3KINB

Kinesin (dimeric) from rattus norvegicus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
NKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVIQHLEVELNRWRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of dimeric kinesin and implications for microtubule-dependent motility.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
molecule keywords KINESIN HEAVY CHAIN
total genus 37
structure length 117
sequence length 117
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1980 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kinB00
3KINB
chains in the Genus database with same CATH superfamily
4DUZT 3TLVA 3KVBA 1SA0E 4B6XA 3RRWA 2KWIB 2RA1A 1UGOA 2A9UA 1N33T 2N1GA 3O1HA 5HXHA 2EHOB 2YN6A 4OYKA 4LFAT 3PUWF 2JQHA 1HNZT 4WW0A 4JI6T 4AKIA 4HGAA 4B3MT 3H3AA 1N32T 3NWIA 1SUMB 4UELA 3SFDA 5LG3A 3NVOA 2IC6A 2LE8A 3ETUA 2X51A 5L3GB 3ZC0A 2PG8A 4CZZB 4DBQA 2XJ7A 1IJ6A 1KK7A 1OEDA 2D9DA 1HG2A 2H3RA 2K48A 2YU1A 1KNRA 3IEEA 4HFIA 4LMKA 2Q9QC 4QXHB 2MBGA 5C8YE 5LHIB 2HN1A 2XM2A 3JAFA 4DV4T 2CCQA 4DNDA 1WYCA 4I50E 3OPCA 4KMCA 3K8PC 5ABHA 3UQ4A 3HKDE 5L2LA 2IC9A 1YKEB 3QB5K 4H9SE 5FY7A 3AEDA 2X9HA 4O4JE 4O2BE 4Z90A 4CXWA 4DV7T 1WR6A 2D5UA 4PFPA 4HN9A 2BS2A 3B13A 5L3DB 4DV3T 3AEGA 2NOXA 4HWFA 4CQIA 3AA1B 2IHR1 2XQ6A 4QH1A 5JR9B 2LM2A 3PUQA 4YJ2E 5BMVE 4BA9A 4CXXA 4HTEA 2LLYA 3RKGA 2LSKA 3NKZA 1IJ5A 4IHJE 2XQ4A 3C4WA 4U3CA 2FUPA 2V26A 5IHYA 4EOZB 3OBVE 2XHEB 4GYRA 2D0TA 1HF8A 5JQGE 4DV2T 2Y6XA 4X65T 3RQUA 3AE8A 3QNUA 2KXPB 5LGTB 3WAKA 1HNXT 5JR9C 1AJ3A 3AAAB 3AEBA 3LK3B 4YT0A 1IAPA 2LM9A 5J2TE 3VRBA 4ZS3A 1OXZA 5J2UE 4H9NC 4EGWA 5JRCA 4JEUB 3DTOA 4H9OC 3GMIA 3C50A 5FVLA 1J5WA 4U72A 5L3CB 5LMNT 3MK7C 2X9YA 2WAUA 3R6NA 2KZ7B 3ZMUB 5JDGA 1BR4A 4EIWA 2E9XC 1M62A 2GK9A 3ETVA 1LVKA 3LK42 3N2KE 4PJJA 4KP3C 2M67A 3N9PA 5EZYE 1CUNA 3F2EA 3PTRB 2YOEA 3V5UA 3E0ZA 2XQ7A 2PJQA 2K24A 4NPPA 4EZHA 4AXPA 3I0OA 4TN7B 5FP3A 5AQLB 3I1AA 3UUNA 5LHHB 2CA5A 1DU2A 4JBWF 3HKEE 2VASA 2KINB 1T8BA 3A5XA 4I4TE 4IE6A 4YTMA 2JJ9A 3UFGA 1N36T 5JDFA 3U3IA 3U78A 4LFBT 3EI0A 2CXFA 3AVSA 2KLQA 3UT5E 3GA8A 3QK6A 5H6QB 3F57A 4PJMA 3TLWA 3VR9A 2D2SA 5EK3A 3ZMZB 2WBLA 3PUAA 4EYUA 2X0YA 2BVMA 3KDSE 5F8PA 2CWYA 4JI0T 4DR6T 1EZ3A 3AA6B 1QUUA 2V5CA 2MOZA 2BDEA 2WS3A 2WWVA 2VKDA 3RYCE 4IDZA 3VHLA 5JREA 3P50A 5FXZA 3ZCIA 3ZN0B 5LG4A 1D0YA 2C0SA 4IE0A 3KV6A 2NTYA 4KX6A 1OEDC 3JCFA 2LJLA 3N9NA 4GIWA 4QH4A 4U2YA 4X1YE 5FYMA 2YINA 3R84B 3T1HT 4L9IA 3ZYLA 5C2TA 4IIJE 2UXNB 2EHOA 4LF9T 3C64A 2CBJA 3ZYMA 5AQFB 5ABGA 3IHRA 3OYXA 1MMGA 4V1Av 5CJ5A 4FJOA 2W0GA 1HNWT 2BBHA 3C4ZA 2LOSA 2JMHA 2ZMAA 4IREA 1XDPA 4JUYA 5AQMB 5ABEA 2VB6A 4JI2T 1ZHCA 1FEWA 2N9DA 2LHRA 4ZOLE 3UU6A 2PFVA 2W2UA 2CE7A 4OK0A 2UU9T 3O1IA 1S35A 3FB2A 4DV1T 1WYBA 1ZP0A 4BJNA 2LRLA 2Q9QA 4DR5T 4ZZCA 4F6RC 4U7IA 4LF8T 4DMWA 3EDUA 4YTNA 2MYSA 3FHNA 5HEUA 3TLUA 2J47A 1WR0A 3ZT5A 1SHZC 1ZEEA 2KMFA 2XAFB 3CK6A 3AAIA 2V8SV 3CQGB 3ZSTA 4YHHT 4JI8T 4DR4T 1HS7A 3SRZA 4U2ZA 5ABFA 5FY1A 1IZNB 1N34T 3DJBA 4TWDA 2VL8A 5HXEA 2DI4A 4IDQA 2VKOA 2LSYA 2V7MA 2I0MA 3FXDB 3LJCA 1G8XA 4UVCB 5HCMA 3TKLB 4EYYR 4I0UA 3HR0A 3AXJA 1MMDA 1OEDE 2W4XA 4TV9E 4X1IE 4Z91A 2XM1A 4IDOA 5JVDE 4DIDB 1XNRT 2DLRA 4O4IE 5AQHB 2H7VC 3FBLA 3P4WA 3RGLA 4CN4A 3L09A 5FKYA 1MIYA 2VURA 5HXRA 3ZJ2A 4C91A 3FBZA 3OTOT 3CX7B 4UR9A 4Z8XA 2JPFA 4BJMA 3ZMVB 1VCSA 2LRKA 4ILUA 4QHOA 3SFEA 5FMNA 4YHJA 5BR8T 2WDRA 4ZI7E 1J5ET 2LSJA 4U33A 5CB4E 1IBKT 3ZEFB 4H63H 4QH5A 5A1LA 3UU5A 3RIFA 4I55E 3OKQA 4IDNA 2IIUA 4JI1T 4QX7B 2XTLA 2JQ9A 2V7LA 3ONXA 4O2AE 4TV8E 5FVKA 2K9AA 5TAOA 2JRKA 3RYHE 2R6GF 3UUBA 3ZCJA 2IW5B 3AECA 4TUYE 3UUMA 2UUAT 4GKKT 3WI3A 3E22E 3LBXB 2WZIA 3MJXA 1GQEA 2VQFT 5L4EA 2HN2A 3T1YT 2UXCT 4ASKA 2QA7A 3SOLA 4PW8A 5AQTB 2LKHA 3PU8A 2W62A 5L4HA 4U74A 2CHOA 2YU2A 3RX6A 4X64T 2P9BA 3UU8A 4ZI2D 3AE1A 4ISSA 5AQQB 5HYAA 3K3NA 2BG9C 4L5GA 1D1BA 4PK4A 4TWHA 2EHOD 3JC6D 5L3BB 3I9YA 1J1JA 3EABA 1JNZA 5AQGB 2Y48B 4C90A 1OEDB 3ABVA 4EEBA 1ZV4X 4B3ST 4OYJA 2E9XB 2WSSV 4DR7T 4IGUA 2UXDT 3ONLC 2VWAA 4PK6A 5F5WA 5AFUL 4GKJT 3J7Yq 1XDOA 2CMRA 3FZFB 3AA0B 4O8SA 4LMLA 4AQFA 2CXDA 2CXLA 1VRBA 2VKHA 5J1GA 2E2AA 3W15B 4EV6A 4ZHQE 1G73A 2HHHT 2IAKA 4B3TT 2NW7A 3AXJB 3FZMB 3ZPOA 2MTQA 2SPCA 4U31A 4ADZA 4ZI3C 4H9RC 1HG5A 2XASB 2Y8DA 4AISA 2B1EA 4EEDA 4YSZA 2WP9A 2XAHB 5DJQC 2XAGB 4JV5T 4UV9B 3PURA 5CA0E 4K0KT 1HTJF 1SE7A 1MNDA 2BZBA 3HKCE 3KFWX 2AXDS 4L0RA 3AE4A 4N78D 2E9XD 5LXTE 3S4UA 2YEVC 3KBTA 2W66A 1I6ZA 2XSBA 4A56A 1US7B 3SS1A 2JMKA 1NAFA 4A5XA 4A97A 5LHGB 4KHPT 4P0AA 3EDVA 3QC9A 4CXYA 1XMOT 2ZM0A 1M7KA 2CLYC 5FL0A 4HWHA 3RC8A 3P8CD 2WQYA 4HFDA 2VVNA 5LB7B 3VKGA 2WY2A 3GN5A 3RRCA 5HWXA 4YTPA 3Q9DA 2E5LT 1UURA 3BQLA 3H37A 3MKDA 3N2GE 1Y01A 2CM0A 4PNIA 2QVAA 3EAMA 4UV8B 5FXXA 1U4QA 1Z8UA 5FXWA 5HCJA 1HCIA 5LYJE 2ZM6T 2XQ3A 3NRYA 4NUVA 2ZM2A 3ZSSA 5LGNB 4DUYT 1QSDA 5JRCB 1BR1A 3KV4A 2WDQA 2JQKA 3KINB 3B57A 4WNKA 1W09A 4EZ4A 5ABFB 1U5PA 2BS3A 5KX5E 2XQAA 4PK5A 4TX5A 5F3JA 2ODVA 2CLYB 1I94T 5HXSA 4LF6T 1D1CA 3ZYKA 4AKLA 4YSYA 2KSRA 4EAHA 5LJNA 2J62A 5L3EB 4JI5T 3PUSA 4HKAA 4ZS2A 2E9XA 4ANJA 1O3XA 2WMOA 3LK2B 2H89A 1HR0T 1Z0PA 2LSGA 4H9PC 4X1KE 4CN1A 2Q9QB 3D0TA 5CA1E 1YD8G 4KUMB 1BR0A 4P0BA 3OYZA 5AQJB 2N2NA 2CBIA 1XWMA 3RYFE 3O9XA 3PUZF 2NWBA 5LMUT 3P4SA 4O4LE 3UUXB 3HI2A 1FMVA 3T8OA 1QLBA 1WFDA 2C5IT 2X68A 2XUEA 2K3WA 1YQ4A 3ANWA 4OHFA 5HEHA 3RKOA 2BG9E 3SWHA 5JTGA 5JDHA 3K3OA 3ZMSB 5JDQA 3N9QA 2CHNA 4MHCA 3HL6A 3ZC1A 3KBUA 4YLHA 3RLFF 4YSXA 3RQWA 2V6XA 5JDNA 4GYSA 1X79A 1MNEA 3ONJA 4P09A 2MPKA 3NRXA 2XPKA 1Y64B 2NR4A 2BS4A 2JQQA 4HFHA 4E7ZA 4ZEYA 2A3DA 2H88A 4LF4T 4F8HA 2K5BB 1MIWA 2V1DB 3HKBE 3ZT7A 1WCRA 5LBMA 5H6RB 3AE6A 3M3ZB 4I43B 4HEAA 4IL9A 4XBFB 2BG9A 3UQ7A 3GN5B 2DCFA 2BKOA 3AE3A 1KNPA 3NZPA 3P4QA 4TNVA 5AQRB 2XY8B 4CI2B 2DNXA 1MIVA 2IUBA 4FI5A 5M4YA 3O1JA 1UK5A 3UFEA 3PUVF 3NBXX 4NIQA 2X66A 5JDLA 1IBLT 4TWFA 1VOMA 1LKXA 3JAEA 5HXCA 5AQIB 4QWNB 2PBIA 4IE4A 4AQFC 4DO0A 2C5JA 4PFOA 4BAYB 2Q9QD 4AQYT 4AKGA 2X0HA 3I9WA 3CWZB 4CN6A 5LJMA 5C3JA 4M1PA 1XZYA 1S94A 2OV9A 3RIUC 2V5DA 5CGMA 2JIWA 3RC3A 3AAEB 5FY0A 2UXBT 3X1DA 3PV0F 2RPAA 2ES0A 4HFEA 5L3FB 2J1DG 2LT3A 4WBNE 3CX6B 1NENA 2X9XA 2XQYA 2UUBT 4G2AA 1WLXA 2AE9A 1ZKEA 4MBQA 2WB5A 2WU5A 3GWHA 5HEJA 3QOFA 1UX5A 3TLTA 3WAJA 3RPUA 4JEHB 5LNKA 4ZI2C 1T98A 4YJ3E 3V5SA 3FZKB 1L0VA 3MXZA 5LCYA 4CI3B 4MALA 2YKSA 4EXTA 5LA6E 4UF0B 2XSAA 1B7TA 2V6YA 3PJAJ 2LOPA 3C98B 4J2CA 4NXNT 2KWHA 3CVRA 2KT9A 2VQET 4KHZF 2NP9A 3ANWB 4ISTA 5JR9A 3VR8A 2LKGA 4DBRA 2RP4A 3CIRA 4AIUA 4Q25A 3BQIA 1BR2A 3LDQB 4HFVA 3CMLA 2F4VT 2YDSA 1E2AA 1LVFA 4X66T 3HA4A 1D0ZA 3EVYA 3OVUA 5AQSB 4JI7T 4AI6A 2B76A 2HH7A 1KF6A 2D0UA 3G06A 3LFMA 3PU3A 3UU4A 1T72A 5KXJA 4HFBA 5J0ZA 2W67A 4X20E 1XNQT 2ACZA 3H3MA 3AA7B 2QGSA 4HWDA 4JLEA 2LSIA 5AQKB 4DV0T 2PTFA 1NWMX 3LBXA 2VVSA 4LMJA 4NUUA 5JDMA 3PDYA 5HEGA 4DR3T 3ZKRA 2CRBA 2ACXA 4ZZBA 5HEOA 1IBMT 4WZXA 4DVDA 3UU3A 2FJBA 3A7MA 4IE7A 2W61A 2M6BA 3MZKB 3N9MA 4YFSA 2FJDA 3E08A 2NW9A 4PAGA 4WYVA 2WWUA 5E0OA 3ZN1B 2WMNA 3L8RA 2L8KA 4PJLA 2ZM8A 3PUXF 5AQNB 4IE5A 5DABA 3VRAA 4E7SA 1YXRA 2I6HA 4IT4A 3C4XA 3N2OA 2DWKA 4DMVA 3BK9A 3AEFA 2UUCT 4AKRB 5EK2A 3AE5A 3KV5A 4O4HE 5DQWA 1MMAA 2M6IA 1JNRA 4GOUA 4P1NA 4U7YA 2H7OA 4MFRA 4A98A 2HPLA 1FMWA 1YW0A 2HPJA 2YK0A 3CPZA 3OJAA 4UVAB 1HX8A 3CQXC 4ZI3D 2VK9A 1VCTA 2IMLA 2QRXA 4MLKA 5IYZE 3ESLA 3FZLB 4IL4A 5JH7E 3RH3A 1YQ3A 2V7JA 5DQVA 3ZLIA 2Z6EA 4UVBB 2I59A 2V7IA 5FL1A 5LP6E 1V9DA 5ETWA 4KI0F 2EHOC 3JC6C 1X9BA 5FXVA 4AQGA 2XAJB 2UXXB 4OFZA 1FIOA 3FXEB 4K0UA 1H7CA 2W00A 2C5KT 1D1AA 2WU2A 4OX9T 2VL0A 4AKHA 4G63A 3IBPA 4QX8B 4DR1T 3AB3B 2WCAA 3AEAA 4YY3T 1D0XA 2BKPA 3CQCB 3EHZA 3M65A 3N9OA 4TZ4C 3A8YC 3CKDA 3EUHA 4KBMB 5AQPB 3RI5A 3RYIE 4COFA 4NXMT 5EK4A 4ZXLA 3ZT6A 4GK5E 4XZCA 2CWOA 3AEEA 5IUXA 2NW8A 3J9X1 1E1HB 1UUSA 3JADA 3IF8B 4UIGA 3VKHA 1KNZA 2FJAA 5GONE 2X9WA 3F31A 2XQ9A 4LF5T 2XZEA 3K3QC 4ERRA 5AQUB 1R8IA 3L3PA 3L39A 3VU7H 2LEHA 2E8IA 1W0AA 2XQ8A 3LSVA 3QB5A 5HAXA 1FJGT 2L3LA 2X0LB 4DV6T 4IDPA 2A2FX 2BG9B 3N9LA 3IA3A 2FJEA 3PUGA 4PJNA 1UCUA 2V7KA 4YXDA 4XAXB 4JYAT 4JI4T 5HWYA 2X67A 4HFCA 3UULA 4X62T 2DHRA 5FNVE 5KMGP 1OWAA 3N5LA 5IWAT 2CPTA 2XQ5A 3P7IA 3KVAA 4HWIB 4UXNB 5LBQB 2V6YB 1MMNA 1HX1B 4DR2T 3UTKA 1KEYA 3BQKA 2WZHA 3Q5XA 3K1SA 4ILBA 3AE7A 3C51A 2MAWA 3LG7A 3MA9A 2BVLA 2YDRA 3PJAA 4HWCA 3AE2A 2L9QA 3RF1A 3RIAA 3FZHB 2LHNA 3I0QA 4LFCT 1CHUA 1W0BA 2CEAA 2W63A 3CX8B 4GK0E 2WM9A 1WRDA 5AQOB 1NEKA 4UEMA 3P4PA 3Q5EA 3AE9A 4QXCB 5LOVE 3PUYF 2J4GA 2G0UA 4HE8A 4TNWA 5ADXL 4JI3T 1YKHB 3TLSA 2XAQB 2A72A 3DP7A 2IDOB 3PE0A 2OLTA 2DWGA 2DL1A 3Q5DA 3ZMTB 3QUJA 3B5MA 5LGUB 3MACA 1T7SA 3O4XE 2WDVA 5CFBA 4LF7T 3ZJ1A 1UX4A 5KDMC 4B3RT 2NTXA 1HFAA 1LRZA 2BBJA 3AVRA 1XMQT 1ZOYA 4WBOA 2ZLYA 4H9QC 4ILCA 4QXBB 4X5TA 4UF0A 2E5VA 4ILAA 3P4RA 2KNDA 1W9RA 2YDQA 4CI1B 5L47A 3NZQA 4DV5T 3KV9A 3RHWA 3RIUA 2FBWA 3Q2MA 1KFYA 4QKNA 4EB6E 2ODUA 5AQVB 4H63V 2VKJA 2QYWA 2BKNA 3Q5WA 1E7PA 2OA5A
chains in the Genus database with same CATH topology
3KVBA 1SA0E 4B6XA 3RRWA 2KWIB 2RA1A 2N1GA 3O1HA 5HXHA 2EHOB 4OYKA 4WW0A 4AKIA 4HGAA 3H3AA 4UELA 3ZC0A 2IC6A 2LE8A 3ETUA 2X51A 5L3GB 2PG8A 4CZZB 4DBQA 3KV4A 1IJ6A 1KK7A 2H3RA 2YU1A 1HG2A 2K48A 3IEEA 3T8OA 5C8YE 4QXHB 1AJ3A 2Q9QC 2MBGA 5LHIB 2CCQA 4DNDA 1WYCA 4I50E 4KMCA 3K8PC 5L2LA 3HKDE 2IC9A 1YKEB 4H9SE 5FY7A 4O4JE 2X9HA 4O2BE 4CXWA 1WR6A 2D5UA 4PFPA 4HN9A 3B13A 2NOXA 4CQIA 3AA1B 5JR9B 3PUQA 4YJ2E 5BMVE 4BA9A 4CXXA 4HTEA 2LSKA 1IJ5A 4IHJE 3C4WA 5IHYA 2V26A 4EOZB 3OBVE 2XHEB 4GYRA 2D0TA 1HF8A 5JQGE 2Y6XA 2KXPB 5LGTB 3WAKA 5JR9C 3AAAB 3LK3B 1IAPA 2LM9A 5J2TE 4ZS3A 1OXZA 5J2UE 4H9NC 5JRCA 4JEUB 3DTOA 4H9OC 3GMIA 3C50A 4U72A 5L3CB 3MK7C 2X9YA 2WAUA 3R6NA 2KZ7B 3ZMUB 5JDGA 1BR4A 4EIWA 2E9XC 5DQVA 2GK9A 3ETVA 1LVKA 3LK42 3N2KE 4PJJA 4KP3C 2M67A 3N9PA 5EZYE 1CUNA 3F2EA 3PTRB 3V5UA 3E0ZA 2PJQA 2K24A 4EZHA 4AXPA 3I0OA 4TN7B 5FP3A 3I1AA 3UUNA 5LHHB 2CA5A 3HKEE 2VASA 2KINB 4IE6A 3A5XA 4I4TE 2JJ9A 5JDFA 3U3IA 3U78A 2CXFA 3AVSA 2KLQA 3UT5E 3GA8A 3QK6A 5H6QB 3F57A 4PJMA 2D2SA 5EK3A 3ZMZB 2WBLA 3PUAA 4EYUA 2BVMA 3KDSE 5F8PA 2CWYA 1EZ3A 3AA6B 1QUUA 2MOZA 2BDEA 3RYCE 5JREA 2VKDA 4IDZA 3VHLA 5FXZA 3ZCIA 3ZN0B 5LG4A 1D0YA 2C0SA 4IE0A 3KV6A 2NTYA 4X1YE 2LJLA 3N9NA 4GIWA 5FYMA 3R84B 2YINA 4L9IA 3ZYLA 4IIJE 2UXNB 2EHOA 3C64A 3ZYMA 3IHRA 3OYXA 1MMGA 4V1Av 4FJOA 2W0GA 3C4ZA 2LOSA 2JMHA 2ZMAA 4JUYA 2VB6A 1ZHCA 1FEWA 2N9DA 2LHRA 4ZOLE 2PFVA 2CE7A 4OK0A 3O1IA 1S35A 3FB2A 1WYBA 4BJNA 2Q9QA 4F6RC 4DMWA 3EDUA 2MYSA 3FHNA 1SHZC 1ZEEA 2KMFA 2XAFB 3CQGB 3AAIA 1HS7A 3SRZA 5FY1A 1IZNB 3DJBA 2VL8A 5HXEA 2DI4A 2VKOA 2LSYA 2V7MA 3FXDB 3LJCA 3TKLB 1G8XA 4UVCB 4EYYR 3HR0A 1MMDA 4TV9E 4X1IE 5JVDE 2DLRA 4O4IE 2H7VC 3FBLA 3L09A 1MIYA 3ZJ2A 5HXRA 3FBZA 3CX7B 4Z8XA 2JPFA 4BJMA 3ZMVB 4ILUA 4QHOA 5FMNA 4YHJA 4ZI7E 2LSJA 5CB4E 4H63H 5A1LA 4I55E 3OKQA 4QX7B 2XTLA 5L3DB 2V7LA 3ONXA 4O2AE 4TV8E 5TAOA 2K9AA 3RYHE 2JRKA 3ZCJA 2IW5B 4TUYE 3UUMA 3WI3A 3E22E 3LBXB 3MJXA 4ASKA 2QA7A 3SOLA 4PW8A 3PU8A 2W62A 4U74A 2YU2A 3RX6A 2P9BA 4ZI2D 4ISSA 5HYAA 3K3NA 4L5GA 1D1BA 4PK4A 2EHOD 3JC6D 5L3BB 3I9YA 4C90A 2Y48B 1ZV4X 4OYJA 2E9XB 2WSSV 4IGUA 2VWAA 4PK6A 5AFUL 3J7Yq 2CMRA 4AQFA 3AA0B 4O8SA 4ZHQE 2CXDA 2CXLA 1VRBA 2VKHA 5J1GA 3W15B 1G73A 2IAKA 2NW7A 4ADZA 3ZPOA 2MTQA 2SPCA 4ZI3C 4H9RC 1HG5A 2XASB 2Y8DA 2B1EA 2XAHB 5DJQC 2XAGB 4UV9B 3PURA 5CA0E 1HTJF 1MNDA 2BZBA 3HKCE 3KFWX 4L0RA 4N78D 2E9XD 5LXTE 3S4UA 2YEVC 3KBTA 4A56A 1US7B 3SS1A 2JMKA 1NAFA 5LHGB 4P0AA 3EDVA 3QC9A 4CXYA 2ZM0A 2CLYC 3RC8A 3P8CD 3VKGA 3RRCA 3GN5A 5HWXA 3Q9DA 3BQLA 3H37A 3MKDA 3N2GE 4PNIA 4UV8B 2CM0A 5FXXA 5FXWA 1U4QA 5LYJE 1HCIA 3NRYA 4NUVA 5LGNB 2ZM2A 5JRCB 1QSDA 1BR1A 3KINB 3B57A 4WNKA 4EZ4A 1U5PA 5KX5E 5F3JA 4PK5A 4TX5A 2ODVA 2CLYB 5HXSA 1D1CA 3ZYKA 4AKLA 5LJNA 4EAHA 5L3EB 3PUSA 4HKAA 4ZS2A 2E9XA 4ANJA 1O3XA 2WMOA 3LK2B 1Z0PA 2LSGA 4H9PC 4X1KE 2Q9QB 3D0TA 5CA1E 1YD8G 4KUMB 4P0BA 3OYZA 2N2NA 3RYFE 3O9XA 2NWBA 4O4LE 3UUXB 3HI2A 1FMVA 2C5IT 2X68A 2XUEA 3ANWA 4OHFA 3RKOA 3SWHA 5JDHA 3K3OA 3ZMSB 5JDQA 3N9QA 4MHCA 4AI6A 3HL6A 3ZC1A 3KBUA 4YLHA 5JDNA 4GYSA 1X79A 1MNEA 4P09A 3NRXA 1Y64B 2JQQA 4E7ZA 2A3DA 2K5BB 1MIWA 2V1DB 3HKBE 5LBMA 5H6RB 4I43B 4HEAA 4XBFB 3GN5B 2DCFA 3NZPA 4C91A 4CI2B 2DNXA 1MIVA 4FI5A 5M4YA 3O1JA 3UFEA 3NBXX 5JDLA 2X66A 1VOMA 1LKXA 5HXCA 3ZEFB 4QWNB 2PBIA 4IE4A 4AQFC 4DO0A 2C5JA 4PFOA 4BAYB 2Q9QD 4AKGA 3I9WA 3CWZB 5LJMA 4M1PA 1S94A 3RC3A 3AAEB 5FY0A 2ES0A 5L3FB 2J1DG 2LT3A 4WBNE 3CX6B 2XQYA 2X9XA 4G2AA 1WLXA 4MBQA 1ZKEA 3GWHA 1UX5A 3WAJA 3RPUA 4JEHB 5LNKA 4ZI2C 1T98A 4YJ3E 3V5SA 4CI3B 3MXZA 5LCYA 4MALA 4EXTA 5LA6E 4UF0B 1B7TA 2LOPA 3C98B 4J2CA 2KWHA 3CVRA 2KT9A 2NP9A 3ANWB 4ISTA 5JR9A 4DBRA 2RP4A 3BQIA 1BR2A 4HFVA 3CMLA 1LVFA 3HA4A 1D0ZA 3EVYA 2HH7A 2D0UA 3LFMA 3PU3A 4X20E 3AA7B 2QGSA 4JLEA 2LSIA 3LBXA 1NWMX 5JDMA 4NUUA 3PDYA 2ACXA 4DVDA 4IE7A 2W61A 3MZKB 4YFSA 3N9MA 2NW9A 3E08A 4PAGA 2WWUA 5E0OA 3ZN1B 2WMNA 2L8KA 4PJLA 2ZM8A 1BR0A 4IE5A 5DABA 4E7SA 3C4XA 3N2OA 2DWKA 4DMVA 3BK9A 4AKRB 5EK2A 3KV5A 4O4HE 5DQWA 1MMAA 4GOUA 2H7OA 4MFRA 2HPLA 1FMWA 1YW0A 2HPJA 2YK0A 3CPZA 3OJAA 4UVAB 1HX8A 3CQXC 4ZI3D 2VK9A 4MLKA 5IYZE 3ESLA 5JH7E 3RH3A 3ZLIA 2V7JA 5LP6E 2Z6EA 4UVBB 2I59A 2V7IA 1V9DA 5ETWA 2EHOC 3JC6C 5FXVA 4AQGA 2XAJB 2UXXB 4OFZA 1FIOA 3FXEB 4K0UA 1H7CA 2W00A 2C5KT 1D1AA 4AKHA 4G63A 3IBPA 4QX8B 3AB3B 1D0XA 3CQCB 3N9OA 4TZ4C 3M65A 3CKDA 3EUHA 4KBMB 3RYIE 5EK4A 4GK5E 4XZCA 2CWOA 2NW8A 3J9X1 1E1HB 4UIGA 3VKHA 3IF8B 5GONE 2X9WA 3F31A 3K3QC 4ERRA 3L3PA 3VU7H 2LEHA 2E8IA 5HAXA 2L3LA 2X0LB 2A2FX 3N9LA 3PUGA 4PJNA 1UCUA 2V7KA 4XAXB 5HWYA 2X67A 3UULA 2DHRA 5FNVE 5KMGP 1OWAA 3N5LA 4UXNB 3P7IA 5LBQB 3KVAA 1MMNA 3UTKA 3BQKA 3Q5XA 3C51A 3MA9A 1KNZA 3LG7A 2BVLA 2L9QA 2LHNA 3I0QA 2CEAA 2W63A 3CX8B 4GK0E 2WM9A 1WRDA 4UEMA 5LOVE 4QXCB 5ADXL 2G0UA 4HE8A 1YKHB 2XAQB 2A72A 3DP7A 3PE0A 2DWGA 3ZMTB 5LGUB 3QUJA 3MACA 3O4XE 3ZJ1A 1UX4A 5KDMC 2NTXA 1HFAA 1LRZA 3AVRA 4WBOA 2ZLYA 4H9QC 4QXBB 4UF0A 2KNDA 4CI1B 3NZQA 3KV9A 3Q2MA 4EB6E 4QKNA 2ODUA 4H63V 2VKJA 3Q5WA 2OA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KIN B; 
#chains in the Genus database with same CATH topology
 4DUZ T;  3TLV A;  3KVB A;  1SA0 E;  4B6X A;  3RRW A;  2KWI B;  2RA1 A;  1UGO A;  2A9U A;  1N33 T;  2N1G A;  3O1H A;  5HXH A;  2EHO B;  2YN6 A;  4OYK A;  4LFA T;  3PUW F;  2JQH A;  1HNZ T;  4WW0 A;  4JI6 T;  4AKI A;  4HGA A;  4B3M T;  3H3A A;  1N32 T;  3NWI A;  1SUM B;  4UEL A;  3SFD A;  5LG3 A;  3NVO A;  2IC6 A;  2LE8 A;  3ETU A;  2X51 A;  5L3G B;  3ZC0 A;  2PG8 A;  4CZZ B;  4DBQ A;  2XJ7 A;  1IJ6 A;  1KK7 A;  1OED A;  2D9D A;  1HG2 A;  2H3R A;  2K48 A;  2YU1 A;  1KNR A;  3IEE A;  4HFI A;  4LMK A;  2Q9Q C;  4QXH B;  2MBG A;  5C8Y E;  5LHI B;  2HN1 A;  2XM2 A;  3JAF A;  4DV4 T;  2CCQ A;  4DND A;  1WYC A;  4I50 E;  3OPC A;  4KMC A;  3K8P C;  5ABH A;  3UQ4 A;  3HKD E;  5L2L A;  2IC9 A;  1YKE B;  3QB5 K;  4H9S E;  5FY7 A;  3AED A;  2X9H A;  4O4J E;  4O2B E;  4Z90 A;  4CXW A;  4DV7 T;  1WR6 A;  2D5U A;  4PFP A;  4HN9 A;  2BS2 A;  3B13 A;  5L3D B;  4DV3 T;  3AEG A;  2NOX A;  4HWF A;  4CQI A;  3AA1 B;  2IHR 1;  2XQ6 A;  4QH1 A;  5JR9 B;  2LM2 A;  3PUQ A;  4YJ2 E;  5BMV E;  4BA9 A;  4CXX A;  4HTE A;  2LLY A;  3RKG A;  2LSK A;  3NKZ A;  1IJ5 A;  4IHJ E;  2XQ4 A;  3C4W A;  4U3C A;  2FUP A;  2V26 A;  5IHY A;  4EOZ B;  3OBV E;  2XHE B;  4GYR A;  2D0T A;  1HF8 A;  5JQG E;  4DV2 T;  2Y6X A;  4X65 T;  3RQU A;  3AE8 A;  3QNU A;  2KXP B;  5LGT B;  3WAK A;  1HNX T;  5JR9 C;  1AJ3 A;  3AAA B;  3AEB A;  3LK3 B;  4YT0 A;  1IAP A;  2LM9 A;  5J2T E;  3VRB A;  4ZS3 A;  1OXZ A;  5J2U E;  4H9N C;  4EGW A;  5JRC A;  4JEU B;  3DTO A;  4H9O C;  3GMI A;  3C50 A;  5FVL A;  1J5W A;  4U72 A;  5L3C B;  5LMN T;  3MK7 C;  2X9Y A;  2WAU A;  3R6N A;  2KZ7 B;  3ZMU B;  5JDG A;  1BR4 A;  4EIW A;  2E9X C;  1M62 A;  2GK9 A;  3ETV A;  1LVK A;  3LK4 2;  3N2K E;  4PJJ A;  4KP3 C;  2M67 A;  3N9P A;  5EZY E;  1CUN A;  3F2E A;  3PTR B;  2YOE A;  3V5U A;  3E0Z A;  2XQ7 A;  2PJQ A;  2K24 A;  4NPP A;  4EZH A;  4AXP A;  3I0O A;  4TN7 B;  5FP3 A;  5AQL B;  3I1A A;  3UUN A;  5LHH B;  2CA5 A;  1DU2 A;  4JBW F;  3HKE E;  2VAS A;  2KIN B;  1T8B A;  3A5X A;  4I4T E;  4IE6 A;  4YTM A;  2JJ9 A;  3UFG A;  1N36 T;  5JDF A;  3U3I A;  3U78 A;  4LFB T;  3EI0 A;  2CXF A;  3AVS A;  2KLQ A;  3UT5 E;  3GA8 A;  3QK6 A;  5H6Q B;  3F57 A;  4PJM A;  3TLW A;  3VR9 A;  2D2S A;  5EK3 A;  3ZMZ B;  2WBL A;  3PUA A;  4EYU A;  2X0Y A;  2BVM A;  3KDS E;  5F8P A;  2CWY A;  4JI0 T;  4DR6 T;  1EZ3 A;  3AA6 B;  1QUU A;  2V5C A;  2MOZ A;  2BDE A;  2WS3 A;  2WWV A;  2VKD A;  3RYC E;  4IDZ A;  3VHL A;  5JRE A;  3P50 A;  5FXZ A;  3ZCI A;  3ZN0 B;  5LG4 A;  1D0Y A;  2C0S A;  4IE0 A;  3KV6 A;  2NTY A;  4KX6 A;  1OED C;  3JCF A;  2LJL A;  3N9N A;  4GIW A;  4QH4 A;  4U2Y A;  4X1Y E;  5FYM A;  2YIN A;  3R84 B;  3T1H T;  4L9I A;  3ZYL A;  5C2T A;  4IIJ E;  2UXN B;  2EHO A;  4LF9 T;  3C64 A;  2CBJ A;  3ZYM A;  5AQF B;  5ABG A;  3IHR A;  3OYX A;  1MMG A;  4V1A v;  5CJ5 A;  4FJO A;  2W0G A;  1HNW T;  2BBH A;  3C4Z A;  2LOS A;  2JMH A;  2ZMA A;  4IRE A;  1XDP A;  4JUY A;  5AQM B;  5ABE A;  2VB6 A;  4JI2 T;  1ZHC A;  1FEW A;  2N9D A;  2LHR A;  4ZOL E;  3UU6 A;  2PFV A;  2W2U A;  2CE7 A;  4OK0 A;  2UU9 T;  3O1I A;  1S35 A;  3FB2 A;  4DV1 T;  1WYB A;  1ZP0 A;  4BJN A;  2LRL A;  2Q9Q A;  4DR5 T;  4ZZC A;  4F6R C;  4U7I A;  4LF8 T;  4DMW A;  3EDU A;  4YTN A;  2MYS A;  3FHN A;  5HEU A;  3TLU A;  2J47 A;  1WR0 A;  3ZT5 A;  1SHZ C;  1ZEE A;  2KMF A;  2XAF B;  3CK6 A;  3AAI A;  2V8S V;  3CQG B;  3ZST A;  4YHH T;  4JI8 T;  4DR4 T;  1HS7 A;  3SRZ A;  4U2Z A;  5ABF A;  5FY1 A;  1IZN B;  1N34 T;  3DJB A;  4TWD A;  2VL8 A;  5HXE A;  2DI4 A;  4IDQ A;  2VKO A;  2LSY A;  2V7M A;  2I0M A;  3FXD B;  3LJC A;  1G8X A;  4UVC B;  5HCM A;  3TKL B;  4EYY R;  4I0U A;  3HR0 A;  3AXJ A;  1MMD A;  1OED E;  2W4X A;  4TV9 E;  4X1I E;  4Z91 A;  2XM1 A;  4IDO A;  5JVD E;  4DID B;  1XNR T;  2DLR A;  4O4I E;  5AQH B;  2H7V C;  3FBL A;  3P4W A;  3RGL A;  4CN4 A;  3L09 A;  5FKY A;  1MIY A;  2VUR A;  5HXR A;  3ZJ2 A;  4C91 A;  3FBZ A;  3OTO T;  3CX7 B;  4UR9 A;  4Z8X A;  2JPF A;  4BJM A;  3ZMV B;  1VCS A;  2LRK A;  4ILU A;  4QHO A;  3SFE A;  5FMN A;  4YHJ A;  5BR8 T;  2WDR A;  4ZI7 E;  1J5E T;  2LSJ A;  4U33 A;  5CB4 E;  1IBK T;  3ZEF B;  4H63 H;  4QH5 A;  5A1L A;  3UU5 A;  3RIF A;  4I55 E;  3OKQ A;  4IDN A;  2IIU A;  4JI1 T;  4QX7 B;  2XTL A;  2JQ9 A;  2V7L A;  3ONX A;  4O2A E;  4TV8 E;  5FVK A;  2K9A A;  5TAO A;  2JRK A;  3RYH E;  2R6G F;  3UUB A;  3ZCJ A;  2IW5 B;  3AEC A;  4TUY E;  3UUM A;  2UUA T;  4GKK T;  3WI3 A;  3E22 E;  3LBX B;  2WZI A;  3MJX A;  1GQE A;  2VQF T;  5L4E A;  2HN2 A;  3T1Y T;  2UXC T;  4ASK A;  2QA7 A;  3SOL A;  4PW8 A;  5AQT B;  2LKH A;  3PU8 A;  2W62 A;  5L4H A;  4U74 A;  2CHO A;  2YU2 A;  3RX6 A;  4X64 T;  2P9B A;  3UU8 A;  4ZI2 D;  3AE1 A;  4ISS A;  5AQQ B;  5HYA A;  3K3N A;  2BG9 C;  4L5G A;  1D1B A;  4PK4 A;  4TWH A;  2EHO D;  3JC6 D;  5L3B B;  3I9Y A;  1J1J A;  3EAB A;  1JNZ A;  5AQG B;  2Y48 B;  4C90 A;  1OED B;  3ABV A;  4EEB A;  1ZV4 X;  4B3S T;  4OYJ A;  2E9X B;  2WSS V;  4DR7 T;  4IGU A;  2UXD T;  3ONL C;  2VWA A;  4PK6 A;  5F5W A;  5AFU L;  4GKJ T;  3J7Y q;  1XDO A;  2CMR A;  3FZF B;  3AA0 B;  4O8S A;  4LML A;  4AQF A;  2CXD A;  2CXL A;  1VRB A;  2VKH A;  5J1G A;  2E2A A;  3W15 B;  4EV6 A;  4ZHQ E;  1G73 A;  2HHH T;  2IAK A;  4B3T T;  2NW7 A;  3AXJ B;  3FZM B;  3ZPO A;  2MTQ A;  2SPC A;  4U31 A;  4ADZ A;  4ZI3 C;  4H9R C;  1HG5 A;  2XAS B;  2Y8D A;  4AIS A;  2B1E A;  4EED A;  4YSZ A;  2WP9 A;  2XAH B;  5DJQ C;  2XAG B;  4JV5 T;  4UV9 B;  3PUR A;  5CA0 E;  4K0K T;  1HTJ F;  1SE7 A;  1MND A;  2BZB A;  3HKC E;  3KFW X;  2AXD S;  4L0R A;  3AE4 A;  4N78 D;  2E9X D;  5LXT E;  3S4U A;  2YEV C;  3KBT A;  2W66 A;  1I6Z A;  2XSB A;  4A56 A;  1US7 B;  3SS1 A;  2JMK A;  1NAF A;  4A5X A;  4A97 A;  5LHG B;  4KHP T;  4P0A A;  3EDV A;  3QC9 A;  4CXY A;  1XMO T;  2ZM0 A;  1M7K A;  2CLY C;  5FL0 A;  4HWH A;  3RC8 A;  3P8C D;  2WQY A;  4HFD A;  2VVN A;  5LB7 B;  3VKG A;  2WY2 A;  3GN5 A;  3RRC A;  5HWX A;  4YTP A;  3Q9D A;  2E5L T;  1UUR A;  3BQL A;  3H37 A;  3MKD A;  3N2G E;  1Y01 A;  2CM0 A;  4PNI A;  2QVA A;  3EAM A;  4UV8 B;  5FXX A;  1U4Q A;  1Z8U A;  5FXW A;  5HCJ A;  1HCI A;  5LYJ E;  2ZM6 T;  2XQ3 A;  3NRY A;  4NUV A;  2ZM2 A;  3ZSS A;  5LGN B;  4DUY T;  1QSD A;  5JRC B;  1BR1 A;  3KV4 A;  2WDQ A;  2JQK A;  3KIN B;  3B57 A;  4WNK A;  1W09 A;  4EZ4 A;  5ABF B;  1U5P A;  2BS3 A;  5KX5 E;  2XQA A;  4PK5 A;  4TX5 A;  5F3J A;  2ODV A;  2CLY B;  1I94 T;  5HXS A;  4LF6 T;  1D1C A;  3ZYK A;  4AKL A;  4YSY A;  2KSR A;  4EAH A;  5LJN A;  2J62 A;  5L3E B;  4JI5 T;  3PUS A;  4HKA A;  4ZS2 A;  2E9X A;  4ANJ A;  1O3X A;  2WMO A;  3LK2 B;  2H89 A;  1HR0 T;  1Z0P A;  2LSG A;  4H9P C;  4X1K E;  4CN1 A;  2Q9Q B;  3D0T A;  5CA1 E;  1YD8 G;  4KUM B;  1BR0 A;  4P0B A;  3OYZ A;  5AQJ B;  2N2N A;  2CBI A;  1XWM A;  3RYF E;  3O9X A;  3PUZ F;  2NWB A;  5LMU T;  3P4S A;  4O4L E;  3UUX B;  3HI2 A;  1FMV A;  3T8O A;  1QLB A;  1WFD A;  2C5I T;  2X68 A;  2XUE A;  2K3W A;  1YQ4 A;  3ANW A;  4OHF A;  5HEH A;  3RKO A;  2BG9 E;  3SWH A;  5JTG A;  5JDH A;  3K3O A;  3ZMS B;  5JDQ A;  3N9Q A;  2CHN A;  4MHC A;  3HL6 A;  3ZC1 A;  3KBU A;  4YLH A;  3RLF F;  4YSX A;  3RQW A;  2V6X A;  5JDN A;  4GYS A;  1X79 A;  1MNE A;  3ONJ A;  4P09 A;  2MPK A;  3NRX A;  2XPK A;  1Y64 B;  2NR4 A;  2BS4 A;  2JQQ A;  4HFH A;  4E7Z A;  4ZEY A;  2A3D A;  2H88 A;  4LF4 T;  4F8H A;  2K5B B;  1MIW A;  2V1D B;  3HKB E;  3ZT7 A;  1WCR A;  5LBM A;  5H6R B;  3AE6 A;  3M3Z B;  4I43 B;  4HEA A;  4IL9 A;  4XBF B;  2BG9 A;  3UQ7 A;  3GN5 B;  2DCF A;  2BKO A;  3AE3 A;  1KNP A;  3NZP A;  3P4Q A;  4TNV A;  5AQR B;  2XY8 B;  4CI2 B;  2DNX A;  1MIV A;  2IUB A;  4FI5 A;  5M4Y A;  3O1J A;  1UK5 A;  3UFE A;  3PUV F;  3NBX X;  4NIQ A;  2X66 A;  5JDL A;  1IBL T;  4TWF A;  1VOM A;  1LKX A;  3JAE A;  5HXC A;  5AQI B;  4QWN B;  2PBI A;  4IE4 A;  4AQF C;  4DO0 A;  2C5J A;  4PFO A;  4BAY B;  2Q9Q D;  4AQY T;  4AKG A;  2X0H A;  3I9W A;  3CWZ B;  4CN6 A;  5LJM A;  5C3J A;  4M1P A;  1XZY A;  1S94 A;  2OV9 A;  3RIU C;  2V5D A;  5CGM A;  2JIW A;  3RC3 A;  3AAE B;  5FY0 A;  2UXB T;  3X1D A;  3PV0 F;  2RPA A;  2ES0 A;  4HFE A;  5L3F B;  2J1D G;  2LT3 A;  4WBN E;  3CX6 B;  1NEN A;  2X9X A;  2XQY A;  2UUB T;  4G2A A;  1WLX A;  2AE9 A;  1ZKE A;  4MBQ A;  2WB5 A;  2WU5 A;  3GWH A;  5HEJ A;  3QOF A;  1UX5 A;  3TLT A;  3WAJ A;  3RPU A;  4JEH B;  5LNK A;  4ZI2 C;  1T98 A;  4YJ3 E;  3V5S A;  3FZK B;  1L0V A;  3MXZ A;  5LCY A;  4CI3 B;  4MAL A;  2YKS A;  4EXT A;  5LA6 E;  4UF0 B;  2XSA A;  1B7T A;  2V6Y A;  3PJA J;  2LOP A;  3C98 B;  4J2C A;  4NXN T;  2KWH A;  3CVR A;  2KT9 A;  2VQE T;  4KHZ F;  2NP9 A;  3ANW B;  4IST A;  5JR9 A;  3VR8 A;  2LKG A;  4DBR A;  2RP4 A;  3CIR A;  4AIU A;  4Q25 A;  3BQI A;  1BR2 A;  3LDQ B;  4HFV A;  3CML A;  2F4V T;  2YDS A;  1E2A A;  1LVF A;  4X66 T;  3HA4 A;  1D0Z A;  3EVY A;  3OVU A;  5AQS B;  4JI7 T;  4AI6 A;  2B76 A;  2HH7 A;  1KF6 A;  2D0U A;  3G06 A;  3LFM A;  3PU3 A;  3UU4 A;  1T72 A;  5KXJ A;  4HFB A;  5J0Z A;  2W67 A;  4X20 E;  1XNQ T;  2ACZ A;  3H3M A;  3AA7 B;  2QGS A;  4HWD A;  4JLE A;  2LSI A;  5AQK B;  4DV0 T;  2PTF A;  1NWM X;  3LBX A;  2VVS A;  4LMJ A;  4NUU A;  5JDM A;  3PDY A;  5HEG A;  4DR3 T;  3ZKR A;  2CRB A;  2ACX A;  4ZZB A;  5HEO A;  1IBM T;  4WZX A;  4DVD A;  3UU3 A;  2FJB A;  3A7M A;  4IE7 A;  2W61 A;  2M6B A;  3MZK B;  3N9M A;  4YFS A;  2FJD A;  3E08 A;  2NW9 A;  4PAG A;  4WYV A;  2WWU A;  5E0O A;  3ZN1 B;  2WMN A;  3L8R A;  2L8K A;  4PJL A;  2ZM8 A;  3PUX F;  5AQN B;  4IE5 A;  5DAB A;  3VRA A;  4E7S A;  1YXR A;  2I6H A;  4IT4 A;  3C4X A;  3N2O A;  2DWK A;  4DMV A;  3BK9 A;  3AEF A;  2UUC T;  4AKR B;  5EK2 A;  3AE5 A;  3KV5 A;  4O4H E;  5DQW A;  1MMA A;  2M6I A;  1JNR A;  4GOU A;  4P1N A;  4U7Y A;  2H7O A;  4MFR A;  4A98 A;  2HPL A;  1FMW A;  1YW0 A;  2HPJ A;  2YK0 A;  3CPZ A;  3OJA A;  4UVA B;  1HX8 A;  3CQX C;  4ZI3 D;  2VK9 A;  1VCT A;  2IML A;  2QRX A;  4MLK A;  5IYZ E;  3ESL A;  3FZL B;  4IL4 A;  5JH7 E;  3RH3 A;  1YQ3 A;  2V7J A;  5DQV A;  3ZLI A;  2Z6E A;  4UVB B;  2I59 A;  2V7I A;  5FL1 A;  5LP6 E;  1V9D A;  5ETW A;  4KI0 F;  2EHO C;  3JC6 C;  1X9B A;  5FXV A;  4AQG A;  2XAJ B;  2UXX B;  4OFZ A;  1FIO A;  3FXE B;  4K0U A;  1H7C A;  2W00 A;  2C5K T;  1D1A A;  2WU2 A;  4OX9 T;  2VL0 A;  4AKH A;  4G63 A;  3IBP A;  4QX8 B;  4DR1 T;  3AB3 B;  2WCA A;  3AEA A;  4YY3 T;  1D0X A;  2BKP A;  3CQC B;  3EHZ A;  3M65 A;  3N9O A;  4TZ4 C;  3A8Y C;  3CKD A;  3EUH A;  4KBM B;  5AQP B;  3RI5 A;  3RYI E;  4COF A;  4NXM T;  5EK4 A;  4ZXL A;  3ZT6 A;  4GK5 E;  4XZC A;  2CWO A;  3AEE A;  5IUX A;  2NW8 A;  3J9X 1;  1E1H B;  1UUS A;  3JAD A;  3IF8 B;  4UIG A;  3VKH A;  1KNZ A;  2FJA A;  5GON E;  2X9W A;  3F31 A;  2XQ9 A;  4LF5 T;  2XZE A;  3K3Q C;  4ERR A;  5AQU B;  1R8I A;  3L3P A;  3L39 A;  3VU7 H;  2LEH A;  2E8I A;  1W0A A;  2XQ8 A;  3LSV A;  3QB5 A;  5HAX A;  1FJG T;  2L3L A;  2X0L B;  4DV6 T;  4IDP A;  2A2F X;  2BG9 B;  3N9L A;  3IA3 A;  2FJE A;  3PUG A;  4PJN A;  1UCU A;  2V7K A;  4YXD A;  4XAX B;  4JYA T;  4JI4 T;  5HWY A;  2X67 A;  4HFC A;  3UUL A;  4X62 T;  2DHR A;  5FNV E;  5KMG P;  1OWA A;  3N5L A;  5IWA T;  2CPT A;  2XQ5 A;  3P7I A;  3KVA A;  4HWI B;  4UXN B;  5LBQ B;  2V6Y B;  1MMN A;  1HX1 B;  4DR2 T;  3UTK A;  1KEY A;  3BQK A;  2WZH A;  3Q5X A;  3K1S A;  4ILB A;  3AE7 A;  3C51 A;  2MAW A;  3LG7 A;  3MA9 A;  2BVL A;  2YDR A;  3PJA A;  4HWC A;  3AE2 A;  2L9Q A;  3RF1 A;  3RIA A;  3FZH B;  2LHN A;  3I0Q A;  4LFC T;  1CHU A;  1W0B A;  2CEA A;  2W63 A;  3CX8 B;  4GK0 E;  2WM9 A;  1WRD A;  5AQO B;  1NEK A;  4UEM A;  3P4P A;  3Q5E A;  3AE9 A;  4QXC B;  5LOV E;  3PUY F;  2J4G A;  2G0U A;  4HE8 A;  4TNW A;  5ADX L;  4JI3 T;  1YKH B;  3TLS A;  2XAQ B;  2A72 A;  3DP7 A;  2IDO B;  3PE0 A;  2OLT A;  2DWG A;  2DL1 A;  3Q5D A;  3ZMT B;  3QUJ A;  3B5M A;  5LGU B;  3MAC A;  1T7S A;  3O4X E;  2WDV A;  5CFB A;  4LF7 T;  3ZJ1 A;  1UX4 A;  5KDM C;  4B3R T;  2NTX A;  1HFA A;  1LRZ A;  2BBJ A;  3AVR A;  1XMQ T;  1ZOY A;  4WBO A;  2ZLY A;  4H9Q C;  4ILC A;  4QXB B;  4X5T A;  4UF0 A;  2E5V A;  4ILA A;  3P4R A;  2KND A;  1W9R A;  2YDQ A;  4CI1 B;  5L47 A;  3NZQ A;  4DV5 T;  3KV9 A;  3RHW A;  3RIU A;  2FBW A;  3Q2M A;  1KFY A;  4QKN A;  4EB6 E;  2ODU A;  5AQV B;  4H63 V;  2VKJ A;  2QYW A;  2BKN A;  3Q5W A;  1E7P A;  2OA5 A; 
#chains in the Genus database with same CATH homology
 3KVB A;  1SA0 E;  4B6X A;  3RRW A;  2KWI B;  2RA1 A;  2N1G A;  3O1H A;  5HXH A;  2EHO B;  4OYK A;  4WW0 A;  4AKI A;  4HGA A;  3H3A A;  4UEL A;  3ZC0 A;  2IC6 A;  2LE8 A;  3ETU A;  2X51 A;  5L3G B;  2PG8 A;  4CZZ B;  4DBQ A;  3KV4 A;  1IJ6 A;  1KK7 A;  2H3R A;  2YU1 A;  1HG2 A;  2K48 A;  3IEE A;  3T8O A;  5C8Y E;  4QXH B;  1AJ3 A;  2Q9Q C;  2MBG A;  5LHI B;  2CCQ A;  4DND A;  1WYC A;  4I50 E;  4KMC A;  3K8P C;  5L2L A;  3HKD E;  2IC9 A;  1YKE B;  4H9S E;  5FY7 A;  4O4J E;  2X9H A;  4O2B E;  4CXW A;  1WR6 A;  2D5U A;  4PFP A;  4HN9 A;  3B13 A;  2NOX A;  4CQI A;  3AA1 B;  5JR9 B;  3PUQ A;  4YJ2 E;  5BMV E;  4BA9 A;  4CXX A;  4HTE A;  2LSK A;  1IJ5 A;  4IHJ E;  3C4W A;  5IHY A;  2V26 A;  4EOZ B;  3OBV E;  2XHE B;  4GYR A;  2D0T A;  1HF8 A;  5JQG E;  2Y6X A;  2KXP B;  5LGT B;  3WAK A;  5JR9 C;  3AAA B;  3LK3 B;  1IAP A;  2LM9 A;  5J2T E;  4ZS3 A;  1OXZ A;  5J2U E;  4H9N C;  5JRC A;  4JEU B;  3DTO A;  4H9O C;  3GMI A;  3C50 A;  4U72 A;  5L3C B;  3MK7 C;  2X9Y A;  2WAU A;  3R6N A;  2KZ7 B;  3ZMU B;  5JDG A;  1BR4 A;  4EIW A;  2E9X C;  5DQV A;  2GK9 A;  3ETV A;  1LVK A;  3LK4 2;  3N2K E;  4PJJ A;  4KP3 C;  2M67 A;  3N9P A;  5EZY E;  1CUN A;  3F2E A;  3PTR B;  3V5U A;  3E0Z A;  2PJQ A;  2K24 A;  4EZH A;  4AXP A;  3I0O A;  4TN7 B;  5FP3 A;  3I1A A;  3UUN A;  5LHH B;  2CA5 A;  3HKE E;  2VAS A;  2KIN B;  4IE6 A;  3A5X A;  4I4T E;  2JJ9 A;  5JDF A;  3U3I A;  3U78 A;  2CXF A;  3AVS A;  2KLQ A;  3UT5 E;  3GA8 A;  3QK6 A;  5H6Q B;  3F57 A;  4PJM A;  2D2S A;  5EK3 A;  3ZMZ B;  2WBL A;  3PUA A;  4EYU A;  2BVM A;  3KDS E;  5F8P A;  2CWY A;  1EZ3 A;  3AA6 B;  1QUU A;  2MOZ A;  2BDE A;  3RYC E;  5JRE A;  2VKD A;  4IDZ A;  3VHL A;  5FXZ A;  3ZCI A;  3ZN0 B;  5LG4 A;  1D0Y A;  2C0S A;  4IE0 A;  3KV6 A;  2NTY A;  4X1Y E;  2LJL A;  3N9N A;  4GIW A;  5FYM A;  3R84 B;  2YIN A;  4L9I A;  3ZYL A;  4IIJ E;  2UXN B;  2EHO A;  3C64 A;  3ZYM A;  3IHR A;  3OYX A;  1MMG A;  4V1A v;  4FJO A;  2W0G A;  3C4Z A;  2LOS A;  2JMH A;  2ZMA A;  4JUY A;  2VB6 A;  1ZHC A;  1FEW A;  2N9D A;  2LHR A;  4ZOL E;  2PFV A;  2CE7 A;  4OK0 A;  3O1I A;  1S35 A;  3FB2 A;  1WYB A;  4BJN A;  2Q9Q A;  4F6R C;  4DMW A;  3EDU A;  2MYS A;  3FHN A;  1SHZ C;  1ZEE A;  2KMF A;  2XAF B;  3CQG B;  3AAI A;  1HS7 A;  3SRZ A;  5FY1 A;  1IZN B;  3DJB A;  2VL8 A;  5HXE A;  2DI4 A;  2VKO A;  2LSY A;  2V7M A;  3FXD B;  3LJC A;  3TKL B;  1G8X A;  4UVC B;  4EYY R;  3HR0 A;  1MMD A;  4TV9 E;  4X1I E;  5JVD E;  2DLR A;  4O4I E;  2H7V C;  3FBL A;  3L09 A;  1MIY A;  3ZJ2 A;  5HXR A;  3FBZ A;  3CX7 B;  4Z8X A;  2JPF A;  4BJM A;  3ZMV B;  4ILU A;  4QHO A;  5FMN A;  4YHJ A;  4ZI7 E;  2LSJ A;  5CB4 E;  4H63 H;  5A1L A;  4I55 E;  3OKQ A;  4QX7 B;  2XTL A;  5L3D B;  2V7L A;  3ONX A;  4O2A E;  4TV8 E;  5TAO A;  2K9A A;  3RYH E;  2JRK A;  3ZCJ A;  2IW5 B;  4TUY E;  3UUM A;  3WI3 A;  3E22 E;  3LBX B;  3MJX A;  4ASK A;  2QA7 A;  3SOL A;  4PW8 A;  3PU8 A;  2W62 A;  4U74 A;  2YU2 A;  3RX6 A;  2P9B A;  4ZI2 D;  4ISS A;  5HYA A;  3K3N A;  4L5G A;  1D1B A;  4PK4 A;  2EHO D;  3JC6 D;  5L3B B;  3I9Y A;  4C90 A;  2Y48 B;  1ZV4 X;  4OYJ A;  2E9X B;  2WSS V;  4IGU A;  2VWA A;  4PK6 A;  5AFU L;  3J7Y q;  2CMR A;  4AQF A;  3AA0 B;  4O8S A;  4ZHQ E;  2CXD A;  2CXL A;  1VRB A;  2VKH A;  5J1G A;  3W15 B;  1G73 A;  2IAK A;  2NW7 A;  4ADZ A;  3ZPO A;  2MTQ A;  2SPC A;  4ZI3 C;  4H9R C;  1HG5 A;  2XAS B;  2Y8D A;  2B1E A;  2XAH B;  5DJQ C;  2XAG B;  4UV9 B;  3PUR A;  5CA0 E;  1HTJ F;  1MND A;  2BZB A;  3HKC E;  3KFW X;  4L0R A;  4N78 D;  2E9X D;  5LXT E;  3S4U A;  2YEV C;  3KBT A;  4A56 A;  1US7 B;  3SS1 A;  2JMK A;  1NAF A;  5LHG B;  4P0A A;  3EDV A;  3QC9 A;  4CXY A;  2ZM0 A;  2CLY C;  3RC8 A;  3P8C D;  3VKG A;  3RRC A;  3GN5 A;  5HWX A;  3Q9D A;  3BQL A;  3H37 A;  3MKD A;  3N2G E;  4PNI A;  4UV8 B;  2CM0 A;  5FXX A;  5FXW A;  1U4Q A;  5LYJ E;  1HCI A;  3NRY A;  4NUV A;  5LGN B;  2ZM2 A;  5JRC B;  1QSD A;  1BR1 A;  3KIN B;  3B57 A;  4WNK A;  4EZ4 A;  1U5P A;  5KX5 E;  5F3J A;  4PK5 A;  4TX5 A;  2ODV A;  2CLY B;  5HXS A;  1D1C A;  3ZYK A;  4AKL A;  5LJN A;  4EAH A;  5L3E B;  3PUS A;  4HKA A;  4ZS2 A;  2E9X A;  4ANJ A;  1O3X A;  2WMO A;  3LK2 B;  1Z0P A;  2LSG A;  4H9P C;  4X1K E;  2Q9Q B;  3D0T A;  5CA1 E;  1YD8 G;  4KUM B;  4P0B A;  3OYZ A;  2N2N A;  3RYF E;  3O9X A;  2NWB A;  4O4L E;  3UUX B;  3HI2 A;  1FMV A;  2C5I T;  2X68 A;  2XUE A;  3ANW A;  4OHF A;  3RKO A;  3SWH A;  5JDH A;  3K3O A;  3ZMS B;  5JDQ A;  3N9Q A;  4MHC A;  4AI6 A;  3HL6 A;  3ZC1 A;  3KBU A;  4YLH A;  5JDN A;  4GYS A;  1X79 A;  1MNE A;  4P09 A;  3NRX A;  1Y64 B;  2JQQ A;  4E7Z A;  2A3D A;  2K5B B;  1MIW A;  2V1D B;  3HKB E;  5LBM A;  5H6R B;  4I43 B;  4HEA A;  4XBF B;  3GN5 B;  2DCF A;  3NZP A;  4C91 A;  4CI2 B;  2DNX A;  1MIV A;  4FI5 A;  5M4Y A;  3O1J A;  3UFE A;  3NBX X;  5JDL A;  2X66 A;  1VOM A;  1LKX A;  5HXC A;  3ZEF B;  4QWN B;  2PBI A;  4IE4 A;  4AQF C;  4DO0 A;  2C5J A;  4PFO A;  4BAY B;  2Q9Q D;  4AKG A;  3I9W A;  3CWZ B;  5LJM A;  4M1P A;  1S94 A;  3RC3 A;  3AAE B;  5FY0 A;  2ES0 A;  5L3F B;  2J1D G;  2LT3 A;  4WBN E;  3CX6 B;  2XQY A;  2X9X A;  4G2A A;  1WLX A;  4MBQ A;  1ZKE A;  3GWH A;  1UX5 A;  3WAJ A;  3RPU A;  4JEH B;  5LNK A;  4ZI2 C;  1T98 A;  4YJ3 E;  3V5S A;  4CI3 B;  3MXZ A;  5LCY A;  4MAL A;  4EXT A;  5LA6 E;  4UF0 B;  1B7T A;  2LOP A;  3C98 B;  4J2C A;  2KWH A;  3CVR A;  2KT9 A;  2NP9 A;  3ANW B;  4IST A;  5JR9 A;  4DBR A;  2RP4 A;  3BQI A;  1BR2 A;  4HFV A;  3CML A;  1LVF A;  3HA4 A;  1D0Z A;  3EVY A;  2HH7 A;  2D0U A;  3LFM A;  3PU3 A;  4X20 E;  3AA7 B;  2QGS A;  4JLE A;  2LSI A;  3LBX A;  1NWM X;  5JDM A;  4NUU A;  3PDY A;  2ACX A;  4DVD A;  4IE7 A;  2W61 A;  3MZK B;  4YFS A;  3N9M A;  2NW9 A;  3E08 A;  4PAG A;  2WWU A;  5E0O A;  3ZN1 B;  2WMN A;  2L8K A;  4PJL A;  2ZM8 A;  1BR0 A;  4IE5 A;  5DAB A;  4E7S A;  3C4X A;  3N2O A;  2DWK A;  4DMV A;  3BK9 A;  4AKR B;  5EK2 A;  3KV5 A;  4O4H E;  5DQW A;  1MMA A;  4GOU A;  2H7O A;  4MFR A;  2HPL A;  1FMW A;  1YW0 A;  2HPJ A;  2YK0 A;  3CPZ A;  3OJA A;  4UVA B;  1HX8 A;  3CQX C;  4ZI3 D;  2VK9 A;  4MLK A;  5IYZ E;  3ESL A;  5JH7 E;  3RH3 A;  3ZLI A;  2V7J A;  5LP6 E;  2Z6E A;  4UVB B;  2I59 A;  2V7I A;  1V9D A;  5ETW A;  2EHO C;  3JC6 C;  5FXV A;  4AQG A;  2XAJ B;  2UXX B;  4OFZ A;  1FIO A;  3FXE B;  4K0U A;  1H7C A;  2W00 A;  2C5K T;  1D1A A;  4AKH A;  4G63 A;  3IBP A;  4QX8 B;  3AB3 B;  1D0X A;  3CQC B;  3N9O A;  4TZ4 C;  3M65 A;  3CKD A;  3EUH A;  4KBM B;  3RYI E;  5EK4 A;  4GK5 E;  4XZC A;  2CWO A;  2NW8 A;  3J9X 1;  1E1H B;  4UIG A;  3VKH A;  3IF8 B;  5GON E;  2X9W A;  3F31 A;  3K3Q C;  4ERR A;  3L3P A;  3VU7 H;  2LEH A;  2E8I A;  5HAX A;  2L3L A;  2X0L B;  2A2F X;  3N9L A;  3PUG A;  4PJN A;  1UCU A;  2V7K A;  4XAX B;  5HWY A;  2X67 A;  3UUL A;  2DHR A;  5FNV E;  5KMG P;  1OWA A;  3N5L A;  4UXN B;  3P7I A;  5LBQ B;  3KVA A;  1MMN A;  3UTK A;  3BQK A;  3Q5X A;  3C51 A;  3MA9 A;  1KNZ A;  3LG7 A;  2BVL A;  2L9Q A;  2LHN A;  3I0Q A;  2CEA A;  2W63 A;  3CX8 B;  4GK0 E;  2WM9 A;  1WRD A;  4UEM A;  5LOV E;  4QXC B;  5ADX L;  2G0U A;  4HE8 A;  1YKH B;  2XAQ B;  2A72 A;  3DP7 A;  3PE0 A;  2DWG A;  3ZMT B;  5LGU B;  3QUJ A;  3MAC A;  3O4X E;  3ZJ1 A;  1UX4 A;  5KDM C;  2NTX A;  1HFA A;  1LRZ A;  3AVR A;  4WBO A;  2ZLY A;  4H9Q C;  4QXB B;  4UF0 A;  2KND A;  4CI1 B;  3NZQ A;  3KV9 A;  3Q2M A;  4EB6 E;  4QKN A;  2ODU A;  4H63 V;  2VKJ A;  3Q5W A;  2OA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...