3KINB

Kinesin (dimeric) from rattus norvegicus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
NKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVIQHLEVELNRWRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords KINESIN HEAVY CHAIN
publication title The crystal structure of dimeric kinesin and implications for microtubule-dependent motility.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
total genus 37
structure length 117
sequence length 117
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1980 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kinB00
3KINB
chains in the Genus database with same CATH superfamily
2KLQA 2UU9T 4ZOLE 5LGNB 2JPFA 5AQUB 3AVRA 4ZI2C 4YJ2E 4DV5T 1IAPA 3JAFA 3SS1A 4F6RC 2XQ9A 3JAEA 3AAAB 2VVSA 2V6YB 3RKOA 2CXLA 2VURA 1WR0A 1LVKA 2XASB 2XUEA 3B57A 2LKGA 3RYHE 4YTMA 2Y48B 3IF8B 2B76A 4P0BA 1Y01A 3O1JA 3CX7B 3UUMA 4HFHA 3SWHA 3Q2MA 4AXPA 3RYCE 1G8XA 2JQ9A 5FL1A 3PUGA 3RRWA 4MBQA 1MMDA 5LB7B 3L8RA 1UUSA 2HN2A 4ZI3C 3DJBA 4GYSA 1JNZA 5HXEA 4EEDA 1YD8G 4P09A 4CXWA 5ADXL 1I6ZA 2PBIA 2YDRA 4PK5A 2DWGA 1XNQT 1SHZC 4AKGA 4TV8E 4GKKT 4HFBA 2E2AA 3WAKA 2HPJA 2BKNA 1OEDC 3PJAJ 1FMWA 1NAFA 3OKQA 3JC6D 3CMLA 5JH7E 1D1BA 2UXBT 3VRAA 2PFVA 5HXSA 5CA0E 2LHNA 4O4IE 3C51A 4Z91A 4JI3T 2L8KA 4IDQA 3RHWA 3OVUA 5HCJA 4U2YA 2VASA 3P4RA 3ZKRA 2LKHA 5AQMB 2DL1A 4DV6T 3I0OA 1YKEB 4IDPA 5FP3A 1JNRA 5FVKA 3VR9A 4QH4A 2I59A 1US7B 2XQ4A 2LJLA 5FXZA 5JVDE 2WCAA 5KXJA 4DV3T 4OK0A 2CWOA 4CZZB 4ILUA 2VK9A 2BG9E 2HN1A 3ZYKA 5C8YE 2D5UA 4QXCB 4DV1T 5JTGA 3Q9DA 3K3NA 2D0UA 1T98A 2N2NA 2IC9A 5KMGP 1WFDA 4N78D 4XAXB 5FNVE 2LSJA 4LF7T 3L3PA 2ZM6T 4B3ST 4ADZA 2K3WA 2RP4A 3N2GE 2YOEA 1AJ3A 3LBXB 2W61A 1IJ6A 2ES0A 2YDQA 1BR4A 3GWHA 1IBMT 2LE8A 1LKXA 4QX7B 2MPKA 2K48A 3P4SA 2WWVA 2Y6XA 3HL6A 3ZMSB 3UFGA 2UXNB 1VCSA 5LXTE 2M67A 2XM1A 4G2AA 4KUMB 3AXJB 2LT3A 1KNZA 4GOUA 5J2UE 2ZM2A 4YJ3E 3RC8A 3ZMUB 4LF4T 3A8YC 4JUYA 5AQTB 2XHEB 3J7Yq 4GYRA 3DP7A 4JI0T 4ILCA 2KWIB 2JMHA 1NEKA 2JRKA 1HX1B 1ZHCA 4EYYR 2XAGB 1MMAA 3RPUA 3Q5XA 5LJNA 4IE0A 4O4LE 5AQIB 1J5ET 3N2OA 4EAHA 4WW0A 3P4QA 2OA5A 5HEUA 1CUNA 4PFOA 5ABFB 5JDHA 4LMLA 4IREA 2X0HA 2XZEA 4X1YE 1SA0E 3VKGA 4MHCA 3LK42 2MAWA 2E9XD 4I43B 2BKOA 3V5SA 4JI2T 4BJMA 2UXCT 5JDLA 3E22E 4NIQA 2BS2A 2KWHA 2LRKA 3ANWB 2K5BB 3RX6A 5LNKA 2VKJA 3ZSSA 4ISTA 4JI5T 3T1YT 2W63A 3CX8B 2LRLA 2NW8A 2PG8A 3RYIE 3ZC1A 2YU1A 5FY7A 2EHOC 2XQ5A 1MIWA 4CXXA 3PURA 4DR3T 3AA7B 2X68A 1YW0A 4HEAA 5FXWA 3MKDA 3I1AA 3LK3B 1SUMB 5TAOA 2V6XA 2KXPB 5AQKB 5FL0A 3GN5A 4B3RT 3IA3A 3PUYF 2KZ7B 4IDNA 1N33T 2H89A 1FEWA 5HWYA 3W15B 3VU7H 4JI7T 4KHPT 3NWIA 5JRCA 1MNEA 2VB6A 1VOMA 5LOVE 1HX8A 4H9PC 3EUHA 2FUPA 5F3JA 4LMJA 4YSXA 2CXDA 5KX5E 2MYSA 4YSZA 3CVRA 2J62A 1NENA 4U3CA 4EIWA 5L3FB 2NW9A 3MXZA 4HFVA 2XJ7A 3NZQA 1E2AA 2X0YA 5JDNA 2YKSA 2E9XA 4WZXA 2X51A 1XMOT 2YINA 3K3QC 4JI8T 4JI6T 2HH7A 2CEAA 2WB5A 4AQYT 5FXXA 2M6IA 2BG9C 3BK9A 3ZJ2A 2D9DA 2IIUA 4L9IA 1YQ4A 2YN6A 2KT9A 5IHYA 4PK4A 2E5VA 3KFWX 4EZ4A 4JV5T 1N34T 2EHOB 4F8HA 4QH5A 2AE9A 4DBQA 3PUQA 2CRBA 3KV9A 4DR4T 2WDRA 1UX4A 3N9OA 4YXDA 3NRYA 5EK4A 5AQJB 2Q9QA 4HE8A 5EK2A 1HFAA 4WYVA 2AXDS 2BS4A 4A56A 1IBLT 1KK7A 2NTYA 3CQCB 2KINB 3OYXA 3B13A 1KNRA 5LBQB 2FJEA 2E5LT 4TWHA 4X62T 3R6NA 2A72A 1ZV4X 3OPCA 4IDOA 4PJLA 4L5GA 3GA8A 1FIOA 4AQFC 1G73A 2OV9A 1LVFA 3R84B 3UFEA 2JQHA 5F5WA 1Z0PA 5LGUB 3LSVA 3KBUA 3JC6C 3C64A 4AKRB 1ZEEA 2E8IA 5FYMA 2X9WA 1ZOYA 4DMWA 3CK6A 2BG9B 3ZT7A 5AQNB 4DR1T 2A3DA 3UTKA 3N5LA 4I55E 4ISSA 1U4QA 5CA1E 3PUSA 1WCRA 4L0RA 4U7YA 3V5UA 4A5XA 1R8IA 2XAHB 2VKDA 4DUYT 3HKBE 4NPPA 4TV9E 3RQWA 2A9UA 3QB5K 1MMNA 3PUXF 2SPCA 3J9X1 3PTRB 3QUJA 2G0UA 1SE7A 2ZM0A 2VQFT 5CGMA 1OWAA 3UUBA 3PUZF 5C3JA 3PV0F 1W9RA 4CN6A 3AEGA 4V1Av 3DTOA 4JEHB 1KEYA 4ASKA 3JADA 5H6RB 2UXDT 4UF0B 4EB6E 3ZN1B 4TNVA 2V6YA 2JQKA 4HWCA 4PAGA 5FMNA 4HN9A 1N36T 3ZJ1A 4ANJA 1Z8UA 3C4XA 3KINB 3O4XE 5L3DB 1WRDA 3A5XA 5JR9C 3E08A 1IZNB 4EZHA 4YSYA 4NXNT 2NW7A 3ONXA 2X9HA 5L4EA 3VHLA 4H63V 2R6GF 2IAKA 2W4XA 4CI2B 5HXHA 3CPZA 3N9QA 3RH3A 2CMRA 2CA5A 4O2AE 1D0YA 3ZCIA 1HCIA 3AE5A 4BA9A 4UXNB 3B5MA 3Q5DA 5J0ZA 3M3ZB 4ZS3A 3AEDA 3OJAA 2X9YA 2ZM8A 3UU5A 3RGLA 4NUUA 5LG4A 2XAJB 2WP9A 3EDVA 3ZMVB 4OFZA 4X65T 3K3OA 5HEHA 4COFA 1KNPA 4X1IE 2XSBA 5JDFA 2CHOA 5HAXA 4WNKA 5HXCA 3WAJA 1MIVA 2D0TA 4OHFA 4UVBB 4CN1A 3ZC0A 4HWFA 5FKYA 3N9NA 4OYKA 1KFYA 5L4HA 3RKGA 2CM0A 3HKDE 3HA4A 4ERRA 3PU8A 2YDSA 5DQVA 4B6XA 1MIYA 1BR1A 2X9XA 4DUZT 5E0OA 3ETVA 3U78A 2WM9A 2V7JA 3MA9A 2H7VC 4UVAB 4KBMB 4WBOA 2M6BA 1OEDB 3NZPA 1X79A 3FXDB 5ETWA 3PU3A 2XM2A 3QNUA 3C4WA 1T8BA 2BS3A 5H6QB 4DR2T 2C5KT 3CIRA 4YTNA 3OBVE 2WS3A 3VRBA 2V26A 3JCFA 4NXMT 1W0AA 4A97A 4EXTA 5JDQA 5FY1A 3F31A 4O8SA 5HEGA 2IC6A 3MACA 1VCTA 3AEAA 3EDUA 3P4PA 5L3EB 3NKZA 3BQLA 2NTXA 3NBXX 1WYCA 3LK2B 4B3TT 4X64T 1L0VA 5LBMA 1XNRT 5L3CB 5F8PA 1FJGT 3AE7A 1T72A 3LBXA 2LM9A 3Q5WA 3RIAA 5DJQC 3RC3A 2KMFA 2VKHA 2ZLYA 5A1LA 4ILBA 1GQEA 1QLBA 3O9XA 2OLTA 2CWYA 4IGUA 3T8OA 4DV7T 5KDMC 2LSGA 5AQQB 3P8CD 3AE3A 4K0UA 3ZT6A 5JQGE 2ODUA 1HNXT 4HTEA 1XWMA 4Z90A 4TN7B 2FJAA 2Q9QC 2QVAA 3EAMA 3OTOT 5LHIB 3E0ZA 2CLYC 4X66T 2VWAA 4DBRA 5L2LA 4G63A 3FBLA 3RIFA 3AXJA 4DO0A 4IL4A 4J2CA 2UUAT 2YK0A 4C90A 4O4JE 4HWDA 3MJXA 1E7PA 4WBNE 2CHNA 5AQOB 2MTQA 4P1NA 2J4GA 4ZZBA 2W00A 3AVSA 4ZZCA 2Z6EA 2CCQA 3TLWA 2NWBA 3L09A 3AAEB 2BDEA 4GIWA 3AAIA 4DR5T 3EI0A 1UK5A 2CBIA 2XQAA 2ACXA 2W0GA 2LEHA 4E7ZA 3AE6A 3ETUA 4XZCA 5JREA 1IBKT 5CJ5A 2F4VT 4QHOA 3AE4A 1HG5A 3CKDA 1XMQT 2XTLA 2W66A 2C5IT 4BAYB 5ABFA 2D2SA 2KNDA 1HG2A 3UUNA 5BMVE 1YXRA 3PE0A 1YKHB 3AEEA 5AQHB 2IHR1 2V1DB 3UT5E 2XPKA 2CXFA 4UR9A 1MMGA 3F57A 2WZHA 2XQ6A 5IYZE 4OYJA 3G06A 3PUAA 2B1EA 2BVMA 2WU2A 3ANWA 3UQ4A 2ACZA 3C4ZA 4PW8A 5ABEA 2C0SA 3UULA 4LF6T 4H9NC 5FXVA 2QYWA 3EABA 3GMIA 4UV9B 1UGOA 4ZXLA 2C5JA 5FY0A 3ZT5A 1U5PA 2WMOA 3FZKB 5L3BB 3RQUA 4EGWA 2EHOD 4E7SA 5HEOA 5LHGB 2A2FX 4YHJA 3RIUA 3M65A 2QA7A 2N1GA 4HWIB 3SRZA 4U33A 4GKJT 3TLSA 4DR6T 4H9OC 5HWXA 5HEJA 3HKEE 3ZYMA 5DABA 5LMNT 3N9PA 2XQ7A 4PK6A 4ILAA 4CI3B 4IE7A 2WSSV 4UV8B 1EZ3A 2VQET 3SFDA 2NP9A 3CQXC 3KV6A 2DHRA 4O4HE 3QK6A 3PDYA 3FXEB 4UVCB 5DQWA 4PJJA 1E1HB 4PJMA 1CHUA 4EYUA 4QXHB 4Z8XA 3MK7C 2JIWA 2IDOB 3UU4A 1X9BA 4QXBB 5J2TE 4X1KE 2W62A 3NRXA 4LFBT 3ONLC 4CQIA 4IT4A 4Q25A 3L39A 3HKCE 2BZBA 1N32T 1H7CA 3S4UA 2UUBT 4UIGA 2K24A 4DR7T 2YEVC 2EHOA 3VKHA 2IMLA 2X67A 3AE2A 1D0XA 2WZIA 3BQIA 5LGTB 1UCUA 3CWZB 4CI1B 1D0ZA 2CBJA 5IWAT 3AB3B 4U31A 1HF8A 4H9RC 5EZYE 1HTJF 1XZYA 4ZEYA 1BR0A 2XY8B 2CPTA 2WU5A 1QUUA 2WWUA 4DIDB 3F2EA 4I0UA 1DU2A 4AIUA 2LOSA 5AQPB 4DV2T 4AI6A 2JMKA 2WMNA 2H88A 3T1HT 3I0QA 4HFCA 4YTPA 4ZI7E 4LF9T 4CXYA 2PJQA 3IBPA 4ZI2D 4YY3T 5IUXA 5AQSB 2LHRA 1BR2A 1HS7A 3ONJA 2V7KA 3SOLA 3QOFA 3QC9A 2IUBA 3CX6B 2BBHA 3RYFE 4AKIA 4LFCT 3N9MA 2DWKA 4IIJE 3UU8A 5HCMA 2BG9A 3AEBA 3RF1A 3PJAA 3NVOA 2XSAA 2YU2A 1J5WA 3FZHB 3HI2A 4PJNA 4B3MT 4BJNA 2DI4A 3FZFB 2KSRA 3WI3A 1HR0T 1IJ5A 4LMKA 2UUCT 2LOPA 3AE8A 4KP3C 3HR0A 2JQQA 1LRZA 4DNDA 2V7MA 4ZI3D 4IHJE 3P4WA 4CN4A 4PFPA 4K0KT 2FJBA 4EV6A 5LYJE 4DV0T 4FJOA 4TNWA 4ZS2A 4MFRA 4UF0A 2LLYA 4IE5A 4KMCA 3AA1B 2QGSA 3ZCJA 1B7TA 2WDVA 1S94A 3TLTA 3H3AA 4IL9A 3H37A 4UEMA 5LA6E 2HHHT 2JJ9A 4TZ4C 5LHHB 4AKHA 1Y64B 2RPAA 2UXXB 3N9LA 1ZP0A 5AQRB 1UX5A 2XQ3A 3C50A 3VR8A 4AQFA 3AE9A 5AFUL 3AECA 2FJDA 4P0AA 2MOZA 2BBJA 2I6HA 4XBFB 2V5CA 1UURA 2X0LB 5JR9B 5ABGA 4QH1A 3LDQB 1V9DA 2HPLA 1XDOA 3FZMB 2N9DA 3KBTA 4A98A 5CFBA 4PNIA 2J1DG 1NWMX 3A7MA 3QB5A 5LP6E 4GK0E 2E9XC 4EOZB 2V8SV 3ZYLA 3C98B 2WQYA 5EK3A 3MZKB 3KV4A 5AQLB 4LFAT 4JI1T 3I9WA 2H7OA 5FVLA 4AKLA 4EEBA 4JI4T 4U2ZA 1XDPA 3EHZA 4I50E 3AE1A 3RIUC 2XAFB 2VVNA 1WYBA 5HYAA 1OEDA 3KVBA 3X1DA 2DCFA 4LF5T 5C2TA 3FBZA 2XQYA 2CE7A 2J47A 4U72A 3FHNA 5JR9A 4C91A 4YT0A 5LCYA 3LG7A 4KX6A 2W2UA 3RLFF 3GN5B 1S35A 1HNZT 2ODVA 5HXRA 1M7KA 4JEUB 3BQKA 4KHZF 2ZMAA 5JRCB 3Q5EA 3LJCA 4YFSA 2LSIA 3EVYA 5AQGB 4DVDA 3TLUA 4JYAT 5CB4E 2FBWA 3PUVF 1OEDE 4QX8B 1WR6A 4UELA 1VRBA 1D1AA 2BKPA 5L47A 2VL8A 4H63H 4HFIA 1M62A 4JLEA 2RA1A 2I0MA 1OXZA 4I4TE 4NUVA 3TLVA 4JBWF 4MLKA 3CQGB 4GK5E 4MALA 2E9XB 2NR4A 1HNWT 4TUYE 3ZMTB 4IE4A 2NOXA 2QRXA 2VKOA 2X66A 4QWNB 5M4YA 2XQ8A 4OX9T 3ZN0B 4TX5A 3LFMA 4IE6A 2V7IA 3SFEA 5ABHA 1WLXA 1ZKEA 2L3LA 4X20E 4DMVA 3AEFA 5L3GB 2DNXA 2DLRA 2Q9QD 4TWDA 3TKLB 4H9SE 3P7IA 3FB2A 4HFEA 4U7IA 5LG3A 4FI5A 2MBGA 4AQGA 1KF6A 3ZSTA 1D1CA 5GONE 3ZMZB 1J1JA 1I94T 3UU6A 2V7LA 5AQFB 2VL0A 4AISA 2IW5B 3IEEA 5AQVB 1QSDA 3KDSE 3P50A 2Q9QB 3O1HA 3IHRA 2CLYB 4HFDA 3UQ7A 5J1GA 5JDGA 3AA0B 2GK9A 2K9AA 4TWFA 2L9QA 3U3IA 4U74A 1T7SA 1O3XA 4YHHT 4KI0F 4X5TA 3OYZA 2LSYA 4IDZA 4HKAA 3D0TA 3K8PC 3UU3A 1W0BA 4ZHQE 3FZLB 3ZLIA 3H3MA 3O1IA 2P9BA 2PTFA 1W09A 2WBLA 1YQ3A 4QKNA 3ABVA 4HGAA 4HWHA 2WY2A 2Y8DA 3AA6B 5BR8T 3ZPOA 2WAUA 2LM2A 2XAQB 2LSKA 3RI5A 3KVAA 5LMUT 5JDMA 3K1SA 3I9YA 2V5DA 1MNDA 4DV4T 3RRCA 4LF8T 4M1PA 2H3RA 2WDQA 3ZEFB 5LJMA 3ESLA 4O2BE 4YLHA 1FMVA 4H9QC 2BVLA 3PUWF 3UUXB 3N2KE 3KV5A 2W67A
chains in the Genus database with same CATH topology
1IJ5A 1FEWA 5HWYA 3W15B 3VU7H 2KLQA 2LOPA 4ZOLE 5LGNB 5LBMA 2JPFA 4ZI2C 3AVRA 4YJ2E 5JRCA 1MNEA 1IAPA 4KP3C 2VB6A 1VOMA 5F8PA 5L3CB 3HR0A 3SS1A 4F6RC 5LOVE 1HX8A 4H9PC 2JQQA 3EUHA 3LBXA 1LRZA 5F3JA 2LM9A 3Q5WA 4DNDA 2V7MA 3AAAB 5DJQC 2CXDA 5KX5E 3RC3A 2MYSA 4ZI3D 4IHJE 2KMFA 2VKHA 3RKOA 2ZLYA 5A1LA 3CVRA 2CXLA 4PFPA 4EIWA 1LVKA 2XASB 5L3FB 2XUEA 5LYJE 3O9XA 2CWYA 4IGUA 3T8OA 2NW9A 3MXZA 4FJOA 4HFVA 5KDMC 2LSGA 3NZQA 4ZS2A 3P8CD 3B57A 4MFRA 4UF0A 3RYHE 5JDNA 2Y48B 4IE5A 3IF8B 4KMCA 3AA1B 2E9XA 2QGSA 4K0UA 3ZCJA 1B7TA 1S94A 2X51A 3H3AA 5JQGE 4P0BA 2YINA 3K3QC 3H37A 2ODUA 3O1JA 4UEMA 4HTEA 3CX7B 5LA6E 4TN7B 2HH7A 2CEAA 2JJ9A 2Q9QC 4TZ4C 5LHHB 3UUMA 5FXXA 4AKHA 3SWHA 5LHIB 3E0ZA 2CLYC 3Q2MA 1Y64B 2VWAA 3BK9A 2UXXB 3N9LA 4DBRA 4AXPA 3RYCE 1UX5A 3ZJ2A 5L2LA 4G63A 3FBLA 1G8XA 3C50A 4L9IA 4AQFA 4DO0A 3PUGA 3RRWA 5AFUL 4MBQA 1MMDA 2KT9A 4J2CA 5IHYA 2MOZA 4P0AA 2YK0A 4PK4A 4ZI3C 4C90A 3DJBA 4O4JE 3KFWX 4EZ4A 4GYSA 3MJXA 4XBFB 5HXEA 4WBNE 2MTQA 1YD8G 4P09A 4CXWA 2W00A 3AVSA 2X0LB 5ADXL 2Z6EA 2PBIA 2CCQA 2EHOB 5JR9B 4PK5A 2NWBA 3L09A 2DWGA 3AAEB 1SHZC 4AKGA 4TV8E 4DBQA 3PUQA 3WAKA 2HPJA 2BDEA 3KV9A 4GIWA 3AAIA 1V9DA 2HPLA 1UX4A 3N9OA 2ACXA 2W0GA 2LEHA 4E7ZA 3NRYA 2N9DA 3KBTA 3ETUA 4XZCA 5EK4A 5JREA 1FMWA 2Q9QA 4HE8A 5EK2A 1NAFA 3OKQA 4PNIA 3JC6D 3CMLA 1HFAA 2J1DG 5JH7E 1NWMX 1D1BA 5LP6E 4QHOA 2PFVA 4GK0E 4A56A 1KK7A 5HXSA 2E9XC 2NTYA 2KINB 2LHNA 3CQCB 1HG5A 5CA0E 4O4IE 4EOZB 3OYXA 3C51A 3B13A 3CKDA 3ZYLA 2XTLA 3C98B 4BAYB 2C5IT 5LBQB 5EK3A 3MZKB 2D2SA 2KNDA 3KV4A 2L8KA 3R6NA 1HG2A 3UUNA 5BMVE 3PE0A 2A72A 1YKHB 1ZV4X 2VASA 3I9WA 2H7OA 2V1DB 4AKLA 3UT5E 3I0OA 1YKEB 2CXFA 4PJLA 5FP3A 4L5GA 4I50E 1MMGA 3F57A 3GA8A 1FIOA 4AQFC 1G73A 2XAFB 1LVFA 1WYBA 1US7B 2I59A 3R84B 3UFEA 5IYZE 4OYJA 5HYAA 2LJLA 5FXZA 1Z0PA 3KVBA 5LGUB 3KBUA 2B1EA 2BVMA 3ANWA 3PUAA 2DCFA 3FBZA 5JVDE 2XQYA 3C4ZA 3JC6C 3C64A 4AKRB 1ZEEA 2E8IA 4PW8A 2C0SA 4OK0A 2CWOA 2CE7A 4CZZB 4ILUA 3UULA 5FYMA 2VK9A 2X9WA 4H9NC 5FXVA 4U72A 3FHNA 5JR9A 3ZYKA 5C8YE 2D5UA 4C91A 4DMWA 4QXCB 5LCYA 3Q9DA 3K3NA 3GMIA 2D0UA 4UV9B 3LG7A 2A3DA 3UTKA 1T98A 2N2NA 2IC9A 3N5LA 4I55E 4ISSA 2C5JA 1U4QA 5CA1E 3PUSA 4L0RA 5KMGP 5FY0A 3GN5B 1U5PA 1S35A 2WMOA 3V5UA 5L3BB 2ODVA 4N78D 4XAXB 5FNVE 2LSJA 2EHOD 2XAHB 5HXRA 2VKDA 3L3PA 4E7SA 3HKBE 4JEUB 3BQKA 5LHGB 2A2FX 4ADZA 4TV9E 4YHJA 3M65A 2QA7A 2N1GA 2ZMAA 5JRCB 2RP4A 3LJCA 4YFSA 2LSIA 3SRZA 3EVYA 3N2GE 1MMNA 4H9OC 4DVDA 1AJ3A 3LBXB 5CB4E 5HWXA 3HKEE 3ZYMA 5DABA 2SPCA 3J9X1 2W61A 3PTRB 3QUJA 4QX8B 1WR6A 2G0UA 4UELA 3N9PA 2ZM0A 1VRBA 1OWAA 1D1AA 2VL8A 4H63H 4V1Av 4JLEA 3DTOA 2RA1A 4JEHB 4PK6A 4ASKA 1IJ6A 2ES0A 1BR4A 4CI3B 4IE7A 1OXZA 3GWHA 4I4TE 2WSSV 4UV8B 4NUVA 5H6RB 1EZ3A 4UF0B 2LE8A 4EB6E 4MLKA 2NP9A 3CQGB 3ZN1B 4GK5E 4MALA 3CQXC 2E9XB 3KV6A 4PAGA 4TUYE 1LKXA 3ZMTB 2DHRA 2NOXA 4IE4A 4QX7B 5FMNA 2VKOA 2X66A 4QWNB 4HN9A 3ZJ1A 4ANJA 3KINB 3C4XA 5M4YA 3O4XE 2K48A 4O4HE 3ZN0B 5L3DB 4TX5A 1WRDA 3A5XA 2Y6XA 5JR9C 3E08A 3QK6A 3PDYA 3HL6A 1IZNB 3ZMSB 4EZHA 3LFMA 2UXNB 3FXEB 2V7IA 4IE6A 4UVCB 2NW7A 3ONXA 2X9HA 5DQWA 5LXTE 4PJJA 2M67A 3VHLA 1E1HB 4H63V 4G2AA 4PJMA 4KUMB 1WLXA 2IAKA 1ZKEA 2L3LA 4X20E 3CPZA 4CI2B 4DMVA 5HXHA 3N9QA 4QXHB 3RH3A 4EYUA 2CMRA 2CA5A 2LT3A 4Z8XA 1KNZA 4GOUA 4O2AE 5J2UE 2ZM2A 3MK7C 4YJ3E 3RC8A 1D0YA 3ZCIA 1HCIA 4BA9A 3ZMUB 4UXNB 5L3GB 2DNXA 4QXBB 4JUYA 5J2TE 4ZS3A 2XHEB 2DLRA 2Q9QD 4X1KE 3OJAA 2W62A 4H9SE 2X9YA 3TKLB 3NRXA 3J7Yq 2ZM8A 3P7IA 4GYRA 3FB2A 3DP7A 4CQIA 4FI5A 2MBGA 4AQGA 4NUUA 5LG4A 2XAJB 3EDVA 3ZMVB 4OFZA 1D1CA 5GONE 2KWIB 2JMHA 3ZMZB 3HKCE 3K3OA 2V7LA 2BZBA 2JRKA 1H7CA 3S4UA 1ZHCA 4EYYR 4UIGA 2IW5B 3IEEA 2XAGB 2K24A 1QSDA 4X1IE 1MMAA 3KDSE 5JDFA 2Q9QB 3RPUA 3Q5XA 2YEVC 5LJNA 2EHOA 3VKHA 4IE0A 4O4LE 3O1HA 5HAXA 2X67A 3IHRA 2CLYB 4WNKA 5HXCA 3N2OA 1D0XA 3WAJA 3BQIA 1MIVA 5LGTB 4EAHA 2D0TA 4WW0A 4OHFA 1UCUA 4UVBB 3CWZB 3ZC0A 4CI1B 5J1GA 5JDGA 1D0ZA 2OA5A 3AA0B 3N9NA 4OYKA 3AB3B 1HF8A 4H9RC 1CUNA 2GK9A 4PFOA 2K9AA 2CM0A 3HKDE 5EZYE 3HA4A 1HTJF 4ERRA 3PU8A 5JDHA 5DQVA 4B6XA 1MIYA 1BR1A 2X9XA 4X1YE 1BR0A 1SA0E 5E0OA 2L9QA 3U3IA 3VKGA 4U74A 3ETVA 1O3XA 4MHCA 3LK42 3U78A 3OYZA 2WM9A 1QUUA 2WWUA 2LSYA 4IDZA 4HKAA 3F2EA 2V7JA 3D0TA 2E9XD 3K8PC 4I43B 3MA9A 2H7VC 4ZHQE 4UVAB 4KBMB 4WBOA 3V5SA 4BJMA 2LOSA 5JDLA 4AI6A 3ZLIA 3E22E 3NZPA 2JMKA 2WMNA 3O1IA 2P9BA 2KWHA 3ANWB 3I0QA 4ZI7E 1X79A 3FXDB 5ETWA 2K5BB 3PU3A 3RX6A 5LNKA 4CXYA 2PJQA 3IBPA 4ZI2D 2VKJA 3C4WA 2LHRA 1BR2A 5H6QB 1HS7A 2WBLA 4QKNA 4ISTA 2V7KA 4HGAA 3SOLA 2C5KT 2W63A 3OBVE 3QC9A 3CX6B 3CX8B 2NW8A 2Y8DA 2PG8A 3AA6B 3RYIE 3ZC1A 2V26A 3RYFE 2YU1A 3ZPOA 4AKIA 2WAUA 5FY7A 2EHOC 2XAQB 3N9MA 1MIWA 4CXXA 2LSKA 3PURA 4EXTA 3AA7B 3KVAA 2X68A 2DWKA 5JDMA 4IIJE 1YW0A 5JDQA 5FY1A 3F31A 4HEAA 4O8SA 5FXWA 3MKDA 3I1AA 3I9YA 3LK3B 5TAOA 2IC6A 1MNDA 2YU2A 3RRCA 3MACA 4M1PA 2KXPB 2H3RA 3EDUA 3HI2A 3ZEFB 3ESLA 4PJNA 5L3EB 4O2BE 4YLHA 5LJMA 1FMVA 3GN5A 4H9QC 3BQLA 2NTXA 3NBXX 2BVLA 2KZ7B 4BJNA 2DI4A 3N2KE 1WYCA 3KV5A 3UUXB 3LK2B 3WI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KIN B; 
#chains in the Genus database with same CATH topology
 2KLQ A;  2UU9 T;  4ZOL E;  5LGN B;  2JPF A;  5AQU B;  3AVR A;  4ZI2 C;  4YJ2 E;  4DV5 T;  1IAP A;  3JAF A;  3SS1 A;  4F6R C;  2XQ9 A;  3JAE A;  3AAA B;  2VVS A;  2V6Y B;  3RKO A;  2CXL A;  2VUR A;  1WR0 A;  1LVK A;  2XAS B;  2XUE A;  3B57 A;  2LKG A;  3RYH E;  4YTM A;  2Y48 B;  3IF8 B;  2B76 A;  4P0B A;  1Y01 A;  3O1J A;  3CX7 B;  3UUM A;  4HFH A;  3SWH A;  3Q2M A;  4AXP A;  3RYC E;  1G8X A;  2JQ9 A;  5FL1 A;  3PUG A;  3RRW A;  4MBQ A;  1MMD A;  5LB7 B;  3L8R A;  1UUS A;  2HN2 A;  4ZI3 C;  3DJB A;  4GYS A;  1JNZ A;  5HXE A;  4EED A;  1YD8 G;  4P09 A;  4CXW A;  5ADX L;  1I6Z A;  2PBI A;  2YDR A;  4PK5 A;  2DWG A;  1XNQ T;  1SHZ C;  4AKG A;  4TV8 E;  4GKK T;  4HFB A;  2E2A A;  3WAK A;  2HPJ A;  2BKN A;  1OED C;  3PJA J;  1FMW A;  1NAF A;  3OKQ A;  3JC6 D;  3CML A;  5JH7 E;  1D1B A;  2UXB T;  3VRA A;  2PFV A;  5HXS A;  5CA0 E;  2LHN A;  4O4I E;  3C51 A;  4Z91 A;  4JI3 T;  2L8K A;  4IDQ A;  3RHW A;  3OVU A;  5HCJ A;  4U2Y A;  2VAS A;  3P4R A;  3ZKR A;  2LKH A;  5AQM B;  2DL1 A;  4DV6 T;  3I0O A;  1YKE B;  4IDP A;  5FP3 A;  1JNR A;  5FVK A;  3VR9 A;  4QH4 A;  2I59 A;  1US7 B;  2XQ4 A;  2LJL A;  5FXZ A;  5JVD E;  2WCA A;  5KXJ A;  4DV3 T;  4OK0 A;  2CWO A;  4CZZ B;  4ILU A;  2VK9 A;  2BG9 E;  2HN1 A;  3ZYK A;  5C8Y E;  2D5U A;  4QXC B;  4DV1 T;  5JTG A;  3Q9D A;  3K3N A;  2D0U A;  1T98 A;  2N2N A;  2IC9 A;  5KMG P;  1WFD A;  4N78 D;  4XAX B;  5FNV E;  2LSJ A;  4LF7 T;  3L3P A;  2ZM6 T;  4B3S T;  4ADZ A;  2K3W A;  2RP4 A;  3N2G E;  2YOE A;  1AJ3 A;  3LBX B;  2W61 A;  1IJ6 A;  2ES0 A;  2YDQ A;  1BR4 A;  3GWH A;  1IBM T;  2LE8 A;  1LKX A;  4QX7 B;  2MPK A;  2K48 A;  3P4S A;  2WWV A;  2Y6X A;  3HL6 A;  3ZMS B;  3UFG A;  2UXN B;  1VCS A;  5LXT E;  2M67 A;  2XM1 A;  4G2A A;  4KUM B;  3AXJ B;  2LT3 A;  1KNZ A;  4GOU A;  5J2U E;  2ZM2 A;  4YJ3 E;  3RC8 A;  3ZMU B;  4LF4 T;  3A8Y C;  4JUY A;  5AQT B;  2XHE B;  3J7Y q;  4GYR A;  3DP7 A;  4JI0 T;  4ILC A;  2KWI B;  2JMH A;  1NEK A;  2JRK A;  1HX1 B;  1ZHC A;  4EYY R;  2XAG B;  1MMA A;  3RPU A;  3Q5X A;  5LJN A;  4IE0 A;  4O4L E;  5AQI B;  1J5E T;  3N2O A;  4EAH A;  4WW0 A;  3P4Q A;  2OA5 A;  5HEU A;  1CUN A;  4PFO A;  5ABF B;  5JDH A;  4LML A;  4IRE A;  2X0H A;  2XZE A;  4X1Y E;  1SA0 E;  3VKG A;  4MHC A;  3LK4 2;  2MAW A;  2E9X D;  4I43 B;  2BKO A;  3V5S A;  4JI2 T;  4BJM A;  2UXC T;  5JDL A;  3E22 E;  4NIQ A;  2BS2 A;  2KWH A;  2LRK A;  3ANW B;  2K5B B;  3RX6 A;  5LNK A;  2VKJ A;  3ZSS A;  4IST A;  4JI5 T;  3T1Y T;  2W63 A;  3CX8 B;  2LRL A;  2NW8 A;  2PG8 A;  3RYI E;  3ZC1 A;  2YU1 A;  5FY7 A;  2EHO C;  2XQ5 A;  1MIW A;  4CXX A;  3PUR A;  4DR3 T;  3AA7 B;  2X68 A;  1YW0 A;  4HEA A;  5FXW A;  3MKD A;  3I1A A;  3LK3 B;  1SUM B;  5TAO A;  2V6X A;  2KXP B;  5AQK B;  5FL0 A;  3GN5 A;  4B3R T;  3IA3 A;  3PUY F;  2KZ7 B;  4IDN A;  1N33 T;  2H89 A;  1FEW A;  5HWY A;  3W15 B;  3VU7 H;  4JI7 T;  4KHP T;  3NWI A;  5JRC A;  1MNE A;  2VB6 A;  1VOM A;  5LOV E;  1HX8 A;  4H9P C;  3EUH A;  2FUP A;  5F3J A;  4LMJ A;  4YSX A;  2CXD A;  5KX5 E;  2MYS A;  4YSZ A;  3CVR A;  2J62 A;  1NEN A;  4U3C A;  4EIW A;  5L3F B;  2NW9 A;  3MXZ A;  4HFV A;  2XJ7 A;  3NZQ A;  1E2A A;  2X0Y A;  5JDN A;  2YKS A;  2E9X A;  4WZX A;  2X51 A;  1XMO T;  2YIN A;  3K3Q C;  4JI8 T;  4JI6 T;  2HH7 A;  2CEA A;  2WB5 A;  4AQY T;  5FXX A;  2M6I A;  2BG9 C;  3BK9 A;  3ZJ2 A;  2D9D A;  2IIU A;  4L9I A;  1YQ4 A;  2YN6 A;  2KT9 A;  5IHY A;  4PK4 A;  2E5V A;  3KFW X;  4EZ4 A;  4JV5 T;  1N34 T;  2EHO B;  4F8H A;  4QH5 A;  2AE9 A;  4DBQ A;  3PUQ A;  2CRB A;  3KV9 A;  4DR4 T;  2WDR A;  1UX4 A;  3N9O A;  4YXD A;  3NRY A;  5EK4 A;  5AQJ B;  2Q9Q A;  4HE8 A;  5EK2 A;  1HFA A;  4WYV A;  2AXD S;  2BS4 A;  4A56 A;  1IBL T;  1KK7 A;  2NTY A;  3CQC B;  2KIN B;  3OYX A;  3B13 A;  1KNR A;  5LBQ B;  2FJE A;  2E5L T;  4TWH A;  4X62 T;  3R6N A;  2A72 A;  1ZV4 X;  3OPC A;  4IDO A;  4PJL A;  4L5G A;  3GA8 A;  1FIO A;  4AQF C;  1G73 A;  2OV9 A;  1LVF A;  3R84 B;  3UFE A;  2JQH A;  5F5W A;  1Z0P A;  5LGU B;  3LSV A;  3KBU A;  3JC6 C;  3C64 A;  4AKR B;  1ZEE A;  2E8I A;  5FYM A;  2X9W A;  1ZOY A;  4DMW A;  3CK6 A;  2BG9 B;  3ZT7 A;  5AQN B;  4DR1 T;  2A3D A;  3UTK A;  3N5L A;  4I55 E;  4ISS A;  1U4Q A;  5CA1 E;  3PUS A;  1WCR A;  4L0R A;  4U7Y A;  3V5U A;  4A5X A;  1R8I A;  2XAH B;  2VKD A;  4DUY T;  3HKB E;  4NPP A;  4TV9 E;  3RQW A;  2A9U A;  3QB5 K;  1MMN A;  3PUX F;  2SPC A;  3J9X 1;  3PTR B;  3QUJ A;  2G0U A;  1SE7 A;  2ZM0 A;  2VQF T;  5CGM A;  1OWA A;  3UUB A;  3PUZ F;  5C3J A;  3PV0 F;  1W9R A;  4CN6 A;  3AEG A;  4V1A v;  3DTO A;  4JEH B;  1KEY A;  4ASK A;  3JAD A;  5H6R B;  2UXD T;  4UF0 B;  4EB6 E;  3ZN1 B;  4TNV A;  2V6Y A;  2JQK A;  4HWC A;  4PAG A;  5FMN A;  4HN9 A;  1N36 T;  3ZJ1 A;  4ANJ A;  1Z8U A;  3C4X A;  3KIN B;  3O4X E;  5L3D B;  1WRD A;  3A5X A;  5JR9 C;  3E08 A;  1IZN B;  4EZH A;  4YSY A;  4NXN T;  2NW7 A;  3ONX A;  2X9H A;  5L4E A;  3VHL A;  4H63 V;  2R6G F;  2IAK A;  2W4X A;  4CI2 B;  5HXH A;  3CPZ A;  3N9Q A;  3RH3 A;  2CMR A;  2CA5 A;  4O2A E;  1D0Y A;  3ZCI A;  1HCI A;  3AE5 A;  4BA9 A;  4UXN B;  3B5M A;  3Q5D A;  5J0Z A;  3M3Z B;  4ZS3 A;  3AED A;  3OJA A;  2X9Y A;  2ZM8 A;  3UU5 A;  3RGL A;  4NUU A;  5LG4 A;  2XAJ B;  2WP9 A;  3EDV A;  3ZMV B;  4OFZ A;  4X65 T;  3K3O A;  5HEH A;  4COF A;  1KNP A;  4X1I E;  2XSB A;  5JDF A;  2CHO A;  5HAX A;  4WNK A;  5HXC A;  3WAJ A;  1MIV A;  2D0T A;  4OHF A;  4UVB B;  4CN1 A;  3ZC0 A;  4HWF A;  5FKY A;  3N9N A;  4OYK A;  1KFY A;  5L4H A;  3RKG A;  2CM0 A;  3HKD E;  3HA4 A;  4ERR A;  3PU8 A;  2YDS A;  5DQV A;  4B6X A;  1MIY A;  1BR1 A;  2X9X A;  4DUZ T;  5E0O A;  3ETV A;  3U78 A;  2WM9 A;  2V7J A;  3MA9 A;  2H7V C;  4UVA B;  4KBM B;  4WBO A;  2M6B A;  1OED B;  3NZP A;  1X79 A;  3FXD B;  5ETW A;  3PU3 A;  2XM2 A;  3QNU A;  3C4W A;  1T8B A;  2BS3 A;  5H6Q B;  4DR2 T;  2C5K T;  3CIR A;  4YTN A;  3OBV E;  2WS3 A;  3VRB A;  2V26 A;  3JCF A;  4NXM T;  1W0A A;  4A97 A;  4EXT A;  5JDQ A;  5FY1 A;  3F31 A;  4O8S A;  5HEG A;  2IC6 A;  3MAC A;  1VCT A;  3AEA A;  3EDU A;  3P4P A;  5L3E B;  3NKZ A;  3BQL A;  2NTX A;  3NBX X;  1WYC A;  3LK2 B;  4B3T T;  4X64 T;  1L0V A;  5LBM A;  1XNR T;  5L3C B;  5F8P A;  1FJG T;  3AE7 A;  1T72 A;  3LBX A;  2LM9 A;  3Q5W A;  3RIA A;  5DJQ C;  3RC3 A;  2KMF A;  2VKH A;  2ZLY A;  5A1L A;  4ILB A;  1GQE A;  1QLB A;  3O9X A;  2OLT A;  2CWY A;  4IGU A;  3T8O A;  4DV7 T;  5KDM C;  2LSG A;  5AQQ B;  3P8C D;  3AE3 A;  4K0U A;  3ZT6 A;  5JQG E;  2ODU A;  1HNX T;  4HTE A;  1XWM A;  4Z90 A;  4TN7 B;  2FJA A;  2Q9Q C;  2QVA A;  3EAM A;  3OTO T;  5LHI B;  3E0Z A;  2CLY C;  4X66 T;  2VWA A;  4DBR A;  5L2L A;  4G63 A;  3FBL A;  3RIF A;  3AXJ A;  4DO0 A;  4IL4 A;  4J2C A;  2UUA T;  2YK0 A;  4C90 A;  4O4J E;  4HWD A;  3MJX A;  1E7P A;  4WBN E;  2CHN A;  5AQO B;  2MTQ A;  4P1N A;  2J4G A;  4ZZB A;  2W00 A;  3AVS A;  4ZZC A;  2Z6E A;  2CCQ A;  3TLW A;  2NWB A;  3L09 A;  3AAE B;  2BDE A;  4GIW A;  3AAI A;  4DR5 T;  3EI0 A;  1UK5 A;  2CBI A;  2XQA A;  2ACX A;  2W0G A;  2LEH A;  4E7Z A;  3AE6 A;  3ETU A;  4XZC A;  5JRE A;  1IBK T;  5CJ5 A;  2F4V T;  4QHO A;  3AE4 A;  1HG5 A;  3CKD A;  1XMQ T;  2XTL A;  2W66 A;  2C5I T;  4BAY B;  5ABF A;  2D2S A;  2KND A;  1HG2 A;  3UUN A;  5BMV E;  1YXR A;  3PE0 A;  1YKH B;  3AEE A;  5AQH B;  2IHR 1;  2V1D B;  3UT5 E;  2XPK A;  2CXF A;  4UR9 A;  1MMG A;  3F57 A;  2WZH A;  2XQ6 A;  5IYZ E;  4OYJ A;  3G06 A;  3PUA A;  2B1E A;  2BVM A;  2WU2 A;  3ANW A;  3UQ4 A;  2ACZ A;  3C4Z A;  4PW8 A;  5ABE A;  2C0S A;  3UUL A;  4LF6 T;  4H9N C;  5FXV A;  2QYW A;  3EAB A;  3GMI A;  4UV9 B;  1UGO A;  4ZXL A;  2C5J A;  5FY0 A;  3ZT5 A;  1U5P A;  2WMO A;  3FZK B;  5L3B B;  3RQU A;  4EGW A;  2EHO D;  4E7S A;  5HEO A;  5LHG B;  2A2F X;  4YHJ A;  3RIU A;  3M65 A;  2QA7 A;  2N1G A;  4HWI B;  3SRZ A;  4U33 A;  4GKJ T;  3TLS A;  4DR6 T;  4H9O C;  5HWX A;  5HEJ A;  3HKE E;  3ZYM A;  5DAB A;  5LMN T;  3N9P A;  2XQ7 A;  4PK6 A;  4ILA A;  4CI3 B;  4IE7 A;  2WSS V;  4UV8 B;  1EZ3 A;  2VQE T;  3SFD A;  2NP9 A;  3CQX C;  3KV6 A;  2DHR A;  4O4H E;  3QK6 A;  3PDY A;  3FXE B;  4UVC B;  5DQW A;  4PJJ A;  1E1H B;  4PJM A;  1CHU A;  4EYU A;  4QXH B;  4Z8X A;  3MK7 C;  2JIW A;  2IDO B;  3UU4 A;  1X9B A;  4QXB B;  5J2T E;  4X1K E;  2W62 A;  3NRX A;  4LFB T;  3ONL C;  4CQI A;  4IT4 A;  4Q25 A;  3L39 A;  3HKC E;  2BZB A;  1N32 T;  1H7C A;  3S4U A;  2UUB T;  4UIG A;  2K24 A;  4DR7 T;  2YEV C;  2EHO A;  3VKH A;  2IML A;  2X67 A;  3AE2 A;  1D0X A;  2WZI A;  3BQI A;  5LGT B;  1UCU A;  3CWZ B;  4CI1 B;  1D0Z A;  2CBJ A;  5IWA T;  3AB3 B;  4U31 A;  1HF8 A;  4H9R C;  5EZY E;  1HTJ F;  1XZY A;  4ZEY A;  1BR0 A;  2XY8 B;  2CPT A;  2WU5 A;  1QUU A;  2WWU A;  4DID B;  3F2E A;  4I0U A;  1DU2 A;  4AIU A;  2LOS A;  5AQP B;  4DV2 T;  4AI6 A;  2JMK A;  2WMN A;  2H88 A;  3T1H T;  3I0Q A;  4HFC A;  4YTP A;  4ZI7 E;  4LF9 T;  4CXY A;  2PJQ A;  3IBP A;  4ZI2 D;  4YY3 T;  5IUX A;  5AQS B;  2LHR A;  1BR2 A;  1HS7 A;  3ONJ A;  2V7K A;  3SOL A;  3QOF A;  3QC9 A;  2IUB A;  3CX6 B;  2BBH A;  3RYF E;  4AKI A;  4LFC T;  3N9M A;  2DWK A;  4IIJ E;  3UU8 A;  5HCM A;  2BG9 A;  3AEB A;  3RF1 A;  3PJA A;  3NVO A;  2XSA A;  2YU2 A;  1J5W A;  3FZH B;  3HI2 A;  4PJN A;  4B3M T;  4BJN A;  2DI4 A;  3FZF B;  2KSR A;  3WI3 A;  1HR0 T;  1IJ5 A;  4LMK A;  2UUC T;  2LOP A;  3AE8 A;  4KP3 C;  3HR0 A;  2JQQ A;  1LRZ A;  4DND A;  2V7M A;  4ZI3 D;  4IHJ E;  3P4W A;  4CN4 A;  4PFP A;  4K0K T;  2FJB A;  4EV6 A;  5LYJ E;  4DV0 T;  4FJO A;  4TNW A;  4ZS2 A;  4MFR A;  4UF0 A;  2LLY A;  4IE5 A;  4KMC A;  3AA1 B;  2QGS A;  3ZCJ A;  1B7T A;  2WDV A;  1S94 A;  3TLT A;  3H3A A;  4IL9 A;  3H37 A;  4UEM A;  5LA6 E;  2HHH T;  2JJ9 A;  4TZ4 C;  5LHH B;  4AKH A;  1Y64 B;  2RPA A;  2UXX B;  3N9L A;  1ZP0 A;  5AQR B;  1UX5 A;  2XQ3 A;  3C50 A;  3VR8 A;  4AQF A;  3AE9 A;  5AFU L;  3AEC A;  2FJD A;  4P0A A;  2MOZ A;  2BBJ A;  2I6H A;  4XBF B;  2V5C A;  1UUR A;  2X0L B;  5JR9 B;  5ABG A;  4QH1 A;  3LDQ B;  1V9D A;  2HPL A;  1XDO A;  3FZM B;  2N9D A;  3KBT A;  4A98 A;  5CFB A;  4PNI A;  2J1D G;  1NWM X;  3A7M A;  3QB5 A;  5LP6 E;  4GK0 E;  2E9X C;  4EOZ B;  2V8S V;  3ZYL A;  3C98 B;  2WQY A;  5EK3 A;  3MZK B;  3KV4 A;  5AQL B;  4LFA T;  4JI1 T;  3I9W A;  2H7O A;  5FVL A;  4AKL A;  4EEB A;  4JI4 T;  4U2Z A;  1XDP A;  3EHZ A;  4I50 E;  3AE1 A;  3RIU C;  2XAF B;  2VVN A;  1WYB A;  5HYA A;  1OED A;  3KVB A;  3X1D A;  2DCF A;  4LF5 T;  5C2T A;  3FBZ A;  2XQY A;  2CE7 A;  2J47 A;  4U72 A;  3FHN A;  5JR9 A;  4C91 A;  4YT0 A;  5LCY A;  3LG7 A;  4KX6 A;  2W2U A;  3RLF F;  3GN5 B;  1S35 A;  1HNZ T;  2ODV A;  5HXR A;  1M7K A;  4JEU B;  3BQK A;  4KHZ F;  2ZMA A;  5JRC B;  3Q5E A;  3LJC A;  4YFS A;  2LSI A;  3EVY A;  5AQG B;  4DVD A;  3TLU A;  4JYA T;  5CB4 E;  2FBW A;  3PUV F;  1OED E;  4QX8 B;  1WR6 A;  4UEL A;  1VRB A;  1D1A A;  2BKP A;  5L47 A;  2VL8 A;  4H63 H;  4HFI A;  1M62 A;  4JLE A;  2RA1 A;  2I0M A;  1OXZ A;  4I4T E;  4NUV A;  3TLV A;  4JBW F;  4MLK A;  3CQG B;  4GK5 E;  4MAL A;  2E9X B;  2NR4 A;  1HNW T;  4TUY E;  3ZMT B;  4IE4 A;  2NOX A;  2QRX A;  2VKO A;  2X66 A;  4QWN B;  5M4Y A;  2XQ8 A;  4OX9 T;  3ZN0 B;  4TX5 A;  3LFM A;  4IE6 A;  2V7I A;  3SFE A;  5ABH A;  1WLX A;  1ZKE A;  2L3L A;  4X20 E;  4DMV A;  3AEF A;  5L3G B;  2DNX A;  2DLR A;  2Q9Q D;  4TWD A;  3TKL B;  4H9S E;  3P7I A;  3FB2 A;  4HFE A;  4U7I A;  5LG3 A;  4FI5 A;  2MBG A;  4AQG A;  1KF6 A;  3ZST A;  1D1C A;  5GON E;  3ZMZ B;  1J1J A;  1I94 T;  3UU6 A;  2V7L A;  5AQF B;  2VL0 A;  4AIS A;  2IW5 B;  3IEE A;  5AQV B;  1QSD A;  3KDS E;  3P50 A;  2Q9Q B;  3O1H A;  3IHR A;  2CLY B;  4HFD A;  3UQ7 A;  5J1G A;  5JDG A;  3AA0 B;  2GK9 A;  2K9A A;  4TWF A;  2L9Q A;  3U3I A;  4U74 A;  1T7S A;  1O3X A;  4YHH T;  4KI0 F;  4X5T A;  3OYZ A;  2LSY A;  4IDZ A;  4HKA A;  3D0T A;  3K8P C;  3UU3 A;  1W0B A;  4ZHQ E;  3FZL B;  3ZLI A;  3H3M A;  3O1I A;  2P9B A;  2PTF A;  1W09 A;  2WBL A;  1YQ3 A;  4QKN A;  3ABV A;  4HGA A;  4HWH A;  2WY2 A;  2Y8D A;  3AA6 B;  5BR8 T;  3ZPO A;  2WAU A;  2LM2 A;  2XAQ B;  2LSK A;  3RI5 A;  3KVA A;  5LMU T;  5JDM A;  3K1S A;  3I9Y A;  2V5D A;  1MND A;  4DV4 T;  3RRC A;  4LF8 T;  4M1P A;  2H3R A;  2WDQ A;  3ZEF B;  5LJM A;  3ESL A;  4O2B E;  4YLH A;  1FMV A;  4H9Q C;  2BVL A;  3PUW F;  3UUX B;  3N2K E;  3KV5 A;  2W67 A; 
#chains in the Genus database with same CATH homology
 1IJ5 A;  1FEW A;  5HWY A;  3W15 B;  3VU7 H;  2KLQ A;  2LOP A;  4ZOL E;  5LGN B;  5LBM A;  2JPF A;  4ZI2 C;  3AVR A;  4YJ2 E;  5JRC A;  1MNE A;  1IAP A;  4KP3 C;  2VB6 A;  1VOM A;  5F8P A;  5L3C B;  3HR0 A;  3SS1 A;  4F6R C;  5LOV E;  1HX8 A;  4H9P C;  2JQQ A;  3EUH A;  3LBX A;  1LRZ A;  5F3J A;  2LM9 A;  3Q5W A;  4DND A;  2V7M A;  3AAA B;  5DJQ C;  2CXD A;  5KX5 E;  3RC3 A;  2MYS A;  4ZI3 D;  4IHJ E;  2KMF A;  2VKH A;  3RKO A;  2ZLY A;  5A1L A;  3CVR A;  2CXL A;  4PFP A;  4EIW A;  1LVK A;  2XAS B;  5L3F B;  2XUE A;  5LYJ E;  3O9X A;  2CWY A;  4IGU A;  3T8O A;  2NW9 A;  3MXZ A;  4FJO A;  4HFV A;  5KDM C;  2LSG A;  3NZQ A;  4ZS2 A;  3P8C D;  3B57 A;  4MFR A;  4UF0 A;  3RYH E;  5JDN A;  2Y48 B;  4IE5 A;  3IF8 B;  4KMC A;  3AA1 B;  2E9X A;  2QGS A;  4K0U A;  3ZCJ A;  1B7T A;  1S94 A;  2X51 A;  3H3A A;  5JQG E;  4P0B A;  2YIN A;  3K3Q C;  3H37 A;  2ODU A;  3O1J A;  4UEM A;  4HTE A;  3CX7 B;  5LA6 E;  4TN7 B;  2HH7 A;  2CEA A;  2JJ9 A;  2Q9Q C;  4TZ4 C;  5LHH B;  3UUM A;  5FXX A;  4AKH A;  3SWH A;  5LHI B;  3E0Z A;  2CLY C;  3Q2M A;  1Y64 B;  2VWA A;  3BK9 A;  2UXX B;  3N9L A;  4DBR A;  4AXP A;  3RYC E;  1UX5 A;  3ZJ2 A;  5L2L A;  4G63 A;  3FBL A;  1G8X A;  3C50 A;  4L9I A;  4AQF A;  4DO0 A;  3PUG A;  3RRW A;  5AFU L;  4MBQ A;  1MMD A;  2KT9 A;  4J2C A;  5IHY A;  2MOZ A;  4P0A A;  2YK0 A;  4PK4 A;  4ZI3 C;  4C90 A;  3DJB A;  4O4J E;  3KFW X;  4EZ4 A;  4GYS A;  3MJX A;  4XBF B;  5HXE A;  4WBN E;  2MTQ A;  1YD8 G;  4P09 A;  4CXW A;  2W00 A;  3AVS A;  2X0L B;  5ADX L;  2Z6E A;  2PBI A;  2CCQ A;  2EHO B;  5JR9 B;  4PK5 A;  2NWB A;  3L09 A;  2DWG A;  3AAE B;  1SHZ C;  4AKG A;  4TV8 E;  4DBQ A;  3PUQ A;  3WAK A;  2HPJ A;  2BDE A;  3KV9 A;  4GIW A;  3AAI A;  1V9D A;  2HPL A;  1UX4 A;  3N9O A;  2ACX A;  2W0G A;  2LEH A;  4E7Z A;  3NRY A;  2N9D A;  3KBT A;  3ETU A;  4XZC A;  5EK4 A;  5JRE A;  1FMW A;  2Q9Q A;  4HE8 A;  5EK2 A;  1NAF A;  3OKQ A;  4PNI A;  3JC6 D;  3CML A;  1HFA A;  2J1D G;  5JH7 E;  1NWM X;  1D1B A;  5LP6 E;  4QHO A;  2PFV A;  4GK0 E;  4A56 A;  1KK7 A;  5HXS A;  2E9X C;  2NTY A;  2KIN B;  2LHN A;  3CQC B;  1HG5 A;  5CA0 E;  4O4I E;  4EOZ B;  3OYX A;  3C51 A;  3B13 A;  3CKD A;  3ZYL A;  2XTL A;  3C98 B;  4BAY B;  2C5I T;  5LBQ B;  5EK3 A;  3MZK B;  2D2S A;  2KND A;  3KV4 A;  2L8K A;  3R6N A;  1HG2 A;  3UUN A;  5BMV E;  3PE0 A;  2A72 A;  1YKH B;  1ZV4 X;  2VAS A;  3I9W A;  2H7O A;  2V1D B;  4AKL A;  3UT5 E;  3I0O A;  1YKE B;  2CXF A;  4PJL A;  5FP3 A;  4L5G A;  4I50 E;  1MMG A;  3F57 A;  3GA8 A;  1FIO A;  4AQF C;  1G73 A;  2XAF B;  1LVF A;  1WYB A;  1US7 B;  2I59 A;  3R84 B;  3UFE A;  5IYZ E;  4OYJ A;  5HYA A;  2LJL A;  5FXZ A;  1Z0P A;  3KVB A;  5LGU B;  3KBU A;  2B1E A;  2BVM A;  3ANW A;  3PUA A;  2DCF A;  3FBZ A;  5JVD E;  2XQY A;  3C4Z A;  3JC6 C;  3C64 A;  4AKR B;  1ZEE A;  2E8I A;  4PW8 A;  2C0S A;  4OK0 A;  2CWO A;  2CE7 A;  4CZZ B;  4ILU A;  3UUL A;  5FYM A;  2VK9 A;  2X9W A;  4H9N C;  5FXV A;  4U72 A;  3FHN A;  5JR9 A;  3ZYK A;  5C8Y E;  2D5U A;  4C91 A;  4DMW A;  4QXC B;  5LCY A;  3Q9D A;  3K3N A;  3GMI A;  2D0U A;  4UV9 B;  3LG7 A;  2A3D A;  3UTK A;  1T98 A;  2N2N A;  2IC9 A;  3N5L A;  4I55 E;  4ISS A;  2C5J A;  1U4Q A;  5CA1 E;  3PUS A;  4L0R A;  5KMG P;  5FY0 A;  3GN5 B;  1U5P A;  1S35 A;  2WMO A;  3V5U A;  5L3B B;  2ODV A;  4N78 D;  4XAX B;  5FNV E;  2LSJ A;  2EHO D;  2XAH B;  5HXR A;  2VKD A;  3L3P A;  4E7S A;  3HKB E;  4JEU B;  3BQK A;  5LHG B;  2A2F X;  4ADZ A;  4TV9 E;  4YHJ A;  3M65 A;  2QA7 A;  2N1G A;  2ZMA A;  5JRC B;  2RP4 A;  3LJC A;  4YFS A;  2LSI A;  3SRZ A;  3EVY A;  3N2G E;  1MMN A;  4H9O C;  4DVD A;  1AJ3 A;  3LBX B;  5CB4 E;  5HWX A;  3HKE E;  3ZYM A;  5DAB A;  2SPC A;  3J9X 1;  2W61 A;  3PTR B;  3QUJ A;  4QX8 B;  1WR6 A;  2G0U A;  4UEL A;  3N9P A;  2ZM0 A;  1VRB A;  1OWA A;  1D1A A;  2VL8 A;  4H63 H;  4V1A v;  4JLE A;  3DTO A;  2RA1 A;  4JEH B;  4PK6 A;  4ASK A;  1IJ6 A;  2ES0 A;  1BR4 A;  4CI3 B;  4IE7 A;  1OXZ A;  3GWH A;  4I4T E;  2WSS V;  4UV8 B;  4NUV A;  5H6R B;  1EZ3 A;  4UF0 B;  2LE8 A;  4EB6 E;  4MLK A;  2NP9 A;  3CQG B;  3ZN1 B;  4GK5 E;  4MAL A;  3CQX C;  2E9X B;  3KV6 A;  4PAG A;  4TUY E;  1LKX A;  3ZMT B;  2DHR A;  2NOX A;  4IE4 A;  4QX7 B;  5FMN A;  2VKO A;  2X66 A;  4QWN B;  4HN9 A;  3ZJ1 A;  4ANJ A;  3KIN B;  3C4X A;  5M4Y A;  3O4X E;  2K48 A;  4O4H E;  3ZN0 B;  5L3D B;  4TX5 A;  1WRD A;  3A5X A;  2Y6X A;  5JR9 C;  3E08 A;  3QK6 A;  3PDY A;  3HL6 A;  1IZN B;  3ZMS B;  4EZH A;  3LFM A;  2UXN B;  3FXE B;  2V7I A;  4IE6 A;  4UVC B;  2NW7 A;  3ONX A;  2X9H A;  5DQW A;  5LXT E;  4PJJ A;  2M67 A;  3VHL A;  1E1H B;  4H63 V;  4G2A A;  4PJM A;  4KUM B;  1WLX A;  2IAK A;  1ZKE A;  2L3L A;  4X20 E;  3CPZ A;  4CI2 B;  4DMV A;  5HXH A;  3N9Q A;  4QXH B;  3RH3 A;  4EYU A;  2CMR A;  2CA5 A;  2LT3 A;  4Z8X A;  1KNZ A;  4GOU A;  4O2A E;  5J2U E;  2ZM2 A;  3MK7 C;  4YJ3 E;  3RC8 A;  1D0Y A;  3ZCI A;  1HCI A;  4BA9 A;  3ZMU B;  4UXN B;  5L3G B;  2DNX A;  4QXB B;  4JUY A;  5J2T E;  4ZS3 A;  2XHE B;  2DLR A;  2Q9Q D;  4X1K E;  3OJA A;  2W62 A;  4H9S E;  2X9Y A;  3TKL B;  3NRX A;  3J7Y q;  2ZM8 A;  3P7I A;  4GYR A;  3FB2 A;  3DP7 A;  4CQI A;  4FI5 A;  2MBG A;  4AQG A;  4NUU A;  5LG4 A;  2XAJ B;  3EDV A;  3ZMV B;  4OFZ A;  1D1C A;  5GON E;  2KWI B;  2JMH A;  3ZMZ B;  3HKC E;  3K3O A;  2V7L A;  2BZB A;  2JRK A;  1H7C A;  3S4U A;  1ZHC A;  4EYY R;  4UIG A;  2IW5 B;  3IEE A;  2XAG B;  2K24 A;  1QSD A;  4X1I E;  1MMA A;  3KDS E;  5JDF A;  2Q9Q B;  3RPU A;  3Q5X A;  2YEV C;  5LJN A;  2EHO A;  3VKH A;  4IE0 A;  4O4L E;  3O1H A;  5HAX A;  2X67 A;  3IHR A;  2CLY B;  4WNK A;  5HXC A;  3N2O A;  1D0X A;  3WAJ A;  3BQI A;  1MIV A;  5LGT B;  4EAH A;  2D0T A;  4WW0 A;  4OHF A;  1UCU A;  4UVB B;  3CWZ B;  3ZC0 A;  4CI1 B;  5J1G A;  5JDG A;  1D0Z A;  2OA5 A;  3AA0 B;  3N9N A;  4OYK A;  3AB3 B;  1HF8 A;  4H9R C;  1CUN A;  2GK9 A;  4PFO A;  2K9A A;  2CM0 A;  3HKD E;  5EZY E;  3HA4 A;  1HTJ F;  4ERR A;  3PU8 A;  5JDH A;  5DQV A;  4B6X A;  1MIY A;  1BR1 A;  2X9X A;  4X1Y E;  1BR0 A;  1SA0 E;  5E0O A;  2L9Q A;  3U3I A;  3VKG A;  4U74 A;  3ETV A;  1O3X A;  4MHC A;  3LK4 2;  3U78 A;  3OYZ A;  2WM9 A;  1QUU A;  2WWU A;  2LSY A;  4IDZ A;  4HKA A;  3F2E A;  2V7J A;  3D0T A;  2E9X D;  3K8P C;  4I43 B;  3MA9 A;  2H7V C;  4ZHQ E;  4UVA B;  4KBM B;  4WBO A;  3V5S A;  4BJM A;  2LOS A;  5JDL A;  4AI6 A;  3ZLI A;  3E22 E;  3NZP A;  2JMK A;  2WMN A;  3O1I A;  2P9B A;  2KWH A;  3ANW B;  3I0Q A;  4ZI7 E;  1X79 A;  3FXD B;  5ETW A;  2K5B B;  3PU3 A;  3RX6 A;  5LNK A;  4CXY A;  2PJQ A;  3IBP A;  4ZI2 D;  2VKJ A;  3C4W A;  2LHR A;  1BR2 A;  5H6Q B;  1HS7 A;  2WBL A;  4QKN A;  4IST A;  2V7K A;  4HGA A;  3SOL A;  2C5K T;  2W63 A;  3OBV E;  3QC9 A;  3CX6 B;  3CX8 B;  2NW8 A;  2Y8D A;  2PG8 A;  3AA6 B;  3RYI E;  3ZC1 A;  2V26 A;  3RYF E;  2YU1 A;  3ZPO A;  4AKI A;  2WAU A;  5FY7 A;  2EHO C;  2XAQ B;  3N9M A;  1MIW A;  4CXX A;  2LSK A;  3PUR A;  4EXT A;  3AA7 B;  3KVA A;  2X68 A;  2DWK A;  5JDM A;  4IIJ E;  1YW0 A;  5JDQ A;  5FY1 A;  3F31 A;  4HEA A;  4O8S A;  5FXW A;  3MKD A;  3I1A A;  3I9Y A;  3LK3 B;  5TAO A;  2IC6 A;  1MND A;  2YU2 A;  3RRC A;  3MAC A;  4M1P A;  2KXP B;  2H3R A;  3EDU A;  3HI2 A;  3ZEF B;  3ESL A;  4PJN A;  5L3E B;  4O2B E;  4YLH A;  5LJM A;  1FMV A;  3GN5 A;  4H9Q C;  3BQL A;  2NTX A;  3NBX X;  2BVL A;  2KZ7 B;  4BJN A;  2DI4 A;  3N2K E;  1WYC A;  3KV5 A;  3UUX B;  3LK2 B;  3WI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...