3KINB

Kinesin (dimeric) from rattus norvegicus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
b'NKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVIQHLEVELNRWRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords KINESIN HEAVY CHAIN
publication title The crystal structure of dimeric kinesin and implications for microtubule-dependent motility.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
total genus 37
structure length 117
sequence length 117
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1980 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kinB00
3KINB
chains in the Genus database with same CATH superfamily
2WQYA 3C51A 3LJCA 4LFAT 1UX5A 3RLFF 3AE3A 1NAFA 4O4LE 5JDHA 3AE9A 3AEBA 4L0RA 3ZCJA 2QA7A 2XSAA 4A98A 3UQ7A 4QX7B 4DIDB 3RIUC 3FBLA 2V7KA 3AE5A 1HF8A 4TWFA 2VASA 4PK5A 2D2SA 4AQGA 1KNRA 1J5ET 4PJNA 4U2ZA 3PU8A 2LRLA 5ADXL 3J7Yq 2JJ9A 2CXFA 3U78A 4CZZB 4DR7T 3P4SA 4K0UA 4O4JE 1EZ3A 1SE7A 4IL4A 5LXTE 4TUYE 3UUNA 2UUAT 4ZHQE 5FXXA 3FZHB 4ISSA 2BVLA 4UR9A 3AA6B 2IC9A 4QWNB 3LDQB 3PUYF 3UQ4A 5ABEA 4DUZT 2YDSA 2AXDS 2A9UA 3AEGA 3AE4A 4DUYT 3UFGA 2CXLA 4OX9T 3NZQA 4DV1T 5LCYA 4GYSA 4B3MT 1HCIA 2DI4A 3IF8B 2WWUA 1WRDA 3BK9A 4YXDA 4ZEYA 2NTXA 3R84B 2V6YA 4UF0A 3RF1A 3UU4A 1D1CA 4KMCA 5JDNA 1D1BA 4HWHA 3BQLA 3PUGA 4I4TE 4YJ2E 1XMQT 2QRXA 2VVSA 2IHR1 4GKJT 4HFVA 1LVFA 4IL9A 3H3AA 1XDPA 1XWMA 4DMWA 5TAOA 2XQ8A 4EAHA 3HI2A 5FL1A 3PUAA 3O1IA 2DLRA 2QYWA 4TNWA 2WWVA 2UXDT 4C90A 1MNDA 1YQ4A 3RYCE 2CEAA 3D0TA 1DU2A 3QUJA 5AQHB 1M7KA 4IE7A 4JUYA 2J62A 5HEOA 5L3CB 5LYJE 5JH7E 1FJGT 2ES0A 2NWBA 3RX6A 2A2FX 1QLBA 3SRZA 3UUMA 4AI6A 3KVBA 2IW5B 2ACXA 4AIUA 4NXMT 4JV5T 1T98A 2M6IA 4YHJA 2K48A 3Q2MA 4J2CA 2B76A 1UX4A 3DJBA 3EI0A 1X9BA 4NXNT 3CIRA 2RPAA 3UUXB 2EHOA 4TWDA 4OK0A 5HEUA 2IIUA 2LSYA 3NKZA 2LM9A 3LK42 4AKLA 4UVBB 1QUUA 3N9PA 4JI5T 1G8XA 1M62A 2CLYC 2DNXA 5H6RB 2BBJA 1HNWT 1OEDE 3R6NA 2Y48B 4I55E 2JQHA 1VCTA 1ZEEA 4LFCT 4DR5T 5AQJB 2V7IA 4IT4A 3LK2B 3KINB 2ZM0A 5HYAA 4M1PA 3IBPA 3VRBA 2E9XB 1IBMT 2E5LT 2Y6XA 2BG9B 2KT9A 2WB5A 2D9DA 1O3XA 2UXXB 2LOPA 5FKYA 5C3JA 4OHFA 4YTMA 2LEHA 3N2OA 4H9RC 3UU5A 2N2NA 2KWIB 4DV7T 4QH5A 2LLYA 3ZYLA 1LRZA 4B3TT 2KNDA 4LF6T 4ASKA 5AQKB 3AA0B 3QOFA 4JI6T 3CWZB 4PFPA 3T1YT 4AKIA 4Q25A 2C5KT 2DHRA 2LHRA 4CQIA 4HWIB 5JQGE 4PW8A 2P9BA 3GN5A 4CI2B 3RYHE 5JR9B 2XTLA 3KV4A 2JMHA 3AEFA 3JAFA 4EIWA 3RKGA 2CHOA 2WM9A 2V26A 4QXCB 1L0VA 4AQFA 4TX5A 1T7SA 2WAUA 3RHWA 3CX6B 5LG4A 3ZKRA 2ODUA 5HWYA 2MYSA 1R8IA 5AQRB 2Z6EA 1WCRA 1ZHCA 2CPTA 3K1SA 4PFOA 2ZM2A 3B5MA 4AXPA 3I9WA 2X9YA 5IHYA 5DJQC 3AAEB 5HXRA 3EAMA 5F8PA 3OBVE 3ONXA 4UV8B 4DO0A 4MFRA 4LF9T 5HXSA 4JI4T 4G63A 3PUSA 4IDNA 4UXNB 4TV9E 1BR4A 3AVSA 4U7IA 3ZPOA 3AVRA 4CI3B 5KX5E 2CBIA 1H7CA 2VVNA 2VURA 4H9SE 4QH4A 5JVDE 1FMWA 3E08A 4ILCA 1XDOA 2V5CA 2W67A 5FY7A 4O4HE 5JDQA 4HKAA 3K3NA 4DR6T 4MHCA 4EEBA 2X9XA 3ETVA 2XAFB 4LMLA 2W61A 2Q9QA 4DR4T 3VU7H 1Z8UA 5HCMA 1N34T 1G73A 2CHNA 1D0YA 1XNRT 1GQEA 4B3ST 3ZEFB 3V5SA 4WW0A 4IDQA 2LHNA 1IJ5A 3N9LA 4LF7T 5LG3A 3ZLIA 2WDVA 2NW8A 2WP9A 2WU2A 1MMGA 2X0LB 3FZKB 4DR3T 4AQFC 3AXJB 2VL0A 4CN4A 1CUNA 4JI7T 4F6RC 3L09A 1B7TA 1OEDA 5FMNA 2WCAA 3S4UA 2XY8B 2JQQA 3A5XA 2YU1A 4YLHA 2XHEB 4EV6A 3C4ZA 2VKJA 3IEEA 4HTEA 1YKHB 2FJBA 3OPCA 4LMJA 3MA9A 3AE7A 4FJOA 3FXEB 5EZYE 5LHHB 3KDSE 5ETWA 4P0BA 3WAJA 5FNVE 3UT5E 2XAHB 4HWFA 2MAWA 1IBKT 2IAKA 3KBUA 4JLEA 3KV9A 1N32T 3PUWF 5LMNT 4YHHT 4LF4T 4CXWA 4BJNA 1SHZC 4ILBA 3AE2A 3EHZA 3QC9A 1WYCA 3HA4A 4O2BE 2XQYA 2QGSA 1HX8A 1MIWA 5FXVA 3LK3B 5LBQB 1NWMX 2LSJA 4KUMB 4U74A 4X1YE 3VRAA 3PJAA 4U31A 2XQ6A 3AB3B 4A5XA 3BQKA 2V7LA 4TWHA 4DNDA 2NOXA 3RC3A 4HFHA 4PJLA 3OYXA 3RIAA 5KXJA 4DV2T 5AQUB 2CMRA 3L39A 4DV6T 3ZT6A 1W0AA 2Q9QC 2UU9T 3P8CD 3L3PA 1N36T 3P4WA 1IJ6A 1WFDA 1KNZA 3HKBE 3VKHA 2HHHT 3MJXA 2HH7A 4EXTA 4AKRB 4Z8XA 5L3EB 4MBQA 4WYVA 4KHZF 3IHRA 4ZZCA 2N9DA 1I6ZA 3PTRB 4X66T 2HPLA 4ZOLE 4ZS2A 1NENA 2X67A 4NUUA 4EEDA 2MOZA 1U5PA 3UULA 2Q9QD 3O4XE 3C64A 1YW0A 4WBNE 2N1GA 2ODVA 2XQAA 2VQET 3OJAA 4L5GA 4HWDA 3UU3A 4JI2T 4EYUA 4H9OC 1KK7A 1ZP0A 5A1LA 4AKGA 5L4HA 4HE8A 4EGWA 2IC6A 4HFBA 4H63V 5AQLB 3BQIA 2YU2A 4EZ4A 2WSSV 1UUSA 4KHPT 3NBXX 2XAQB 4HWCA 1HR0T 3PUXF 4U3CA 4YFSA 2KINB 4TNVA 1AJ3A 4YSZA 4Z91A 2LOSA 4BJMA 5AQTB 1HS7A 1KEYA 2WZHA 2H88A 2WDRA 3MACA 4X5TA 2FBWA 1YKEB 4P09A 2JMKA 4IHJE 3E0ZA 1BR1A 3P4QA 2KWHA 2NP9A 3MK7C 5AQOB 1D0XA 2HN1A 1FEWA 3VKGA 3NVOA 1KFYA 1IAPA 2J47A 3CX7B 3PURA 5AQGB 2FJEA 2VQFT 5LGUB 3N9NA 4ZI3C 5HWXA 2YK0A 3N2GE 5LJNA 5AQFB 2JQ9A 2F4VT 3ANWA 4COFA 2CA5A 3KFWX 2M6BA 3PUZF 2LRKA 3LBXA 2I6HA 2L3LA 4DV5T 3AE1A 1I94T 3SWHA 5LBMA 4B3RT 4LMKA 5L3DB 4ZI3D 5JRCA 4JYAT 2WS3A 4I50E 1FMVA 2A72A 2SPCA 1XNQT 5DQVA 4ZZBA 4IE4A 5FVLA 5JDMA 4A97A 1BR2A 4HFEA 3F57A 2LM2A 3RRWA 4I0UA 4XZCA 1W0BA 3HR0A 1NEKA 2LT3A 5HCJA 5KDMC 1LKXA 2K3WA 4CN6A 3K3QC 5JDGA 3K3OA 4FI5A 2FJDA 3LSVA 3JCFA 2XM2A 2VWAA 4TZ4C 5AQMB 4DR1T 3ZMZB 2YINA 5LA6E 1S35A 1IBLT 2BG9E 2ZM8A 5LHGB 2LKHA 3OTOT 5L2LA 3PV0F 2HPJA 4ZI7E 3EABA 3UUBA 2LJLA 4IIJE 5FY0A 1UGOA 1VCSA 4YTNA 3SFDA 1MMDA 4UVAB 5FP3A 3RQWA 4X65T 4WNKA 3ZMTB 2XM1A 2V7MA 1HG5A 3UU8A 4CXXA 2XZEA 3IA3A 2WU5A 2G0UA 3EVYA 3UFEA 3P4PA 2CLYB 2KXPB 2UUBT 2X0YA 4EB6E 3Q5EA 4IDPA 4WBOA 2DWGA 2WDQA 1OXZA 4YJ3E 4IDZA 3AAIA 4JI0T 2CM0A 1VRBA 2EHOC 2V6YB 3LG7A 4YSYA 4UF0B 1JNZA 4DV3T 3ETUA 2CE7A 1W09A 1YQ3A 4ZS3A 3A7MA 2C5IT 2V6XA 4ISTA 2XQ4A 2VK9A 2CXDA 2WMNA 4UELA 5JDFA 5ABGA 2ZMAA 3TLWA 2BS3A 1U4QA 2PG8A 5BR8T 2VKOA 3F2EA 1HNZT 2V1DB 4PNIA 4UEMA 2OLTA 1HX1B 5L47A 3W15B 2L8KA 4X1KE 4A56A 3WI3A 2NR4A 2EHOD 1V9DA 4KI0F 4LF5T 2PTFA 2MTQA 3TLSA 2ZLYA 1SUMB 4DV4T 3OKQA 4DBRA 2H7VC 1T8BA 3P50A 1MIYA 1E7PA 4BAYB 3CMLA 1T72A 3Q5DA 3O1JA 3RPUA 3TKLB 4O2AE 4HFIA 4C91A 4IE5A 3AEDA 4X62T 3CKDA 3C4WA 1ZOYA 2LSKA 2BBHA 3RH3A 3EDUA 3HL6A 3E22E 4GOUA 2X68A 2XAJB 5J2UE 3TLTA 2LE8A 1MNEA 3ZCIA 4U2YA 5FXZA 5H6QB 2WY2A 5AQVB 4GK0E 4NIQA 5LP6E 3B57A 2LSIA 2H89A 1CHUA 2R6GF 3UTKA 2X9HA 4MLKA 5FYMA 4IE6A 3AEAA 3ZMUB 2EHOB 2BKOA 4IE0A 3QK6A 3N5LA 2BKPA 4N78D 5L3FB 5AQQB 5J2TE 2L9QA 5AFUL 3ZYMA 3HKDE 4NUVA 2DWKA 2UXCT 4CXYA 3P4RA 2HN2A 4GKKT 2CBJA 4KP3C 3RIFA 5M4YA 2XQ3A 3VHLA 2UUCT 2ACZA 2V8SV 2GK9A 4DBQA 3CQGB 2IDOB 2Y8DA 4ANJA 4HFDA 3DP7A 4IREA 2VKHA 3WAKA 4GYRA 4X20E 2W62A 2PBIA 4IDOA 5CA0E 5AQIB 2MBGA 5GONE 2M67A 3PUVF 4MALA 2FJAA 3N9MA 2MPKA 1JNRA 5FY1A 4G2AA 5C2TA 3I9YA 2JPFA 4DV0T 2E9XA 3SFEA 2BG9A 1HFAA 4UVCB 3ZYKA 5HXEA 4EYYR 2K9AA 3N9QA 1QSDA 2I59A 4JI1T 1HG2A 1S94A 3JAEA 3GN5B 2J4GA 5KMGP 2IUBA 4JBWF 2CWOA 3ZT7A 2JRKA 5DQWA 3B13A 5J1GA 4H63H 2RP4A 3K8PC 5JREA 3RGLA 1KNPA 3QB5K 4BA9A 2K24A 2W4XA 3RI5A 3SOLA 2AE9A 3ZSSA 3MKDA 2PFVA 5JR9A 3N2KE 2XASB 2VL8A 4ILAA 4QH1A 2X0HA 5EK2A 2YDRA 5EK3A 1N33T 1ZKEA 3O9XA 5EK4A 3FHNA 1FIOA 3H3MA 1YXRA 1ZV4X 4X64T 3RYIE 1OEDC 3RQUA 2UXBT 4PJJA 2W0GA 4P0AA 4PK4A 1LVKA 4IGUA 5LGTB 3I0QA 3RKOA 4NPPA 3ZJ2A 1XMOT 2W66A 1KF6A 1J5WA 4JI8T 4XBFB 2FUPA 3EUHA 3FXDB 2X51A 1XZYA 2YKSA 4LF8T 5CFBA 4ZXLA 3OYZA 3CQXC 3Q5WA 2C0SA 1E2AA 3CX8B 2E5VA 3MXZA 1YD8G 2Q9QB 2LSGA 2YDQA 4E7ZA 3LFMA 1D0ZA 2WZIA 2E9XC 3AA7B 2BG9C 3CQCB 3JC6C 3MZKB 5IWAT 2LKGA 5CB4E 4Z90A 4AISA 5ABFA 2NW7A 3EDVA 3T1HT 3H37A 3ZJ1A 3C50A 4XAXB 2RA1A 4UV9B 2NTYA 2UXNB 2XPKA 3P7IA 3ZT5A 3N9OA 4F8HA 3RYFE 2XUEA 3KVAA 2E9XD 2XAGB 1OEDB 4KBMB 5CJ5A 3JC6D 2KMFA 5AQSB 4QHOA 5JR9C 3SS1A 4GK5E 2WBLA 2E8IA 4AQYT 2XQ5A 5JDLA 4JEUB 4YY3T 2XQ7A 3AXJA 1Y64B 4PK6A 4DMVA 2YN6A 3ZC1A 5F3JA 5FXWA 3Q5XA 2CWYA 1IZNB 4V1Av 4I43B 5J0ZA 1VOMA 3FZMB 1HTJF 4DVDA 1HNXT 2BVMA 4WZXA 5LOVE 4CI1B 2X9WA 5C8YE 4YTPA 3HKCE 4JI3T 3GWHA 3U3IA 4U7YA 5LJMA 2ZM6T 1J1JA 2E2AA 5FVKA 3TLVA 4TV8E 3L8RA 3FB2A 3GA8A 5L4EA 3ZMSB 2BS2A 2I0MA 5HEJA 2B1EA 3PE0A 3NWIA 2NW9A 5AQPB 4EZHA 3F31A 2W63A 4U33A 4L9IA 2D0UA 4B6XA 2V5DA 4QKNA 4CN1A 1WYBA 3A8YC 3NZPA 3CVRA 5HEHA 5BMVE 3RC8A 2XQ9A 3KV6A 4QXBB 3RRCA 3ZN0B 4YSXA 3KBTA 2D0TA 3I1AA 4EOZB 1E1HB 3ZSTA 4ZI2C 2QVAA 3AEEA 5E0OA 5DABA 3QNUA 4O8SA 3VR9A 2J1DG 3VR8A 2JIWA 2JQKA 2CRBA 4OYJA 4U72A 3T8OA 3M3ZB 4HFCA 5HAXA 1WR0A 2XJ7A 3AAAB 4HGAA 2DCFA 4H9NC 3AECA 1D1AA 5L3GB 4E7SA 3TLUA 1Z0PA 4H9PC 2YEVC 5HEGA 4K0KT 2BKNA 5HXHA 1MIVA 1MMAA 4ZI2D 5LB7B 3QB5A 2DL1A 3I0OA 1Y01A 2D5UA 2VKDA 2H7OA 4ERRA 3GMIA 5CA1E 4X1IE 2BZBA 3ABVA 2IMLA 2WMOA 1BR0A 4HN9A 2XSBA 2BDEA 2YOEA 3ONLC 3DTOA 5ABHA 1UCUA 3ZMVB 4UIGA 2OV9A 2PJQA 5F5WA 2BS4A 5L3BB 3Q9DA 3RIUA 5IYZE 2W2UA 1OWAA 2W00A 1US7B 3NRXA 3PU3A 4PAGA 3M65A 5ABFB 4O4IE 2X66A 3KV5A 3PUQA 2C5JA 1UURA 4OFZA 1X79A 4H9QC 5LHIB 3C4XA 3PDYA 3PJAJ 3HKEE 3O1HA 3ZN1B 5FL0A 3G06A 3CK6A 3ANWB 4QX8B 4AKHA 1W9RA 3AE8A 3J9X1 3FZFB 3CPZA 5IUXA 2KLQA 3LBXB 3NRYA 2OA5A 5CGMA 1UK5A 4HEAA 5LMUT 3FBZA 4P1NA 1WR6A 2V7JA 3ZC0A 4JEHB 1WLXA 3C98B 4QXHB 3FZLB 4TN7B 3AA1B 4KX6A 5AQNB 4YT0A 4ILUA 5JTGA 5JRCB 2KSRA 3UU6A 2CCQA 5HXCA 5LNKA 3V5UA 3AE6A 3OVUA 2H3RA 1SA0E 2VB6A 5LGNB 2K5BB 4GIWA 4ADZA 2A3DA 3ESLA 3JADA 3X1DA 2KZ7B 4DR2T 4OYKA 4PJMA 3ONJA 4LFBT 1MMNA
chains in the Genus database with same CATH topology
3C51A 4UXNB 3LJCA 4TV9E 1BR4A 3AVSA 4XBFB 1UX5A 3ZPOA 2LT3A 3EUHA 5KDMC 1LKXA 3FXDB 3AVRA 2X51A 3K3QC 5JDGA 4CI3B 1NAFA 5KX5E 1H7CA 3K3OA 4FI5A 4O4LE 5JDHA 2VWAA 4TZ4C 4H9SE 3OYZA 3ZMZB 3CQXC 4L0RA 3ZCJA 2QA7A 2YINA 5JVDE 3Q5WA 2C0SA 1FMWA 3CX8B 3E08A 3MXZA 5LA6E 1YD8G 2Q9QB 2LSGA 1S35A 4E7ZA 5FY7A 2ZM8A 3LFMA 4O4HE 5JDQA 5LHGB 1D0ZA 4QX7B 5L2LA 2HPJA 4HKAA 2E9XC 3K3NA 4ZI7E 3AA7B 3FBLA 4MHCA 2X9XA 3CQCB 2LJLA 2V7KA 3ETVA 4IIJE 1HF8A 2XAFB 5FY0A 2VASA 3JC6C 2D2SA 3MZKB 4PK5A 2W61A 5CB4E 4AQGA 4PJNA 2Q9QA 3PU8A 2NW7A 5ADXL 3EDVA 1MMDA 3J7Yq 2JJ9A 3VU7H 2CXFA 4UVAB 5FP3A 4WNKA 3U78A 3H37A 3ZJ1A 3ZMTB 2V7MA 1HG5A 4CZZB 1G73A 4CXXA 4K0UA 4O4JE 1D0YA 1EZ3A 3C50A 4XAXB 2G0UA 3EVYA 3UFEA 2RA1A 5LXTE 4TUYE 4UV9B 3UUNA 3ZEFB 4ZHQE 5FXXA 2CLYB 2KXPB 2NTYA 3V5SA 4ISSA 4WW0A 2BVLA 2LHNA 2UXNB 1IJ5A 3AA6B 3N9LA 4EB6E 2IC9A 3P7IA 4QWNB 3N9OA 4WBOA 3RYFE 3ZLIA 2XUEA 2DWGA 3KVAA 2E9XD 2NW8A 2XAGB 1MMGA 1OXZA 2X0LB 4KBMB 4AQFC 4YJ3E 3JC6D 4IDZA 2CXLA 2KMFA 3AAIA 3NZQA 1CUNA 4QHOA 5JR9C 2CM0A 3SS1A 4GK5E 1VRBA 2EHOC 5LCYA 3LG7A 4UF0B 2WBLA 2E8IA 4GYSA 3ETUA 1HCIA 4F6RC 5JDLA 2DI4A 3L09A 2CE7A 3IF8B 1B7TA 1WRDA 2WWUA 3BK9A 4ZS3A 5FMNA 4JEUB 3S4UA 2C5IT 4G63A 4ISTA 2VK9A 2JQQA 2CXDA 2WMNA 3A5XA 4UELA 2YU1A 4YLHA 1Y64B 5JDFA 2XHEB 4PK6A 4DMVA 2NTXA 2ZMAA 3R84B 3C4ZA 4UF0A 2VKJA 3IEEA 1U4QA 2PG8A 3ZC1A 5F3JA 5FXWA 4HTEA 1YKHB 2VKOA 3Q5XA 1D1CA 2CWYA 1IZNB 3MA9A 4V1Av 4I43B 3F2EA 4KMCA 5JDNA 4FJOA 2V1DB 4PNIA 1VOMA 3FXEB 1HTJF 4DVDA 5EZYE 1D1BA 4UEMA 5LHHB 3BQLA 2BVMA 3PUGA 4I4TE 4YJ2E 3KDSE 5ETWA 4P0BA 3WAJA 5FNVE 5LOVE 3W15B 4CI1B 2L8KA 2X9WA 2XAHB 4X1KE 3UT5E 5C8YE 3HKCE 3GWHA 4HFVA 4A56A 3WI3A 1LVFA 2EHOD 2IAKA 3KBUA 4JLEA 3U3IA 3H3AA 5LJMA 1V9DA 3KV9A 2MTQA 4DMWA 2ZLYA 4CXWA 5TAOA 4BJNA 4EAHA 1SHZC 3HI2A 3OKQA 4TV8E 3PUAA 3FB2A 3GA8A 3O1IA 3ZMSB 4DBRA 2DLRA 3QC9A 1WYCA 2H7VC 3HA4A 4O2BE 2XQYA 2QGSA 4C90A 1HX8A 1MNDA 1MIWA 5FXVA 2B1EA 3LK3B 5LBQB 3RYCE 1NWMX 1MIYA 3PE0A 2CEAA 4BAYB 3D0TA 2NW9A 3CMLA 2LSJA 3O1JA 4KUMB 4EZHA 3RPUA 3TKLB 3F31A 2W63A 3QUJA 4U74A 4X1YE 4IE7A 4O2AE 4C91A 4IE5A 3CKDA 4JUYA 3AB3B 4L9IA 3C4WA 2LSKA 2D0UA 4B6XA 3RH3A 5L3CB 3BQKA 5LYJE 2V7LA 3EDUA 4DNDA 3HL6A 3E22E 5JH7E 4GOUA 2X68A 2NOXA 2XAJB 2ES0A 4PJLA 3OYXA 4QKNA 3RC3A 5J2UE 3ZCIA 2CMRA 1MNEA 2LE8A 2NWBA 5FXZA 3RX6A 5H6QB 1WYBA 2A2FX 3NZPA 3CVRA 4GK0E 5BMVE 3RC8A 3SRZA 5LP6E 3B57A 2LSIA 3UUMA 4AI6A 3UTKA 3KV6A 2X9HA 2Q9QC 3KVBA 4QXBB 3P8CD 2ACXA 2IW5B 4MLKA 3L3PA 3RRCA 5FYMA 3ZN0B 4IE6A 3KBTA 2D0TA 3I1AA 3ZMUB 4EOZB 1E1HB 2EHOB 1T98A 1IJ6A 4YHJA 2K48A 1KNZA 3Q2MA 4IE0A 3QK6A 3HKBE 4J2CA 4ZI2C 1UX4A 3VKHA 3N5LA 5E0OA 5DABA 3DJBA 3MJXA 2HH7A 4EXTA 4O8SA 4AKRB 4N78D 4Z8XA 5L3EB 2J1DG 4MBQA 5L3FB 5J2TE 2L9QA 5AFUL 3UUXB 3ZYMA 2EHOA 3HKDE 4NUVA 4OK0A 4OYJA 4U72A 2DWKA 3IHRA 2LSYA 2N9DA 3T8OA 5HAXA 3PTRB 2LM9A 3AAAB 3LK42 4AKLA 2HPLA 4HGAA 4UVBB 4ZOLE 1QUUA 2DCFA 4ZS2A 4H9NC 2X67A 4NUUA 4CXYA 3N9PA 1G8XA 1D1AA 2CLYC 2DNXA 5H6RB 5L3GB 4E7SA 2MOZA 1U5PA 3UULA 1Z0PA 4H9PC 2Q9QD 2YEVC 3O4XE 3R6NA 2Y48B 4I55E 5HXHA 3C64A 1YW0A 4WBNE 2N1GA 1MIVA 1MMAA 2ODVA 4KP3C 4ZI2D 5M4YA 3OJAA 3VHLA 4L5GA 1ZEEA 3I0OA 4H9OC 4EYUA 1KK7A 2GK9A 5A1LA 4DBQA 4AKGA 2D5UA 2V7IA 2VKDA 2Y8DA 3CQGB 2H7OA 3LK2B 3DP7A 3KINB 4ANJA 4ERRA 4HE8A 3GMIA 5CA1E 2ZM0A 4X1IE 2BZBA 5HYAA 2IC6A 2VKHA 4M1PA 3WAKA 2WMOA 4GYRA 4X20E 3IBPA 4H63V 2W62A 2E9XB 2PBIA 2Y6XA 3BQIA 2YU2A 2KT9A 4EZ4A 2WSSV 1BR0A 4HN9A 5CA0E 3NBXX 2XAQB 2MBGA 1O3XA 5GONE 2M67A 2BDEA 4MALA 4YFSA 2KINB 3N9MA 1AJ3A 3DTOA 2UXXB 1UCUA 2LOSA 4G2AA 5FY1A 3ZMVB 4BJMA 4UIGA 2LOPA 2PJQA 3I9YA 2JPFA 1HS7A 4OHFA 2E9XA 3Q9DA 5L3BB 5IYZE 2LEHA 1OWAA 2W00A 3N2OA 4H9RC 1US7B 2N2NA 2KWIB 1HFAA 3NRXA 3PU3A 4UVCB 3ZYKA 4PAGA 3MACA 5HXEA 3ZYLA 4EYYR 2K9AA 3N9QA 1LRZA 1YKEB 4P09A 1QSDA 2JMKA 3M65A 2KNDA 2I59A 4ASKA 4O4IE 2X66A 4IHJE 1HG2A 1S94A 3E0ZA 1BR1A 3GN5B 3AA0B 3KV5A 3PUQA 2KWHA 2C5JA 2NP9A 4OFZA 5KMGP 1X79A 4H9QC 5LHIB 3C4XA 3CWZB 3PDYA 3MK7C 3HKEE 4PFPA 2CWOA 4AKIA 2C5KT 2DHRA 3O1HA 1D0XA 3ZN1B 2LHRA 2JRKA 4CQIA 5JQGE 5DQWA 1FEWA 3B13A 5J1GA 3VKGA 4PW8A 2P9BA 3ANWB 3GN5A 2RP4A 3K8PC 4H63H 4QX8B 3RYHE 4CI2B 1IAPA 3CX7B 5JREA 3PURA 4AKHA 3J9X1 5JR9B 2XTLA 5LGUB 3CPZA 3KV4A 3N9NA 2KLQA 4ZI3C 2JMHA 3LBXB 3NRYA 5HWXA 4BA9A 2OA5A 2K24A 4EIWA 2YK0A 2WM9A 4HEAA 3N2GE 2V26A 4QXCB 3SOLA 3FBZA 4AQFA 5LJNA 1WR6A 2V7JA 3ANWA 3ZC0A 2CA5A 4JEHB 4TX5A 3MKDA 2PFVA 3KFWX 5JR9A 1WLXA 3C98B 3N2KE 4QXHB 2XASB 3LBXA 2WAUA 4TN7B 3AA1B 2VL8A 2L3LA 3CX6B 5LG4A 2ODUA 5EK2A 4ILUA 5HWYA 5JRCB 2MYSA 5EK3A 2Z6EA 1ZKEA 3O9XA 3SWHA 5EK4A 1ZHCA 2CCQA 5HXCA 5LBMA 3V5UA 5LNKA 4PFOA 2ZM2A 3FHNA 1FIOA 4AXPA 3I9WA 2X9YA 5IHYA 5L3DB 2H3RA 1SA0E 4ZI3D 1ZV4X 5DJQC 5JRCA 3RYIE 3AAEB 2VB6A 4I50E 5HXRA 5LGNB 1FMVA 2A72A 2SPCA 4PJJA 2K5BB 4GIWA 2W0GA 4ADZA 4P0AA 5DQVA 2A3DA 3ESLA 5F8PA 3OBVE 3ONXA 4PK4A 4UV8B 1LVKA 4IE4A 4DO0A 5JDMA 4IGUA 1BR2A 5LGTB 2KZ7B 3I0QA 4OYKA 4PJMA 3F57A 4MFRA 3RRWA 3RKOA 5HXSA 3ZJ2A 4XZCA 1MMNA 3HR0A 3PUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KIN B; 
#chains in the Genus database with same CATH topology
 2WQY A;  3C51 A;  3LJC A;  4LFA T;  1UX5 A;  3RLF F;  3AE3 A;  1NAF A;  4O4L E;  5JDH A;  3AE9 A;  3AEB A;  4L0R A;  3ZCJ A;  2QA7 A;  2XSA A;  4A98 A;  3UQ7 A;  4QX7 B;  4DID B;  3RIU C;  3FBL A;  2V7K A;  3AE5 A;  1HF8 A;  4TWF A;  2VAS A;  4PK5 A;  2D2S A;  4AQG A;  1KNR A;  1J5E T;  4PJN A;  4U2Z A;  3PU8 A;  2LRL A;  5ADX L;  3J7Y q;  2JJ9 A;  2CXF A;  3U78 A;  4CZZ B;  4DR7 T;  3P4S A;  4K0U A;  4O4J E;  1EZ3 A;  1SE7 A;  4IL4 A;  5LXT E;  4TUY E;  3UUN A;  2UUA T;  4ZHQ E;  5FXX A;  3FZH B;  4ISS A;  2BVL A;  4UR9 A;  3AA6 B;  2IC9 A;  4QWN B;  3LDQ B;  3PUY F;  3UQ4 A;  5ABE A;  4DUZ T;  2YDS A;  2AXD S;  2A9U A;  3AEG A;  3AE4 A;  4DUY T;  3UFG A;  2CXL A;  4OX9 T;  3NZQ A;  4DV1 T;  5LCY A;  4GYS A;  4B3M T;  1HCI A;  2DI4 A;  3IF8 B;  2WWU A;  1WRD A;  3BK9 A;  4YXD A;  4ZEY A;  2NTX A;  3R84 B;  2V6Y A;  4UF0 A;  3RF1 A;  3UU4 A;  1D1C A;  4KMC A;  5JDN A;  1D1B A;  4HWH A;  3BQL A;  3PUG A;  4I4T E;  4YJ2 E;  1XMQ T;  2QRX A;  2VVS A;  2IHR 1;  4GKJ T;  4HFV A;  1LVF A;  4IL9 A;  3H3A A;  1XDP A;  1XWM A;  4DMW A;  5TAO A;  2XQ8 A;  4EAH A;  3HI2 A;  5FL1 A;  3PUA A;  3O1I A;  2DLR A;  2QYW A;  4TNW A;  2WWV A;  2UXD T;  4C90 A;  1MND A;  1YQ4 A;  3RYC E;  2CEA A;  3D0T A;  1DU2 A;  3QUJ A;  5AQH B;  1M7K A;  4IE7 A;  4JUY A;  2J62 A;  5HEO A;  5L3C B;  5LYJ E;  5JH7 E;  1FJG T;  2ES0 A;  2NWB A;  3RX6 A;  2A2F X;  1QLB A;  3SRZ A;  3UUM A;  4AI6 A;  3KVB A;  2IW5 B;  2ACX A;  4AIU A;  4NXM T;  4JV5 T;  1T98 A;  2M6I A;  4YHJ A;  2K48 A;  3Q2M A;  4J2C A;  2B76 A;  1UX4 A;  3DJB A;  3EI0 A;  1X9B A;  4NXN T;  3CIR A;  2RPA A;  3UUX B;  2EHO A;  4TWD A;  4OK0 A;  5HEU A;  2IIU A;  2LSY A;  3NKZ A;  2LM9 A;  3LK4 2;  4AKL A;  4UVB B;  1QUU A;  3N9P A;  4JI5 T;  1G8X A;  1M62 A;  2CLY C;  2DNX A;  5H6R B;  2BBJ A;  1HNW T;  1OED E;  3R6N A;  2Y48 B;  4I55 E;  2JQH A;  1VCT A;  1ZEE A;  4LFC T;  4DR5 T;  5AQJ B;  2V7I A;  4IT4 A;  3LK2 B;  3KIN B;  2ZM0 A;  5HYA A;  4M1P A;  3IBP A;  3VRB A;  2E9X B;  1IBM T;  2E5L T;  2Y6X A;  2BG9 B;  2KT9 A;  2WB5 A;  2D9D A;  1O3X A;  2UXX B;  2LOP A;  5FKY A;  5C3J A;  4OHF A;  4YTM A;  2LEH A;  3N2O A;  4H9R C;  3UU5 A;  2N2N A;  2KWI B;  4DV7 T;  4QH5 A;  2LLY A;  3ZYL A;  1LRZ A;  4B3T T;  2KND A;  4LF6 T;  4ASK A;  5AQK B;  3AA0 B;  3QOF A;  4JI6 T;  3CWZ B;  4PFP A;  3T1Y T;  4AKI A;  4Q25 A;  2C5K T;  2DHR A;  2LHR A;  4CQI A;  4HWI B;  5JQG E;  4PW8 A;  2P9B A;  3GN5 A;  4CI2 B;  3RYH E;  5JR9 B;  2XTL A;  3KV4 A;  2JMH A;  3AEF A;  3JAF A;  4EIW A;  3RKG A;  2CHO A;  2WM9 A;  2V26 A;  4QXC B;  1L0V A;  4AQF A;  4TX5 A;  1T7S A;  2WAU A;  3RHW A;  3CX6 B;  5LG4 A;  3ZKR A;  2ODU A;  5HWY A;  2MYS A;  1R8I A;  5AQR B;  2Z6E A;  1WCR A;  1ZHC A;  2CPT A;  3K1S A;  4PFO A;  2ZM2 A;  3B5M A;  4AXP A;  3I9W A;  2X9Y A;  5IHY A;  5DJQ C;  3AAE B;  5HXR A;  3EAM A;  5F8P A;  3OBV E;  3ONX A;  4UV8 B;  4DO0 A;  4MFR A;  4LF9 T;  5HXS A;  4JI4 T;  4G63 A;  3PUS A;  4IDN A;  4UXN B;  4TV9 E;  1BR4 A;  3AVS A;  4U7I A;  3ZPO A;  3AVR A;  4CI3 B;  5KX5 E;  2CBI A;  1H7C A;  2VVN A;  2VUR A;  4H9S E;  4QH4 A;  5JVD E;  1FMW A;  3E08 A;  4ILC A;  1XDO A;  2V5C A;  2W67 A;  5FY7 A;  4O4H E;  5JDQ A;  4HKA A;  3K3N A;  4DR6 T;  4MHC A;  4EEB A;  2X9X A;  3ETV A;  2XAF B;  4LML A;  2W61 A;  2Q9Q A;  4DR4 T;  3VU7 H;  1Z8U A;  5HCM A;  1N34 T;  1G73 A;  2CHN A;  1D0Y A;  1XNR T;  1GQE A;  4B3S T;  3ZEF B;  3V5S A;  4WW0 A;  4IDQ A;  2LHN A;  1IJ5 A;  3N9L A;  4LF7 T;  5LG3 A;  3ZLI A;  2WDV A;  2NW8 A;  2WP9 A;  2WU2 A;  1MMG A;  2X0L B;  3FZK B;  4DR3 T;  4AQF C;  3AXJ B;  2VL0 A;  4CN4 A;  1CUN A;  4JI7 T;  4F6R C;  3L09 A;  1B7T A;  1OED A;  5FMN A;  2WCA A;  3S4U A;  2XY8 B;  2JQQ A;  3A5X A;  2YU1 A;  4YLH A;  2XHE B;  4EV6 A;  3C4Z A;  2VKJ A;  3IEE A;  4HTE A;  1YKH B;  2FJB A;  3OPC A;  4LMJ A;  3MA9 A;  3AE7 A;  4FJO A;  3FXE B;  5EZY E;  5LHH B;  3KDS E;  5ETW A;  4P0B A;  3WAJ A;  5FNV E;  3UT5 E;  2XAH B;  4HWF A;  2MAW A;  1IBK T;  2IAK A;  3KBU A;  4JLE A;  3KV9 A;  1N32 T;  3PUW F;  5LMN T;  4YHH T;  4LF4 T;  4CXW A;  4BJN A;  1SHZ C;  4ILB A;  3AE2 A;  3EHZ A;  3QC9 A;  1WYC A;  3HA4 A;  4O2B E;  2XQY A;  2QGS A;  1HX8 A;  1MIW A;  5FXV A;  3LK3 B;  5LBQ B;  1NWM X;  2LSJ A;  4KUM B;  4U74 A;  4X1Y E;  3VRA A;  3PJA A;  4U31 A;  2XQ6 A;  3AB3 B;  4A5X A;  3BQK A;  2V7L A;  4TWH A;  4DND A;  2NOX A;  3RC3 A;  4HFH A;  4PJL A;  3OYX A;  3RIA A;  5KXJ A;  4DV2 T;  5AQU B;  2CMR A;  3L39 A;  4DV6 T;  3ZT6 A;  1W0A A;  2Q9Q C;  2UU9 T;  3P8C D;  3L3P A;  1N36 T;  3P4W A;  1IJ6 A;  1WFD A;  1KNZ A;  3HKB E;  3VKH A;  2HHH T;  3MJX A;  2HH7 A;  4EXT A;  4AKR B;  4Z8X A;  5L3E B;  4MBQ A;  4WYV A;  4KHZ F;  3IHR A;  4ZZC A;  2N9D A;  1I6Z A;  3PTR B;  4X66 T;  2HPL A;  4ZOL E;  4ZS2 A;  1NEN A;  2X67 A;  4NUU A;  4EED A;  2MOZ A;  1U5P A;  3UUL A;  2Q9Q D;  3O4X E;  3C64 A;  1YW0 A;  4WBN E;  2N1G A;  2ODV A;  2XQA A;  2VQE T;  3OJA A;  4L5G A;  4HWD A;  3UU3 A;  4JI2 T;  4EYU A;  4H9O C;  1KK7 A;  1ZP0 A;  5A1L A;  4AKG A;  5L4H A;  4HE8 A;  4EGW A;  2IC6 A;  4HFB A;  4H63 V;  5AQL B;  3BQI A;  2YU2 A;  4EZ4 A;  2WSS V;  1UUS A;  4KHP T;  3NBX X;  2XAQ B;  4HWC A;  1HR0 T;  3PUX F;  4U3C A;  4YFS A;  2KIN B;  4TNV A;  1AJ3 A;  4YSZ A;  4Z91 A;  2LOS A;  4BJM A;  5AQT B;  1HS7 A;  1KEY A;  2WZH A;  2H88 A;  2WDR A;  3MAC A;  4X5T A;  2FBW A;  1YKE B;  4P09 A;  2JMK A;  4IHJ E;  3E0Z A;  1BR1 A;  3P4Q A;  2KWH A;  2NP9 A;  3MK7 C;  5AQO B;  1D0X A;  2HN1 A;  1FEW A;  3VKG A;  3NVO A;  1KFY A;  1IAP A;  2J47 A;  3CX7 B;  3PUR A;  5AQG B;  2FJE A;  2VQF T;  5LGU B;  3N9N A;  4ZI3 C;  5HWX A;  2YK0 A;  3N2G E;  5LJN A;  5AQF B;  2JQ9 A;  2F4V T;  3ANW A;  4COF A;  2CA5 A;  3KFW X;  2M6B A;  3PUZ F;  2LRK A;  3LBX A;  2I6H A;  2L3L A;  4DV5 T;  3AE1 A;  1I94 T;  3SWH A;  5LBM A;  4B3R T;  4LMK A;  5L3D B;  4ZI3 D;  5JRC A;  4JYA T;  2WS3 A;  4I50 E;  1FMV A;  2A72 A;  2SPC A;  1XNQ T;  5DQV A;  4ZZB A;  4IE4 A;  5FVL A;  5JDM A;  4A97 A;  1BR2 A;  4HFE A;  3F57 A;  2LM2 A;  3RRW A;  4I0U A;  4XZC A;  1W0B A;  3HR0 A;  1NEK A;  2LT3 A;  5HCJ A;  5KDM C;  1LKX A;  2K3W A;  4CN6 A;  3K3Q C;  5JDG A;  3K3O A;  4FI5 A;  2FJD A;  3LSV A;  3JCF A;  2XM2 A;  2VWA A;  4TZ4 C;  5AQM B;  4DR1 T;  3ZMZ B;  2YIN A;  5LA6 E;  1S35 A;  1IBL T;  2BG9 E;  2ZM8 A;  5LHG B;  2LKH A;  3OTO T;  5L2L A;  3PV0 F;  2HPJ A;  4ZI7 E;  3EAB A;  3UUB A;  2LJL A;  4IIJ E;  5FY0 A;  1UGO A;  1VCS A;  4YTN A;  3SFD A;  1MMD A;  4UVA B;  5FP3 A;  3RQW A;  4X65 T;  4WNK A;  3ZMT B;  2XM1 A;  2V7M A;  1HG5 A;  3UU8 A;  4CXX A;  2XZE A;  3IA3 A;  2WU5 A;  2G0U A;  3EVY A;  3UFE A;  3P4P A;  2CLY B;  2KXP B;  2UUB T;  2X0Y A;  4EB6 E;  3Q5E A;  4IDP A;  4WBO A;  2DWG A;  2WDQ A;  1OXZ A;  4YJ3 E;  4IDZ A;  3AAI A;  4JI0 T;  2CM0 A;  1VRB A;  2EHO C;  2V6Y B;  3LG7 A;  4YSY A;  4UF0 B;  1JNZ A;  4DV3 T;  3ETU A;  2CE7 A;  1W09 A;  1YQ3 A;  4ZS3 A;  3A7M A;  2C5I T;  2V6X A;  4IST A;  2XQ4 A;  2VK9 A;  2CXD A;  2WMN A;  4UEL A;  5JDF A;  5ABG A;  2ZMA A;  3TLW A;  2BS3 A;  1U4Q A;  2PG8 A;  5BR8 T;  2VKO A;  3F2E A;  1HNZ T;  2V1D B;  4PNI A;  4UEM A;  2OLT A;  1HX1 B;  5L47 A;  3W15 B;  2L8K A;  4X1K E;  4A56 A;  3WI3 A;  2NR4 A;  2EHO D;  1V9D A;  4KI0 F;  4LF5 T;  2PTF A;  2MTQ A;  3TLS A;  2ZLY A;  1SUM B;  4DV4 T;  3OKQ A;  4DBR A;  2H7V C;  1T8B A;  3P50 A;  1MIY A;  1E7P A;  4BAY B;  3CML A;  1T72 A;  3Q5D A;  3O1J A;  3RPU A;  3TKL B;  4O2A E;  4HFI A;  4C91 A;  4IE5 A;  3AED A;  4X62 T;  3CKD A;  3C4W A;  1ZOY A;  2LSK A;  2BBH A;  3RH3 A;  3EDU A;  3HL6 A;  3E22 E;  4GOU A;  2X68 A;  2XAJ B;  5J2U E;  3TLT A;  2LE8 A;  1MNE A;  3ZCI A;  4U2Y A;  5FXZ A;  5H6Q B;  2WY2 A;  5AQV B;  4GK0 E;  4NIQ A;  5LP6 E;  3B57 A;  2LSI A;  2H89 A;  1CHU A;  2R6G F;  3UTK A;  2X9H A;  4MLK A;  5FYM A;  4IE6 A;  3AEA A;  3ZMU B;  2EHO B;  2BKO A;  4IE0 A;  3QK6 A;  3N5L A;  2BKP A;  4N78 D;  5L3F B;  5AQQ B;  5J2T E;  2L9Q A;  5AFU L;  3ZYM A;  3HKD E;  4NUV A;  2DWK A;  2UXC T;  4CXY A;  3P4R A;  2HN2 A;  4GKK T;  2CBJ A;  4KP3 C;  3RIF A;  5M4Y A;  2XQ3 A;  3VHL A;  2UUC T;  2ACZ A;  2V8S V;  2GK9 A;  4DBQ A;  3CQG B;  2IDO B;  2Y8D A;  4ANJ A;  4HFD A;  3DP7 A;  4IRE A;  2VKH A;  3WAK A;  4GYR A;  4X20 E;  2W62 A;  2PBI A;  4IDO A;  5CA0 E;  5AQI B;  2MBG A;  5GON E;  2M67 A;  3PUV F;  4MAL A;  2FJA A;  3N9M A;  2MPK A;  1JNR A;  5FY1 A;  4G2A A;  5C2T A;  3I9Y A;  2JPF A;  4DV0 T;  2E9X A;  3SFE A;  2BG9 A;  1HFA A;  4UVC B;  3ZYK A;  5HXE A;  4EYY R;  2K9A A;  3N9Q A;  1QSD A;  2I59 A;  4JI1 T;  1HG2 A;  1S94 A;  3JAE A;  3GN5 B;  2J4G A;  5KMG P;  2IUB A;  4JBW F;  2CWO A;  3ZT7 A;  2JRK A;  5DQW A;  3B13 A;  5J1G A;  4H63 H;  2RP4 A;  3K8P C;  5JRE A;  3RGL A;  1KNP A;  3QB5 K;  4BA9 A;  2K24 A;  2W4X A;  3RI5 A;  3SOL A;  2AE9 A;  3ZSS A;  3MKD A;  2PFV A;  5JR9 A;  3N2K E;  2XAS B;  2VL8 A;  4ILA A;  4QH1 A;  2X0H A;  5EK2 A;  2YDR A;  5EK3 A;  1N33 T;  1ZKE A;  3O9X A;  5EK4 A;  3FHN A;  1FIO A;  3H3M A;  1YXR A;  1ZV4 X;  4X64 T;  3RYI E;  1OED C;  3RQU A;  2UXB T;  4PJJ A;  2W0G A;  4P0A A;  4PK4 A;  1LVK A;  4IGU A;  5LGT B;  3I0Q A;  3RKO A;  4NPP A;  3ZJ2 A;  1XMO T;  2W66 A;  1KF6 A;  1J5W A;  4JI8 T;  4XBF B;  2FUP A;  3EUH A;  3FXD B;  2X51 A;  1XZY A;  2YKS A;  4LF8 T;  5CFB A;  4ZXL A;  3OYZ A;  3CQX C;  3Q5W A;  2C0S A;  1E2A A;  3CX8 B;  2E5V A;  3MXZ A;  1YD8 G;  2Q9Q B;  2LSG A;  2YDQ A;  4E7Z A;  3LFM A;  1D0Z A;  2WZI A;  2E9X C;  3AA7 B;  2BG9 C;  3CQC B;  3JC6 C;  3MZK B;  5IWA T;  2LKG A;  5CB4 E;  4Z90 A;  4AIS A;  5ABF A;  2NW7 A;  3EDV A;  3T1H T;  3H37 A;  3ZJ1 A;  3C50 A;  4XAX B;  2RA1 A;  4UV9 B;  2NTY A;  2UXN B;  2XPK A;  3P7I A;  3ZT5 A;  3N9O A;  4F8H A;  3RYF E;  2XUE A;  3KVA A;  2E9X D;  2XAG B;  1OED B;  4KBM B;  5CJ5 A;  3JC6 D;  2KMF A;  5AQS B;  4QHO A;  5JR9 C;  3SS1 A;  4GK5 E;  2WBL A;  2E8I A;  4AQY T;  2XQ5 A;  5JDL A;  4JEU B;  4YY3 T;  2XQ7 A;  3AXJ A;  1Y64 B;  4PK6 A;  4DMV A;  2YN6 A;  3ZC1 A;  5F3J A;  5FXW A;  3Q5X A;  2CWY A;  1IZN B;  4V1A v;  4I43 B;  5J0Z A;  1VOM A;  3FZM B;  1HTJ F;  4DVD A;  1HNX T;  2BVM A;  4WZX A;  5LOV E;  4CI1 B;  2X9W A;  5C8Y E;  4YTP A;  3HKC E;  4JI3 T;  3GWH A;  3U3I A;  4U7Y A;  5LJM A;  2ZM6 T;  1J1J A;  2E2A A;  5FVK A;  3TLV A;  4TV8 E;  3L8R A;  3FB2 A;  3GA8 A;  5L4E A;  3ZMS B;  2BS2 A;  2I0M A;  5HEJ A;  2B1E A;  3PE0 A;  3NWI A;  2NW9 A;  5AQP B;  4EZH A;  3F31 A;  2W63 A;  4U33 A;  4L9I A;  2D0U A;  4B6X A;  2V5D A;  4QKN A;  4CN1 A;  1WYB A;  3A8Y C;  3NZP A;  3CVR A;  5HEH A;  5BMV E;  3RC8 A;  2XQ9 A;  3KV6 A;  4QXB B;  3RRC A;  3ZN0 B;  4YSX A;  3KBT A;  2D0T A;  3I1A A;  4EOZ B;  1E1H B;  3ZST A;  4ZI2 C;  2QVA A;  3AEE A;  5E0O A;  5DAB A;  3QNU A;  4O8S A;  3VR9 A;  2J1D G;  3VR8 A;  2JIW A;  2JQK A;  2CRB A;  4OYJ A;  4U72 A;  3T8O A;  3M3Z B;  4HFC A;  5HAX A;  1WR0 A;  2XJ7 A;  3AAA B;  4HGA A;  2DCF A;  4H9N C;  3AEC A;  1D1A A;  5L3G B;  4E7S A;  3TLU A;  1Z0P A;  4H9P C;  2YEV C;  5HEG A;  4K0K T;  2BKN A;  5HXH A;  1MIV A;  1MMA A;  4ZI2 D;  5LB7 B;  3QB5 A;  2DL1 A;  3I0O A;  1Y01 A;  2D5U A;  2VKD A;  2H7O A;  4ERR A;  3GMI A;  5CA1 E;  4X1I E;  2BZB A;  3ABV A;  2IML A;  2WMO A;  1BR0 A;  4HN9 A;  2XSB A;  2BDE A;  2YOE A;  3ONL C;  3DTO A;  5ABH A;  1UCU A;  3ZMV B;  4UIG A;  2OV9 A;  2PJQ A;  5F5W A;  2BS4 A;  5L3B B;  3Q9D A;  3RIU A;  5IYZ E;  2W2U A;  1OWA A;  2W00 A;  1US7 B;  3NRX A;  3PU3 A;  4PAG A;  3M65 A;  5ABF B;  4O4I E;  2X66 A;  3KV5 A;  3PUQ A;  2C5J A;  1UUR A;  4OFZ A;  1X79 A;  4H9Q C;  5LHI B;  3C4X A;  3PDY A;  3PJA J;  3HKE E;  3O1H A;  3ZN1 B;  5FL0 A;  3G06 A;  3CK6 A;  3ANW B;  4QX8 B;  4AKH A;  1W9R A;  3AE8 A;  3J9X 1;  3FZF B;  3CPZ A;  5IUX A;  2KLQ A;  3LBX B;  3NRY A;  2OA5 A;  5CGM A;  1UK5 A;  4HEA A;  5LMU T;  3FBZ A;  4P1N A;  1WR6 A;  2V7J A;  3ZC0 A;  4JEH B;  1WLX A;  3C98 B;  4QXH B;  3FZL B;  4TN7 B;  3AA1 B;  4KX6 A;  5AQN B;  4YT0 A;  4ILU A;  5JTG A;  5JRC B;  2KSR A;  3UU6 A;  2CCQ A;  5HXC A;  5LNK A;  3V5U A;  3AE6 A;  3OVU A;  2H3R A;  1SA0 E;  2VB6 A;  5LGN B;  2K5B B;  4GIW A;  4ADZ A;  2A3D A;  3ESL A;  3JAD A;  3X1D A;  2KZ7 B;  4DR2 T;  4OYK A;  4PJM A;  3ONJ A;  4LFB T;  1MMN A; 
#chains in the Genus database with same CATH homology
 3C51 A;  4UXN B;  3LJC A;  4TV9 E;  1BR4 A;  3AVS A;  4XBF B;  1UX5 A;  3ZPO A;  2LT3 A;  3EUH A;  5KDM C;  1LKX A;  3FXD B;  3AVR A;  2X51 A;  3K3Q C;  5JDG A;  4CI3 B;  1NAF A;  5KX5 E;  1H7C A;  3K3O A;  4FI5 A;  4O4L E;  5JDH A;  2VWA A;  4TZ4 C;  4H9S E;  3OYZ A;  3ZMZ B;  3CQX C;  4L0R A;  3ZCJ A;  2QA7 A;  2YIN A;  5JVD E;  3Q5W A;  2C0S A;  1FMW A;  3CX8 B;  3E08 A;  3MXZ A;  5LA6 E;  1YD8 G;  2Q9Q B;  2LSG A;  1S35 A;  4E7Z A;  5FY7 A;  2ZM8 A;  3LFM A;  4O4H E;  5JDQ A;  5LHG B;  1D0Z A;  4QX7 B;  5L2L A;  2HPJ A;  4HKA A;  2E9X C;  3K3N A;  4ZI7 E;  3AA7 B;  3FBL A;  4MHC A;  2X9X A;  3CQC B;  2LJL A;  2V7K A;  3ETV A;  4IIJ E;  1HF8 A;  2XAF B;  5FY0 A;  2VAS A;  3JC6 C;  2D2S A;  3MZK B;  4PK5 A;  2W61 A;  5CB4 E;  4AQG A;  4PJN A;  2Q9Q A;  3PU8 A;  2NW7 A;  5ADX L;  3EDV A;  1MMD A;  3J7Y q;  2JJ9 A;  3VU7 H;  2CXF A;  4UVA B;  5FP3 A;  4WNK A;  3U78 A;  3H37 A;  3ZJ1 A;  3ZMT B;  2V7M A;  1HG5 A;  4CZZ B;  1G73 A;  4CXX A;  4K0U A;  4O4J E;  1D0Y A;  1EZ3 A;  3C50 A;  4XAX B;  2G0U A;  3EVY A;  3UFE A;  2RA1 A;  5LXT E;  4TUY E;  4UV9 B;  3UUN A;  3ZEF B;  4ZHQ E;  5FXX A;  2CLY B;  2KXP B;  2NTY A;  3V5S A;  4ISS A;  4WW0 A;  2BVL A;  2LHN A;  2UXN B;  1IJ5 A;  3AA6 B;  3N9L A;  4EB6 E;  2IC9 A;  3P7I A;  4QWN B;  3N9O A;  4WBO A;  3RYF E;  3ZLI A;  2XUE A;  2DWG A;  3KVA A;  2E9X D;  2NW8 A;  2XAG B;  1MMG A;  1OXZ A;  2X0L B;  4KBM B;  4AQF C;  4YJ3 E;  3JC6 D;  4IDZ A;  2CXL A;  2KMF A;  3AAI A;  3NZQ A;  1CUN A;  4QHO A;  5JR9 C;  2CM0 A;  3SS1 A;  4GK5 E;  1VRB A;  2EHO C;  5LCY A;  3LG7 A;  4UF0 B;  2WBL A;  2E8I A;  4GYS A;  3ETU A;  1HCI A;  4F6R C;  5JDL A;  2DI4 A;  3L09 A;  2CE7 A;  3IF8 B;  1B7T A;  1WRD A;  2WWU A;  3BK9 A;  4ZS3 A;  5FMN A;  4JEU B;  3S4U A;  2C5I T;  4G63 A;  4IST A;  2VK9 A;  2JQQ A;  2CXD A;  2WMN A;  3A5X A;  4UEL A;  2YU1 A;  4YLH A;  1Y64 B;  5JDF A;  2XHE B;  4PK6 A;  4DMV A;  2NTX A;  2ZMA A;  3R84 B;  3C4Z A;  4UF0 A;  2VKJ A;  3IEE A;  1U4Q A;  2PG8 A;  3ZC1 A;  5F3J A;  5FXW A;  4HTE A;  1YKH B;  2VKO A;  3Q5X A;  1D1C A;  2CWY A;  1IZN B;  3MA9 A;  4V1A v;  4I43 B;  3F2E A;  4KMC A;  5JDN A;  4FJO A;  2V1D B;  4PNI A;  1VOM A;  3FXE B;  1HTJ F;  4DVD A;  5EZY E;  1D1B A;  4UEM A;  5LHH B;  3BQL A;  2BVM A;  3PUG A;  4I4T E;  4YJ2 E;  3KDS E;  5ETW A;  4P0B A;  3WAJ A;  5FNV E;  5LOV E;  3W15 B;  4CI1 B;  2L8K A;  2X9W A;  2XAH B;  4X1K E;  3UT5 E;  5C8Y E;  3HKC E;  3GWH A;  4HFV A;  4A56 A;  3WI3 A;  1LVF A;  2EHO D;  2IAK A;  3KBU A;  4JLE A;  3U3I A;  3H3A A;  5LJM A;  1V9D A;  3KV9 A;  2MTQ A;  4DMW A;  2ZLY A;  4CXW A;  5TAO A;  4BJN A;  4EAH A;  1SHZ C;  3HI2 A;  3OKQ A;  4TV8 E;  3PUA A;  3FB2 A;  3GA8 A;  3O1I A;  3ZMS B;  4DBR A;  2DLR A;  3QC9 A;  1WYC A;  2H7V C;  3HA4 A;  4O2B E;  2XQY A;  2QGS A;  4C90 A;  1HX8 A;  1MND A;  1MIW A;  5FXV A;  2B1E A;  3LK3 B;  5LBQ B;  3RYC E;  1NWM X;  1MIY A;  3PE0 A;  2CEA A;  4BAY B;  3D0T A;  2NW9 A;  3CML A;  2LSJ A;  3O1J A;  4KUM B;  4EZH A;  3RPU A;  3TKL B;  3F31 A;  2W63 A;  3QUJ A;  4U74 A;  4X1Y E;  4IE7 A;  4O2A E;  4C91 A;  4IE5 A;  3CKD A;  4JUY A;  3AB3 B;  4L9I A;  3C4W A;  2LSK A;  2D0U A;  4B6X A;  3RH3 A;  5L3C B;  3BQK A;  5LYJ E;  2V7L A;  3EDU A;  4DND A;  3HL6 A;  3E22 E;  5JH7 E;  4GOU A;  2X68 A;  2NOX A;  2XAJ B;  2ES0 A;  4PJL A;  3OYX A;  4QKN A;  3RC3 A;  5J2U E;  3ZCI A;  2CMR A;  1MNE A;  2LE8 A;  2NWB A;  5FXZ A;  3RX6 A;  5H6Q B;  1WYB A;  2A2F X;  3NZP A;  3CVR A;  4GK0 E;  5BMV E;  3RC8 A;  3SRZ A;  5LP6 E;  3B57 A;  2LSI A;  3UUM A;  4AI6 A;  3UTK A;  3KV6 A;  2X9H A;  2Q9Q C;  3KVB A;  4QXB B;  3P8C D;  2ACX A;  2IW5 B;  4MLK A;  3L3P A;  3RRC A;  5FYM A;  3ZN0 B;  4IE6 A;  3KBT A;  2D0T A;  3I1A A;  3ZMU B;  4EOZ B;  1E1H B;  2EHO B;  1T98 A;  1IJ6 A;  4YHJ A;  2K48 A;  1KNZ A;  3Q2M A;  4IE0 A;  3QK6 A;  3HKB E;  4J2C A;  4ZI2 C;  1UX4 A;  3VKH A;  3N5L A;  5E0O A;  5DAB A;  3DJB A;  3MJX A;  2HH7 A;  4EXT A;  4O8S A;  4AKR B;  4N78 D;  4Z8X A;  5L3E B;  2J1D G;  4MBQ A;  5L3F B;  5J2T E;  2L9Q A;  5AFU L;  3UUX B;  3ZYM A;  2EHO A;  3HKD E;  4NUV A;  4OK0 A;  4OYJ A;  4U72 A;  2DWK A;  3IHR A;  2LSY A;  2N9D A;  3T8O A;  5HAX A;  3PTR B;  2LM9 A;  3AAA B;  3LK4 2;  4AKL A;  2HPL A;  4HGA A;  4UVB B;  4ZOL E;  1QUU A;  2DCF A;  4ZS2 A;  4H9N C;  2X67 A;  4NUU A;  4CXY A;  3N9P A;  1G8X A;  1D1A A;  2CLY C;  2DNX A;  5H6R B;  5L3G B;  4E7S A;  2MOZ A;  1U5P A;  3UUL A;  1Z0P A;  4H9P C;  2Q9Q D;  2YEV C;  3O4X E;  3R6N A;  2Y48 B;  4I55 E;  5HXH A;  3C64 A;  1YW0 A;  4WBN E;  2N1G A;  1MIV A;  1MMA A;  2ODV A;  4KP3 C;  4ZI2 D;  5M4Y A;  3OJA A;  3VHL A;  4L5G A;  1ZEE A;  3I0O A;  4H9O C;  4EYU A;  1KK7 A;  2GK9 A;  5A1L A;  4DBQ A;  4AKG A;  2D5U A;  2V7I A;  2VKD A;  2Y8D A;  3CQG B;  2H7O A;  3LK2 B;  3DP7 A;  3KIN B;  4ANJ A;  4ERR A;  4HE8 A;  3GMI A;  5CA1 E;  2ZM0 A;  4X1I E;  2BZB A;  5HYA A;  2IC6 A;  2VKH A;  4M1P A;  3WAK A;  2WMO A;  4GYR A;  4X20 E;  3IBP A;  4H63 V;  2W62 A;  2E9X B;  2PBI A;  2Y6X A;  3BQI A;  2YU2 A;  2KT9 A;  4EZ4 A;  2WSS V;  1BR0 A;  4HN9 A;  5CA0 E;  3NBX X;  2XAQ B;  2MBG A;  1O3X A;  5GON E;  2M67 A;  2BDE A;  4MAL A;  4YFS A;  2KIN B;  3N9M A;  1AJ3 A;  3DTO A;  2UXX B;  1UCU A;  2LOS A;  4G2A A;  5FY1 A;  3ZMV B;  4BJM A;  4UIG A;  2LOP A;  2PJQ A;  3I9Y A;  2JPF A;  1HS7 A;  4OHF A;  2E9X A;  3Q9D A;  5L3B B;  5IYZ E;  2LEH A;  1OWA A;  2W00 A;  3N2O A;  4H9R C;  1US7 B;  2N2N A;  2KWI B;  1HFA A;  3NRX A;  3PU3 A;  4UVC B;  3ZYK A;  4PAG A;  3MAC A;  5HXE A;  3ZYL A;  4EYY R;  2K9A A;  3N9Q A;  1LRZ A;  1YKE B;  4P09 A;  1QSD A;  2JMK A;  3M65 A;  2KND A;  2I59 A;  4ASK A;  4O4I E;  2X66 A;  4IHJ E;  1HG2 A;  1S94 A;  3E0Z A;  1BR1 A;  3GN5 B;  3AA0 B;  3KV5 A;  3PUQ A;  2KWH A;  2C5J A;  2NP9 A;  4OFZ A;  5KMG P;  1X79 A;  4H9Q C;  5LHI B;  3C4X A;  3CWZ B;  3PDY A;  3MK7 C;  3HKE E;  4PFP A;  2CWO A;  4AKI A;  2C5K T;  2DHR A;  3O1H A;  1D0X A;  3ZN1 B;  2LHR A;  2JRK A;  4CQI A;  5JQG E;  5DQW A;  1FEW A;  3B13 A;  5J1G A;  3VKG A;  4PW8 A;  2P9B A;  3ANW B;  3GN5 A;  2RP4 A;  3K8P C;  4H63 H;  4QX8 B;  3RYH E;  4CI2 B;  1IAP A;  3CX7 B;  5JRE A;  3PUR A;  4AKH A;  3J9X 1;  5JR9 B;  2XTL A;  5LGU B;  3CPZ A;  3KV4 A;  3N9N A;  2KLQ A;  4ZI3 C;  2JMH A;  3LBX B;  3NRY A;  5HWX A;  4BA9 A;  2OA5 A;  2K24 A;  4EIW A;  2YK0 A;  2WM9 A;  4HEA A;  3N2G E;  2V26 A;  4QXC B;  3SOL A;  3FBZ A;  4AQF A;  5LJN A;  1WR6 A;  2V7J A;  3ANW A;  3ZC0 A;  2CA5 A;  4JEH B;  4TX5 A;  3MKD A;  2PFV A;  3KFW X;  5JR9 A;  1WLX A;  3C98 B;  3N2K E;  4QXH B;  2XAS B;  3LBX A;  2WAU A;  4TN7 B;  3AA1 B;  2VL8 A;  2L3L A;  3CX6 B;  5LG4 A;  2ODU A;  5EK2 A;  4ILU A;  5HWY A;  5JRC B;  2MYS A;  5EK3 A;  2Z6E A;  1ZKE A;  3O9X A;  3SWH A;  5EK4 A;  1ZHC A;  2CCQ A;  5HXC A;  5LBM A;  3V5U A;  5LNK A;  4PFO A;  2ZM2 A;  3FHN A;  1FIO A;  4AXP A;  3I9W A;  2X9Y A;  5IHY A;  5L3D B;  2H3R A;  1SA0 E;  4ZI3 D;  1ZV4 X;  5DJQ C;  5JRC A;  3RYI E;  3AAE B;  2VB6 A;  4I50 E;  5HXR A;  5LGN B;  1FMV A;  2A72 A;  2SPC A;  4PJJ A;  2K5B B;  4GIW A;  2W0G A;  4ADZ A;  4P0A A;  5DQV A;  2A3D A;  3ESL A;  5F8P A;  3OBV E;  3ONX A;  4PK4 A;  4UV8 B;  1LVK A;  4IE4 A;  4DO0 A;  5JDM A;  4IGU A;  1BR2 A;  5LGT B;  2KZ7 B;  3I0Q A;  4OYK A;  4PJM A;  3F57 A;  4MFR A;  3RRW A;  3RKO A;  5HXS A;  3ZJ2 A;  4XZC A;  1MMN A;  3HR0 A;  3PUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...