3KIPA

Crystal structure of type-ii 3-dehydroquinase from c. albicans
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
147
structure length
143
Chain Sequence
b'LVKKVLLINGPNLNLLGTRYGTTSLSDIEQAAIEQAKLKNNDSEVLVFQSNTEGFIIDRIHEAKRQGVGFVVINAGAYTHTSVGIRDALLGTAIPFIEVHITNVHQREPFRHQSYLSDKAVAVICGLGVYGYTAAIEYALNYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinase, type II
publication title Macromolecular crystal data phased by negative-stained electron-microscopy reconstructions.
pubmed doi rcsb
source organism Candida albicans
molecule tags Lyase
total genus 52
structure length 143
sequence length 147
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2009-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 3kipA00
1UQRA 3N8NA 4CKWA 4CKYA 4CIYA 2BT4A 3LWZA 3N7AA 2CJFA 4CKWB 4CIVA 4CIWA 3N86A 4KIUA 4CIXA 4B6QA 3KIPA 3N8KA 4L8LA 2Y71A 4ZC1A 4RHCA 4CKXA 4B6OA 2DHQA 1D0IA 1H0SA 1H05A 2C4VA 4B6SA 4CL0A 2XD9A 1GU1A 3N59A 2Y76A 3N87A 1H0RA 3N76A 4KIWA 4B6PA 4B6RA 5WRFA 1J2YA 4CKZA 2Y77A 4V0SA 1GQOA 2XB8A 4KIJA 2C57A 1V1JA 4KI7A 2XDAA 1GTZA 2UYGA 2WKSA 3U80A 4RC9A 5B6PA 2XB9A 1GU0A 2C4WA
chains in the Genus database with same CATH superfamily
3UEOA 1SR8A 2AEMA 4NMMA 4S12A 1MEOA 1VI6A 1DFGA 2Q2NA 2VWHA 3JVEA 1PKXA 1H5NA 2R5WA 1OPRA 2FUKA 2ENUA 3DAPA 1SVUA 4FOOA 3ZVKA 4WERA 4DARA 1F3OA 3AEQB 1E8MA 4BO7A 2X9VA 3ELBA 3L1VA 4ZU3A 3LY9A 5K8CA 4JLPA 4JYCA 2X0FA 1J1IA 4GNRA 3N58A 1CNFA 4LX0A 3TKYA 3C6XA 2YXPX 3OMLA 2Q7OE 3WKAA 1ESCA 1LI4A 1FVFA 2V4ZA 3RANA 2EFHB 3QOFA 3N3AC 1Q17A 3FAKA 3KUUA 5FADA 1BDBA 3OHSX 5IP5A 4KPGA 3IODA 4YT4A 1UWVA 1XZFA 3EXFA 1JFVA 4OMUA 5H83A 4A23A 3LHKA 4B74A 3E35A 2ISSD 3R0JA 4JFRA 4U7HA 2WTMA 2AKAB 2QE6A 2WIAA 3KT0A 1UC8A 3I1YA 5CB4F 1P17A 5LYJB 3EBOA 5JXJA 1ZM7A 4E07A 1B8OA 1WXGA 2HQOA 5DXFA 2IYOA 1ACLA 4QFMA 4QD3A 3MGKA 2QU8A 5G41A 4C2UA 2VRCA 4FFOA 4G2TA 1MW9X 4JP1A 1E1NA 5K8LA 1GVNB 3IELA 4DWJA 4NV1A 4BFZA 2PRZA 1RXCA 2C2HA 2F7SA 4MPJA 1R6DA 2COUA 2YOHA 2QRUA 2I4TA 3BAFA 3C6KA 3D4IA 4A8JB 5AW3A 3BGDA 2VYVA 5K01A 3ZXUB 3SVLA 1PAUA 3IIEA 1G8SA 4XYEA 3EGWA 3PR2B 4YP6A 2R79A 4F5EA 1ECJA 3GVIA 4ZIRA 5A5EA 2O59A 3RSCA 2GEFA 3BJZA 2O3JA 3SEAA 2YJNA 3T12A 3KUCA 2O23A 1HE2A 4O4JA 2AS0A 1ISMA 3JYLA 5HUJA 1GV0A 1KEZA 5DW0A 3K94A 1G1MA 3BCUA 1SOVA 2ODBA 2V7GA 3ZK7A 5LZ7A 1LQUA 2WIDA 2V96A 1OTYA 3DBLB 1E77A 3OD1A 1KH2A 1C0LA 4Y30A 5AOCA 5BQFA 2YV1A 2H85A 5KYYA 4M7WA 5BPHA 1DTWA 5F76A 4C3VA 3SYKA 4KQWA 4BUZA 4LPSA 5LQUA 2FOXA 4WZAB 1V9SA 4EFNA 4JJ7A 3I92A 4LZOA 1P8JA 2QLTA 2ZB8A 5U4XA 4INOA 3U13A 2ICAA 1KC3A 2IY8A 3BSYA 2YMQA 4MYCA 3KJIA 5HGJA 3WLEA 5G0SA 4NZ9A 2G72A 1X1AA 2QSYA 1L5YA 1OBFO 2VC2B 2DPGA 1QJ4A 3OQIB 3WHLA 2Q8PA 2RE8A 5ALWA 4E7OA 3LDUA 5H4GA 3BFKA 1C9MA 4X44A 5A0VA 1XLUA 1LLDA 3MB8A 2PRYA 1KZ6A 3CH6A 3DWEX 4NJMB 1FE8A 3G5UA 4QO8A 4TZ6A 1U2PA 1J23A 1H9AA 2WAAA 3RSFA 1WB5A 2QP9X 5B4VA 4FYKA 4MUXA 2CL0X 3JQFA 1B1CA 1OLUA 3K9QO 4MCIA 4ZQCB 4B31A 3BHJA 4JVLA 1KZ9A 3CVOA 2PUTA 3CFYA 4OSEA 4A0QA 2AR7A 1ECPA 4ICIA 5BUSA 1VJRA 4N12A 3OIGA 5HIMA 3VNAA 4M6WB 4MSUA 2C4MA 1FCJA 1UBTS 3RS9A 3RS0A 1JJBA 4BY9E 3GDGA 5GVRA 1CJKC 2ZXUA 4E5DA 4MDFA 1M1NB 2RB5A 1UANA 1Q12A 1X7GA 1YSCA 5FTLA 2ONJA 3DDWA 3HCWA 2MJLA 4UCQA 2F8MA 5CA0F 5GIPE 1L4GA 3ER6A 4CV2A 4QZVA 3S28A 3FNFA 3PYXA 5D1HA 1DAFA 3PGVA 1X1CA 4KWHA 4QWMA 2J7KA 3GQBA 2XNDA 2H54A 2I67A 2ZRCA 1PNOA 4R1PA 4IZ6A 1CLUA 1R0WA 3HN6A 3P0RA 3JQDA 4FGJA 3ZW9A 2R6JA 2FU5C 2R7MA 1DC6A 2P9ZA 3WL6A 4CMBA 5KNCA 1TFRA 1JR3D 3V7WA 4TV9A 2WD8A 2P8JA 4KP7A 1AMNA 3EVDA 2WUDA 4G9EA 5CU7A 5JOQA 5KWIA 1M0TA 2XVAA 1Y1TA 4CM7A 2B5VA 1Z6PA 1TIBA 2AMLA 5ECWA 5H68A 3RC1A 3V8PA 2IXFA 4Z7OB 1Q44A 1G6KA 3CO5A 1DADA 3TUJC 1E1MA 8AT1A 4YVFA 5KPDA 2XAUA 3AM5A 1J8FA 4CI0B 2TMGA 1OWNA 3IT3A 5IASA 1K4YA 4RZ2A 1PNQA 1E79D 2FFHA 3PP8A 3RK1A 1C4OA 1RKVA 3Q12A 4U3JA 1KH3A 5E1BA 2QYSA 3CVVA 1AQLA 2O8NA 1C7EA 5KKAA 4AJKA 3UW3A 3TFQA 4PNEA 1YJ8A 3GEEA 4GMGA 5HQTA 2BI8A 1P4GA 2D4HA 1RRFA 3U7EB 2PH1A 3BDVA 3NR2A 4R1MA 1KJIA 1SG0A 3R5JA 3R9XB 4CODB 2CE7A 3OPYA 2EEZA 1RAHA 4LSMA 1JX6A 4TLBA 2EKPA 1TU3A 3PKIA 3UFXB 5ALDA 3USCS 3VVLA 1G20B 3CVUA 4DV6B 3VNSA 1AC5A 1D6MA 3S2IA 5DMHA 3EQ9A 5FLXA 1P2DA 4EI7A 1POXA 1AV7A 2BFOA 1P1IA 2EP7A 1RYMA 4BQPA 3O8RA 3IKVA 4ZZ2A 4YMLA 2OHJA 5B5SA 3DNFA 5EHNA 3K4PA 1E96A 1NF8A 1YRHA 3L6BA 4YCMA 2RGAA 3O8NA 3H5TA 4PYRA 3LKZA 5CA0A 1I5OA 1HM5A 1YR1A 2BEWB 3E58A 4U5XA 4N41A 2KBFA 4DYVA 4EI2A 5AP9A 1V95A 1U99A 1ILEA 1LI7A 1ATIA 1II8A 3GVCA 2G83A 1ZQ9A 1YGPA 1TCBA 4JHLA 4KLRA 4M37A 1V5EA 1GTSA 1M74A 2C7GA 4V39A 5BOSA 4U2CA 1OXVA 4QHYA 3RR2A 2NZJA 4B3RB 1SCAA 3P7MA 1JHXA 3RVBA 2EFEB 2OHOA 4FNOA 4J2TA 5BVHB 3J81k 3L8CA 3PFGA 1T0JB 2QX4A 4JCCA 4BFTA 1O0BA 1I4LD 5HJ2A 5BP7A 2O8FA 3RUCA 3PE4A 4F3CA 3H2SA 1CP3A 3SSAA 5A7HA 1EJBA 4M9UA 4B34A 2JGNA 3QVTA 3K1JA 5COBA 4IRUB 4ZVKA 1BEZA 1T5IA 4FW8A 4YRIA 4JI6B 3NJ4A 4CCAA 4FYIA 5K0LA 1M2JA 3OZVA 4EEXA 2R65A 2XWPA 4N5DA 3B3QA 2B98A 4MTLA 3LUDA 5K05A 3Q1KA 4YACA 3MRXA 2H29A 3VBCA 4QLOA 5FPYA 1BAPA 2PM8A 3IE0A 5IYZA 5KSZA 1XPUA 4GPD1 2CXPA 1NMYA 5JWRA 4WADA 5JCJA 2PLAA 4MA0A 2O20A 1CUEA 1L7QA 1ZR2A 3WMGA 1FFBA 3QVJA 4Q9NA 5IMSA 1XNRB 3GLVA 5CXQA 2XTJA 1Z5OA 2L19A 2GO1A 3DZFA 3GBPA 3N8KA 3IQHX 3IUSA 1QYIA 3TEJA 2WNSA 1QG0A 4B7ZA 4DV3B 3QEBZ 2WRZA 3H6HA 2A1UB 2MTBA 2QRVA 5IN5A 1OB2A 4RZHA 5L3QA 3PEFA 2JHCA 4B2PA 5EKTA 1SXJD 3JAWA 4RLSA 4Q1AA 2WUVA 4P7FA 1L5LA 5BSGA 4NJEA 5LYJF 4GLJA 3W8EA 3HJCA 4MP8A 5HJ7A 3H11A 1CZKA 1FYDA 1VIDA 1ZRHA 1G3IA 1YS6A 3BD8A 3O1LA 3TZCA 2D54A 4U7PB 3D2BA 4EGAA 5B12A 5K5EA 4JEIA 1VKJA 2PKWA 1L9XA 3EC7A 5FBKA 2UV8A 1JEJA 4RL4A 1TA4A 2QVLA 1LPBB 5DX0A 1R50A 1YS1X 2FG7C 4D3DA 2C1ZA 3IPXA 4Y9TA 5G4KB 5LZ4A 1JJAA 3F67A 4OAPA 2QMQA 1SH7A 3NVMB 2CJWA 3OE5A 4HDOB 4W1QA 1GZSA 1ODSA 2PGXA 3D6JA 2O3SA 3RIHA 1NUAA 2B1IA 3KP1A 1Z6GA 2K4MA 2W2LA 1UMKA 4BNZA 2P30A 4EO9A 2B82A 3OCVA 1PT8A 4PO8A 5AHOA 2FPLA 3RVLA 3L6RA 4G23A 4PTZA 2ZBDA 1K92A 4UHHA 4CM3A 2DY1A 2WG2A 1F0YA 3I12A 4U2GA 1JDUA 2XTAA 1F2DA 1Y1PA 3KXPA 3V33A 4HVLA 3BYZA 1OVMA 3PVCA 1OWLA 2NNWB 4XIYA 3RF7A 3AEQA 1LF5A 4P6VF 1G3MA 3KAPA 4C05A 3ZGYA 4CFZA 4PYJA 2E49A 3L77A 2DBZA 4L5YA 1XCPA 1FDVA 5BW4A 1YZGA 2CNWA 1RPAA 1FL9A 1TMOA 3Q5EA 1LTKA 5CLGA 3T5BA 4MHTA 2ZE8A 1ZICA 4Z9BA 1MB2A 5KSWB 1E0SA 3I42A 4LGCA 3KKKA 2OXFA 2C58A 3OLQA 9LDTA 1XGKA 2W2TA 1TCAA 4JB8A 2O8EA 1DE0A 2J7PD 3A1FA 3DEKA 4ZAGA 3FCUB 4BB9A 1HEIA 3SLRA 1NF9A 1RWWA 1ZKMA 3L46A 2W2KB 4GWGA 3PIDA 4PWZA 2Y68A 2ZRHA 4ZQEA 5LYJA 3W5BA 2BZSA 1DC8A 3LWBA 4CKWB 2ZWOA 2XF2A 5A2GA 2P9EA 3B7PA 4U6NA 4B8WA 1RQXA 1KMIY 1S8NA 1QMPA 4B3TB 1COZA 3RVNA 1SCKA 3TCXB 5JEDA 5JH7A 3IUEA 3MLEA 3DVLA 5KTOA 3BZWA 4A8JA 4FWIB 4B47A 4GX1A 3T7DA 3ILYA 2PX6A 5AM5A 1J2YA 1GARA 5CRIA 1JIXA 3BL6A 1IHUA 4JU8A 1FXWF 4ZICA 4ZMSA 5KC8A 5CCEA 4YHHB 1UKAA 1XU4A 2CBXA 2VNAA 3OZCA 4PC7A 1SZPA 4IUBS 2QPLA 3FI9A 3IXLA 2II6A 3LQ2A 3OTOB 2CNLA 2NAPA 4L4RA 5FIUA 2GEKA 3STUA 1KMCA 4AJ4A 2C4KA 1F4LA 2CLDX 3N86A 4UXHA 4MVCA 3CXUA 4MUIA 3TCKA 1P4AA 1KO7A 1U3FA 1JHAA 2G0TA 3LCCA 3SLGA 5TGTA 1UFRA 3TEFA 3WRYA 4BO2A 2VRWA 1TT5B 2R8EA 3F7NA 1NVEA 3R9KA 5IM5A 3M49A 3NUGA 2ZUEA 3BWXA 4LFAB 4UQPA 2OCPA 4WZAA 4TTAA 3ND7A 2LNDA 2NIPA 2HU8A 2B8WA 2QL6A 3WRVA 2ZJ6A 1BG6A 1OC2A 1XHEA 2I6GA 1B8PA 2QUBA 5GY7A 1CR6A 2H4FA 3L6OO 4FDTA 4MUYA 4DG8A 5ALXA 3T5TA 1Z5NA 1CY4A 2XDYA 3DC7A 1Q95A 1U9IA 1T6NA 1E2LA 4KIJA 2IPMA 3OQIA 3SSOA 2YJTD 5CT8A 4R84A 1Y9DA 5F4ZA 1TO2E 3SNHA 4WY2A 2PD3A 3DQPA 4YRCA 2X8JB 1NU6A 4NJMA 2NAFA 2QVXX 4B6QA 3VJKA 4RK5A 4ARAA 3PQ5A 4BNGA 4KTVE 1BH6A 2O8CB 1T9BA 3G5MA 2VOJA 3UK2A 4U0JA 3NKLA 1PSDA 1IJFA 1FU8A 3CUKA 3LBIA 3Q0TA 2PS9A 4DEYA 3CW2A 4M6WA 5EHXA 3T54A 2NTJA 2ZZNA 1SU8A 2B3DA 2ZYWX 2NG1A 3CPJB 4HDAA 4IOLA 4MKZA 4B9EA 4D79A 1A4UA 3UAXA 3W2GA 1EVJA 2GBIA 1M1NA 3C3EA 1R16A 1KAOA 2PEYA 1TM7E 2EF1A 3CB2A 3DZBA 1NKSA 3I2IA 3IMGA 4MYDA 4P8RA 4O2LA 4CMGA 3ZE2B 4FZJA 4B8YA 2I4RA 4FYMA 4ZCMA 1DKQA 2W6CX 1LWOA 3B6JA 3UPTA 4KLAA 5HRAA 3DL7A 3AU8A 1FXWA 1PZXA 2GTIA 4O2BB 1U65A 4HLNA 1A9OA 1T25A 5J4LA 1GYRA 4GICA 4TRJA 3TGPA 2MT9A 3IHLA 3KE9A 4Y9DA 4MIEA 4OKNA 1YI1A 5AIAA 4IDQA 3DCIA 3WZLA 1EZ4A 2O2SA 3P2JA 4LRUA 3TVTA 4QPPA 4E13A 2JB9A 3AKEA 4Y6RA 2ZT7A 5DO9A 4H4DA 3RVDA 3PGKA 5JCZA 5KYXB 3FH0A 4XYLA 2OVBA 2DH5A 3DLIA 1KORA 2OUKA 4DZTA 3LLMA 3DT6A 3NM5A 2YJGA 2J5QA 1GU0A 2J3DA 2IPLA 1KS2A 1FLDA 1NY5A 3LFTA 4JUAA 1W0KD 2EZTA 4RVCA 2HKIA 1P5HA 1Q3TA 3RNLA 2XYVA 3IEXA 2WSMA 2CVZA 3C5WP 3BE4A 1FYEA 5EJ2A 1J0AA 1SIBE 4P84A 5TS2A 5BWOA 1PDWA 1E6CA 3FMFA 5JZ9A 1ITZA 4H7HA 2IPXA 3K09A 3VDRA 4KFCA 2IYQA 5EXDA 1FMJA 3RRNA 2BN4A 3F7OA 3N0WA 4DV2B 5DFAA 1UF9A 2XJ4A 3F3YA 1D07A 2FEMA 2I5PO 3OZWA 1TYBE 1HEYA 3GFFA 4MYSA 4C7KA 2NQ2C 4H08A 3KB1A 3UFXA 2X14A 1G20A 3VKGA 3ZR4B 2LW7A 4E4TA 4J9UE 2K2WA 1RHMA 1DKPA 3KSRA 3URKA 2ODEA 3K7EA 1YK1A 3N2KB 5CEFA 1CWUA 1XIVA 2CFRA 2HV8A 1AS3A 5DK6A 5C7IO 2P9TA 1GPJA 3RHZA 2AZXA 1PJBA 1HY3A 1NRIA 4YMWA 4DMGA 1L1QA 2WA1A 3CY6A 4XLLA 1MOPA 2R6GA 2NGRA 2NUBA 1C0KA 2H9IA 2BEWA 2OCIA 1H93A 1UDBA 3AIMA 3L0BA 1QE5A 3MQ2A 3RC9A 4Z3KA 4FGZA 2QQEA 4TWJA 5BNIA 2A5YB 5JD6A 4R2KA 5EQDA 2OY0A 3P19A 4UM7A 4B6SA 1KEKA 3SM9A 1TF7A 2X8LA 3C3BA 5A4DA 3OKAA 1KSHA 4FNAA 4K9QA 4AF6A 5F64A 2WUFA 3CHYA 2ABWA 5FOUA 4WKGA 3I30X 4F45A 1GGVA 2GWRA 1DJPA 1S02A 5DN9A 1QTNA 4OJYA 4D1YA 1DXHA 2QV7A 4RXUA 1T5HX 3H0EA 1FW6A 1V47A 4MGIR 3EIHA 3EDCA 2CKDA 2V3WA 2DTXA 2YZKA 4Q05A 1S2IA 3GEBA 1E99A 2QT1A 3FLEA 3WQRA 1E3WB 1JEQB 5B4UA 1GSOA 4N8DA 4PPGA 3DOFA 2JFXA 2D2FA 2A5LA 2EL9A 3TZLA 2HZ7A 1IL0A 3PXCX 2BGJA 3K53A 4R1LA 3VGJA 4AUKA 1U8UA 4AY2A 2QAGC 2R6FA 1AUVA 5TMEA 1RMQA 3RAEC 2DETA 1Y4SA 5LD2B 4MCAA 1P0IA 3KDPA 3N28A 5TQ2B 3DOIA 1OAAA 3ZHVA 3GT4A 1GIAA 3KS9A 3X1ZA 2IDJA 1QIHA 2NV6A 2REBA 3N39C 5EY5B 5IN4A 3EPLA 1R0LA 1WNFA 5DNWA 1YONA 2G17A 4IX1A 3RPEA 1GPAA 3W2HA 2G3YA 2I9PA 3JQGB 4DKXA 3HJBA 2A1UA 2YCLA 1Z0IA 4I6GA 1NUSA 4TTRA 4X64B 1QRRA 2V54A 3DA8A 2VT3A 5KMGB 1T1JA 2ZBQA 4ILKA 3WGVA 1HQDA 5LMZA 2J0SA 1SHUX 4NZZA 1IEXA 3W5AA 4I6EA 2Z95A 1K6EA 4AJ1A 2ZZMA 1QF6A 2ZU6A 3O8CA 2JLUA 3H1PA 4JV5B 4GWLA 1A7KA 1JIKA 1G21E 3I45A 4G65A 5CVTA 1SVIA 2WW8A 3OJXA 1DJNA 3OOHA 5KYTA 1LBEA 1IB0A 1ZW1A 4IQGA 5KTPA 1H8ED 1B0AA 3UBMA 4R51A 4GS5A 2P0AA 2Z3WA 3N8NA 3LX8A 1QVVA 2A57A 2GDJA 3A14A 4HS4A 1WX1A 4F7DA 4TYWA 2XT0A 3RVPA 4WL0A 4ZO6A 1D8TA 4MUHA 1M7HA 1Z6YA 2O2CA 1VE1A 2PPLA 3OU7A 4MI1A 4NNOA 5G4KA 3VR5A 4LNAA 3THOA 3WHIA 1VLQA 2YW9A 3F4KA 1EJ0A 4FBGA 5BRJA 2YICA 1WMBA 4KSBA 4ZYYA 4Y6QA 3BJMA 4B3SB 1VSTA 1EFDN 3R8XA 4HTFB 3R7WB 4OUDB 1NW6A 1OFUX 3DMTA 1KJZA 1YBMA 2OCYC 2ZUDA 1ZI8A 4YP5A 2HDWA 3X1MA 2JS7A 4Q82A 3ZD7A 2ID4A 1P2SA 3UMCA 3I39X 1JQAA 3R24A 1JDTA 4HAUA 4MVJF 2I9KA 4C9BA 4HL6A 3VHLB 3HDGA 4LF8B 1K63A 2N9UA 1C4KA 1A5SB 1TCUA 3IQFA 1U3UA 1HE4A 4LV5B 3GLFE 3GFBA 2Q0QA 5DTMA 2GEBA 5HP4A 3EMVA 1Z47A 2IXEA 3ZNOA 2VDPB 4OXQA 5F35A 3O90A 3O26A 2CFCA 3AH8A 4HFNA 4REMA 5KWEA 1NVGA 1T9KA 3EA5A 2BSXA 3HB9A 3WTBA 2XEDA 3GUVA 3L93A 4GBJA 3PQDA 3S4YA 1G55A 5FYQA 4KN6A 3KEGA 3BMCB 3LPNA 4L8WB 3VSAA 2GM5A 3O7WA 4Y3UA 4KBFA 4HVAA 3ZJTA 1VKHA 2DMRA 4W7SA 1LBHA 1A5BB 1UT6A 4FIDA 4H7DA 1Z5WA 2VJNA 5BUZA 1L4KA 3DL4A 3P4YA 4YT2A 2COEA 1P5ZB 2Z56A 5EZ6B 2W5UA 2RH4A 1L8QA 5HX7A 5HZHA 2W2KA 3I9V6 1WMEA 1O58A 3ZV6A 4DVGA 1JFRA 1MQ8B 1XMXA 2VRCD 2WE7A 2Y3IA 1P5FA 4QFCA 4QYTA 4MTCA 5TJ9A 2B1GA 4Z4HA 4CKWA 5ERYA 1Q3KA 4YAIA 5CFMA 5IANA 3OFKA 1NNLA 2YBDA 4F0JA 1GDDA 4KREA 5C35A 5HYVA 1P1RA 2VYVD 3D4BA 2AXEA 2FN3A 3EW9A 3HRIA 4JBWA 5FP0A 3TUIC 5C5IA 5JFOA 4O8CA 5HZMA 1JJVA 5K3OA 3TVYA 2GBFA 3LPLA 2FZEA 3FBGA 4HXYA 4GOXA 4AXBA 2PXAA 4NDZA 3IAM1 1AKNA 1VPTA 1C50A 3EVAA 4HEJA 4R8KA 4EKEA 2ZWVA 1Q16A 3WDSA 3TR5A 2GPAA 4BVAA 4J43A 1UPXA 2AX3A 1KJ8A 2BLNA 1JHVA 2WDZA 3BSFA 4R01A 4RZXA 2BMVA 2IY7A 1JA0A 4UASA 4ZVLA 2Z1MA 1DBIA 5CPBA 1Q3HA 3MK31 3HUFA 4JQOA 4IXMA 4MVJA 4MR9B 2R5FA 2C5FA 2CXSA 2QVZX 4QIHA 4F4UA 4DUPA 5JS7A 1MCZA 1F1JA 4FSXA 1R2QA 2BDUA 4I5EA 4LDQA 2H7YA 4MICA 1LPMA 3VRHA 2EV9A 3NIBA 1OJLA 2ZWMA 4U2DA 1L4NA 4NZNA 4A0RA 1XQ9A 2C7BA 3D3NA 1QTRA 3WQBA 4W5HA 2PBRA 2Z9DA 3V8VA 1QVRA 1NQUA 1GUAA 1ZHFA 3SOPA 4C4ZA 1GZUA 4CL0A 3A3NA 3GYGA 2WPNA 5E38A 3L0CA 4XGQA 5F12A 3ZWMA 3UWMA 3UV7A 3ZHQA 4MWBA 3SZRA 3GAMA 1LKZA 1THGA 4E3WA 1ETHA 1XJQA 1E20A 1K5GA 3N2GB 4MW6A 5A04A 3HPQA 2LCQA 1RRCA 4XARA 3HVRA 4QUEA 2X8JA 2CK3A 4ZJZA 3W4KA 1J9EA 4N6OA 4BMZA 4PICA 3JAMA 3IEIA 4ML3A 4JC8A 3DF9A 3OE4A 4L9SA 3PC4A 1DUVG 2C04A 3T8YA 4QGSA 1Y7PA 2O8CA 4OK5A 5CFNA 4ETWA 3M82A 3OIFA 3K71B 1DKOA 1U3DA 1VJGA 2B6NA 4Q01A 2JPDA 2XMRA 3DZJA 5FDFA 5JADA 4GSYA 3AB8A 4EY5A 5D51S 4RTKA 1AT1A 3L6UA 2YWJA 1DCMA 1I2CA 3H87A 1FEZA 2X76A 3ICVA 5AJTA 3R9XA 1G66A 2ZVQX 3AILA 3E27A 4MJ3A 3RT9A 4FJ2A 2XNDD 2NZUG 3M6VA 4RHFA 4WKCA 4BLWA 4QEZA 4XDZA 5CFZA 2FG6C 5JMWA 1OXUA 3A58B 5E9AA 4JUIA 5JYCA 5KNCD 3H1AA 4OD0A 1V1RB 4HAOA 4NBWA 1F14A 4C0HA 5IXSA 4O2BA 1ZWLA 1KZ4A 4I9NA 2ZS8A 5JZSA 1WW3A 4BNWA 3DE3X 1LW7A 3KR9A 1YIOA 3V34A 4L57A 1K86A 2GILA 3FPJA 1XA0A 3MINB 4MQMA 3H8JA 1EB9A 4JLKA 5IAJA 3WA6A 4DJJA 3DMYA 1EHYA 3KZCA 5AI9A 3VA7A 2CUTA 3WVNA 3VZQA 4OB6A 2WSIA 2JLVA 1T8RA 4PR0A 5EGSA 1VE6A 2ZBEA 4JUCA 4WX2B 5EMKA 3WXBA 2NMVA 3B9PA 1Q7GA 3CBGA 3GMIA 5NULA 4B79A 1QSGA 1M72A 1WCWA 1R6AA 2FZVA 1G0OA 2BMWA 2VPQA 2LUOA 3NHUA 4HOYA 5EA2A 3RK4A 1D4OA 5AUNB 2BFAA 2HPHA 1NPDA 1ZRNA 3JRXA 3I0NA 4F9EA 1O6GA 1Z16A 2UUBB 4R7TA 1GLVA 1WKVA 3H6KA 5IZCA 3BWEA 3C3XA 3O1JC 1XCLA 4JJGA 2PJRA 1DJQA 1ZESA 5EJAA 1QGYA 5FUWA 3AF1A 1C30B 4YAFA 1B7GO 5FOTA 2UXBB 2XB2A 1LNQA 2HBZA 2HFJA 3B60A 3VPFA 2V1UA 1M8PA 1I4DD 1I32A 1K88A 2WKPA 4GXRA 3LGSA 4MW2A 4ZQGA 2WPDD 3C1UA 5DYYA 5LZ5A 2WM3A 2GN9A 3SIRA 2HY7A 3ZDDA 3QOYA 4BTLA 2OHXA 5GJCA 4F3RA 1SUAA 2PGAA 2PZLA 3GO4A 4XWWA 1DKNA 3N2KA 2ATCA 4US0R 4DPLA 5B58C 1PCXA 1PTJA 3BXZA 2DFTA 3MHPA 1US8B 4NMWA 4WOBA 3K09C 1XTUA 1Z38A 2RHCA 1X1RA 3GNLA 3QVKA 3STHA 3TINA 5FBVB 5HIAA 1U1CA 5E9WA 4C5BA 5G02A 3ROQA 1K4MA 3OJEA 3NB0A 3RWOA 5ECDA 3CNBA 4OFWA 3NALA 1OAOA 4TTVA 1LRJA 5ALOA 3TQCA 8GPBA 4JK3A 4D3FA 5CITA 2QRMA 3EGIA 1ZG3A 4LTNA 1JVSA 2EBFX 2O2YA 2EIHA 4RLFA 1KIAA 2OT3B 1IN7A 1X92A 3QBDA 1BFKA 4A36A 2I8CA 4M3NA 2HCRA 1Z4QA 4HDMB 1IXZA 4M54A 4XSGA 1I9GA 2QJOA 4QXAA 3C14C 1V8BA 1VL0A 2ZT8A 5BT9A 5B7PA 3O8DA 4OQFA 4Q4JA 1U7OA 5EZSA 3KT3A 5G2OA 4DKJA 1E3WA 1JEQA 1BU8A 5E0KB 3O47A 1TAGA 4RMJA 3TECE 2AJTA 3BBLA 3K20A 4FYHA 4ND6A 3SFVA 2POQX 2QNRA 2B1JA 3NU1A 1GZVA 3B3JA 2H6EA 4N7JA 5JCJD 1Z28A 1C7JA 3HP7A 1E0KA 4ZPXA 1WAMA 2PKXA 2WTEA 1GUFA 2XODA 3EAQA 3ZJ5A 4KW7A 3DWFA 3VYTB 4A2CA 2VP9A 5C8YB 2Z2XA 3BORA 4DR4B 2XUOA 3LWNA 3MTJA 4HGOA 2BKUA 5HBGA 1RIFA 2ZJ2A 5J2UB 1VYUA 3ONWA 1MR3F 3OH8A 2CSXA 1OBCA 3FFAA 5KCZA 1XPOA 3JQGA 4GG1A 1ZIOA 3W5HA 3GJ0A 4I1VA 4JASB 4K6CA 4C7VA 5KOJB 2BI7A 3OSUA 1GGJA 1D1QA 3F9CA 5KMGA 2P6UA 4DLTA 4A6EA 2OBLA 2JIZD 4NEGA 4L27A 3WGLA 4EY4A 2HF7A 3AGQA 5U4QA 5JQGF 1RWXA 2B35A 4NOMA 4XI9A 4PZYA 1F8UA 1TFUA 2OM2A 2X1MA 2H3HA 4GRDA 1HX7A 1TQ4A 3R3ZA 4YYEA 1IIBA 3V3TA 3HXKA 3K1AB 4RF2A 5CEEA 1FNBA 4LDJA 3OEWA 1JU9A 4BFCA 2BPOA 2OYCA 2WIFA 2Z2JA 4AI6A 5BVHA 1ZUNB 2Q3LA 3URMA 2W2LD 2PSJA 3PQ6A 1AB5A 1PZEA 1MO4A 3AO0B 3VPSA 2JGKA 1XL1A 4C22A 3NASA 1SG6A 3QFHA 4HTFA 4OUDA 3R7WA 3GFPA 3WL3A 4TXJA 5BRNA 3INNA 3QOXA 2GZ2A 4Q3DA 4WMLA 3STXA 5JS1A 2P9JA 3R0IA 3HA2A 3KZKA 3FMPB 4WGFA 2G9VA 1PT6A 2EG5A 3F47A 4OHBA 2Y0PA 1Z0KA 1RSZA 1QH8B 1YVUA 4INZA 2CNWD 2BFDB 3W6ZA 4UVDA 3LQFA 1VXOA 3HXTA 5KPJA 1VHWA 1N4DA 2XBLA 4RE5A 4X24A 4RDHA 4DCTA 3ML1A 3FYSA 3KQPA 2PH7A 1FSZA 3TPFA 4BVKA 4GYJA 3UJ9A 3OQHA 4DQKA 1W75A 2FWBA 3DMTC 4CTJA 2VRNA 3GFVA 2YHSA 1SXHA 4TWIA 3WGUA 1SUPA 4DS3A 3BMCA 1NQAO 4K87A 4C2AA 2IPAB 3UFBA 2RG7A 4NNJA 4UTXA 3S5JA 3TAUA 1NFRA 1HYQA 1I01A 3E53A 1UXIA 4FEAA 4Y0VA 4NNPA 4YRDA 4Z8XA 5EE9A 4XVHA 2HSWA 1PT5A 4G5OA 3EVNA 1MOZA 4Q4CA 3U6BA 1IRIA 4W5NA 4JSRA 3UT0A 3JU3A 4LCEA 2QPAA 1XAJA 2OYRA 4HN4B 4M8SA 1P2VA 1QFSA 5F2EA 4RZIA 3ZU5A 5CDSA 5JQGA 5KKCA 4N7MA 3L0OA 3MWJA 1J0XO 4KUHA 4LXQA 5ARCA 1JECA 1KEPA 1R0CA 1TK2A 1E2HA 3NGMA 3N5KA 2UZ0A 1NX6A 4UBNA 1R10A 2XVMA 3M0EA 3HL4A 2ZW9A 2GN6A 3JZIA 2DEUA 5ENDA 4DW8A 3ENKA 1GM5A 2QYTA 1Y3FE 4X91A 1FX0B 2P1DA 1CR1A 3PPWA 4GP6A 4CEJB 4M1WA 2EATA 5LNK1 2BJVA 3RB8A 4BVJA 4AZ3B 2W2OA 3PGMA 4ZOEA 1LD3A 5C8XA 3OCXA 4R2XA 4DB4A 3H18A 3MQFA 3RAJA 2QRHA 1DSSG 2CWWA 2EX1A 4QXQA 5FQNA 1HBJA 2FPOA 4RUKA 4WBXC 3VSEA 4DLRA 1MFPA 1Z12A 2HRDA 3RUHA 3CV3A 4JLOA 1BWRA 2B2XA 1I2ZA 3U4IA 4KXQA 4HDKB 4MR9A 3U4QB 1W1IA 4IR7A 1G17A 5BQ5A 4HDNB 2IU3A 3B1VA 2JI8A 1PLKA 1THMA 2HMSA 1WF6A 2APJA 3TLKA 4EKIA 2A6PA 5U9CA 3G9UA 1TJ4A 4A8TA 3BRCA 2I8AA 5FI5A 1T2CA 3ME5A 2GAIA 1TMGE 3EVZA 2XGGA 4QDOA 2QN2A 1JTEA 2IUUA 4UDYX 1CYDA 3L4SO 1MBZA 1O1YA 1UPBA 5JD4A 4L6CA 3ENQA 4C03A 2AL7A 2JAUA 2B83A 4G0VA 1IVYA 3MXOA 1TKCA 3N2GA 3DOOA 2QDKA 2VEDA 3PT5A 1WNTA 1DWPA 2HF9A 4IXDA 2NZ2A 5CR9A 2O06A 1Y37A 2FPRA 3LV8A 3E7PA 4IUCS 4PXAA 4XQGA 5DYIA 5G53C 1YKSA 3TPZA 1GILA 1W76A 1XJCA 3UO8B 2FSSA 1KL7A 4M0LA 4CIAA 2HA7A 1JJIA 2IHTA 4EHLA 1O4VA 2JFVA 1U7ZA 4PYKA 1DCTA 5DIZA 5LKRA 2J3KA 4UTRA 3UANA 3JW8A 4J6FA 1JDBB 5B1EA 1R0KA 5JG7A 2QN7A 3VR3A 1DQSA 1SOWA 4R0NA 5HOEA 1T4MA 5EJMA 1A8UA 4TKUB 1UL1X 2Z5LA 1Q6ZA 3QVGB 1I6MA 1BXKA 1JEDA 2OCBA 2ZDQA 3FWYA 4GYYA 3PHBE 2IH2A 1HSZA 3GD7A 4X93A 4GR5A 4QVKA 2QVYX 3D0RA 1GUDA 4UCFA 1V1RA 2R68A 4YRLA 5TB5A 2Z6QA 3DLBA 4GM4A 2E82A 3UC5A 3O1HB 2GZ3A 1E98A 2Q27A 4PLWA 1A9YA 1M2GA 1CC1S 3MINA 3EUAA 2X4IA 3HCPA 4HB4A 4TT3D 1QLHA 2GCIA 2O2IA 3UKJA 1GD1O 4URWR 1KFJB 2NNLD 3WLIA 4BX3A 4F86A 4WCVA 3F5MA 4L4ZA 4WPGA 2H08A 3C5EA 3CR8A 4INJA 1UBNA 5JR3A 1VL6A 1RJ9A 2DUUA 2V8OA 2P4UA 4QTXA 4RA6B 5TPWB 3ZHSA 2V55B 3LNCA 4PNPA 1P7CA 2J3QA 4HPWA 3D2CA 3PQEA 2WAMA 4LKRA 5IS2A 3IVRA 3D8TA 4FFNA 4KQ6A 5PNTA 3AF0A 4KACA 5U1PA 1E9VA 2Z04A 1ZK2A 1A04A 2H1VA 5FLEX 5EJ5A 3HMQA 2ZS7A 3GMDA 1QB7A 1W4CA 3GPLA 3KG2A 4OQYA 1YU9A 1XO1A 1Z37A 4YUZA 1P4HA 5G0TA 3MPOA 1N2SA 5C8YF 1EIZA 4JQYA 3FTFA 3R77A 5DGHA 4ENPA 3HWX1 5DDIP 1KWKA 5J2UF 3X43A 3FYTA 5LIRA 4LY6A 4Q1BA 1YQEA 3PB3A 5CEJA 5E4TA 5KUTA 4RGQA 3WLQA 3RKRA 1XZMA 4MUEA 3ZS9A 4BBZA 5IZCC 1L1FA 1PNVA 3RYTC 1EP2B 1AQIA 3RS4A 5AHWA 1US8A 2WOJA 2X9NA 4QQ8A 3ZDAA 2WM2A 4CE6A 2AJ8A 1K4KA 5KI6A 3DDZX 1ZVJA 4LYJA 1RVV1 2B7CA 2XQIA 3COZA 4YJDA 2DFVA 4PHGA 2XCRB 3GRKA 4YAEA 3LCMA 4XX0B 4FS8A 1PZGA 3R44A 4OI2A 3AESB 3RS8A 3H13A 1E7MA 3T9FA 2G80A 3PDUA 5JSHA 5LL6P 4WLNA 2G06A 2ONZA 1E2KA 3OJOA 3D1VA 1M5TA 4KXMA 2H9AA 4LMPA 3CLVA 4Q1CA 5D3KA 2ILVA 1IHDA 1Z29A 3LVRE 5TPZA 3TLGB 3G85A 3RJ9A 4WTOA 5AM2A 1C3XA 1NX9A 4GKKB 2OFWA 3D6VA 1R37A 3IAXA 1KFCB 3E82A 2YV3A 3JSXA 1RKUA 2BEVA 5B58T 1GDHA 4RJLA 1UBSB 3VAAA 2FUNB 3GP5A 3MMNA 2O5VA 1AQ6A 4XOUA 1OAOC 3IP5A 1ECCA 1LPOA 2IXGA 3IOBA 1SU4A 1VC2A 3O93A 1C5KA 1H5UA 2EGUA 4UPVA 2J31A 3W8DA 4XWOA 3COJA 3B13B 3LY5A 3QH4A 2BGNA 3L8FA 5DW3A 3W9YA 3DDOA 2JC3A 2NO5A 4IYRA 5IKXA 2GFIA 4PPQA 1C9JA 4AQYB 3S6JA 16PKA 3A1DA 5FULA 3WG9A 1ECLA 2P11A 1YF3A 2Q6IA 2JJYA 1OZAA 4LE1A 4WCFB 5ITWA 5C8YA 3UK0A 5AT1A 1HQCA 4DANA 1BC5A 4DOMA 1J06A 4UXJA 1GPDG 1N6LA 1XZPA 2DLDA 5L7TA 3U7HB 1BFUA 3KKMA 4IMPA 4KB5A 5KOJA 3HGTA 5EP2A 2VKTA 2F6RA 1NASA 3GDWA 3AONB 2ZKIA 5AW1A 1PS8A 4NARA 3UOWA 1XWFA 1PVDA 3BQ9A 4I1IA 2ZITA 3RS7A 1HSOA 1BJRE 2R7AA 1DB3A 3DQQA 2LP4Y 1CVIA 3GFRA 3DZIA 4FEGA 3Q8XB 1VBFA 3GZ4A 4PSVA 3ETLA 1VYVA 2PLRA 3GHHA 3Q7EA 2A0YA 1Y5RA 3QKRB 2FSVA 2TECE 5DHPA 5K3BA 4US2R 3UG6A 4DUZB 3GJ3A 3K1AA 4QPZA 5AKXA 4TMKA 3VR5D 1ODKA 2DSNA 2OFOA 3G0IA 3L0ZA 1M8FA 4FOLA 4IGAA 4MRNA 3T4XA 3ZC3A 1E4VA 5C46F 1U11A 5JJIA 5JV5A 1ULUA 3TFOA 4QICA 4EA8A 4F56A 2UUOA 3HA5A 3T7TA 2YXNA 4BNFA 1T3ZA 4Q02A 3MUOA 3DEHA 1ZUNA 1U2GA 2IEGA 4TMFA 3VR5H 4C0SA 2XQFA 2A3RA 4PZDA 5DU2A 5GJVC 4DDMA 1YL5A 3E8MA 3ZPXA 3JWGA 2OO3A 3WNBA 3EC2A 4K9LA 1CSEE 4F71A 4RDXA 4GI1A 5KYGA 3MAGA 3RVMA 2V03A 4V03A 4EHKA 1KJ9A 3R8FA 1K5PA 2XMSA 1QHEA 4JLBA 4EBBA 3KSUA 3K9CA 1I1OA 3W2TA 1N2BA 3V55A 3O38A 5K4AA 1MIOB 1P61B 1ST2A 4R9SA 3W5DA 4D9CA 1ATZA 2X19A 2PT7A 1KGDA 1A5AB 3NDBB 1EUDB 1QH8A 4F8JA 4GI5A 4II2A 4L5BA 1D7AA 2BFDA 3BCRA 3VUEA 1NPYA 1ZEMA 1R15A 3W8FA 3FPBA 4OSPA 4D0NA 2WA2A 3CGWA 3JTMA 2CW5A 1LX7A 1RYDA 3TD2A 5J4VA 4M21A 1S1MA 1U0BB 4B3GA 1J00A 5LUAA 1B26A 4MIKA 1DRKA 4JLNA 4N03A 5B3LA 4BP1A 5I9SA 5K0JA 2WV9A 2MMCA 1XKLA 1U3WA 1GAXA 1P2GA 3JQ9A 3O82A 4E2XA 2GXAA 2QN1A 1U8FO 4BFSA 1QLJA 1SVOA 1FRFS 3GLQA 3G0CA 4S3MA 5AUQA 3MRSA 4LOKA 3C6ZA 3A11A 4ARCA 2I2XB 3EOAI 3FGZA 1NW8A 2C5AA 1Q1GA 3T1TA 1DC7A 1W5BA 5GWXA 4XWTA 1I7LA 1RC1A 1HL7A 1M2EA 4I4LA 5DBFA 3SHOA 1SKBA 1ESZA 1ZK1A 3AM4A 1E2IA 3D59A 3LC0A 1NP6A 4PCAA 3FMGA 1BRMA 1X1SA 3F49S 4FKBA 4G85A 1X0XA 3C6MA 3M81A 2LPMA 2VHYA 1XCGB 4ZQFA 3SYMA 3UXHA 2XH8A 1FX0A 1ZIXA 3AI2A 2BSQA 5BURA 5KSOA 3NWOA 4FMCB 5D8DA 4HCJA 3WKBA 3UAYA 1C0EA 3SHTA 4AZ3A 4NPHA 5E2AA 4CIDA 1JP7A 2ATIA 4GGOA 3LU1A 1NHWA 4MVJD 2O19A 2N3ZA 1I80A 1PFWA 1ZUWA 1YVDA 4MR8B 3ZJ4A 1MX5A 1V1JA 4KIFA 4Q9IA 2IIBA 3TIIA 1QVWA 2NZWA 2OTCA 2NUAB 4UEQA 4FUTA 4HDKA 4ZQBA 3U4QA 3SFZA 3GGOA 4MVJH 1XYGA 2RC5A 2CYAA 4HDNA 2XGSA 4N5IX 4ZZ1A 3GUYA 7ABPA 5GZ3A 4D44A 1DX4A 1JWAB 2KYRA 3HABA 4FFBB 1IBRA 4O0MA 2GFQA 3I2JA 3U7RA 4AO7A 1EVIA 2Q1WA 1Z36A 3A8TA 4KX5A 4P58A 3WMWA 4F2WA 5B36A 4F8EA 3RHSA 3JYPA 1URPA 3M3PA 3E9NA 3WWPA 4G01B 3I5UA 1I6WA 2AUNA 3NMUF 4KR9A 1I2BA 4TROA 5A3JA 3BGWA 5C1PA 4BWVA 4DIDA 2CK3D 2FK8A 2IW3A 2OWDA 3BPSA 1OGJA 2CE2X 4Y2UA 3LA8A 5T4HA 3SF8B 1XPRA 1UJ5A 2AK3A 4AY3A 1QP4A 3AJAA 4K3UA 2CJPA 3H9UA 4FJ0A 3NEYA 2FDRA 2WF7A 3DG9A 3NWEA 5FBLB 2IIVA 1SXQA 5EJEA 2BDEA 1J2TA 1ORWA 1WP9A 1KMNA 4IP0A 3SDBA 3YASA 4OKIA 1HMYA 4CIXA 2QTTA 3CJRA 521PA 1QQ7A 1FVHA 4E0BA 4WNYA 5CFLA 1IQUA 3IAM6 4MGKR 1V9LA 4YGXB 3W6OA 3T1VA 2G6TA 4NH0A 5DNDA 4BMSA 3ECCA 4YRSA 3N2ZB 4NC9A 1MT0A 4UVIA 2OD7A 3ZWWA 4F3YA 1IM5A 4WLOA 4TKUA 2GZDA 4YASA 2DLNA 1K98A 5KWVA 2P0EA 3FOAA 3KVVA 5CCXA 1PEAA 4RIEA 1HXHA 4TLCA 2J3JA 1PFYA 2HX1A 2RGUA 1OGIA 3TMYA 4ZVNA 4ZXFA 3I2FA 1N3YA 4RD2A 3KTAB 3EULA 4GVPA 3IPAA 3A04A 3ONNA 4MUMA 1I14A 3B5IA 3CO0S 1QQAA 1WV1A 3NPAA 1JLKA 1X19A 1GGMA 1UDXA 2GUWA 2NZXA 3GLKA 4BNTA 1SG9A 5LR6A 1D1SA 4BLVA 1LBIA 4DLZA 2OWEA 4BQQA 1LLQA 4G1MB 4LHWA 1LK5A 2VNIA 3SN6A 1NXSA 5D3ZA 2P7HA 3D7NA 3KWLA 1UK9A 4RA6A 5DBGA 1UFVA 3LT5A 4Z0TA 5TPWA 1RM4A 3IPCA 5JDCA 2TYSB 1W5SA 2JFOA 1KTVA 5DEOA 1ZSVA 3LECA 3SE7A 4KO8A 4KQKA 4OO3A 3V9PA 1JHYA 1K7FB 1U2ZA 2E4ZA 4Y2QA 4EFDA 1J90A 1TQ6A 2WJVA 3U62A 4KQHA 4KMRA 4R68A 2FI1A 1CJMA 4L0MA 1DKLA 3OKPA 3ZDFA 3CR3C 1W0JA 1IAQA 1G5TA 3GLHA 2X58A 3QA9A 1ZUHA 3MD9A 3QEOA 4Z2YA 5EIBC 2XDQB 1P6UA 4Q4AB 3JASB 2DFKB 1HLPA 2NSJA 3BD7A 4FHCA 5CNKA 1Y42X 5FEMA 4JI8B 3BTVA 4LJLA 2PUDA 3UZUA 2BBOA 4JYAB 2VYQA 1UK6A 3KOMA 3PBKA 4TS1A 4YLEA 3AKZA 3T0FA 1YDMA 3TTYA 4F6LA 1NM5A 1RYEA 3T9EA 3WK4A 5CFOA 1NVDA 3LQYA 4XYGA 4NTZA 1PV2A 1G4UR 2J6IA 2Q5OA 3M5CA 3P52A 1IOWA 4GIBA 4JLJA 1QDEA 1CJSA 1MJ5A 3AQ4A 3DCNA 4XIFA 1E63A 4MRRA 1XRNA 4YNBA 4OXNA 5JO9A 1NMSA 4RULA 2CVFA 2B7LA 2CLLB 3E4DA 3CZRA 3FFTA 4UUAA 3ANLA 5IDVA 5ADVA 3MIIA 4I55B 4XX0A 2GHQA 5AVJA 4QBIA 4G0YA 5D87A 1S5PA 1U31A 821PA 3MWDA 3AESA 4IHJB 1XTJA 5I7HA 3GV0A 1C2YA 3HVIA 4I3GA 1GNPA 1GAJA 2HTFA 2VJMB 5G0UA 2ZUVA 3D7KA 3WWEA 1F6BA 1UQTA 3GLUA 5IBQA 3EZNA 4BQNA 1OXMA 2JATA 1K7CA 1KO4A 2ZSUA 2NV2B 4U2KA 5C3UA 1G3QA 3QENA 3IMCA 1QHNA 3A4VA 3JQ6A 4QUHA 5DJ5A 5MFZA 3C6BA 4TQGA 1SIUA 2VHCA 3WAKA 2J9ZB 1DINA 3JVIA 3X1DA 3ACDA 2C4TA 3HLYA 1YFZA 5F1YA 1GTVA 3B52X 1TUBB 4UOZA 3KQUA 3D6UA 3W34A 4JL8A 2VAPA 3X3HA 3BHMA 2R6AA 1A4XA 1C3EA 1NN1A 2ZB4A 3B51X 3BXOA 1JRLA 4HNQA 4X3CA 5DLQC 3AK4A 3PX3A 3SC4A 4DTIA 4QPJC 3DBRB 3KKZA 4M0CA 1JEAA 1GNLA 3FBWA 2HR1A 3IJ5A 4CETA 3HO6A 2BHRA 3OE7A 1SBZA 4FGWA 4C1NA 2QGFA 3EFOB 1NSFA 2R48A 1MMFB 5BWNA 2ZQYA 1QMGA 3LDHA 2QR3A 4MQLA 3CE9A 4Q7LA 4WCFA 4EOGA 5EWJB 4KPEC 2WHXA 1EAMA 1TI7A 1NTRA 2LTAA 4ND7A 1WG8A 3FNIA 3RYCB 2Z30A 2VWPA 1WDMA 3U9TA 1UBEA 7ADHA 2XUHA 4IQ4A 1U28A 2R2AA 3MJVA 2G5CA 3OA0A 1H4QA 1KYXA 2FCAA 1KA9H 3I34X 2JRCA 2O0MA 4YUWA 1FS6A 4UW9A 4IDEA 4PGFA 3ZX4A 4Z9XA 1K9VF 1N6RA 1UWLA 2B1RA 1NVTA 3BZBA 2P75A 1NRJB 5FYDA 4ENSA 1QIJA 1EFVB 3QKRA 1OIWA 2OPBA 4DIEA 4O59O 1PFQA 1OWMA 3UAVA 1MB9A 3PXGA 2GM4A 2OG1A 2D5AA 1A76A 3BIWA 2J33A 3HB0A 5AJWA 5FQOA 3ZE7A 4D7AA 4RQTA 4HBGA 4Q3CA 1AK2A 4WUTA 3GBSA 4NCHA 2DQSA 4PLHA 2PL9A 2HA0A 4ZU1X 2EERA 4EI9A 4D4IA 2W2QA 2VCHA 1MG0A 4ZAZA 4NCNA 4F9TA 3KTFA 1GVHA 1RJFA 3LQRA 5LQAA 4FMCF 1M73E 1NULA 1V43A 2C99A 1LA2A 2BTQA 3AERB 2PDAA 3LQ4A 2FQWA 2FJUA 4L0CA 4CEJA 4PHFA 2GWHA 3ORRA 3GU3A 5D5QA 1W0CA 3D64A 2DFDA 2PT5A 5E4JA 2IX9A 3ZXXA 2OP1A 4GI2A 4GF5A 2BCEA 1B0UA 1MIOA 1EWVA 4M86A 3NC1C 4QEDA 3MWFA 4CQMA 5F2NA 3KB2A 2W6OA 1JTVA 4M36A 4PHTA 3A9RA 2J4CA 3OTIA 2WLSA 5JCXA 1EUDA 1QZ3A 5E1DA 3I8SA 3CLSC 3IEPA 5DLDA 4EVSA 3BXXA 1PL6A 5LLSA 2XNJA 3KYIB 5ELMA 4LGYA 1WO8A 2AYZA 3RASA 2KQUA 2ERXA 4FX5A 3NGLA 2C1XA 3L05A 5IAEA 4AYWA 3SDSA 1I3MA 4N49A 4BAZA 4ZI7A 4ARVA 1HA3A 3G8YA 3I9OA 1QYXA 2HYDA 3VR1A 4YRGA 1ZLXA 3MBOA 5IHXA 3NRCA 5CVUA 4BJ5A 3Q7IA 4G63A 4PO9A 3T3IA 4B4KA 1LDNA 2VTDA 3E03A 1ESEA 4H7EA 1UZMA 3V6MA 1PO7A 3BM5A 1O9BA 1EX6A 3TBHA 4F46A 2JLBA 2N75A 4XPIB 4QOJA 2PA3A 2Y1DA 5CK5A 2HW8A 3C70A 2MWMA 3E2MA 4ALMA 1ZR4A 2W8BB 4W1RA 3KXIA 2X7XA 1Z45A 1GU7A 4MEJA 2IRWA 2OV2A 2Y1WA 3F7MA 3K2QA 2OQ2A 3NHFA 2YN4A 1JBEA 5FWXB 3CUYA 3QNMA 4OH1A 3PI7A 2I7DA 3UOGA 1RRVA 4XRGA 4BOYA 5EJ4A 3DNPA 1NBEA 4AS2A 3T5MA 2L69A 2RAPA 2H1IA 1PS0A 3KJXA 2AFHE 4TKMA 5IJ9B 1VB3A 1P2FA 5ANRB 1VFNA 1I24A 1W36C 2WD7B 5EE0A 1QP0A 3SIWA 5JCOC 4ILEA 5FUXA 1QUEA 3R09A 4YR9A 5C2JB 3SWWA 2X42A 5I9BA 4MO2A 5FTJA 3SHFA 4IJVA 1UBGA 3U16A 4M7PA 3DEJA 4P3YA 4BWGA 1Y3AA 2E4YA 4UXIA 3KWFA 5HMLA 2OPHA 2M32A 5IAGA 4MR8A 2N1MA 1B42A 4R6WA 1F5SA 4N40A 5F21A 1EESA 5KTYA 3K9NA 2NUAA 4HVCA 2A9FA 3ANMA 1H85A 4YC7A 5I3CA 4IZOA 1YB7A 4PZCA 3NBMA 1FA9A 1Z8DA 1UINA 4K03A 4QRHA 3C3PA 4FFBA 1W34A 2Q5LA 4JQCA 4XUGB 5E7MA 5BSMA 5AW9A 2CNNA 5LC1A 3WYGA 1C80A 3X1JA 4DQDA 5C8ZA 1NC3A 4UBLA 3UJNA 2I3ZA 3DE2X 3WIOA 2QTBA 2HK9A 4YCAA 2C95A 3JQCA 1AO3A 1BVHA 2FPXA 1HG1A 3ZV4A 1F7UA 3EG9B 4J75A 3SF8A 4ZAVA 3W7BA 5I8PA 3IMFA 2ECQA 2YHAA 2QZ4A 3QXCA 4IHKA 5EUMA 1RI1A 4D3ZA 2H65A 4ZT5A 3PS9A 4AL4A 4Z8YA 1NQ5A 4CF4A 1KHTA 2AHOA 1KAHA 3NDIA 4EGQA 4ZYTA 1A27A 3ZD9A 1K6XA 3OZEA 4BFUA 3HKBB 3HXOA 2I4IA 2QTFA 4ZEMA 3EGOA 3FI0A 3MAJA 1HFKA 1GTL1 2M9MA 2QX6A 5LNK6 1LC0A 4L51A 2Z98A 5JXIA 3ZW7A 5THQA 1BA2A 1JWBB 4NE2A 4XAQA 2XR1A 2DGDA 3UK1A 3V97A 3ZKWB 4MKHA 3IDFA 1JR4A 4WXPA 2XRYA 2V9ZA 2YY6A 3HVUA 3A6EA 2IDKA 3MWKA 4B0OA 2M2IA 4BO9A 1EI9A 1AKQA 1VCNA 2XITA 4IKPA 3SIPA 1Z13A 2CB0A 1HFEL 3DVQX 3VFDA 3CEMA 3D6MA 1AE1A 3QVXA 4H27A 2I4MA 4HZGA 4I55F 5DIFA 4YRZA 2X4DA 4TKZA 2ON6A 5DNVA 4IHJF 3KTAA 3EDYA 2QN9A 2VSQA 4TLAA 4IWXA 3I72A 4B6GA 3LO5A 2V8BA 1FFSA 4ERNA 5L95A 4X71A 4C0LA 1PR5A 2VJQA 4CN8A 1MW8X 2O57A 4HK4A 4WLEA 5FHRA 2YMLA 5FPQA 2FW8A 5K1ZA 3DEZA 1RWQA 4HB3A 3SVZA 1R8XA 5AVVA 2EHDA 3P4UA 2OXCA 4LVOA 5I5GA 5K7SA 4OQNA 1JSXA 2WWWA 2LKCA 2OHVA 3DJFA 2QM0A 4JJAA 4NQRA 1YKGA 2W83A 5CHEA 1QYDA 3O95A 5DNUA 3PFNA 4G0NA 5AI8A 4PFKA 4BNHA 1RWPA 1M0EA 1WHTB 2GPWA 2CVOA 2O0JA 2YN2A 1ZAYA 3SBDA 1PP4A 2A59A 3KVRA 4CG0A 2I87A 4L5IA 2WK1A 3DBOB 3Q41A 4HWOA 4N3CA 1GRCA 2VIIA 1O95A 1RLJA 1RYFA 4AU1A 5DNCA 1EXVA 3BDAA 1G8YA 2XDQA 4Q4AA 3JASA 4M0UA 1RBQA 1YBAA 2D1YA 4IJ5A 1SWVA 1XAHA 2BGTA 1DBRA 1NV8A 3L92A 4H1UA 4PLCA 2Y05A 4JYMA 4RHTA 4IVNA 5JC1A 1QKIA 1SQSA 1VZ2A 4CUZA 3GLGE 3IBFA 4YAOA 3VHXB 1GZ5A 2HJSA 2H4WA 2VJLA 3HDTA 3ESQA 4ZO9A 5DULA 4NX2A 5JAIA 1OFUA 1I3OA 3THXB 1OYWA 1JEYB 1D04A 4BCDA 3W1EA 4XVCA 3NATA 2QN3A 1B14A 4LXXA 1CDOA 4UNNA 3IUYA 1RABA 1T3GA 3O4JA 3P27A 3AUKA 4I55A 3VJLA 1P7WA 3V8EA 1QF7A 3FCSB 2FN9A 5JW6A 4IICA 1W4AA 2JIRA 5TPZD 4FX2A 1RRGA 1G5RA 2QD3A 3M4XA 1LVGA 2IU6A 2X5NA 1NM5C 3PXUA 4XVRA 2VJMA 3TLCA 4GRAA 2F48A 4J16A 4LVUA 4JXKA 4RKWA 3SVTA 4HRVA 2FDCA 2OV3A 4BKOA 3I64A 2ZSDA 5IXYA 3OTWA 3ABSB 1YQGA 2HLNA 2LDXA 1MIHA 2QTZA 4OJTA 3QKTA 3M1LA 4DIUA 1DBPA 3JZAA 1Q11A 4NCKA 5AVZA 2WJ6A 4YR7A 1QO7A 5HTOA 4GOLD 2ACVA 1TUBA 3NNSA 4I9FA 2SECE 2AOVA 3UNXA 2UUPA 1WXWA 3HS3A 4LYAA 2Z9BA 2ZJBA 2O1EA 4TYYA 1J09A 1NF2A 5FLYA 3CT6A 4JSYA 3R23A 3ZS8A 3EZ6A 1CUHA 1KAMA 3IBCA 4M83A 2XZPA 4XOIA 3PFIA 1ZK4A 4ZEVA 5AVSA 4Q21A 1F4PA 5JAZA 3LBAA 4AROA 3EFOA 5M29A 2VA8A 5AI0A 6ABPA 1M67A 1QUFA 3VAZA 2PZFA 2C31A 2LWIA 1O96B 2WIGA 3G13A 2BR3A 3EIWA 1GGKA 2GESA 3FWKA 3MWEB 5EWJA 4Q7QA 1NJSA 4MI9A 5JNUA 1ZC3A 1HZZC 1K2WA 3A7DA 1BW9B 4EZBA 2H1CA 4HNSA 4W5OA 1P6XA 2PSDA 2YWXA 5CCDA 4YMHA 1N36B 3Q0EA 4PLFA 1JKMA 3D2AA 1QB8A 3W6NA 4HGYA 4ZRMA 2Z2YA 3UQYS 2VTKA 1Z4IA 4OI1A 3EA4A 2ENWA 2H31A 4OHMA 4EVQA 2OCLA 5F98A 3TMKA 3UJAA 3BD9A 2C2GA 2ZWIA 5FOWA 1EFVA 1XEWX 2D3WA 2OENG 1SD1A 1TZCA 1DAIA 3GR6A 1EA7A 1XDUA 3D6HA 3LPCA 4PHHA 1KJNA 4XPZA 4CFYA 1YJCA 1I0IA 3QIAA 3QVVA 1O3YA 3F90A 5JZOA 3T1NA 1NZFA 2BHNA 2O8EB 3AR4A 2IZ7A 3CLSD 5EUCA 3QITA 1D6NA 2DC1A 2H4HA 4N5MA 4Y1RA 1BJTA 2PLFA 2FAXA 2XE6A 3NHBA 3NTXA 3J7AC 1L0BA 3ZVRA 4NR0A 3JALB 5CTAA 4ZCPA 4JC5A 1E2FA 2FLKA 4GL4A 4DGQA 2QYOA 3AERA 5FPSA 1IUPA 1FF9A 4P5PA 1P5JA 1X8KA 1F20A 2FR8C 2QY6A 1RBZA 1Y8QB 2VNSA 2WSLA 4IJKA 1NUPA 4XDYA 2FHPA 2R66A 3AY0A 2V7TA 5BSWA 1V3TA 4P7JA 5ENVA 1ISHA 1ZN2A 1E64A 3NYWA 5IJ0B 3HP1A 2DZDA 4IDOA 4TYMA 2R87A 2XCTB 3HKCA 2ODPA 4IEIA 1O97C 4QO7A 5ILGA 3ZG6A 4KYTA 2A94A 2F3RA 2HWKA 1Q5PA 1AO0A 1FLAA 2D2EA 3HJRA 2WTUA 2AQHA 2AE2A 4CM1A 3HU2A 3CEJA 4CKZA 1UMDB 1XRPA 4I81A 4IIUA 5A3RA 3HC7A 3FHCB 2N0SA 4OFBA 4LXTA 3TFWA 4PLPA 5H3CA 4ZGGA 2F4VB 1V0JA 2QL7A 1NQVA 3IFSA 3QPDA 4Y6OA 3UQZA 3W3AD 2IXTA 4EGJA 3G9QA 3R40A 4OFZA 4P53A 5HWSA 4BKMA 1L6RA 2B8JA 3MYRA 1JLLB 4BJ6A 3QK7A 4BKRA 3W6UA 2UDPA 1R5JA 4PPFA 5KSYA 4ZTUB 1VLLA 5BN4B 1SVWA 3FMIA 4OA5A 5FOXA 2QNIA 4EJSA 5LQNA 3U0VA 2AFIE 5DHSA 1CE8B 3QGMA 5E3IA 1ZM9A 3PUVA 3OC6A 4W7HA 1H2XA 2H4YA 1CXZA 1UR5A 3FVWA 3WGKA 4Z4GA 3GJRA 2W8BA 1X8XA 3RS3A 3USZA 3W5JA 1H9BA 2X1HA 1RYYA 3AWDA 4B45A 2AZMA 4Y67A 3FY4A 1ENOA 2VTBB 1NI3A 4IDGA 3UN1A 2NQTA 3BRQA 1KDRA 1TF2A 2VK8A 4YUXA 1AUQA 8LDHA 5LMCA 2ZI9A 5IJ9A 1UKZA 1E7RA 1JHRA 1VA4A 5LYYA 3CF4A 1SMKA 3S99A 3WNQA 1U0FA 2WHRA 4CM9A 5JMOA 1IM8A 2G1AA 2O6HA 2V5VA 5C1OA 2PX3A 2JA2A 4ZCLA 2VF4X 2BBSA 2WHEA 1IDN1 3IDZA 1DFHA 1YULA 2VJAA 3WSVA 4AP5A 5J23A 1RZRA 1E3IA 3G2QA 3HJHA 4V0QA 1CFZA 1L8XA 2JI6A 5AVRA 1FUEA 1VCHA 2YC4C 1IM2A 1JHDA 3F5SA 3PQFA 4LBVA 4ZVVA 1XA4A 4EY8A 4XUDA 3SMVA 3ULKA 3UWPA 5BSEA 3OQJA 4MPRA 2IODA 1IUKA 4R0MA 3P9ZA 2FMHA 3GJQA 1ACJA 4MWTA 4EDHA 1IUOA 2IJGX 2FGJA 4JA2A 4DCVA 1GZ7A 1XE3A 1SZJG 1ORIA 2BF7A 3QXXA 3RUFA 5TMDA 1Z26A 1R64A 2Y0EA 4WN9B 3L1JA 1S0UA 4J4TA 1MOQA 4W5TA 4FTWA 1KPGA 4E2ZA 1R0XA 4OKSA 2ZUCA 3QLEA 5FUYA 2QX7A 4J0GA 1EPUA 2W70A 3JQBA 2W2VA 3EG9A 1C7IA 3CZ4A 2O7VA 1GY8A 5B37A 3FWHA 4LQ4A 1UJMA 3GDHA 3Q3GE 2CSUA 2X1LA 3CNLA 3CUTA 2Q6KA 1PJ8A 1SBNE 1IQRA 5K20A 1RD4A 3W77A 1ND5A 1Z83A 2Q6OA 2JGDB 4OATA 5IJXA 1RKBA 1E1LA 1HOXA 2PT9A 2NXNA 4RIIA 1IBCA 2YS6A 3WTCA 5BY2A 2Q3CA 3BS4A 4B4OA 1OT5A 2QZ9A 1IXKA 4RSGA 2VDWB 2QVCA 4GPTA 4RHXA 4TXHA 5IH7A 1C4WA 2XYRA 4QVIA 2K6GA 2W4MA 4FFMA 3MTIA 3ZKWA 3ESZA 1T1EA 1DT3A 1T3LA 2ZYRA 2CWDA 2Z6VA 2GI4A 3EARA 1KMQA 4N7RA 3ETJA 4D4MA 1J21A 1FBNA 3I5XA 1LQ2A 4I50A 2GARA 3RAFC 1ZOOA 4J3NA 1A9PA 2V58A 4XA8A 5ED4A 2PBLA 2Z43A 1SVMA 1ZJ5A 3TX2A 4C87A 3EEOA 3PV0A 1P4JA 2BJWA 1V37A 3A6JA 3IVCA 1EB8A 4XEHA 3DXZA 1U4OA 3QLTA 3VI3B 1OVGA 2CXXA 1VPVA 4QQFA 1SD2A 3PNMA 4FLMA 2VJYA 3BEOA 3N7UA 4WA8A 4TSKA 4TGLA 4WNAA 5H1YA 3VU0A 1FFDA 5I7SA 3K9WA 1UEIA 3OVMA 4U63A 3TOCA 3STWA 4ZK6A 3EPHA 1L6IA 3E7DA 4CMIB 3J80A 1G7TA 5HR5A 3MRVA 3R3SA 2QN8A 2C8LA 2PGIA 4V02A 4YONB 2MSDB 2G82A 3VNQA 4HADA 4IY1A 1CIPA 2FPUA 1GZ4A 2PA0A 3EF1A 4CGZA 4KR6A 4PG5A 1VKNA 1GPLA 3F4LA 1XNJA 3LK6A 5A4FS 3H5AA 5KNDH 1W0JD 3P0HA 3PZRA 1WHTA 2QTWB 3KEMA 4O2RA 3OFNA 4RZSA 3SOZA 1Q7RA 3BAZA 4M8KA 4D98A 3SZ3A 2AOUB 5KWSA 2WJYA 4DLLA 1Q50A 3HH8A 5FLKA 1E7WA 1XCOA 1PK8A 4URVR 4PZ0A 4QGHA 4LDNA 4DDHA 3U4GA 4CL3A 2WIKA 3IX7A 1I94B 1CT9A 3H84A 2AI2A 3CS3A 3G7UA 1G7CA 2BZGA 2FFQA 4L8GA 4EQ6B 4EFMA 1KKMA 4C2TA 1KI9A 3HY4A 2HHHB 1Q7BA 4A03A 2J9FA 4EGSA 4FN5A 2FF5A 1AQNA 4G5XA 5EQJB 4D9IA 3PRKE 4ZO4A 3VHXA 4MUGA 5ALQA 2PWPA 3EMBA 4JT8A 2Y77A 3DFFA 4XGRA 3VNBA 2GZHA 5E95A 2C29D 4X6LA 1XMOB 3THXA 3FGNA 1Q7CA 5K0GA 1J24A 2EKQA 1XWWA 3H4TA 1JEYA 2ZAGA 1PDOA 1PT7A 5T7BA 4C6RA 4URFA 2LDBA 5A4AA 2NXJA 3GZTB 3WYFA 4LHSA 4GP7A 1Y4AE 2PKRA 2CMGA 3GAAA 2J85A 2EU8A 4JELA 1G4HA 2HK7A 2JAXA 1H8HA 1ICEA 2IDMA 1P1FA 3HJAA 3RC7A 3K6SB 1YCDA 5KNBA 4DY6A 4RYLA 3FZQA 2YIMA 2QM3A 4NMLA 4D02A 2PMCA 3OQNA 4CQLB 1JVNA 2BKAA 5LQCA 3EMDA 1KXJA 3B1FA 1S7GA 4PGMA 2P8SA 3HYNA 5TC4A 5ULLA 1CUSA 1D1PA 1G41A 1JSLA 2B4TO 2WJWA 2A3NA 3P9IA 1A5TA 1EXNA 4IJQA 4KXUA 4Q9HA 5T3YA 2P5YA 3V80A 4OQZA 4AJJA 5FUMA 1MO3A 4GOJA 1DPFA 2AW5A 2Q07A 3OCUA 4QDJA 5C9ZA 5K9ZA 1E5QA 4FD3A 3OE7D 4GT1A 1CQXA 1WZIA 1E3EA 2CLCX 1FNMA 2W11A 2QI9C 1MENA 1H94A 1I10A 3IJEB 4UATA 4J0IA 4F6RB 2GRAA 1KQNA 2QJRA 4U6SA 1JTFA 5LZ8A 1G5PA 5TS3A 3E3NA 5IC6A 1FYWA 4EJ6A 4AO6A 2BGLA 1O96A 2QA5A 1SHZA 2YZ2A 3D0KA 4IV5A 5FUQA 1EK2A 2GZ1A 1I9CA 2HN9A 4NCJA 1ODIA 3NOVA 3TLEA 3PPXA 5HS6A 3KKEA 5D84A 4CGYA 1GQOA 2IWHA 4N0MA 4ARZB 4CKCA 5I8WA 1BW9A 3QE9Y 3ZWBA 4Q3KA 4UTZA 3G0OA 4HKTA 4CYMA 4G5RA 3VDXA 4EA9A 3QQPA 1HLDA 2NSLA 2KSQA 4FI3C 2IUTA 4OGGA 7YASA 4RWEA 3IOYA 1PGOA 3PUJA 3CUSA 3NRBA 4NBNA 4K9RA 5FOSA 1EE2A 2QVBA 5JXGA 5EFZA 4URXR 1L4MA 5ICEA 3UMYA 3NWJA 3SE0A 1YNOA 3CRVA 1CULC 3PKJA 5CDFE 1O97D 1TIPA 2NVWA 4IHAA 4FR0A 3VO1A 2OCDA 3PLAE 1BWSA 3GAZA 4C43A 2BHTA 3KETA 2P4QA 3R5FA 4MDHA 4F5WA 3KV3O 1NF3A 3SXUA 3UB4A 3RF6A 4Q5IA 3MUNA 2CXNA 2HNBA 3C1TA 3JALA 4HZUA 4C04A 2O2JA 1GSIA 4HDCA 1EK0A 5EKSA 1CBUA 1PZFA 1QRAA 1L5MA 2MMGA 1IB6A 2PEZA 4N6GA 2Y4NA 5TMBA 3INYA 3SBXA 5HKOA 5KHOC 1Y8QA 2DPLA 2GVZC 5J59A 1SQGA 3ZWDA 1YL6A 2ZAYA 3FZGA 2PJUA 5DLPA 4CQMD 1DHRA 2YHUA 3B2NA 3D4OA 1JW9B 5IJ0A 1W6RA 2ACEA 3OF2A 5FL7A 3P96A 3G2OA 4Y2RA 1YIAA 1UUFA 3W6PA 4IW3B 4E08A 4MWZA 1XD2B 2HJHA 4XTCS 4R8RA 4K1XA 4BFWA 5LMNB 2PIAA 3D1JA 5K8VA 1W6UA 3C85A 3KSDO 5KB3A 5AI5A 2AJCA 1UMDA 2EJCA 4RCVA 3DMRA 3PSAA 4I66A 4YP7A 5FTNA 1YDHA 4QPCA 1L7AA 3AR6A 3VU1A 1ORHA 4QOSA 4L15A 4ZHSA 5F4BA 4YDHB 1YRWA 2HUPA 3LUAA 4PZPA 4EH1A 1YIDA 3NNDA 3H7IA 3L82B 4UARA 1X87A 3JY6A 1XZCA 1CIVA 1YMVA 3ON5A 3PD7A 3F6BX 2H2AA 4BMVA 4KK3A 1QYVA 3ET4A 1CE8A 3CF0A 2JLZA 3I62A 1U2DA 2YMMA 3C3MA 3R8CA 2X3YA 4KFRA 2ZRBA 1ONBA 2G1KA 4LKOA 4RZ3A 4IZIA 3UUWA 4YX9A 3EXG2 2QGNA 5AW6A 2PQ0A 3LFUA 1N34B 2PQ2A 3KCNA 2XMPA 1PYOA 4CLHA 1I1NA 5C0OE 5BWCA 1CY1A 1P7ZA 2H1LA 5DWVA 3RT7A 4WZBB 2F1JA 4ZEXA 5BSFA 4K6HA 4HMQA 3ZU4A 2CCGA 1OH8A 2OK7A 1LF0A 2AUMA 3VR6H 3PNBA 3QVUA 1S96A 1SELA 4EJSC 4L2IB 4WXRA 3O1IC 4OP3A 1Z22A 6GPBA 1FMTA 5AFSA 5KQRA 1P3DA 2R97A 2UZ3A 2WHQA 5M04A 1MVNA 3PNVA 1EVLA 4WJLA 4NBRA 3Q8MA 3FNBA 1W46A 4E5UA 4EDFA 1UKEA 1W88B 1Z17A 1FP4B 3FOEC 4M0FA 4BFVA 3KK0A 1P62B 4AVYA 1UXKA 2PZMA 5LLTA 2ETVA 2XQVA 2Y99A 1MX3A 4NYIR 4WVLA 1WZ2A 1D2AA 3V2HA 1XXLA 4LDZA 1BWQA 4MAFA 1O7JA 4M1KA 4MLDA 3TKAA 4ESOA 2G8NA 5E6RB 3QI2A 1N1DA 2OB1A 2DHRA 4OYYA 4P80A 4F4CA 2ZI5A 1Q1BA 5ALNA 3T52A 3ESDA 5DLEA 2C2KA 4DCGA 4EG0A 2JLYA 4N01A 2AC4A 3MMZA 3PWZA 4RM2A 3GROA 4R98A 4RK7A 4A2WA 2W6PA 3DPIA 2FRDA 1LC3A 4RVDA 1Z0JA 4DR1B 2Z5GA 1RRMA 1XMPA 3G2LA 2DHCA 3GPCA 3ONVA 4K26A 4EYSA 2GSDA 3RK0A 3NHYA 5JYEA 1HF3A 3ZVMA 2Q8NA 4UFPA 1M54A 2ZVPX 1VL2A 1QPZA 1T15A 1Q0SA 2YUIA 1IPEA 1CHDA 1CFJA 1KJWA 1L7RA 3HJNA 2QT9A 3PC7A 4KIWA 2OCGA 3PDCA 3OUUA 1TVKB 2OO5C 3VTKA 5I5EA 2IP1A 2X0DA 4M9SA 5ERXA 2IYRA 2DY0A 3G0GA 1T35A 3O9ZA 3GEIA 2JGDA 2X5JO 4IVQA 2QMEA 3GW8A 1PK7A 1JJ7A 2IBMA 4RJIA 5TGZA 3OZ7A 1RXIA 4F06A 3ED5A 3ZYCA 3I28A 4NG4A 2BH2A 4WLFA 2VDWA 4PGGA 1QS0B 4G5YA 2SKDA 1Q1QA 3LCVB 4PSKA 3PX2A 3CZCA 3A2KA 4JKOA 5KJEA 3MWLA 3TDNA 3C3YA 4KDFA 1OLXB 2GCGA 4LNHA 1YS9A 2PTHA 2BTEA 2RHTA 4PBRA 3MB5A 2FSIA 1QIDA 2XADA 4XJSA 3AFNA 3WLNA 4BPBA 5JQWA 2VQDA 2Y9MB 1X2EA 4D3XA 2HK6A 1XN4A 4YO8A 3HYRA 1YR3A 3MN1A 2HI0A 2QZSA 1BWPA 5A5DA 3B36A 4OXRA 5KTRA 1PYGA 3IBSA 3R7FA 4EHAA 1FTSA 4GLOA 1T5DX 1GQQA 3ODPA 4GZ3A 4L7QA 4MQEB 3ZXSA 1UOOA 3OX4A 1NVMB 3T5CA 2I7VA 4FB5A 1XNGA 1G3UA 2JGLA 3FETA 1CUAA 3STTA 3WIVA 4B7XA 3F6YA 4NMHA 4C0JA 1E2EA 1ILWA 1DWOA 1JQLB 1UPFA 2QKYA 3P2IA 3PNQA 4CMIA 3A1NA 5F7ZA 4IVRA 4MA4A 1T8PA 1WLSA 1X74A 2YRFA 2ZRMA 2DJ5A 3BCHA 3BE5A 4NPAA 5KU7A 3WV4A 2X8BA 2R4UA 3KRTA 3DB1A 5EVCA 5ESXA 1W19A 4OAOA 4R05A 3RTBA 3U1TA 3UA3A 1CDZA 4BHTA 2QQ0A 2XHEA 4ZYUA 5DGCA 1O89A 1O95D 1AJEA 2AOUA 1GTZA 2YWHA 3CXRA 4EX6A 5FBRB 3DM9B 4JP3A 4OBWA 4PZEA 2Z3ZA 2PLWA 2VF8A 1L5SA 4K6OA 1QNFA 3ZH9B 5JJBA 1USIA 1XELA 4S1NA 5AOBA 4A6DA 3C8ZA 2MYPA 2WWTA 2O6LA 2FWAA 3GNQA 3OSZA 3HEBA 3VX4A 4GZLA 3HGMA 4NU0A 4EQ6A 5KHLB 2HSJA 5TXGA 1FDWA 2BBWA 4RFVA 2I80A 4K6FA 2EF0A 4TRNA 1IAVA 1Q57A 4XCXA 1T9AA 2NVOA 3QNWA 2JFQA 4WI1A 4DWWA 1EFPB 4P83A 2C1EA 2P41A 1U0GA 1ZZEA 3Q8LA 2ZYHA 4YXFA 2Y1GA 3B1KA 1USVA 1QCYA 4XD7A 2PH3A 4DZRA 3UXEA 4UMEA 2CDCA 5EJIA 5T67A 3FPLA 4FHEA 3WFIA 3BHIA 5A6VA 3P9KA 5DTJA 3TI9A 3G2JA 4OLHA 5CXXA 4NXNB 4ZT7A 5JHHB 2NO0A 3K6SA 4IH4A 3O9VA 1UMBB 2BP7A 2PUAA 3UIEA 1KI1A 1OF1A 2Z83A 4PF1A 4POAA 1YK0A 1EWTA 3AW8A 1W9MA 4BUCA 4F2GA 4CQLA 4ECAA 2WWFA 3ETDA 3LQKA 2IT1A 1KZHA 3R3JA 1KSJA 1NMZA 2VP0A 1GUBA 3AB3A 3OPVA 4QYWA 4JL6A 3T7SA 2OFPA 1U3CA 2PQMA 4HRYA 3U3RA 4KEAA 2QMOA 5JRZA 3DO6A 4M8LA 2FN4A 4NP6A 2A9QA 1UP7A 4C21A 4E21A 2FQQA 4IWYA 5IDYA 4YP1A 4PVCA 1YVRA 3EIEA 4K6KA 1O94C 4P4GA 1Y1LA 2CEKA 2ZUWA 2QD4A 3HBNA 4GOND 2GHTA 5FR2A 3COWA 1FK8A 1GT91 1M2FA 1RI3A 4UM8B 4F6RA 2IBTA 5CT6A 1NVUQ 1VHQA 2NZ8A 4QXPA 3H6GA 2GZRA 1R4MB 3E4CA 3PHGA 4P5EA 4EQZA 3GB9A 1TX4B 1FZTA 1O03A 1CNEA 1CUJA 2NX2A 2O3UA 2WT9A 3N3BC 2I2FA 1JQDA 3A9TA 2Q3DA 1YZNA 2RGEA 4XWAA 1CUCA 1Z0ZA 4HC4A 5ESWA 1UODA 4LBZA 2Z1DA 1SQ5A 4YDSA 2G08A 1E32A 2XWBF 3KOXA 5HA5A 2HNAA 3SQNA 4ARZA 4BRWA 2SCUB 4D82A 4UQLA 5IF3A 1PFKA 2AOXA 4FE3A 4J7UA 1J0DA 2AN5A 3N8IA 5HCNA 4EKDA 4IO0A 5JASA 4MCHA 3VOTA 1OOEA 4KMMA 1YVEI 3VUFA 1H2ZA 7GPBA 3PGJA 3RIYA 5BW5A 1JFSA 1C9YA 4FT4A 1Y6RA 3BMOB 1OLSB 3C3CA 4QGGA 1NG9A 3D4NA 2WU4A 1Y1SA 3IJPA 1KY5A 2YWCA 1C0IA 3IHTA 4D97A 3B12A 2H0AA 3M9XA 1CR0A 5GZ1A 3RKSA 1ZRMA 3SX4A 3L8YA 4GBGA 4ROTA 4UU0A 1VKZA 3T99A 4DR3B 1LRKA 4RJKA 4Z4QA 2WSBA 3B7GA 1VJ5A 1ZH8A 3OP1A 3RQIA 3E5MA 3CTPA 1G59A 1ZCJA 1CUXA 3HUDA 4OM8A 1R3DA 4B6JA 1K0UA 2WVJA 4A6XA 5INTA 4GYWA 5JMTA 1OW3B 1JDPA 4NYJR 5AJZA 1EKXA 4FOPA 4O4HF 5EIAA 1TUIA 1PD1A 3A6LA 1V5IA 2P9GA 3IXQA 3EIXA 1D2HA 3G5LA 1XN1A 2IV3A 2ZRQA 3U2QA 3WL4A 4HNGA 3UHJA 3R0ZA 5JIBA 4N0PA 1WF3A 4IDCA 4RY9A 4UHFA 3PWKA 3ACBA 2I6TA 4RMNA 1MO2A 1WMSA 3AHEA 4YUAA 1JL3A 4DMKA 2JZOA 3H8VA 1PR3A 2V7PA 4J4BA 4R8VA 2RGBA 3QM1A 4LRQA 4YEDA 4UU8A 1IZ9A 5JH7B 5FFMA 1FPMA 1EINA 4JJIA 4IGKA 1ST3A 2WB2A 3VKUA 2ZBFA 3BK2A 4JROA 5SZIA 3FB4A 4XQ0A 5HIIA 3EWSA 4OYHA 4UE3S 3S7ZA 1XJ5A 4MW4A 2VF5X 3JAKA 3L8DA 1UXHA 4B80A 4IPTA 3VTFA 3GG9A 4HQKA 1S8FA 3W79A 2XUFA 2JHGA 3CZMA 4FU0A 1X70A 4ZOAA 4ZVUA 3G0HA 2WFLB 2J1LA 1GV1A 4D4GA 3ESRA 3DFKA 5KX5B 5ICMA 1CP2A 3HFJA 3TLZA 2ZWPA 2W9XA 2C7VA 3NBAA 1WPXA 4FCTA 4PYQA 5G1OA 3AIIA 5A0FA 4WZBA 3NHAA 2EIXA 1PX2A 1R5OA 2P4SA 3ANYB 1BU5A 1PIWA 2JVKA 1QH0A 2XI4A 3A6ZA 1G2OA 3G23A 3VR2A 4UUPA 2BI4A 1XZQA 4MJ7A 3AKYA 4MLCA 4CM9D 4L2IA 5G1PA 2Q5IA 9GPBA 5IUJC 5KTKA 3TQIA 4AURA 2WF6A 4ZTBA 1U2DC 1P1BA 3DR5A 2F55A 3G9ZA 2OG2A 3NKVA 1CCWA 3HFSA 3UGQA 5TF4A 2C3MA 2BV3A 1KPHA 1Y9EA 2CF6A 2MHCA 1W88A 1ZNZA 1FP4A 1JFLA 3GRUA 4LJ8A 4RMGA 3WL7A 1L4EA 3UKDA 4P4NA 2HF2A 4JR1A 2FWRA 3CH7A 3T1QA 2BL4A 2E4VA 3SYRA 5IT9A 1P2BA 4X9XA 2IU4A 5BORA 2ZEJA 4XGNA 1I51A 5EI5A 1U0OC 5E6RA 5KVQA 5TY0A 3VU8A 1E6WA 4C0BA 4Q6WA 4WQMA 1A9TA 4OLAA 2JI9A 3M34A 1BROA 1P9RA 4P3KA 3V4OA 2PLNA 3I0MA 1T6ZA 3QPUA 2XT9A 3VPCA 4B3HA 4KFSA 3IT1A 1EGVB 4HFRA 5AK6A 1XKXA 4BNIA 1P9OA 1TB4A 1JKXA 3PYMA 4Y6PA 3PNYA 3KQYA 1EWQA 1D9ZA 1MB3A 4QXRA 4BYGA 5MN6A 1BFDA 1YRBA 3EDRA 3KZMA 1MAHA 4Y2HA 3DOEA 3H99A 3IVMA 3LL4A 2QJFA 3I73A 2IBSA 3QJGA 1EEHA 3AU9A 2XUIA 4S05A 3UA4A 2TMDA 3EMKA 4J7AA 2Y6VA 3B8EA 3L04A 1ZC4A 4MPDA 3WOVA 2ZETA 4I36A 2YVUA 4ER3A 4MYRA 2Q7DA 2ZT5A 3L1IA 1TVKA 4CEIA 3JQAA 1EGMB 2WU8A 3ZCTA 3QE0A 2F9LA 3OHMA 5ITZB 4F3KA 4BGVA 4ZVOA 3VH1A 1JKIA 1W4ZA 2H0RA 5BRAA 3LHDA 2FRDC 2ZTUA 3QWIA 3RU2A 4ZCTA 1SULA 4X84A 1UMCA 1HDZA 2A58A 4IQFA 4HB0A 4PVDA 3ZZUA 3ZWCA 4ER7A 1PZHA 1PL7A 3BJEA 2NPIA 1L7MA 2QE7A 1JILA 2WMOB 3EVFA 3RRMA 3PJDA 4L50A 4MW5A 1P9NA 1VI2A 2VH1A 1QS0A 4HD8A 4DCSA 5J43A 1WPGA 3LHFA 5HDBB 4RTJA 2J6HA 2DRIA 2VP4A 2VUIB 3CLRD 4QDUA 5IDXA 2ZSEA 1EVEA 5ETJA 4CI9A 1OLXA 3NC0C 1QM5A 3O5AA 4W9MC 4J0CA 1P4SA 3DYIA 3BQNB 4WK4B 1MJGA 4BMDA 3OFJA 4GC5A 2H2HA 1GYQA 1F17A 4KBGA 3HA7A 3ZOZA 1YR6A 2HWYA 3ROEA 4TWRA 3NBFA 3CW9A 4FYJA 2X0RA 1XDZA 3DPUA 1TTHA 4DB2A 4WZ6A 3F5QA 3WGTA 5IXJA 4ZZIA 1Q6YA 3P9RA 3FVQA 1V8DA 4MQEA 5F3WB 1LNSA 3DBHB 2YINC 4I1RA 3FVVA 3CM0A 1O6BA 5IDQA 1R74A 2CMHA 3IUMA 5FV7A 4G0UA 4ODIA 1D9XA 1UDCA 4LRSB 3QYFA 4TYPA 4YPFA 3WLRA 5TQVA 2XKKA 4BDTA 1P31A 1UM8A 1GYPA 1P9WA