3KINB

Kinesin (dimeric) from rattus norvegicus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
NKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVIQHLEVELNRWRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords KINESIN HEAVY CHAIN
publication title The crystal structure of dimeric kinesin and implications for microtubule-dependent motility.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
total genus 37
structure length 117
sequence length 117
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1980 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kinB00
3KINB
chains in the Genus database with same CATH superfamily
3O1IA 3RPUA 2L9QA 3L3PA 2W62A 3JCFA 2FUPA 2WDRA 5EK4A 3C4ZA 2LHRA 2DWKA 3RH3A 2CLYB 4N78D 3OBVE 3VRBA 3TLSA 5H6RB 2LSGA 3RC8A 5L47A 2XHEB 3EVYA 3SFEA 3ZYMA 5L3CB 2JJ9A 4L9IA 2VL0A 5HEUA 3GMIA 4FI5A 4MBQA 4KBMB 1YQ3A 4WZXA 4HFCA 3IHRA 2JQHA 2N1GA 3LSVA 2C0SA 3Q5XA 2VASA 3E08A 4O2BE 2VQFT 3ABVA 3QC9A 1KNRA 4TZ4C 1U5PA 4B3ST 2XAFB 5JR9A 4DV7T 3SRZA 3FZFB 4ZI3D 3AE9A 2DWGA 3UT5E 3A8YC 5F3JA 2KXPB 2CRBA 1FEWA 4YFSA 5KDMC 4GKJT 4EXTA 3ZPOA 2V6YB 3CX7B 5LNKA 1W0BA 2C5IT 2KMFA 4MHCA 1MNDA 3R6NA 2H7VC 3LBXA 4H9QC 3PE0A 1KFYA 1BR1A 2W67A 2HPLA 2A3DA 2X0YA 4C90A 2W66A 3HKEE 5HAXA 3JC6C 4KUMB 1W9RA 4HKAA 4LFBT 3TLUA 2C5KT 2IHR1 5KXJA 3LFMA 5DQVA 2WQYA 3AVRA 1LVFA 3TKLB 2HPJA 3C51A 3UU3A 4M1PA 3H37A 3K3NA 3ZT7A 1E7PA 2XQ7A 3KBUA 1FMVA 4PJJA 3RYFE 5F5WA 1XNQT 3Q5EA 2XQ8A 1VCSA 3RYHE 2CA5A 1HFAA 3UUNA 2KWHA 3VR8A 4YSXA 3BQIA 4TWFA 3AA0B 5IYZE 3RHWA 4COFA 5AQGB 4X62T 4X1IE 3HI2A 1X9BA 4TWDA 4ZS3A 4UEMA 3AE2A 5LHGB 2E9XC 4DV3T 2QGSA 4L0RA 4OYKA 3LDQB 2VURA 2N9DA 5CFBA 2D9DA 4O8SA 4HGAA 4X1YE 3FB2A 5LGUB 2VWAA 3PUWF 3Q9DA 4JI1T 1U4QA 3AA6B 4X65T 4AKHA 4DR4T 3PUYF 2X51A 4UV8B 2V7MA 4QH4A 2XAGB 2IIUA 3ZSTA 2CPTA 2V6YA 4NIQA 2CE7A 5EK2A 4DV5T 3ZYLA 3CX8B 4K0UA 2KNDA 5LCYA 5CA1E 3RIUA 3N2OA 4X20E 1E1HB 3N2KE 4HWHA 4CXWA 4NPPA 3AB3B 4EIWA 1KEYA 3VHLA 1I6ZA 1SA0E 2VK9A 4DV4T 2E5VA 2CXDA 2ZM2A 4AI6A 3K1SA 4O4LE 4HFEA 3J9X1 4KHZF 4ZI7E 3P7IA 2BZBA 4ZZBA 5EZYE 3CX6B 5AFUL 2I59A 3UTKA 2IUBA 4QH5A 5FXVA 4CXXA 3RYCE 1JNZA 1ZV4X 4I50E 2JPFA 4IDQA 5LBMA 2WB5A 4PK4A 4WNKA 5JDQA 2BKOA 4OYJA 3A5XA 4B6XA 3MKDA 2L8KA 2A72A 2LRKA 1NWMX 2WWVA 4HWFA 3AEBA 4X66T 4JI7T 4JI3T 2K9AA 3KDSE 3NBXX 2NW9A 4AQFA 3LJCA 1FIOA 4JV5T 4ZHQE 4YTMA 2K5BB 5FL0A 4QX8B 4AKRB 4EV6A 4HTEA 5HXSA 3L39A 2D5UA 4HN9A 2YK0A 2EHOD 1ZHCA 2WS3A 4DR2T 3KV4A 4JEUB 4HFVA 4UVCB 4BAYB 2KWIB 2LSIA 4GYSA 5AQQB 4G2AA 3JAFA 4EYYR 3DTOA 5L3GB 5JDGA 3PUAA 3PUGA 2CXLA 2ZM0A 2WU2A 3SS1A 2VVSA 3KBTA 2VKHA 2WWUA 2YDRA 3A7MA 3LK3B 1CHUA 3PV0F 4U72A 4ZI3C 2X9HA 2ZLYA 2CLYC 3FBLA 4U2YA 2BBJA 2NW8A 2X67A 3BK9A 3RQWA 4TV9E 5DQWA 4AIUA 2CMRA 1MMAA 2XM2A 5F8PA 3ETUA 2Q9QB 5HWXA 2LOPA 3FXEB 3MK7C 2BS2A 4H63V 2VL8A 2EHOA 3HKCE 2D0UA 2J47A 3AE7A 4Q25A 5M4YA 2LSJA 4NUVA 1HNWT 5CJ5A 3ZSSA 2ZMAA 4LF4T 4DBQA 4JYAT 4NUUA 4CQIA 3ZLIA 5FKYA 5IWAT 5AQRB 3QUJA 2W63A 3UU5A 3LBXB 2RP4A 4DR3T 5C8YE 2FJAA 3AAAB 4J2CA 3PUSA 1V9DA 1ZEEA 2YOEA 4ZXLA 4PJLA 3EDVA 3E22E 4A56A 2PTFA 2X68A 2D2SA 2BS3A 4IHJE 2H89A 4EOZB 4DBRA 2MYSA 4KI0F 1FJGT 2Q9QD 2WM9A 3RIUC 2LJLA 1HTJF 5LHIB 1HG2A 3GA8A 2AE9A 1BR4A 1MIVA 2W00A 1MMDA 1D1AA 2I0MA 3RC3A 4KHPT 3J7Yq 4DO0A 2WMNA 2ZM6T 2ES0A 1US7B 2VKOA 3M65A 1MNEA 2Y48B 4ISTA 5CA0E 4JUYA 2K3WA 5CB4E 3OVUA 5L4EA 3O1JA 1XMOT 1WYCA 4DV6T 2JMKA 4LMLA 4GYRA 5LB7B 1MMNA 2ODUA 2PFVA 3AVSA 3PDYA 5BMVE 3DP7A 3GWHA 1GQEA 4YTPA 3NVOA 2DI4A 4X64T 4IE6A 2XSAA 3CMLA 3UU4A 4Z8XA 2XQ6A 5J0ZA 5L3BB 3C4XA 3MXZA 4MFRA 4DVDA 3OTOT 4YSYA 4AQFC 2Q9QA 1D0YA 3O4XE 4QXCB 4AQYT 3ZEFB 4L5GA 2VVNA 4YXDA 4YLHA 2GK9A 2UUBT 4TX5A 2X66A 4EB6E 5JTGA 2KLQA 2LSKA 3UFGA 1I94T 4DV0T 3U78A 1T72A 3ZJ2A 4I43B 4PW8A 5LHHB 4P09A 3ONXA 2FBWA 3O9XA 1Y01A 4HFHA 4YJ2E 3P4PA 3ESLA 2DLRA 1B7TA 2WCAA 4TN7B 3N5LA 3I0OA 3AECA 5FNVE 1D1BA 4H9SE 1UCUA 3EHZA 3QK6A 5C2TA 4AKGA 1HX1B 2WMOA 3ETVA 4DR1T 5AQOB 4DV1T 1HS7A 2XUEA 5AQVB 1W0AA 2W0GA 4HE8A 4PNIA 4C91A 4U3CA 4TUYE 3BQKA 1VOMA 5LP6E 2K24A 4NXNT 3E0ZA 2EHOC 2UUAT 4B3TT 5LJNA 2W4XA 5TAOA 3NZQA 1J1JA 1UX5A 1UGOA 4E7SA 2FJBA 5HCMA 4CI1B 3ANWB 2MAWA 3I1AA 3N9QA 3PJAJ 2BG9C 3ZKRA 2WZIA 2H7OA 1YKEB 3CPZA 3CVRA 2IC6A 1G73A 5JQGE 3PUQA 3VR9A 2MBGA 3SWHA 1M7KA 3GN5B 2V8SV 4UELA 1LKXA 2XY8B 4BA9A 5LA6E 4O2AE 4P0BA 2XQAA 4A97A 2BVLA 3HL6A 4EEDA 3SOLA 3VKGA 4JBWF 3KV9A 3PTRB 2XQ4A 3QNUA 5LYJE 2UXDT 5HEOA 1J5ET 2XQYA 2C5JA 4LMKA 4B3RT 3Q5WA 2WDQA 5A1LA 3AA1B 4CN4A 1IZNB 1Y64B 3AA7B 5J2TE 4DMWA 5AQKB 4A5XA 4BJMA 1HX8A 4CXYA 3P4WA 2CXFA 3PU8A 5ADXL 1WLXA 2NR4A 4LF5T 2M67A 4ZI2D 3N9LA 2UXNB 3UU8A 4IL4A 4LF8T 4TWHA 4YSZA 3TLVA 4H9PC 3ZMUB 4IGUA 3F57A 1KK7A 3OJAA 4U33A 5LMNT 3B5MA 4GIWA 3C64A 3IF8B 4QWNB 3WAJA 3ZCJA 3KINB 3VRAA 2XAQB 4FJOA 2BKNA 2HN1A 2EHOB 3V5UA 4U7YA 3BQLA 2H3RA 2XAHB 5FY0A 1HF8A 4CI3B 4JEHB 3UQ7A 4DR5T 1UURA 2BG9E 3T1YT 2D0TA 2CHNA 2X9XA 1HG5A 3UUBA 1G8XA 2QRXA 1QSDA 4U2ZA 4HFDA 2BG9B 1T7SA 2M6IA 3ZC1A 2Q9QC 5EK3A 3AE8A 5AQTB 2X0LB 3LG7A 1YXRA 1OWAA 3N9MA 3JAEA 2KZ7B 3ONLC 3OKQA 4UF0B 5J2UE 4E7ZA 4CZZB 2LRLA 3JADA 2YKSA 4U31A 3ANWA 4BJNA 5KMGP 2RA1A 1IBMT 2VB6A 2OLTA 5FP3A 3UUMA 4OK0A 3GN5A 3TLTA 5HCJA 4I55E 2DCFA 1MIWA 1T8BA 1R8IA 2FJDA 3I0QA 1LRZA 4XBFB 2IC9A 3AEGA 1D1CA 2VKJA 3O1HA 4MALA 4NXMT 2P9BA 1S35A 1HNZT 4DUZT 4O4HE 1QLBA 4H9RC 3KV6A 1EZ3A 2V5CA 3ZN1B 4LF6T 2WSSV 4HWCA 5DABA 2BS4A 2XQ5A 3CK6A 3AXJB 2ACXA 3P4QA 3RLFF 3UFEA 3DJBA 1Z0PA 3K3OA 5AQSB 1NENA 3N9PA 4ADZA 3IA3A 4QHOA 2ODVA 1IAPA 2X9YA 2AXDS 2B76A 2WU5A 4LFAT 3H3MA 3VU7H 4LMJA 2A2FX 3ZMSB 2UXXB 3Q2MA 1HCIA 3MJXA 5AQFB 1UUSA 2LM9A 2FJEA 5LJMA 5JDHA 4IE5A 1BR2A 1E2AA 3AE3A 5FVKA 1KNPA 4IDZA 4X5TA 3PUVF 2XPKA 2BG9A 3IEEA 4GK5E 3ZMTB 4G63A 1YW0A 4ERRA 1WFDA 2OV9A 3CQCB 2V6XA 5CGMA 4IIJE 2CBJA 4UF0A 2N2NA 5ABEA 4HFBA 2CWYA 3NZPA 4IT4A 4JI5T 3RI5A 5JVDE 4U7IA 4OHFA 4IREA 4YT0A 5IUXA 1D0ZA 3L8RA 4ZS2A 5GONE 1WYBA 4EAHA 3F31A 2JRKA 2V7LA 2PJQA 3AEAA 3RIFA 5LGNB 5HWYA 4JI6T 4PK6A 5L3DB 2NWBA 3D0TA 3AE6A 3WAKA 4PK5A 4H9OC 1FMWA 4ZOLE 4QH1A 1OEDE 4LFCT 3EDUA 4MLKA 5LOVE 1J5WA 1N33T 1OEDB 4EZ4A 5DJQC 3FZMB 4JI0T 2NW7A 2MTQA 4CN6A 5J1GA 3U3IA 5JRCB 4JI8T 3NWIA 5FXZA 2LE8A 3AXJA 4DV2T 3N9NA 5JDNA 2WBLA 2X9WA 1WR0A 4GOUA 5HXRA 3AEDA 2BVMA 3HA4A 2YN6A 1LVKA 3AE1A 4ASKA 3HKBE 4ZZCA 5HYAA 4ZI2C 2QVAA 4UXNB 3EUHA 4HWIB 3HKDE 3W15B 1NEKA 1M62A 4UVBB 2YU2A 4YTNA 5ETWA 3CQXC 2RPAA 2Z6EA 1YKHB 4ILUA 3OYZA 2VQET 3CQGB 3I9YA 2V1DB 3RKOA 1S94A 4CN1A 1NAFA 2IDOB 2J1DG 3RF1A 1N36T 3UQ4A 5HEGA 2YDQA 4YHHT 2XASB 5AQHB 5HEHA 2BKPA 4U74A 5JDFA 2V7JA 4WYVA 1L0VA 3AEEA 3T8OA 3X1DA 3OPCA 1XNRT 4HFIA 2XZEA 3P4RA 4OFZA 2LSYA 3FZHB 1VCTA 2ZM8A 3NRYA 3F2EA 4IDPA 5HXCA 3I9WA 5IHYA 4KMCA 4PJMA 3UU6A 4X1KE 5JDMA 5JH7E 4Z91A 4ILBA 3PUXF 1BR0A 3MA9A 3P8CD 1OEDA 4UV9B 2CHOA 2PBIA 4EZHA 2HN2A 3M3ZB 5AQPB 2CEAA 4KP3C 4IDOA 5C3JA 2YINA 4I4TE 4TNWA 2M6BA 1T98A 2WP9A 2V7KA 3RRCA 5JRCA 2IW5B 3MACA 4ANJA 5LGTB 2X0HA 4QX7B 1XDOA 1HNXT 2KT9A 3ZCIA 3RRWA 4AKLA 3IBPA 4EEBA 2XQ3A 3ZN0B 4PFOA 2R6GF 3L09A 4WBNE 1ZKEA 2LHNA 3V5SA 2LOSA 3TLWA 3UUXB 5H6QB 2UUCT 5ABFB 3ZC0A 2G0UA 2H88A 5AQNB 2XTLA 1SHZC 2XSBA 3OYXA 2DHRA 4O4IE 2B1EA 3N2GE 4YJ3E 5L3EB 1VRBA 1ZOYA 3N9OA 3QB5K 4XZCA 4QXHB 2UXBT 4ILCA 1OXZA 1QUUA 4EGWA 3QB5A 4JLEA 4IE4A 5L3FB 1CUNA 5HXEA 4I0UA 3P4SA 5AQMB 2WDVA 2JQ9A 1HR0T 3S4UA 3KFWX 3WI3A 4KX6A 2QA7A 3C98B 3FHNA 4YHJA 1XZYA 5FVLA 4WW0A 3AE5A 1IBKT 2JMHA 2E8IA 4V1Av 4DNDA 4ILAA 5ABGA 2W61A 4UIGA 3CIRA 3FZKB 3SFDA 1AJ3A 2IMLA 5LMUT 4TNVA 4AXPA 2CBIA 5LXTE 4AQGA 3EAMA 3PURA 1Z8UA 2NP9A 5FL1A 2A9UA 1UK5A 2SPCA 5HXHA 1X79A 3B13A 4HWDA 1D0XA 4DIDB 5L2LA 3RIAA 2J4GA 1ZP0A 1H7CA 3KVBA 1MIYA 3ONJA 5FY7A 2JQQA 4H63H 3FZLB 3ZJ1A 2DL1A 3Q5DA 3EI0A 1MMGA 3MZKB 3JC6D 4CI2B 2LEHA 2VKDA 1WR6A 2UXCT 1W09A 5JDLA 3CWZB 2XM1A 2LM2A 1XMQT 4AKIA 3AAIA 3T1HT 3LK42 4IE0A 5JR9C 2OA5A 4UVAB 2F4VT 5LG4A 3C4WA 2E9XB 2I6HA 5LBQB 3CKDA 5AQUB 1DU2A 5FYMA 2CWOA 4F6RC 1IJ5A 4IE7A 1YQ4A 4P0AA 3KVAA 3RYIE 4ZEYA 2LLYA 5ABFA 3K3QC 3K8PC 4LF9T 5LG3A 2L3LA 4PAGA 4DR6T 5KX5E 3VKHA 5AQLB 4YY3T 1UX4A 2UU9T 4IDNA 4PFPA 3PU3A 5FXXA 3ZMZB 1WRDA 2JQKA 4H9NC 4QKNA 2PG8A 3LK2B 4PJNA 4IL9A 1OEDC 2LT3A 4GKKT 2J62A 5JREA 4DUYT 1N32T 4O4JE 2QYWA 2E2AA 4ISSA 3G06A 2E9XD 4HEAA 4WBOA 2WZHA 5L4HA 3RKGA 4F8HA 1XWMA 5FMNA 4JI4T 3AE4A 3RGLA 3ZYKA 4XAXB 2E5LT 4GK0E 2XJ7A 5AQJB 1KNZA 2HHHT 2V7IA 3C50A 3KV5A 2LKGA 5HEJA 2NOXA 1XDPA 4JI2T 3EABA 3P50A 2BBHA 4AISA 2Y6XA 2YU1A 1YD8G 4OX9T 5JR9B 2WY2A 3PUZF 1KF6A 2IAKA 3ZMVB 3AAEB 1SUMB 2DNXA 4Z90A 3NRXA 2BDEA 4TV8E 3ZT5A 2YDSA 4EYUA 5E0OA 2XAJB 1N34T 2LKHA 5ABHA 3B57A 4QXBB 5AQIB 2CCQA 2CM0A 3QOFA 2ACZA 1SE7A 2KSRA 2JIWA 4DMVA 2XQ9A 3RQUA 2Y8DA 3AEFA 3HR0A 1IJ6A 2YEVC 2MOZA 4B3MT 2E9XA 3FBZA 2KINB 3NKZA 3UULA 1WCRA 2HH7A 2NTXA 4LF7T 4K0KT 2K48A 2MPKA 4UR9A 5FXWA 4P1NA 5FY1A 3ZT6A 2V5DA 3PJAA 5BR8T 1O3XA 3H3AA 3RX6A 2W2UA 2WAUA 1IBLT 4A98A 2NTYA 3FXDB 1JNRA 4DR7T 3R84B 2V26A
chains in the Genus database with same CATH topology
3O1IA 2WWUA 3RPUA 3C64A 2L9QA 3IF8B 2W62A 3L3PA 4QWNB 5IHYA 3WAJA 4KMCA 3ZCJA 3KINB 4PJMA 4X1KE 5JDMA 5EK4A 3LK3B 3C4ZA 5JH7E 2LHRA 2XAQB 2DWKA 4FJOA 3RH3A 2CLYB 1BR0A 3MA9A 4U72A 4ZI3C 2X9HA 2ZLYA 3P8CD 4UV9B 4N78D 2EHOB 2PBIA 2CLYC 3FBLA 3V5UA 4EZHA 2CEAA 3BQLA 3OBVE 2H3RA 2NW8A 2XAHB 4KP3C 2X67A 3BK9A 5FY0A 5H6RB 2LSGA 2YINA 4I4TE 3RC8A 1HF8A 4CI3B 4TV9E 4JEHB 5DQWA 1T98A 2XHEB 3EVYA 2D0TA 2X9XA 2CMRA 3ZYMA 5L3CB 1HG5A 3RRCA 2V7KA 1MMAA 1G8XA 5JRCA 2JJ9A 5F8PA 1QSDA 3ETUA 2IW5B 3MACA 4ANJA 5LGTB 2Q9QB 4QX7B 4L9IA 5HWXA 2LOPA 2KT9A 3FXEB 3MK7C 3GMIA 3ZCIA 3RRWA 2Q9QC 5EK3A 3ZC1A 4AKLA 3IBPA 4FI5A 4H63V 2X0LB 2VL8A 4MBQA 2EHOA 3LG7A 1OWAA 3HKCE 4KBMB 3N9MA 3ZN0B 2KZ7B 4PFOA 2D0UA 3L09A 3OKQA 4UF0B 5J2UE 4E7ZA 3IHRA 5M4YA 2LSJA 4WBNE 1ZKEA 2LHNA 2N1GA 4NUVA 4CZZB 2C0SA 3Q5XA 2VASA 3V5SA 3E08A 4O2BE 2LOSA 3UUXB 2ZMAA 3ANWA 4DBQA 4BJNA 5KMGP 2RA1A 3QC9A 5H6QB 4NUUA 4TZ4C 4CQIA 3ZC0A 1U5PA 3ZLIA 2VB6A 3QUJA 2G0UA 2XAFB 5JR9A 3SRZA 2W63A 2XTLA 5FP3A 3UUMA 3LBXB 1SHZC 2RP4A 4OK0A 5C8YE 4ZI3D 2DWGA 3GN5A 3UT5E 3AAAB 3OYXA 4J2CA 2KXPB 5F3JA 2DHRA 4O4IE 2B1EA 3N2GE 4I55E 1FEWA 2DCFA 3PUSA 1MIWA 4YJ3E 5L3EB 4YFSA 5KDMC 1VRBA 1V9DA 1ZEEA 4EXTA 3N9OA 3I0QA 1LRZA 3ZPOA 2IC9A 4XBFB 1D1CA 3CX7B 5LNKA 4PJLA 3EDVA 4XZCA 3E22E 2VKJA 3O1HA 4MALA 2C5IT 2KMFA 2P9BA 1S35A 4A56A 4QXHB 4MHCA 1MNDA 3R6NA 1OXZA 1QUUA 2X68A 2D2SA 4JLEA 4IHJE 4EOZB 4DBRA 2MYSA 2H7VC 4IE4A 5L3FB 1CUNA 2Q9QD 2WM9A 3LBXA 4H9QC 3PE0A 4O4HE 1BR1A 4H9RC 5HXEA 2LJLA 3KV6A 1HTJF 1EZ3A 5LHIB 1HG2A 2HPLA 3ZN1B 3GA8A 3S4UA 2A3DA 4C90A 2WSSV 1BR4A 3HKEE 3KFWX 3WI3A 5HAXA 3JC6C 2QA7A 3C98B 5DABA 4KUMB 1MIVA 2W00A 3FHNA 4YHJA 4HKAA 1MMDA 2ACXA 4WW0A 3UFEA 1D1AA 2JMHA 3DJBA 2E8IA 2C5KT 4V1Av 4DNDA 3RC3A 3J7Yq 4DO0A 2WMNA 1Z0PA 3LFMA 3K3OA 2ES0A 1US7B 2VKOA 3M65A 2W61A 4UIGA 5DQVA 3N9PA 3AVRA 1LVFA 1MNEA 4ADZA 2Y48B 4QHOA 2ODVA 4ISTA 1IAPA 5CA0E 2X9YA 1AJ3A 4JUYA 3TKLB 2HPJA 3C51A 5CB4E 4AXPA 4M1PA 3O1JA 3VU7H 1WYCA 5LXTE 4AQGA 3PURA 2JMKA 2A2FX 3ZMSB 2NP9A 4GYRA 3H37A 2UXXB 3Q2MA 1MMNA 3K3NA 2ODUA 3KBUA 2PFVA 3AVSA 2SPCA 1FMVA 1HCIA 3MJXA 4PJJA 3PDYA 5BMVE 3RYFE 5HXHA 2LM9A 3DP7A 3GWHA 1X79A 3B13A 1D0XA 5L2LA 2DI4A 5LJMA 5JDHA 1H7CA 3KVBA 4IE6A 4IE5A 1MIYA 1BR2A 3CMLA 5FY7A 2JQQA 4H63H 3RYHE 3ZJ1A 4Z8XA 2CA5A 1HFAA 3UUNA 2KWHA 4IDZA 3C4XA 5L3BB 3MXZA 1MMGA 3MZKB 3BQIA 3JC6D 4MFRA 4DVDA 4CI2B 2LEHA 3AA0B 5IYZE 4AQFC 2Q9QA 2VKDA 1WR6A 4X1IE 1D0YA 5JDLA 3CWZB 3IEEA 3HI2A 3O4XE 4GK5E 3AAIA 4QXCB 3ZMTB 3LK42 4AKIA 3ZEFB 4L5GA 4G63A 1YW0A 4IE0A 4ERRA 2OA5A 5JR9C 4UVAB 4ZS3A 4UEMA 3CQCB 5LG4A 3C4WA 4YLHA 2GK9A 2E9XB 5LHGB 4TX5A 4IIJE 2X66A 4UF0A 2N2NA 2CWYA 2E9XC 3NZPA 5LBQB 4EB6E 3CKDA 2KLQA 2QGSA 4L0RA 5JVDE 2LSKA 4OYKA 5FYMA 4OHFA 2N9DA 3U78A 2CWOA 4F6RC 4O8SA 1IJ5A 1D0ZA 4HGAA 4IE7A 4X1YE 4P0AA 3FB2A 4ZS2A 3ZJ2A 3KVAA 3RYIE 5LGUB 4I43B 4PW8A 2VWAA 5GONE 3Q9DA 5LHHB 4P09A 1U4QA 1WYBA 3AA6B 3ONXA 4EAHA 3F31A 4AKHA 2JRKA 3K3QC 2V7LA 2PJQA 3O9XA 3K8PC 5LGNB 4YJ2E 5HWYA 2X51A 4PK6A 2L3LA 5L3DB 4PAGA 4UV8B 2NWBA 5KX5E 3VKHA 3ESLA 2V7MA 3D0TA 2DLRA 1B7TA 2XAGB 3WAKA 4PK5A 4H9OC 4TN7B 1FMWA 3N5LA 3I0OA 1UX4A 4ZOLE 4PFPA 5FNVE 1D1BA 2CE7A 5EK2A 4H9SE 3EDUA 3ZYLA 1UCUA 3CX8B 3PU3A 4K0UA 4MLKA 5FXXA 5LOVE 3ZMZB 1WRDA 4H9NC 4QKNA 2PG8A 3LK2B 4EZ4A 3QK6A 2KNDA 5LCYA 4AKGA 5CA1E 3N2OA 4X20E 5DJQC 4PJNA 2LT3A 1E1HB 5JREA 2NW7A 2MTQA 2WMOA 3ETVA 4O4JE 3N2KE 5J1GA 3U3IA 5JRCB 1HS7A 2XUEA 4CXWA 4ISSA 3AB3B 2E9XD 4HEAA 4WBOA 2W0GA 4HE8A 4EIWA 5FXZA 2LE8A 3VHLA 1SA0E 2VK9A 4PNIA 2CXDA 3N9NA 2ZM2A 5JDNA 2WBLA 2X9WA 5FMNA 4C91A 4AI6A 4TUYE 4O4LE 3BQKA 4GOUA 1VOMA 5HXRA 3ZYKA 2K24A 5LP6E 4XAXB 4GK0E 3E0ZA 3J9X1 4ZI7E 2EHOC 1KNZA 3P7IA 2V7IA 5LJNA 2BVMA 2BZBA 3HA4A 5TAOA 3NZQA 5EZYE 3CX6B 5AFUL 2I59A 3C50A 3UTKA 5FXVA 1UX5A 1LVKA 3KV5A 4ASKA 4E7SA 4CXXA 3RYCE 3HKBE 5HYAA 2NOXA 4ZI2C 1ZV4X 3EUHA 4UXNB 4CI1B 3ANWB 4I50E 2JPFA 3I1AA 3N9QA 3HKDE 5LBMA 3W15B 4PK4A 4WNKA 2Y6XA 5JDQA 2H7OA 1YKEB 2YU1A 3CPZA 4OYJA 1YD8G 4UVBB 3A5XA 2YU2A 3CVRA 2IC6A 1G73A 4B6XA 5ETWA 5JR9B 5JQGE 3PUQA 3CQXC 2Z6EA 3MKDA 1YKHB 2MBGA 2L8KA 3SWHA 3GN5B 2A72A 4UELA 2IAKA 4ILUA 1NWMX 1LKXA 3I9WA 3ZMVB 3AAEB 4BA9A 5LA6E 4O2AE 3OYZA 4P0BA 2BVLA 2DNXA 3CQGB 3HL6A 3NRXA 3SOLA 3I9YA 2V1DB 2BDEA 4TV8E 3VKGA 3RKOA 1S94A 2K9AA 3KDSE 3NBXX 3KV9A 4EYUA 2NW9A 4AQFA 5E0OA 3PTRB 1NAFA 2XAJB 3LJCA 1FIOA 5LYJE 2J1DG 3B57A 4QXBB 4ZHQE 2XQYA 2CCQA 2C5JA 2K5BB 2CM0A 4QX8B 4AKRB 3Q5WA 4DMVA 2Y8DA 3AA1B 4HTEA 3HR0A 5A1LA 5HXSA 2XASB 1IJ6A 2YEVC 1IZNB 1Y64B 2D5UA 2MOZA 2E9XA 3AA7B 3FBZA 2KINB 3UULA 5J2TE 4HN9A 2HH7A 4U74A 2YK0A 4DMWA 4BJMA 2NTXA 2EHOD 1ZHCA 5JDFA 2V7JA 1HX8A 4CXYA 2K48A 5FXWA 3KV4A 4JEUB 4HFVA 4UVCB 5FY1A 2CXFA 4BAYB 2KWIB 3PU8A 5ADXL 1WLXA 3T8OA 2LSIA 2M67A 4ZI2D 3N9LA 2UXNB 4G2AA 4GYSA 4EYYR 3DTOA 1O3XA 3H3AA 3RX6A 4OFZA 2LSYA 2WAUA 5L3GB 5JDGA 3PUAA 2ZM8A 3PUGA 4H9PC 3ZMUB 4IGUA 3NRYA 3F57A 1KK7A 2CXLA 2ZM0A 3F2EA 3OJAA 3SS1A 2NTYA 3FXDB 3KBTA 5HXCA 2VKHA 3R84B 2V26A 4GIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KIN B; 
#chains in the Genus database with same CATH topology
 3O1I A;  3RPU A;  2L9Q A;  3L3P A;  2W62 A;  3JCF A;  2FUP A;  2WDR A;  5EK4 A;  3C4Z A;  2LHR A;  2DWK A;  3RH3 A;  2CLY B;  4N78 D;  3OBV E;  3VRB A;  3TLS A;  5H6R B;  2LSG A;  3RC8 A;  5L47 A;  2XHE B;  3EVY A;  3SFE A;  3ZYM A;  5L3C B;  2JJ9 A;  4L9I A;  2VL0 A;  5HEU A;  3GMI A;  4FI5 A;  4MBQ A;  4KBM B;  1YQ3 A;  4WZX A;  4HFC A;  3IHR A;  2JQH A;  2N1G A;  3LSV A;  2C0S A;  3Q5X A;  2VAS A;  3E08 A;  4O2B E;  2VQF T;  3ABV A;  3QC9 A;  1KNR A;  4TZ4 C;  1U5P A;  4B3S T;  2XAF B;  5JR9 A;  4DV7 T;  3SRZ A;  3FZF B;  4ZI3 D;  3AE9 A;  2DWG A;  3UT5 E;  3A8Y C;  5F3J A;  2KXP B;  2CRB A;  1FEW A;  4YFS A;  5KDM C;  4GKJ T;  4EXT A;  3ZPO A;  2V6Y B;  3CX7 B;  5LNK A;  1W0B A;  2C5I T;  2KMF A;  4MHC A;  1MND A;  3R6N A;  2H7V C;  3LBX A;  4H9Q C;  3PE0 A;  1KFY A;  1BR1 A;  2W67 A;  2HPL A;  2A3D A;  2X0Y A;  4C90 A;  2W66 A;  3HKE E;  5HAX A;  3JC6 C;  4KUM B;  1W9R A;  4HKA A;  4LFB T;  3TLU A;  2C5K T;  2IHR 1;  5KXJ A;  3LFM A;  5DQV A;  2WQY A;  3AVR A;  1LVF A;  3TKL B;  2HPJ A;  3C51 A;  3UU3 A;  4M1P A;  3H37 A;  3K3N A;  3ZT7 A;  1E7P A;  2XQ7 A;  3KBU A;  1FMV A;  4PJJ A;  3RYF E;  5F5W A;  1XNQ T;  3Q5E A;  2XQ8 A;  1VCS A;  3RYH E;  2CA5 A;  1HFA A;  3UUN A;  2KWH A;  3VR8 A;  4YSX A;  3BQI A;  4TWF A;  3AA0 B;  5IYZ E;  3RHW A;  4COF A;  5AQG B;  4X62 T;  4X1I E;  3HI2 A;  1X9B A;  4TWD A;  4ZS3 A;  4UEM A;  3AE2 A;  5LHG B;  2E9X C;  4DV3 T;  2QGS A;  4L0R A;  4OYK A;  3LDQ B;  2VUR A;  2N9D A;  5CFB A;  2D9D A;  4O8S A;  4HGA A;  4X1Y E;  3FB2 A;  5LGU B;  2VWA A;  3PUW F;  3Q9D A;  4JI1 T;  1U4Q A;  3AA6 B;  4X65 T;  4AKH A;  4DR4 T;  3PUY F;  2X51 A;  4UV8 B;  2V7M A;  4QH4 A;  2XAG B;  2IIU A;  3ZST A;  2CPT A;  2V6Y A;  4NIQ A;  2CE7 A;  5EK2 A;  4DV5 T;  3ZYL A;  3CX8 B;  4K0U A;  2KND A;  5LCY A;  5CA1 E;  3RIU A;  3N2O A;  4X20 E;  1E1H B;  3N2K E;  4HWH A;  4CXW A;  4NPP A;  3AB3 B;  4EIW A;  1KEY A;  3VHL A;  1I6Z A;  1SA0 E;  2VK9 A;  4DV4 T;  2E5V A;  2CXD A;  2ZM2 A;  4AI6 A;  3K1S A;  4O4L E;  4HFE A;  3J9X 1;  4KHZ F;  4ZI7 E;  3P7I A;  2BZB A;  4ZZB A;  5EZY E;  3CX6 B;  5AFU L;  2I59 A;  3UTK A;  2IUB A;  4QH5 A;  5FXV A;  4CXX A;  3RYC E;  1JNZ A;  1ZV4 X;  4I50 E;  2JPF A;  4IDQ A;  5LBM A;  2WB5 A;  4PK4 A;  4WNK A;  5JDQ A;  2BKO A;  4OYJ A;  3A5X A;  4B6X A;  3MKD A;  2L8K A;  2A72 A;  2LRK A;  1NWM X;  2WWV A;  4HWF A;  3AEB A;  4X66 T;  4JI7 T;  4JI3 T;  2K9A A;  3KDS E;  3NBX X;  2NW9 A;  4AQF A;  3LJC A;  1FIO A;  4JV5 T;  4ZHQ E;  4YTM A;  2K5B B;  5FL0 A;  4QX8 B;  4AKR B;  4EV6 A;  4HTE A;  5HXS A;  3L39 A;  2D5U A;  4HN9 A;  2YK0 A;  2EHO D;  1ZHC A;  2WS3 A;  4DR2 T;  3KV4 A;  4JEU B;  4HFV A;  4UVC B;  4BAY B;  2KWI B;  2LSI A;  4GYS A;  5AQQ B;  4G2A A;  3JAF A;  4EYY R;  3DTO A;  5L3G B;  5JDG A;  3PUA A;  3PUG A;  2CXL A;  2ZM0 A;  2WU2 A;  3SS1 A;  2VVS A;  3KBT A;  2VKH A;  2WWU A;  2YDR A;  3A7M A;  3LK3 B;  1CHU A;  3PV0 F;  4U72 A;  4ZI3 C;  2X9H A;  2ZLY A;  2CLY C;  3FBL A;  4U2Y A;  2BBJ A;  2NW8 A;  2X67 A;  3BK9 A;  3RQW A;  4TV9 E;  5DQW A;  4AIU A;  2CMR A;  1MMA A;  2XM2 A;  5F8P A;  3ETU A;  2Q9Q B;  5HWX A;  2LOP A;  3FXE B;  3MK7 C;  2BS2 A;  4H63 V;  2VL8 A;  2EHO A;  3HKC E;  2D0U A;  2J47 A;  3AE7 A;  4Q25 A;  5M4Y A;  2LSJ A;  4NUV A;  1HNW T;  5CJ5 A;  3ZSS A;  2ZMA A;  4LF4 T;  4DBQ A;  4JYA T;  4NUU A;  4CQI A;  3ZLI A;  5FKY A;  5IWA T;  5AQR B;  3QUJ A;  2W63 A;  3UU5 A;  3LBX B;  2RP4 A;  4DR3 T;  5C8Y E;  2FJA A;  3AAA B;  4J2C A;  3PUS A;  1V9D A;  1ZEE A;  2YOE A;  4ZXL A;  4PJL A;  3EDV A;  3E22 E;  4A56 A;  2PTF A;  2X68 A;  2D2S A;  2BS3 A;  4IHJ E;  2H89 A;  4EOZ B;  4DBR A;  2MYS A;  4KI0 F;  1FJG T;  2Q9Q D;  2WM9 A;  3RIU C;  2LJL A;  1HTJ F;  5LHI B;  1HG2 A;  3GA8 A;  2AE9 A;  1BR4 A;  1MIV A;  2W00 A;  1MMD A;  1D1A A;  2I0M A;  3RC3 A;  4KHP T;  3J7Y q;  4DO0 A;  2WMN A;  2ZM6 T;  2ES0 A;  1US7 B;  2VKO A;  3M65 A;  1MNE A;  2Y48 B;  4IST A;  5CA0 E;  4JUY A;  2K3W A;  5CB4 E;  3OVU A;  5L4E A;  3O1J A;  1XMO T;  1WYC A;  4DV6 T;  2JMK A;  4LML A;  4GYR A;  5LB7 B;  1MMN A;  2ODU A;  2PFV A;  3AVS A;  3PDY A;  5BMV E;  3DP7 A;  3GWH A;  1GQE A;  4YTP A;  3NVO A;  2DI4 A;  4X64 T;  4IE6 A;  2XSA A;  3CML A;  3UU4 A;  4Z8X A;  2XQ6 A;  5J0Z A;  5L3B B;  3C4X A;  3MXZ A;  4MFR A;  4DVD A;  3OTO T;  4YSY A;  4AQF C;  2Q9Q A;  1D0Y A;  3O4X E;  4QXC B;  4AQY T;  3ZEF B;  4L5G A;  2VVN A;  4YXD A;  4YLH A;  2GK9 A;  2UUB T;  4TX5 A;  2X66 A;  4EB6 E;  5JTG A;  2KLQ A;  2LSK A;  3UFG A;  1I94 T;  4DV0 T;  3U78 A;  1T72 A;  3ZJ2 A;  4I43 B;  4PW8 A;  5LHH B;  4P09 A;  3ONX A;  2FBW A;  3O9X A;  1Y01 A;  4HFH A;  4YJ2 E;  3P4P A;  3ESL A;  2DLR A;  1B7T A;  2WCA A;  4TN7 B;  3N5L A;  3I0O A;  3AEC A;  5FNV E;  1D1B A;  4H9S E;  1UCU A;  3EHZ A;  3QK6 A;  5C2T A;  4AKG A;  1HX1 B;  2WMO A;  3ETV A;  4DR1 T;  5AQO B;  4DV1 T;  1HS7 A;  2XUE A;  5AQV B;  1W0A A;  2W0G A;  4HE8 A;  4PNI A;  4C91 A;  4U3C A;  4TUY E;  3BQK A;  1VOM A;  5LP6 E;  2K24 A;  4NXN T;  3E0Z A;  2EHO C;  2UUA T;  4B3T T;  5LJN A;  2W4X A;  5TAO A;  3NZQ A;  1J1J A;  1UX5 A;  1UGO A;  4E7S A;  2FJB A;  5HCM A;  4CI1 B;  3ANW B;  2MAW A;  3I1A A;  3N9Q A;  3PJA J;  2BG9 C;  3ZKR A;  2WZI A;  2H7O A;  1YKE B;  3CPZ A;  3CVR A;  2IC6 A;  1G73 A;  5JQG E;  3PUQ A;  3VR9 A;  2MBG A;  3SWH A;  1M7K A;  3GN5 B;  2V8S V;  4UEL A;  1LKX A;  2XY8 B;  4BA9 A;  5LA6 E;  4O2A E;  4P0B A;  2XQA A;  4A97 A;  2BVL A;  3HL6 A;  4EED A;  3SOL A;  3VKG A;  4JBW F;  3KV9 A;  3PTR B;  2XQ4 A;  3QNU A;  5LYJ E;  2UXD T;  5HEO A;  1J5E T;  2XQY A;  2C5J A;  4LMK A;  4B3R T;  3Q5W A;  2WDQ A;  5A1L A;  3AA1 B;  4CN4 A;  1IZN B;  1Y64 B;  3AA7 B;  5J2T E;  4DMW A;  5AQK B;  4A5X A;  4BJM A;  1HX8 A;  4CXY A;  3P4W A;  2CXF A;  3PU8 A;  5ADX L;  1WLX A;  2NR4 A;  4LF5 T;  2M67 A;  4ZI2 D;  3N9L A;  2UXN B;  3UU8 A;  4IL4 A;  4LF8 T;  4TWH A;  4YSZ A;  3TLV A;  4H9P C;  3ZMU B;  4IGU A;  3F57 A;  1KK7 A;  3OJA A;  4U33 A;  5LMN T;  3B5M A;  4GIW A;  3C64 A;  3IF8 B;  4QWN B;  3WAJ A;  3ZCJ A;  3KIN B;  3VRA A;  2XAQ B;  4FJO A;  2BKN A;  2HN1 A;  2EHO B;  3V5U A;  4U7Y A;  3BQL A;  2H3R A;  2XAH B;  5FY0 A;  1HF8 A;  4CI3 B;  4JEH B;  3UQ7 A;  4DR5 T;  1UUR A;  2BG9 E;  3T1Y T;  2D0T A;  2CHN A;  2X9X A;  1HG5 A;  3UUB A;  1G8X A;  2QRX A;  1QSD A;  4U2Z A;  4HFD A;  2BG9 B;  1T7S A;  2M6I A;  3ZC1 A;  2Q9Q C;  5EK3 A;  3AE8 A;  5AQT B;  2X0L B;  3LG7 A;  1YXR A;  1OWA A;  3N9M A;  3JAE A;  2KZ7 B;  3ONL C;  3OKQ A;  4UF0 B;  5J2U E;  4E7Z A;  4CZZ B;  2LRL A;  3JAD A;  2YKS A;  4U31 A;  3ANW A;  4BJN A;  5KMG P;  2RA1 A;  1IBM T;  2VB6 A;  2OLT A;  5FP3 A;  3UUM A;  4OK0 A;  3GN5 A;  3TLT A;  5HCJ A;  4I55 E;  2DCF A;  1MIW A;  1T8B A;  1R8I A;  2FJD A;  3I0Q A;  1LRZ A;  4XBF B;  2IC9 A;  3AEG A;  1D1C A;  2VKJ A;  3O1H A;  4MAL A;  4NXM T;  2P9B A;  1S35 A;  1HNZ T;  4DUZ T;  4O4H E;  1QLB A;  4H9R C;  3KV6 A;  1EZ3 A;  2V5C A;  3ZN1 B;  4LF6 T;  2WSS V;  4HWC A;  5DAB A;  2BS4 A;  2XQ5 A;  3CK6 A;  3AXJ B;  2ACX A;  3P4Q A;  3RLF F;  3UFE A;  3DJB A;  1Z0P A;  3K3O A;  5AQS B;  1NEN A;  3N9P A;  4ADZ A;  3IA3 A;  4QHO A;  2ODV A;  1IAP A;  2X9Y A;  2AXD S;  2B76 A;  2WU5 A;  4LFA T;  3H3M A;  3VU7 H;  4LMJ A;  2A2F X;  3ZMS B;  2UXX B;  3Q2M A;  1HCI A;  3MJX A;  5AQF B;  1UUS A;  2LM9 A;  2FJE A;  5LJM A;  5JDH A;  4IE5 A;  1BR2 A;  1E2A A;  3AE3 A;  5FVK A;  1KNP A;  4IDZ A;  4X5T A;  3PUV F;  2XPK A;  2BG9 A;  3IEE A;  4GK5 E;  3ZMT B;  4G63 A;  1YW0 A;  4ERR A;  1WFD A;  2OV9 A;  3CQC B;  2V6X A;  5CGM A;  4IIJ E;  2CBJ A;  4UF0 A;  2N2N A;  5ABE A;  4HFB A;  2CWY A;  3NZP A;  4IT4 A;  4JI5 T;  3RI5 A;  5JVD E;  4U7I A;  4OHF A;  4IRE A;  4YT0 A;  5IUX A;  1D0Z A;  3L8R A;  4ZS2 A;  5GON E;  1WYB A;  4EAH A;  3F31 A;  2JRK A;  2V7L A;  2PJQ A;  3AEA A;  3RIF A;  5LGN B;  5HWY A;  4JI6 T;  4PK6 A;  5L3D B;  2NWB A;  3D0T A;  3AE6 A;  3WAK A;  4PK5 A;  4H9O C;  1FMW A;  4ZOL E;  4QH1 A;  1OED E;  4LFC T;  3EDU A;  4MLK A;  5LOV E;  1J5W A;  1N33 T;  1OED B;  4EZ4 A;  5DJQ C;  3FZM B;  4JI0 T;  2NW7 A;  2MTQ A;  4CN6 A;  5J1G A;  3U3I A;  5JRC B;  4JI8 T;  3NWI A;  5FXZ A;  2LE8 A;  3AXJ A;  4DV2 T;  3N9N A;  5JDN A;  2WBL A;  2X9W A;  1WR0 A;  4GOU A;  5HXR A;  3AED A;  2BVM A;  3HA4 A;  2YN6 A;  1LVK A;  3AE1 A;  4ASK A;  3HKB E;  4ZZC A;  5HYA A;  4ZI2 C;  2QVA A;  4UXN B;  3EUH A;  4HWI B;  3HKD E;  3W15 B;  1NEK A;  1M62 A;  4UVB B;  2YU2 A;  4YTN A;  5ETW A;  3CQX C;  2RPA A;  2Z6E A;  1YKH B;  4ILU A;  3OYZ A;  2VQE T;  3CQG B;  3I9Y A;  2V1D B;  3RKO A;  1S94 A;  4CN1 A;  1NAF A;  2IDO B;  2J1D G;  3RF1 A;  1N36 T;  3UQ4 A;  5HEG A;  2YDQ A;  4YHH T;  2XAS B;  5AQH B;  5HEH A;  2BKP A;  4U74 A;  5JDF A;  2V7J A;  4WYV A;  1L0V A;  3AEE A;  3T8O A;  3X1D A;  3OPC A;  1XNR T;  4HFI A;  2XZE A;  3P4R A;  4OFZ A;  2LSY A;  3FZH B;  1VCT A;  2ZM8 A;  3NRY A;  3F2E A;  4IDP A;  5HXC A;  3I9W A;  5IHY A;  4KMC A;  4PJM A;  3UU6 A;  4X1K E;  5JDM A;  5JH7 E;  4Z91 A;  4ILB A;  3PUX F;  1BR0 A;  3MA9 A;  3P8C D;  1OED A;  4UV9 B;  2CHO A;  2PBI A;  4EZH A;  2HN2 A;  3M3Z B;  5AQP B;  2CEA A;  4KP3 C;  4IDO A;  5C3J A;  2YIN A;  4I4T E;  4TNW A;  2M6B A;  1T98 A;  2WP9 A;  2V7K A;  3RRC A;  5JRC A;  2IW5 B;  3MAC A;  4ANJ A;  5LGT B;  2X0H A;  4QX7 B;  1XDO A;  1HNX T;  2KT9 A;  3ZCI A;  3RRW A;  4AKL A;  3IBP A;  4EEB A;  2XQ3 A;  3ZN0 B;  4PFO A;  2R6G F;  3L09 A;  4WBN E;  1ZKE A;  2LHN A;  3V5S A;  2LOS A;  3TLW A;  3UUX B;  5H6Q B;  2UUC T;  5ABF B;  3ZC0 A;  2G0U A;  2H88 A;  5AQN B;  2XTL A;  1SHZ C;  2XSB A;  3OYX A;  2DHR A;  4O4I E;  2B1E A;  3N2G E;  4YJ3 E;  5L3E B;  1VRB A;  1ZOY A;  3N9O A;  3QB5 K;  4XZC A;  4QXH B;  2UXB T;  4ILC A;  1OXZ A;  1QUU A;  4EGW A;  3QB5 A;  4JLE A;  4IE4 A;  5L3F B;  1CUN A;  5HXE A;  4I0U A;  3P4S A;  5AQM B;  2WDV A;  2JQ9 A;  1HR0 T;  3S4U A;  3KFW X;  3WI3 A;  4KX6 A;  2QA7 A;  3C98 B;  3FHN A;  4YHJ A;  1XZY A;  5FVL A;  4WW0 A;  3AE5 A;  1IBK T;  2JMH A;  2E8I A;  4V1A v;  4DND A;  4ILA A;  5ABG A;  2W61 A;  4UIG A;  3CIR A;  3FZK B;  3SFD A;  1AJ3 A;  2IML A;  5LMU T;  4TNV A;  4AXP A;  2CBI A;  5LXT E;  4AQG A;  3EAM A;  3PUR A;  1Z8U A;  2NP9 A;  5FL1 A;  2A9U A;  1UK5 A;  2SPC A;  5HXH A;  1X79 A;  3B13 A;  4HWD A;  1D0X A;  4DID B;  5L2L A;  3RIA A;  2J4G A;  1ZP0 A;  1H7C A;  3KVB A;  1MIY A;  3ONJ A;  5FY7 A;  2JQQ A;  4H63 H;  3FZL B;  3ZJ1 A;  2DL1 A;  3Q5D A;  3EI0 A;  1MMG A;  3MZK B;  3JC6 D;  4CI2 B;  2LEH A;  2VKD A;  1WR6 A;  2UXC T;  1W09 A;  5JDL A;  3CWZ B;  2XM1 A;  2LM2 A;  1XMQ T;  4AKI A;  3AAI A;  3T1H T;  3LK4 2;  4IE0 A;  5JR9 C;  2OA5 A;  4UVA B;  2F4V T;  5LG4 A;  3C4W A;  2E9X B;  2I6H A;  5LBQ B;  3CKD A;  5AQU B;  1DU2 A;  5FYM A;  2CWO A;  4F6R C;  1IJ5 A;  4IE7 A;  1YQ4 A;  4P0A A;  3KVA A;  3RYI E;  4ZEY A;  2LLY A;  5ABF A;  3K3Q C;  3K8P C;  4LF9 T;  5LG3 A;  2L3L A;  4PAG A;  4DR6 T;  5KX5 E;  3VKH A;  5AQL B;  4YY3 T;  1UX4 A;  2UU9 T;  4IDN A;  4PFP A;  3PU3 A;  5FXX A;  3ZMZ B;  1WRD A;  2JQK A;  4H9N C;  4QKN A;  2PG8 A;  3LK2 B;  4PJN A;  4IL9 A;  1OED C;  2LT3 A;  4GKK T;  2J62 A;  5JRE A;  4DUY T;  1N32 T;  4O4J E;  2QYW A;  2E2A A;  4ISS A;  3G06 A;  2E9X D;  4HEA A;  4WBO A;  2WZH A;  5L4H A;  3RKG A;  4F8H A;  1XWM A;  5FMN A;  4JI4 T;  3AE4 A;  3RGL A;  3ZYK A;  4XAX B;  2E5L T;  4GK0 E;  2XJ7 A;  5AQJ B;  1KNZ A;  2HHH T;  2V7I A;  3C50 A;  3KV5 A;  2LKG A;  5HEJ A;  2NOX A;  1XDP A;  4JI2 T;  3EAB A;  3P50 A;  2BBH A;  4AIS A;  2Y6X A;  2YU1 A;  1YD8 G;  4OX9 T;  5JR9 B;  2WY2 A;  3PUZ F;  1KF6 A;  2IAK A;  3ZMV B;  3AAE B;  1SUM B;  2DNX A;  4Z90 A;  3NRX A;  2BDE A;  4TV8 E;  3ZT5 A;  2YDS A;  4EYU A;  5E0O A;  2XAJ B;  1N34 T;  2LKH A;  5ABH A;  3B57 A;  4QXB B;  5AQI B;  2CCQ A;  2CM0 A;  3QOF A;  2ACZ A;  1SE7 A;  2KSR A;  2JIW A;  4DMV A;  2XQ9 A;  3RQU A;  2Y8D A;  3AEF A;  3HR0 A;  1IJ6 A;  2YEV C;  2MOZ A;  4B3M T;  2E9X A;  3FBZ A;  2KIN B;  3NKZ A;  3UUL A;  1WCR A;  2HH7 A;  2NTX A;  4LF7 T;  4K0K T;  2K48 A;  2MPK A;  4UR9 A;  5FXW A;  4P1N A;  5FY1 A;  3ZT6 A;  2V5D A;  3PJA A;  5BR8 T;  1O3X A;  3H3A A;  3RX6 A;  2W2U A;  2WAU A;  1IBL T;  4A98 A;  2NTY A;  3FXD B;  1JNR A;  4DR7 T;  3R84 B;  2V26 A; 
#chains in the Genus database with same CATH homology
 3O1I A;  2WWU A;  3RPU A;  3C64 A;  2L9Q A;  3IF8 B;  2W62 A;  3L3P A;  4QWN B;  5IHY A;  3WAJ A;  4KMC A;  3ZCJ A;  3KIN B;  4PJM A;  4X1K E;  5JDM A;  5EK4 A;  3LK3 B;  3C4Z A;  5JH7 E;  2LHR A;  2XAQ B;  2DWK A;  4FJO A;  3RH3 A;  2CLY B;  1BR0 A;  3MA9 A;  4U72 A;  4ZI3 C;  2X9H A;  2ZLY A;  3P8C D;  4UV9 B;  4N78 D;  2EHO B;  2PBI A;  2CLY C;  3FBL A;  3V5U A;  4EZH A;  2CEA A;  3BQL A;  3OBV E;  2H3R A;  2NW8 A;  2XAH B;  4KP3 C;  2X67 A;  3BK9 A;  5FY0 A;  5H6R B;  2LSG A;  2YIN A;  4I4T E;  3RC8 A;  1HF8 A;  4CI3 B;  4TV9 E;  4JEH B;  5DQW A;  1T98 A;  2XHE B;  3EVY A;  2D0T A;  2X9X A;  2CMR A;  3ZYM A;  5L3C B;  1HG5 A;  3RRC A;  2V7K A;  1MMA A;  1G8X A;  5JRC A;  2JJ9 A;  5F8P A;  1QSD A;  3ETU A;  2IW5 B;  3MAC A;  4ANJ A;  5LGT B;  2Q9Q B;  4QX7 B;  4L9I A;  5HWX A;  2LOP A;  2KT9 A;  3FXE B;  3MK7 C;  3GMI A;  3ZCI A;  3RRW A;  2Q9Q C;  5EK3 A;  3ZC1 A;  4AKL A;  3IBP A;  4FI5 A;  4H63 V;  2X0L B;  2VL8 A;  4MBQ A;  2EHO A;  3LG7 A;  1OWA A;  3HKC E;  4KBM B;  3N9M A;  3ZN0 B;  2KZ7 B;  4PFO A;  2D0U A;  3L09 A;  3OKQ A;  4UF0 B;  5J2U E;  4E7Z A;  3IHR A;  5M4Y A;  2LSJ A;  4WBN E;  1ZKE A;  2LHN A;  2N1G A;  4NUV A;  4CZZ B;  2C0S A;  3Q5X A;  2VAS A;  3V5S A;  3E08 A;  4O2B E;  2LOS A;  3UUX B;  2ZMA A;  3ANW A;  4DBQ A;  4BJN A;  5KMG P;  2RA1 A;  3QC9 A;  5H6Q B;  4NUU A;  4TZ4 C;  4CQI A;  3ZC0 A;  1U5P A;  3ZLI A;  2VB6 A;  3QUJ A;  2G0U A;  2XAF B;  5JR9 A;  3SRZ A;  2W63 A;  2XTL A;  5FP3 A;  3UUM A;  3LBX B;  1SHZ C;  2RP4 A;  4OK0 A;  5C8Y E;  4ZI3 D;  2DWG A;  3GN5 A;  3UT5 E;  3AAA B;  3OYX A;  4J2C A;  2KXP B;  5F3J A;  2DHR A;  4O4I E;  2B1E A;  3N2G E;  4I55 E;  1FEW A;  2DCF A;  3PUS A;  1MIW A;  4YJ3 E;  5L3E B;  4YFS A;  5KDM C;  1VRB A;  1V9D A;  1ZEE A;  4EXT A;  3N9O A;  3I0Q A;  1LRZ A;  3ZPO A;  2IC9 A;  4XBF B;  1D1C A;  3CX7 B;  5LNK A;  4PJL A;  3EDV A;  4XZC A;  3E22 E;  2VKJ A;  3O1H A;  4MAL A;  2C5I T;  2KMF A;  2P9B A;  1S35 A;  4A56 A;  4QXH B;  4MHC A;  1MND A;  3R6N A;  1OXZ A;  1QUU A;  2X68 A;  2D2S A;  4JLE A;  4IHJ E;  4EOZ B;  4DBR A;  2MYS A;  2H7V C;  4IE4 A;  5L3F B;  1CUN A;  2Q9Q D;  2WM9 A;  3LBX A;  4H9Q C;  3PE0 A;  4O4H E;  1BR1 A;  4H9R C;  5HXE A;  2LJL A;  3KV6 A;  1HTJ F;  1EZ3 A;  5LHI B;  1HG2 A;  2HPL A;  3ZN1 B;  3GA8 A;  3S4U A;  2A3D A;  4C90 A;  2WSS V;  1BR4 A;  3HKE E;  3KFW X;  3WI3 A;  5HAX A;  3JC6 C;  2QA7 A;  3C98 B;  5DAB A;  4KUM B;  1MIV A;  2W00 A;  3FHN A;  4YHJ A;  4HKA A;  1MMD A;  2ACX A;  4WW0 A;  3UFE A;  1D1A A;  2JMH A;  3DJB A;  2E8I A;  2C5K T;  4V1A v;  4DND A;  3RC3 A;  3J7Y q;  4DO0 A;  2WMN A;  1Z0P A;  3LFM A;  3K3O A;  2ES0 A;  1US7 B;  2VKO A;  3M65 A;  2W61 A;  4UIG A;  5DQV A;  3N9P A;  3AVR A;  1LVF A;  1MNE A;  4ADZ A;  2Y48 B;  4QHO A;  2ODV A;  4IST A;  1IAP A;  5CA0 E;  2X9Y A;  1AJ3 A;  4JUY A;  3TKL B;  2HPJ A;  3C51 A;  5CB4 E;  4AXP A;  4M1P A;  3O1J A;  3VU7 H;  1WYC A;  5LXT E;  4AQG A;  3PUR A;  2JMK A;  2A2F X;  3ZMS B;  2NP9 A;  4GYR A;  3H37 A;  2UXX B;  3Q2M A;  1MMN A;  3K3N A;  2ODU A;  3KBU A;  2PFV A;  3AVS A;  2SPC A;  1FMV A;  1HCI A;  3MJX A;  4PJJ A;  3PDY A;  5BMV E;  3RYF E;  5HXH A;  2LM9 A;  3DP7 A;  3GWH A;  1X79 A;  3B13 A;  1D0X A;  5L2L A;  2DI4 A;  5LJM A;  5JDH A;  1H7C A;  3KVB A;  4IE6 A;  4IE5 A;  1MIY A;  1BR2 A;  3CML A;  5FY7 A;  2JQQ A;  4H63 H;  3RYH E;  3ZJ1 A;  4Z8X A;  2CA5 A;  1HFA A;  3UUN A;  2KWH A;  4IDZ A;  3C4X A;  5L3B B;  3MXZ A;  1MMG A;  3MZK B;  3BQI A;  3JC6 D;  4MFR A;  4DVD A;  4CI2 B;  2LEH A;  3AA0 B;  5IYZ E;  4AQF C;  2Q9Q A;  2VKD A;  1WR6 A;  4X1I E;  1D0Y A;  5JDL A;  3CWZ B;  3IEE A;  3HI2 A;  3O4X E;  4GK5 E;  3AAI A;  4QXC B;  3ZMT B;  3LK4 2;  4AKI A;  3ZEF B;  4L5G A;  4G63 A;  1YW0 A;  4IE0 A;  4ERR A;  2OA5 A;  5JR9 C;  4UVA B;  4ZS3 A;  4UEM A;  3CQC B;  5LG4 A;  3C4W A;  4YLH A;  2GK9 A;  2E9X B;  5LHG B;  4TX5 A;  4IIJ E;  2X66 A;  4UF0 A;  2N2N A;  2CWY A;  2E9X C;  3NZP A;  5LBQ B;  4EB6 E;  3CKD A;  2KLQ A;  2QGS A;  4L0R A;  5JVD E;  2LSK A;  4OYK A;  5FYM A;  4OHF A;  2N9D A;  3U78 A;  2CWO A;  4F6R C;  4O8S A;  1IJ5 A;  1D0Z A;  4HGA A;  4IE7 A;  4X1Y E;  4P0A A;  3FB2 A;  4ZS2 A;  3ZJ2 A;  3KVA A;  3RYI E;  5LGU B;  4I43 B;  4PW8 A;  2VWA A;  5GON E;  3Q9D A;  5LHH B;  4P09 A;  1U4Q A;  1WYB A;  3AA6 B;  3ONX A;  4EAH A;  3F31 A;  4AKH A;  2JRK A;  3K3Q C;  2V7L A;  2PJQ A;  3O9X A;  3K8P C;  5LGN B;  4YJ2 E;  5HWY A;  2X51 A;  4PK6 A;  2L3L A;  5L3D B;  4PAG A;  4UV8 B;  2NWB A;  5KX5 E;  3VKH A;  3ESL A;  2V7M A;  3D0T A;  2DLR A;  1B7T A;  2XAG B;  3WAK A;  4PK5 A;  4H9O C;  4TN7 B;  1FMW A;  3N5L A;  3I0O A;  1UX4 A;  4ZOL E;  4PFP A;  5FNV E;  1D1B A;  2CE7 A;  5EK2 A;  4H9S E;  3EDU A;  3ZYL A;  1UCU A;  3CX8 B;  3PU3 A;  4K0U A;  4MLK A;  5FXX A;  5LOV E;  3ZMZ B;  1WRD A;  4H9N C;  4QKN A;  2PG8 A;  3LK2 B;  4EZ4 A;  3QK6 A;  2KND A;  5LCY A;  4AKG A;  5CA1 E;  3N2O A;  4X20 E;  5DJQ C;  4PJN A;  2LT3 A;  1E1H B;  5JRE A;  2NW7 A;  2MTQ A;  2WMO A;  3ETV A;  4O4J E;  3N2K E;  5J1G A;  3U3I A;  5JRC B;  1HS7 A;  2XUE A;  4CXW A;  4ISS A;  3AB3 B;  2E9X D;  4HEA A;  4WBO A;  2W0G A;  4HE8 A;  4EIW A;  5FXZ A;  2LE8 A;  3VHL A;  1SA0 E;  2VK9 A;  4PNI A;  2CXD A;  3N9N A;  2ZM2 A;  5JDN A;  2WBL A;  2X9W A;  5FMN A;  4C91 A;  4AI6 A;  4TUY E;  4O4L E;  3BQK A;  4GOU A;  1VOM A;  5HXR A;  3ZYK A;  2K24 A;  5LP6 E;  4XAX B;  4GK0 E;  3E0Z A;  3J9X 1;  4ZI7 E;  2EHO C;  1KNZ A;  3P7I A;  2V7I A;  5LJN A;  2BVM A;  2BZB A;  3HA4 A;  5TAO A;  3NZQ A;  5EZY E;  3CX6 B;  5AFU L;  2I59 A;  3C50 A;  3UTK A;  5FXV A;  1UX5 A;  1LVK A;  3KV5 A;  4ASK A;  4E7S A;  4CXX A;  3RYC E;  3HKB E;  5HYA A;  2NOX A;  4ZI2 C;  1ZV4 X;  3EUH A;  4UXN B;  4CI1 B;  3ANW B;  4I50 E;  2JPF A;  3I1A A;  3N9Q A;  3HKD E;  5LBM A;  3W15 B;  4PK4 A;  4WNK A;  2Y6X A;  5JDQ A;  2H7O A;  1YKE B;  2YU1 A;  3CPZ A;  4OYJ A;  1YD8 G;  4UVB B;  3A5X A;  2YU2 A;  3CVR A;  2IC6 A;  1G73 A;  4B6X A;  5ETW A;  5JR9 B;  5JQG E;  3PUQ A;  3CQX C;  2Z6E A;  3MKD A;  1YKH B;  2MBG A;  2L8K A;  3SWH A;  3GN5 B;  2A72 A;  4UEL A;  2IAK A;  4ILU A;  1NWM X;  1LKX A;  3I9W A;  3ZMV B;  3AAE B;  4BA9 A;  5LA6 E;  4O2A E;  3OYZ A;  4P0B A;  2BVL A;  2DNX A;  3CQG B;  3HL6 A;  3NRX A;  3SOL A;  3I9Y A;  2V1D B;  2BDE A;  4TV8 E;  3VKG A;  3RKO A;  1S94 A;  2K9A A;  3KDS E;  3NBX X;  3KV9 A;  4EYU A;  2NW9 A;  4AQF A;  5E0O A;  3PTR B;  1NAF A;  2XAJ B;  3LJC A;  1FIO A;  5LYJ E;  2J1D G;  3B57 A;  4QXB B;  4ZHQ E;  2XQY A;  2CCQ A;  2C5J A;  2K5B B;  2CM0 A;  4QX8 B;  4AKR B;  3Q5W A;  4DMV A;  2Y8D A;  3AA1 B;  4HTE A;  3HR0 A;  5A1L A;  5HXS A;  2XAS B;  1IJ6 A;  2YEV C;  1IZN B;  1Y64 B;  2D5U A;  2MOZ A;  2E9X A;  3AA7 B;  3FBZ A;  2KIN B;  3UUL A;  5J2T E;  4HN9 A;  2HH7 A;  4U74 A;  2YK0 A;  4DMW A;  4BJM A;  2NTX A;  2EHO D;  1ZHC A;  5JDF A;  2V7J A;  1HX8 A;  4CXY A;  2K48 A;  5FXW A;  3KV4 A;  4JEU B;  4HFV A;  4UVC B;  5FY1 A;  2CXF A;  4BAY B;  2KWI B;  3PU8 A;  5ADX L;  1WLX A;  3T8O A;  2LSI A;  2M67 A;  4ZI2 D;  3N9L A;  2UXN B;  4G2A A;  4GYS A;  4EYY R;  3DTO A;  1O3X A;  3H3A A;  3RX6 A;  4OFZ A;  2LSY A;  2WAU A;  5L3G B;  5JDG A;  3PUA A;  2ZM8 A;  3PUG A;  4H9P C;  3ZMU B;  4IGU A;  3NRY A;  3F57 A;  1KK7 A;  2CXL A;  2ZM0 A;  3F2E A;  3OJA A;  3SS1 A;  2NTY A;  3FXD B;  3KBT A;  5HXC A;  2VKH A;  3R84 B;  2V26 A;  4GIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...