3KINB

Kinesin (dimeric) from rattus norvegicus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
NKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVIQHLEVELNRWRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of dimeric kinesin and implications for microtubule-dependent motility.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
molecule keywords KINESIN HEAVY CHAIN
total genus 37
structure length 117
sequence length 117
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1980 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kinB00
3KINB
chains in the Genus database with same CATH superfamily
3RQUA 1LVKA 3ONJA 5GONE 3ZJ2A 3NRXA 2CEAA 2W2UA 4U33A 5LBMA 1Y01A 3TLWA 2IC6A 2NP9A 4QWNB 4ZZCA 2DWGA 3V5SA 5L47A 2JPFA 4IE5A 4ILUA 4A98A 3TLUA 3K1SA 3VRAA 2LT3A 2X9WA 2X66A 3F31A 1XDOA 4QXBB 3I1AA 2H7OA 5FMNA 2XJ7A 2QYWA 2IIUA 2RA1A 3L09A 3MK7C 3MA9A 4HEAA 1IJ5A 2HN1A 5FY0A 4DMVA 5JRCA 4ZEYA 1HNXT 2M67A 4YTPA 2WDVA 1LRZA 2A3DA 3B5MA 2V7KA 4ZI7E 2X0LB 3AEAA 5LOVE 1KK7A 3AE1A 3AEBA 4CXYA 4AKGA 2CMRA 1SE7A 2BS3A 2E5VA 4H9PC 4OFZA 4ERRA 3FBZA 1VRBA 2BG9A 2VKDA 4AKRB 3T1YT 4LF7T 4MALA 1XNRT 4G63A 3T1HT 2JJ9A 4PJLA 2WU2A 2X9YA 3I0QA 4ZS3A 1X9BA 3LBXB 2C5IT 2LEHA 3RIAA 5J2TE 2YK0A 1IZNB 2VK9A 2VKHA 4P0AA 1QSDA 2VKJA 1IBMT 3RYFE 1Y64B 4WBOA 2A72A 3NZPA 4GOUA 1IAPA 5AQPB 4CQIA 5KXJA 1D1BA 2CWYA 2UXDT 5HEUA 2M6BA 3P7IA 4P09A 2PG8A 2Q9QC 1HNZT 2DLRA 5EK4A 5AQIB 5AQUB 3MXZA 4IT4A 1YKEB 3RC3A 4ADZA 2D5UA 4LFCT 4AKHA 3LDQB 1FMVA 3WAJA 2UUAT 4B3TT 4YSYA 2WWUA 3ETUA 5AFUL 4L0RA 4TV9E 5FKYA 2WBLA 5JDMA 4HFEA 4TV8E 2X0YA 2H89A 2X9XA 2XTLA 4IL9A 4JBWF 4P1NA 2PTFA 4PK5A 4UV9B 3ZMUB 5ABHA 4IDNA 4KHZF 2VL0A 1H7CA 3OKQA 4KUMB 4PFPA 3N9PA 4UXNB 3UU8A 3CQCB 2PJQA 3KVAA 2BDEA 4NUVA 3KV9A 2LOPA 2V1DB 4WYVA 3ZSTA 2V7LA 1OEDE 2XQYA 2BG9E 2ES0A 4G2AA 1W9RA 4HE8A 2DI4A 1I94T 3RIUC 4MBQA 5DQVA 1HG5A 3ZYMA 4ISSA 4DMWA 5IWAT 2I59A 3PDYA 3PUZF 2W4XA 4HWIB 2CLYC 4NUUA 4EV6A 4DNDA 2CXLA 4BJMA 4BA9A 5FVLA 2YN6A 2BZBA 4ZI3C 1U4QA 3AE7A 3RKGA 4GK5E 2HH7A 2KMFA 2Q9QD 5DABA 4EZ4A 2IW5B 2C5JA 2WZIA 2E9XC 5KMGP 4ZZBA 5LYJE 4H9NC 3RYIE 2CLYB 5FNVE 1E1HB 3AE5A 3PU8A 3VRBA 4B3ST 4CN1A 1N33T 1UCUA 1SA0E 1CHUA 1MIWA 2XQAA 3IBPA 4I43B 2N1GA 2SPCA 4QH5A 3SFEA 1OEDB 5F3JA 3VR9A 2XQ7A 4HWCA 2BS2A 3E08A 4COFA 4DR7T 5ABEA 3AE2A 1T8BA 3PUQA 5LGNB 5LHGB 2V7IA 2QA7A 2B76A 2W0GA 2X68A 4DVDA 3L3PA 5AQKB 1YD8G 1UGOA 1ZV4X 2WS3A 2K48A 3B13A 3OYZA 4YFSA 1XDPA 3JCFA 3CQXC 3RYHE 5ABFB 2LHNA 5AQGB 4GIWA 2VVSA 3BQLA 3EUHA 4KP3C 2WMNA 3P8CD 3UTKA 4LFAT 1KNZA 5HXCA 3ZCJA 1MMDA 5F5WA 3UT5E 4TWHA 3DP7A 5JREA 5BR8T 1R8IA 4DV6T 3AE4A 3M65A 4AKLA 4U72A 2BVMA 5AQFB 4IE0A 5L3BB 3SWHA 3EHZA 1D1CA 2MOZA 2XSAA 3G06A 4ILBA 3ZMTB 2BG9B 3ZMZB 5IHYA 2H3RA 4QKNA 4PNIA 4MHCA 2LSYA 3UU4A 2HN2A 2VURA 4HN9A 4QH4A 3CMLA 4O2BE 3UU6A 3SS1A 4DUYT 3IA3A 3PE0A 4ILCA 5JR9B 2IDOB 2UXXB 3KINB 3MJXA 1S35A 3N2OA 1SHZC 3ZYKA 3E22E 3O1HA 4LFBT 1UURA 2WCAA 1WYCA 2IUBA 3N2GE 3ZC0A 4EZHA 1J5WA 2YDQA 3FZHB 4U2YA 2JIWA 2XAFB 1WCRA 3C98B 1WFDA 2WSSV 3EDUA 3H3AA 3HL6A 2IMLA 3P50A 4LF8T 2WAUA 4A5XA 4YJ2E 3O9XA 2H88A 4YJ3E 5CA0E 4HFHA 1HX1B 2YU2A 4PJNA 3HR0A 5AQRB 3AEGA 3CX6B 5CA1E 5JR9A 1N34T 1OEDC 1YXRA 2EHOB 2V6YB 2XUEA 2YU1A 3AVRA 3N9LA 4U74A 3TLVA 3NWIA 2M6IA 2CPTA 4LF6T 3FB2A 4H9QC 1I6ZA 4JI4T 3T8OA 3CKDA 3ZMVB 2LRKA 3PUWF 2Y48B 2C0SA 1HNWT 2WY2A 3KV5A 2JRKA 3OJAA 3ZKRA 4X1IE 4DO0A 4EOZB 1XMOT 1UX4A 1W0AA 3N5LA 2ZM8A 4PK4A 2CM0A 4H9RC 4UVAB 2YDRA 1NENA 3AA0B 2BS4A 4X5TA 5FVKA 4ILAA 1QUUA 4KI0F 4PJMA 1D0YA 3RIUA 3RRWA 3UUNA 3ZC1A 4F8HA 3AE6A 4IGUA 5LMNT 2IC9A 3RQWA 3TLTA 3N9MA 2VL8A 3AA7B 4HFBA 2E9XB 2FBWA 4UF0A 1T7SA 4GYSA 3GWHA 1D0ZA 2VASA 1MMNA 3F57A 4TN7B 1BR2A 4LMLA 2CWOA 3DTOA 3UU3A 3V5UA 1V9DA 2YKSA 4ASKA 2XQ5A 4EYUA 3R6NA 4OX9T 3CIRA 3UUMA 2NTYA 2XQ6A 2BBHA 5H6RB 3RF1A 1WR6A 2EHOD 5HCJA 3RHWA 4HWFA 5J2UE 3LK42 2WDRA 3GMIA 1S94A 4N78D 2V7MA 3VU7H 4PJJA 3FZLB 5M4YA 2ZM2A 4DV7T 2YEVC 3LK3B 3OBVE 4B3MT 2BKOA 2XQ3A 4GYRA 4I50E 3FXDB 3RLFF 5AQOB 3TLSA 3OTOT 5LXTE 3RKOA 4QXCB 1US7B 4O8SA 4DV2T 4EEDA 2ZMAA 4H9SE 2L3LA 4TNWA 4JI6T 1G73A 3P4QA 4NIQA 3AA6B 4V1Av 5LG3A 3WI3A 5ABGA 3ZSSA 5CJ5A 4LF4T 4BJNA 2YINA 4JV5T 1U5PA 4O4LE 4O4HE 5A1LA 5HWYA 3JC6D 1XMQT 3RH3A 2DHRA 2UXCT 4HFVA 4E7SA 5AQNB 3ZYLA 4X62T 1GQEA 4JI8T 2LSJA 5AQMB 1XNQT 3NZQA 1Z8UA 4CXXA 3PUVF 2NR4A 2LSIA 1B7TA 3AECA 5HWXA 2AE9A 1M62A 1HCIA 5JDLA 3GN5B 3EVYA 1EZ3A 1HTJF 3JADA 3LK2B 3NKZA 3PTRB 3UU5A 2ZM0A 2LLYA 4ANJA 2LM9A 5DQWA 5HXHA 3UUXB 1MMAA 1ZP0A 4EEBA 2I0MA 1N36T 4GKKT 2J47A 4QH1A 2D0UA 4TNVA 3UFGA 5L3GB 5LB7B 3AB3B 2UUCT 3FZKB 1YQ4A 3AXJB 4H63H 2VWAA 4DR2T 4O4IE 1SUMB 5AQJB 2E2AA 1HF8A 1WLXA 2LKHA 3ANWB 1VOMA 4J2CA 4DBQA 4LF9T 4AI6A 4CI1B 3Q5DA 3Q2MA 1NAFA 2V7JA 1BR0A 4AISA 3KBTA 4TZ4C 2F4VT 2H7VC 2Z6EA 4L9IA 3HKEE 3P4SA 4YHHT 5JDHA 4Z8XA 5AQLB 4UF0B 2WQYA 2ODVA 3PUYF 5AQSB 1J1JA 3PU3A 2X67A 4QHOA 2B1EA 3CX7B 5HXSA 5AQTB 2Q9QA 4B3RT 4JI1T 3ZEFB 3HKCE 4ISTA 2WZHA 1ZKEA 3FBLA 3UQ7A 3Q9DA 3MZKB 1FJGT 2MYSA 3OVUA 5LGUB 1HR0T 2KINB 4WBNE 4TX5A 3AE3A 5JRCB 3OYXA 3EAMA 4X66T 3ZJ1A 2ZM6T 4DIDB 3PV0F 3NBXX 1E2AA 5LBQB 4DR5T 3HKDE 3JAEA 4AQGA 5ABFA 2VKOA 3PUSA 2NW7A 3QUJA 4YSZA 2K5BB 2WP9A 3KV6A 2QGSA 2BG9C 2E8IA 3EABA 2V5DA 4O4JE 4EIWA 4X64T 1FMWA 2AXDS 1M7KA 4YLHA 5L4EA 2MAWA 2NOXA 3M3ZB 5L3FB 4I4TE 5C3JA 3AEFA 3KFWX 2WDQA 2WM9A 2K9AA 4KHPT 4X65T 1MIVA 2KWIB 4TUYE 3BQKA 1JNZA 1ZHCA 1W0BA 2IAKA 4P0BA 4EXTA 4JI7T 3AA1B 2X9HA 2BKPA 5C2TA 1LVFA 1W09A 2LHRA 3A5XA 2G0UA 3EDVA 2GK9A 4KBMB 2JMKA 5C8YE 2W62A 4DUZT 1MIYA 1ZEEA 3QB5K 4DV5T 5FXZA 4H9OC 3UFEA 3AEDA 5KX5E 2KT9A 1QLBA 2KLQA 2CA5A 2JQQA 2MBGA 5LGTB 5FP3A 1WR0A 4AIUA 4PW8A 1G8XA 3PUGA 1IBLT 2Y6XA 2LSKA 2UXNB 1HG2A 1MNEA 2D0TA 2XQ9A 1X79A 3ZT7A 2LKGA 4XZCA 1J5ET 5FY7A 4DR4T 2HPLA 3D0TA 3B57A 3IHRA 1YW0A 1L0VA 4DR3T 2WMOA 1MNDA 4ZOLE 4GKJT 3C51A 2HHHT 5FXXA 3ZT5A 3O1IA 3C4XA 2FJBA 1Z0PA 3C64A 3I9WA 3K3OA 3AXJA 3SRZA 3UUBA 4CI2B 4DV3T 3QK6A 2LE8A 5EZYE 3TKLB 2CHNA 2I6HA 4U2ZA 2KZ7B 3RI5A 4ZI2D 3K3NA 3I0OA 3ZPOA 4O2AE 5LJNA 2VVNA 4PAGA 4WNKA 4C91A 2ACZA 1KNRA 4X1KE 2FJDA 2VB6A 2CBJA 3JAFA 3SOLA 5JTGA 4DV0T 2LOSA 3C4ZA 4CN6A 1NEKA 1AJ3A 3ZN1B 3MACA 2LRLA 3N9NA 4F6RC 4X1YE 3P4PA 5HEGA 2KNDA 2E9XA 3LG7A 2FUPA 3QC9A 4HGAA 4UELA 4UVCB 5AQVB 2YDSA 2N2NA 4UVBB 5HCMA 4IL4A 2V8SV 3R84B 5JH7E 4Z90A 5FY1A 3J7Yq 2BKNA 5LG4A 5IYZE 1XWMA 2IHR1 5JDFA 2CXDA 4H63V 3Q5EA 3FXEB 4I0UA 5TAOA 2JQHA 1LKXA 1ZOYA 2K24A 4YSXA 2LM2A 3H3MA 3RGLA 5JR9C 4JI5T 3RC8A 3LBXA 3K8PC 4EYYR 3OPCA 2OV9A 4HFIA 4JYAT 3PURA 2Q9QB 4ZS2A 3WAKA 4DV1T 1D1AA 1UUSA 2JQKA 1YQ3A 3E0ZA 4MLKA 3VHLA 4ZI3D 4NXMT 1OXZA 2LSGA 2ACXA 2MPKA 3O4XE 4LF5T 1HS7A 5IUXA 4GK0E 4QXHB 2V26A 1E7PA 5L3EB 3CK6A 2WB5A 4JI3T 2RP4A 2W67A 5DJQC 5FXWA 1IJ6A 4QX8B 5LNKA 3CWZB 4YY3T 4X20E 5J1GA 4CZZB 4K0KT 2CRBA 2UU9T 1KF6A 5HXRA 2QRXA 4AQYT 4HFDA 4NXNT 3C50A 5L3CB 5JVDE 4JI0T 5FXVA 3IEEA 3LSVA 4AQFA 4CXWA 3L39A 1D0XA 2C5KT 2WU5A 3MKDA 4KX6A 5BMVE 5JDQA 3FHNA 2XY8B 3GA8A 5ADXL 1T72A 4XBFB 2A9UA 1FEWA 2V6XA 2Y8DA 2X51A 5KDMC 2E5LT 3GN5A 1DU2A 2N9DA 2V5CA 4Z91A 3RYCE 1T98A 3ZCIA 2KXPB 2XQ8A 5JQGE 3AVSA 3QNUA 5FL0A 3KVBA 2NTXA 3CPZA 2BVLA 4HWHA 4IDPA 1YKHB 3AAEB 2XPKA 2J4GA 5LMUT 3QB5A 4UR9A 3RIFA 3HI2A 1CUNA 2FJEA 2PBIA 3P4WA 3W15B 2VQET 3PJAA 4TWFA 4OYKA 3N2KE 5FYMA 1UK5A 2UXBT 4JEHB 4NPPA 1MMGA 1XZYA 4WW0A 3KV4A 4FJOA 3BQIA 3KBUA 4I55E 3X1DA 4OHFA 3ZN0B 5LHHB 4EB6E 5AQHB 2D9DA 3VKHA 3C4WA 3PUXF 4CN4A 2J62A 3AEEA 2KSRA 3FZFB 4AXPA 2UUBT 4FI5A 4IREA 4AKIA 1VCSA 1O3XA 4YHJA 3AE9A 2OLTA 4IDQA 2XASB 4IE7A 3LJCA 3QOFA 4IDOA 4JI2T 2NWBA 3ZLIA 2DCFA 2LJLA 3ANWA 3VKGA 4OK0A 4YTMA 5EK3A 4B6XA 4YXDA 4DR6T 5L4HA 2VQFT 1UX5A 1BR1A 2XZEA 4KMCA 2YOEA 3BK9A 4IHJE 4PFOA 2BBJA 2ZLYA 3N9OA 2CCQA 3CX8B 4A97A 3ONLC 2R6GF 2P9BA 4HWDA 5HEJA 3RRCA 5ETWA 5AQQB 3AAAB 5HEHA 1VCTA 2JQ9A 4U31A 5L2LA 3A8YC 2NW8A 4L5GA 5F8PA 4QX7B 2D2SA 3Q5XA 2DWKA 3A7MA 4AQFC 2HPJA 5JDNA 3JC6C 4HTEA 3VR8A 5LA6E 3HA4A 2DNXA 4WZXA 5HXEA 4JLEA 1JNRA 1IBKT 4DR1T 2W61A 4JUYA 3O1JA 2RPAA 2E9XD 5J0ZA 3L8RA 4OYJA 3I9YA 3P4RA 3K3QC 3PJAJ 2A2FX 1WYBA 2XAQB 4K0UA 5CGMA 3RX6A 3NVOA 5E0OA 4M1PA 4EGWA 3UQ4A 1FIOA 3CVRA 4UEMA 3EI0A 2FJAA 3ONXA 2WWVA 5CFBA 1KEYA 2CXFA 5LHIB 4CI3B 1BR4A 2PFVA 4C90A 5HEOA 1NWMX 4PK6A 4A56A 4BAYB 4E7ZA 4UV8B 1HX8A 2NW9A 2OA5A 2JMHA 1OEDA 1OWAA 2J1DG 2XSBA 3HKBE 3LFMA 4XAXB 2EHOA 2L9QA 2V6YA 4EAHA 2EHOC 2XM2A 5LP6E 3DJBA 2W00A 3ZT6A 4DBRA 3SFDA 3UULA 3AAIA 5JDGA 3AE8A 4HKAA 4HFCA 5EK2A 4ZI2C 2ODUA 2QVAA 5HAXA 3RPUA 2CBIA 2W66A 4LMKA 4LMJA 3F2EA 1N32T 4IIJE 5L3DB 2XAGB 4DV4T 3Q5WA 5H6QB 2XAHB 4MFRA 3IF8B 4IE4A 2DL1A 1WRDA 4U7IA 2XQ4A 4U7YA 4U3CA 5LCYA 3J9X1 3S4UA 3ETVA 5LJMA 3N9QA 5CB4E 4YT0A 1HFAA 2XAJB 3ZMSB 4IE6A 3KDSE 4JEUB 1KNPA 2CHOA 2K3WA 2MTQA 3H37A 4UIGA 4ZXLA 3NRYA 4IDZA 4YTNA 5HYAA 3ABVA 3ESLA 3CQGB 3U78A 3U3IA 2XM1A 4ZHQE 2W63A 3FZMB 2X0HA 2L8KA 1KFYA 3PUAA 2CE7A 4Q25A 4TWDA 2XHEB 5FL1A 2KWHA
chains in the Genus database with same CATH topology
1LVKA 5GONE 3ZJ2A 3NRXA 2CEAA 5LBMA 2IC6A 2NP9A 4QWNB 2DWGA 3V5SA 2JPFA 4IE5A 4ILUA 2LT3A 2X9WA 2X66A 3F31A 5FMNA 4QXBB 3I1AA 2H7OA 3L09A 3MK7C 2RA1A 4HEAA 3MA9A 1IJ5A 5FY0A 4DMVA 5JRCA 2M67A 1LRZA 2A3DA 2V7KA 4ZI7E 2X0LB 5LOVE 1KK7A 4CXYA 2CMRA 4H9PC 4OFZA 4ERRA 3FBZA 1VRBA 4AKRB 2VKDA 4MALA 4G63A 2JJ9A 4PJLA 2X9YA 3I0QA 4ZS3A 3LBXB 2C5IT 2LEHA 5J2TE 2YK0A 1IZNB 2VK9A 2VKHA 4P0AA 1QSDA 2VKJA 3RYFE 1Y64B 4WBOA 2A72A 3NZPA 4GOUA 1IAPA 4CQIA 1D1BA 2CWYA 3P7IA 4P09A 2PG8A 2Q9QC 2DLRA 5EK4A 3MXZA 4ADZA 1YKEB 3RC3A 4AKHA 2D5UA 1FMVA 3WAJA 5AFUL 2WWUA 3ETUA 4L0RA 4TV9E 2WBLA 5JDMA 4TV8E 2XTLA 2X9XA 3ZMUB 3ZMZB 4PK5A 4UV9B 1H7CA 3OKQA 4KUMB 4PFPA 3N9PA 4UXNB 3CQCB 2PJQA 3KVAA 2BDEA 4NUVA 3KV9A 2LOPA 2V1DB 2V7LA 2XQYA 4G2AA 2ES0A 4HE8A 2DI4A 4MBQA 5DQVA 1HG5A 3ZYMA 4ISSA 4DMWA 2I59A 3PDYA 4NUUA 2CLYC 4DNDA 2CXLA 4BJMA 4BA9A 2BZBA 4ZI3C 1U4QA 4GK5E 2HH7A 2KMFA 2Q9QD 5DABA 4EZ4A 2IW5B 2C5JA 2E9XC 5KMGP 5LYJE 4H9NC 3RYIE 2CLYB 5FNVE 1E1HB 3PU8A 1UCUA 1SA0E 1MIWA 3IBPA 4I43B 2N1GA 2SPCA 5F3JA 3E08A 3PUQA 5LGNB 5LHGB 2V7IA 2QA7A 2W0GA 2X68A 4DVDA 3L3PA 1YD8G 1ZV4X 3B13A 2K48A 3OYZA 4YFSA 3RYHE 5LJNA 3CQXC 2LHNA 4GIWA 3BQLA 3EUHA 4KP3C 2WMNA 3P8CD 3UTKA 1KNZA 5HXCA 3ZCJA 1MMDA 5JREA 3UT5E 3DP7A 3M65A 4AKLA 4U72A 2BVMA 5L3BB 4IE0A 3SWHA 1D1CA 2MOZA 3ZMTB 5IHYA 2H3RA 4QKNA 4PNIA 4MHCA 2LSYA 4HN9A 3CMLA 4O2BE 3SS1A 3PE0A 5JR9B 3N2OA 2UXXB 3KINB 3MJXA 1S35A 3ZYKA 1SHZC 3E22E 3O1HA 3ZC0A 1WYCA 3N2GE 4EZHA 2XAFB 3C98B 3EDUA 2WSSV 3H3AA 3HL6A 4YJ2E 2WAUA 3O9XA 4YJ3E 5CA0E 2YU2A 4PJNA 3HR0A 3CX6B 5CA1E 5JR9A 3N9LA 2EHOB 2YU1A 2XUEA 3AVRA 4U74A 3FB2A 4H9QC 3T8OA 3CKDA 3ZMVB 2Y48B 2C0SA 3KV5A 2JRKA 3OJAA 4X1IE 4DO0A 4EOZB 1UX4A 3N5LA 2ZM8A 4PK4A 2CM0A 4H9RC 4UVAB 3AA0B 3RRWA 1QUUA 4PJMA 3UUNA 1D0YA 3ZC1A 4IGUA 2IC9A 3N9MA 2VL8A 3AA7B 2E9XB 4UF0A 4GYSA 3GWHA 1D0ZA 2VASA 1MMNA 3F57A 4TN7B 1BR2A 2CWOA 3DTOA 3V5UA 1V9DA 4ASKA 4EYUA 3R6NA 3UUMA 2NTYA 5H6RB 1WR6A 2EHOD 5J2UE 3LK42 3GMIA 1S94A 4N78D 2V7MA 3VU7H 4PJJA 5M4YA 2ZM2A 2YEVC 3LK3B 3OBVE 4GYRA 4I50E 3FXDB 5LXTE 3RKOA 4QXCB 1US7B 4O8SA 2ZMAA 4H9SE 2L3LA 1G73A 3AA6B 4V1Av 3WI3A 4BJNA 2YINA 1U5PA 4O4LE 4O4HE 5A1LA 5HWYA 3JC6D 3RH3A 2DHRA 4HFVA 4E7SA 3ZYLA 2LSJA 3NZQA 4CXXA 2LSIA 1B7TA 5HWXA 1HCIA 5JDLA 3GN5B 3EVYA 1EZ3A 1HTJF 3LK2B 3PTRB 4ANJA 2ZM0A 5HXHA 2LM9A 5DQWA 3UUXB 1MMAA 2D0UA 5L3GB 3AB3B 4H63H 2VWAA 4O4IE 3ANWB 1HF8A 1WLXA 4J2CA 4DBQA 1VOMA 4AI6A 4CI1B 3Q2MA 1NAFA 2V7JA 1BR0A 3KBTA 4TZ4C 2H7VC 2Z6EA 4L9IA 3HKEE 5JDHA 4Z8XA 4UF0B 2ODVA 3PU3A 2X67A 4QHOA 2B1EA 3CX7B 5HXSA 2Q9QA 3ZEFB 3HKCE 4ISTA 1ZKEA 3FBLA 3Q9DA 3MZKB 2MYSA 5LGUB 5JRCB 2KINB 4WBNE 4TX5A 3OYXA 3ZJ1A 5LBQB 3NBXX 3HKDE 4AQGA 2VKOA 3PUSA 2NW7A 3QUJA 2K5BB 4O4JE 3KV6A 2QGSA 2E8IA 4EIWA 1FMWA 4YLHA 2NOXA 5L3FB 4I4TE 3KFWX 2WM9A 2K9AA 1MIVA 2KWIB 4TUYE 3BQKA 1ZHCA 2IAKA 4P0BA 4EXTA 3AA1B 2X9HA 1LVFA 2LHRA 3A5XA 2G0UA 3EDVA 2GK9A 4KBMB 2JMKA 5C8YE 2W62A 1ZEEA 1MIYA 5FXZA 4H9OC 3UFEA 5KX5E 5LGTB 2KT9A 2KLQA 2MBGA 2CA5A 2JQQA 5FP3A 4PW8A 1G8XA 3PUGA 2Y6XA 2LSKA 2UXNB 1HG2A 1MNEA 2D0TA 1X79A 4XZCA 5FY7A 2HPLA 3D0TA 3B57A 3IHRA 1YW0A 2WMOA 1MNDA 4ZOLE 3C51A 5FXXA 3O1IA 3C4XA 3K3OA 1Z0PA 3C64A 3I9WA 4CI2B 3SRZA 3QK6A 2LE8A 5EZYE 3TKLB 2KZ7B 4ZI2D 3K3NA 3I0OA 3ZPOA 4O2AE 4PAGA 4WNKA 4C91A 4X1KE 3SOLA 2VB6A 2LOSA 3C4ZA 1AJ3A 3ZN1B 3MACA 3N9NA 4F6RC 4X1YE 5CB4E 3ZMSB 2KNDA 2E9XA 3LG7A 3QC9A 4HGAA 4UELA 4UVCB 2N2NA 4UVBB 3R84B 5JH7E 5FY1A 3J7Yq 5LG4A 5IYZE 5JDFA 2CXDA 4H63V 3FXEB 5TAOA 1LKXA 2K24A 5JR9C 3RC8A 3LBXA 3K8PC 4EYYR 3PURA 2Q9QB 4ZS2A 3WAKA 1D1AA 4MLKA 3VHLA 4ZI3D 3E0ZA 1OXZA 2LSGA 2ACXA 1HS7A 3O4XE 4GK0E 4QXHB 2V26A 5L3EB 2RP4A 5DJQC 5FXWA 1IJ6A 4QX8B 5LNKA 3CWZB 4X20E 5J1GA 4CZZB 5HXRA 3C50A 5L3CB 5JVDE 5FXVA 3IEEA 4AQFA 4CXWA 1D0XA 2C5KT 3MKDA 5BMVE 5JDQA 3FHNA 3GA8A 5ADXL 4XBFB 1FEWA 2Y8DA 2X51A 5KDMC 3GN5A 2N9DA 3RYCE 1T98A 3ZCIA 2KXPB 5JQGE 3AVSA 3KVBA 2NTXA 3CPZA 2BVLA 1YKHB 3AAEB 3HI2A 1CUNA 2PBIA 3W15B 4OYKA 3N2KE 5FYMA 4JEHB 1MMGA 4WW0A 3KV4A 4FJOA 3BQIA 3KBUA 4I55E 3ZN0B 4OHFA 5LHHB 4EB6E 3VKHA 3C4WA 4AXPA 4AKIA 4FI5A 1O3XA 4YHJA 4IE7A 2XASB 3LJCA 2NWBA 3ZLIA 2DCFA 2LJLA 3ANWA 3VKGA 4OK0A 4B6XA 5EK3A 1UX5A 1BR1A 4KMCA 3BK9A 4IHJE 4PFOA 2ZLYA 3N9OA 2CCQA 3CX8B 2P9BA 3RRCA 5ETWA 3AAAB 5L2LA 2NW8A 4L5GA 5F8PA 4QX7B 2D2SA 3Q5XA 2DWKA 4AQFC 2HPJA 5JDNA 3JC6C 4HTEA 5LA6E 3HA4A 2DNXA 5HXEA 4JLEA 2W61A 4JUYA 3O1JA 2E9XD 4OYJA 3I9YA 3K3QC 2A2FX 1WYBA 2XAQB 4K0UA 3RX6A 5E0OA 4M1PA 1FIOA 3CVRA 4UEMA 3ONXA 5LHIB 4AKGA 2CXFA 4CI3B 1BR4A 2PFVA 4C90A 4A56A 1NWMX 4PK6A 4BAYB 4E7ZA 4UV8B 1HX8A 2NW9A 2OA5A 2JMHA 1OWAA 2J1DG 3HKBE 3LFMA 4XAXB 2EHOA 2L9QA 4EAHA 2EHOC 5LP6E 3DJBA 2W00A 4DBRA 5JDGA 3UULA 3AAIA 4HKAA 5EK2A 4ZI2C 2ODUA 5HAXA 3RPUA 3F2EA 4IIJE 5L3DB 2XAGB 3Q5WA 5H6QB 2XAHB 4MFRA 3IF8B 4IE4A 1WRDA 3J9X1 5LCYA 3S4UA 3ETVA 5LJMA 3N9QA 1HFAA 2XAJB 4IE6A 3KDSE 4JEUB 2MTQA 3H37A 4UIGA 5HYAA 3NRYA 4IDZA 3ESLA 3CQGB 3U78A 3U3IA 4ZHQE 2W63A 3PUAA 2L8KA 2CE7A 2XHEB 2KWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KIN B; 
#chains in the Genus database with same CATH topology
 3RQU A;  1LVK A;  3ONJ A;  5GON E;  3ZJ2 A;  3NRX A;  2CEA A;  2W2U A;  4U33 A;  5LBM A;  1Y01 A;  3TLW A;  2IC6 A;  2NP9 A;  4QWN B;  4ZZC A;  2DWG A;  3V5S A;  5L47 A;  2JPF A;  4IE5 A;  4ILU A;  4A98 A;  3TLU A;  3K1S A;  3VRA A;  2LT3 A;  2X9W A;  2X66 A;  3F31 A;  1XDO A;  4QXB B;  3I1A A;  2H7O A;  5FMN A;  2XJ7 A;  2QYW A;  2IIU A;  2RA1 A;  3L09 A;  3MK7 C;  3MA9 A;  4HEA A;  1IJ5 A;  2HN1 A;  5FY0 A;  4DMV A;  5JRC A;  4ZEY A;  1HNX T;  2M67 A;  4YTP A;  2WDV A;  1LRZ A;  2A3D A;  3B5M A;  2V7K A;  4ZI7 E;  2X0L B;  3AEA A;  5LOV E;  1KK7 A;  3AE1 A;  3AEB A;  4CXY A;  4AKG A;  2CMR A;  1SE7 A;  2BS3 A;  2E5V A;  4H9P C;  4OFZ A;  4ERR A;  3FBZ A;  1VRB A;  2BG9 A;  2VKD A;  4AKR B;  3T1Y T;  4LF7 T;  4MAL A;  1XNR T;  4G63 A;  3T1H T;  2JJ9 A;  4PJL A;  2WU2 A;  2X9Y A;  3I0Q A;  4ZS3 A;  1X9B A;  3LBX B;  2C5I T;  2LEH A;  3RIA A;  5J2T E;  2YK0 A;  1IZN B;  2VK9 A;  2VKH A;  4P0A A;  1QSD A;  2VKJ A;  1IBM T;  3RYF E;  1Y64 B;  4WBO A;  2A72 A;  3NZP A;  4GOU A;  1IAP A;  5AQP B;  4CQI A;  5KXJ A;  1D1B A;  2CWY A;  2UXD T;  5HEU A;  2M6B A;  3P7I A;  4P09 A;  2PG8 A;  2Q9Q C;  1HNZ T;  2DLR A;  5EK4 A;  5AQI B;  5AQU B;  3MXZ A;  4IT4 A;  1YKE B;  3RC3 A;  4ADZ A;  2D5U A;  4LFC T;  4AKH A;  3LDQ B;  1FMV A;  3WAJ A;  2UUA T;  4B3T T;  4YSY A;  2WWU A;  3ETU A;  5AFU L;  4L0R A;  4TV9 E;  5FKY A;  2WBL A;  5JDM A;  4HFE A;  4TV8 E;  2X0Y A;  2H89 A;  2X9X A;  2XTL A;  4IL9 A;  4JBW F;  4P1N A;  2PTF A;  4PK5 A;  4UV9 B;  3ZMU B;  5ABH A;  4IDN A;  4KHZ F;  2VL0 A;  1H7C A;  3OKQ A;  4KUM B;  4PFP A;  3N9P A;  4UXN B;  3UU8 A;  3CQC B;  2PJQ A;  3KVA A;  2BDE A;  4NUV A;  3KV9 A;  2LOP A;  2V1D B;  4WYV A;  3ZST A;  2V7L A;  1OED E;  2XQY A;  2BG9 E;  2ES0 A;  4G2A A;  1W9R A;  4HE8 A;  2DI4 A;  1I94 T;  3RIU C;  4MBQ A;  5DQV A;  1HG5 A;  3ZYM A;  4ISS A;  4DMW A;  5IWA T;  2I59 A;  3PDY A;  3PUZ F;  2W4X A;  4HWI B;  2CLY C;  4NUU A;  4EV6 A;  4DND A;  2CXL A;  4BJM A;  4BA9 A;  5FVL A;  2YN6 A;  2BZB A;  4ZI3 C;  1U4Q A;  3AE7 A;  3RKG A;  4GK5 E;  2HH7 A;  2KMF A;  2Q9Q D;  5DAB A;  4EZ4 A;  2IW5 B;  2C5J A;  2WZI A;  2E9X C;  5KMG P;  4ZZB A;  5LYJ E;  4H9N C;  3RYI E;  2CLY B;  5FNV E;  1E1H B;  3AE5 A;  3PU8 A;  3VRB A;  4B3S T;  4CN1 A;  1N33 T;  1UCU A;  1SA0 E;  1CHU A;  1MIW A;  2XQA A;  3IBP A;  4I43 B;  2N1G A;  2SPC A;  4QH5 A;  3SFE A;  1OED B;  5F3J A;  3VR9 A;  2XQ7 A;  4HWC A;  2BS2 A;  3E08 A;  4COF A;  4DR7 T;  5ABE A;  3AE2 A;  1T8B A;  3PUQ A;  5LGN B;  5LHG B;  2V7I A;  2QA7 A;  2B76 A;  2W0G A;  2X68 A;  4DVD A;  3L3P A;  5AQK B;  1YD8 G;  1UGO A;  1ZV4 X;  2WS3 A;  2K48 A;  3B13 A;  3OYZ A;  4YFS A;  1XDP A;  3JCF A;  3CQX C;  3RYH E;  5ABF B;  2LHN A;  5AQG B;  4GIW A;  2VVS A;  3BQL A;  3EUH A;  4KP3 C;  2WMN A;  3P8C D;  3UTK A;  4LFA T;  1KNZ A;  5HXC A;  3ZCJ A;  1MMD A;  5F5W A;  3UT5 E;  4TWH A;  3DP7 A;  5JRE A;  5BR8 T;  1R8I A;  4DV6 T;  3AE4 A;  3M65 A;  4AKL A;  4U72 A;  2BVM A;  5AQF B;  4IE0 A;  5L3B B;  3SWH A;  3EHZ A;  1D1C A;  2MOZ A;  2XSA A;  3G06 A;  4ILB A;  3ZMT B;  2BG9 B;  3ZMZ B;  5IHY A;  2H3R A;  4QKN A;  4PNI A;  4MHC A;  2LSY A;  3UU4 A;  2HN2 A;  2VUR A;  4HN9 A;  4QH4 A;  3CML A;  4O2B E;  3UU6 A;  3SS1 A;  4DUY T;  3IA3 A;  3PE0 A;  4ILC A;  5JR9 B;  2IDO B;  2UXX B;  3KIN B;  3MJX A;  1S35 A;  3N2O A;  1SHZ C;  3ZYK A;  3E22 E;  3O1H A;  4LFB T;  1UUR A;  2WCA A;  1WYC A;  2IUB A;  3N2G E;  3ZC0 A;  4EZH A;  1J5W A;  2YDQ A;  3FZH B;  4U2Y A;  2JIW A;  2XAF B;  1WCR A;  3C98 B;  1WFD A;  2WSS V;  3EDU A;  3H3A A;  3HL6 A;  2IML A;  3P50 A;  4LF8 T;  2WAU A;  4A5X A;  4YJ2 E;  3O9X A;  2H88 A;  4YJ3 E;  5CA0 E;  4HFH A;  1HX1 B;  2YU2 A;  4PJN A;  3HR0 A;  5AQR B;  3AEG A;  3CX6 B;  5CA1 E;  5JR9 A;  1N34 T;  1OED C;  1YXR A;  2EHO B;  2V6Y B;  2XUE A;  2YU1 A;  3AVR A;  3N9L A;  4U74 A;  3TLV A;  3NWI A;  2M6I A;  2CPT A;  4LF6 T;  3FB2 A;  4H9Q C;  1I6Z A;  4JI4 T;  3T8O A;  3CKD A;  3ZMV B;  2LRK A;  3PUW F;  2Y48 B;  2C0S A;  1HNW T;  2WY2 A;  3KV5 A;  2JRK A;  3OJA A;  3ZKR A;  4X1I E;  4DO0 A;  4EOZ B;  1XMO T;  1UX4 A;  1W0A A;  3N5L A;  2ZM8 A;  4PK4 A;  2CM0 A;  4H9R C;  4UVA B;  2YDR A;  1NEN A;  3AA0 B;  2BS4 A;  4X5T A;  5FVK A;  4ILA A;  1QUU A;  4KI0 F;  4PJM A;  1D0Y A;  3RIU A;  3RRW A;  3UUN A;  3ZC1 A;  4F8H A;  3AE6 A;  4IGU A;  5LMN T;  2IC9 A;  3RQW A;  3TLT A;  3N9M A;  2VL8 A;  3AA7 B;  4HFB A;  2E9X B;  2FBW A;  4UF0 A;  1T7S A;  4GYS A;  3GWH A;  1D0Z A;  2VAS A;  1MMN A;  3F57 A;  4TN7 B;  1BR2 A;  4LML A;  2CWO A;  3DTO A;  3UU3 A;  3V5U A;  1V9D A;  2YKS A;  4ASK A;  2XQ5 A;  4EYU A;  3R6N A;  4OX9 T;  3CIR A;  3UUM A;  2NTY A;  2XQ6 A;  2BBH A;  5H6R B;  3RF1 A;  1WR6 A;  2EHO D;  5HCJ A;  3RHW A;  4HWF A;  5J2U E;  3LK4 2;  2WDR A;  3GMI A;  1S94 A;  4N78 D;  2V7M A;  3VU7 H;  4PJJ A;  3FZL B;  5M4Y A;  2ZM2 A;  4DV7 T;  2YEV C;  3LK3 B;  3OBV E;  4B3M T;  2BKO A;  2XQ3 A;  4GYR A;  4I50 E;  3FXD B;  3RLF F;  5AQO B;  3TLS A;  3OTO T;  5LXT E;  3RKO A;  4QXC B;  1US7 B;  4O8S A;  4DV2 T;  4EED A;  2ZMA A;  4H9S E;  2L3L A;  4TNW A;  4JI6 T;  1G73 A;  3P4Q A;  4NIQ A;  3AA6 B;  4V1A v;  5LG3 A;  3WI3 A;  5ABG A;  3ZSS A;  5CJ5 A;  4LF4 T;  4BJN A;  2YIN A;  4JV5 T;  1U5P A;  4O4L E;  4O4H E;  5A1L A;  5HWY A;  3JC6 D;  1XMQ T;  3RH3 A;  2DHR A;  2UXC T;  4HFV A;  4E7S A;  5AQN B;  3ZYL A;  4X62 T;  1GQE A;  4JI8 T;  2LSJ A;  5AQM B;  1XNQ T;  3NZQ A;  1Z8U A;  4CXX A;  3PUV F;  2NR4 A;  2LSI A;  1B7T A;  3AEC A;  5HWX A;  2AE9 A;  1M62 A;  1HCI A;  5JDL A;  3GN5 B;  3EVY A;  1EZ3 A;  1HTJ F;  3JAD A;  3LK2 B;  3NKZ A;  3PTR B;  3UU5 A;  2ZM0 A;  2LLY A;  4ANJ A;  2LM9 A;  5DQW A;  5HXH A;  3UUX B;  1MMA A;  1ZP0 A;  4EEB A;  2I0M A;  1N36 T;  4GKK T;  2J47 A;  4QH1 A;  2D0U A;  4TNV A;  3UFG A;  5L3G B;  5LB7 B;  3AB3 B;  2UUC T;  3FZK B;  1YQ4 A;  3AXJ B;  4H63 H;  2VWA A;  4DR2 T;  4O4I E;  1SUM B;  5AQJ B;  2E2A A;  1HF8 A;  1WLX A;  2LKH A;  3ANW B;  1VOM A;  4J2C A;  4DBQ A;  4LF9 T;  4AI6 A;  4CI1 B;  3Q5D A;  3Q2M A;  1NAF A;  2V7J A;  1BR0 A;  4AIS A;  3KBT A;  4TZ4 C;  2F4V T;  2H7V C;  2Z6E A;  4L9I A;  3HKE E;  3P4S A;  4YHH T;  5JDH A;  4Z8X A;  5AQL B;  4UF0 B;  2WQY A;  2ODV A;  3PUY F;  5AQS B;  1J1J A;  3PU3 A;  2X67 A;  4QHO A;  2B1E A;  3CX7 B;  5HXS A;  5AQT B;  2Q9Q A;  4B3R T;  4JI1 T;  3ZEF B;  3HKC E;  4IST A;  2WZH A;  1ZKE A;  3FBL A;  3UQ7 A;  3Q9D A;  3MZK B;  1FJG T;  2MYS A;  3OVU A;  5LGU B;  1HR0 T;  2KIN B;  4WBN E;  4TX5 A;  3AE3 A;  5JRC B;  3OYX A;  3EAM A;  4X66 T;  3ZJ1 A;  2ZM6 T;  4DID B;  3PV0 F;  3NBX X;  1E2A A;  5LBQ B;  4DR5 T;  3HKD E;  3JAE A;  4AQG A;  5ABF A;  2VKO A;  3PUS A;  2NW7 A;  3QUJ A;  4YSZ A;  2K5B B;  2WP9 A;  3KV6 A;  2QGS A;  2BG9 C;  2E8I A;  3EAB A;  2V5D A;  4O4J E;  4EIW A;  4X64 T;  1FMW A;  2AXD S;  1M7K A;  4YLH A;  5L4E A;  2MAW A;  2NOX A;  3M3Z B;  5L3F B;  4I4T E;  5C3J A;  3AEF A;  3KFW X;  2WDQ A;  2WM9 A;  2K9A A;  4KHP T;  4X65 T;  1MIV A;  2KWI B;  4TUY E;  3BQK A;  1JNZ A;  1ZHC A;  1W0B A;  2IAK A;  4P0B A;  4EXT A;  4JI7 T;  3AA1 B;  2X9H A;  2BKP A;  5C2T A;  1LVF A;  1W09 A;  2LHR A;  3A5X A;  2G0U A;  3EDV A;  2GK9 A;  4KBM B;  2JMK A;  5C8Y E;  2W62 A;  4DUZ T;  1MIY A;  1ZEE A;  3QB5 K;  4DV5 T;  5FXZ A;  4H9O C;  3UFE A;  3AED A;  5KX5 E;  2KT9 A;  1QLB A;  2KLQ A;  2CA5 A;  2JQQ A;  2MBG A;  5LGT B;  5FP3 A;  1WR0 A;  4AIU A;  4PW8 A;  1G8X A;  3PUG A;  1IBL T;  2Y6X A;  2LSK A;  2UXN B;  1HG2 A;  1MNE A;  2D0T A;  2XQ9 A;  1X79 A;  3ZT7 A;  2LKG A;  4XZC A;  1J5E T;  5FY7 A;  4DR4 T;  2HPL A;  3D0T A;  3B57 A;  3IHR A;  1YW0 A;  1L0V A;  4DR3 T;  2WMO A;  1MND A;  4ZOL E;  4GKJ T;  3C51 A;  2HHH T;  5FXX A;  3ZT5 A;  3O1I A;  3C4X A;  2FJB A;  1Z0P A;  3C64 A;  3I9W A;  3K3O A;  3AXJ A;  3SRZ A;  3UUB A;  4CI2 B;  4DV3 T;  3QK6 A;  2LE8 A;  5EZY E;  3TKL B;  2CHN A;  2I6H A;  4U2Z A;  2KZ7 B;  3RI5 A;  4ZI2 D;  3K3N A;  3I0O A;  3ZPO A;  4O2A E;  5LJN A;  2VVN A;  4PAG A;  4WNK A;  4C91 A;  2ACZ A;  1KNR A;  4X1K E;  2FJD A;  2VB6 A;  2CBJ A;  3JAF A;  3SOL A;  5JTG A;  4DV0 T;  2LOS A;  3C4Z A;  4CN6 A;  1NEK A;  1AJ3 A;  3ZN1 B;  3MAC A;  2LRL A;  3N9N A;  4F6R C;  4X1Y E;  3P4P A;  5HEG A;  2KND A;  2E9X A;  3LG7 A;  2FUP A;  3QC9 A;  4HGA A;  4UEL A;  4UVC B;  5AQV B;  2YDS A;  2N2N A;  4UVB B;  5HCM A;  4IL4 A;  2V8S V;  3R84 B;  5JH7 E;  4Z90 A;  5FY1 A;  3J7Y q;  2BKN A;  5LG4 A;  5IYZ E;  1XWM A;  2IHR 1;  5JDF A;  2CXD A;  4H63 V;  3Q5E A;  3FXE B;  4I0U A;  5TAO A;  2JQH A;  1LKX A;  1ZOY A;  2K24 A;  4YSX A;  2LM2 A;  3H3M A;  3RGL A;  5JR9 C;  4JI5 T;  3RC8 A;  3LBX A;  3K8P C;  4EYY R;  3OPC A;  2OV9 A;  4HFI A;  4JYA T;  3PUR A;  2Q9Q B;  4ZS2 A;  3WAK A;  4DV1 T;  1D1A A;  1UUS A;  2JQK A;  1YQ3 A;  3E0Z A;  4MLK A;  3VHL A;  4ZI3 D;  4NXM T;  1OXZ A;  2LSG A;  2ACX A;  2MPK A;  3O4X E;  4LF5 T;  1HS7 A;  5IUX A;  4GK0 E;  4QXH B;  2V26 A;  1E7P A;  5L3E B;  3CK6 A;  2WB5 A;  4JI3 T;  2RP4 A;  2W67 A;  5DJQ C;  5FXW A;  1IJ6 A;  4QX8 B;  5LNK A;  3CWZ B;  4YY3 T;  4X20 E;  5J1G A;  4CZZ B;  4K0K T;  2CRB A;  2UU9 T;  1KF6 A;  5HXR A;  2QRX A;  4AQY T;  4HFD A;  4NXN T;  3C50 A;  5L3C B;  5JVD E;  4JI0 T;  5FXV A;  3IEE A;  3LSV A;  4AQF A;  4CXW A;  3L39 A;  1D0X A;  2C5K T;  2WU5 A;  3MKD A;  4KX6 A;  5BMV E;  5JDQ A;  3FHN A;  2XY8 B;  3GA8 A;  5ADX L;  1T72 A;  4XBF B;  2A9U A;  1FEW A;  2V6X A;  2Y8D A;  2X51 A;  5KDM C;  2E5L T;  3GN5 A;  1DU2 A;  2N9D A;  2V5C A;  4Z91 A;  3RYC E;  1T98 A;  3ZCI A;  2KXP B;  2XQ8 A;  5JQG E;  3AVS A;  3QNU A;  5FL0 A;  3KVB A;  2NTX A;  3CPZ A;  2BVL A;  4HWH A;  4IDP A;  1YKH B;  3AAE B;  2XPK A;  2J4G A;  5LMU T;  3QB5 A;  4UR9 A;  3RIF A;  3HI2 A;  1CUN A;  2FJE A;  2PBI A;  3P4W A;  3W15 B;  2VQE T;  3PJA A;  4TWF A;  4OYK A;  3N2K E;  5FYM A;  1UK5 A;  2UXB T;  4JEH B;  4NPP A;  1MMG A;  1XZY A;  4WW0 A;  3KV4 A;  4FJO A;  3BQI A;  3KBU A;  4I55 E;  3X1D A;  4OHF A;  3ZN0 B;  5LHH B;  4EB6 E;  5AQH B;  2D9D A;  3VKH A;  3C4W A;  3PUX F;  4CN4 A;  2J62 A;  3AEE A;  2KSR A;  3FZF B;  4AXP A;  2UUB T;  4FI5 A;  4IRE A;  4AKI A;  1VCS A;  1O3X A;  4YHJ A;  3AE9 A;  2OLT A;  4IDQ A;  2XAS B;  4IE7 A;  3LJC A;  3QOF A;  4IDO A;  4JI2 T;  2NWB A;  3ZLI A;  2DCF A;  2LJL A;  3ANW A;  3VKG A;  4OK0 A;  4YTM A;  5EK3 A;  4B6X A;  4YXD A;  4DR6 T;  5L4H A;  2VQF T;  1UX5 A;  1BR1 A;  2XZE A;  4KMC A;  2YOE A;  3BK9 A;  4IHJ E;  4PFO A;  2BBJ A;  2ZLY A;  3N9O A;  2CCQ A;  3CX8 B;  4A97 A;  3ONL C;  2R6G F;  2P9B A;  4HWD A;  5HEJ A;  3RRC A;  5ETW A;  5AQQ B;  3AAA B;  5HEH A;  1VCT A;  2JQ9 A;  4U31 A;  5L2L A;  3A8Y C;  2NW8 A;  4L5G A;  5F8P A;  4QX7 B;  2D2S A;  3Q5X A;  2DWK A;  3A7M A;  4AQF C;  2HPJ A;  5JDN A;  3JC6 C;  4HTE A;  3VR8 A;  5LA6 E;  3HA4 A;  2DNX A;  4WZX A;  5HXE A;  4JLE A;  1JNR A;  1IBK T;  4DR1 T;  2W61 A;  4JUY A;  3O1J A;  2RPA A;  2E9X D;  5J0Z A;  3L8R A;  4OYJ A;  3I9Y A;  3P4R A;  3K3Q C;  3PJA J;  2A2F X;  1WYB A;  2XAQ B;  4K0U A;  5CGM A;  3RX6 A;  3NVO A;  5E0O A;  4M1P A;  4EGW A;  3UQ4 A;  1FIO A;  3CVR A;  4UEM A;  3EI0 A;  2FJA A;  3ONX A;  2WWV A;  5CFB A;  1KEY A;  2CXF A;  5LHI B;  4CI3 B;  1BR4 A;  2PFV A;  4C90 A;  5HEO A;  1NWM X;  4PK6 A;  4A56 A;  4BAY B;  4E7Z A;  4UV8 B;  1HX8 A;  2NW9 A;  2OA5 A;  2JMH A;  1OED A;  1OWA A;  2J1D G;  2XSB A;  3HKB E;  3LFM A;  4XAX B;  2EHO A;  2L9Q A;  2V6Y A;  4EAH A;  2EHO C;  2XM2 A;  5LP6 E;  3DJB A;  2W00 A;  3ZT6 A;  4DBR A;  3SFD A;  3UUL A;  3AAI A;  5JDG A;  3AE8 A;  4HKA A;  4HFC A;  5EK2 A;  4ZI2 C;  2ODU A;  2QVA A;  5HAX A;  3RPU A;  2CBI A;  2W66 A;  4LMK A;  4LMJ A;  3F2E A;  1N32 T;  4IIJ E;  5L3D B;  2XAG B;  4DV4 T;  3Q5W A;  5H6Q B;  2XAH B;  4MFR A;  3IF8 B;  4IE4 A;  2DL1 A;  1WRD A;  4U7I A;  2XQ4 A;  4U7Y A;  4U3C A;  5LCY A;  3J9X 1;  3S4U A;  3ETV A;  5LJM A;  3N9Q A;  5CB4 E;  4YT0 A;  1HFA A;  2XAJ B;  3ZMS B;  4IE6 A;  3KDS E;  4JEU B;  1KNP A;  2CHO A;  2K3W A;  2MTQ A;  3H37 A;  4UIG A;  4ZXL A;  3NRY A;  4IDZ A;  4YTN A;  5HYA A;  3ABV A;  3ESL A;  3CQG B;  3U78 A;  3U3I A;  2XM1 A;  4ZHQ E;  2W63 A;  3FZM B;  2X0H A;  2L8K A;  1KFY A;  3PUA A;  2CE7 A;  4Q25 A;  4TWD A;  2XHE B;  5FL1 A;  2KWH A; 
#chains in the Genus database with same CATH homology
 1LVK A;  5GON E;  3ZJ2 A;  3NRX A;  2CEA A;  5LBM A;  2IC6 A;  2NP9 A;  4QWN B;  2DWG A;  3V5S A;  2JPF A;  4IE5 A;  4ILU A;  2LT3 A;  2X9W A;  2X66 A;  3F31 A;  5FMN A;  4QXB B;  3I1A A;  2H7O A;  3L09 A;  3MK7 C;  2RA1 A;  4HEA A;  3MA9 A;  1IJ5 A;  5FY0 A;  4DMV A;  5JRC A;  2M67 A;  1LRZ A;  2A3D A;  2V7K A;  4ZI7 E;  2X0L B;  5LOV E;  1KK7 A;  4CXY A;  2CMR A;  4H9P C;  4OFZ A;  4ERR A;  3FBZ A;  1VRB A;  4AKR B;  2VKD A;  4MAL A;  4G63 A;  2JJ9 A;  4PJL A;  2X9Y A;  3I0Q A;  4ZS3 A;  3LBX B;  2C5I T;  2LEH A;  5J2T E;  2YK0 A;  1IZN B;  2VK9 A;  2VKH A;  4P0A A;  1QSD A;  2VKJ A;  3RYF E;  1Y64 B;  4WBO A;  2A72 A;  3NZP A;  4GOU A;  1IAP A;  4CQI A;  1D1B A;  2CWY A;  3P7I A;  4P09 A;  2PG8 A;  2Q9Q C;  2DLR A;  5EK4 A;  3MXZ A;  4ADZ A;  1YKE B;  3RC3 A;  4AKH A;  2D5U A;  1FMV A;  3WAJ A;  5AFU L;  2WWU A;  3ETU A;  4L0R A;  4TV9 E;  2WBL A;  5JDM A;  4TV8 E;  2XTL A;  2X9X A;  3ZMU B;  3ZMZ B;  4PK5 A;  4UV9 B;  1H7C A;  3OKQ A;  4KUM B;  4PFP A;  3N9P A;  4UXN B;  3CQC B;  2PJQ A;  3KVA A;  2BDE A;  4NUV A;  3KV9 A;  2LOP A;  2V1D B;  2V7L A;  2XQY A;  4G2A A;  2ES0 A;  4HE8 A;  2DI4 A;  4MBQ A;  5DQV A;  1HG5 A;  3ZYM A;  4ISS A;  4DMW A;  2I59 A;  3PDY A;  4NUU A;  2CLY C;  4DND A;  2CXL A;  4BJM A;  4BA9 A;  2BZB A;  4ZI3 C;  1U4Q A;  4GK5 E;  2HH7 A;  2KMF A;  2Q9Q D;  5DAB A;  4EZ4 A;  2IW5 B;  2C5J A;  2E9X C;  5KMG P;  5LYJ E;  4H9N C;  3RYI E;  2CLY B;  5FNV E;  1E1H B;  3PU8 A;  1UCU A;  1SA0 E;  1MIW A;  3IBP A;  4I43 B;  2N1G A;  2SPC A;  5F3J A;  3E08 A;  3PUQ A;  5LGN B;  5LHG B;  2V7I A;  2QA7 A;  2W0G A;  2X68 A;  4DVD A;  3L3P A;  1YD8 G;  1ZV4 X;  3B13 A;  2K48 A;  3OYZ A;  4YFS A;  3RYH E;  5LJN A;  3CQX C;  2LHN A;  4GIW A;  3BQL A;  3EUH A;  4KP3 C;  2WMN A;  3P8C D;  3UTK A;  1KNZ A;  5HXC A;  3ZCJ A;  1MMD A;  5JRE A;  3UT5 E;  3DP7 A;  3M65 A;  4AKL A;  4U72 A;  2BVM A;  5L3B B;  4IE0 A;  3SWH A;  1D1C A;  2MOZ A;  3ZMT B;  5IHY A;  2H3R A;  4QKN A;  4PNI A;  4MHC A;  2LSY A;  4HN9 A;  3CML A;  4O2B E;  3SS1 A;  3PE0 A;  5JR9 B;  3N2O A;  2UXX B;  3KIN B;  3MJX A;  1S35 A;  3ZYK A;  1SHZ C;  3E22 E;  3O1H A;  3ZC0 A;  1WYC A;  3N2G E;  4EZH A;  2XAF B;  3C98 B;  3EDU A;  2WSS V;  3H3A A;  3HL6 A;  4YJ2 E;  2WAU A;  3O9X A;  4YJ3 E;  5CA0 E;  2YU2 A;  4PJN A;  3HR0 A;  3CX6 B;  5CA1 E;  5JR9 A;  3N9L A;  2EHO B;  2YU1 A;  2XUE A;  3AVR A;  4U74 A;  3FB2 A;  4H9Q C;  3T8O A;  3CKD A;  3ZMV B;  2Y48 B;  2C0S A;  3KV5 A;  2JRK A;  3OJA A;  4X1I E;  4DO0 A;  4EOZ B;  1UX4 A;  3N5L A;  2ZM8 A;  4PK4 A;  2CM0 A;  4H9R C;  4UVA B;  3AA0 B;  3RRW A;  1QUU A;  4PJM A;  3UUN A;  1D0Y A;  3ZC1 A;  4IGU A;  2IC9 A;  3N9M A;  2VL8 A;  3AA7 B;  2E9X B;  4UF0 A;  4GYS A;  3GWH A;  1D0Z A;  2VAS A;  1MMN A;  3F57 A;  4TN7 B;  1BR2 A;  2CWO A;  3DTO A;  3V5U A;  1V9D A;  4ASK A;  4EYU A;  3R6N A;  3UUM A;  2NTY A;  5H6R B;  1WR6 A;  2EHO D;  5J2U E;  3LK4 2;  3GMI A;  1S94 A;  4N78 D;  2V7M A;  3VU7 H;  4PJJ A;  5M4Y A;  2ZM2 A;  2YEV C;  3LK3 B;  3OBV E;  4GYR A;  4I50 E;  3FXD B;  5LXT E;  3RKO A;  4QXC B;  1US7 B;  4O8S A;  2ZMA A;  4H9S E;  2L3L A;  1G73 A;  3AA6 B;  4V1A v;  3WI3 A;  4BJN A;  2YIN A;  1U5P A;  4O4L E;  4O4H E;  5A1L A;  5HWY A;  3JC6 D;  3RH3 A;  2DHR A;  4HFV A;  4E7S A;  3ZYL A;  2LSJ A;  3NZQ A;  4CXX A;  2LSI A;  1B7T A;  5HWX A;  1HCI A;  5JDL A;  3GN5 B;  3EVY A;  1EZ3 A;  1HTJ F;  3LK2 B;  3PTR B;  4ANJ A;  2ZM0 A;  5HXH A;  2LM9 A;  5DQW A;  3UUX B;  1MMA A;  2D0U A;  5L3G B;  3AB3 B;  4H63 H;  2VWA A;  4O4I E;  3ANW B;  1HF8 A;  1WLX A;  4J2C A;  4DBQ A;  1VOM A;  4AI6 A;  4CI1 B;  3Q2M A;  1NAF A;  2V7J A;  1BR0 A;  3KBT A;  4TZ4 C;  2H7V C;  2Z6E A;  4L9I A;  3HKE E;  5JDH A;  4Z8X A;  4UF0 B;  2ODV A;  3PU3 A;  2X67 A;  4QHO A;  2B1E A;  3CX7 B;  5HXS A;  2Q9Q A;  3ZEF B;  3HKC E;  4IST A;  1ZKE A;  3FBL A;  3Q9D A;  3MZK B;  2MYS A;  5LGU B;  5JRC B;  2KIN B;  4WBN E;  4TX5 A;  3OYX A;  3ZJ1 A;  5LBQ B;  3NBX X;  3HKD E;  4AQG A;  2VKO A;  3PUS A;  2NW7 A;  3QUJ A;  2K5B B;  4O4J E;  3KV6 A;  2QGS A;  2E8I A;  4EIW A;  1FMW A;  4YLH A;  2NOX A;  5L3F B;  4I4T E;  3KFW X;  2WM9 A;  2K9A A;  1MIV A;  2KWI B;  4TUY E;  3BQK A;  1ZHC A;  2IAK A;  4P0B A;  4EXT A;  3AA1 B;  2X9H A;  1LVF A;  2LHR A;  3A5X A;  2G0U A;  3EDV A;  2GK9 A;  4KBM B;  2JMK A;  5C8Y E;  2W62 A;  1ZEE A;  1MIY A;  5FXZ A;  4H9O C;  3UFE A;  5KX5 E;  5LGT B;  2KT9 A;  2KLQ A;  2MBG A;  2CA5 A;  2JQQ A;  5FP3 A;  4PW8 A;  1G8X A;  3PUG A;  2Y6X A;  2LSK A;  2UXN B;  1HG2 A;  1MNE A;  2D0T A;  1X79 A;  4XZC A;  5FY7 A;  2HPL A;  3D0T A;  3B57 A;  3IHR A;  1YW0 A;  2WMO A;  1MND A;  4ZOL E;  3C51 A;  5FXX A;  3O1I A;  3C4X A;  3K3O A;  1Z0P A;  3C64 A;  3I9W A;  4CI2 B;  3SRZ A;  3QK6 A;  2LE8 A;  5EZY E;  3TKL B;  2KZ7 B;  4ZI2 D;  3K3N A;  3I0O A;  3ZPO A;  4O2A E;  4PAG A;  4WNK A;  4C91 A;  4X1K E;  3SOL A;  2VB6 A;  2LOS A;  3C4Z A;  1AJ3 A;  3ZN1 B;  3MAC A;  3N9N A;  4F6R C;  4X1Y E;  5CB4 E;  3ZMS B;  2KND A;  2E9X A;  3LG7 A;  3QC9 A;  4HGA A;  4UEL A;  4UVC B;  2N2N A;  4UVB B;  3R84 B;  5JH7 E;  5FY1 A;  3J7Y q;  5LG4 A;  5IYZ E;  5JDF A;  2CXD A;  4H63 V;  3FXE B;  5TAO A;  1LKX A;  2K24 A;  5JR9 C;  3RC8 A;  3LBX A;  3K8P C;  4EYY R;  3PUR A;  2Q9Q B;  4ZS2 A;  3WAK A;  1D1A A;  4MLK A;  3VHL A;  4ZI3 D;  3E0Z A;  1OXZ A;  2LSG A;  2ACX A;  1HS7 A;  3O4X E;  4GK0 E;  4QXH B;  2V26 A;  5L3E B;  2RP4 A;  5DJQ C;  5FXW A;  1IJ6 A;  4QX8 B;  5LNK A;  3CWZ B;  4X20 E;  5J1G A;  4CZZ B;  5HXR A;  3C50 A;  5L3C B;  5JVD E;  5FXV A;  3IEE A;  4AQF A;  4CXW A;  1D0X A;  2C5K T;  3MKD A;  5BMV E;  5JDQ A;  3FHN A;  3GA8 A;  5ADX L;  4XBF B;  1FEW A;  2Y8D A;  2X51 A;  5KDM C;  3GN5 A;  2N9D A;  3RYC E;  1T98 A;  3ZCI A;  2KXP B;  5JQG E;  3AVS A;  3KVB A;  2NTX A;  3CPZ A;  2BVL A;  1YKH B;  3AAE B;  3HI2 A;  1CUN A;  2PBI A;  3W15 B;  4OYK A;  3N2K E;  5FYM A;  4JEH B;  1MMG A;  4WW0 A;  3KV4 A;  4FJO A;  3BQI A;  3KBU A;  4I55 E;  3ZN0 B;  4OHF A;  5LHH B;  4EB6 E;  3VKH A;  3C4W A;  4AXP A;  4AKI A;  4FI5 A;  1O3X A;  4YHJ A;  4IE7 A;  2XAS B;  3LJC A;  2NWB A;  3ZLI A;  2DCF A;  2LJL A;  3ANW A;  3VKG A;  4OK0 A;  4B6X A;  5EK3 A;  1UX5 A;  1BR1 A;  4KMC A;  3BK9 A;  4IHJ E;  4PFO A;  2ZLY A;  3N9O A;  2CCQ A;  3CX8 B;  2P9B A;  3RRC A;  5ETW A;  3AAA B;  5L2L A;  2NW8 A;  4L5G A;  5F8P A;  4QX7 B;  2D2S A;  3Q5X A;  2DWK A;  4AQF C;  2HPJ A;  5JDN A;  3JC6 C;  4HTE A;  5LA6 E;  3HA4 A;  2DNX A;  5HXE A;  4JLE A;  2W61 A;  4JUY A;  3O1J A;  2E9X D;  4OYJ A;  3I9Y A;  3K3Q C;  2A2F X;  1WYB A;  2XAQ B;  4K0U A;  3RX6 A;  5E0O A;  4M1P A;  1FIO A;  3CVR A;  4UEM A;  3ONX A;  5LHI B;  4AKG A;  2CXF A;  4CI3 B;  1BR4 A;  2PFV A;  4C90 A;  4A56 A;  1NWM X;  4PK6 A;  4BAY B;  4E7Z A;  4UV8 B;  1HX8 A;  2NW9 A;  2OA5 A;  2JMH A;  1OWA A;  2J1D G;  3HKB E;  3LFM A;  4XAX B;  2EHO A;  2L9Q A;  4EAH A;  2EHO C;  5LP6 E;  3DJB A;  2W00 A;  4DBR A;  5JDG A;  3UUL A;  3AAI A;  4HKA A;  5EK2 A;  4ZI2 C;  2ODU A;  5HAX A;  3RPU A;  3F2E A;  4IIJ E;  5L3D B;  2XAG B;  3Q5W A;  5H6Q B;  2XAH B;  4MFR A;  3IF8 B;  4IE4 A;  1WRD A;  3J9X 1;  5LCY A;  3S4U A;  3ETV A;  5LJM A;  3N9Q A;  1HFA A;  2XAJ B;  4IE6 A;  3KDS E;  4JEU B;  2MTQ A;  3H37 A;  4UIG A;  5HYA A;  3NRY A;  4IDZ A;  3ESL A;  3CQG B;  3U78 A;  3U3I A;  4ZHQ E;  2W63 A;  3PUA A;  2L8K A;  2CE7 A;  2XHE B;  2KWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...