3KIPA

Crystal structure of type-ii 3-dehydroquinase from c. albicans
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
147
structure length
143
Chain Sequence
LVKKVLLINGPNLNLLGTRYGTTSLSDIEQAAIEQAKLKNNDSEVLVFQSNTEGFIIDRIHEAKRQGVGFVVINAGAYTHTSVGIRDALLGTAIPFIEVHITNVHQREPFRHQSYLSDKAVAVICGLGVYGYTAAIEYALNYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinase, type II
publication title Macromolecular crystal data phased by negative-stained electron-microscopy reconstructions.
pubmed doi rcsb
source organism Candida albicans
molecule tags Lyase
total genus 52
structure length 143
sequence length 147
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2009-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 3kipA00
2BT4A 4CKXA 4KI7A 1H0RA 1GU1A 2C4VA 2Y77A 5WRFA 4KIWA 3N59A 1GQOA 1J2YA 4CIVA 4CL0A 3LWZA 3N8NA 4V0SA 2XB9A 4B6OA 2XDAA 4ZC1A 2CJFA 3N8KA 2C4WA 4L8LA 3N76A 2DHQA 3N87A 2Y76A 4B6PA 4CKZA 4B6QA 3N86A 1V1JA 3N7AA 4RC9A 4CKWA 4KIJA 1H05A 2WKSA 4CIWA 2UYGA 1D0IA 1GU0A 1GTZA 2C57A 4B6RA 3U80A 4CIXA 5B6PA 2XD9A 3KIPA 4KIUA 1H0SA 4CKYA 2Y71A 4CKWB 4B6SA 4RHCA 4CIYA 2XB8A 1UQRA
chains in the Genus database with same CATH superfamily
4IFEA 3STUA 2AC2A 1NMEA 1PGNA 1ZM4A 3H7IA 3PSAA 2IF0A 1H0RA 1I3LA 1SPBS 1U2DA 3B1FA 4J0KA 3VPDA 4AJ9A 1ISGA 2O0JA 5B55A 3IJRA 3AR4A 3N8NA 4IQ8A 3ETJA 2O06A 2RHMA 4DADA 1P9LA 1K2VN 2CEAA 1SBNE 4OP3A 3D1JA 1M2OA 1WJGA 2WDPA 2RHGB 1WHSB 3B1YA 3HWSA 3EUEA 3O03A 1RACA 3UXMA 5ALEA 3E9CA 4FOPA 1OA0A 3QXGA 5JNVA 3J80A 4GU5A 2G6TA 4IIVA 4MK4A 1M34E 4D4KA 2MYNA 3JQFC 4KO2S 5JATA 1F6WA 3IILA 3HBNA 1S8NA 4QPZA 1HYQA 1PGPA 1ZM7A 1SBZA 1YRAA 2Y67A 3AW8A 3HBFA 3NVAA 1W5SA 3JAWB 4OU5A 1ZAYA 4ENRA 3QJGA 3O4GA 1B00A 3GWGA 4J4HA 3BBPA 1DDIA 2GK4A 3DD5A 3KFLA 1XE3A 4OQZA 3HEBA 1T10A 4F3YA 2WKQA 4AULA 5E3HA 3F5FA 5JXHA 2AZXA 4J49A 1MVNA 3DUFA 3VR5D 3WP1B 1BX3A 3QF4B 3NDRA 3TTVA 4BMSA 4XQCA 1P39A 2C1XA 1XTTA 4MVJF 2QVCA 4S1VA 3VJMA 3WRXC 4DUGD 5HKOA 2RKOA 4AZ0A 2Q1XA 5AI9A 3MWJA 1K5HA 3NVMB 1LI5A 2VXOA 2Z30A 2ZVJA 2BGKA 5TPWB 4TTVA 4XB6B 2A5GA 2M6KA 2JCSA 2CCGA 4DR2B 2O8EA 4O6VA 3H3FA 3NT2A 3TLCA 1WDTA 4UOZA 1KIAA 1C8VB 3P9KA 3DCJA 3WYDA 4YBZA 4CGYA 2P4EA 1TEXA 3KTDA 4GM1A 4J90A 5C5EA 3IDZA 5MN6A 5LMUB 1WUIS 4W9NC 4E0BA 4YV7A 3O4RA 1Q16A 2H3HA 4V0LA 3NEJA 2SCUB 3IUQA 4G0QA 2QAJA 4OREX 4R9RA 1HNXB 3SOZA 2J09A 4BWVA 2P5SA 4QVIA 2IK8A 1OPRA 2QM7A 1JEAA 2PT6A 3G5AA 1AS0A 3ZZ1A 3EXIB 2HMSA 2COEA 2AMJA 3U4CA 2VHUA 1T1SA 2BJHA 2VHYA 2X2OA 1YT5A 3BTUA 4S2EA 1Z63A 1YZGA 4CT4B 4WD3A 1H4QA 1W0CA 4EF4A 1I7SB 1SVIA 1P1HA 1GPJA 1M2EA 1C1XB 5K51A 5G0WA 1PNTA 1XTRA 1B6RA 1C80A 4JUAA 4KNYA 1XMVA 2E5WA 2MSLA 1K2WA 5CB4B 4EECA 1T9ZA 2JEYA 2HC9A 1ORTA 2Z83A 3ZI7A 5IZ4A 5HP4A 1JU9A 1LSJA 3UHJA 1A2BA 1U5BB 4O5OA 3RAEC 5JCJA 4BJ3A 4MUKA 1CUEA 3HLYA 4OI2A 4RVHA 3A4IA 3PLAE 3C3KA 3KQTA 3B3FA 5AHKA 3QI7A 2CDNA 3FHTA 2WEKA 1CFZA 5DXFA 3V1TC 1EBBA 2O19A 1B1AA 3P94A 4YJ3B 1AGXA 4NFYA 5F21A 2KMLA 2X6RA 4R05A 4R1NA 1GKYA 3G5MA 3THYA 1QRUA 1ZVJA 1NVXQ 5L3QA 1T5OA 1O3YA 1XDSA 5CLGA 3ZI0A 1PJTA 4D45A 1VBKA 1U5CA 2DHCA 4OQEA 4Q1BA 3N6RA 3FYHA 4QLAA 1DJMA 2WAMA 2NXCA 4J3FA 4M1OA 3GV0A 4NMMA 3ZWOA 3L2OB 2ZTLA 3KR0A 4G8CA 2R6FA 1E99A 3HUDA 1V8ZA 3FUWA 4QEKA 1H8EA 3A26A 1UBHS 2PUEA 2R7AA 1GD1O 4KGVA 4NYIR 3VR1A 1RPZA 5AUPB 3FROA 2H65A 2M6LA 3LTEA 1DQRA 1K6MA 5TIIA 4JI2B 1LGYA 5H1YA 3WKBA 3OZVA 2NO7A 2QLLA 3UM9A 4LHXA 4LY6A 3UB4A 4JP5A 3CR3C 1ZJ6A 5TQJA 2C4TA 3ZDXB 1AMUA 1GILA 3BVPA 3I92A 4QT0A 4UFPA 1LNSA 1PK7A 1Y3DE 4U7GA 2GX6A 4QXMA 1NJFA 3LJKA 5COAA 3A4TA 3UAVA 2K7ZA 2X2PA 2ZE8A 1Y63A 1VYUA 1AA6A 2LDXA 5ILQA 4F3KA 3BN3A 1EFLA 4GXNA 4RY0A 1QRTA 2WFMA 4UAJA 1PU2A 5IH3A 2A9JA 1QAMA 2CN1A 1MTZA 4RCYA 2VH1A 1NXSA 4RMGA 4DTCA 3BCHA 1LS6A 3N2NA 4EUFA 3PGVA 4J1TC 3X43A 2BT4A 2FETA 1CIJA 5ALYA 1J9ZA 3IAEA 1I5EA 1WDKA 1Z4KA 1AXRA 2EQAA 4KTVE 1XZCA 4HNQA 2J9FA 2JK1A 4LTMA 1WXQA 4JKIA 3ZE1B 5I01A 2J0UB 4R2XA 5KYYB 4CXMA 4JBHA 2D7CA 3KKMA 1NY5A 1UBTS 2WSSA 2Q3CA 2AOUA 1ZIXA 5BR1A 4LSGA 3GPIA 4S05A 1X14A 3HU5A 4UNPA 2P4SA 4V1CA 3OLVA 1E1DA 1PR4A 2RAUA 5FPPA 2WSBA 3CUKA 1DEKA 3GA0A 1D2CA 1NW8A 4KIJA 5BQPA 4ZIRB 3G23A 3N2ZB 3NXKA 2R8YA 4WVFA 5G4KA 4E32A 2IH5A 4DVJA 1TCVA 4WBXC 3DWGA 2MINA 3PFGA 4PX5A 7REQB 1JE0A 2JLXA 1GY8A 4X1YA 4BMXA 1WU8A 3G1WA 5BWBA 2H7VA 4HWTA 3N3BC 5J4VA 3ETDA 1QJ4A 1KI6A 1V3TA 2QJWA 4C05A 4B40A 1SHJA 2DERA 4MITA 2XRMA 4CL2A 4E46A 3QMVA 2C5GA 3H2BA 4NDAA 1X1QA 3OURA 3DVQX 3IP9A 2QROA 4AF7A 5ADWA 2WD7A 4LY3A 2BOVA 3FPBA 3NP9A 1V41E 4K05A 4M9SA 2XIJA 1KAGA 1NQ5A 1QC5B 4GOKA 1NP3A 1YI8A 3S2ZA 1QFXA 1CY7A 1P1BA 4H35A 3X2FA 2Y93A 5CA1A 4JUDX 2YUTA 1A8SA 3D7LA 3OA0A 2CZCA 1PF7E 3STHA 2EL7A 1NVWQ 2GVZC 4PS1A 1BO6A 1Z13A 2Q4RA 1UK7A 5FOVA 4DLXA 1ORDA 4TM7A 4DCPA 4S1TA 1MZPA 3RC9A 2GVDC 4LXQA 4BBZA 4R51A 2BDTA 5T4HA 1M72A 1V4BA 1T6BY 1QGYA 3H5AA 3EXEA 3L02A 1JJIA 4LWZA 5EESA 2WG0A 4YJ2B 5GP1A 3WJ1A 2TSYB 5FEMA 1CCWA 1THGA 3UJ6A 5HE9A 4FSXA 1JP7A 5JFTA 2C97A 4I9FA 4J7CA 2QL9A 5IHXA 4K88A 4Q24A 5ELMA 1X80A 2EFJA 3MN1A 1OX5A 3ITEA 3R8XA 3A1UA 3FCCA 2DBZA 1K8QA 2NUTB 1NWHA 3MCTA 3C3YA 3BE5A 1PQWA 3I6QA 3PDIA 3UJ8A 3LPAA 3L6UA 4C4PA 2X8WA 1SGWA 5DBHX 5BY2A 3I0MA 2C04A 3DMFA 4QUEA 3HCFA 5I51A 3HWX1 3VSEA 3O83A 3QITA 2EP7A 4U6QA 2IZ0A 3ZHXA 2J41A 4UVDA 4E3WA 3Q9SA 2GPAA 1SB8A 2D59A 3PCRB 1WD7A 2X1MA 4IINA 3B6KA 3O8OA 3ONVA 1X7YA 3FMOB 3FMIA 1Z4QA 1C5KA 3N59A 2CWWA 2WFLB 4GKAA 1ORRA 3BCUA 4NLLA 1QB8A 4M54A 2QUHA 2QTGA 3KQKA 4U4AA 2J5XA 4E5KA 5GINE 5JJ5A 3PRKE 5AW5A 4C4SA 1SVNA 6AT1A 2R47A 1L9KA 3GO4A 3W3AA 4BP8A 1TKRA 4WLEA 3UAZA 4CIWA 2WTUA 3BH7A 2H51A 4GX1A 5BVHB 2A7QA 5FFNA 1QTNA 1QG0A 4P54A 1IEVA 2IS2A 2EGGA 3BGOS 4RADA 4NBTA 5DB4A 2OQVA 1P9RA 2H48A 1PZFA 4L9AA 1JIKA 4Y2TA 4ENPA 4FNGA 4ND8A 4CIYA 4M9QA 2AMYA 3G02A 1JHPA 4Q3DA 3QPWA 5DV9A 1QGED 4S35A 1NG1A 3CNEA 2C99A 1D4AA 5CX1B 4YCMA 3EMVA 1MG5A 1YR7A 5KSOA 5K5EA 4X62B 4AB1A 3MOSA 1SXPA 4C5CA 4CR8A 2PFKA 3KYDA 4EZIA 2REBA 4IQGA 3Q3IA 3IOYA 2X2EA 3KOWA 1JSLA 5AW9A 1E7QA 1JHOA 4D57A 3WQBA 3O95A 3PR2B 2QJFA 1CS0B 4A6PA 4DEYA 4UE3S 1PKEA 1JLLA 4KSYA 2WJ6A 2ETVA 4QL3A 3JYNA 1YJBA 2CBZA 2Q2OA 5H16A 1E2NA 2HDHA 4JP8A 4IIJF 4EOGA 1I2DA 2EYUA 2WW8A 4HV4A 4KGXA 2A0FA 4C4YA 4C89A 4G0YA 2PBLA 2JVJA 1TKCA 1NQVA 2A9PA 1RLTA 2PJUA 2R3SA 1W4AA 3MC1A 3Q9NA 3BGIA 5ALTA 1NJSA 3BWVA 1KZ4A 5SYNA 1HG0A 4WEQA 4BNNA 5LP6F 4GZ3A 2AKYA 4H3HB 3IBSA 5AW4A 1ID8A 4C29A 1JFFA 1OXSC 1BDHA 5IWAB 1DIAA 5BSRA 4TWBA 4REQA 4IZOA 4WCFA 1DWOA 1P4GA 1S2DA 1F38A 3LC1O 4QEDA 5U4QA 3QUCA 1AGNA 1EK0A 1JS1X 2AN4A 3QM1A 1WEKA 2PAAA 1T9GR 1SC4A 1T1JA 1ZY2A 4JEMA 1QH8B 4MW9A 6PFKA 1CVIA 3K05A 3B9RA 2E21A 5LQMA 2O6LA 2CKDA 5A0VA 3IPLA 3N3AC 3K0SA 2VATA 3U9TA 1OXKB 4QO7A 4DV4B 5AOAA 3W5VA 2WAYA 4FW9A 1VLLA 3O92A 2EWWA 3KQHA 2R8ZA 1G19A 1TQDA 5EKDA 4MS3A 1E1CB 2JAQA 1Z0UA 2JD0A 3RM3A 5JAZA 2ZXUA 3FNRA 1SC3A 3KHTA 3OZBA 4YMUA 3TQTA 3WA6A 4LGVA 3DEIA 1J20A 2Z5GA 1TO6A 3CS3A 3LQKA 3I76A 4NYMR 2WU4A 4RYLA 5DFAA 4CF4A 1UKCA 1ZGGA 1KQGA 3ZH9B 4WOKA 1ZOIA 2PSJA 3EZGA 3USES 4L08A 1X86B 5EJ5A 4G0OA 4MPJA 2IUEA 5FL7D 1GNTA 4HOYA 3UJHA 5C2JB 1KO5A 1U8YA 1YCGA 1I5OA 4O2RA 3C87A 1LWOA 1SQGA 2Q41A 3KBBA 3V1YA 1GTG1 3KB2A 2J1LA 2BP7B 3INTA 3NHPA 4HDNB 3LXUX 2LPMA 4JJ8A 1R8JA 1PL7A 1FA9A 3K16A 3CNQS 1W4BA 1J42A 1RWNA 2BHTA 2PS3A 2WWGA 3AT1A 3KKOA 4X91A 4JVSB 2PZGA 4J9UE 1H6BA 5I5GA 1H5QA 3F1LA 3H86A 3NS7A 5BWLA 2PBZA 1HDOA 5JAUA 1BJKA 1P7VA 4GP9A 2B92A 2ZT5A 4NY1A 1A76A 3T99A 2YMPA 3E7PA 1EDDA 1TKAA 4MB0A 5FA6A 3SGLA 1N1GA 2IEGA 3Q5EA 4QOSA 4EW2A 1RRPA 5D2CA 4CMHA 5AVKA 2IXFA 4DTIA 3DW3X 1YRLA 3EVBA 1R4ZA 2NVUA 3Q3EA 4MW2A 3TJMA 4AJ2A 1OZAA 1XUOA 1FS6A 1UAGA 2Q49A 3QKIA 3P2OA 4WOPA 2CEKA 3A0UA 4X8MA 3B12A 1J6UA 4GH5A 3JAMA 3UC9A 3S99A 2FWIA 2GERA 4KBFA 3RV4A 5JNWA 3U4QA 3OE4A 5KTRA 2VJQA 4B3RB 1YH3A 2DFKB 3DZJA 1YS1X 4YRMA 4OYLA 2EVWX 2GNAA 5KQRA 3CRVA 1XAIA 5KOJB 5LU8A 2ZB3A 3LPNA 2PD6A 1EFCA 3PRYA 1T6XA 3C7DB 2IELA 1AUXA 1DBRA 1NQTA 1Z2EA 2D3TA 3CCCA 3R23A 4LKRA 2R4UA 3WJAA 1OX4A 1D0SA 2PT9A 2ON6A 2VZLA 5A5VA 3H2SA 1USUA 1XTSA 1G9XA 3KEOA 2BFBB 1TZMA 1VZ2A 2GJKA 5FV4A 5F5XA 3EX7C 4DLVA 2HT6A 4UM9B 5GZ1A 1FFEA 4MS1B 5ALNA 5ECDA 4EA9A 2ZTUA 4DMRA 3PVCA 5DMHA 3G1UA 1D2RA 3C3AA 5DX1A 1SUDA 1TYCA 3DM5A 3SSOA 3UB2A 4NP6A 1Z26A 1SQFA 1PZXA 2ASVA 2BMJA 1ZW1A 1NUSA 2G7ZA 3NNSA 4KZPA 5CPBA 3KKPA 3N07A 1EM8B 3N39C 4DCTA 2O20A 3AF2A 4RD1A 5DRYA 3W2GA 1PI3A 5TY0A 1M1YB 3DE7X 4W5WA 5KNBD 3ZE0B 3HI6A 4F21A 1PS9A 4A8JC 5FQNA 3OLYA 3U1TA 4FQ8A 4YQYA 1U2GA 2WD9A 1G291 3HACA 4J7AA 5HSGA 2UKDA 2CXRA 3HTXA 3ZU5A 1B74A 1EBFA 4UUOA 3MWDA 3ZDEA 4W5RA 1XQXA 1ISFA 3OWOA 4QX6A 3WLEA 2OGSA 1XVAA 4IFBA 4CF7A 3CMCO 2ZJ6A 2IBMA 3D02A 3PGKA 4N0DA 2BFCB 1ORHA 2YFQA 3H2JA 2HWXA 2JFVA 3CUSA 1PR6A 3LUJA 5AFSA 1ZK3A 1W9HA 4FFSA 4WWHA 1G8MA 3AHDA 3MXTA 3K73O 4JFRA 4E2YA 3GVIA 1OFHA 4F4JA 4EY4A 1DC5A 1Z5GA 1ID1A 2HQBA 3E3OA 4HWRA 3V46A 3W4KA 2NP7A 3DG9A 2AWNA 4ZVRA 5DHPA 1AK9A 1HYBA 1J24A 1FB5A 1FRZA 1Z0AA 5E3JA 3IBTA 1F5SA 2PPLA 4JITA 4NPCA 3WLFA 3WK9A 4TRRA 3VU8A 2ANCA 5DM2A 1XZJA 5JVDF 4BVFA 3GLFB 2OBFA 3GMTA 1QOZA 3AJAA 1FJ2A 4NCXA 3KAPA 3RU7A 3T5CA 1SZPA 3U0BA 5K05A 1FJHA 3H84A 4GXQA 4MRAA 3TL2A 2ISCA 3UUFA 4ACBA 1T34A 4DGQA 4LTNA 1GN8A 1AOXA 1DAGA 4M99A 5EYPB 4FX5A 3R3JA 4G4SP 5EXSA 2E82A 4HQLA 3Q7QA 5GJCA 1LV7A 3KU1A 1HYGA 2QZSA 4KQFA 1L7RA 3L46A 5AI6A 1NJ1A 1N6IA 3C6BA 1XNQB 3AV3A 2D5LA 3EG9A 3OZUA 2EBFX 2PX4A 2Q3MA 3BKWA 4HDKA 1Y8CA 2QT9A 1EA5A 2C5BA 1NF3A 2X5NA 1ABEA 3O6VA 3GFBA 4RLFA 2UYCA 3R9WA 3TW0A 3MTBA 2NSDA 3QXJA 1QKJA 3HVIA 2Z5LA 2HBZA 2C4NA 2Z4SA 1GNLA 3X1YA 3JWHA 5IASA 2D5CA 4K2HA 3QV1A 4OXRA 3ROQA 1Q84A 3NM6B 1C3OB 4U2FA 3U80A 1NXXA 2ZUTA 2FSPA 4OJMX 2JLQA 3EJWA 1TT5A 4FMPA 4HB2A 4QXRA 4OHVA 4D4HA 5ELLA 2X14A 2B3DA 3RK1A 4DMUB 3A9CA 1HNWB 5ECWA 2HN9A 1CIPA 1WVGA 2VN8A 4L3VA 1ZUHA 4NE9A 1T0BA 4BEWA 4ARIA 3U4HA 2CHGA 4OHBA 2FZEA 4HQ0A 2C58A 3B1KA 3IRVA 3SYLA 4YCDA 4YLEA 3NBMA 5C8ZA 1N4DA 3F6BX 4QAQA 4NMLA 1U3WA 1CQIB 4V02A 3ZWNA 2QLBA 3Q2OA 2E1PA 1HK7A 5GJBA 1J8DA 5K6TA 4OGLA 1G8HA 2Y0EA 5LFAA 2LNDA 3CSDA 3DEFA 4Z5XA 1R00A 1LBTA 3D3KA 1W87A 1OMOA 2WIJA 1MX3A 1DJNA 2G77B 3O1IC 4TL9A 3EZYA 3O84A 4KTTE 4R8RA 4CFSA 4XQEA 3S7TA 3LT0A 1I4LD 5FNVA 2APJA 5GM2A 4FB5A 3P97A 1F60A 2FHSA 4M0LA 4QQKA 2E48A 3LX6A 3M82A 4BXOB 4OHMA 1ZWKA 4U2GA 1VG1A 1WCV1 2CWDA 4FEEA 5K3FA 4D0LB 2IKQA 3THWB 3TEJA 4S1WA 3ERCA 3UIEA 4J0JA 2ZYDA 4IDQA 3PD7A 3R2JA 4CLEA 3FNFA 2C4HA 1C3LA 3ZWPA 1U80A 3PCXA 1URPA 1MN6A 3FNBA 2Q5LA 2QN3A 3O74A 3MJRA 3P96A 4HQFA 3Q40A 4QZVA 2R7NA 3TRJA 2KQUA 3LNCA 3GG9A 3WRYA 1I30A 4MCIA 1V8PA 3W9YA 3BC1A 3K96A 3B5IA 4GIBA 3I2JA 4V39A 1JEQB 1GARA 4JBGA 2W0SA 4TLAA 4N47A 5ITWA 5JR3A 3BDAA 4EJSB 1E9SA 4FSHA 4LOAA 2YC2C 1Z2OX 3OE5A 1KJQA 1JZTA 2WK1A 5K0BA 2ZUSA 3FM9A 4HEQA 4JC8A 4DCGA 2NU9A 4F7DA 4Z3KA 5I7EA 2IGTA 3FKSA 3NTVA 4D5EA 2XBUA 2A88A 1W48A 3IMFA 2DEUA 1ZK2A 2O6HA 2LKCA 3K9QO 1SCUB 3LHSA 3WZLA 4Y67A 1G21B 1XWWA 2P9GA 3KYCA 1YB5A 2LWIA 4F5EA 3T06B 1QZ3A 4GPBA 2EP5A 4V0ME 2VZ8A 2DC1A 1B73A 1FMJA 1XKLA 3DULA 2QG4A 4MWCA 3O38A 3GJ4A 4TV8A 3AHGA 2ZSKA 4GOOD 4WX2B 1GPKA 3TGLA 3SFZA 1JH9A 5B5SA 4XTRA 2J6IA 3S2FA 3MJ4A 4RA6A 4X7MA 5JZOA 4PIMA 5C4MA 4FYHA 2GBLA 4NQZA 2RDMA 3ZWXA 3K0AB 5GM1A 1FNNA 3PNYA 4ZZ3A 3CF0A 4MDHA 5H4GA 1D2GA 2FUCA 3LHKA 1XDGA 3L01A 4LOIA 3RYHB 3W5JA 1YS6A 1NG9A 3HKDB 3AVYA 3N2GB 4P83A 4QYXA 3AIMA 4PNPA 4P0PB 2PX5A 3WYEA 1I6KA 2VXBA 1QQTA 1P61B 3TVYA 3V97A 4YMLA 2Z6AA 1L5SA 4DZRA 1YDMA 4PR0A 1UBNA 2ES4A 1JJBA 4QATA 2JAOA 4OGFA 4TXNA 1USKA 3NFYA 2AZDA 4FS8A 4E6EA 3CH4B 5IM4F 3PKZA 4MYCA 4X20A 4KDEA 2C9ZA 4KR2A 4CI9A 1GQ2A 4MLCA 2GCGA 1QU2A 2Q6TA 2F3TA 3GWZA 2QRLA 2QGNA 1V1MA 3TKYA 3V3KA 2HFKA 3QMPA 3S5UA 1YFZA 2XVZA 3K72B 2FN8A 3ICQB 3AYXB 4NC9A 1L4GA 1U7PA 1TUBA 2CHUA 1ULTA 2I2FA 4RZIA 1UZLA 2ZJFA 3G2JA 1Z16A 1Q3KA 2AL7A 3KZ1E 4YN3A 3M6MD 1JPVA 1U98A 4YWJA 1X3SA 2BH9A 2XAAA 4QREA 2C2YA 2Q1TA 3M6VA 4V38A 3SQOA 2IUSA 1VLVA 1M6NA 3ZCPA 3GZJA 3FTEA 2M1XA 5CFZA 1C9EA 3MGCA 5IDQA 4X24A 2NZVG 3EVGA 3JQGB 2IP1A 1JEYB 2P6MA 3BERA 2IF2A 2RCYA 3DVRX 3KWJA 4RV4A 5DGIA 4D3FA 3HFGA 5K3OA 2PL1A 1AQYA 1DB3A 1GZ5A 2GILA 1K6XA 1OGYA 2R60A 5CLLA 2JHCA 4M0MA 3R7FA 2P1RA 3ESAA 4XOIA 1L5VA 1U9YA 2XUKA 3P4UA 3AYZB 1ZN9A 4A0GA 5LZ5A 4I1IA 4YDRA 2F48A 1YCDA 3DNMA 2ZE7A 4C9BA 1NT4A 4FJ2A 2ZUEA 2Q21A 5LP6B 4R81A 1ODKA 2BMVA 2I2DA 2FJUA 3TCNA 2CMKA 1BQ3A 3WYFA 2XH8A 1TEHA 3CBGA 1R6AA 1NVGA 3FWPA 2WM3A 3KQSA 3L8MA 3ZCUA 2V3VA 5ALVA 3ZNOA 4XWKA 5TMBA 3NNDA 1N7HA 4H7DA 3UAOA 3FSEA 3THOA 3NDJA 1CHDA 5BWCA 1EZ4A 4H27A 3GFFA 1ZMBA 4F84A 2OV2A 1AGYA 1QH1B 2CC2A 4HO1X 2WFZA 2H6EA 1NDUA 5EEGA 1KS2A 3EN0A 3N28A 4MUEA 4B3GA 3PGJA 1ZLXA 2YJ4A 1KVRA 4AJOA 3F6EX 1JB9A 3ZV4A 2DH5A 2OAQ1 1G59A 2L18A 4AQ7A 4UHKA 1YBMA 2Z08A 3DKRA 2L17A 1W0JD 2ZR8A 3BFJA 1Z5UA 3DFMA 4TTQA 3SQNA 3I5YA 3U39A 3BD6A 3VXKA 1APBA 1SCAA 3LUCA 2PWZA 5F7XA 2G8NA 5DNUA 2YN0A 4QFCA 4RSGA 2VDQB 1Q1NA 4HAIA 5KDLA 8ABPA 1EX1A 4TMTA 3RYFB 3WY9A 2A5YB 4EG7A 2XQKA 1G4AE 3BJRA 1PG5A 1VA5A 5JYDA 5LDDC 4G4GA 4I55B 3PL5A 4O3FA 4UMDA 5J9FA 3AEXA 1JIVA 2J45A 4QKQA 3V2GA 4EK9A 1X7ZA 2G70A 2IIQA 4HMPA 1DAOA 2GZAA 1XROA 4MJ7A 4W99A 4LDRA 4A0RA 2ZGVA 3C4JA 4Y2RA 4ZJPA 3AZOA 1M8GA 3KSRA 2C78A 2ZRMA 3N1UA 5ADVA 3LZDA 1QBKC 1W0JA 4KXYA 2EFCB 4ESHA 3PNQA 3NUQA 1BCSB 3L7MA 3QLJA 1IZ8A 4XX0B 3UZUA 2ZBEA 3F6YA 3PFCA 3QLVC 4IHJA 3VSCA 4RAQA 4FHZA 1TW3A 5EIBC 4EG1A 1T3SA 3DA8A 1W88A 1JGTA 1T5DX 3I0NA 4UE2A 1UBMS 2O3RA 1SXJB 4KFRA 5FJIA 3WWPA 4UAUA 4ERNA 4O2AB 4FP9A 1SHZA 2GEBA 1J06A 1AKWA 2QD4A 4FWIB 3LBHA 3GJ5A 4WPGA 3OM0A 2Z1MA 2AF3C 4BQRA 1QSGA 4E1BA 4JU9A 4II2A 1JLRA 1CJBA 3ON5A 3DJFA 3QEBZ 3HR8A 5DZSA 3AUYA 5K20A 4FBMA 4BP3A 3L6EA 4KN8A 5TJ9A 4B5KA 4MPDA 2I03A 4HUQA 4RS4A 3GLSA 2YZNA 3VZQA 2R44A 3GLUA 5B1YA 2ISQA 5HK9A 4DV7B 4GKKB 1XRQA 4FSDA 4O08A 4YAEA 3M6UA 4YJFB 5F5LA 4TZKA 3A4NA 4DSNA 1ADGA 3LQRA 3EOAI 4CLXA 2WLTA 2OM6A 5LXTA 1RE0A 2TMDA 4YUVA 4CQLA 5KYUA 1MGPA 1ZRSA 4OBXA 1W5AA 3FW1A 2NV6A 4UW9A 2QK4A 3AKYA 4HAUA 5CXUA 4PG6A 4E7PA 1WMFA 2CHFA 2V7PA 3ROTA 1F0NA 1KARA 4NDNE 3A9RA 4CUKA 4OY3A 2HW8A 1I7PA 1WUYA 4E7OA 2JIDA 3PQDA 3FF4A 3WL6A 3NAQA 2ZU0C 4AQDA 1PQPA 3U7RA 1WHSA 4NWIA 2D5IA 1IG3A 3KOXA 3GEEA 2OD2A 4WACA 2BF4A 4MKZA 4QGSA 3C7KA 3SJAA 1MOSA 1PZGA 2DTDA 4E15A 3LCCA 4L02A 3C0KA 4PGMA 3E61A 4H7HA 2ZIEA 2RG1A 5CH3A 3KQMA 3E9YA 4WZAA 1T8TA 1IOWA 2DUJA 1K3UB 2A4KA 2GSWA 2O5RA 2PO7A 4GOJA 4BV9A 4UQPA 5ADHA 4EX7A 5CTJA 2FWNA 2PHZA 3IVRA 3ORYA 3U9SA 3ZY5A 4HTFA 1GPYA 2Z3VA 3GLIB 2HLHA 1DC6A 3ZQJA 1Q0HA 4KN9S 2EOAA 3OKCA 4YP7A 4AKSA 4JL8A 4G5QA 1SA0B 3EARA 3TAXA 2FZWA 3E03A 4AZTA 2IYWA 4LV8B 4KN6A 2EEPA 2W8BB 5EIAA 2FZ5A 1GXSB 2C4WA 4XWAA 2IPXA 2EQBA 1NL3A 5JJLA 1KPIA 3OWHA 2GZHA 2D5BA 3H0CA 4KSBA 3TVDA 2AG1A 4L15A 3MAGA 2C7OA 3RHSA 2BJVA 1C7EA 1LI4A 1V1JA 2X4GA 1B6GA 4I5FA 3A4VA 5HF8A 4ZV7A 2CB9A 2OD7A 2OVFA 5FAKA 3EG5A 1JHRA 1M8FA 4IKEA 2XZDA 4JLSA 1TYEB 2OCXA 5CD1A 2I4LA 1OC2A 2FEKA 2OBYA 3PENA 2CUTA 3H17A 4RY9A 4YMVA 1NV9A 4YUXA 2ZULA 3RQSA 5A5FA 2L42A 2ECOA 3S2GA 1D2NA 2I1QA 2DUMA 4FYVA 4G24A 5K09A 3E7DA 2XB2A 1VG9B 3EXIA 2RI6A 2OMKA 3UMCA 4JVMA 4MYDA 1H42A 1VL0A 2C82A 1WW8A 3E1GA 3IP1A 1X9HA 3N2YA 3PHJA 3Q6IA 3QPDA 1HH4A 2B4YA 2LDBA 4GECA 5KU7A 3HXPA 2IC5A 4YDQA 4PF1A 4R1MA 4UDYX 3MG9A 1HTWA 1B26A 3DLTA 4Q05A 1I1NA 3D59A 3TCXB 4CFYA 3VPGA 1DQNA 1VHTA 2FWBA 5JAPA 4F0JA 2AUNA 3BWEA 1ETHA 4FZJA 3F73A 1YULA 3VDXA 2AWOA 2ETXA 3V00A 3QOXA 4BCBA 2ZUDA 3UJBA 4E5MA 5L3VA 5I9BA 2REQA 3UGJA 1E9VA 1NVFA 4O63O 3HDTA 3ZHOA 1ULSA 2ZITA 3OZFA 3D43A 5ICSA 4F71A 1U5BA 1GPUA 2BM9A 2HV8A 1MABB 1RIFA 1R12A 1TJ4A 1W30A 3AUAA 3HCBA 4GPD1 4YXFA 2CFIA 4RU1A 5BN3A 4J07A 1XPRA 5AK5A 4UTNA 5D6OA 3WLIA 3MT7A 2UYHA 2NT4A 2YFYA 5CH8A 4Q19A 2O7VA 2H7YA 1WCIA 4LX0A 1XR3A 1YQUA 5KYWA 1LCIA 3MJVA 3T1NA 3DEKA 4QD3A 1QO0A 2FPGA 3P19A 1OU4A 2C9CA 1YV9A 5H83A 4BMDA 2O8CA 3C8HA 4FK8A 1XZKA 3C5WP 3UAGA 3STVA 5L8VA 3VJRA 3K5WA 1VHLA 4RABA 4AO6A 4H77A 3BMOB 4BO0A 3LVQE 3JTEA 4V0RA 5JCOA 4QEZA 4ZYXA 1O0SA 4MQ6A 2KSQA 2FJPA 4TVSA 1VE5A 3A3KA 2XJ9A 3ZQ4A 2J9XB 4QWMA 2EFYA 3PPYA 5ENZA 3SBEA 3OQVA 4RF3A 5AI5A 4AZ3A 1G8PA 1OH8A 3WB9A 3HDHA 5F12A 4MGYR 3Q8MA 1L0BA 1OFUX 5LA6A 2CVFA 3WHKA 1IB0A 5CK5A 3IKTA 3PPVA 2ZYAA 2HBRA 2ZJZA 3MT0A 3OZRA 2W4MA 1ST3A 3CLSD 2ZAGA 1DEOA 4N01A 4CF6A 1TKBA 1AVTA 1TLLA 3KIPA 5K6AC 1X8KA 1M8JA 3TN7A 4JELA 3HUFA 2JNWA 2JJ1D 1T3GA 2P78A 3RNLA 4BO4A 5IEJA 1W49A 3B7WA 2J08A 1ZITA 1GL6A 1WXGA 2AG8A 3MMNA 1RI4A 3HA2A 2GN9A 2BELA 3D8BA 4FOLA 2Q6LA 2HPVA 2CFRA 2HRQA 1P5JA 4MP8A 4NCNA 2FRDA 3UJPA 4UM7A 5B12A 2PE5A 1JT9A 1ZOSA 3QKSA 4G1CA 1K68A 3IQZA 3KR9A 4K87A 3NDIA 2ZM6B 2D8MA 4LK3A 1Z33A 4OKNA 4EJMA 2G9RA 2J4FA 2MJLA 3WLQA 4NJMB 4HZUB 3KT6A 4LXYA 3KHSA 3R4VA 2CVQA 5BQ3A 1H05A 1RQ2A 3NOQA 3VO1A 2EKPA 4FGKA 4KHPB 1FNSA 3D8NA 3DKVA 4YIHA 5FLEX 3L8YA 1C30B 1Y8AA 2WIDA 5IDYA 3ZVMA 2HUPA 4DNPA 2JJ1A 4JLKA 2MR5A 5DM0A 2RGCA 4R0VA 4H9GA 4NZOA 4PGHA 5IJAA 5JQGB 4G01B 3HPQA 4G1VA 4NIMA 1CNFA 3FI0A 3R7WB 5CIYA 1EVEA 1XZPA 2EFHB 1KETA 2I8LA 2KS6A 2EV9A 4ZCMA 4YCLA 1RT9A 4KFUA 4JAVC 1ZRMA 2ZRAA 1XK7A 5T4BA 4B09A 5AUOB 2HEIA 5H68A 2WM9B 2GI4A 3STXA 2FPMA 2FQXA 4RD3A 2VI5A 5E1DA 1RTTA 3MJSA 1T8WA 3QFTA 1NW7A 3S2EA 2JIQA 4NBWA 3QEMA 1VJ5A 3KHKA 4HEJA 4BPBA 1A1SA 1UMBA 1GFZA 3I2HA 3JY6A 1Y3HA 4ZI7A 1SZDA 1T4GA 3UT5A 1DTEA 1Z47A 2BZ1A 3P2EA 3OIUA 4BVLA 2DCUA 3GFGA 1KWKA 1YTLA 5K0JA 3I4CA 2NP6A 2J5BA 5LBIA 3RTCA 3AF0A 5KWVA 2V6BA 3A58B 5FFFA 1LX6A 4YFVA 2OFOA 5BWOA 4LXHA 2CXHA 1IHPA 4QOGA 4YCNA 5CBPB 1BHJA 1K4YA 2PMEA 4TZ6A 2AT1A 5EZYA 1S96A 4LVOA 2G36A 1E60A 1DTWB 1PR3A 3IBCA 3JRWA 2VXYA 5EGSA 2BY4A 4M88A 1NXQA 5L7YA 2M32A 1J00A 2AOWA 1Q20A 3ND6A 1E6WA 5CVJA 3VR6D 3AM5A 1IU9A 1Z07A 4OHPA 2IV7A 2EEZA 1F2TA 1A5BB 4ZQIA 3RBAA 2BZ0A 3W5CA 3FD8A 1L7BA 4D26A 1F06A 2WJ4A 3FNGA 2O3JA 3F6CA 3SAJA 3WWOA 1UKAA 1SOMA 1BMFD 2FMKA 1QBGA 2Z5FA 2X0IA 4MWBA 4LDJA 4YEDA 3N5KA 3T0FA 4J91A 5JBQA 1PV2A 1QAOA 2XI4A 3ZU3A 4B6SA 4PHGA 3ZLBA 1DWUA 3BWMA 3K0HA 1F9AA 4ZOBA 3TAHA 2WV9A 2XA2A 2QQ5A 3ZDCA 1H94A 3W78A 5LOVA 1HLPA 2A57A 1QIKA 5C1OA 4RKWA 5FI5A 4OAOA 3VR6A 1MNAA 2PJZA 2ZYIA 3LQFA 4FB4A 2I4OA 1AQJA 1LX7A 3G6WA 2C8VA 2H1RA 1N2CA 1ZINA 2VUHB 3BHIA 3ETNA 4YALA 3W6PA 2YYYA 3PXUA 3L9XA 4JC4A 2J3DA 3EPHA 1Z56C 5K0EA 2C9BA 2YV4A 2RGUA 2V98A 3OPYA 3QYPA 1XCPA 4LBWA 1UFVA 3M4NA 3PSHA 4G1UC 4LE2A 3JYOA 3AZPA 5C52B 1PE0A 1TU4A 1H2XA 2PZMA 1AKRA 1V2GA 4Q3LA 1NVVR 2BI8A 1B3RA 4MV4A 5EQFA 3H5RA 3GC6A 1CUVA 1NMSA 1J90A 1PL0A 1E8DA 1MMFB 1N3BA 3EZ2A 2PMKA 4HC4A 1E2DA 3SXJA 1QH9A 2AJ8A 2UUPA 4J4BA 4TT8A 5HUQA 1JTFA 4J8PA 5AT1A 2ZETA 4JI0B 1JR3D 2WJGA 4XQ0A 5CXSA 4DCNA 3LO5A 3E5HA 4L0DA 4RX1A 1U9ZA 1ZMRA 2OLKA 4DQDA 4JUIA 2WWWA 1VJ1A 3MILA 5EE1A 1XPJA 4DIBA 3GH3A 5EQDA 3PQ5A 1L1FA 3K0FB 2PRJA 4BVBA 5L7TA 3OZWA 4BZQA 2JEZA 1JIXA 2V7GA 4D0RA 1EFPA 1HYEA 3MEQA 4PAOA 5CYOA 1V71A 4F5YA 5IF3A 1IEWA 4Y6QA 4C1NA 4WOCA 2IL1A 4DKXA 1V35A 4NONA 4UBMA 3U7JA 2FK7A 3KUKA 4ER7A 3NHFA 3G88A 2KB0A 5M34A 1V4VA 3Q10A 1G6Q1 5CX1A 2ZUVA 1HE8B 1QANA 2YXLA 5FPKA 3UOAB 5JOQA 5HCUA 4PZ0A 4AW9A 4XUGB 5ICMA 2HEGA 4XPIA 4MMYB 3NAGA 2JATA 4PLYA 3V42A 5KIAA 3O82A 4FM9A 2LCFA 3NPMA 1XZGA 3CZQA 2B3TA 2Q6OA 1E9EA 3GY0A 5D1NA 3TNFA 2BDUA 1CS0A 2X6TA 4AWBA 3TFOA 2NW6A 1T9AA 2CLDX 3LDAA 4R68A 3JATB 1QOPB 2O3UA 1MO6A 2I54A 1BD3A 3KSUA 4JI6B 2WT9A 4O4IA 3A27A 1KMIY 2YZ7A 4HWGA 2PIAA 3EIEA 1D07A 3LV8A 1B8NA 3GLHA 3KUCA 1KVQA 3RBXA 1T29A 2Q0XA 1FRNA 4R2HA 1P4RA 4OHXA 2GJSA 4R2KA 3IUSA 5IJ0B 2DPGA 4KZKA 2YBEA 3MCWA 4NZNA 3VKUA 5K3BA 1CZOA 3STWA 1MIOB 5H4HA 3W7VA 3FOFC 3PGLA 1E3EA 2HU8A 4UE6A 4RTOA 4JLJA 1ESCA 4MA5A 3RUEA 1Y37A 13PKA 4TMYA 1TQ2A 2YX1A 4WA8A 1OFVA 3MBOA 5AVRA 1M34B 4FHEA 4RS3A 3T5MA 4E30A 2A5FA 1ZFNA 2N1BA 2IW3A 4CEHA 1YMVA 4BV8A 2DSNA 2ZEJA 4I2NA 4PX3A 2EX1A 3VRHA 4L22A 1I3MA 2NVWA 1MTOA 3GJ7A 4EF5A 3ND5A 5LL6P 1KIFA 2HXYA 1U4SA 3G8BA 1HZJA 4UAVA 1BOOA 3DLCA 4BQQA 3DHEA 2A9FA 3KJEA 4JR2A 3RIEA 4CN9A 3ZZ0A 1TU3A 2R8BA 2QN9A 3QVLA 3RU3A 1XZHA 3GPBA 1E2HA 3GZNA 4XRGA 5P8WA 2RGNC 3REQA 2VNSA 4IFTA 1Y4DE 1AS3A 3G85A 1M1NB 1QNFA 2FOIA 4U6NA 2W6IA 2XB9A 1HKUA 3AR3A 3QQ5A 1PSDA 4PINA 2HNAA 1DCKA 2GEJA 1XU7A 3R3WA 1GZ6A 1E7SA 4JNCA 4L2IB 4MVJD 4PQGA 5EPEA 1RI1A 2R8EA 3E8MA 4CLHA 5I7FA 4QWWA 2FMHA 4RPCA 5JYCA 2XZOA 1KGSA 2FG5A 3TMKA 4PZEA 4IJWA 4II3A 1KHTA 2XUOA 2B34A 1SBIA 2H1HA 1ZEJA 2PUHA 3QG1A 1T25A 4I19A 2BMAA 2WC1A 2FQQA 3FWHA 2VBFA 1JQ3A 2AYZA 1Y5MA 4LNUA 4JT9A 1E5QA 1ZP6A 4IZHA 4DM4A 4EIWA 2QUZA 2W83A 1TIKA 1TVCA 1WV1A 2G07A 1M1ZA 2WIKA 2VHVA 2Y1DA 4P6VF 2OTCA 1KNXA 3ABSB 5M5BA 1TVKB 2OV4A 3A6KA 1I4DD 3ITKA 5D8DA 4YR9A 5EP3A 5BURA 3DQQA 2G4LA 3DXYA 4UM9D 4GC9A 4IWYA 5FO0A 4MVJA 1DCFA 1YFJA 3SS7X 1NLZA 1UEIA 3IP6A 1SH7A 3QX7A 1UDAA 3Q5DA 4WW0A 3C5CA 3TQRA 2P1ZA 2ROQA 4EG5A 3U56A 4JDUA 1EGHA 2B4AA 4LWQA 4MHSA 5H81A 3KC2A 3Q0EA 4NYJQ 2QRGA 4I4TF 5LC1A 5AK3A 4EUEA 2ZVPX 4YAWA 1M5UA 3JQ7A 1OXTA 5CVDA 2XNDA 1CZKA 3VR3A 3OHSX 1SEPA 4MPTA 3QF7A 3QEAZ 4TZTA 3CURA 4HRVA 4S0ZA 5DEIA 3OIVA 3EC2A 3TTWA 1SC1A 2E87A 1L9XA 2QN2A 2JASA 1YZYA 1H2BA 4LI3X 2EKDA 1W93A 5AO9A 4XYMA 1XMXA 3ZGXA 1RM4A 3I09A 4KODA 1RQLA 4UNSA 5K8LA 1J8QA 3BS4A 1DBPA 4YV0A 3A1CA 5EP2A 3JU3A 3KTFA 4JLVA 4ZO6A 4IDDA 4ZI5A 3L0BA 5EKXA 1Z7BA 5A5EA 1AS2A 4BOYA 1EM8A 3IELA 4ER5A 1M2KA 4YMHA 2ATIA 3BL8A 3PEEA 2D06A 5GWXA 4YJHB 1DUSA 1XFAA 2XVMA 4EEKA 1E8MA 2EKLA 2QTHA 4BUCA 1PVOA 1P80A 5ALZA 1JA1A 5JPIA 5DDIP 2OKCA 1VLHA 5I9MA 1BYUA 2H31A 4UMEA 4IDGA 4C4AA 3KETA 3EH1A 2PVSA 2AYXA 4IW3B 4H7PA 3B1ZA 1EE1A 3MUFA 1C7QA 1KTIA 1ULUA 3OKAA 5BORA 1CE8B 2QU7A 3PXBA 5T57A 3R8CA 4OQLA 3B85A 2P11A 4FT2A 4QUBA 3I58A 5C7OO 3GDGA 3WWCA 3JWPA 2J7PA 2RB5A 3AJ8A 3F2VA 2BHNA 1ZGBA 3LLSA 1ZW6A 2NLOA 4MNTA 4CF3A 5HZGA 1F2VA 2I33A 1GZVA 1DAPA 1E2IA 2GN2A 2YYZA 2G63A 3FHJA 4V0MA 4GNKA 4QRHA 4EWLA 4UUMA 3OFND 3CW9A 3TAUA 4C30A 3CLTC 3GNLA 3KQQA 2OXCA 1BWSA 4D98A 1DI0A 1CZRA 2HMWA 2QZ4A 2XMZA 5EXXA 1USWA 1IVSA 4M7PA 2ZPTX 3M89A 4ITVA 5BSEA 1OLXB 1UOQA 2BFEB 4Q34A 3THSA 3ZOKA 1S8FA 2FSFA 5FUVA 4UTRA 1WF6A 2QN1A 4CM9A 1ULHA 3NOOA 3FWNA 2P9ZA 1V8FA 2YZMA 4X94A 1RFGE 2ZDGA 1GPBA 3EGIA 3IDSA 3HJGA 1N2SA 4RVNA 4B7AA 4D80A 3V1UA 2WUDA 1XSEA 4LNAA 2Q45A 1D2HA 2FSIA 4HX2A 5FR1A 3I6YA 4X00A 2IVFA 3PUWA 5E9WA 3AVTA 3WV4A 1L8XA 2AH5A 1OFUA 2RGEA 1I6MA 3KE8A 3K1AA 1CJCA 4UHBA 4BAGA 2QUAA 3M9XA 1JPJA 3VOAA 5F9FA 3HZOA 1BQEA 1TYAE 4G0NA 1TO1E 3JVVA 2GSDA 4PYQA 4MQEA 4PGFA 3JD3A 1R6TA 1OAOA 4PYLA 2B5OA 2ZJYA 3MOGA 5DCLA 2VAWA 4GP6A 1OXVA 1ZCAA 4MB6A 4TXJA 4CDRA 4L85A 1MRSA 3O4JA 3EDYA 2X0EA 1XA4A 2EQ5A 2PK3A 4AYTA 2R6AA 3GFPA 1BEUB 2P2SA 3WHPA 3R7BA 4GT1A 1J22A 3DDWA 1V11A 3X1MA 1A9XB 5GGYA 2XR1A 1D6JA 3BJEA 1JR4A 3H9UA 2BYTA 1YZNA 1BHSA 1ZJJA 3H8JA 4LHVA 2ONZA 3R9XB 3TXAA 4P9NA 1UIRA 2QM8A 2WQ7A 1M5RA 3PEYA 1XALA 1E3WB 1HEIA 1GAWA 2R6CA 3E9DA 4FGUA 4A8JB 1G60A 1RKVA 4JYCA 5FWAA 3ANXA 1W36C 4Q01A 1MB0A 2JFZA 4EITA 3QKWA 2WA2A 3VZPA 4ZDIA 1S3SA 3ZS9A 4JI8B 4FCWA 2JI8A 4EMTA 4G25A 4PZDA 2XRYA 2H08A 3INYA 2Y1XA 4X63A 4DWWA 9ABPA 2ORVA 2XWPA 1ILWA 4MGKR 2JLAA 3BSWA 3C48A 5JFOA 4TSRA 4I8DA 2E4WA 4JQSA 1JWAB 4RKEA 1O94A 4YAFA 3B3AA 5KINB 3V7FA 1DL5A 1E2BA 4R9SA 4PNZA 3MELA 3R0VA 4ARVA 5A04A 1U8EA 4HNVA 2PTHA 3EXFB 4FCTA 4BFCA 2OG1A 2V9CA 4ZZ0A 4Y98A 3EEFA 3WAJA 5JDCC 1UXHA 2UVPA 3E7WA 5T4EA 1IRXA 1UXJA 4FDTA 5BQOA 4ACAA 2IPAB 3M3DA 4O4JA 1L4LA 4W5HA 3ZIAD 1U3DA 4R4JA 5LWQA 1G5IA 1TM1E 3EA4A 1FDIA 1IK4A 4MUMA 1A82A 3LBYA 3QVMA 5BVGB 2VRNA 3VKHA 1SOAA 1GWNA 1PSZA 3HY4A 3DPUA 5CG1A 4K03A 1VHDA 2J4CA 1PS0A 4QHTA 1K6JA 1X2EA 4B4KA 4TSFA 3FY4A 5LBUA 4DEVA 5AW3A 3L4KA 1JBKA 1MDFA 1AB6A 2ORYA 1D7AA 2DWCA 1YVDA 4IUDS 1QHYA 4BYGA 4DT1A 1E3SA 1T4CB 1HDZA 3DQPA 2WUVA 3E27A 2I62A 1J5EB 2QZZA 5JC1A 2DBVO 1EXMA 2WF7A 4TMFA 1Q11A 1E77A 3CSSA 1AN0A 3GIDA 2QW1A 3FGPA 1XPOA 1W4CA 4G85A 2VJNA 4QXQA 3OIFA 2MOKA 3C8DA 4XARA 4AROA 1UP7A 1LXCA 4MJLA 4B3FX 1H5UA 4LVUA 1IXSB 1N6PA 3CNNA 3H9JA 1A8UA 2CMDA 3OKPA 1L1QA 5EJ8A 5IJZA 3PGA1 4GKBA 3KYIB 3A4YA 4FFNA 3TG8A 3PNLA 3QJ5A 2AVNA 3TKLA 1WRBA 1IN4A 2Y2VA 3HKEA 3W2EA 1P2VA 4KE6A 4PZAA 1L5YA 3TLYA 3K09C 4PC3A 4UU8A 5HILA 3RG2A 1TZJA 3A1VA 4CT5A 1FSZA 1P2FA 1YJCA 2GN1A 5J4YA 2X1HA 1Y6FA 2FDRA 3HKDA 4YTEA 1TI7A 1BDIA 1YK0A 1R0YA 4CKYA 3B70A 1FX0B 1SO8A 1W6UA 1XEFA 2EARA 2PRKA 1GZDA 2XUJA 3FA2A 3L05A 3LC2O 1OWLA 4BU1A 4D0NA 5MN4A 1VP3A 1CUCA 5DK4A 2IX3A 4ZAXA 4TUYF 5CT9A 4Y6OA 1RQ7A 2DQZA 4BO1A 3HYNA 4UBNA 4Z9BA 1ZH4A 3RPEA 4RGBA 4IYRA 3BKXA 3EEQA 4MW0A 4BLTA 1ES9A 4C43A 1C1DA 4HGQA 1R6UA 3AXSA 1SOUA 3T52A 5T8KA 1K0FA 1R5OA 4OL9A 1SN7A 4NPHA 1RWBA 3DAHA 3KZVA 5JWRA 4QBFA 1KH2A 1TAHA 1NF9A 3DLBA 2PLAA 4L4ZA 4G5XA 4J0DA 2EERA 4OAPA 3HZZA 4RIFA 5C7YA 2QLMA 1HZZA 1L4BA 1XXHE 2PRIA 2JEOA 2P2DA 4Y9TA 4GWKA 1IOZA 3W2HA 2HXSA 2XB6A 4L73A 2VQ3A 3KXDA 4TVKA 4DRYA 1DO2A 4BQOA 2PJRA 2MTBA 1S3GA 1JA0A 1QRDA 1YQXA 2C5AA 2GZSA 1NW3A 3P9NA 4MR8B 5DHRA 3L93A 2B1QA 3RIGA 2V6JA 4KVAA 5JY6A 4WMLA 2VT3A 5KZMB 5ITVA 4S3MA 1VJTA 3W9UA 5AUNB 1YIAA 2I4TA 2NNLD 2JDID 4YO7A 3X1JA 4FKBA 1IDOA 1WP9A 5TS2A 2IYQA 2NYRA 2BEUA 2JLRA 4MUNA 4DQKA 3ID6C 2YINC 5LYJB 4EEZA 3U3OA 5LKAA 2AXQA 5A7FA 1IHOA 3M9WA 5A3SA 4R40A 2NXEA 2BFDA 3DB2A 3DHWC 4PW0A 2XKKA 4IIJA 4IICA 2IW1A 2IZ6A 4FR2A 1TTPB 1G6HA 1A95A 3RYTC 3TW6A 1XYYA 4Q6BA 2P8JA 1AY0A 3E8SA 4XGQA 5CT6A 3ZXIA 1U65A 2FN3A 1H1LA 3ICCA 3KPJA 4GLOA 1R3DA 5DJ5A 2EIHA 4MV9A 3VX4A 3I53A 2XPCA 4FYPA 1Z7WA 4B3JA 5LP6A 2Z8XA 2WWRA 2HU5A 1NFFA 3I39X 1VKZA 5K8CA 4RULA 4ME6A 2C5HA 3SE0A 3D8TA 2PEZA 1IJFA 2P2CA 3UW1A 5KNCH 1KRXA 4BTVA 1U31A 2JDIA 4F91B 2CNNA 2DY0A 4M1TA 4CNQA 2P7HA 1DAHA 3E9ZA 4UHJA 5J23A 5B3JA 1VKJA 4B82A 4OU4A 4HZGA 2BFAA 2HH9A 4E5PA 4C0HA 4ISCA 2QTAA 4MW7A 1LB1B 2AF4C 1JDUA 3HFSA 4DR7B 3H2GA 4PLFA 2VK8A 1HNZB 4K86A 1QFSA 1NUHA 1AZWA 1Q50A 2YXDA 1ZCJA 1FMLA 1Z75A 1ZC3A 2CXNA 2G8LA 2F59A 2GPBA 1U2QA 2MSDB 1D8AA 2QGZA 1Q6ZA 3DZBA 3IUBA 4U2KA 2CNDA 3AVQA 1RJEA 4GDMA 2ONJA 3WHLA 4C3OB 3BRQA 1EUDB 2OBXA 2QHXA 2OHVA 2VUIB 3CLVA 4BX9A 5BOSA 1KJZA 1TU0A 1S2NA 3SICE 3TQIA 4W7HA 5EVJA 1SXJD 1L5KA 1B76A 1S9DA 1XVLA 2ZAYA 1G2OA 3OCUA 1IC6A 4ASUA 3U5ZB 3C8ZA 3OZDA 3SHTA 4ZFNA 3B8EA 3TIVA 4JWTA 4PO9A 3W5HA 9LDTA 5HBGA 1PJZA 1UQUA 4BO9A 3CKLA 3ZUGA 3NIWA 4KGDA 1KH3A 2EJVA 3NU1A 1SK9A 1U7WA 2BLLA 2GLXA 4H59A 2GRAA 4Z2YA 5TVKA 4DWOA 4DYHA 2NTNA 2IODA 2CBGA 3U44B 1UCFA 5IN4A 3B5JA 1IBKB 1ONOA 3CLUD 4QNMA 3I04A 4IVRA 2OXFA 1DBIA 1Y98A 3E70C 2Q3EA 4E5YA 1YNSA 2CVPA 1L8OA 3GCXA 3V8NA 4BFYA 4H6XA 2OMEA 3I73A 4H6WA 5IH7A 4ZV4A 2I6TA 4NK4A 3WB0A 3ZY4A 2BEKA 2WSIA 3K0KA 2P2YA 1EPUA 1HO3A 4B44A 2XD9A 1I0LA 4KCGA 1MAUA 1PL6A 3IURA 5KNDD 1E1MA 4PO1A 3AEKB 2XQGA 3E81A 3VPAA 2QRNA 4YASA 1VL1A 2W2TA 4PXSA 1XAJA 3A36A 4UZEA 1Z6PA 3WBKA 1PT8A 3NKLA 4GMXA 1QV6A 1PQYA 1T8YA 2FWPA 1NR1A 4E2WA 2H8KA 3E2IA 4RF5A 3V9PA 1GQSA 1LK7A 5E1BA 3OQBA 3HCNA 3CE6A 4U5XA 3RU2A 5CXXA 5AJVB 3EVNA 2ZRIA 4TXLA 3CINA 4UUNA 3ZGLA 3R0XA 1DCMA 3ZTWA 3BB3A 3L41A 5BW5A 3ABRB 3DBIA 3BMNB 1TUEA 4Y9RA 5EXDA 2OV1A 1PEDA 4JN6B 1P6QA 4CMKA 4HH1A 4P5EA 1KMQA 3LLMA 1BVUA 2P9YA 1HDEA 1NURA 2JANA 3PZRA 4B7ZA 4C2TA 4JBNA 3GMSA 3KLPX 2O54A 1F51E 1FYWA 5KNDA 3CVYA 1IZYA 1UT8A 3OIDA 4GGOA 4IRMA 4IMRA 4GYYA 4PVDA 3RAPR 4H4EA 5AOVA 1DT5A 1DJOA 1G3MA 4CLRA 3OLQA 4N3CA 5UKDA 1W4LA 3K6KA 4AG3A 1H2ZA 4XVCA 3WK4A 2IS6A 1SKYB 4FYIA 2QNBA 1IZ0A 3DVSX 1PT9A 4ER0A 1USVA 3LUHA 1P2UA 2XWSA 4H1TA 4EB8A 2IYXA 2ZS9A 3CLHA 3IP8A 4OM7A 1KU0A 2P5UA 3HU1A 5BN4A 4PN3A 2E3JA 3PEFA 3U49A 3LPMA 4RQBA 4ID9A 5IKPA 4MX8A 1U9JA 2P9QA 2F55A 4ALLA 3DFUA 3CNLA 3DBVO 5TT0A 2ZWPA 3IIMA 2IH2A 5F77A 4AP5A 3BJMA 5AK0A 1V4NA 1YZFA 1FZQA 3G9ZA 3ZHZA 1B3BA 1RPNA 2I67A 3DFIA 3OG9A 2IEAA 5LQJA 1U0RA 5TE9A 4AWXA 2ZKLA 2IZ7A 1ZD1A 1IWPB 4KEAA 2A0WA 4CM8B 1VOTA 1PAUA 3FZGA 1SA0A 3VR5H 3E9MA 3DD1A 3K15A 1BWPA 1ISRA 1CX9B 1PR9A 2DWUA 4KQXA 4NH4A 4URWR 5KTSA 4DQLA 3UJNA 3CEPB 2XIQA 3JD0A 2E2WA 2AEEA 1YKGA 3P0IA 4WL0A 1USIA 4S1NA 2BGWA 5G41A 1Y5IA 3ZBPA 4AXBA 1UZNA 3N8KA 4K6FA 4M46A 1N0UA 3DL2A 2YY7A 3QI2A 1QK5A 2O4CA 2XMQA 3DGFC 3N87A 5JVDA 2OHJA 2IYAA 4G97A 4YJGB 3N86A 4RC9A 3TTUA 2A33A 1G4HA 2XCIA 3CY6A 4CTNA 1OH6A 4IS2A 2NGRA 1Y3IA 1ZI9A 3LKDA 3LM8A 4WLVA 3T61A 4DPKA 4EYOA 4LFAB 3VHXB 4V24A 1JSCA 1VJ0A 4K9NA 4U7JA 5JU6A 1Z5VA 1OLUB 1YVRA 4R84A 4CM4A 4OA8A 1T9HA 1ST2A 4DREA 1VA4A 1ECLA 1TVMA 1CYDA 3I6IA 4FE7A 3C74A 4JHXA 4KGZA 4BB6A 3W0LB 1YSCA 4IDEA 4PIPA 2R87A 2PUJA 5D7BA 5L7WA 1U6JA 4IR7A 2XKJE 1JNXX 2VT6A 2ZTSA 2WM2A 5CHEA 6ABPA 1YRYE 2IHBA 3BD7A 5B1SA 3IOBA 2JRLA 4XEUA 2EJUA 5CIQA 4ERXA 3GLIE 3DUWA 3DBRB 4P80A 3U62A 5A9SA 4BTLA 3B82A 1WABA 3DYVA 3ZK8A 2C2OA 1TTTA 1C7RA 3V4VB 3RS9A 5AVYA 1E5LA 4I6GA 5K8VA 1JYFA 4B4VA 4RSMA 3F96A 1AZTA 3ESQA 4MR7B 5D1HA 5F9MA 3QVXA 3NHLA 4WTOA 3TCKA 1GTL1 3W9SA 2B98A 4BAZA 2YC4C 3FOAA 4GPAA 1E1NA 3PP8A 5J5CA 2HRDA 4FI3C 4K3UA 2P4UA 3H6KA 4RK1A 3UOGA 3KJNA 1F5NA 4C0QC 4A73A 4OJNA 2RH9B 4GRAA 4OYHA 4E09A 2H4YA 2ZT6A 1E2UA 1MABA 5I7SA 1I7LA 3L8ZA 4I3HA 4EFKA 5IT9A 1OJLA 4IVNA 4PLZA 1Y0BA 1HR0B 2UZ0A 3EEIA 1V47A 1XRJA 3N58A 2DHQA 3IV6A 1W5FA 4WEOA 2IUUA 1OSNA 4QOFA 4EUKA 1VLZA 1RADA 3OF3A 1C9KA 4IJ5A 5K3EA 4BFUA 2GOYA 1Q83A 3MGAA 4IILA 3T1YB 1G20E 7MDHA 1FTYA 3I6MA 3HO1A 3WLJA 1FDSA 2W43A 1LFAA 4DWVA 3LL7A 3QELA 2A1UA 4KBYA 3G13A 1S8OA 2PJDA 3AHFA 3D4PA 1V48A 3QIVA 1BTOA 2XUAA 3FVTA 4AMZA 4ZAGA 5DM70 1P6XA 1KK2A 3FDFA 5KAPA 5EFOA 1U9IC 3L6CA 2O0KA 4PC7A 4AY5A 4XIIA 1II8B 2WZQA 2DKNA 4V0SA 1GL3A 4IRUB 3E84A 1HGXA 3TL6A 5KSYA 4Z3OA 1SVWA 3UBTA 1MQ9A 4GOND 4QOEA 5D00A 2ZTVA 2ZYGA 3DV2A 1QB7A 4DARA 2HPAA 3ZY2A 1YBHA 3H5TA 3TR5A 4FFRA 3UGTA 3DMRA 4F6RA 1CRPA 1EESA 4U7WA 1D4OA 1Y81A 1SXGA 4AI6A 1VC2A 5CB6A 3GAMA 1P74A 1YS9A 1P81A 3MWYW 1WXDA 4W82A 4W9NA 1Y7LA 3NHYA 2ZIGA 2VEOA 2YFKA 4J6FA 5E0KB 4BVAA 2BTOA 3I42A 8LDHA 2MMCA 1U63A 2O8FA 1ZNQO 1N2BA 1YB2A 3UYKA 5JAQA 3H5WA 2MIIA 3R3XA 1KSFX 4TOIA 2HLPA 2V6FA 2Z95A 1GA1A 1DEHA 1O96A 1UANA 1S4MA 4C6HA 2QQFA 3IBFA 3ILYA 4GUDA 3JQEA 1C7FA 3PNBA 3EQZA 2D0DA 4NENB 2OWEA 3TE6A 4XD7D 4LF6B 2EW1A 1MFZA 1MDBA 1P8AA 4NVRA 1T4BA 2VHJA 5DWVA 3UKJA 3GRKA 2VYCA 4O1IA 2HQOA 1O2DA 3SXUA 5I4CA 4R1SA 4DV2B 4PTYA 1JF8A 3JALB 4O4LA 2XF2A 2ZANA 2TMKA 3VOBA 1IUNA 4CKEB 5KTKA 4WXMA 3ZX5A 3ZXSA 1P1RA 4ZARA 2QZJA 3K2QA 4XGIA 5EMJA 4B46A 1JWLA 2YWXA 1IY9A 3JS5A 3LP8A 4KR6A 1V95A 1UOOA 1MB2A 2I1VB 2OKGA 2H0RA 3OTIA 4OQYA 4XVRA 4DDUA 1GKLA 1LSUA 4Y18A 3RFCA 4TUYB 1HE5A 2G04A 2IOFK 3MCZA 4WNCA 1R6BX 1M6HA 3BIXA 2WWVD 2LUOA 4JJGA 5IM4A 3DQZA 5IAJA 1ZESA 1B8PA 3A37A 1EJ2A 1GPNA 4J2TA 2BGNA 2GN8A 2V4ZA 4MQFB 4RIGA 4TROA 4MGEA 4WXRA 3NBYC 3CO5A 1T0IA 3DMTC 8GPBA 1WM1A 3VUFA 4UNQA 1SUAA 2P0EA 3LBIA 1VJDA 4JB8A 5L9AA 1R8SA 2N46A 3A11A 1QE5A 4S1OA 1ZRHA 1RZRD 1RNLA 1IQRA 2YJNA 5CEFA 4GVXA 3OOHA 3PNSA 4OLHA 4BX0A 2QE7A 5KWEA 5JS7A 3D6NB 1KZ7B 2HHAA 4AUNA 1E79D 4ZOLF 3WLKX 2GFQA 3CZCA 1P0QA 4MQBA 3AHIA 3PX2A 1WUJS 5BNFA 1DG1G 1BFKA 4GSYA 2IWHA 3VR2A 1KWGA 3EDRA 5D3ZA 1Z7GA 2OV8A 3LWNA 3M5CA 2N47A 3DZ8A 5L45A 1RJGA 5DGTA 4B85A 2KWIA 3ZCTA 1R6DA 1ZJYA 5CB0A 5BN1A 4AKEA 2CVHA 1Y3FE 4IUBS 4M9ZA 1H0SA 2KI5A 4E14A 2AOTB 2OFPA 2UYOA 3AB3A 2O23A 1JG3A 1M76A 3F8SA 1WUKS 3RC2A 4IOKA 3NH9A 4JJAA 4X1OA 1KR2A 1BSVA 3L4BA 4Y2YA 4YT8A 3ILXA 4YX9A 3W3AH 1WB4A 3ESDA 3PU6A 4JGIA 1HOTA 2Z9BA 1PNQA 2FW9A 1D5WA 5C46F 5I7RA 5JNSA 1O8BA 3D6MA 3ZU2A 2PL5A 1M75A 3DBHB 4IMIB 4Z7OB 1XQ6A 2ECPA 1ODCA 1OZFA 1QFZA 2HGZA 3M0EA 4MV8A 5HKLA 5DX8A 3U40A 2VWGA 5IG2A 3KYJB 4OL0A 2WHPA 4LHZA 3TIIA 1CG6A 3TRIA 1T0PA 4BFTA 4DYVA 1A7KA 2BR4A 3QWAA 2GXQA 5E9QA 3TB4A 4BV2A 3ZLJA 4P3PA 1DAIA 4QPNA 4YRIA 5F52A 3BK1A 5EMMA 1YQDA 1XDWA 2QA5A 3FH0A 3PC6A 3TR0A 1NXWA 1VBNA 2W98A 3MWLA 4COOA 4ZDKA 2GZRA 4G86A 1MXFA 4NMXB 1JZSA 5BQXA 1Z74A 4V3BA 3IEIA 3PWZA 1MHPA 1T24A 3NM5A 4A2PA 3WO1A 2ZYVX 3H87A 3F49S 2DZDA 1FUIA 4ZDWA 5KVCA 3LGXA 3W9BA 2O2HA 2PO5A 1GQFA 3D6TB 1UM9B 4I14A 3T3EA 2B35A 2ERYA 4X95A 4XWWA 1DXYA 2I7DA 3H3JA 1XZBA 2JLWA 3I9OA 2JI4A 3DDCA 1N9GB 4RV9A 3AJDA 1E1KA 2YKGA 5JJKA 4HF7A 2FFJA 2PKYX 3DZKA 3GHHA 4X84A 2B4KA 4ALKA 1QHNA 5FBKA 3NC0C 5IUKC 3H4IA 2V7BA 5JTTA 4N41A 2E4UA 2AI1A 3HEMA 4W8GA 4Y1RA 5EE3A 3AINA 4HSGA 1SZCA 4DJFC 2QEQA 4G1FA 1L5HA 2XOKA 3IKJA 4UQOA 3TUIC 4DMLA 2PPVA 3RF6A 4D5GA 4CDGA 2DUUA 2BUAA 3P4YA 4AX8A 5DLYA 4NXMB 1CC1S 4FE4A 4K0RA 3CVXA 3GEPA 1EVYA 4X3PA 1YOBA 4UTZA 4D0SA 5IJ0A 1SBTA 3MGKA 4NEQA 2FEMA 4XCVA 1GAJA 5DOVA 4F9FA 1RBQA 1TEZA 1PGJA 2PLRA 4HX5A 2ZR0A 4LJLA 2VF7A 3QPBA 4B47A 3OTOB 5ALQA 4XZ3A 2FI1A 4R31A 1F2DA 3ANYB 5JI2E 2X15A 1FTSA 3OCZA 1L4FA 3PQCA 3R6TA 1KMHB 4MUXA 4C7JA 4DDWA 3MINB 1ZNZA 5LZ4A 2DPHA 1N5JA 4WE3A 4J7XA 2GM5A 3WS7A 4EDHA 2FN7A 4UAGA 1H1DA 3FZEA 2HHCA 1A96A 3GPLA 1RAFA 1LBEA 3C7CB 1VXRA 3PJDA 1N8TA 5AKKA 5JDIA 1G8YA 1IBSA 1N5MA 1R5NA 1FSFA 2DQKA 3N0XA 5DGCA 3L5KA 4ZQGA 4KWHA 3OUTA 3K2IA 3R7SA 4UU7A 1L4EA 4IQ0A 1ECGA 1KYXA 5AM4A 5HMMA 4QTXA 4E2FA 4AM8A 1N36B 2AV6A 4NE7A 1DAKA 2IZOA 4PSKA 4UM8B 3T7AA 4B2YA 3L92A 4DOMA 2WUWE 4EM6A 2D0OB 1WZCA 3GJ0A 2O7NA 2AX3A 2MDTA 3WZ2A 3KDAA 2J6CA 5K2MA 1EXDA 1N33B 1QCYA 1QO9A 4L2IA 2I76A 2G09A 3N7TA 4LYYA 4V0QA 3WSVA 3VA7A 3GXBA 5HBRA 3VPFA 3H2HA 2W6JA 5AHRA 3ZXUB 3AGQA 2VQDA 4NG4A 4A5SA 4WFJA 3S7ZA 3G2KA 4XKJA 5B37A 1N6HA 2Y1OA 1Z12A 5AESA 1VSVA 4XD2A 3T35A 4QU8A 5IAOA 2ATXA 1M2HA 2AS0A 2O2DA 3ZPXA 5JPCA 1XCBA 1CQZA 3ZI4A 1ECFA 4MUIA 1E7RA 2A5JA 1L5ZA 4L5CA 4N40A 4Y6LA 4C7KA 2PLFA 3V2IA 3GNQA 4KO4S 2XTMA 1AIPA 4N0EA 3ZGVA 5FOTA 3KKEA 2OAEA 4G5GA 4D9FA 2RC5A 1TVKA 5EPOA 1P2BA 1A9OA 3H2ZA 2BTEA 2W2LA 2GPNA 2A9RA 4JZKA 2ZE5A 1MJGA 1Y8RA 2ONKA 3KV1A 2G5CA 4OXYA 2FUKA 3LK7A 5J3JA 1R10A 2XECA 1RJ9A 1DX9A 2X5OA 3RW9A 5I7WA 1O9HA 5FLYA 3DTTA 1YUNA 2EWMA 3KLOA 3ASUA 3NDPA 4LX8A 4W1PA 1EP3B 2I7VA 3EPJA 3KVVA 1X8XA 4F5DA 3FOEC 3S29A 1RYBA 1BS9A 4JUFA 4D81A 2WJAA 4LCBA 4ALJA 4AC9A 4RETA 1GTSA 1E2LA 3HO6A 2V3WA 1U0JA 1DHTA 3LKVA 1Y5RA 3MLEA 1JQLB 2GMWA 2X9GA 2G9NA 3GGGA 3PD1A 3ZIUA 4BQEA 4OXIA 2H11A 1MJ5A 1RLJA 5B4TA 4FMCF 3C3MA 3PEWA 1IOVA 3L1IA 1FU8A 1A2KC 1MX9A 1OBHA 1VHQA 3CX4A 4XDGA 3S1AB 4CUJA 5HRCA 4M1WA 1R64A 4CEIB 2CNKA 4LXIA 5B2EA 1JI0A 1M1XB 2VF4X 4OFBA 5LZ2A 1VMDA 1HYHA 1NUPA 4U1RA 1W1UA 3VU9A 3AO0B 3JR7A 1RC8A 4CHGA 1J5XA 2JVIA 4J6EA 3NBXX 3NWBA 1YTUA 2AEFA 4TL7A 1V7ZA 4RZ3A 3GJRA 3ND7A 4AQYB 1JQ5A 1SXIA 1N3LA 2JAXA 1DVRA 1QP7A 3DOJA 1DPGA 1PDWA 2Y1EA 3LUDA 4QTZA 4YJHA 3DAGA 3MLBA 5AVUA 3B38A 2BMWA 4ZYYA 5KNBH 1L5GB 1FFAA 2JAHA 4DMGA 1HG1A 2IFTA 1P7PA 3UENA 4Q9KA 3UV3A 1GZ4A 1ECPA 4BNDA 3V4LA 2P2ZA 1T8PA 2GVNA 3DDUA 5L3RA 3TQFA 4EGQA 4DLLA 1E58A 4TT3D 3TJZA 1JEEA 1XBTA 4RZ2A 3UPUA 3OZIA 2Y2UA 1M8KA 3CB4A 3OTHA 2F8MA 2HJGA 3AETB 1LWNA 1FY2A 1CYEA 5KI6A 2B99A 1KMNA 3HJBA 5BNWA 4R69A 3RABA 2HA0A 2AJBA 1NLYA 4O3MA 1SNYA 3R3UA 4X71A 3A32A 1W5TA 1FDTA 1SULA 2SKEA 4UARA 4XWGA 3VKVA 4IL5A 4MIKA 3UK2A 5JQWA 4PM4A 2GZ1A 5CRIA 4G09A 4FILA 3R20A 3GXOA 4CR7A 4EELA 1GU1A 1WU7A 1YO6A 3T3MB 3CWZA 4DIEA 5CG2A 2JBAB 2ZROA 3I32A 4IGIA 1O0CA 3CX7A 1TZBA 1RM5A 1XLTA 4EW3A 4D3XA 3W8RA 3QRWA 1HC7A 5H8WA 2WHXA 2YTZA 5FBZA 1X42A 1Z6AA 3B5EA 3TNJA 2X7JA 1VIVA 2RGBA 4MZXA 1FQWA 1NVMB 4RD6A 2VKTA 4GPZA 4DDTA 2FPPB 4KJZA 2VJMB 4TWRA 5KTOA 1IJEA 2DHRA 4LIPD 4RD0A 1HA3A 1OB5A 3V1MA 3MTAA 1RW4A 3P2YA 4PYRA 1DHRA 3FDZA 3OSUA 1LKZA 2J46A 3O4IA 3C8MA 4MB2A 5E9AA 5CLJA 3GG2A 5JMPA 2OHGA 3I9JA 4OTZA 1UFKA 1MF7A 2PV0A 1VL6A 3INRA 3KO8A 1L4YA 2RGYA 2V74B 1Z38A 1RKBA 4RA9A 3PFWO 1KGDA 3AMVA 1KXZA 1RSZA 4ZEVA 4DUPA 4DL9A 3BE6A 4Z0TA 2OBNA 1UDRA 1KJNA 1PJ3A 1K08A 3L07A 4Q37A 3OM8A 3PGMA 1I1QB 1I94B 2IT1A 4MV1A 2I9PA 4MYHA 2GESA 2JJ8A 3QW2A 1GGVA 4C6TA 1LEHA 3BMQB 3L0OA 4FHCA 1VSTA 3BFPA 3W6ZA 1GDTA 4LKOA 2FR8C 1II0A 1XHLA 4RM2A 3R3SA 1WDLA 2GBIA 2Z98A 1NRJB 4OGKA 3PXGA 3T7TA 4B75A 3PJFA 3K9NA 1QS0A 3R0JA 4I0WB 2FMUA 5D3KA 4LGYA 3HM9A 3G2MA 3ECAA 3GQBA 1QUFA 3BBLA 4FDAA 5DNWA 2I8AA 3ANNA 4RK5A 5IBQA 3WRVA 3LAWA 5LNK6 1EVJA 1NYRA 4BKQA 1C3VA 1NDQA 2XMCA 1XAGA 4UZFA 3JASB 4QDOA 1YZLA 1JFLA 2WJPA 4BO3A 3H18A 1FQKA 3P9QA 2AE1A 2CD9A 1XCMA 1QGUB 2Q1UA 2FEAA 3DLAA 4EAAA 3LT1A 4F97A 2C59A 4I1YA 4L4RA 5DCWA 4RTMA 2BMDA 2GCIA 1ICEA 2W6CX 3BRWD 3HZHA 3NBUA 1LC3A 2I1LA 5HJ5A 2W37A 1STOA 4JQYA 3T5TA 2ZKIA 3ANMA 1XELA 3KB8A 1X7WA 4OK5A 3ZLUA 1F48A 2XMPA 1ZHOA 4RPJA 3PC2A 4RL6A 3O90A 4GX2A 4P7BA 1JDPA 1YQQA 3LPDA 1FDRA 3K9WA 5CNMA 3SHVA 4E08A 2PT5A 1VIDA 3DFFA 4IF6A 5FPTA 1VB5A 3HCRA 4WKNA 3TDKA 1DMRA 2B20A 2CLEB 1Y9DA 4ZOLB 4F1KA 1UC9A 4F11A 3GW8A 1FFSA 1V3UA 4E6PA 5ALMA 3D8SA 4HJRA 4KQIA 1OJ7A 1PYDA 5HM8A 4AN4A 5HVNA 1L7AA 3VR4D 5CDFE 4Z4HA 4G0VA 3BRWA 5AHOA 3SZOA 1Z22A 3RFXA 4JLPA 1U99A 2ECKA 2YV1A 3JQ8B 4QVKA 3UMRA 4EF6A 4ES6A 3DNPA 2W58A 3PKJA 2WU0A 4AIIA 1YMUA 2JFXA 3G7SA 3H9EO 1V3VA 3W2TA 3IVMA 2GJAA 3P9CA 4YROA 1XL1A 2H2GA 4V0KA 1UPXA 4NBVA 4ATNA 1WV0A 5FLKA 4GBED 4C3VA 2CJYA 3BRCA 3ONEA 5KYVA 3HXLA 1JIQA 3F9RA 3NT4A 4TLLB 1W85A 3U4DA 4DCOA 2X41A 2WSLA 1M6EX 2EP8A 2Q6KA 3ORQA 1PJLA 3IQXA 1ZO8A 1SQSA 4XQGA 5B6IA 3DAYA 4KYTA 4Q9LA 2VQ6A 1FX0A 1HBJA 1SEVA 2V9PA 3AC0A 3E1KA 2UXDB 1OXBB 3W1WA 2IY8A 2CLHB 2J59A 1UAYA 1SU4A 4PHCA 3TJRA 5CEEA 4A15A 5I9TA 3GB9A 2F43B 2VR1A 3JZIA 2G0AA 2VDVE 3BA1A 4PPNA 5DTMA 2FTKE 1D9XA 4RXUA 3VNRA 3VC7A 1OI3A 1PJCA 1XRPA 1BMQA 1W36B 2B8EA 3F7NA 1QZUA 2B9EA 2YYSA 3EQ6A 4K9SA 3I30X 3N2IA 4X60A 2NO1A 4N5MA 4OYRA 4DANA 4F8JA 1B16A 3L7YA 4D9NA 5HTOA 3DAOA 2QTLA 3KOZA 2AUMA 1BE8A 2AA3A 4O2LA 1VCIA 4R9VA 4MICA 1E7YA 4ROSA 2QNIA 4MROA 3UXYA 2JIZA 2RONA 1OWMA 3CWCA 2VWQA 1QJCA 4R8KA 3WKAA 1NA5A 3V1NA 3GP5A 4B6JA 3WL8A 3AF3A 2L69A 4HDRB 3TQQA 5BSHA 3TVTA 5F23A 1U94A 5JWOA 2CSXA 1QV9A 3PRJA 4M38A 3BSSA 3D3JA 4KKXB 2NU8A 3ZWDA 3E5MA 5F7ZA 3QVWA 5LJLA 3JQBA 3IQFA 4K9KA 4QHYA 1XEWY 3IC5A 1HDXA 3IKVA 1BE1A 1FMFA 2R1TB 3AHHA 4A6DA 4MGZR 4A0QA 4DNQA 5K7SA 4DV0B 3IE1A 4CLOA 4L9SA 5IDWA 4AMBA 1K9VF 2E9SA 3KB6A 3EDOA 5JNTA 1FPQA 3CN7A 3Q7TA 4LJYA 2QRVA 1WBBA 1HQCA 3EDMA 3RUHA 3IV9A 3T3IA 3EFEA 1I2BA 1NATA 4MPPA 4ND4A 2IDMA 2Q4DA 2FV8A 2GAAA 3CX6A 4MEAA 5G2OA 5C0OE 4WJZA 1OC4A 4QBKA 3M1IA 1PFYA 1XZNA 3LBNA 2WWYA 4GLLA 1NOJA 3SBDA 1QDEA 5K3SA 4G89A 2VA9A 5AKLA 3MWGA 4QDUA 4NS4A 2QL7A 3ME5A 4MUHA 4LWPA 2I78A 3ORFA 3OPYI 5F1YA 3LY5A 2W2KA 1Q17A 1COWD 2XKAA 3SQDA 2WWXA 2AE2A 2HADA 2JJYA 2BDEA 5DULA 3EVAA 4MQ4A 1R0SA 2F2TA 2QR5A 4MJ3A 1OGIA 2ID9A 2OFWA 4BZZA 3C8UA 1U8FO 2DLDA 1FFXA 4URZR 1BW9B 1CUXA 3PV0A 3V8MA 2DPMA 1TTHA 3B13B 4DZTA 1EB8A 2V6MA 3JTMA 4PYOA 2OPHA 4URFA 1GFSA 2AI2A 2AN3A 1Q92A 1Q15A 1VPVA 3Q6MA 3OF5A 2DLCX 5D5QA 3UN1A 5FWXA 2ZLBA 4V2IA 4ZOAA 3EC1A 2RGRA 1KAOA 1VI6A 3JR3A 1KFBB 5KC9A 1E92A 2NTVA 3AR7A 1A0OA 2AK2A 3GQVA 1YOVB 4D4GA 1AF7A 2ZRHA 2VQSA 3Q3CA 4D3DA 2XQFA 1U0NA 2WTMA 4XYLA 3HXQA 1J2YA 2UYQA 3DZGA 1DBVO 2Y3IA 1B0UA 3OJCA 1F7VA 1QQBA 3VHLB 3IVGA 2IHNA 4M53A 4DYDA 3E35A 3UC5A 3GT0A 3H4VA 3UK1A 2A30A 4KQMA 3DO5A 2QTNA 3GDFA 3EZXA 4X9XA 2ZCJA 4WZBE 3WGVA 1R4AA 3FR8A 5E6UB 5IM5A 4A3SA 3A25A 1Z8HA 3S2SA 3C3EA 2TMGA 1G5PA 2Z09A 4E94A 5LNK1 3M1AA 4HAVA 5FTKA 2Q5QA 5C9ZA 5C8XA 2Z1NA 5ITZA 4O2BF 3TECE 3GLIA 2PUFA 4NE2A 3QVKA 1ZJZA 3U44A 3NJRA 4TLBA 2XYHA 5J5VA 2ZCVA 3JPYA 1UPFA 2QVYX 3H2YA 2C94A 2IXBA 2R8RA 2Z3ZA 4ZZ2A 3RS7A 4KN5A 3Q11A 4DIDA 3H99A 4IDCA 1G9SA 5IPFA 1W0KD 2A9QA 3ZVNA 2WABA 3JSXA 3G2PA 3QPAA 5FADA 1QR2A 4OB7A 4H17A 1WSDA 3WL5A 4IXWA 4JX9A 1BNCA 4HXEB 4EVIA 4A23A 1M0EA 3UMVA 1C4OA 2G25A 3LC7O 3FPHA 1LU9A 3F1KA 1GT6A 1NPYA 3D7MA 2RBEA 4OX9B 1C1HA 3W7BA 1PLLA 1OVMA 1W44A 4I4TA 1VG0B 1U0BB 2P5TB 2DWOA 2VPXA 4E51A 4IPTA 3ZHQA 4G37A 1A27A 1HE1C 1VFNA 4NFHA 2Y6VA 2QJOA 3L7OA 4I9NA 2FNAA 3X2SA 1G20A 2PXHA 5AVVA 3UUEA 4FFWA 2ZBDA 4HVAA 5JSZA 2BGRA 3FHOA 4J7UA 3PR3A 4RQAA 4DLBA 4ZCRA 2GK7A 3HCWA 1QQ7A 3U9LA 3BFXA 2X8JA 3OEYA 4GI7A 1TLFA 2B69A 4F86A 1FTGA 4WJKB 1I4OA 2Q5EA 1DBWA 2W6OA 1H4TA 3FDJA 2VYNA 2XMDA 3DL7A 1HT3A 1P0MA 3GUUA 3RE1A 3W04A 3MRSA 2PA3A 3MOIA 4F3CA 2XOXA 5CURA 4FEAA 1H0HA 3IXMA 4AJLA 3AM4A 3TI7A 3OT5A 4D8TA 5EXTA 1DAEA 4DLPA 4NBSA 2BFOA 3FIJA 3H9GA 4GKVA 4KB5A 2IJGX 4PSAA 2FPKA 5ECYA 2BGJA 2YICA 1FCJA 4IJKA 1WY5A 1GITA 5KTTA 2EZ9A 2X0FA 3ZGYA 2ZUFA 1RYHA 3OIGA 2YQ4A 1Y89A 5A4KA 1ZBQA 4YMSA 3EAFA 1TB4A 2QN8A 3MIZA 2CFSA 4UBKA 5EIBD 1J8MF 4OBWA 3FYDA 1XYGA 1AQNA 5KU1A 2FN4A 2XCOA 3P0FA 3RS5A 3BIWA 3U13A 5BNZA 4NF2A 2VP0A 4JDPA 3WOVA 3RG8A 3TINA 4FONA 1CVRA 4HWOA 1QGOA 1ZH6A 1IL0A 1UZUA 5JS8A 4ZT6A 4I50B 3QE9Y 1NVTA 3RTEA 3UATA 4JEUA 2J3EA 4QPDA 1V1RB 5KKNB 2IPMA 2WAOA 1FUUA 4GF5A 5EHGA 1ZM2A 2HF9A 3GN1A 4AZVA 2KX7A 3C6XA 3HADA 4WH0A 3TH5A 1YXMA 1O1YA 2WHEA 4TTAA 5AQEA 3S1SA 3ES9A 1EK1A 2HV9A 3L9WA 1T2FA 3VPBA 1H2FA 1KHHA 2OLEA 4KO3S 1II9A 5BR4A 1ZHFA 2QSJA 2QPLA 4RF4A 2P0AA 2RHOA 1I33A 1JQDA 2ZBRA 1QP0A 2KYRA 2HF7A 4U00A 3L79A 5GONB 2XY4A 3D54D 3H5LA 1S2LA 1SBHA 1WSBA 2JFWA 4X8HA 1QCZA 2XQVA 4P81A 4CWAA 4DS3A 2IPLA 3A6LA 4FOSA 2PXCA 5LWHA 1P2SA 3K9HA 5ESRA 1Z4MA 3C1UA 4JGBA 4JOCA 1C9NA 2ZJ0A 4HQKA 3T4PA 1E4EA 4TV9F 3QKUA 1TAQA 1XDDA 2RB4A 2O2SA 2WHYA 4RM3A 3E82A 2SNIE 3A1FA 3GFOA 5DCYA 5E7QA 5JCZA 3GA7A 4MKIA 5IDXA 3LXXA 3H5NA 4BQIA 5EHZA 3BL5A 5FHQA 5AICA 3W90A 4Z4EA 4HAZA 1E2QA 3ABIA 1Y48E 3ABOB