3KINB

Kinesin (dimeric) from rattus norvegicus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
NKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVIQHLEVELNRWRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of dimeric kinesin and implications for microtubule-dependent motility.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
molecule keywords KINESIN HEAVY CHAIN
total genus 37
structure length 117
sequence length 117
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1980 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kinB00
3KINB
chains in the Genus database with same CATH superfamily
4GIWA 3QUJA 3CX6B 5L3EB 2LSJA 5EK4A 1J5WA 3HKEE 3O9XA 5FL0A 3B5MA 4HFBA 4UELA 1S35A 2WZIA 1HG5A 5F5WA 3UUNA 5ABFB 4JI0T 4AKIA 1OEDE 3FB2A 3IHRA 3ZLIA 4X1KE 5LHHB 4Z91A 1SUMB 3AA6B 4B3RT 3QC9A 2M6IA 4E7SA 2H88A 5AQSB 2DNXA 5AFUL 4DR4T 1IBMT 3Q2MA 3OVUA 4UV9B 2CXLA 4O4IE 3JC6D 4F6RC 2NTYA 2YU2A 3LK3B 2BZBA 3PUGA 4A97A 4DR6T 2MAWA 2XUEA 2XY8B 1T98A 2EHOC 4DMWA 4J2CA 3OPCA 3RIUA 4X62T 2W63A 2CLYB 5FKYA 2PG8A 5LYJE 2DL1A 3C51A 2UXXB 2WWVA 2BS2A 2LT3A 4HN9A 3TLUA 4YTMA 2PBIA 5AQMB 1KF6A 2BS4A 2A2FX 4YHJA 4C91A 5HXEA 5KMGP 2X66A 5AQNB 4ILBA 1W0AA 1US7B 2QYWA 4DV4T 2QA7A 4ZZBA 2BKPA 2NW7A 3X1DA 2JMHA 2HHHT 2X0YA 2NWBA 3IA3A 3JADA 4HWCA 4IDZA 4NIQA 5JR9B 3KDSE 2JJ9A 4O4LE 2JPFA 4EEBA 2ZM2A 3H37A 1J5ET 3C64A 3UU5A 4LMLA 4YY3T 2YDQA 2WS3A 4TZ4C 4B6XA 4U3CA 2HH7A 3PUSA 2FUPA 2V5CA 3AEDA 4AQGA 3RF1A 3P50A 4U2ZA 5HAXA 2L8KA 5LP6E 2DI4A 2IDOB 5JDNA 3TLVA 4LF9T 1VCTA 3PUZF 3CKDA 4JEUB 4TWHA 5CJ5A 3PJAA 2XAFB 4AKRB 2VQFT 4HWHA 2RPAA 2YEVC 3GMIA 4Q25A 2LOSA 3MKDA 3MZKB 3PUVF 2V26A 2V5DA 3AA1B 4DO0A 3RIAA 4CXWA 3UU6A 4KHZF 4CI3B 4OFZA 1XMQT 3RYHE 1AJ3A 4ADZA 3AA0B 4HFHA 4NUUA 1GQEA 3HKBE 2H7VC 4WZXA 4X5TA 1SA0E 2OLTA 2Y48B 4X20E 4EXTA 4O4HE 4JI7T 5A1LA 2RP4A 2BBHA 2CBIA 2XQ3A 4QXCB 3SFEA 2YDSA 1N34T 2UUAT 4CI1B 4JI1T 4YJ2E 3ZC1A 2V7IA 3ZT7A 1UK5A 1WYCA 2MTQA 4TWFA 2ZM0A 3RI5A 2BDEA 4HE8A 5HXRA 4DR5T 4I50E 1WYBA 2KSRA 3N9NA 4ZHQE 4OK0A 4HFCA 3AAAB 1G8XA 2R6GF 3ZYKA 2CCQA 4P0BA 4U72A 3UU8A 5ABHA 5JH7E 4ILCA 4YLHA 2WY2A 2FJBA 2VQET 5LHIB 2UUBT 3SOLA 2N2NA 1HF8A 1KNPA 1R8IA 3RKOA 3BK9A 3P8CD 2CA5A 4WW0A 2LKHA 3ZT5A 3PTRB 4GYSA 4DR3T 4JYAT 1OEDC 2VL0A 2WDQA 2KT9A 2WMNA 3PJAJ 4DV1T 2HPJA 2SPCA 4QH4A 1XNQT 2JQ9A 5AQQB 3AAIA 1OWAA 3TLWA 4YSZA 1ZKEA 4M1PA 4LFCT 3ZYMA 4DV7T 5F3JA 4AQFA 1S94A 3R6NA 3FBZA 2ZM6T 2DCFA 4JI6T 4MLKA 4LF7T 3B57A 3ONLC 5FXVA 2AXDS 4Z8XA 5LHGB 4EYUA 4EZ4A 5EK2A 2W62A 5AQTB 5FY7A 4JI5T 2LHRA 5L47A 4QX7B 5L4EA 4IL4A 2IHR1 1KNZA 2X0LB 2E2AA 2XQYA 3ONJA 4ZI7E 5H6QB 4QXBB 5LG3A 4PW8A 4U33A 4OYKA 2GK9A 2CHOA 4ZI2D 4HWFA 4E7ZA 3EVYA 3L09A 2YU1A 5L3FB 1BR0A 1D0YA 1LRZA 4GK0E 1JNRA 4P09A 3ONXA 2B76A 3N9MA 4UVBB 4H63V 5FNVE 3ZYLA 3RQWA 2H7OA 3ZSTA 4LMKA 4UF0B 2OA5A 2W4XA 2X9WA 4WYVA 4IGUA 2X9HA 4CN6A 5LXTE 2KNDA 5HYAA 4JI4T 2FBWA 2XQ9A 4HFIA 3N2GE 3ZCJA 3LBXB 3F57A 3M3ZB 2BVLA 4ILAA 4ZOLE 4DV6T 1WFDA 2E9XD 2KMFA 2XQ4A 2CXFA 3CX8B 3MXZA 4JUYA 4EEDA 1Z8UA 2NOXA 2WDRA 2XM1A 3ETUA 3RQUA 5CB4E 4O4JE 2E9XA 3F2EA 3VKHA 2RA1A 2LE8A 3EDUA 5AQHB 1CHUA 4U2YA 4C90A 4TNVA 2OV9A 4EYYR 2X51A 1HNXT 4TV9E 2C5JA 2CPTA 2FJAA 1UURA 4LF8T 5JDMA 3A5XA 2Q9QC 1WR0A 2UUCT 3FXEB 4OHFA 1MNDA 3FHNA 2J47A 2PFVA 5ADXL 5LJMA 3UQ7A 4P1NA 3Q5WA 1MNEA 3OJAA 2MYSA 2XJ7A 3RYFE 3UU4A 1SE7A 4GOUA 3AE8A 4XAXB 1U4QA 3HA4A 4BAYB 4IREA 5LCYA 4CZZB 5EZYE 4JBWF 1XZYA 3I9WA 3AVSA 5CGMA 3PURA 2H89A 2VB6A 2UXNB 3KBUA 3FBLA 3LFMA 2JRKA 3LK2B 4PK4A 5IHYA 4A5XA 4EAHA 2W00A 4ISTA 1IJ5A 5FVLA 2ES0A 2JMKA 3KINB 4K0UA 1NAFA 3ANWB 4JI2T 3ZPOA 3RGLA 4AIUA 3QB5K 2FJDA 2E9XC 3K1SA 1FIOA 3VHLA 3Q5EA 3MK7C 3VR9A 4AQYT 1U5PA 3N9QA 5HEOA 1HNWT 2J1DG 3RPUA 3PU8A 1HX8A 4MHCA 1YQ3A 1BR2A 4QH1A 5FP3A 3UTKA 3WAKA 2JQHA 4BA9A 4QHOA 2LJLA 5L3DB 2XQAA 2V8SV 2LSGA 1QUUA 1KK7A 4DUZT 4LF6T 2WZHA 2IW5B 4DR1T 4ZI3C 2BBJA 2M67A 4WNKA 4EZHA 1IBLT 3LK42 2X9XA 2VKDA 4LF4T 2XAHB 3UU3A 3ZT6A 3EDVA 5AQOB 4DV3T 1D1CA 2FJEA 3EI0A 4IE5A 5FXZA 3VU7H 3J9X1 3O1JA 4GK5E 2V1DB 1UUSA 3RHWA 3U78A 1ZP0A 4L9IA 3ZMVB 4DV0T 5F8PA 5JR9C 5JRCB 1YD8G 1VOMA 5ABFA 4H9NC 3Q5XA 3CPZA 4ZS2A 4HGAA 2VVSA 1JNZA 1M62A 4U31A 3A8YC 2BS3A 5LA6E 1HS7A 5CFBA 1MMAA 2BG9B 5HEGA 3ZMZB 2NW9A 3SFDA 4YXDA 3AEGA 5L2LA 2Q9QB 3CIRA 5L3BB 4BJNA 5AQUB 5LMUT 4DR2T 2NW8A 2CBJA 3ZCIA 4QH5A 4F8HA 1UX4A 5C3JA 1WRDA 5HEJA 1N36T 4CQIA 4FJOA 4IHJE 2UXDT 4YTPA 3OYZA 4ZZCA 4DV2T 4IT4A 2D9DA 2E8IA 3NZQA 4H9PC 5FY0A 2LKGA 2LRLA 2Q9QA 5J0ZA 2KWIB 2DHRA 3CQCB 4HFDA 4I55E 3RIFA 3G06A 3RYCE 1KNRA 3EUHA 4N78D 2XPKA 1BR1A 1Y01A 2NP9A 2QRXA 2XQ6A 2XTLA 3ABVA 4IDNA 1VRBA 4PFPA 5DQWA 5GONE 2D2SA 2QVAA 4DMVA 1OEDB 4HFEA 2YDRA 2D0UA 3CWZB 5KXJA 5LJNA 5E0OA 4ZS3A 5JDLA 2PTFA 1YKHB 2A72A 2N9DA 1Y64B 3CK6A 1CUNA 5FXXA 2J4GA 5FMNA 4ZEYA 4HWDA 2MOZA 2VKJA 1XWMA 3ZN1B 4IE7A 1MMNA 3AA7B 3O4XE 1ZEEA 3ZSSA 1QSDA 4EIWA 4B3ST 2X9YA 3EHZA 2LSIA 2JQKA 1W0BA 3O1HA 3RRCA 3KFWX 3UULA 3Q9DA 4BJMA 3PV0F 5CA1E 1FMWA 3HR0A 2I59A 3NZPA 3P7IA 2N1GA 2X0HA 2XAQB 4YJ3E 1E7PA 3MA9A 4Z90A 3NRYA 3A7MA 4B3MT 1E1HB 1FMVA 4V1Av 5ABGA 2WP9A 4A98A 2C5KT 4ASKA 3FZHB 4WBNE 3LDQB 4L5GA 4QXHB 4PJLA 2XQ7A 3O1IA 4KUMB 3VRAA 2IAKA 3I0QA 5JDGA 5JREA 2NTXA 4UV8B 4UXNB 1FJGT 2VVNA 2WBLA 4OX9T 3JAEA 3RC8A 1FEWA 4IDOA 4TV8E 2UXCT 4JV5T 4L0RA 1M7KA 3N2KE 3AXJB 3RH3A 4YHHT 2WQYA 2LEHA 2E5VA 3CVRA 5ETWA 1IZNB 4QX8B 3E08A 5IYZE 3N9LA 3IBPA 4XBFB 2CHNA 3RRWA 4KMCA 4NPPA 2I6HA 2EHOA 3UUBA 3C4ZA 3ZEFB 5BMVE 2I0MA 1L0VA 3J7Yq 4PAGA 5FXWA 3NWIA 2K48A 2K24A 2WDVA 3AB3B 4JLEA 4COFA 4B3TT 1NWMX 2HN2A 3K3OA 3ZMTB 4OYJA 5AQJB 3CMLA 4LF5T 2IUBA 1MMGA 2NR4A 2UXBT 3ZMUB 2DWKA 3AE3A 3N9OA 2Q9QD 2LRKA 4QWNB 5AQLB 4HTEA 5LG4A 4DIDB 2A9UA 2WSSV 3UUXB 2KWHA 1SHZC 3UQ4A 4ANJA 4AI6A 3NKZA 3AEBA 5FY1A 4CN4A 3PUQA 2A3DA 2YKSA 1B7TA 2W2UA 3P4RA 2BG9C 3P4SA 5J1GA 4DBRA 3T1YT 1I6ZA 3ZMSB 3JCFA 2KINB 1LVKA 4CXXA 2X67A 3NBXX 3AECA 5AQKB 3ZC0A 1IJ6A 4G63A 5LMNT 4X64T 3AE5A 4LFBT 2Y6XA 5L3GB 2WAUA 2VWAA 3RLFF 4KP3C 4MFRA 4NXMT 4LFAT 2BKOA 3GN5A 4U7YA 3T1HT 3PU3A 2J62A 4X1IE 1X79A 2EHOD 2EHOB 2ODUA 2XQ8A 2XAJB 1Z0PA 1WLXA 4NUVA 2HN1A 2WM9A 4CI2B 3C50A 1ZV4X 3S4UA 1O3XA 5DJQC 1EZ3A 2ZLYA 2L9QA 4AQFC 1MIVA 1E2AA 4CXYA 2Y8DA 1WR6A 3EABA 2QGSA 2WCAA 2YK0A 3OYXA 3RKGA 1W09A 3B13A 4DUYT 4DBQA 3K8PC 4DV5T 2AE9A 3I1AA 3P4PA 4HEAA 4NXNT 3W15B 2WU5A 3FZMB 3L39A 4TNWA 3QB5A 3LG7A 2V7JA 3AE4A 3KV6A 3IF8B 4H9QC 4O2BE 3ETVA 1W9RA 5LB7B 5BR8T 2V6YA 2V7LA 5AQFB 4G2AA 4X66T 3KV4A 2JQQA 4CN1A 2W61A 5FYMA 4H63H 3AE6A 4TN7B 1MIWA 3K3NA 1UCUA 3LBXA 4KI0F 2XZEA 3FZKB 2LSKA 3RC3A 3ZN0B 5J2UE 3VKGA 3CQXC 3BQIA 3M65A 4XZCA 2W0GA 5HEHA 1IAPA 1T72A 3AXJA 4IDQA 4KX6A 2LLYA 5DQVA 5AQPB 3H3AA 2YINA 4QKNA 4TUYE 5L4HA 5C2TA 3UUMA 3QNUA 4PJMA 1UX5A 2ZM8A 3AE1A 3K3QC 4TWDA 4KHPT 1D0ZA 3JC6C 4PJJA 3T8OA 3RYIE 1QLBA 4IE6A 4U74A 2V6YB 3AE7A 1LVFA 5JDHA 2MBGA 3KV5A 4PFOA 4AKGA 3QOFA 4YFSA 2V6XA 5AQGB 5DABA 1XMOT 2V7MA 5L3CB 3PE0A 1HNZT 1KFYA 2HPLA 4HWIB 4ZI3D 3TLSA 5FVKA 4JEHB 4FI5A 5IUXA 4H9OC 2K9AA 2IC6A 3ANWA 2ACXA 3WAJA 1ZHCA 3UT5E 2XSAA 2MPKA 5HEUA 3PUYF 5LNKA 3FZLB 1MIYA 2KLQA 1WCRA 3F31A 5JDFA 2IIUA 1ZOYA 2DWGA 4AISA 5HWXA 5JTGA 2E5LT 2M6BA 2WWUA 4GKJT 2XHEB 4JI8T 3LJCA 3V5SA 3BQLA 5HCMA 4A56A 2G0UA 3N9PA 5LGNB 3AE9A 3N2OA 2BG9A 4UEMA 2CEAA 2D5UA 5EK3A 5AQIB 4EV6A 4IE0A 2CE7A 3C98B 3R84B 4UF0A 4EB6E 5IWAT 1YXRA 4GKKT 1D1BA 4EOZB 4O2AE 3ESLA 2UU9T 2XM2A 2Z6EA 4PK5A 5LBMA 2VASA 4HKAA 4K0KT 4ZXLA 3AVRA 2V7KA 2VKHA 3NRXA 1UGOA 2D0TA 3EAMA 3HI2A 3SS1A 1V9DA 1KEYA 1DU2A 2WB5A 5HXCA 4AXPA 3GN5B 3AE2A 4ILUA 4UVCB 5HXSA 3HL6A 4UR9A 2X68A 1I94T 5JRCA 2XASB 2XSBA 2W67A 4HFVA 4AKLA 3L8RA 2WU2A 3ZJ1A 3TKLB 4KBMB 1HG2A 1X9BA 2VL8A 3RX6A 4UVAB 3VR8A 4ISSA 2YN6A 5TAOA 1YKEB 2JIWA 2PJQA 3KV9A 4MBQA 4DNDA 5CA0E 5LOVE 2C0SA 5KX5E 1T8BA 3HKDE 4AKHA 4YTNA 4MALA 3CX7B 3SRZA 2IC9A 3NVOA 3V5UA 4YT0A 5JDQA 1G73A 2CM0A 1XNRT 2C5IT 2CWOA 2E9XB 3I9YA 2CLYC 3KVBA 3OKQA 4I4TE 3UFGA 2LM9A 4LMJA 2CWYA 2XQ5A 1HCIA 2VK9A 4UIGA 5KDMC 1D0XA 2P9BA 1BR4A 2ACZA 2LOPA 2F4VT 1NEKA 1N32T 2W66A 2ODVA 3BQKA 3P4WA 4TX5A 4X1YE 5LGUB 1J1JA 2VKOA 3L3PA 4EGWA 1IBKT 2WMOA 3U3IA 3AEEA 3CQGB 3FZFB 3UFEA 4WBOA 4IE4A 5LGTB 4PNIA 4U7IA 2B1EA 2KZ7B 3GA8A 4PK6A 5J2TE 1YQ4A 3AEAA 3PDYA 1HFAA 5H6RB 2IMLA 4GYRA 1OXZA 3I0OA 3LSVA 4X65T 1XDOA 3DTOA 2L3LA 2LM2A 2CMRA 4YSXA 2BVMA 1NENA 2XAGB 3VRBA 3PUWF 3PUXF 2LHNA 3P4QA 4PJNA 4I43B 3D0TA 3C4WA 5ABEA 2BG9E 3MACA 3HKCE 3KBTA 2K3WA 3Q5DA 3E22E 2CXDA 4ERRA 5HWYA 3E0ZA 5FL1A 1MMDA 5M4YA 2KXPB 4P0AA 3IEEA 1VCSA 3DJBA 3SWHA 1OEDA 3OTOT 3ZKRA 3AEFA 3GWHA 5HCJA 2LSYA 4H9SE 1HX1B 5AQRB 2K5BB 3TLTA 2CRBA 3C4XA 3JAFA 3PUAA 3KVAA 3MJXA 3ZJ2A 1HR0T 4DR7T 2YOEA 4ZI2C 1YW0A 2VURA 5JR9A 1HTJF 4I0UA 5JVDE 1LKXA 4IIJE 5LBQB 3H3MA 4IL9A 5AQVB 3RIUC 4IDPA 2H3RA 5HXHA 4DVDA 2DLRA 5JQGE 3N5LA 2ZMAA 1H7CA 5C8YE 1D1AA 3WI3A 2BKNA 4YSYA 1N33T 4JI3T 1XDPA 4H9RC 3AAEB 4O8SA 3DP7A 1T7SA 3FXDB 3OBVE 3QK6A
chains in the Genus database with same CATH topology
4GIWA 3QUJA 3CX6B 5L3EB 2LSJA 5EK4A 3HKEE 3O9XA 4UELA 1S35A 3UUNA 1HG5A 4AKIA 3IHRA 3FB2A 3ZLIA 4X1KE 5LHHB 3AA6B 3QC9A 4E7SA 5AFUL 2DNXA 3Q2MA 4UV9B 2CXLA 4O4IE 3JC6D 4F6RC 2NTYA 2YU2A 3LK3B 2BZBA 3PUGA 4DMWA 2XUEA 1T98A 2EHOC 4J2CA 2W63A 2CLYB 5LYJE 2PG8A 3C51A 2UXXB 4HN9A 2LT3A 2PBIA 4YHJA 2A2FX 4C91A 5HXEA 5KMGP 2X66A 1US7B 2QA7A 2NW7A 2JMHA 2NWBA 4IDZA 3KDSE 2JJ9A 4O4LE 2JPFA 2ZM2A 3H37A 3C64A 4B6XA 4TZ4C 2HH7A 3PUSA 4AQGA 5HAXA 2L8KA 5LP6E 2DI4A 5JDNA 3CKDA 4JEUB 2XAFB 4AKRB 3GMIA 2YEVC 2LOSA 3MKDA 3MZKB 2V26A 3AA1B 4DO0A 4CXWA 4CI3B 4OFZA 3RYHE 1AJ3A 3AA0B 4NUUA 3HKBE 2H7VC 4EXTA 1SA0E 2Y48B 4X20E 4O4HE 5A1LA 2RP4A 4QXCB 4CI1B 4YJ2E 3ZC1A 2V7IA 1WYCA 2MTQA 2ZM0A 2BDEA 4HE8A 5HXRA 4I50E 1WYBA 3N9NA 4ZHQE 4OK0A 3AAAB 1G8XA 3ZYKA 2CCQA 4P0BA 4U72A 5JH7E 4YLHA 5LHIB 3SOLA 2N2NA 1HF8A 3RKOA 3BK9A 3P8CD 2CA5A 4WW0A 3PTRB 4GYSA 2KT9A 2WMNA 2HPJA 2SPCA 3AAIA 1OWAA 1ZKEA 4M1PA 3ZYMA 5F3JA 4AQFA 1S94A 3R6NA 3FBZA 2DCFA 4MLKA 3B57A 5FXVA 5LHGB 4Z8XA 4EYUA 4EZ4A 5EK2A 2W62A 5FY7A 2LHRA 4QX7B 1KNZA 2X0LB 4ZI7E 2XQYA 5H6QB 4QXBB 4PW8A 4OYKA 2GK9A 4ZI2D 3EVYA 3L09A 2YU1A 5L3FB 1BR0A 1D0YA 1LRZA 4GK0E 4P09A 3ONXA 5FNVE 3N9MA 4UVBB 4H63V 3ZYLA 4CI2B 4CZZB 2H7OA 5JR9B 4UF0B 2OA5A 2X9WA 4IGUA 2X9HA 5LXTE 2KNDA 5HYAA 3ZCJA 3N2GE 3LBXB 3F57A 4ZOLE 2BVLA 2E9XD 2KMFA 3CX8B 3MXZA 2CXFA 4JUYA 2NOXA 3ETUA 5CB4E 4O4JE 2E9XA 3F2EA 3VKHA 2RA1A 2LE8A 3EDUA 4EYYR 4C90A 2X51A 4TV9E 2C5JA 5JDMA 3A5XA 2Q9QC 3FXEB 4OHFA 1MNDA 3FHNA 2PFVA 5ADXL 5LJMA 3Q5WA 1MNEA 3OJAA 2MYSA 3RYFE 4GOUA 4XAXB 1U4QA 3HA4A 4BAYB 5LCYA 5EZYE 3I9WA 3AVSA 3PURA 2VB6A 2UXNB 3KBUA 3FBLA 3LFMA 2JRKA 3LK2B 4PK4A 5IHYA 4EAHA 2W00A 4ISTA 1IJ5A 2ES0A 2JMKA 3KINB 4K0UA 1NAFA 3ANWB 3ZPOA 4E7ZA 3VHLA 2E9XC 1FIOA 3MK7C 1U5PA 3N9QA 2J1DG 3RPUA 3PU8A 1HX8A 4MHCA 1BR2A 5FP3A 3UTKA 3WAKA 4BA9A 5L3DB 4QHOA 2LJLA 2LSGA 1QUUA 1KK7A 2IW5B 4ZI3C 4WNKA 2M67A 4EZHA 3LK42 2X9XA 2VKDA 2XAHB 3EDVA 1D1CA 4IE5A 5FXZA 3VU7H 3J9X1 3O1JA 4GK5E 2V1DB 3U78A 3ZMVB 4L9IA 5F8PA 5JR9C 5JRCB 1YD8G 1VOMA 4H9NC 3Q5XA 3CPZA 4ZS2A 4HGAA 5LA6E 1HS7A 1MMAA 3ZMZB 2NW9A 5L2LA 2Q9QB 5L3BB 4BJNA 2NW8A 3ZCIA 1UX4A 1WRDA 4CQIA 4FJOA 4IHJE 3OYZA 3NZQA 2E8IA 4H9PC 5FY0A 2Q9QA 2KWIB 2DHRA 3CQCB 4I55E 3RYCE 3EUHA 4N78D 1BR1A 2NP9A 2XTLA 4PFPA 5DQWA 5GONE 1VRBA 4DMVA 2D2SA 2D0UA 3CWZB 5LJNA 5E0OA 4ZS3A 5JDLA 1YKHB 2A72A 2N9DA 1Y64B 1CUNA 5FXXA 5FMNA 2MOZA 2VKJA 3ZN1B 4IE7A 1MMNA 3AA7B 3O4XE 1ZEEA 4EIWA 1QSDA 2X9YA 2LSIA 3O1HA 3RRCA 3KFWX 3UULA 3Q9DA 4BJMA 5CA1E 1FMWA 3HR0A 2I59A 3NZPA 3P7IA 2N1GA 5JVDE 2XAQB 4YJ3E 3MA9A 4ADZA 3NRYA 1E1HB 1FMVA 4V1Av 2C5KT 4ASKA 4WBNE 4L5GA 4QXHB 4PJLA 3O1IA 4KUMB 5JDGA 2IAKA 3I0QA 5JREA 2NTXA 4UV8B 4UXNB 2WBLA 3RC8A 1FEWA 4TV8E 4L0RA 3N2KE 3RH3A 2LEHA 3CVRA 5ETWA 1IZNB 4QX8B 3E08A 5IYZE 3N9LA 3IBPA 4XBFB 3RRWA 4KMCA 2EHOA 3C4ZA 3ZEFB 5BMVE 3J7Yq 4PAGA 5FXWA 2K48A 2K24A 4JLEA 3AB3B 1NWMX 3K3OA 3ZMTB 4OYJA 3CMLA 1MMGA 3ZMUB 2DWKA 3N9OA 5LG4A 2Q9QD 4QWNB 4HTEA 3UUXB 2WSSV 4ANJA 2KWHA 1SHZC 4AI6A 5FY1A 3PUQA 2A3DA 1B7TA 5J1GA 4DBRA 3ZMSB 2KINB 1LVKA 4CXXA 2X67A 3NBXX 3ZC0A 1IJ6A 4G63A 2Y6XA 5L3GB 2WAUA 2VWAA 4KP3C 4MFRA 3GN5A 3PU3A 4X1IE 1X79A 2EHOD 2EHOB 2ODUA 2XAJB 1Z0PA 1WLXA 4NUVA 2WM9A 3C50A 1ZV4X 3S4UA 1O3XA 5DJQC 1EZ3A 2ZLYA 2L9QA 4AQFC 1MIVA 4CXYA 2Y8DA 1WR6A 2QGSA 2YK0A 3OYXA 3B13A 4DBQA 3K8PC 4HEAA 3I1AA 3W15B 3LG7A 2V7JA 3KV6A 4O2BE 3IF8B 4H9QC 3ETVA 2V7LA 4G2AA 3KV4A 2JQQA 2W61A 5FYMA 4H63H 4TN7B 1MIWA 3K3NA 1UCUA 3LBXA 3RC3A 3ZN0B 5J2UE 2LSKA 3VKGA 3CQXC 3BQIA 3M65A 4XZCA 2W0GA 1IAPA 5DQVA 3H3AA 2YINA 4QKNA 4TUYE 3UUMA 4PJMA 1UX5A 2ZM8A 3K3QC 1D0ZA 3JC6C 4PJJA 3T8OA 3RYIE 4IE6A 4U74A 1LVFA 5JDHA 2MBGA 3KV5A 4PFOA 4AKGA 4YFSA 5DABA 2V7MA 5L3CB 3PE0A 2HPLA 4ZI3D 4JEHB 4FI5A 4H9OC 2K9AA 2IC6A 3ANWA 2ACXA 3WAJA 1ZHCA 3UT5E 5LNKA 1MIYA 2KLQA 3F31A 5JDFA 5HWXA 2DWGA 2WWUA 2XHEB 3LJCA 3V5SA 3BQLA 4A56A 2G0UA 3N9PA 5LGNB 3N2OA 4UEMA 2CEAA 2D5UA 5EK3A 4IE0A 2CE7A 3C98B 3R84B 4UF0A 4EB6E 1D1BA 4EOZB 4O2AE 3ESLA 2Z6EA 4PK5A 5LBMA 2VASA 4HKAA 3AVRA 2V7KA 2VKHA 3NRXA 3SS1A 3HI2A 2D0TA 1V9DA 5HXCA 4AXPA 3GN5B 4ILUA 4UVCB 5HXSA 3HL6A 2X68A 5JRCA 2XASB 4HFVA 4AKLA 3ZJ1A 3TKLB 4KBMB 1HG2A 2VL8A 3RX6A 4UVAB 4ISSA 5TAOA 1YKEB 3KV9A 2PJQA 5CA0E 4MBQA 4DNDA 5LOVE 2C0SA 5KX5E 3HKDE 4AKHA 4MALA 3CX7B 3SRZA 2IC9A 5JDQA 3V5UA 1G73A 2CM0A 2C5IT 2CWOA 2E9XB 3I9YA 2CLYC 3KVBA 3OKQA 4I4TE 2LM9A 5KDMC 2CWYA 1HCIA 2VK9A 4UIGA 1D0XA 2P9BA 1BR4A 2LOPA 2ODVA 3BQKA 4TX5A 4X1YE 5LGUB 2VKOA 3L3PA 2WMOA 3U3IA 3CQGB 3UFEA 4WBOA 4IE4A 5LGTB 4PNIA 2B1EA 2KZ7B 3GA8A 4PK6A 5J2TE 3PDYA 1HFAA 5H6RB 4GYRA 1OXZA 3I0OA 3DTOA 2L3LA 2CMRA 2BVMA 2XAGB 2LHNA 4PJNA 4I43B 3D0TA 3C4WA 3MACA 3HKCE 3KBTA 3E22E 2CXDA 4ERRA 5HWYA 3E0ZA 1MMDA 5M4YA 2KXPB 4P0AA 3IEEA 3SWHA 3DJBA 3GWHA 2LSYA 4H9SE 2K5BB 3C4XA 3PUAA 3KVAA 3MJXA 3ZJ2A 4ZI2C 1YW0A 5JR9A 1HTJF 1LKXA 4IIJE 5LBQB 5HXHA 5JQGE 2H3RA 4DVDA 2DLRA 3N5LA 2ZMAA 1H7CA 5C8YE 1D1AA 3WI3A 4H9RC 3AAEB 4O8SA 3DP7A 3FXDB 3OBVE 3QK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KIN B; 
#chains in the Genus database with same CATH topology
 4GIW A;  3QUJ A;  3CX6 B;  5L3E B;  2LSJ A;  5EK4 A;  1J5W A;  3HKE E;  3O9X A;  5FL0 A;  3B5M A;  4HFB A;  4UEL A;  1S35 A;  2WZI A;  1HG5 A;  5F5W A;  3UUN A;  5ABF B;  4JI0 T;  4AKI A;  1OED E;  3FB2 A;  3IHR A;  3ZLI A;  4X1K E;  5LHH B;  4Z91 A;  1SUM B;  3AA6 B;  4B3R T;  3QC9 A;  2M6I A;  4E7S A;  2H88 A;  5AQS B;  2DNX A;  5AFU L;  4DR4 T;  1IBM T;  3Q2M A;  3OVU A;  4UV9 B;  2CXL A;  4O4I E;  3JC6 D;  4F6R C;  2NTY A;  2YU2 A;  3LK3 B;  2BZB A;  3PUG A;  4A97 A;  4DR6 T;  2MAW A;  2XUE A;  2XY8 B;  1T98 A;  2EHO C;  4DMW A;  4J2C A;  3OPC A;  3RIU A;  4X62 T;  2W63 A;  2CLY B;  5FKY A;  2PG8 A;  5LYJ E;  2DL1 A;  3C51 A;  2UXX B;  2WWV A;  2BS2 A;  2LT3 A;  4HN9 A;  3TLU A;  4YTM A;  2PBI A;  5AQM B;  1KF6 A;  2BS4 A;  2A2F X;  4YHJ A;  4C91 A;  5HXE A;  5KMG P;  2X66 A;  5AQN B;  4ILB A;  1W0A A;  1US7 B;  2QYW A;  4DV4 T;  2QA7 A;  4ZZB A;  2BKP A;  2NW7 A;  3X1D A;  2JMH A;  2HHH T;  2X0Y A;  2NWB A;  3IA3 A;  3JAD A;  4HWC A;  4IDZ A;  4NIQ A;  5JR9 B;  3KDS E;  2JJ9 A;  4O4L E;  2JPF A;  4EEB A;  2ZM2 A;  3H37 A;  1J5E T;  3C64 A;  3UU5 A;  4LML A;  4YY3 T;  2YDQ A;  2WS3 A;  4TZ4 C;  4B6X A;  4U3C A;  2HH7 A;  3PUS A;  2FUP A;  2V5C A;  3AED A;  4AQG A;  3RF1 A;  3P50 A;  4U2Z A;  5HAX A;  2L8K A;  5LP6 E;  2DI4 A;  2IDO B;  5JDN A;  3TLV A;  4LF9 T;  1VCT A;  3PUZ F;  3CKD A;  4JEU B;  4TWH A;  5CJ5 A;  3PJA A;  2XAF B;  4AKR B;  2VQF T;  4HWH A;  2RPA A;  2YEV C;  3GMI A;  4Q25 A;  2LOS A;  3MKD A;  3MZK B;  3PUV F;  2V26 A;  2V5D A;  3AA1 B;  4DO0 A;  3RIA A;  4CXW A;  3UU6 A;  4KHZ F;  4CI3 B;  4OFZ A;  1XMQ T;  3RYH E;  1AJ3 A;  4ADZ A;  3AA0 B;  4HFH A;  4NUU A;  1GQE A;  3HKB E;  2H7V C;  4WZX A;  4X5T A;  1SA0 E;  2OLT A;  2Y48 B;  4X20 E;  4EXT A;  4O4H E;  4JI7 T;  5A1L A;  2RP4 A;  2BBH A;  2CBI A;  2XQ3 A;  4QXC B;  3SFE A;  2YDS A;  1N34 T;  2UUA T;  4CI1 B;  4JI1 T;  4YJ2 E;  3ZC1 A;  2V7I A;  3ZT7 A;  1UK5 A;  1WYC A;  2MTQ A;  4TWF A;  2ZM0 A;  3RI5 A;  2BDE A;  4HE8 A;  5HXR A;  4DR5 T;  4I50 E;  1WYB A;  2KSR A;  3N9N A;  4ZHQ E;  4OK0 A;  4HFC A;  3AAA B;  1G8X A;  2R6G F;  3ZYK A;  2CCQ A;  4P0B A;  4U72 A;  3UU8 A;  5ABH A;  5JH7 E;  4ILC A;  4YLH A;  2WY2 A;  2FJB A;  2VQE T;  5LHI B;  2UUB T;  3SOL A;  2N2N A;  1HF8 A;  1KNP A;  1R8I A;  3RKO A;  3BK9 A;  3P8C D;  2CA5 A;  4WW0 A;  2LKH A;  3ZT5 A;  3PTR B;  4GYS A;  4DR3 T;  4JYA T;  1OED C;  2VL0 A;  2WDQ A;  2KT9 A;  2WMN A;  3PJA J;  4DV1 T;  2HPJ A;  2SPC A;  4QH4 A;  1XNQ T;  2JQ9 A;  5AQQ B;  3AAI A;  1OWA A;  3TLW A;  4YSZ A;  1ZKE A;  4M1P A;  4LFC T;  3ZYM A;  4DV7 T;  5F3J A;  4AQF A;  1S94 A;  3R6N A;  3FBZ A;  2ZM6 T;  2DCF A;  4JI6 T;  4MLK A;  4LF7 T;  3B57 A;  3ONL C;  5FXV A;  2AXD S;  4Z8X A;  5LHG B;  4EYU A;  4EZ4 A;  5EK2 A;  2W62 A;  5AQT B;  5FY7 A;  4JI5 T;  2LHR A;  5L47 A;  4QX7 B;  5L4E A;  4IL4 A;  2IHR 1;  1KNZ A;  2X0L B;  2E2A A;  2XQY A;  3ONJ A;  4ZI7 E;  5H6Q B;  4QXB B;  5LG3 A;  4PW8 A;  4U33 A;  4OYK A;  2GK9 A;  2CHO A;  4ZI2 D;  4HWF A;  4E7Z A;  3EVY A;  3L09 A;  2YU1 A;  5L3F B;  1BR0 A;  1D0Y A;  1LRZ A;  4GK0 E;  1JNR A;  4P09 A;  3ONX A;  2B76 A;  3N9M A;  4UVB B;  4H63 V;  5FNV E;  3ZYL A;  3RQW A;  2H7O A;  3ZST A;  4LMK A;  4UF0 B;  2OA5 A;  2W4X A;  2X9W A;  4WYV A;  4IGU A;  2X9H A;  4CN6 A;  5LXT E;  2KND A;  5HYA A;  4JI4 T;  2FBW A;  2XQ9 A;  4HFI A;  3N2G E;  3ZCJ A;  3LBX B;  3F57 A;  3M3Z B;  2BVL A;  4ILA A;  4ZOL E;  4DV6 T;  1WFD A;  2E9X D;  2KMF A;  2XQ4 A;  2CXF A;  3CX8 B;  3MXZ A;  4JUY A;  4EED A;  1Z8U A;  2NOX A;  2WDR A;  2XM1 A;  3ETU A;  3RQU A;  5CB4 E;  4O4J E;  2E9X A;  3F2E A;  3VKH A;  2RA1 A;  2LE8 A;  3EDU A;  5AQH B;  1CHU A;  4U2Y A;  4C90 A;  4TNV A;  2OV9 A;  4EYY R;  2X51 A;  1HNX T;  4TV9 E;  2C5J A;  2CPT A;  2FJA A;  1UUR A;  4LF8 T;  5JDM A;  3A5X A;  2Q9Q C;  1WR0 A;  2UUC T;  3FXE B;  4OHF A;  1MND A;  3FHN A;  2J47 A;  2PFV A;  5ADX L;  5LJM A;  3UQ7 A;  4P1N A;  3Q5W A;  1MNE A;  3OJA A;  2MYS A;  2XJ7 A;  3RYF E;  3UU4 A;  1SE7 A;  4GOU A;  3AE8 A;  4XAX B;  1U4Q A;  3HA4 A;  4BAY B;  4IRE A;  5LCY A;  4CZZ B;  5EZY E;  4JBW F;  1XZY A;  3I9W A;  3AVS A;  5CGM A;  3PUR A;  2H89 A;  2VB6 A;  2UXN B;  3KBU A;  3FBL A;  3LFM A;  2JRK A;  3LK2 B;  4PK4 A;  5IHY A;  4A5X A;  4EAH A;  2W00 A;  4IST A;  1IJ5 A;  5FVL A;  2ES0 A;  2JMK A;  3KIN B;  4K0U A;  1NAF A;  3ANW B;  4JI2 T;  3ZPO A;  3RGL A;  4AIU A;  3QB5 K;  2FJD A;  2E9X C;  3K1S A;  1FIO A;  3VHL A;  3Q5E A;  3MK7 C;  3VR9 A;  4AQY T;  1U5P A;  3N9Q A;  5HEO A;  1HNW T;  2J1D G;  3RPU A;  3PU8 A;  1HX8 A;  4MHC A;  1YQ3 A;  1BR2 A;  4QH1 A;  5FP3 A;  3UTK A;  3WAK A;  2JQH A;  4BA9 A;  4QHO A;  2LJL A;  5L3D B;  2XQA A;  2V8S V;  2LSG A;  1QUU A;  1KK7 A;  4DUZ T;  4LF6 T;  2WZH A;  2IW5 B;  4DR1 T;  4ZI3 C;  2BBJ A;  2M67 A;  4WNK A;  4EZH A;  1IBL T;  3LK4 2;  2X9X A;  2VKD A;  4LF4 T;  2XAH B;  3UU3 A;  3ZT6 A;  3EDV A;  5AQO B;  4DV3 T;  1D1C A;  2FJE A;  3EI0 A;  4IE5 A;  5FXZ A;  3VU7 H;  3J9X 1;  3O1J A;  4GK5 E;  2V1D B;  1UUS A;  3RHW A;  3U78 A;  1ZP0 A;  4L9I A;  3ZMV B;  4DV0 T;  5F8P A;  5JR9 C;  5JRC B;  1YD8 G;  1VOM A;  5ABF A;  4H9N C;  3Q5X A;  3CPZ A;  4ZS2 A;  4HGA A;  2VVS A;  1JNZ A;  1M62 A;  4U31 A;  3A8Y C;  2BS3 A;  5LA6 E;  1HS7 A;  5CFB A;  1MMA A;  2BG9 B;  5HEG A;  3ZMZ B;  2NW9 A;  3SFD A;  4YXD A;  3AEG A;  5L2L A;  2Q9Q B;  3CIR A;  5L3B B;  4BJN A;  5AQU B;  5LMU T;  4DR2 T;  2NW8 A;  2CBJ A;  3ZCI A;  4QH5 A;  4F8H A;  1UX4 A;  5C3J A;  1WRD A;  5HEJ A;  1N36 T;  4CQI A;  4FJO A;  4IHJ E;  2UXD T;  4YTP A;  3OYZ A;  4ZZC A;  4DV2 T;  4IT4 A;  2D9D A;  2E8I A;  3NZQ A;  4H9P C;  5FY0 A;  2LKG A;  2LRL A;  2Q9Q A;  5J0Z A;  2KWI B;  2DHR A;  3CQC B;  4HFD A;  4I55 E;  3RIF A;  3G06 A;  3RYC E;  1KNR A;  3EUH A;  4N78 D;  2XPK A;  1BR1 A;  1Y01 A;  2NP9 A;  2QRX A;  2XQ6 A;  2XTL A;  3ABV A;  4IDN A;  1VRB A;  4PFP A;  5DQW A;  5GON E;  2D2S A;  2QVA A;  4DMV A;  1OED B;  4HFE A;  2YDR A;  2D0U A;  3CWZ B;  5KXJ A;  5LJN A;  5E0O A;  4ZS3 A;  5JDL A;  2PTF A;  1YKH B;  2A72 A;  2N9D A;  1Y64 B;  3CK6 A;  1CUN A;  5FXX A;  2J4G A;  5FMN A;  4ZEY A;  4HWD A;  2MOZ A;  2VKJ A;  1XWM A;  3ZN1 B;  4IE7 A;  1MMN A;  3AA7 B;  3O4X E;  1ZEE A;  3ZSS A;  1QSD A;  4EIW A;  4B3S T;  2X9Y A;  3EHZ A;  2LSI A;  2JQK A;  1W0B A;  3O1H A;  3RRC A;  3KFW X;  3UUL A;  3Q9D A;  4BJM A;  3PV0 F;  5CA1 E;  1FMW A;  3HR0 A;  2I59 A;  3NZP A;  3P7I A;  2N1G A;  2X0H A;  2XAQ B;  4YJ3 E;  1E7P A;  3MA9 A;  4Z90 A;  3NRY A;  3A7M A;  4B3M T;  1E1H B;  1FMV A;  4V1A v;  5ABG A;  2WP9 A;  4A98 A;  2C5K T;  4ASK A;  3FZH B;  4WBN E;  3LDQ B;  4L5G A;  4QXH B;  4PJL A;  2XQ7 A;  3O1I A;  4KUM B;  3VRA A;  2IAK A;  3I0Q A;  5JDG A;  5JRE A;  2NTX A;  4UV8 B;  4UXN B;  1FJG T;  2VVN A;  2WBL A;  4OX9 T;  3JAE A;  3RC8 A;  1FEW A;  4IDO A;  4TV8 E;  2UXC T;  4JV5 T;  4L0R A;  1M7K A;  3N2K E;  3AXJ B;  3RH3 A;  4YHH T;  2WQY A;  2LEH A;  2E5V A;  3CVR A;  5ETW A;  1IZN B;  4QX8 B;  3E08 A;  5IYZ E;  3N9L A;  3IBP A;  4XBF B;  2CHN A;  3RRW A;  4KMC A;  4NPP A;  2I6H A;  2EHO A;  3UUB A;  3C4Z A;  3ZEF B;  5BMV E;  2I0M A;  1L0V A;  3J7Y q;  4PAG A;  5FXW A;  3NWI A;  2K48 A;  2K24 A;  2WDV A;  3AB3 B;  4JLE A;  4COF A;  4B3T T;  1NWM X;  2HN2 A;  3K3O A;  3ZMT B;  4OYJ A;  5AQJ B;  3CML A;  4LF5 T;  2IUB A;  1MMG A;  2NR4 A;  2UXB T;  3ZMU B;  2DWK A;  3AE3 A;  3N9O A;  2Q9Q D;  2LRK A;  4QWN B;  5AQL B;  4HTE A;  5LG4 A;  4DID B;  2A9U A;  2WSS V;  3UUX B;  2KWH A;  1SHZ C;  3UQ4 A;  4ANJ A;  4AI6 A;  3NKZ A;  3AEB A;  5FY1 A;  4CN4 A;  3PUQ A;  2A3D A;  2YKS A;  1B7T A;  2W2U A;  3P4R A;  2BG9 C;  3P4S A;  5J1G A;  4DBR A;  3T1Y T;  1I6Z A;  3ZMS B;  3JCF A;  2KIN B;  1LVK A;  4CXX A;  2X67 A;  3NBX X;  3AEC A;  5AQK B;  3ZC0 A;  1IJ6 A;  4G63 A;  5LMN T;  4X64 T;  3AE5 A;  4LFB T;  2Y6X A;  5L3G B;  2WAU A;  2VWA A;  3RLF F;  4KP3 C;  4MFR A;  4NXM T;  4LFA T;  2BKO A;  3GN5 A;  4U7Y A;  3T1H T;  3PU3 A;  2J62 A;  4X1I E;  1X79 A;  2EHO D;  2EHO B;  2ODU A;  2XQ8 A;  2XAJ B;  1Z0P A;  1WLX A;  4NUV A;  2HN1 A;  2WM9 A;  4CI2 B;  3C50 A;  1ZV4 X;  3S4U A;  1O3X A;  5DJQ C;  1EZ3 A;  2ZLY A;  2L9Q A;  4AQF C;  1MIV A;  1E2A A;  4CXY A;  2Y8D A;  1WR6 A;  3EAB A;  2QGS A;  2WCA A;  2YK0 A;  3OYX A;  3RKG A;  1W09 A;  3B13 A;  4DUY T;  4DBQ A;  3K8P C;  4DV5 T;  2AE9 A;  3I1A A;  3P4P A;  4HEA A;  4NXN T;  3W15 B;  2WU5 A;  3FZM B;  3L39 A;  4TNW A;  3QB5 A;  3LG7 A;  2V7J A;  3AE4 A;  3KV6 A;  3IF8 B;  4H9Q C;  4O2B E;  3ETV A;  1W9R A;  5LB7 B;  5BR8 T;  2V6Y A;  2V7L A;  5AQF B;  4G2A A;  4X66 T;  3KV4 A;  2JQQ A;  4CN1 A;  2W61 A;  5FYM A;  4H63 H;  3AE6 A;  4TN7 B;  1MIW A;  3K3N A;  1UCU A;  3LBX A;  4KI0 F;  2XZE A;  3FZK B;  2LSK A;  3RC3 A;  3ZN0 B;  5J2U E;  3VKG A;  3CQX C;  3BQI A;  3M65 A;  4XZC A;  2W0G A;  5HEH A;  1IAP A;  1T72 A;  3AXJ A;  4IDQ A;  4KX6 A;  2LLY A;  5DQV A;  5AQP B;  3H3A A;  2YIN A;  4QKN A;  4TUY E;  5L4H A;  5C2T A;  3UUM A;  3QNU A;  4PJM A;  1UX5 A;  2ZM8 A;  3AE1 A;  3K3Q C;  4TWD A;  4KHP T;  1D0Z A;  3JC6 C;  4PJJ A;  3T8O A;  3RYI E;  1QLB A;  4IE6 A;  4U74 A;  2V6Y B;  3AE7 A;  1LVF A;  5JDH A;  2MBG A;  3KV5 A;  4PFO A;  4AKG A;  3QOF A;  4YFS A;  2V6X A;  5AQG B;  5DAB A;  1XMO T;  2V7M A;  5L3C B;  3PE0 A;  1HNZ T;  1KFY A;  2HPL A;  4HWI B;  4ZI3 D;  3TLS A;  5FVK A;  4JEH B;  4FI5 A;  5IUX A;  4H9O C;  2K9A A;  2IC6 A;  3ANW A;  2ACX A;  3WAJ A;  1ZHC A;  3UT5 E;  2XSA A;  2MPK A;  5HEU A;  3PUY F;  5LNK A;  3FZL B;  1MIY A;  2KLQ A;  1WCR A;  3F31 A;  5JDF A;  2IIU A;  1ZOY A;  2DWG A;  4AIS A;  5HWX A;  5JTG A;  2E5L T;  2M6B A;  2WWU A;  4GKJ T;  2XHE B;  4JI8 T;  3LJC A;  3V5S A;  3BQL A;  5HCM A;  4A56 A;  2G0U A;  3N9P A;  5LGN B;  3AE9 A;  3N2O A;  2BG9 A;  4UEM A;  2CEA A;  2D5U A;  5EK3 A;  5AQI B;  4EV6 A;  4IE0 A;  2CE7 A;  3C98 B;  3R84 B;  4UF0 A;  4EB6 E;  5IWA T;  1YXR A;  4GKK T;  1D1B A;  4EOZ B;  4O2A E;  3ESL A;  2UU9 T;  2XM2 A;  2Z6E A;  4PK5 A;  5LBM A;  2VAS A;  4HKA A;  4K0K T;  4ZXL A;  3AVR A;  2V7K A;  2VKH A;  3NRX A;  1UGO A;  2D0T A;  3EAM A;  3HI2 A;  3SS1 A;  1V9D A;  1KEY A;  1DU2 A;  2WB5 A;  5HXC A;  4AXP A;  3GN5 B;  3AE2 A;  4ILU A;  4UVC B;  5HXS A;  3HL6 A;  4UR9 A;  2X68 A;  1I94 T;  5JRC A;  2XAS B;  2XSB A;  2W67 A;  4HFV A;  4AKL A;  3L8R A;  2WU2 A;  3ZJ1 A;  3TKL B;  4KBM B;  1HG2 A;  1X9B A;  2VL8 A;  3RX6 A;  4UVA B;  3VR8 A;  4ISS A;  2YN6 A;  5TAO A;  1YKE B;  2JIW A;  2PJQ A;  3KV9 A;  4MBQ A;  4DND A;  5CA0 E;  5LOV E;  2C0S A;  5KX5 E;  1T8B A;  3HKD E;  4AKH A;  4YTN A;  4MAL A;  3CX7 B;  3SRZ A;  2IC9 A;  3NVO A;  3V5U A;  4YT0 A;  5JDQ A;  1G73 A;  2CM0 A;  1XNR T;  2C5I T;  2CWO A;  2E9X B;  3I9Y A;  2CLY C;  3KVB A;  3OKQ A;  4I4T E;  3UFG A;  2LM9 A;  4LMJ A;  2CWY A;  2XQ5 A;  1HCI A;  2VK9 A;  4UIG A;  5KDM C;  1D0X A;  2P9B A;  1BR4 A;  2ACZ A;  2LOP A;  2F4V T;  1NEK A;  1N32 T;  2W66 A;  2ODV A;  3BQK A;  3P4W A;  4TX5 A;  4X1Y E;  5LGU B;  1J1J A;  2VKO A;  3L3P A;  4EGW A;  1IBK T;  2WMO A;  3U3I A;  3AEE A;  3CQG B;  3FZF B;  3UFE A;  4WBO A;  4IE4 A;  5LGT B;  4PNI A;  4U7I A;  2B1E A;  2KZ7 B;  3GA8 A;  4PK6 A;  5J2T E;  1YQ4 A;  3AEA A;  3PDY A;  1HFA A;  5H6R B;  2IML A;  4GYR A;  1OXZ A;  3I0O A;  3LSV A;  4X65 T;  1XDO A;  3DTO A;  2L3L A;  2LM2 A;  2CMR A;  4YSX A;  2BVM A;  1NEN A;  2XAG B;  3VRB A;  3PUW F;  3PUX F;  2LHN A;  3P4Q A;  4PJN A;  4I43 B;  3D0T A;  3C4W A;  5ABE A;  2BG9 E;  3MAC A;  3HKC E;  3KBT A;  2K3W A;  3Q5D A;  3E22 E;  2CXD A;  4ERR A;  5HWY A;  3E0Z A;  5FL1 A;  1MMD A;  5M4Y A;  2KXP B;  4P0A A;  3IEE A;  1VCS A;  3DJB A;  3SWH A;  1OED A;  3OTO T;  3ZKR A;  3AEF A;  3GWH A;  5HCJ A;  2LSY A;  4H9S E;  1HX1 B;  5AQR B;  2K5B B;  3TLT A;  2CRB A;  3C4X A;  3JAF A;  3PUA A;  3KVA A;  3MJX A;  3ZJ2 A;  1HR0 T;  4DR7 T;  2YOE A;  4ZI2 C;  1YW0 A;  2VUR A;  5JR9 A;  1HTJ F;  4I0U A;  5JVD E;  1LKX A;  4IIJ E;  5LBQ B;  3H3M A;  4IL9 A;  5AQV B;  3RIU C;  4IDP A;  2H3R A;  5HXH A;  4DVD A;  2DLR A;  5JQG E;  3N5L A;  2ZMA A;  1H7C A;  5C8Y E;  1D1A A;  3WI3 A;  2BKN A;  4YSY A;  1N33 T;  4JI3 T;  1XDP A;  4H9R C;  3AAE B;  4O8S A;  3DP7 A;  1T7S A;  3FXD B;  3OBV E;  3QK6 A; 
#chains in the Genus database with same CATH homology
 4GIW A;  3QUJ A;  3CX6 B;  5L3E B;  2LSJ A;  5EK4 A;  3HKE E;  3O9X A;  4UEL A;  1S35 A;  3UUN A;  1HG5 A;  4AKI A;  3IHR A;  3FB2 A;  3ZLI A;  4X1K E;  5LHH B;  3AA6 B;  3QC9 A;  4E7S A;  5AFU L;  2DNX A;  3Q2M A;  4UV9 B;  2CXL A;  4O4I E;  3JC6 D;  4F6R C;  2NTY A;  2YU2 A;  3LK3 B;  2BZB A;  3PUG A;  4DMW A;  2XUE A;  1T98 A;  2EHO C;  4J2C A;  2W63 A;  2CLY B;  5LYJ E;  2PG8 A;  3C51 A;  2UXX B;  4HN9 A;  2LT3 A;  2PBI A;  4YHJ A;  2A2F X;  4C91 A;  5HXE A;  5KMG P;  2X66 A;  1US7 B;  2QA7 A;  2NW7 A;  2JMH A;  2NWB A;  4IDZ A;  3KDS E;  2JJ9 A;  4O4L E;  2JPF A;  2ZM2 A;  3H37 A;  3C64 A;  4B6X A;  4TZ4 C;  2HH7 A;  3PUS A;  4AQG A;  5HAX A;  2L8K A;  5LP6 E;  2DI4 A;  5JDN A;  3CKD A;  4JEU B;  2XAF B;  4AKR B;  3GMI A;  2YEV C;  2LOS A;  3MKD A;  3MZK B;  2V26 A;  3AA1 B;  4DO0 A;  4CXW A;  4CI3 B;  4OFZ A;  3RYH E;  1AJ3 A;  3AA0 B;  4NUU A;  3HKB E;  2H7V C;  4EXT A;  1SA0 E;  2Y48 B;  4X20 E;  4O4H E;  5A1L A;  2RP4 A;  4QXC B;  4CI1 B;  4YJ2 E;  3ZC1 A;  2V7I A;  1WYC A;  2MTQ A;  2ZM0 A;  2BDE A;  4HE8 A;  5HXR A;  4I50 E;  1WYB A;  3N9N A;  4ZHQ E;  4OK0 A;  3AAA B;  1G8X A;  3ZYK A;  2CCQ A;  4P0B A;  4U72 A;  5JH7 E;  4YLH A;  5LHI B;  3SOL A;  2N2N A;  1HF8 A;  3RKO A;  3BK9 A;  3P8C D;  2CA5 A;  4WW0 A;  3PTR B;  4GYS A;  2KT9 A;  2WMN A;  2HPJ A;  2SPC A;  3AAI A;  1OWA A;  1ZKE A;  4M1P A;  3ZYM A;  5F3J A;  4AQF A;  1S94 A;  3R6N A;  3FBZ A;  2DCF A;  4MLK A;  3B57 A;  5FXV A;  5LHG B;  4Z8X A;  4EYU A;  4EZ4 A;  5EK2 A;  2W62 A;  5FY7 A;  2LHR A;  4QX7 B;  1KNZ A;  2X0L B;  4ZI7 E;  2XQY A;  5H6Q B;  4QXB B;  4PW8 A;  4OYK A;  2GK9 A;  4ZI2 D;  3EVY A;  3L09 A;  2YU1 A;  5L3F B;  1BR0 A;  1D0Y A;  1LRZ A;  4GK0 E;  4P09 A;  3ONX A;  5FNV E;  3N9M A;  4UVB B;  4H63 V;  3ZYL A;  4CI2 B;  4CZZ B;  2H7O A;  5JR9 B;  4UF0 B;  2OA5 A;  2X9W A;  4IGU A;  2X9H A;  5LXT E;  2KND A;  5HYA A;  3ZCJ A;  3N2G E;  3LBX B;  3F57 A;  4ZOL E;  2BVL A;  2E9X D;  2KMF A;  3CX8 B;  3MXZ A;  2CXF A;  4JUY A;  2NOX A;  3ETU A;  5CB4 E;  4O4J E;  2E9X A;  3F2E A;  3VKH A;  2RA1 A;  2LE8 A;  3EDU A;  4EYY R;  4C90 A;  2X51 A;  4TV9 E;  2C5J A;  5JDM A;  3A5X A;  2Q9Q C;  3FXE B;  4OHF A;  1MND A;  3FHN A;  2PFV A;  5ADX L;  5LJM A;  3Q5W A;  1MNE A;  3OJA A;  2MYS A;  3RYF E;  4GOU A;  4XAX B;  1U4Q A;  3HA4 A;  4BAY B;  5LCY A;  5EZY E;  3I9W A;  3AVS A;  3PUR A;  2VB6 A;  2UXN B;  3KBU A;  3FBL A;  3LFM A;  2JRK A;  3LK2 B;  4PK4 A;  5IHY A;  4EAH A;  2W00 A;  4IST A;  1IJ5 A;  2ES0 A;  2JMK A;  3KIN B;  4K0U A;  1NAF A;  3ANW B;  3ZPO A;  4E7Z A;  3VHL A;  2E9X C;  1FIO A;  3MK7 C;  1U5P A;  3N9Q A;  2J1D G;  3RPU A;  3PU8 A;  1HX8 A;  4MHC A;  1BR2 A;  5FP3 A;  3UTK A;  3WAK A;  4BA9 A;  5L3D B;  4QHO A;  2LJL A;  2LSG A;  1QUU A;  1KK7 A;  2IW5 B;  4ZI3 C;  4WNK A;  2M67 A;  4EZH A;  3LK4 2;  2X9X A;  2VKD A;  2XAH B;  3EDV A;  1D1C A;  4IE5 A;  5FXZ A;  3VU7 H;  3J9X 1;  3O1J A;  4GK5 E;  2V1D B;  3U78 A;  3ZMV B;  4L9I A;  5F8P A;  5JR9 C;  5JRC B;  1YD8 G;  1VOM A;  4H9N C;  3Q5X A;  3CPZ A;  4ZS2 A;  4HGA A;  5LA6 E;  1HS7 A;  1MMA A;  3ZMZ B;  2NW9 A;  5L2L A;  2Q9Q B;  5L3B B;  4BJN A;  2NW8 A;  3ZCI A;  1UX4 A;  1WRD A;  4CQI A;  4FJO A;  4IHJ E;  3OYZ A;  3NZQ A;  2E8I A;  4H9P C;  5FY0 A;  2Q9Q A;  2KWI B;  2DHR A;  3CQC B;  4I55 E;  3RYC E;  3EUH A;  4N78 D;  1BR1 A;  2NP9 A;  2XTL A;  4PFP A;  5DQW A;  5GON E;  1VRB A;  4DMV A;  2D2S A;  2D0U A;  3CWZ B;  5LJN A;  5E0O A;  4ZS3 A;  5JDL A;  1YKH B;  2A72 A;  2N9D A;  1Y64 B;  1CUN A;  5FXX A;  5FMN A;  2MOZ A;  2VKJ A;  3ZN1 B;  4IE7 A;  1MMN A;  3AA7 B;  3O4X E;  1ZEE A;  4EIW A;  1QSD A;  2X9Y A;  2LSI A;  3O1H A;  3RRC A;  3KFW X;  3UUL A;  3Q9D A;  4BJM A;  5CA1 E;  1FMW A;  3HR0 A;  2I59 A;  3NZP A;  3P7I A;  2N1G A;  5JVD E;  2XAQ B;  4YJ3 E;  3MA9 A;  4ADZ A;  3NRY A;  1E1H B;  1FMV A;  4V1A v;  2C5K T;  4ASK A;  4WBN E;  4L5G A;  4QXH B;  4PJL A;  3O1I A;  4KUM B;  5JDG A;  2IAK A;  3I0Q A;  5JRE A;  2NTX A;  4UV8 B;  4UXN B;  2WBL A;  3RC8 A;  1FEW A;  4TV8 E;  4L0R A;  3N2K E;  3RH3 A;  2LEH A;  3CVR A;  5ETW A;  1IZN B;  4QX8 B;  3E08 A;  5IYZ E;  3N9L A;  3IBP A;  4XBF B;  3RRW A;  4KMC A;  2EHO A;  3C4Z A;  3ZEF B;  5BMV E;  3J7Y q;  4PAG A;  5FXW A;  2K48 A;  2K24 A;  4JLE A;  3AB3 B;  1NWM X;  3K3O A;  3ZMT B;  4OYJ A;  3CML A;  1MMG A;  3ZMU B;  2DWK A;  3N9O A;  5LG4 A;  2Q9Q D;  4QWN B;  4HTE A;  3UUX B;  2WSS V;  4ANJ A;  2KWH A;  1SHZ C;  4AI6 A;  5FY1 A;  3PUQ A;  2A3D A;  1B7T A;  5J1G A;  4DBR A;  3ZMS B;  2KIN B;  1LVK A;  4CXX A;  2X67 A;  3NBX X;  3ZC0 A;  1IJ6 A;  4G63 A;  2Y6X A;  5L3G B;  2WAU A;  2VWA A;  4KP3 C;  4MFR A;  3GN5 A;  3PU3 A;  4X1I E;  1X79 A;  2EHO D;  2EHO B;  2ODU A;  2XAJ B;  1Z0P A;  1WLX A;  4NUV A;  2WM9 A;  3C50 A;  1ZV4 X;  3S4U A;  1O3X A;  5DJQ C;  1EZ3 A;  2ZLY A;  2L9Q A;  4AQF C;  1MIV A;  4CXY A;  2Y8D A;  1WR6 A;  2QGS A;  2YK0 A;  3OYX A;  3B13 A;  4DBQ A;  3K8P C;  4HEA A;  3I1A A;  3W15 B;  3LG7 A;  2V7J A;  3KV6 A;  4O2B E;  3IF8 B;  4H9Q C;  3ETV A;  2V7L A;  4G2A A;  3KV4 A;  2JQQ A;  2W61 A;  5FYM A;  4H63 H;  4TN7 B;  1MIW A;  3K3N A;  1UCU A;  3LBX A;  3RC3 A;  3ZN0 B;  5J2U E;  2LSK A;  3VKG A;  3CQX C;  3BQI A;  3M65 A;  4XZC A;  2W0G A;  1IAP A;  5DQV A;  3H3A A;  2YIN A;  4QKN A;  4TUY E;  3UUM A;  4PJM A;  1UX5 A;  2ZM8 A;  3K3Q C;  1D0Z A;  3JC6 C;  4PJJ A;  3T8O A;  3RYI E;  4IE6 A;  4U74 A;  1LVF A;  5JDH A;  2MBG A;  3KV5 A;  4PFO A;  4AKG A;  4YFS A;  5DAB A;  2V7M A;  5L3C B;  3PE0 A;  2HPL A;  4ZI3 D;  4JEH B;  4FI5 A;  4H9O C;  2K9A A;  2IC6 A;  3ANW A;  2ACX A;  3WAJ A;  1ZHC A;  3UT5 E;  5LNK A;  1MIY A;  2KLQ A;  3F31 A;  5JDF A;  5HWX A;  2DWG A;  2WWU A;  2XHE B;  3LJC A;  3V5S A;  3BQL A;  4A56 A;  2G0U A;  3N9P A;  5LGN B;  3N2O A;  4UEM A;  2CEA A;  2D5U A;  5EK3 A;  4IE0 A;  2CE7 A;  3C98 B;  3R84 B;  4UF0 A;  4EB6 E;  1D1B A;  4EOZ B;  4O2A E;  3ESL A;  2Z6E A;  4PK5 A;  5LBM A;  2VAS A;  4HKA A;  3AVR A;  2V7K A;  2VKH A;  3NRX A;  3SS1 A;  3HI2 A;  2D0T A;  1V9D A;  5HXC A;  4AXP A;  3GN5 B;  4ILU A;  4UVC B;  5HXS A;  3HL6 A;  2X68 A;  5JRC A;  2XAS B;  4HFV A;  4AKL A;  3ZJ1 A;  3TKL B;  4KBM B;  1HG2 A;  2VL8 A;  3RX6 A;  4UVA B;  4ISS A;  5TAO A;  1YKE B;  3KV9 A;  2PJQ A;  5CA0 E;  4MBQ A;  4DND A;  5LOV E;  2C0S A;  5KX5 E;  3HKD E;  4AKH A;  4MAL A;  3CX7 B;  3SRZ A;  2IC9 A;  5JDQ A;  3V5U A;  1G73 A;  2CM0 A;  2C5I T;  2CWO A;  2E9X B;  3I9Y A;  2CLY C;  3KVB A;  3OKQ A;  4I4T E;  2LM9 A;  5KDM C;  2CWY A;  1HCI A;  2VK9 A;  4UIG A;  1D0X A;  2P9B A;  1BR4 A;  2LOP A;  2ODV A;  3BQK A;  4TX5 A;  4X1Y E;  5LGU B;  2VKO A;  3L3P A;  2WMO A;  3U3I A;  3CQG B;  3UFE A;  4WBO A;  4IE4 A;  5LGT B;  4PNI A;  2B1E A;  2KZ7 B;  3GA8 A;  4PK6 A;  5J2T E;  3PDY A;  1HFA A;  5H6R B;  4GYR A;  1OXZ A;  3I0O A;  3DTO A;  2L3L A;  2CMR A;  2BVM A;  2XAG B;  2LHN A;  4PJN A;  4I43 B;  3D0T A;  3C4W A;  3MAC A;  3HKC E;  3KBT A;  3E22 E;  2CXD A;  4ERR A;  5HWY A;  3E0Z A;  1MMD A;  5M4Y A;  2KXP B;  4P0A A;  3IEE A;  3SWH A;  3DJB A;  3GWH A;  2LSY A;  4H9S E;  2K5B B;  3C4X A;  3PUA A;  3KVA A;  3MJX A;  3ZJ2 A;  4ZI2 C;  1YW0 A;  5JR9 A;  1HTJ F;  1LKX A;  4IIJ E;  5LBQ B;  5HXH A;  5JQG E;  2H3R A;  4DVD A;  2DLR A;  3N5L A;  2ZMA A;  1H7C A;  5C8Y E;  1D1A A;  3WI3 A;  4H9R C;  3AAE B;  4O8S A;  3DP7 A;  3FXD B;  3OBV E;  3QK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...