHZA 1SOTA 4A92A 3GCHB 3L6PA 4MDSA 2G8TA 2C93B 2XW9A 3RP2A 1JMOH 2SNWA 5IDKA 2VH6A 3NUMA 1QJ7B 3NKKA 3U1JB 3MH6A 1JXPA 1C5ZB 1Q3XA 4AZ2B 4B74A 1F0RA 2VINA 4U01A 3V12A 4BAKB 1O3MA 2F9BH 1TFXA 1ZZZA 2XRCA 1VJ9U 2GMTC 1SVPA 4XBDA 3HPTB 2Z7FE 2OUAA 1GI0A 1GMDF 4ABIA 1TA6A 1ZMLA 3RXTA 1EAIA 2CF8H 3T29A 1VCQA 2B5TB 3ZYEA 1F0TA 1AO5A 1TONA 1DWEH 1SGIB 5BPEA 4D7FA 1RJXB 1O2XA 1EB1H 1YYY1 2GV6A 1GJBB 3VGCC 4X1QU 6GCHG 1P06A 1SQAA 3A8BA 5ESBA 1G36A 1P2MA 4XBCA 1JRTA 2NU3E 1HNEE 1VITH 1O3PB 3TLOA 1TQ0B 6CHAC 4NG9H 1D3QB 3ZZ6A 1HXEH 4Y11E 1TPAE 1UCYH 1LTOA 4H4FA 1LHFH 1QNJA 3H7OA 4DG4A 3Q3XA 5ETXA 5CHAC 1EUFA 2QYIA 5I25A 3RXEA 3VB7A 1PYTC 5GJ4B 4AGKA 4Y7BA 1MCTA 2F83A 2ZDAH 4KKDA 4MPWA 1MKWK 1XUJA 2NWNA 1ZHPA 1EOLA 3UFAA 2BD7A 3M3VA 5T6FA 1ELEE 1A3EH 1A5HA 1MKXH 1W7XH 1PPCE 2FESH 1ZMJA 1Z8GA 1FDPA 1QFKH 2ZU1A 2F9UA 1QHRB 1CT2E 2W5EA 5SGAE 4TPIZ 1O2OA 1SGPE 2A1DB 2ZKSA 2XBXA 1CSOE 2ZIQH 4MNXA 1PPGE 3URCA 3NCLA 1H9LB 3RC6A 2BZ6H 2I6SA 3SU5A 1YKTA 2AMPA 1HGTH 1