3KIPA

Crystal structure of type-ii 3-dehydroquinase from c. albicans
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
147
structure length
143
Chain Sequence
LVKKVLLINGPNLNLLGTRYGTTSLSDIEQAAIEQAKLKNNDSEVLVFQSNTEGFIIDRIHEAKRQGVGFVVINAGAYTHTSVGIRDALLGTAIPFIEVHITNVHQREPFRHQSYLSDKAVAVICGLGVYGYTAAIEYALNYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinase, type II
publication title Macromolecular crystal data phased by negative-stained electron-microscopy reconstructions.
pubmed doi rcsb
source organism Candida albicans
molecule tags Lyase
total genus 52
structure length 143
sequence length 147
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2009-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 3kipA00
1V1JA 3U80A 3N59A 4KI7A 1GTZA 2C4WA 4ZC1A 3KIPA 2Y71A 4CL0A 4CIWA 2WKSA 4RC9A 2XDAA 4B6QA 2DHQA 2XB8A 2C4VA 2Y76A 3N8KA 4B6SA 1J2YA 1D0IA 4RHCA 4CKYA 2BT4A 5B6PA 1H05A 4B6RA 4CKZA 1GU0A 4KIJA 2Y77A 2UYGA 4KIWA 1GQOA 3N7AA 4CIVA 1H0RA 3N76A 2C57A 4V0SA 4CKWA 1H0SA 5WRFA 4CKWB 4KIUA 2XB9A 3LWZA 3N8NA 4CIYA 2CJFA 2XD9A 1UQRA 3N87A 4L8LA 4B6PA 4B6OA 4CKXA 1GU1A 3N86A 4CIXA
chains in the Genus database with same CATH superfamily
1RPJA 5A5EA 1ODKA 4CQLB 1T2AA 3PGA1 4JGIA 1FB5A 1N3LA 4KVFA 2UXCB 1NYQA 1ZK4A 3FDXA 3N05A 1BOOA 4IS2A 4ZCSA 3WZ2A 2IS4A 3GLKA 3R5KA 3G0BA 3H1TA 4RDIA 1VHQA 3SJBA 3N8IA 4G0NA 4NK5A 2ZRGA 4M0LA 5CYOA 1V1RB 2QD3A 5ULLA 4GZLA 1TE2A 1T6YA 2EZ8A 3E7DA 5LA6A 2VJLA 1JSRA 2OC9A 2CXHA 3GN2A 4OH7A 1H0RA 4R01A 4IZIA 3HCWA 4Y6SA 1ABFA 1E9AA 3PNMA 4Z2YA 4BWVA 1KVUA 1PJ2A 5FBLB 2P62A 3BRCA 1GHTA 2PLFA 5EZYA 2PH3A 2A4KA 4RGBA 4DCNA 4QGGA 2XCUA 4QREA 4US2R 1VG8A 3JTEA 3VMFA 4KN8A 2N75A 3TUZC 5K3DA 4PLHA 4GC9A 3EFOB 2HSJA 5B1SA 4ZGWA 4ZDIA 3HL4A 1TZMA 2V6GA 4RAQA 5EIBC 1Q1NA 2ZIGA 5KJEA 4WCFA 3O4GA 2CGEA 1CU1A 1BDMA 3GVIA 3RG2A 2PSEA 4RZ2A 5IVDA 2TSYB 2IL1A 4D5EA 5CT5A 1T24A 1D8TA 4AJ1A 1VP9A 3K3PA 5KSZA 1Z5VA 2FWPA 3P9XA 2A0FA 1NYRA 3A9CA 4BNIA 2IPXA 2CMKA 1KY3A 1XMPA 2PU7A 2WKQA 3BD6A 3QSGA 5IMSA 2VH5R 4BQSA 1IHDA 3W4IA 1MQ9A 2FQQA 3OM1A 1X38A 1K7FB 3SBEA 3SI7A 1JIKA 1DBWA 3BMNB 3QHQA 1GRNA 1PW7A 1EZ4A 2DSTA 1YR2A 2FCAA 1DKRA 2GF0A 2GBGA 2WKWA 4TYPA 2XVYA 3HCNA 5FR2A 1G5IA 3ZBQA 2SICE 3D6UA 4OGKA 3CNNA 1T0HB 5FAXA 4F4UA 1DQSA 4W5WA 4WESA 1R4NA 2GZRA 3UAWA 1MAAA 3DOFA 3LLUA 3B2NA 1XN1A 4GYKA 2W6QA 5I6DA 2NVOA 3LNCA 1TO6A 5B3KA 3P2IA 3D2LA 5CG1A 1AQNA 4K6KA 5F2NA 1KJIA 4IMRA 1Y6ZA 4FFSA 4KR0A 5ERXA 3WLJA 3EW7A 1IUNA 3ZW7A 4GOXA 3H1FA 4MRSA 1UKEA 1Q0SA 1OWMA 4FWTA 4I1RA 4EY3A 1IN4A 4IG9A 1TF2A 4ZARA 5K0ZA 3I62A 4R31A 1P0CA 2VJDA 4H31A 1E9EA 3EMKA 4GZ3A 4QLOA 3FSEA 4EW3A 5CYGA 1N25A 2V7WA 4P81A 1W87A 1JG2A 3UBTA 2AR9A 4QXRA 4CM5A 2DBVO 1NGSA 1M7GA 2I1LA 4NJEA 3PF8A 3ON5A 4F72A 2GZ1A 3PZRA 3R5SA 1S3FA 2EL7A 4EGQA 2DTEA 1ZD2P 3X1XA 2BGNA 2C8LA 1MB3A 2VJNA 4D9MA 3OLVA 1IBKB 1KARA 3SFVA 3O8NA 3T3PB 1SU8A 2JGLA 3R7FA 3T06B 4QTXA 1UT5A 1YVPA 2IYSA 4P7KA 4TN1A 5DYTA 3GNTA 2AVNA 5K0SA 5ADHA 1D2CA 2QX7A 3NT5A 4W5NA 4Z7QB 4JLDA 3BDIA 1OROA 4CLEA 4YACA 2YHSA 2C94A 1HXHA 3N9IA 4K26A 3R3HA 4RY2A 2HH9A 5T8KC 4BRZA 4HRAA 3CSUA 4J9UE 2REQA 2WF8A 2XMRA 2YYSA 4OQFA 3EIXA 3KQMA 5HS4A 4L5JA 4CIWA 4U6SA 5IM5A 3KKQA 1L5KA 4B2PA 1CKEA 5IJ9B 1CY8A 4Y6PA 3RFVA 4CM8A 5BR1A 3NVAA 4UHEA 1Q83A 2JCGA 4E09A 3U7IA 2XCOA 2HLDD 3DC7A 1WVMA 4NBWA 3QE9Y 1J70A 1R8YA 2YW9A 3WJ2A 2YRWA 3KR9A 1JKIA 2AVDA 4E3ZA 3H5LA 4JSRA 1QFYA 3N5KA 1U0BB 1W49A 4DHWA 1OWNA 1P61B 4DG5A 5K3BA 1Y7LA 1U7PA 3PXBA 3P2OA 2WJ3A 1KK0A 4JYCA 1CLUA 1YL6A 4AY6A 5ENDA 3MWDB 1IAQA 4MGZR 2OCGA 1QHSA 2F59A 1FMCA 2FMFA 2TMGA 1T1JA 3IUQA 3OO1A 4M9SA 1KJ8A 2OBNA 4MYUA 1Y3IA 4EFLA 1FDOA 3ELUA 3Q6NA 4BLPA 4NMLA 1E20A 1YS9A 3OZDA 1E2HA 4LDNA 1EJ6A 3F71A 1K1EA 5SY9A 1QQAA 4KGDA 4JT8A 2LZ0A 2D00A 2VJQA 3T1VA 4NOLA 1OOEA 3I0NA 4NG4A 3WNQA 4HB2A 3NEYA 1IG3A 1RTTA 2BBOA 2Z98A 5JD3A 1CUAA 1NP3A 221PA 5CJPA 2NTVA 2BSQA 4RESA 3KQQA 5GP1A 1FP4A 1ID1A 4PAWA 2VP9A 3DMPA 5KC9A 3T15A 1QYDA 1Y8RA 4HDAA 3OQIB 1LY1A 3QF7A 3I9MA 1NV8A 1ZMOA 3FJ1A 5EAIA 1M6HA 4D99A 4EEXA 1OFUX 4Q4LA 1VPLA 3KR2A 1NUSA 1ZJ5A 4O4JB 5J3JA 2QXUA 1GZDA 4DA6A 2H4YA 3VYVA 4RD0A 1ZN2A 1Q0PA 2Z2ZA 4KX3A 1JKJB 1YFKA 4HDKB 4YRLA 5CCXA 1JE1A 3OOWA 1JI3A 3F6BX 3N8GA 4LSGA 1SN7A 1XCGB 4H3SA 2O2IA 4CGYA 1RYNA 2EX4A 1R8SA 4PHFA 1U9CA 4PONA 4B2IA 2KBFA 1XE3A 2FY8A 1H3NA 1JSXA 3DV2A 3EGVA 1EWKA 2QTAA 1H8HA 3OP4A 4YGYA 4YXWD 5JCOC 5KJ6A 3Q72A 1W8IA 5DHSA 2K7ZA 1YB7A 4DA7A 2JLBA 4PZEA 2CV0A 4B2LA 3OBIA 1QIFA 1T1IA 2VUTA 3H2BA 1GXSB 2Q0SA 3BMCA 5TB5A 1VGRA 3LDAA 4MP3A 4RTPA 4CNBA 1J97A 3A36A 5EIWA 1H2BA 3L46A 5C5IA 3MTBA 4B17A 3OWHA 5CDTA 5ITZA 4XOIA 4ZV9A 3HI6A 3N8KA 1F8UA 3PQ7A 1QS0A 4YTEA 5L3QA 4HZUA 1ES9A 1Y6GA 3VMMA 4DIBA 5JSFA 1ZM9A 3PT9A 1ISMA 1Y8AA 4NECA 5AXAA 3C0KA 5JQGF 4PSDA 5ALNA 4BGEA 4FXPA 3ZK7A 4MW6A 4ZO9A 3I6IA 1WEKA 4BFTA 3Q11A 1TYZA 4CCSA 1ZRNA 2VJCA 3R3WA 5CHEA 1NR7A 4HH4A 4UTVA 3PS9A 2VA9A 1KK1A 3CNQS 2GK6A 3MCWA 1E0AA 1R9MA 5C7IO 1FFSA 5A3SA 3WNBA 5JH7F 3EVEA 3BC1A 5CXQA 4JLNA 2D2VA 1PKXA 1MMFB 2R47A 3N59A 4MWBA 3ZVLA 3ENNA 1XXLA 1PJSA 2OHGA 2C5LA 2PYZA 3O47A 4Q34A 4QUBA 2PD3A 4E5VA 1E4YA 1XTVA 4ABTA 3KZOA 1GSIA 1B1AA 3CH4B 4JB3A 4RJ2A 4C76A 1DAEA 4ML3A 4Z7OB 4FOPA 1Z4PX 2PTGA 2GESA 3OIFA 3EPKA 1CLEA 3ZV6A 3OE7D 1XQ1A 3BFPA 4DR1B 1CJTC 3FPSA 4FM9A 4Q3KA 5CGZA 3SU8A 1X1QA 4O4LA 5JDIC 1GAWA 3K4QA 3LFHA 4KJXA 1KHHA 5ALVA 3EPLA 3T5PA 3THYB 3VU9A 1DKQA 4RTSA 1W73A 3IVXA 1ODFA 2H17A 4FLFA 4TMKA 4DCCA 4D02A 2FWAA 2WYHA 4HQFA 5DP1A 5IJ0B 1J0BA 2QPAA 2HSEA 2JAHA 1KY4A 3A4YA 4ZVOA 5B58T 5JE8A 3U7JA 1ZUNB 3VDRA 3TAXA 3AHGA 4Z0HO 3U09A 4URXR 3DZGA 3QMMA 5JARA 4IO1A 2J87A 3Q3VA 4QPDA 1RC8A 3OMLA 3NH6A 2CWWA 4GP6A 2ZIWB 4R8RA 1QIKA 2J31A 3RHFA 1UINA 1A8QA 2FWNA 5F1YA 1VB3A 4LY6A 4DR7B 3F7OA 4WXMA 1YUBA 3WNCA 3H1AA 1OCEA 4YR7A 3OZAA 2OAGA 2DHRA 2WJAA 3NEAA 4FK8A 1YRQA 4MUMA 1C3OA 3R7BA 4W9MC 1RI4A 4GH5A 3NVMB 1HQDA 2X2PA 3BJIC 1JPNA 3K09A 3U37A 2OMKA 1N0WA 3OOSA 3JD2A 4RY9A 4ODIA 4M0MA 1VGQA 4XM0A 1SCDA 3R76A 1KOJA 3UJ6A 3OQOA 1L5FA 2O2EA 3ND8A 4EI2A 1TFRA 1UKBA 2P6PA 4AK9A 5CDYA 2DULA 2FUNB 4IOJA 1SA0A 3CRVA 3W8RA 5DEOA 4K9MA 3GLSA 3SNKA 4FE4A 1IJFA 4EKDA 5DTRA 1JEDA 1AQUA 1BXGA 3PT5A 2V97A 4CMBA 4ZZ0A 5ALWA 1MABA 2R00A 4QDZA 3TZLA 4CQJA 4DZRA 1XAGA 2DLNA 4Y7DA 1M10A 1PYGA 1IB6A 3V8NA 5CA1A 1JBKA 1QGOA 2P9HA 4JENA 3PD1A 4PPFA 2KB0A 1XKQA 2BKXA 1MH9A 3KLOA 4Q12A 4UMFA 3M9XA 2F9FA 2FX3A 1GSHA 3BH6A 3CFYA 4XCXA 4B3JA 1EB8A 1YHNA 3OPQA 1C9NA 3DNFA 2YOHA 3GEDA 3LWNA 2HF8A 1G41A 3PXGA 4RHTA 4JITA 2C98A 3UA3A 3TTTA 3D4BA 4H60A 2Y71A 4JP5A 2NXCA 2OUKA 4GXQA 1RVDA 4MLCA 1HEUA 3H4MA 2ANCA 4CV3A 3L1UA 1L7NA 3M1AA 2GR9A 1UBEA 3P9SA 1QIDA 4I9FA 2PU5A 1KR2A 3GPCA 5LQDA 3G5TA 4KLCA 5CA0F 3RFFA 3VR2A 4GQIA 5DISB 2ZUFA 1I2AA 5AUNB 3D4PA 3CZ9A 4CMIB 1L7VC 4ENQA 2YZGA 2V7UA 1L4UA 1QIHA 1ZCBA 2OSVA 4GIBA 1YNSA 1RADA 4B3FX 2ZWVA 3RK1A 2PY6A 1QGYA 3TTXA 4AUNA 3G2QA 3NMUF 1VJCA 2OHIA 3HUEA 3TECE 1Y34E 3JQAB 1Q1QA 1ONOA 3AF5A 1EUDA 1TUBA 1NZJA 1OTHA 1ZK1A 4JP1A 3ZWOA 2CNDA 4BLOA 2A5YB 4ZV7A 3ADDA 2WWFA 1W88B 4MUGA 3R5JA 2SECE 1XKTA 1LS1A 3RJTA 1D4ZA 1IL0A 1JT2A 1KKMA 3K1YA 1US8B 4BHTA 1A1VA 3H6HA 4J1NA 2CHQA 4I3GA 3OX4A 5TJHA 3ZDYB 1XNGA 1ZD8A 2GZAA 1BH6A 3ZS9A 5HIKA 3AFGA 4XYLA 4GZMA 2IU0A 2Q2VA 1DQNA 2XKJE 1HDZA 1LDYA 3FKSD 3CG4A 4YROA 4MQBA 1XU7A 3Q9NA 2Q7DA 3ZLVA 2QR3A 3BE8A 4G97A 1VMEA 3RM3A 1KEWA 3RVDA 3LY5A 3PIRA 4NQRA 4ZAYA 4YECA 3U4AA 3PUWA 4YXFA 3GRFA 1OUMA 4ND3A 4QPNA 2XA1A 5CRIA 2Q5HA 3DVAA 4PBSA 1JI0A 7MDHA 1WKBA 1ANKA 1VJDA 2IXAA 2C20A 1WWKA 1E7WA 1M8JA 4FGKA 4UHJA 5BSTA 3G8BA 3HY6A 3QYFA 3QTBA 4TXHA 1L6RA 2DWPA 4IIUA 3SPXA 3W6ZA 4BMVA 2ZTHA 1KRHA 2RKBA 1X2BA 3OU6A 4N0MA 3TEJA 1PSWA 3WIUA 1ZH2A 2C9CA 2BMAA 4JQSA 4QNNA 4YALA 3K6JA 3S2YA 1N8TA 1XTQA 4KTVE 1RAIA 1AKQA 4R71A 4XRRA 1YS1X 4JWTA 4Y7CA 3JQPA 2AZDA 3NTXA 1R0CA 4KK3A 4AJ9A 2GXSA 3OZGA 1UWKA 4PYKA 3H5NA 4FX2A 4C0BA 2X5NA 4B3XA 2W6PA 3H18A 3VNAA 1GL7A 2R6GA 1BYUA 3G2LA 4EAAA 4TYYA 4N3BA 3ML1A 4D45A 5AW7A 4OP2A 2XRYA 5FKJA 3CNHA 2W6JA 2PZAA 4HDNA 5DMHA 4RC9A 2VPTA 2O2ZA 5EPOA 5GZ3A 1G3QA 5LSAA 2NU8B 5ICCA 2OM6A 1AT1A 3T8YA 1XPRA 4FYIA 1LFDB 5DMXA 1DIAA 1KYQA 1QTIA 4YFVA 3ROXA 1E6UA 3SLRA 1J7JA 1YZYA 4TLEA 3ZVKA 4B33A 2F8TA 3M6MD 3EYAA 2Z8YA 4PG5A 2E49A 3OFKA 3OWOA 1KI9A 2NU6A 5HVNA 1JJBA 3DKVA 4G65A 2YVAA 1GTVA 2CLEB 5BRJA 1GCAA 5DLEA 1RPAA 1BROA 3IBYA 2GFIA 2LXNA 4BB6A 4GVXA 4JH0A 3VH3A 2OQVA 4OA8A 1NYLA 3DJFA 1WXQA 3DONA 3O75A 5IXJA 2J46A 1P5ZB 3T0GA 2ZT7A 3GJ6A 3KQTA 1XDSA 5E3JA 2DEUA 5B4VA 1TEHA 4OIMA 2IOFK 2IHTA 2Z58A 3DS8A 5C18A 3MRVA 1E2DA 2FLVA 2ONCA 4P1ZA 5FD8A 1G8KA 3G9ZA 3KFLA 5C7YA 2VQFB 4X20A 2Z3WA 1GEEA 3LQYA 4DLBA 2H4HA 4IM7A 4C2TA 1BXRA 2HPHA 4I6GA 5ESXA 2DFKB 1PBNA 2AL7A 2GRAA 5G1PA 4D4JA 1HDIA 1DUSA 3SZRA 1T2EA 2L82A 3AR9A 3HO6A 1VPTA 1BQEA 3KB6A 5I9LA 5AJZA 3T7DA 1EAYA 2WB2A 3ZXYA 2JH8A 1H9AA 1W4AA 5F9FA 4GX2A 1M2OA 5E7QA 3O84A 5T3YA 4J1TC 1U3UA 3WLFA 3WIBA 3MMZA 3NDIA 4NKRA 1J8YF 2OC4A 5ALMA 2Z6VA 2VZLA 3OETA 4V0RA 5H82A 2ZAGA 4WE3A 4DJTA 3D4NA 1P5FA 5JO0A 1ST2A 1N33B 4OQYA 3WA7A 4P3OA 3QIAA 2YN0A 2A3NA 2PRKA 2Q4TA 3CZMA 3FOAA 1ZW6A 5FFNA 1F5SA 1TA4A 4PR3A 3L43A 5IT5A 2QRVB 2QIPA 4PFSA 5JEEA 1AA9A 5HGJA 3TKLA 4HPWA 5KYKA 2NUAB 3UXYA 3WFJA 4EPVA 4QBFA 3WLAA 2HA2A 4I7EA 5DI3A 2QX6A 5FHRA 5TS3A 3JQ7A 3FUTA 1JHYA 2E85A 5BN3B 2FQ1A 3HJHA 2X0FA 1NNLA 2FDRA 3E8MA 4AZWA 2V54A 3W3AA 4JBYA 2ID9A 1WR8A 3DW1X 3LBAA 3EZYA 4UZSA 2EF0A 4Y2GA 2DUNA 2HXSA 4FFPA 3AB3A 3ZE0B 1HQKA 5J63A 1GPUA 4MA5A 2QSJA 4A1OA 3F46A 1Q14A 1SRRA 3QUAA 1ACJA 4UUPA 4NYJQ 5B6IA 2YVUA 5JS8A 1DAMA 1P3Y1 1QFXA 4CV1A 1T8TA 3O7MA 3PXXA 3CCBA 2Y0PA 2ZYDA 2BEWA 4UQPA 5A9SB 2PSFA 1OXBB 3KXKA 5BWOA 1SNYA 2IA5A 3NBAA 4H0FA 4UHBA 5KNDA 3IOYA 3K71B 3FTFA 3RGGA 5IK2A 1SPXA 2HU5A 2GK3A 4X1IA 3RFUA 4XJXA 4MV6A 1F2UA 5EKUA 3ED1A 3SP1A 2IE8A 2C95A 2HEIA 3IOMA 3S68A 2R3SA 3JQEA 4ZTBA 1HGXA 3GRCA 3AV3A 4MQFA 3GVPA 1LX6A 3CZAA 4MQMA 1NI4B 2XF8A 3QITA 5G4LA 5FTJA 3T9DA 3UT5B 1E1YA 1JXMA 1U3FA 2JDID 4LCBA 1GYPA 1NVBA 2YS7A 4RVCA 3NDBB 1B4DA 2YJ3A 1U8CB 4R54A 2ERXA 3FSGD 3M6WA 3JATB 4JKIA 4DV1B 4IZHA 5AKLA 1FNNA 1WVIA 1USKA 4F4JA 3EC1A 3GBSA 4QDTA 3LH5A 3IERA 3LKZA 3JVEA 1RM5A 2PO5A 3CJTA 4OVKA 1IRXA 4BNLA 1YI8A 4DYDA 1W7AA 1CY6A 3UIEA 3VJRA 3KTAA 1XEXB 2JVJA 2IYUA 3KLBA 3ONVA 1NULA 3BCUA 1U0GA 4KKXB 5EN4A 1LLDA 1CUYA 1QLHA 3EZLA 3BWDD 4GG1A 3TTYA 5CFLA 4HNVA 4R2XA 1AMNA 5HF9A 4YWHA 4E2FA 3FGOA 4P4GA 1NNUA 3INYA 5DGXA 5TQ2A 5KJFA 1EWYA 5TVKA 4KPUA 1TUEA 2BI8A 4AP9A 3CQ9A 4D3SA 5TLSA 1DZ3A 4XM1A 4HMPA 3U3XA 4MI1A 2DX7A 4G8DA 4E5DA 4B7AA 1OILA 5A62A 3GC6A 2KM1A 3G79A 2WSYB 1Z62A 4G8JA 4LYYA 2BAGA 4ARIA 2C3YA 4DYVA 3WWZA 1W75A 2J3QA 3K9WA 1S02A 3LHFA 2VAWA 4NCIA 3HS3A 4QECA 3RRXA 3T4XA 3HCAA 4RMIA 3VR4A 5EOVA 3WL3A 2N1MA 4AJHA 3R6TA 4KSBA 4RORA 2IK8A 3HP7A 1KEZA 2BM1A 1DG3A 2VC2B 3ESRA 3WGVA 5A7FA 5DNUA 1R2QA 2QI9C 3FTQA 3PR1A 2X0KA 4OXQA 4BWFB 4HQNA 5TQ0A 4CETA 1G5PA 3COVA 4M37A 4OU4A 1GRCA 1W93A 3IHWA 4LDQA 3MJCA 4WBXC 2QU8A 2QW8A 4ECAA 1NX9A 1TZKA 3GF4A 2ECOA 3IDQA 1ZQ9A 1KBOA 1V26A 2PJRA 2GBCA 1D03A 1XZMA 3H2YA 2DOKA 1JMKC 4PZDA 1T3ZA 5LJLA 3RADC 4EL0A 2NSJA 1UJ5A 2WZCA 1M2HA 2VRWA 4Q05A 3ASVA 1VHDA 3JV7A 4OL9A 1OU0A 1PRYA 2ZIXB 3CM0A 3HA7A 3VYRB 3JZIA 3K8OE 4Q00A 4CODB 1W0KA 1YB2A 3DEAA 2JARA 4IIBA 1EZ1A 3Q41A 2HC9A 3OJOA 1CFZA 5DHTA 3VHQA 5MFZA 4IR7A 3EXHC 2O50A 1B16A 1C7EA 3TJMA 1RJ9B 5IZCA 3IUSA 1FSPA 1P4AA 1JTVA 3MWKA 2YBDA 4L2IA 2Q07A 3VPSA 1XL1A 3WZLA 1U4NA 2PKXA 3PEYA 1V1JA 1GOTA 2ZT5A 4LWOA 4BZPA 3U5ZB 4H6XA 1GTSA 3PXCX 1CVLA 2AQKA 3IOBA 1TTPB 3IPXA 1GSOA 3PVCA 5EFOA 4OFXA 3VVLA 4G0VA 3EVNA 4LRYA 2ZBDA 1N5RA 2P9EA 3Q5GA 3EG5A 3OUUA 4TROA 1E69A 4JJ8A 4D0SA 1UKZA 1ZD9A 1Z6XA 2HUPA 2IYYA 3CU5A 3JD3A 4JBXA 5GONA 4EW6A 4LDPA 4WXYB 1BZYA 1XEWX 3TIVA 3QKSA 3C15C 1BD4A 1RXEA 1SUFA 2A0UA 5KOJB 2CYBA 3IXLA 3AUXA 2PT6A 4GKKB 1YCDA 1V45E 4JHXA 1IBCA 1T5LA 2LIVA 3VVCA 4JYPA 3ZI0A 4RK5A 1L5ZA 3ZX5A 2FG7C 3IQDB 3O1LA 1UMCA 3W05A 4BO8A 3U7RA 4RXUA 5LN1A 4GZ6A 5E8RA 2I91A 2XCSB 5A3QA 1G18A 1RXCA 2E89A 3H2IA 2XMCA 4W82A 3JR7A 5D01A 2WYIA 2E37A 1MBZA 1TK2A 4IV0A 1QMGA 3ZNQA 1QZUA 4ZOAA 3V5NA 2A5JA 2R60A 3OPVA 2MYTA 2VJPA 3MWEA 3T9CA 5JG7A 1IHYA 2ZFUA 3N6RA 5DIZA 5AOCA 4BNXA 4CKCA 4P0TA 3UUGA 3WSVA 4ZMSA 3OA0A 1HSOA 1D09A 1KQOA 1YC5A 1PJTA 2MSEB 4EFDA 2GN6A 2HHAA 3N76A 3GJYA 3PDIB 1O03A 2BZ1A 2QIOA 2WU3A 3KFVA 4JYMA 3N58A 4X0EA 4B7UA 2A14A 4XTCS 4JI4B 4K9RA 1I0ZA 1HF3A 3WDMA 4CQMB 2YY5A 4MCHA 3LS2A 5DF1A 4A27A 2EYQA 3PZBA 5LOVF 3GROA 4WKBA 3AEQA 4OAOA 5C8ZA 1JKXA 1JRLA 4AMZA 1I51A 5ARBA 4LPSA 1IRIA 3SQNA 3RVKA 4I5FA 3SR4A 5E6UB 1J06A 1IE3A 4NMWA 1F0YA 4E5KA 1FYFA 1BWRA 3EF0A 4I9HA 3GOQA 3I37X 2GUGA 4B47A 2GYVA 4MDEA 3HCFA 4LWZA 4LF7B 4BE7B 1O96B 2CL6X 3D43A 3NRCA 2WDZA 2ODNA 5BR7A 4XGIA 3UGQA 4AN4A 4TL6A 3OHPA 1G8JA 4MW9A 1UWVA 4IO0A 2XXAB 1LDNA 1IFXA 1A9YA 3S2EA 3OJWA 1DI0A 3CX7A 1KEEB 3JQFC 2IPAB 2YHAA 1NXOA 3IQEA 3E9RA 4IIXA 3TIGA 4PWZA 1M8GA 1EBBA 2C61A 2Q5FA 5CH5A 3TNYA 2P6MA 1GD1O 4AICA 4LZPA 3A26A 3K5IA 5E38A 2HQBA 4KLAA 4OB6A 4TTVA 5A3JA 1NN1A 3LF1A 1VP3A 2WJVA 3OZWA 3PGVA 1G3MA 5I9SA 2IXGA 5HHTA 4WOKA 3D7RA 3TWOA 2BW0A 1WP9A 3VPGA 3AC0A 3M3DA 1U9JA 2JH9A 1Y5MA 1Z22A 3BTUA 5JPDA 3ZJTA 3H2KA 2AC2A 1BFUA 2HT6A 3NXKA 4JUBA 4AL4A 4EUHA 2PT9A 3G2OA 1Y3HA 3BWEA 5ESWA 3I9OA 1XPOA 3BB3A 4I8DA 4RH1A 3Q1LA 3UNXA 2PCLA 2ZI6A 3I9LA 2XNDD 3NIDB 4XDYA 1PTJA 1KY5A 1D9XA 4CUJA 2PUBA 4CPDA 5KDOA 1XTPA 3L8ZA 2IPOA 4IZ6A 5E3IA 1CUEA 3WI7A 3C6BA 1GU1A 3QEOA 3WBFA 2M6RA 3AEUB 3GA7A 4AKTA 2WWGA 2PLRA 2A5GA 1YBHA 3ICEA 4P35A 1W4LA 4G4JA 2AI2A 5CIWA 4TTTS 3KELA 1AE1A 3DNPA 5IARA 4P4SA 5KINB 5C1PA 3C6QA 1PR1A 1L7QA 4R05A 4R51A 3KHKA 3MD0A 5KYWB 4AJ2A 2HJWA 3NAMA 5BV2P 2D6FA 3AR2A 5FA8A 1YF3A 4FS8A 4LWPA 3GDWA 3TIFA 4BNUA 1DB3A 4R6XA 2G7MC 4FQ5A 4FSXA 2F1OA 3Q0EA 3T9EA 1GG9A 1PFKA 2QAGB 2BWJA 4WK0B 5BN5A 5E1MA 2W2PA 3B89A 2IHKA 3IHKA 5GV8A 4INPA 4ZXPA 3UAVA 5FX2A 5LDGA 2AG0A 3GLUA 2H16A 3BD9A 1GUBA 2EHDA 4CI0B 1SQ0A 3Q3IA 4ZQGA 4RSHA 4Q4DA 4R1TA 1U1IA 5UKDA 5BSGA 1QP7A 4FPXA 5JXGA 5JQGA 1NAHA 4RPCA 3T41A 2YUTA 2RC5A 3VZSA 2G9NA 1FYXA 1CJVC 4FIZA 1ZSNA 1YB6A 1SBHA 1IEXA 3S3TA 4OUKX 3CIOA 1OB2A 1TOAA 6ADHA 4JI2B 3WLNA 2JFWA 4U7TB 3AONB 5HTKA 4JI6B 1PGOA 3PQCA 2B7LA 4GKVA 3PRKE 3GGOA 4RTJA 3ZD6A 5HQTA 5ALSA 3RIMA 2BJWA 3FNHA 1E6KA 4QYIB 2VUSA 4J90A 4V0LA 4Z86A 5LB4A 3R7DA 4A23A 5EJ9A 2QN9A 4QASA 3KB2A 3IUNA 5EIBD 1QE5A 1W5AA 3QEMB 4HDQB 4JUCA 5D84A 3WL4A 1UOPA 4Z9BA 1CJBA 1QIMA 1JIVA 4L9RA 4Y18A 3WGKA 1O94A 1RQ7A 2VJAA 3HUUA 4NLLA 3ZS8A 1RABA 2AN5A 1T2UA 4IUYA 3NAQA 3O3MB 4Z0NA 4JXXA 1SVWA 5KJCA 3FPAA 3ZY3A 2D59A 2ROQA 3FCYA 1V48A 1R4MB 4JCCA 4B5KA 1NFFA 1YSCA 1ZN7A 3LFTA 5FWYA 1V4VA 1Z5NA 2FUCA 3DXXA 5U4XA 4BZXA 4OJQA 1KJYA 2C2YA 1DJQA 4G25A 5EP2A 3C5WP 3PQ6A 4D26A 5A03A 2QDXA 2ZI9A 1OXVA 4RK6A 2ZBUA 1P1JA 3DMRA 5BSRA 4BTLA 2ZSKA 1SXIA 1NBHA 1YTLA 5T67A 4YDRA 2Q4OA 1PUJA 3EDRA 1RAFA 1RHQA 3BMOB 3BIFA 4XARA 2EJWA 2MJLA 3HZZA 2J5QA 2BGLA 3LWBA 1AGYA 4GBJA 4EENA 2IU6A 1VRWA 2P30A 3CGWA 1V43A 1DIHA 2VDRB 3NOVA 2YYYA 4I50B 5ALRA 5JNVA 1SHJA 3A0RB 4OI1A 2PZGA 3TNLA 4YY3B 3DAFA 1RKVA 4NVRA 3KR1A 4QARA 4YB8A 2MOKA 4UM9D 4FS3A 4BAZA 4DCMA 4EZIA 4DQDA 1JIQA 1FLDA 3V32A 1CQJA 4JT4A 2WHPA 2FOXA 1TCVA 1A69A 1I4EB 1RQRA 5H81A 4IXNA 1MJFA 3DE6X 3MD9A 1CEXA 3DTVB 4D25A 2CC2A 1V37A 5JCXA 3LLCA 4TV8B 1Q91A 2ZM6B 3C85A 3FSRA 3RYCA 4L51A 4IHJA 1ESNA 2IY7A 5DTQA 3VPXA 3M4YA 5IYZB 3EB9A 4WNYA 3MJFA 1U2QA 4X9XA 3TXYA 3H2HA 2GEDA 5HXAA 4K46A 1N5JA 4W7HA 4TZKA 1C50A 3AVUA 1P29A 1GT6A 2ZJOA 3IR7A 2BEKA 3NHAA 4UDXX 3ZHRA 5CLHA 2H1HA 4BRWA 1CSEE 2D1QA 3RJ9A 3WADA 1TYEB 3E9NA 4LDAA 3O2NA 2P9BA 3K72B 2YZ2A 2VK1A 4RUKA 3MG9A 1AQYA 3L4BC 4WXPA 3U4CA 3SQMA 4GPTA 1F0PA 1X14A 1OD6A 4QJ4A 1ZINA 4WOJA 3UOGA 3KQLA 1JUDA 1QHHA 1VLMA 5JYEA 3ITEA 4CLHA 1CJMA 3AI3A 1MGOA 2GX6A 4M88A 4Q21A 4IIHA 1JXAA 4YRZA 3RS4A 1LZKA 3AEKB 3U7QA 1IZZA 3S29A 1E2MA 4XD7D 3IDSA 3KCQA 1XK7A 4O2BA 3NCTA 1P0MA 3QEJA 1EGHA 4PLYA 4RVDA 4BB5A 1I3LA 3AJ9A 3T0FA 1XALA 4BNHA 3LIPA 2AOTB 1QE3A 4FGSA 1F14A 3RYFA 2L17A 4C0LA 3OLWA 2WTBA 4O4IF 5SV2A 1RVV1 3VSEA 2XYGA 1TW3A 4U63A 2HSWA 1VDMA 2Q6LA 1SUPA 4DLRA 5JMTA 5LP6A 3AJAA 4LUCA 3FDFA 5SYNA 1TZCA 1S6YA 4L0DA 4PZLA 2G9ZA 4RL4A 4YHHB 3NPMA 1EQUA 3DGEC 4KB5A 2VSYA 3SXPA 1W0JA 3QYAA 4J1SA 1IPEA 1NBME 3AJRA 2QTNA 3LCJA 4JXZA 1KZ4A 5H68A 4AZ0A 3OP1A 1TADA 4X90A 3U7EB 1A50B 4BOYA 3I2HA 4JYZA 3HY3A 1QG2A 3LQ4A 3LX5A 4X61A 2PZMA 3IP3A 3LD9A 3B60A 4JZKA 1I3NA 3HC7A 4AF6A 2W2MA 4JJGA 2G28A 3THOA 4LBWA 2AXQA 1VL8A 2XBLA 2IZOA 4M1OA 3K9BA 4DCVA 4EI9A 4M46A 1EVKA 3ZCUA 1YR1A 2W2LA 4TTRA 4JYAB 2Z6AA 4ZCRA 5IBRA 4PAMA 4MQUA 1I3KA 3C4QA 3CF4G 4ZOLA 3W7AA 1F9EA 1FXWA 1GLNA 1GPJA 1XCJA 2B36A 2CJPA 2OILA 3AM4A 2VFAA 4G1MB 2ZATA 2Y9MB 4J0FA 1R74A 1ZVQA 4JA2A 4JLKA 4OHXA 1G9SA 1GTJ1 3AESA 5C5EA 5EE1A 5DK4A 4ALLA 4CT4B 1NFRA 3LOUA 1T13A 1P3JA 3PCTA 4YLEA 3OCYA 2HK8A 3PHGA 4N5DA 1H1LB 4QOHA 2OVFA 4DJEC 5FLXA 1B23P 1VIYA 3BEDA 5DGTA 1BA3A 1GL9B 1UBOS 3MGBA 5JRDS 4J3FA 2PGNA 4K9QA 3ZU4A 4BGVA 2XWQA 3FUVA 5AQEA 4C4XA 1KDOA 3NATA 4R3WA 4ZCMA 5HNKA 1EFPA 5GPBA 1R16A 3D6HA 4UJ5A 3W9UA 4BVJA 4ANFA 2VRCA 2QTVB 1Z7BA 2GO1A 1LU9A 1Q7GA 2P75A 4QLAA 4ZQFA 2O23A 3C8HA 4MDYA 4OHVA 1ZA1A 2QT0A 5I48A 2H2GA 2ZU0C 4G2NA 4ZPXA 2IZ1A 4BP3A 2PWAA 3VKFA 1IDOA 4C2UA 1T29A 3KHSA 4UUOA 5L6LB 2O3JA 1UP6A 3F5FA 3O93A 1N7JA 4CMGA 1LGYA 1UEIA 4M8NE 2PJUA 1EXWA 2EZTA 4EI8A 4BVHA 2M1XA 4GMGA 4EVQA 5E2IA 1EWQA 2ES4A 2QDKA 3LP6A 4M87A 2GWRA 4LVCA 2ONJA 1NF9A 3PD7A 2WG2A 4PYRA 2YZNA 5CT4A 1L8AA 1IC6A 4QBTA 5EJ2A 1VLVA 1LZLA 3ZDXB 2PM8A 3GB9A 1OPRA 2I8CA 3GXOA 4M9UA 5K8CA 5KREA 3PVSA 3WB1A 2WJYA 3I72A 3I04A 2WT9A 3ANNA 1T6BY 1MJGA 1L5HB 2LBPA 1XWFA 2A9RA 4YEDA 1DG1G 1ODLA 3DBHA 3EZ2A 2VBGA 3HR7A 4CXMA 5HIIA 5CX4A 2XB8A 2ZBQA 5FTKA 3ZWPA 3I23A 1TCAA 2YCLA 5IH3A 3TO5A 2EBFX 3RG8A 5KU7A 1E4EA 1EK1A 4HBGA 3LVFO 4K0RA 3RRZA 3VU3A 1Q2UA 5FJIA 3C14C 1TU3A 3IVCA 3EYWA 4IYRA 5CHYA 2JGDB 3UJPA 1WPXA 4J4HA 1HKHA 5FUBA 5J2TF 3W5DA 4WECA 4RPLA 4X7MA 1E3QA 4Z8YA 4IQFA 3REQA 2FW0A 3D0KA 4RXTA 3FYCA 3BIWA 3O26A 4HFMA 4LZWA 1W1UA 2VI5A 4J16A 1H23A 1WX1A 1T91A 2JGMA 3G2PA 3HZOA 3L6OO 4OOFA 2VEDA 4PU0A 3QPWA 2R85A 3AUSA 4I4TF 3TQHA 5IM4A 1CETA 2BIFA 2PPVA 1D5CA 2PGOA 4I0WB 4DN6A 3SQWA 4L07A 3W3AH 5F4BA 1XQ9A 2P0EA 4ZA2A 4P0PB 3OH8A 5KQLA 3X1ZA 2ONYA 5HKKD 2QRZA 5FWXB 4HO1X 3B1ZA 1TVKA 3AILA 1QKKA 5F12A 1JIUA 1OX6A 1UBTS 4IIVA 4R1QA 2WQ6A 2UU9B 2GETA 2ZJ7A 4JHLA 2HSZA 5JAIA 3L82B 1XDBA 5EXPA 4J03A 3I9V1 1JHXA 4FNGA 4NBUA 3I4FA 3DE5X 4KP7A 1RHUA 1SUDA 2F1RA 2HNAA 5KNDH 1DHTA 4Y30A 1M6VA 3PFGA 1KORA 1P2TA 2GYUA 2HCFA 2OXIA 1OFHA 4LJ7A 3W5CA 4LDZA 3ETCA 2IELA 3NHZA 4RMJA 4F93B 3LC7O 4NBKA 4MVJA 4KQGA 5KMGB 3W8NA 4P54A 5F77A 1GNQA 1L7MA 2D7CA 2Y0BA 4BNJA 1OLUB 3UUFA 1RRVA 4OJKA 4PZCA 4URFA 3RO7A 2QN2A 2A1UA 1G16A 4O2AF 3MCVA 4L0QA 4A0HA 3GJ7A 1SXHA 3QW4B 1NX6A 2FZCA 1A9XB 1LLUA 4O1HA 4Y6LA 5AYVA 3TDMA 2Q9AA 4ENTA 1CS4C 4N40A 3G8DA 4UBMA 3FDZA 4ZPJA 4PNHA 1PN3A 2Z2JA 1N0HA 3C16C 4DE5A 1UAYA 2HM7A 3VUEA 2BGKA 3EF1A 1ULHA 1M1UA 2BR3A 3ENZA 3O82A 5JHHB 3HV0A 2QVCA 1JA1A 3JVUA 1MQ8B 4HEJA 1B0ZA 2C9MA 4BLSA 4DCOA 4XVUA 3F5QA 4DCSA 1NT2A 1A7AA 1E99A 2FOIA 4LXQA 4R9SA 5G41A 5LZ7A 2AQ8A 1YR3A 4HC4A 2R1TA 3RUPA 4F96A 2QV0A 5CURA 4KQXA 1WQ4A 1FMFA 2H1OA 4B4DA 2I3GA 4E6PA 3R4VA 1IONA 2RGRA 3LUCA 1OAOC 2J3EA 5K03A 2EJBA 3ROQA 3KTDA 1Z88A 3RHSA 4BQRA 1YDFA 3NHYA 3R9WA 4L8YA 1DDIA 1VA5A 3HK2A 4OBWA 3VR1A 1ORIA 2OBYA 2G82A 1WW2A 2QPLA 1TRHA 2FN3A 2O3RA 1JLHA 2RHHA 3BQ9A 1QIGA 3A58B 3GU3A 4IRMA 1JEOA 5CT8A 1WB6A 3E82A 3VR4H 1FRVA 3EARA 2BFEB 1M5UA 3LO5A 3O3NB 4KQFA 1RHJA 1AC5A 3TIXB 2WSBA 1OA0A 4ZI7B 1NOKA 3Q85A 1QU2A 3EMVA 2H06A 3B48A 1T9ZA 4YNBA 1S7CA 2HY7A 1AKNA 1QOQB 1ODTC 2J6CA 1LK5A 1I6MA 2BY4A 2P79A 3CF4A 2DG2A 1E8NA 4Y9UA 3TLYA 1FE8A 1PNTA 1ECLA 2VNKA 1HRDA 1X3LA 2W7TA 3N87A 1P81A 2HHLA 2QB5A 2WOOA 3QE2A 4R2HA 5EJIA 3BMXA 3ZHOA 1KI1A 2B5OA 2JBHA 1HWYA 5CP8A 2DHEA 3I64A 3KKMA 4HTFA 5KAMA 2JI7A 3R7WA 1T1GA 3RVJA 3OY7A 1HNWB 2GJ4A 3R9KA 4JV5B 3B9BA 1XVIA 1N9ZA 4PFKA 4B8ZA 3FPGA 2P6RA 2AG6A 3I2IA 1OI4A 1SU6A 2R6ZA 4LRQA 3PGKA 5EMLA 4NABA 2G08A 4LDRA 5LBUA 3ZDZB 3H87A 4RIFA 1XNQB 1A9OA 1WF3A 2GEVA 2PKYX 4LCEA 1VC2A 3SS8A 1D0VA 1NLZA 1TFUA 1LWNA 2N1BA 3ANTA 4WERA 5KQGA 2JC3A 13PKA 2MINA 5IAOA 1R8XA 1Z7YA 2O8DB 1NJSA 2W83A 4OHRA 4ROSA 5I8PA 1WZEA 5JALA 3H9QA 2EQAA 3FNBA 3UH0A 1ZNZA 4EATA 1JG4A 2G80A 2YJZA 1KDVA 3DVRX 5E1DA 2PLWA 5K1ZA 4N01A 3I28A 2SHKA 5JOQA 3IQFA 1CE8B 1YNOA 4NX2A 2ODQA 4PCAA 2PX3A 1P6XA 4H7EA 3WK5A 5F2OA 1B6TA 2C3PA 5LMCA 3TR0A 5IKPA 4NDZA 3W79A 4F2HA 2R8RA 2Y1FA 4G1BA 4RYLA 3PNPA 1U0SY 3FAZA 4HDSA 3CRMA 3JYPA 5ANRB 5CEFA 1ULTA 3DAGA 3Q0IA 2RHLA 4UUBA 3E0XA 3TD2A 1XBTA 1X2EA 5LIRA 1I2DA 1QPBA 2EATA 3JQ9A 4B6OA 2FR8A 3B9QA 1JB9A 4NYMQ 1BMTA 3IKLA 1OH5A 3T4UA 4URVR 1ZH0A 4AT1A 4DZTA 4B3CA 2FEAA 4TS1A 1VSTA 1COWD 4QOJA 2X9GA 4L85A 1XRNA 2D1YA 2DWQA 1F8GA 3CX8A 3PICA 4GX5A 1NNI1 4C88A 2PMKA 1M74A 2FFHA 1E7QA 4PIVA 4DANA 4ZRDA 1RIIA 3A6EA 4Y1RA 1J1ZA 3N0RA 1RRKA 1FNDA 1FDVA 1QDUA 3IJRA 3CUTA 3PDHA 5LA6B 1ZITA 5BNFA 2FI1A 3URMA 4MDFA 4C6HA 2J0UA 1UDXA 1QH1B 1U8EA 4TMFA 5KEIA 1PFQA 4C07A 3W77A 5EZYB 4FNOA 2F3UA 5B7GA 5B57C 3AR6A 3PE6A 4B6GA 5EIHA 1OASA 5ILQA 1BVHA 1FYEA 1XNHA 1E9SA 2OWEA 5ALEA 4ZCIA 4M98A 2I4LA 4HGYA 2VJOA 4HF7A 1RM4A 2OHVA 3NIBA 4DA4A 2Y6VA 1B8UA 1FFGA 1P1RA 3CPEA 3KD3A 3OOHA 4WCFB 3GEIA 3OLQA 1JEAA 1R9NA 2HSDA 1N2CA 2X8AA 5C35A 4Q1AA 3SFZA 1QH9A 2GHQA 2XMQA 2Y1GA 4FGLA 5FO1A 5GIPE 5K45A 1I4OA 2FVXA 4U1RA 3BGVA 1P4GA 1P6QA 4HAZA 3Q2IA 4MW7A 2XNCA 5KVVA 4OJYA 4FNMA 3FRIA 3NUGA 4IFBA 5KYXA 1O95C 1RWNA 2FYTA 1QGZA 3AF2A 3B5JA 3N86A 4P3XA 1UK6A 5FPHA 4K6FA 2I2BA 5TJ9A 3WWYA 3RUHA 4DEVA 4LOKA 3TXAA 2UZ4A 1E5TA 4D1YA 5JD6A 3I09A 2IU4A 2BHTA 2OHXA 1LJUA 3I0ZA 2YMLA 3H05A 3EGDB 1QTQA 3CTMA 4TLCA 1R4NB 3PUHA 5M3BA 4D0GA 1NPTO 3R75A 2HJGA 3D6TB 3WIVA 1KYIA 4Z54A 4RA6A 5A05A 1FTSA 4W1PA 4NZZA 2X8BA 4BQEA 3ZDBA 2IE0A 3D8NA 2ISQA 3EBLA 1H6AA 3IAFA 5DSXA 4IJVA 5A5VA 3CW9A 4KL8S 2I71A 4HS9A 4EWLA 2QYTA 4ETNA 1KO4A 3R8FA 4IEEA 3RAGA 1YRAA 1GGEA 3MJEA 3P96A 1YR9A 2ZSDA 5AHXA 1RZRD 3EEFA 3B38A 4TYMA 3FROA 2FB9A 2G04A 2VRNA 4DSZA 4RKYA 1GGFA 4TPKA 1FQOA 5GOZA 3VC1A 1WZ2A 4NE2A 5H3LA 1XZNA 4G1FA 1MU0A 2IEIA 4PC7A 1KQNA 2DQSA 1WPGA 3AB7A 3IRUA 4NJEB 5AK4A 5AM2A 4E46A 4B3TB 2COEA 4C3OB 1X80A 2W0SA 2UZ3A 2FG6C 4CIBA 5KSPA 1V8DA 3B36A 4Y9TA 4O2RA 1SGWA 2HK7A 3N7AA 4OQMA 2PMWB 5AWFC 5B3LA 2GPSA 4EUEA 3WK4A 3WLSA 2QTLA 4J6FA 3KWJA 2GHTA 1JP7A 2Z9BA 4FBMA 1A5ZA 5FPSA 3OE1A 1X74A 2LKCA 2NYAA 5TXGA 2OORA 3U81A 4BVAA 5C4IA 2WFLA 2C7OA 1M0EA 2PBZA 1J25A 1SR8A 3GZ4A 1U9IA 1EAMA 1JPUA 3KDSE 1Y6JA 3EIHA 3KT8A 4I2NA 4BNZA 1GR1A 4QGAA 1SQGA 3IAS1 1T4GA 3MSXA 4QE3A 1WBJB 3A4MA 3A4NA 4GOJA 4UBKA 4KAAA 3GFOA 2I7VA 3DAHA 4CM8B 1ZEMA 2WFMA 4EQ6A 2I65A 1IWOA 2AFIB 3T5MA 4RTLA 1XZFA 4U9IS 2WWHA 3UMBA 3QU7A 4R9NA 4C1BA 3L6RA 1QKIA 2ZAYA 3ZJUA 3PLAE 5JSKA 1XU9A 5E9QA 4FFOA 3BX1A 2I6SA 1AXRA 4PBRA 4DSNA 1SBZA 2XUAA 3A3KA 4RJKA 1QPGA 3PQ3A 2Y93A 4RDHA 4CIDA 4G56A 2M32A 3CRQA 3MJ4A 4CEHA 2GI4A 1W1IA 1PZHA 4IFEA 2B78A 2WNIA 1BN7A 3CO0S 5AP9A 2BRUA 1W2WB 5IJXA 5KSWB 4KQ2A 3PE3A 1WMFA 3E27A 3TRJA 4UHFA 4BATA 3RREA 3RKUA 5C8XA 2H4WA 4M60A 3IR5A 1XUOA 1Q1BA 1PHRA 4AG3A 2DE0X 4DMLA 3UMRA 1HFKA 2B94A 3PDWA 4K9LA 3GRAA 4XGKA 4YJ2A 2ZYWX 4PN7A 4BFSA 4ZV4A 4OI0A 3R5FA 2K4MA 2PX0A 3TMYA 1VJGA 2IPNA 3O92A 2D0PB 1FP4B 2YOFA 1FXUA 4I66A 2VQ3A 3JQCA 4YRCA 3GFQA 5JZ9A 1Y8RB 2E4YA 2XJ9A 4F6CA 3ISJA 1U7HA 1OXUA 3V00A 3WGMA 3V4RA 2VK8A 1S2IA 2Q5CA 2XUGA 1AV6A 3V1UA 2VXBA 1E3SA 1H0HA 2R2AA 2OXCA 2WE8A 4IXWA 1BVYF 1RWPA 1O7JA 1YKGA 3KPVA 3CV3A 5ELXA 3OZFA 2JIRA 4O0LA 4R8SA 4CKBB 4DAOA 5AKKA 3ZGXA 2X76A 4F1WA 2VTBA 4YCNA 3GUVA 2CUKA 4H16A 2CW5A 3ROFA 2XADA 4FYMA 4M1EA 2OZVA 5AVTA 4F8JA 3T6KA 5H1YA 4DLWA 4QBKA 3D64A 4P32A 4MI6A 1SXQA 3ZVRA 2V6JA 3QU9A 4WW0A 3SEQA 4BMZA 4PLPA 5LNK1 1E2QA 1TM7E 3C6ZA 1BW9A 1ZONA 4ZOBA 4G5RA 1RMTA 3BMCB 2I80A 5BPHA 2ECFA 2V1UA 3MQ2A 3NJ4A 1Z3IX 1DU4A 4LG1A 2LIPA 1Z63A 4YJDA 5CNJA 4AIIA 3IV9A 3CMCO 5JC1A 1HNXB 1Y89A 1B76A 5LZ8A 2YWHA 1RHRA 4FTWA 5KSOA 5ITZB 3ZLJA 5L3QB 4OATA 3WE7A 2AKEA 4HZUB 5ERGB 4WADA 1QHIA 1IHXA 1RWVA 2OLKA 1DCMA 5E7JA 2B8EA 2BE7A 2QTGA 2H1WA 3KWMA 2UUBB 4BVFA 3HPRA 3T35A 1X7YA 4RF2A 3PNLA 4WVLA 4C9BA 3C3JA 1N6LA 2VF8A 2XUOA 2AZTA 3PWKA 4ZQIA 5EPUA 4CTNA 3DVQX 5F7XA 3L40A 4BMCA 1IJEA 1KDYA 3W4JA 3H8JA 3UK6A 3DFKA 2VYQA 4H35A 5JS1A 1G21B 1J5PA 1JX6A 2C0CA 5JAHA 3E58A 3G89A 1B74A 1Z26A 2FWJA 4DPLA 2IIPA 3L4JA 1USWA 3DQPA 1DTEA 3RSOA 3CSDA 3OFND 1KRWA 2EIXA 4WRRA 2I9PA 2O2GA 4ZO6A 2J59A 4PQGA 4EHNA 4MTCA 3VGJA 3P52A 3A9WA 3FMPB 3M1IA 2AOWA 2BLNA 1WXHA 1Z83A 2B6NA 4FOOA 4LIPD 4L72A 3N0XA 5SZKB 1CB0A 2WV7A 4MEBA 4NCXA 3X1MA 5B7QA 3CUEF 3AZOA 1J0EA 3CNBA 4M55A 2WJHA 4O4LB 4CF7A 1MT0A 5GINE 2ET6A 3BORA 1PLKA 3PYXA 4KXXA 3VU9B 1T5OA 1GLVA 1YDMA 4C4PA 4HQ6A 3NEPX 2AUMA 3Q40A 3E18A 4RU1A 5T6BA 1QORA 3D7LA 1OBVA 2P6UA 3ENWA 4FINA 1L4NA 2C8VA 3SDBA 2QTRA 2H2WA 5JAQA 4YVFA 1O5TA 2ZZNA 2G25A 1W5EA 3QPBA 4F7DA 4O4JF 2J5KA 2ZRHA 4FFMA 1VKZA 1B14A 1MQAA 5U1PA 4D4HA 4LQLA 5TGTA 4AJJA 3FWPA 4ZODA 1SCNE 2QP3A 3GI1A 2JLQA 2P35A 1G5FA 4UM5A 1MEOA 1C3OB 1ZZGA 1G291 2BBWA 3G0IA 1H2EA 2BHNA 2ZJ4A 1KU6A 3Q7IA 3QUSA 4L6AA 4YJGA 2ARKA 5D5PA 3RVNA 4PFJA 3ZJYA 1GTG1 3OA2A 1V3QE 4R5MA 4TLBA 3S70A 3CVXA 3OTQA 3OEED 3RBXA 4LQ4A 1DIBA 3N28A 4XWKA 1QVVA 3KKPA 3PC8C 4CDGA 1CFJA 4RK1A 5SYAA 3VKHA 3RT9A 1E96A 1ZCAA 2Z09A 1SA0B 1L7RA 1QLWA 5JXWA 3L4EA 2K2WA 2KBEA 3DBIA 1K6JA 3PPYA 3WKDA 3TNFA 1MHTA 2JGEA 1Y9DA 5EJ8A 4UEWA 1BXGB 4C6TA 3VYSB 3I53A 3TSYA 4DQLA 1Z2NX 2YV1A 1GKYA 1ADFA 1Z0DA 1TF5A 4K9KA 3NT2A 3WSTA 1TKCA 1B42A 3DL4A 4C0JA 5M29A 4HB0A 5HFNA 4EYOA 5LZ2A 3U3DA 2EW1A 3JASA 4G0YA 4Q6WA 121PA 4WOBA 2YDXA 3ACDA 2ACEA 5CA1B 4AY5A 3NHPA 3B1FA 4YAOA 1L9XA 1A5SB 1AS0A 3GJSA 3KOMA 4K9OA 4OX9Y 1GNLA 3OC0A 1VKNA 4HQOA 3RQIA 1RP1A 2EFCB 2V6FA 1GVNB 1R6BX 2IITA 1ZZEA 3C7TA 3EIFA 4Z4HA 4LTMA 1ZA2A 2IEZA 3L2OB 3PTAA 2BM8A 4DC1A 3PD0A 2ATCA 3HMQA 1KJQA 2R5NA 3UK1A 4HVAA 4KAJA 2J5RA 3SG0A 4XZ3A 1K4MA 1ZISA 1T4BA 3DL0A 1BDBA 1CDZA 1XZBA 2YJTD 3AVPA 5DNVA 5EMJA 4BV3A 4D4MA 2PUDA 4IINA 3PXUA 1DKUA 1EDDA 3UQYS 4RH3A 1QV6A 1A5AB 4XTRA 2I54A 4DOMA 4M36A 4AX4A 2VP6A 4C22A 1MDBA 2MYUA 1TUIA 3GD7A 2ATVA 2QTWB 4KMSA 4XIJA 4AIRA 1CW2B 1MVNA 1OI7A 1P7PA 3FWKA 2W42A 4O08A 1OV4A 2AN3A 3ANLA 4IP0A 2P6NA 5BUCA 1EUDB 1TUBB 4Q7KA 2DFNA 4D0RA 2F3QA 1GFWA 2QUHA 3AM3A 4OFZA 4QFCA 4M9RA 2DU8A 1PGNA 1EUYA 4HATA 4W5QA 1YIDA 5I01A 2FPIA 3FWYA 4F3YA 3MHTA 2AWOA 2Z4RA 5JSZA 2K6GA 1RU3A 5T57A 2AXEA 1QNLA 3F5SA 3ETDA 3TLZA 3C70A 4H18A 4A03A 1C0LA 4DLVA 3ZBPA 2XMPA 3TOCA 4P36A 3F4KA 3LC2O 1OHHA 3L9XA 1QHYA 4JGBA 4I5IA 1VL6A 2Q4EA 2PR2A 2WA2A 4N3NA 4Y2VA 4B48A 4DXAA 1UBRS 5KUTA 1PK8A 4K2HA 3NTLA 2HIMA 5K0BA 4RDCA 1EYZA 1N6KA 1I94B 3LTNC 4M1SA 1EFRD 2NADA 1J7KA 3E1GA 3S81A 4BFVA 4PSAA 1SCBA 2OHJA 2FPKA 3LUFA 3T38A 2PT7A 3NYRA 3DVAB 4PYNA 3T34A 1ZCJA 2I55A 3L01A 4V3BA 3SE0A 2RB5A 2ZRMA 3H1EA 1M34B 4MV4A 1UPFA 1WRBA 1JA0A 1UPAA 1VJ5A 3WMFA 4W9NA 5FDFA 1MDFA 2AS0A 2WJPA 4MLZA 4CQMD 4QG3A 1QRTA 1XVTA 4M1WA 1P7VA 1JH9A 1TUGA 4LMAA 3UHFA 3AFNA 1JG6A 4L9AA 5BPFA 3BK2A 1H0SA 1KMHA 3N5CA 2IHVA 3FGZA 5AI5A 3ZNNA 5BURA 5LUAA 5LWQA 4MJ3A 2JFHA 4N39A 4X7RA 4XSHA 2EP5A 4PSCA 5H4HA 4B6PA 4D8YA 1YZGA 2A58A 2CUTA 4Q66C 2PZEA 3MRTA 1SKAA 5FPPA 1P1CA 4M0FA 2EKBA 3BCHA 8ATCA 1HNNA 3K7EA 3JD1A 5GV7A 2ASEA 2V9PA 2NUTA 3OO0A 3P0IA 4RD3A 4MVJH 5DM1A 3RTCA 2L19A 4BKQA 1TTTA 1D4OA 1P19A 2H5JA 2XKAA 3VC7A 3UMSA 2XIJA 2FN7A 2VP4A 3BKXA 4XUGB 3AIIA 1E63A 3A4VA 2NUBA 4LJSA 4FFDA 4ALJA 1U0FA 3FFXA 5A0FA 4YJKA 2ST1A 2DBQA 2JB9A 2CNOA 1EX9A 2Y8EA 4IWXA 4X92A 2JZOA 2GCOA 5FI0B 4EKNB 1VZ3A 1NVEA 2NU6B 3NHJA 3VXKA 1M2JA 3PXAA 2YJ5A 1E5LA 3T7SA 4KQ9A 2YN2A 3EQ2A 3K9QO 2HRRA 1C3JA 2XTNA 2YWRA 4JL6A 1C0PA 1I9CA 4KXNA 3EC2A 4G85A 3UXEA 3ZGOA 1N2SA 3QF4A 4R5HA 1KOGA 2XDAA 3DPUA 4OL0A 1I4TD 1YOBA 3OTIA 5REQA 3IMFA 5BV8A 1E5DA 2ZAOA 1OGIA 3DKIA 3PRHA 4QUJA 4PV7A 4I6JA 2VNAA 3VBCA 4XE5A 3MQFA 5E0KB 4KHZA 1PO7A 4G07A 1G3RA 4OQQA 4A2WA 1VL0A 4B1FA 2AXPA 3I45A 2B1IA 4GM1A 4O4HA 5AMXA 4UTPA 1Q57A 2EEZA 4G84A 3OKPA 2NXWA 2VJMA 3KTOA 4X20B 3AFMA 3K70C 4KQWA 1XTRA 4W5RA 1F7UA 5JJKA 1NM5A 2JFGA 5DBGA 1UDCA 1BXRB 3GP5A 3OOEA 4XRGA 4DIDA 4DYHA 1GG8A 1YACA 2VA8A 5AXCA 3K30A 2BMWA 1OV6A 4CCYA 2DR3A 3O4IA 3V3TA 1LRLA 2O2XA 1Q44A 1IY9A 1RYYA 2OHOA 3RBZA 1AV7A 1C3VA 1N92A 5HCUA 2G6BA 2I4MA 2IV7A 3PEVA 1YFJA 3AB8A 4B3SB 4DV2B 1M2OB 5IUJC 1KQFA 1TU0A 2NU9A 1TLTA 4RM3A 1AUPA 1OJLA 1QG0A 4M1KA 5DRYA 3TW6A 1TTQB 4MR7A 2PFKA 3K9NA 2GPYA 2H7XA 5I7FA 4PG6A 1D04A 2J9XB 3EJ6A 1WBBA 4BO3A 2PBFA 4A36A 1JAHA 2JRCA 4DVGA 2CKMA 1FDIA 4Q24A 1VZ2A 5EC8A 2L69A 5CB6A 3U6BA 5TQVA 3COWA 4PLWA 1TQDA 2Q7XA 2Z57A 1ZIDA 3EXHB 2RJOA 3QFFA 4MYRA 4DIOA 2QD1A 4U2EA 2RHGB 2FZ4A 3GFGA 2B3DA 1CJKC 2VXOA 3EA5A 1I36A 3UK7A 3CH7A 1ECFA 2XQGA 4LSWA 5A3RA 5INTA 2KYRA 2DLDA 5DYIA 4GW3A 3L5KA 2QZJA 4CM4A 4CTOA 1IN7A 2TMYA 2AFRA 5DI3B 5BYBA 4EQZA 1U28C 2I78A 1NV9A 2X40A 3JQ7B 3QFCA 4G26A 4KZKA 4OP3A 4QEDA 3RNLA 5AVRA 2JEOA 4BFUA 3AY6A 5JZSA 1DADA 1KS9A 3IIIA 3SJ7A 2PMEA 4YMLA 3CE6A 1JLLA 3QVSA 4FEGA 3DH0A 2HSGA 3FNIA 3KDAA 4ARUA 4TKZA 4U00A 2PUHA 4RMNA 5G53C 5AW1A 1TJPB 3RYIA 1MX9A 2I2XB 1U0RA 2QLFA 1S3SA 4TYWA 1BA2A 2GD0A 4JI8B 1P8AA 2JCBA 2XV1A 3D7MA 2BEUA 2O3TA 2R7NA 3PPIA 5AIAA 5AJXA 2BEWB 1X9IA 4FZRA 4NE7A 3BRQA 5HBRA 1SK8A 3B6IA 5AVQA 4N8DA 5JXIA 3C3PA 3LQ2A 3CBQA 4X1IB 4Z4FA 1F2UB 3NBKA 2WWRA 1VBNA 4HUQA 1Q6ZA 2YIDA 1JDTA 3H5VA 4MQFB 3MB8A 3IAM6 2X22A 3MWLA 5EKDA 1ZOIA 3KK0A 4EW1A 5B4TA 3AW9A 1E2FA 3WWDA 4AX8A 1PG5A 2WJWA 3HXTA 1RLUA 4QUIA 2P3OA 4AO8A 4DJDC 1IZYA 2FW1A 3AW8A 4BKRA 1P0PA 1SUWA 1ICIA 3H6KA 3RROA 4A73A 4ND6A 1THZA 4TRMA 4HRXA 3TOZA 4JJKA 3VU0A 3FHCB 5LB2A 4JQZA 4OKSA 4ARSA 4M8KA 2X5XA 3QYJA 4BAGA 2WU1A 1FJXA 4BWGA 2ZUWA 3I0MA 3CINA 3CNOA 3D7KA 3B1JA 1AXEA 1U3WA 3U62A 1JL3A 1M2KA 5JDCC 3PRYA 3T94A 3HNOA 4CCAA 4EB3A 3KTAB 1JF8A 4P58A 5DX8A 3WLQA 5FPKA 4A2PA 4DDKA 1CUGA 3NH9A 4DR6B 1CUCA 3HSYA 5HUHA 1ZXBA 5IBCA 3GT4A 3AVXA 4BNKA 4JT9A 4MB2A 1WG8A 2SKEA 2NAFA 3K9GA 4IHAA 4EAQA 5TQ2B 3LHDA 1CRQA 4KPUB 4NATA 2R6JA 4ASUA 1RM3A 4U6NA 3OZTA 3T9FA 3EPRA 3NNSA 1LS6A 3LKBA 2BEVA 2JIOA 5JFGA 5CAEA 5K7SA 4PZUA 3OOJA 1D1SA 4LNUA 4B45A 4KPEC 3RAEC 2ZBEA 1WHTA 4BKUA 4IILA 1G6KA 5GZ6A 3KU4A 3GIWA 1JXOA 1GKKA 2BFMA 3ANXA 1F17A 3JZFA 1ZUD1 4BJ6A 1HUQA 1VIMA 2B98A 1ISIA 1XB2A 4HUTA 1S3IA 3A1UA 4Z1MA 3GG9A 2FSSA 4YX9A 2ZVDA 1J4AA 3OVMA 4HDOB 1J0XO 3KYDB 4KQHA 5G0VA 3BRWD 1YU6A 2AMYA 2ZSIA 5DPMA 2NXNA 2FHSA 2WK1A 3FMVA 1QCZA 4CLXA 3UJ8A 4FC6A 2LR0A 2C03A 4FX5A 5BVGA 1UXKA 4K6CA 1E58A 5AUPB 2C83A 1BIFA 1NVDA 1T3LA 1KHTA 2QRMA 1PX2A 2W8BB 3RKRA 2BDUA 1ZVJA 2O0KA 2XUZA 1S2GA 1R0SA 1KAOA 5EERA 3M89A 5IBQA 4M53A 2UZ1A 3DYIA 4HWOA 2QE7A 3MHPA 1HDYA 2OAP1 1RQ2A 1STOA 3NBZC 3KYIB 1OH7A 3DMDA 3DTYA 3S40A 2H3EA 3E4DA 3H0EA 1E7RA 3LK7A 3QWAA 2ZREA 3H84A 2H4XA 4JS0A 3DB2A 4MS3B 4U8HA 4RPKA 3ZW8A 1AA6A 3U5TA 1TYAE 1PEDA 1S2NA 2J33A 1UC9A 5JNTA 3JAMA 4RKEA 4PRYA 4G4GA 4QYWA 4LRSB 4X8HA 5AKJA 2J48A 3PPVA 1QHXA 4M22A 4E88A 3FVRA 3O83A 1CV2A 2B1GA 4JJAA 4O25A 4EHHA 4BP1A 3HJAA 2BFOA 1MB2A 1V2HE 2D3TA 1ZSVA 2XX3A 3IA2A 1AUVA 4L5IA 4MS1A 4YRRA 3V8RA 4FW9A 4YP0A 4MYSA 2BGGA 4OJTA 3TQSA 3CZ5A 3NDRA 3U19A 1XOIA 1CTQA 4L2IB 1HLFA 1DSSG 1EFKA 2GASA 3DZ8A 4QA9A 5I51A 3N2LA 3GVHA 3PDJA 3CH6A 3KYBA 2DBRA 4WEQA 1IK6A 1R27A 4YAFA 1KDZA 4MCIA 2CVQA 3IELA 5LZ4A 2WG1A 1KTIA 2P69A 4MA0A 4XEUA 4YMWA 4HLUA 2OGSA 2PWBA 2XMSA 1PS0A 3I12A 2J9YB 3L77A 4MAAA 3TTSA 1QYXA 5GONB 4YYEA 2GEFA 4ZT6A 3OJXA 5H02A 5EIXA 1ZXLA 1JAYA 1NKSA 2PGIA 1XZAA 1T36A 1LTKA 5K4HA 4EGAA 1QC5A 4PLTA 2DT5A 1G1MA 3SLGA 1G2OA 4C03A 3TFQA 3GMIA 4GWGA 4UFPA 3IGFA 2NMVA 5A4JA 1OZ0A 3VZPA 1UMCB 4CQLA 3R6DA 1XVAA 4Y2PA 3HO1A 3UHOA 1NU6A 4DWOA 1VL5A 2IHBA 1ZK3A 2C0QA 1SCIA 2AWNA 1PT8A 3CKYA 1U90A 2JVKA 5EMHA 4C43A 8LDHA 2GS9A 5CTJA 5JWRA 2CJWB 1O5OA 2ETVA 3ENKA 3I58A 3O2JA 4WTOA 4DMCA 4TVSA 2QLTA 3MWEB 3AJ8A 4D44A 3DE1X 1I7NA 4Q03A 4HQ0A 2RD2A 1QO0D 2C2WA 5IAEA 1V6SA 6GPBA 3SVZA 3AUUA 3KLNA 3WISA 4E31A 3RLIA 1Q0HA 3M1YA 3ORYA 1XFAA 4X3OA 3U3ZA 4EKIA 2IU3A 1B73A 2XMBA 1E2NA 3OZUA 3PUIA 4JLJA 4LRTB 1ZBDA 1PGQA 4BX2A 2X4LA 5C2JB 3HKCA 1JHOA 4UTXA 3ZE6A 5EQJB 1PS8A 1WCXA 2PX6A 3AEQB 4JC0A 1NI3A 2R97A 3ZXUB 4ZCQA 1E1LA 4RLHA 4XIIA 2VDKB 4B84A 2X9LA 2XZLA 4BLWA 3B6KA 3UCXA 3DDOA 3M6AA 3OX1A 1TCUA 1RKXA 4FOLA 3A06A 2ZG6A 4BDSA 4D79A 4F6RB 5BNTA 3K5PA 4C6RA 3BGSA 1D4AA 3QMPA 1UK7A 1Z4NA 1ZY2A 2ZRBA 1JILA 1J0CA 3BE4A 1M7HA 2GBIA 3EISA 3I5AA 4IPTA 4M9CA 4C7MA 4QOGA 1SIOA 2G9QA 2UYGA 4D43A 3UXHA 3ZHUA 5AVUA 1XQVA 3SYTA 4AECA 1FMTA 1NI5A 1VHLA 3FM9A 3OEYA 5H80A 1K4KA 3KAPA 1ECGA 1XZDA 3MT7A 1RS0A 3LCMA 2A7XA 2BF7A 4J0IA 3SC2A 3HCOA 1NNEA 5D3QA 3QVMA 4RWZA 3E5NA 3RSLA 1C1DB 1ZI9A 1P39A 1ORRA 2CDBA 4RENA 4BNWA 4M7OA 5FNZA 2SNIE 4JIGA 2NTEA 3ELBA 2HYDA 4Z3OA 1PJ4A 1OWPA 4Q3AA 2ZTUA 1GADO 1PWEA 3MS4A 1FRFS 1FZTA 3H5WA 1ARZA 1I5RA 3E9YA 4RIIA 5KS2A 3R6GA 4XYGA 1OVMA 2A57A 3GH3A 4EY4A 3ZE7A 3M2TA 2COKA 3HR4A 1UDBA 1AKYA 2AJDA 5CNMA 5K6AC 3EUEA 4S05A 3KT0A 1W36B 4I1VA 3HGQA 4AZ3B 1VMDA 4E2WA 4MWDA 5FBHA 1A9SA 1MO2A 2VDNB 2W0MA 1I5OA 3OF3A 2FPGA 2QD4A 1E1CA 3LPNA 5CFNA 5D6OA 4CR7A 1OMOA 4U39A 2WAYA 2IWRA 3R7LA 5JADA 4CKXA 2G1AA 2NGRA 1IG0A 3TZBA 3VDMA 2H1RA 2XB4A 2PE5A 3IIKA 1QHFA 4HSEA 3VH2A 4ZEVA 2ETXA 1MD9A 4MJLA 4I1PA 1GUZA 3ILXA 3WRWA 2B8JA 5DX0A 5DNEA 4G8CA 3A8TA 5KTSA 5C32A 1ZNQO 2EKDA 3FNGA 4D8TA 3P19A 3P9RA 4X41A 4AMBA 4OXKA 1J0AA 4FR0A 1B6RA 1NIJA 2FZWA 2WMDA 2G0NA 2J4FA 4DM3A 3GOHA 3L04A 2PUJA 4EM6A 1YZUA 4R84A 1BGWA 1H2AS 3N1UA 5BN5B 2JD1A 4IY1A 4ZOQI 4C4YA 4OTZA 5JLJA 4BBJA 3T12A 3EBPA 2JJ8A 1EQAA 3QUBA 4ER7A 3SHVA 1YH3A 1N8SA 3NYQA 4JX9A 4EI7A 3RI3A 3SMQA 2BJHA 2PQ0A 4ZYWA 5J47A 2O0JA 2CWDA 3H04A 4F60A 3DAOA 1YQXA 3ABRB 2ZJ2A 2NUPB 3JQBA 5CFOA 3NVDA 1ADCA 1E0KA 1Z36A 1FUKA 1EE1A 1BMFA 2LCFA 1W46A 3MJTA 2NX2A 3TW0A 3SQXA 4WMLA 3KQVA 3EN0A 1LLFA 1ZR2A 4H7HA 1XO1A 2JFVA 3CNLA 4F56A 1ZJYA 4A6XA 2F67A 1R5BA 1X92A 4O33A 3VAZA 1UK9A 1XA0A 3QV1A 5TQJA 2KQUA 2GO7A 2XWJI 3S5UA 2F9LA 3F6YA 3K0FB 4UOZA 3MWYW 1U02A 2GN9A 5ESRA 4JLUA 4WKGA 2O05A 4RVSA 3EZXA 2VQEB 2EERA 4X64B 4DCPA 4FGWA 4UDNA 1VG1A 2EBHX 1YDHA 2FFAA 2Q1XA 3S7ZA 1QRSA 5JC8A 2Y92A 3R0VA 1X39A 2VPIA 3BSWA 2UVDA 3OHSX 2LPMA 1LDBA 5JMOA 5F7JA 4HJXA 3LL7A 2GJ8A 2ZPUA 1R9GA 4ZT2A 3TEMA 2QGNA 4NV1A 2PGJA 3E5RA 1ZYUA 4CUKA 5KOHA 2ZIVB 2XD9A 3OQIA 3U1BA 4YV1A 4H0CA 3OT1A 1KSFX 1URPA 1Q11A 1IHUA 4Y2YA 5JWOA 2VIIA 3RSQA 2RBGA 4BP8A 3VR5D 1P5HA 2PYIA 3JWPA 1N6RA 4ZYLA 1Q7RA 2M6LA 4O1IA 1DQZA 4HYYA 3NV9A 1WCV1 3B5EA 1PAUA 2Z08A 4O8CA 4OFWA 5KYVA 2DB3A 3OEWA 1KSGA 3WMGA 4BJ3A 3I6QA 5F33A 5MGNA 1TLLA 1X6VA 2VHUA 1O57A 1Z2EA 1ZN9A 4PVDA 1U3DA 3ZNOA 2C4MA 4C4TA 3BOSA 1HTWA 5BOVA 4WZZA 5AJTA 1GPWB 4JVMA 1E6WA 5HUQA 1HDXA 2L2QA 1EHCA 2VHWA 3F5MA 4MIYA 3DDNA 3OBBA 3CB4A 2DBZA 1CQJB 2WUFA 4XWAA 3I73A 4CFSA 4NENA 3ZN2A 2ECQA 2AJLI 3A3PA 4DDVA 1A96A 1V8BA 1O9HA 1PGJA 4R1SA 3VR6A 2A1IA 4K3VA 3E9EA 1Z8DA 2X0IA 1HT2E 1JZQA 5CYPA 3VC3A 4B79A 4E22A 2YY7A 3ZZ0A 4XSVA 4BEJA 1E2LA 4HH3C 3INGA 1R37A 3RYCB 1OC4A 3KPJA 4IHJB 1P77A 1QKJA 4WY8A 3NP7A 1CIJA 1LVGA 2AQHA 3KAJA 4MAMA 1EP2B 3D8BA 4OU5A 2VH2A 2XUIA 2DFPA 4M0KA 5FBKA 3CEJA 4HNQA 2ZGVA 1RSZA 1B2LA 2GF9A 4K5QA 3RH0A 4MQ5A 4F92B 4GECA 3A0UA 1KMNA 1RJEA 5TRTA 2QBYA 1TM3E 2ISCA 4I19A 1YQGA 3WO0A 3S0JA 1IU9A 3IVMA 3H8WA 1GUYA 2R66A 3ZV7A 3WL7A 4PYQA 5I4CA 1W94A 4UEOA 4ZD6A 2ZW9A 1HE4A 3VTAA 3WL6A 1I7SB 2XEXA 1LXCA 3L4KA 4IF6A 1N2OA 1ZIXA 3IB6A 4R1PA 5EINA 1SEPA 2EXXA 3SOPA 2DTDA 3SHQA 3DZHA 3SZUA 3QSYA 4MPJA 3M3PA 4EKEA 1QHHB 4X8MA 4XGNA 2H11A 1RWWA 1MC1A 1K8YB 1UKVY 4X85A 4XIGS 3SS7X 3PK0A 1Y1KE 2YV2A 4CDNA 3OTOB 1RRMA 1CDOA 3U7QB 4I14A 3VA7A 5DSZA 3WQBA 1E0SA 3EIOA 4O2BB 3H2ZA 4OXXA 4BBZA 1JWAB 1MAHA 4H6VA 4IGAA 3W1WA 3CBGA 2ZE8A 4QU9A 3G13A 2FW8A 4V39A 1DP4A 3RYFB 3HJRA 5DOZA 5IT4A 5D3MA 3O5AA 3VHXB 3OE5A 2N3ZA 3WS7A 4WDRA 4OQ4A 2AW5A 3I34X 2YMPA 3BZWA 3I6YA 1IDN1 1QYCA 4LMBA 3WHLA 3TLCA 5LP6B 1JLRA 2C3OA 3KZMA 4B76A 2ZUUA 3I4LA 2DZDA 1W2HA 1N3BA 3EWNA 2W37A 4GDMA 4QQKA 3UB2A 4BNNA 3HM9A 2ACWA 3W2IA 1R7RA 2ZVJA 1ZOOA 2ZTVA 2F1HA 2QJRA 3CUSA 4QQ8A 1TDJA 2FR1A 4MEJA 3GUHA 4W1SA 5ALUA 2RE8A 1P2FA 1R6XA 3LWDA 3RSHA 1A9PA 3ZXXA 3STWA 2H2FA 3RC2A 4AZ0B 3HDHA 4G5QA 4R2LA 4UDOA 2C9YA 1GAJA 3R20A 2PT5A 4I50F 4QUGA 3SY8A 4HLCA 1BKYA 1QJ4A 4ZVTA 2XKBA 2G5GX 4KWIA 4OQEA 3B52X 4UNIA 1U2GC 1EI9A 1I1OA 3K31A 4DR4B 4YJHA 3TW4A 1NVVR 2H7CA 2JJ1D 3PFNA 4C7VA 1DOZA 2W2VA 3A1CA 3UT6A 4NFHA 4BCBA 4RZUA 1BE8A 2EZ4A 4IQ0A 3QLUC 3M5DA 4AY2A 1SXJA 5E7IA 4KYVA 4ZOLB 4TV8F 3FCSB 1HLDA 4B87A 2JAPA 3OM8A 5AM1A 2I2FA 3IC5A 3UV7A 5TIIA 1O0BA 2IY8A 1ENOA 1T4CB 1QX4A 2I3ZA 3HFSA 3L0IB 2C04A 4PANA 3AESB 4PC6A 4RJLA 2VJBA 3TW8A 3G9XA 2Z83A 2C5SA 1Y1LA 4BFCA 2BONA 1SHLA 3B2QA 4CN8A 1FFHA 3ADKA 3BB4A 1XHEA 4Z99A 4XFDA 3IQGX 3JWEA 5DRTA 3LYAA 3U7HB 3RUIA 3OCXA 2R7MA 5L3ZA 2L0XA 5CDSA 5IDWA 2Q5JA 1FX1A 4IMPA 5I9IA 4WUVA 2PIDA 3RTEA 1VL2A 4E11A 3QU4A 2M6SA 1EFPB 2P2DA 2QN1A 4IDEA 3O4RA 3ESAA 4NTZA 4IS3A 3P0HA 4RK0A 1U8XX 2HWWA 2R9VA 2ZK7A 4XAQA 1CUFA 4K2AA 1WTAA 1WULS 3HA2A 4ZVUA 3KNZA 3RK0A 3PYLA 2NTYC 1U8AA 1L5SA 3L0SA 5J43A 3G0HA 1DRJA 3QXXA 4JJIA 1W30A 4ZDKA 1MNQA 1A8PA 2QTCA 4G8BA 5EPEA 2RBEA 4A82A 5JW6A 5KJ1A 2QLNA 3KQNA 2OAQ1 4TTSA 4GHWA 2E5LB 3GVCA 2H0RA 2UVPA 4UM8B 1AX9A 2PVPA 3TYXA 3ANMA 5CUQA 4EFMA 3JQAA 4HAVA 2Z95A 3ULKA 1BE0A 1U6KA 3K2QA 4KMOA 1MG5A 2OFFA 4QOIA 1DRKA 3BXEA 2RH8A 3MOIA 2F3PA 2XOXA 5K5EA 2ZXEA 4QUAA 2PKQP 3GYBA 3P94A 4RZXA 2HGSA 3F3KA 4B6JA 3H13A 5AUOB 5BWLA 2CXXA 2IYOA 4M8SA 4BPBA 1JW9B 2CXSA 3PV0A 5DLQC 3E9ZA 2OPBA 2QA5A 1PZEA 2IEAA 3A1TA 4KMMA 1E4EB 4QPCA 3B51X 3BE6A 4FT2A 3W1EA 1NW8A 4BECA 4V0KA 1GCUA 4IUBS 3UWMA 1KAHA 1X7ZA 2FN9A 3CKLA 4EDHA 1IN8A 1YMUA 3D6FA 3TE6A 3BXHA 4UTZA 3TLJA 2AK3A 2R65A 2KS6A 1K98A 4RPIA 1M83A 2P1ZA 1LVHA 3JXEA 4Y9RA 3ZHXA 3SX2A 1NWCA 1SK9A 2MT9A 1CP3A 1V41E 1IUKA 4QNMA 1C9YA 1AKUA 2W6IA 4HYQA 4Z9AA 3ZU5A 3L3BA 3O4HA 1HE3A 1U98A 3R5TA 1LQ2A 3N0WA 4PIPA 1CQZA 1JDPA 5DWQA 5BNZA 3BSSA 2WTUA 3I1JA 4QFMA 3I2GA 1J5EB 3A70A 1V35A 3G49A 1FPQA 3I83A 3PL5A 4BVGA 2VKTA 2JLSA 1LBTA 4OIFA 2PZ8A 1R0RE 3PKZA 5ILGA 4F4IA 3DDSA 4KDFA 1TVKB 2D7JA 1BU5A 5CT6A 2UZ0A 3PTZA 5GM2A 5K8LA 2GN2A 1TB4A 3T3HA 4C4ZA 1KQ3A 1MOZA 1BEZA 3QYPA 4W5HA 2OMEA 1KNQA 1NQVA 1NDUA 2O7VA 4WNAA 1QZZA 5G2OA 3CIFA 1LC0A 1OBHA 1V3UA 2ZRAA 4IOKA 4LSZA 3FYSA 1SVNA 4Y6QA 4Y2QA 3U7FB 3E3LA 1VCIA 4WOCA 1OH6A 1M6VB 2EKPA 2RCNA 4Q9AA 3MBOA 3OM9A 3W90A 5A06A 3OICA 4JLMA 4RE5A 4L4ZA 1YA6A 3U49A 4EG0A 1D07A 3ZY2A 2JK0A 1XMOB 2XUFA 4FYJA 2HJHA 3D3EA 2OSBA 2R8BA 2YINC 1RLJA 3GBVA 4LHVA 4ZYZA 1KFCB 4Q3LA 4EY5A 4F2GA 2JLZA 1JDVA 1S89A 1MOPA 2A1UB 4OYRA 1HURA 3CKKA 3Q7QA 3O3CA 4UBNA 1FVXA 3EXG1 1D1QA 1JG7A 1WDMA 3EPPA 2G8LA 3AY3A 3VZQA 4EYGA 5BQFA 1XMXA 4R1NA 2WVGA 3GLGB 3AI1A 1E89A 1XRLA 3FDZB 4G6ZA 1W85A 3EUWA 4JQOA 1E7YA 5KHLB 4I46A 5E95A 2XYRA 5IC5A 4U2KA 1KS2A 3ANYB 5IULC 1R0LA 3OZSA 4HVLA 3PHJA 5ETJA 4Z3DA 3NTQA 4QUHA 4M76B 3HFGA 4LOHA 4INOA 1IULA 1X42A 2R1TB 3PGLA 2OD2A 4ID9A 2P4EA 5G1OA 6REQA 5K8IA 1AS2A 4JLAA 5E4YA 4C6SA 4EECA 5HF6A 2OHHA 3IDOA 2JAQA 3VHXA 3D2AA 4FZJA 4OREX 3MVEA 3ONNA 5IAGA 2A0WA 3AUTA 3FETA 3IALA 2WTXA 3LDHA 1S5PA 5HQ3A 1L4FA 5F51A 1FU7A 4AU1A 3N53A 1N0UA 2IT1A 3L7IA 5CM2Z 1DDOA 1YASA 5DN6A 5E9WA 5IANA 1CJCA 3BPSA 2RH4A 3TTVA 2BHLA 5IAAA 2C5FA 3IQIX 3L7NA 1SUAA 3REFA 2H4ZA 1TAHA 1MO5A 4ARZB 4ZOCA 1T26A 2CV2A 3W5SA 2VOEA 1T9GS 5A4IS 2R44A 2XRMA 3QMVA 4H7IA 5LVAA 5MHTA 1RBZA 2ZB2A 2CFSA 4TRJA 1KE1A 1RJGA 1EIWA 3IP6A 2QZSA 3RC3A 1UK8A 1F4PA 2H9YA 1EG2A 5GTDA 3AU9A 2QMOA 3M5PA 1CCWA 3IIEA 3GHHA 1K3UB 1RLIA 4YXWA 3W5JA 2JW5A 1FMLA 5J2UA 4HTFB 4MWSA 3KKLA 1Z6PA 1KAQA 4PX5A 3R7WB 5JYBA 4EA6A 4ZJZA 1P5JA 1KYZA 3MMXA 3QX3A 4D80A 1G60A 2JA1A 2ZR7A 4V03A 1A88A 2QTBA 4GBGA 5BN3A 3KOXA 4CTKA 3BREA 1BXZA 1PR9A 2VT6A 1FVHA 1HG1A 2HA4A 3QWFA 4C5AA 3HXOA 1NVTA 2G4LA 1GKUB 2IYEA 4IWNA 2FRDC 2OO5A 1SIBE 1SCJA 2QVLA 3UUEA 3TPZA 4L7QA 4WDQA 2MINB 2I03A 5TPWA 3E9QA 3TMKA 4E5NA 4F5DA 3C3YA 1ONPA 4K6GA 1CEEA 1K3TA 3EOZA 2P91A 5T6MA 3ORSA 1IK4A 2IF2A 4ENSA 1HDEA 3DMGA 4TGLA 4GICA 1CC1S 4BJ1A 5A3VA 1YI1A 3NGMA 2GAIA 4QU5A 1XX6A 1YJCA 1J5XA 5BWMA 2X8JA 2ID4A 3LE8A 4TWRA 2PWYA 3AJEA 3R0ZA 7GPBA 5J4HA 2ANBA 3DHWC 4ZQBA 3DOUA 4GI3A 5JLAA 3PHIA 3VAAA 1NBOA 3EXIA 4NYIQ 1N5OX 2C2MA 4PAOA 5F3WB 5CD1A 1U7ZA 2GTIA 4HDSB 4YP7A 3R7NA 3BWCA 2OXEA 3MELA 3O8OA 2PHZA 3QFSA 3BCRA 1Z4IA 1L5OA 2LP4Y 2VDQB 2FFBA 1U2PA 5C1DA 1IZ0A 3E84A 3OE7A 1UT6A 3D8SA 4UZEA 3VTFA 3MBIA 2MU1A 2NV2B 4OO3A 2QMHA 1EE9A 2IZ6A 4M0DA 3Q8LA 2Q29A 1V47A 2W8ZA 1M0SA 3AKDA 1YZTA 3IP7A 1Z37A 3GG2A 3HN7A 4IIGA 4PGGA 4UNNA 2QRLA 4Q7EA 1DEAA 5LYYA 3U3JA 3V1YA 4LFAB 4QBGB 2FWIA 1J9GA 2K5UA 4OBXA 2WINI 4YMHA 1J8QA 1K6EA 2G1KA 4DQVA 2DXIA 1BWSA 1TK3A 5FNVA 4DHEA 3K70D 3PJGA 1MB9A