3KIPA

Crystal structure of type-ii 3-dehydroquinase from c. albicans
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
147
structure length
143
Chain Sequence
LVKKVLLINGPNLNLLGTRYGTTSLSDIEQAAIEQAKLKNNDSEVLVFQSNTEGFIIDRIHEAKRQGVGFVVINAGAYTHTSVGIRDALLGTAIPFIEVHITNVHQREPFRHQSYLSDKAVAVICGLGVYGYTAAIEYALNYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Macromolecular crystal data phased by negative-stained electron-microscopy reconstructions.
pubmed doi rcsb
source organism Candida albicans
molecule tags Lyase
molecule keywords 3-dehydroquinase, type II
total genus 52
structure length 143
sequence length 147
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2009-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 3kipA00
2C4VA 1GU0A 4CKYA 4L8LA 2XB8A 2CJFA 4CKWB 3N8KA 3N76A 3LWZA 1H0RA 1GQOA 1GTZA 2DHQA 1GU1A 3N7AA 1UQRA 4RHCA 4KIWA 3U80A 1H05A 3N87A 1D0IA 2XDAA 2Y76A 2XD9A 3N8NA 4B6QA 4RC9A 4KIJA 2UYGA 4V0SA 1J2YA 5WRFA 4B6SA 4CIXA 4KIUA 2BT4A 2Y77A 1H0SA 3KIPA 2C4WA 5B6PA 4B6PA 3N86A 4CKZA 4KI7A 3N59A 1V1JA 4CKXA 2XB9A 4CKWA 4ZC1A 4CIYA 4B6OA 2WKSA 4B6RA 2C57A 2Y71A 4CIWA 4CIVA 4CL0A
chains in the Genus database with same CATH superfamily
3G5AA 3CRQA 4L5CA 3OJCA 2QTNA 3CBGA 3L7KA 1FBTA 2OV6A 3HVJA 3QUAA 3L0ZA 2NPIA 3HBLA 1AA6A 3BRSA 3WWPA 2NO5A 4UFPA 3GFPA 2B82A 2OXCA 4LDPA 5HTOA 2Z8ZA 4P98A 1KVRA 3KPVA 5AFSA 1R27A 4BWFB 1M6YA 4V1CA 5LQUA 2ZWMA 3VJMA 4M9XA 4D9NA 3B1VA 3VDMA 2VG8A 1VG1A 2YCLA 4PYRA 1UDRA 1VJGA 1EZZA 1WBJB 4MUFA 3EUEA 3PZRA 5BQ3A 1I33A 2O6LA 2ZAYA 2R4QA 4M76B 4RMNA 4FGUA 2P91A 4UU0A 2E0IA 1GPWB 1CU1A 3R9XB 1WR8A 3ZV5A 4DLTA 5BNWA 3WLPA 1ADFA 3G8AA 3AF4A 3K1YA 4ZPXA 4FJ1A 4ERXA 4NU0A 4JBXA 1L3CA 4BZPA 3RVDA 3ZDYB 3V2GA 5ICGA 3UPTA 1WZCA 1P6UA 1P7CA 1FYDA 1F60A 4PNHA 1U9IA 3ONDA 4AJ2A 2Z4RA 3RAGA 3WWOA 4ALMA 4DDKA 2JFBA 4DJTA 5JBNA 4CG2A 1KEZA 4LHEA 1MO5A 3OZIA 1DCMA 3QFFA 4Y98A 1CDOA 3WVNA 4RVSA 1MIHA 4JLAA 1G64A 3G2NA 3HJHA 4WFIA 1Q2UA 4CTKA 1MT0A 1PNVA 2NO7A 2JKZA 1MB4A 3EOAI 5BN1A 2NXCA 1JKIA 3FHCB 4BB9A 1QNFA 5FORA 4EUSA 2D62A 4HWOA 4UHBA 5DMHA 4JJAA 5HF8A 1KORA 1TK3A 1KK2A 3KKNA 3WLQA 4YI3A 2Y67A 1Q20A 2KS6A 1Y8QB 2L19A 2D4HA 4FSXA 4C6RA 1QS0A 3KVRA 2NT3A 1W5AA 3ICCA 3QVGA 1DQZA 2G8NA 2QENA 4JFRA 4Q01A 4EG8A 1E59A 5FADA 3F3MA 4EFKA 5AK4A 1TPZA 1MG0A 3Q8LA 1A8PA 3MTJA 1NBAA 3LCRA 3CKMA 4H0NA 1E62A 3UJNA 1ECGA 5KYNA 5FQNA 4CMEC 1NUAA 4RACA 5C0OE 4OK3A 3PUVA 4GICA 4YB8A 5E3HA 4TV9B 3D8SA 1T6NA 3JQDA 4F91B 4GZLA 4V0LA 1YB1A 5DP2A 4NTZA 2VT7A 1JA1A 5BSUA 2BZGA 1RHRA 1XFAA 1Z16A 2GOYA 2WZCA 5D6NA 1N2CA 4ZQEA 3RARA 1BVRA 4C3OB 2QTZA 4WUVA 5KTKA 3ZVMA 2X7XA 2B94A 1MO2A 5DGCA 3V42A 4BKUA 1GCUA 5B5SA 1CY0A 4HH0A 1BE1A 1A7AA 3GHHA 1K6EA 3HA3A 4Z86A 2CK3D 2O8BA 2YVQA 3EDMA 3FYHA 3I5MA 4OHXA 4F92B 1Z33A 1XUOA 4J4HA 1EBBA 4XUGB 5EMKA 5JG7A 1MHPA 5L3QB 2J7PA 1KZ9A 2DPHA 2R8EA 1AX9A 3A6KA 4HYTA 5CVDA 1VA5A 2FHSA 2R6GA 1H23A 2DBRA 2IYXA 2JGRA 2WHRA 2XXJA 3B89A 3GAFA 4U0JA 4UJ5A 5EE9A 4ZAWA 2J32A 2YL2A 3RTBA 3CLSD 1RWKA 1WIWA 2BPOA 1WD5A 5GPBA 3DTVA 4O2RA 4LC0A 2ZIWB 4IJMA 1ECBA 2ZTLA 1EK1A 3IAS1 5F77A 4D82A 4CQLB 2EJWA 3E81A 2YN0A 1X70A 5FBQB 3ZVNA 4PSDA 4ZZ1A 2WSLA 3CNNA 2GZ3A 3HP4A 1KAOA 4GNRA 4LTNA 3FBTA 4X85A 2BEVA 5IU6A 1HTWA 4E30A 5BORA 4GOJA 2R79A 2BMWA 5IJXA 4AZ3B 4LVNA 1KZYC 1NT4A 1ZESA 2CWWA 2YWJA 1ZAYA 1IZYA 3MWYW 1G4HA 2WYUA 3V2IA 4AXBA 2B99A 3AIMA 4HB3A 2OM6A 3EBLA 4Y1GA 4YAJA 2P40A 3DLTA 1FTWA 3O7MA 4JBNA 4XM2A 4XKJA 3DR5A 2EZ9A 5LZ7A 3Q6NA 1ZK0A 2W6NA 5JSQA 1T15A 1XTUA 1YE3A 3QHPA 2DR2A 4YC7A 3THSA 2OP0A 2V0CA 2PA0A 4HNAB 4BLOA 1TKCA 3ZZ1A 1YVDA 1XZNA 4LPKA 5K09A 2C8JA 1IQRA 4CUJA 4DOMA 5ILGA 2QMEA 1L5FA 5FO1A 1D5WA 3BWBA 1Z8NA 1TUBB 1XCBA 3JARA 1GL7A 1HRKA 4ZV9A 3VOSA 3VZQA 5I7VA 3O21A 4X1KB 1JT2A 5BSTA 4PPYA 4ERNA 1L1RA 3A10A 2DU8A 2B4KA 3NFYA 4FZRA 3IDQA 3P2YA 4A5OA 4L28A 1SC6A 4ZCLA 1KMCA 1KE2A 5LPNA 1NJ1A 3F1KA 4XIYA 5L6MB 1CZUA 5EPOA 2F6RA 2Q6LA 3BMCA 1NP7A 1NW7A 3JS5A 5ITVA 1NNLA 4WLEA 4TWBA 1BE0A 2KJQA 4QFDA 2ZYVX 3W5CA 3QIAA 1XTRA 3AUYA 4XLTA 3GL9A 2VXOA 1TM7E 4C7KA 3QUCA 4JLVA 3E7FA 2WYIA 2XE8A 4OSOA 5LR6A 4RW0A 2HA5A 5DRTA 3R3XA 4OJNA 1J97A 3AJDA 1OC2A 2IU3A 3LBFA 3IE2A 1L7QA 2FPWA 3ACCA 4B8WA 2VLBA 2FHPA 3WDLA 1IOZA 4MWBA 1PZGA 1PFQA 1CV2A 1QCDA 4G2TA 4MVJP 4NMLA 3BHNA 3Q10A 5DWQA 1V8OA 3EIEA 3F5MA 3G23A 5G2OA 4RZ3A 3HEMA 4WY8A 3WK4A 4EH1A 5CAEA 2JKYA 2E4XA 3WGIA 1PG2A 1ND5A 4MYRA 1OBHA 3KBBA 2RGUA 4D3FA 4KYVA 2ABWA 4QNMA 2BMEA 1ZK2A 4FU0A 4AZWA 1CUYA 1G19A 3VUEA 5BT8A 4H3VA 1BHSA 2G3YA 1MRSA 2DFLA 1O7JA 3U7QA 3O8DA 4RMGA 5IM5A 1UINA 3RVSA 4RKRA 2OXEA 1HYQA 3F4KA 3J81A 2QXTA 1FMLA 1V3QE 4G0WA 3ITDA 1GGNA 1N6HA 2M98A 4FS8A 1ZBDA 3T1VA 2NU6A 1JAZA 2VZLA 3COSA 3DEIA 2ZROA 3AB8A 3JYOA 5DYIA 3RPEA 4BQQA 3ES9A 1GQQA 4KMSA 5D1NA 4NXMB 5T3YA 2FPOA 4E31A 2FJUA 4W6QA 5E2BA 4CIAA 4YJFA 1XMPA 5HS6A 2O3RA 3FXAA 3NEYA 1TM3E 4LI0A 1F38A 5HQJA 3C7CB 4HFNA 4LY3A 1BE8A 2BL4A 2DT8A 1PBTA 2DLNA 2CFSA 3HY3A 1DBQA 1IPFA 2GGSA 3P97A 3TR6A 3BH0A 4KXYA 3SEFA 1P1CA 4BEVA 4A8JC 3A58B 3NV9A 5BURA 1PJZA 1YUBA 1IVSA 2O54A 1M7BA 3ZUPA 2JIRA 5DO9A 1RQGA 4P3PA 1W1UA 4MPRA 1E8NA 3WDMA 2DUMA 2HNKA 5JJBA 4U7FA 5CXUA 3FJOA 4RTQA 2P9GA 1JU4A 2FRDA 3AEQA 1E4VA 2NU7A 1W4RA 4RGVA 2CLCX 3TD2A 4BGIA 1RBQA 4F06A 4L3WA 3A9CA 4RVCA 3ROZA 4B4KA 3K05A 4CF3A 3D3WB 2O2DA 3PSAA 4HH3C 1UBTS 2HHAA 2W0MA 4X7MA 1YR7A 1KS2A 5F51A 5SYAA 2V6IA 2AJDA 5EHNA 1LNQA 2C2BA 2VDLB 4G41A 1Z18A 1QK5A 1N2BA 4G86A 5CBKA 2PGIA 4A36A 4LMPA 2QW8A 4W5QA 2YZ7A 4TYYA 4DLLA 5A5EA 4M22A 3VOBA 4IHQA 3ZQ4A 1RWPA 3LT1A 2L42A 4PTLA 1L5NA 1W96A 5JVDF 2P9BA 1EZ4A 4GMGA 1CDZA 3VVLA 2ZITA 3DF9A 1JRLA 1O8CA 1TM2A 3IPRA 3R3SA 2Q46A 4INAA 3WL3A 3NEPX 3HO1A 4F2HA 1DDGA 4F2DA 4GPIB 1MB0A 4R1TA 3V4LA 5JMOA 4B9AA 4MRPA 4WFQA 4CQMD 4GBED 2RB5A 3JD4A 4NCAA 1IDOA 1REQB 1OB2A 3WGKA 3FHJA 2HJ9A 1INLA 2JA2A 2J07A 2V4MA 3O93A 4OLFA 4TV9F 3PHIA 3BCUA 2GPTA 2EU8A 1V96A 1DOHA 1ZM4A 4RKEA 5TSDA 3DM5A 3X2SA 3SXUA 1U3WA 1MPTA 1C9DB 2WP0A 4JIMA 3ZDRA 4I9HA 2B3TA 1DJPA 4U7WA 2V59A 1OKKD 3NC0C 2OE2A 4R3NA 4K9PA 1E5TA 3UAGA 2RBKA 3I73A 3ISJA 2QBYB 1Z0FA 4QECA 4D26A 2GF0A 3G17A 4A2WA 2BISA 4D9EA 3K9LA 3L1IA 1YR2A 5GJCA 2PYZA 4MCAA 2GM3A 4MRRA 2A92A 5CDFA 4DR7B 4G5FA 1NVBA 3CUYA 3VU9A 3PGKA 1DFIA 1U2DA 5LWQA 3O31A 4HN2A 4D44A 1K8RA 4EJ2A 4XR9A 4L4RA 3FYCA 1OHHA 2ILVA 4BE4A 1SKBA 1X2BA 4Q00A 3KZCA 4MPDA 3TIXB 4JBHA 1F6WA 4JA2A 5DEIA 5KX5B 3HLKA 5E7IA 4AO7A 2H8GA 1DEXA 1I2DA 4MQ6A 1MU0A 4X92A 2DBZA 2EFCB 1WJGA 2HU2A 2QZ4A 5EYPB 4QM6A 1CRQA 1M2JA 3EMVA 2ZTVA 1E0JA 4CEJB 4LUCA 4HDSB 4I66A 5CVVA 2WWWA 2E5FA 2I2BA 1KY4A 2XITA 1R50A 1RHMA 2ZJ7A 5FTWA 1C8KA 3DV9A 4BV2A 2XNDD 1BWRA 2F3QA 5KOJA 1UM8A 1VMEA 2FFHA 1F2UA 2VATA 1KHTA 2XUFA 5CX4A 4ZO9A 3WIVA 4YUAA 3PDIA 2EW2A 3KTOA 4J43A 3GZNA 2EQAA 1Q0QA 2GHRA 3F47A 4O25A 1R5NA 2BFAA 3K53A 4QUEA 1B6TA 1JHRA 2P65A 4XOIA 4H1VA 3NVMB 1FYWA 3K09A 2HQRA 1QKIA 2WFLB 1TX4B 2H2AA 1Q6ZA 2POQX 2X8JB 2BJWA 2O2YA 3C3DA 1NVXQ 1HDXA 1XDGA 1YKFA 4QGGA 1M7GA 4IOJA 5DZSA 3VR6A 1VLLA 3QLUC 5EC8A 5BN3A 1C7FA 3BRQA 3GYGA 1T8PA 2ZVDA 2DYKA 1JEAA 3B5EA 4ZDJA 5KJ1A 1IBKB 2FFJA 3U7HB 4G0VA 3VDRA 4RSGA 5LQCA 4B3JA 1V3UA 3KL4A 4QL3A 2AL7A 1U5AA 3Q12A 3KWFA 1ZZGA 2WI8A 4J6EA 4KIFA 2W6JD 4CIBA 2Q8PA 1J1ZA 1LA2A 2PPVA 3BB3A 3X44A 1FFAA 1JLSA 1XRQA 3TSAA 4BLTA 4F9GA 5DTQA 1VBKA 3A3YA 3OPNA 2ZIUB 1E61A 1UDWA 2ADMA 5J2TA 3I05A 2FG5A 3K0BA 3E2PA 3PFKA 4LYFA 2ZBQA 4PRZA 4BNNA 4WKNA 4DXAA 3KZNA 1KYTA 4W7IA 3LD9A 1CTQA 2EBUA 2HL6A 1YJ8A 4M7RA 5D3MA 4RPJA 5D5HA 3WG9A 1EWVA 1MFPA 1MB3A 3QRWA 4CW7A 5JLAA 4NHOA 4OIMA 1XZJA 4ZYUA 4I7EA 1OXMA 4ZI5A 3BL5A 1FXWF 2LVBA 2EDCA 2EWMA 1ZP6A 2AX3A 2G5TA 2VJLA 3IMKA 5B57C 4GR9A 1K5PA 1Z73A 1K7CA 4X6YA 1FTSA 2EFDB 1NXWA 2NSDA 3MB8A 3N1UA 4JP3A 5BNTA 1GAEO 3L5OA 4LXGA 1HOXA 3ADKA 4L1KA 2CXTA 3DZKA 4UTOA 2ATEA 2O1WA 3HYCA 1P9OA 2B20A 5KYVA 4EMUA 2D1FA 5CITA 3W2HA 2WSYB 4HDRA 1ESMA 4Q15A 4RHUA 5EFZA 4QOJA 1RYNA 3HI6A 1RKVA 1EQAA 1U9CA 3WK7A 1P4JA 4I4TA 1ZM9A 1FVHA 5DM4A 3RGWS 3UAXA 1GAJA 1EP3B 1ZO8A 5D2CA 4LBZA 4MAMA 5BOVA 3FZGA 4II2A 2AEMA 2OFFA 3JASB 1D03A 1ILWA 4D9CA 4L0MA 3EC1A 4YCCA 3IQDB 2VA9A 2A5LA 3PVZA 4FNMA 4Q3BA 2WUGA 5JJCA 1O08A 2CUNA 2QRGA 3NVAA 1GG2A 4XFDA 5KJFA 1NBEA 1V39A 2Y9PB 4YQEA 2MCFA 4YMGA 3CURA 4FW8A 4RQUA 3NIWA 2TMGA 1RI4A 2PUGA 3FB1A 4K3UA 1JIIA 2BGKA 1KO7A 3ZC3A 1V5IA 4DLBA 1FVFA 2XB9A 3UMYA 5DTJA 2HRBA 5EXDA 2IEGA 5IBRA 2FU5C 1OFVA 4N0MA 5HUHA 4XUDA 1CP2A 2HMWA 5EE5B 1A71A 1SAYA 3VDXA 1RS0A 4EENA 1V6SA 1XSEA 3ZY2A 2FP4A 1NVFA 2GJ9A 3F9IA 3IUEA 3OC6A 2JW5A 3IAM1 5FOSA 2FG6C 2CYCA 4KPUA 2AVNA 1YMQA 3RVLA 1UBEA 1Q2XA 2GPBA 2NZJA 3CUUA 2IE8A 1L1FA 5CJPA 2XDWA 3T95A 1E3LA 3IOEA 4B34A 3A6LA 3PQCA 4M0CA 5H3LA 4HV4A 1ZHOA 2R5NA 2WLSA 1A82A 3OZEA 4DSZA 2NUTB 1P73A 4X1IA 2Z2YA 4X5OA 5EN4A 2Z56A 3WMEA 3HJBA 3CRZA 2C5AA 2XBLA 3D5QA 1DV2A 3T1YB 2V9CA 2UZAA 1SD1A 4TRRA 1CERA 4CM3A 1JAYA 1DT5A 4U5QA 1PDWA 2BKVA 1NF9A 1Q74A 3X1YA 5KPJA 3D4LA 3BDVA 3B8HA 4YPOA 2ZTSA 3R5HA 1V5WA 4GLBA 3H4MA 4FOTA 1P6XA 1ODLA 4JVMA 3K73O 3FG9A 1N3IA 3D1LA 4H3HB 5F64A 1XD9A 2JHAA 3OEHD 1O5TA 5JSZB 3N0WA 3EPLA 3E8XA 5I48A 3QVXA 5DGXA 5EA2A 3S55A 4D9HA 1T5IA 4J9UE 2QTMA 1IH8A 1H2YA 1ENZA 3FLAA 3MQFA 4I9FA 1KY2A 2JGDA 4A73A 3LP5A 4LHSA 2UU9B 3DOIA 3RC1A 2ON6A 4P5EA 1N5RA 1WKVA 4UDXX 4Y6RA 3QVUA 1VIAA 4MJ7A 1J09A 1DEOA 4EELA 1KSJA 1RMQA 3PWKA 4MGZR 4X6UA 4GH5A 1CRLA 5EI5A 3ZDZB 5BRAA 1Y6QA 3THWB 4F45A 4UJ3A 4WCDA 3GLGE 1ZPDA 2X14A 4EYGA 3JTEA 3G8BA 4FYXA 2O2SA 4LV5B 2O8CA 1NDQA 4UVEA 4DYHA 2GPSA 5IARA 1USGA 1XN4A 5D5PA 2OCYC 1YZNA 2O3SA 2R6CA 2RGDA 2WF7A 4AROA 4XVUA 1ZM7A 2MR6A 1O54A 5CNMA 1X7HA 4UMDA 4IL5A 1JJIA 3A4LA 4WVFA 5TVGA 5A4AA 3ZEAA 1UPUA 1KK0A 2VP3A 3V4FA 4AO8A 3UJBA 1KQPA 1C4KA 4QUIA 3H9GA 1OI7A 5EEHA 4PGMA 4FR5A 3QNMA 2X6QA 5REQA 4BNDA 1G3RA 2VDUE 1TJYA 2WMDA 3FBWA 3RYIA 4B87A 1SUDA 1QZUA 1EFTA 2YWCA 3F6CA 4JZYA 4NFLA 4NFYA 1XD2A 4PFJA 3KP1A 2Q8QA 4BNTA 4ZRMA 1ZSNA 4Q4AA 1Y3DE 1AQ6A 3ASVA 4EKEA 1W6RA 4LTMA 1X7YB 4XB2A 2ZSHA 2IZ6A 4OFBA 1AO3A 1YTLA 1JQAA 2XDAA 4YJ2F 3N5KA 1T0JB 3KSZO 4L9SA 4DDVA 5JPCA 1N5OX 2H5LA 2YXLA 3QV2A 1F8XA 2D0PB 4X9XA 3VO8A 1L4MA 3NHUA 5AKKA 3I9JA 1ULBA 2AFHE 4E2YA 3SBDA 1CE8B 5C35A 4DDTA 5TJHA 4BC1A 1M83A 2XF2A 1B6SA 1UZUA 1MQAA 3B82A 2PLFA 1YVEI 3S40A 5B12A 1SBYA 4D4GA 2C83A 2W6OA 4QYSA 3UOAB 1O58A 2VTVA 3ORQA 5IDVA 3C3KA 4HFRA 4GD3Q 5CURA 5HP4A 4X3OA 3Q8KA 1XJQA 3ZDBA 1BN6A 3IVGA 3QMVA 4YWHA 4EBBA 1H3EA 5LP6B 1BHQ1 1N3YA 1NXSA 2O52A 1BJKA 3GLIA 1B14A 3GCZA 1C4XA 4OAPA 4TYWA 4M87A 1MAVA 4N7MA 1ECFA 2YXEA 4PG6A 2HA4A 1Z0ZA 5JBQA 1UAYA 2FZ5A 4PNZA 4F4HA 1IN7A 2Q1UA 4MVWA 3RYFB 4EAQA 1OLUA 5ELLA 5FWYB 3CEAA 4MUKA 4GP6A 1U2ZA 1Z4NA 2XYPA 1X8KA 3PA8A 3MTAA 1CK4A 4G01B 4V1CB 3ER9A 4IIDA 2NXWA 1UDCA 1X8XA 3STVA 5I9IA 5LP6A 2LWIA 2J87A 2ZREA 1Q50A 3EF3A 2H9IA 1OV4A 1O95D 3UXMA 2CYAA 4C4ZA 1G66A 3COWA 3GY0A 4V0NA 4YP0A 4N76A 1SEVA 1MV5A 2BFOA 3VHRA 5KWVA 2IDJA 2DTEA 3CEMA 1Y5IA 2PFSA 2OMEA 1SVOA 3GEHA 1JIQA 3BH6A 4BFSA 1K6XA 2R8BA 4FNOA 5F1PA 3LF1A 1Z2NX 3PNYA 1J2TA 1ZVJA 1T9ZA 2IPLA 2J5QA 3K4QA 3PNBA 5FXMA 5BSRA 4NABA 4IHAA 2PANA 4K03A 5ENZA 2OK8A 2OV2A 5AESA 3T3HA 2H1FA 2WG1A 3E3MA 3W05A 5DU2A 5IAJA 4POOA 3CJTA 1K8QA 4F71A 1RPNA 4ALKA 3FVVA 1H2FA 2Z6AA 3WB0A 4MJXA 4HYEA 4IVQA 3GQVA 4NZPA 1SIUA 1GT6A 3OLXA 4H16A 4PV7A 4BOYA 2JLRA 4ZYYA 5GIOE 4C4RA 2OR3A 3HXOA 3K0FB 3LDAA 2GBGA 2J4FA 4R2XA 3O8RA 4V0KA 1C9MA 2EHJA 3A1TA 3GF4A 3K6RA 4HTAA 4LECA 4R9UC 1FK8A 2GB4A 1YCDA 1YMVA 1CFZA 1GCOA 1Y81A 2IXEA 5H70A 5TB5A 1YNOA 2FG7C 1VJ0A 1GKLA 1LH0A 3NAGA 3O4IA 3LX8A 3SBXA 1DCKA 1RQ7A 4JLOA 1NVGA 4Q12A 3KQYA 3RFUA 5JY1A 4HRYA 2Z57A 3CNOA 3WJ7A 3VSBA 4KLAA 2FN4A 1NQAO 2HU5A 2RI6A 4TVSA 1FF9A 5A2QA 2Y0PA 3V8MA 3VPHA 4CMBA 3TLZA 1G8HA 5H16A 1GUBA 4ZJUA 2QRMA 3R4VA 4JB0A 2ZJOA 3Q15C 1GNRA 1L7AA 3AJEA 4ODIA 2C7BA 3SSAA 4U2FA 4X45A 3NDBB 3OQIA 1QDLB 1OW3B 4JJEA 1UC5B 4C6TA 3C39A 3RFCA 2JVKA 1QO0A 1EX7A 4RMJA 1K8ZB 1U81A 1Y4UA 5FBZA 4FDLA 3QXHA 2ZTMA 2PIDA 1F2TA 2VYNA 1KJJA 1OH6A 3FZQA 2EJBA 3UAZA 3ND8A 2R6R1 3PL5A 3R76A 4MUJA 1C41A 2YDXA 3D7NA 3EYWA 1E2GA 1XCGB 4DC9A 4A6XA 2M32A 2XVMA 2VCYA 1ACLA 3CLRD 4N39A 5REQB 1XQYA 1EJ2A 1P4RA 1QVVA 4YMWA 1NW8A 1GNTA 3ANNA 1WQ1R 1UT8A 1GV1A 4I9NA 3C85A 1KTIA 2CUTA 1NYLA 3OY2A 4NPCA 4DBLE 3M4JA 4FQ7A 4CMKA 1UC8A 4D3XA 1BD3A 2WSIA 4QDJA 4JL6A 3V32A 2PU5A 3SIRA 1LVGA 5BUCA 1MA0A 4XJSA 5F12A 1WPXA 5E1MA 1ESDA 3PNKA 4XD7D 1N0UA 3WGYA 3WP1B 2E4UA 2KB0A 2GPJA 3MLAA 1EGHA 1GSHA 2AR9A 2B4YA 4NCBA 4G1BA 5BV8A 3MD9A 4DMLA 2NW6A 4GYWA 1R8QA 2SNIE 4LOHA 1AKEA 2ZXFA 5KX5A 4DQXA 2QG9A 5JH7F 3AESA 1U7ZA 4YO7A 3UAVA 4AD8A 2KI5A 2I7VA 4PZAA 4EB0A 1Y3HA 3GQBB 2W90A 5IJAA 2Q2VA 1NOKA 3EXG1 4YAIA 3M3HA 1A69A 1HH4A 4K26A 5KWSA 1A5AB 4RK7A 1Z06A 3GVIA 1I0LA 2ZEJA 2JJ2A 2NVOA 2Z2IA 4UEQA 2R1TB 3L7OA 3ROGA 4JQSA 5K8CA 1HY3A 1OLXB 1VRWA 3IAUA 5K8LA 1D0IA 1I2CA 3ZDDA 1Z34A 4AJJA 2ENWA 1WVGA 1D2AA 1I2AA 5CVEA 1JXMA 1OMOA 2GCOA 2FMHA 3B1WA 4LJ8A 2TYSB 4B85A 5HKKA 3W90A 3OCXA 4DYVA 4F8EA 3NYRA 4NCHA 1CWUA 1VGQA 1CR6A 2DUWA 2WB4A 3LPNA 4FD2A 4BJ1A 1E3WB 2WTMA 4U39A 1G2IA 1IM2A 3ZIUA 4AZSA 6GPBA 2XIJA 2LUOA 1HLFA 4BGVA 3WHLA 4YJGB 5HCNA 1SBTA 5K0GA 1T29A 1LPMA 3D3KA 3OZXA 5EWMB 1COWA 2H07A 1XU9A 3PUZA 3R8XA 3TOVA 5JO9A 3NBXX 4D96A 4MKFA 4OOFA 1PAUA 3K4PA 4UOEA 1TDJA 2EKLA 2XHEA 2AYYA 1AKYA 2PGXA 3NBKA 4QSMA 4M8IA 1QVAA 5CPBA 4U5XA 5I45A 3PTZA 4MTCA 2WV7A 3U81A 3L8ZA 4JJ8A 1MC1A 2B5VA 1CQWA 1E2EA 2PUFA 2CXQA 3JQAA 4GWGA 4BVKA 4C04A 2GLXA 1BCRA 4PPFA 4CQMB 3C70A 1VXOA 2NQTA 2WUFA 4X62B 1PT9A 3M6WA 5D3MB 1Z37A 4N65A 3GN1A 3HFRA 2HHJA 1JDBB 2H4WA 3PGMA 2ZJ5A 4Z6KA 1BA3A 1P9LA 4N01A 4CFSA 3ELUA 1X42A 5FOWA 3ZOZA 4B3TB 1NVMB 2GNOA 1HTBA 5M04A 5ECYA 2NZYA 1L5RA 3NTRA 5EERA 5ALWA 1SVNA 1XWWA 3TD6A 2F43A 2ODQA 1OZ0A 4EFLA 1UOEA 3DJYA 1ZGHA 5EPUA 5BQFA 2BMJA 1WCIB 1Q1NA 1ZD1A 3DEKA 1QYCA 1VMIA 2HZBA 5JEDA 5DWDA 3A04A 4TWAA 2B8JA 1OSNA 1JKFA 3ZJYA 3UATA 1CY4A 1D1QA 5JH7A 2FOIA 1XDSA 3GA7A 2OBNA 3MWLA 5LKAA 2Q9AA 3PT9A 2XBUA 3HGMA 5B4UA 1ZVVA 1QE3A 2J0EA 5IBCA 2CXSA 4URZR 1FMFA 1ZD8A 1D9XA 3BWYA 4HOYA 1BWSA 5DCLA 3RRZA 1AK9A 1KKMA 1Z74A 3DL7A 4MARA 6CHYA 1IN6A 3SJCA 4BU1A 4C4TA 5A5DA 1XU4A 2HFJA 3WO1A 2ZBDA 4RWEA 2I8LA 3WGMA 5IKEA 4O4LB 1V8BA 3C74A 2QTVB 5LJLA 5F98A 4L4UA 4QVKA 3SM3A 3HUFA 4L74A 1Y37A 3WQQA 5JSUA 1YR1A 4LYYA 5C5IA 2YZKA 1RJDA 3OQBA 3FDXA 2CJYA 1U1GA 2J9YB 3TZBA 2DP4E 5EP1A 5KQGA 2L0XA 3UK7A 2V0NA 3VO9A 2GKSA 4RTPA 1HE1C 4GMFA 2W83A 4LOJA 3B9BA 3KYBA 4G9BA 3H65A 2JGAA 3ZQ6A 5JZBA 4HVAA 3MT9A 5BMOA 2YXBA 1FP4A 2VP2A 2BEUB 2CXPA 2IU0A 2B1IA 4QRHA 1VJ5A 2ZS8A 3O2QB 3PHGA 4L4SA 1P0PA 4TMKA 1FXUA 3FN4A 4ZEMA 2ZUVA 3WNCA 3TNFA 3ET4A 4RC9A 1IXZA 1D2GA 4YLEA 5I3CA 2Y68A 4FKMA 4JAVC 4TLBA 3F7TA 3I12A 1IIBA 4YWJA 3C3MA 2YH2A 1GQRA 1QSGA 2GT1A 1Y9ZA 2JCGA 3GEDA 4Q4JA 1A95A 1R3UA 5A4KA 3JZDA 5AKYA 3L84A 3L46A 5B4TA 2P41A 2Q5IA 4HFMA 2E1RA 3UM9A 4JGGA 4LRUA 1X8LA 5JE8A 2OBBA 1QIDA 2AC7A 2AKAB 1HL3A 2R4TA 4UUAA 4DTIA 3QOYA 5CR9A 1XA0A 4D4MA 3GJ4A 4REMA 2FWIA 4PG8A 3C0KA 3CLTD 3QFRA 4TQGA 4KX3A 1RLJA 1W4ZA 3CV3A 3EC2A 3KD3A 4MDYA 4WIAA 1M1YE 4IJ6A 3FVRA 3TPFA 1Y1LA 3VPSA 3BB1A 1T8UA 3COVA 3R5JA 4EY6A 3GV0A 1SZDA 2M2IA 3OMWA 3EEYA 3WIBA 3WLOA 3OTWA 3GLRA 4JSYA 3J80A 5EYPA 4PRLA 2J08A 5LQAA 3D8HA 3OZVA 1T8YA 1H2HA 3BCSA 3KKQA 2ZGVA 3HNPA 4JLBA 4NOMA 5DN6A 5SYNA 5LU8A 1J0DA 1BIFA 3U1TA 4GX5A 2X3YA 4CGYA 2B83A 2E5WA 4ZVVA 1NIJA 1M2HA 3F3KA 2CB9A 3NPAA 4W63A 1CNFA 1Z6AA 1YHNA 3OA2A 1CUDA 1FMCA 2DVMA 1VKJA 3REQA 4BJ5A 2ZE6A 1OGIA 1XZGA 2JD0A 4KPFC 1EUCA 1U0OC 4Z49A 3SX2A 1Z56C 3EODA 1R4NA 3D6HA 5BO5A 4LF4B 4QPZA 2AWOA 5FUYA 3HGQA 2I87A 2XCUA 4GSKA 5KYWA 1QLHA 1XZPA 3N2YA 3H1TA 4B7ZA 2EJTA 3OSUA 5D1HA 2ZIAA 2JJ1D 1ISHA 1FXSA 2CXNA 1S0UA 3A31A 3HCRA 1C7IA 2UDPA 1TM5E 1VLHA 2QUKA 2F9LA 3IC5A 4J91A 4N5NA 5L4NA 2B34A 5JXIA 4O3MA 1AS0A 1Z5WA 2XVYA 3DOFA 3DWEX 3ETGA 3U19A 2BGNA 3OTGA 4XI9A 3FR8A 1ZK3A 4LN1A 3D81A 4OATA 1W1IA 1QQ6A 1WZNA 2E9SA 4TMTA 4ALJA 3W5HA 5ES3A 3EZLA 1BHJA 1VHDA 1V1MA 3K30A 5K0TA 1NKSA 3SQXA 3B13B 3GEPA 4PBSA 4J3FA 4QDOA 1TADA 3BSSA 3NH6A 3EWNA 5EJMA 4QATA 1QHHB 5LP1A 2JEZA 4XVRA 3BMXA 4DHEA 2N0SA 3RTAA 4P31A 4G07A 4NCXA 3LLVA 2DSTA 5A3SA 1RXVA 1E77A 2X23A 4HH1A 1V2GA 3D3EA 2IUEA 3PJEA 4KQGA 2I8CA 5FDFA 1HC7A 1ZNXA 2QR5A 2BVNA 3IR5A 4NATA 1WULS 1N8NA 2OB2A 4MHOA 4ZAYA 4CRWB 2G28A 4DNQA 1WWKA 2OHGA 4ZOQI 2OO5C 2OXFA 2YHIB 2CF5A 4Y9DA 3OIGA 2Q5HA 4C0WA 1CJUC 3PEUA 3G9XA 4TV9A 2A88A 2WQZA 4EGAA 4HNQA 3LWDA 4RPKA 3IKLA 1NI5A 1M3SA 4MRVA 2BLNA 4QO7A 5EJ4A 1XMOB 3WSWA 5C80A 1TQ8A 3ZDFA 1QRTA 2Q45A 2PFKA 5FR2A 4EG7A 3KELA 3ZS8A 1WDKA 5CFRA 5AJYA 1NM5A 2J46A 3G7UA 3INTA 3AKDA 3OI7A 2AS0A 3HR8A 1JQ3A 2BKAA 4QFMA 4D97A 1GTMA 1Z5VA 3FOZA 1GUDA 4ENRA 1XLWA 3AHCA 2OKGA 1M2VA 3CVUA 2YS7A 2A57A 3IAS6 1QH1B 1ZIPA 4PC1A 4QQKA 2Q2WA 2K6GA 2DBYA 3SIPA 3OOWA 1VP3A 3WBFA 2OCIA 1Y42X 1W2GA 1P7PA 4MAFA 1E1CA 4ZK6A 4G0YA 4EB3A 2PUAA 1F8FA 4MLPA 1NQVA 1DEHA 3KSRA 3AUXA 2PT9A 4PAOA 4J4BA 1T2DA 2IVFA 1FDWA 2FPGA 3PJGA 3HRKA 1AN0A 4IBOA 1PZXA 3QU7A 3IR7A 5DGTA 3RREA 4IXWA 2C94A 2SKDA 3UT5B 3PNMA 4C0QC 4TXLA 4IGKA 4HGPA 3PJRA 1SXIA 2F90A 4DQ0A 3OSZA 2I9PA 5D6OA 4Z7QB 3CCCA 1HSOA 4J1NA 1W0KD 3I83A 2BBTA 1R6VA 3G9UA 1CQJA 4Y2RA 2C2KA 1PG0A 4KOAA 5EP4A 3JD2A 4P4SB 1A98A 4NJMA 3WXBA 5MFPA 3JQAD 1OZGA 3CUEF 3VM6A 1SELA 4IH9A 5IYZB 1QZXA 3H9UA 1DL5A 4OYYA 4D0SA 2HF2A 1OIXA 4HZGA 3FI0A 4ZGBA 3ASYA 3OPVA 2C04A 4DRYA 2R00C 3MBKA 3L0IB 5BT9A 3K0EA 8ATCA 1B8UA 4MV1A 3KPYA 3CR8A 1M0SA 2VF7A 3KLNA 3LDFA 3T4PA 4F2WA 1ZJWA 2XCTB 3TQOA 3V4VB 3F9RA 3RF7A 5KQRA 2H7CA 3NZEA 3R0IA 5CDGA 2I4LA 1RWMA 2HWUA 2PIAA 3QXCA 3R3UA 3FMVA 1KXZA 4D3DA 1RRGA 2COKA 5CD1A 3GYBA 4LBVA 1DBVO 2BDUA 1M2OB 2HUNA 2YJ5A 3BULA 3FWNA 3I6ZA 1R8JA 1WABA 3NG1A 2PT6A 4LZLA 3KCNA 5LIRA 3BBPA 3BXOA 4B9EA 2J5KA 3K15A 2G4VA 4TTJA 3F73A 2C2OA 4HNVA 3T0GA 4JQCA 3U16A 4UEJA 2HY7A 3DDOA 1FTNA 1UMDA 1VBMA 1ZKMA 4HN9A 2YUTA 1LRJA 5CIYA 3DZ8A 3AY6A 4IY1A 3ED1A 3OQVA 3CLKA 1PUJA 3KYCA 4P7FA 2IP4A 2F4NA 3WHPA 5EMNA 2G40A 4BO7A 4C7JA 4TSFA 4Q1EA 3LPDA 3MM4A 4P80A 5BV1A 5KVSA 3NHLA 4IF4A 2HJSA 3QEMB 3RAPR 4JI5B 3WYAA 5A04A 4IIEA 5KYYB 2BSXA 1L5YA 4C87A 3ESAA 3CXRA 1TTQB 3CT4A 3LQKA 3M6MD 4ZT4A 1V43A 4EUFA 2HDNB 4LGVA 4BFCA 2WVHA 1RHUA 3GO4A 4X3PA 3O5AA 4FMDF 5KIAA 4KQ1A 2I7TA 3MINA 5AKIA 4BCDA 3ZCXA 5ARBA 1ZFNA 5ADUS 3WIUA 2R0QC 2DE0X 1KDPA 1GM5A 3H2YA 2HBYA 2A3NA 2XADA 3CZ5A 4O4HF 4EVSA 4Z3OA 3NV7A 1SCQA 3HZOA 1PJ2A 2OV3A 3FYUC 1NTRA 3HPRA 4MWDA 3TLMA 5LBUA 5HOEA 5HNKA 5IVKA 2I80A 4FFOA 1DKQA 1L8QA 3EQ6A 2Z8XA 4O2AF 1GJRA 2FMXA 4PTYA 4YY3B 1ZU5A 2AEEA 3E5NA 2VRCD 2JJQA 3IMCA 4EBFA 1J21A 1MCZA 4U0KA 1M2WA 3HL4A 4AMYA 1EE9A 2WM8A 5IVHA 2MYNA 3FPFA 3Q9LA 4PBRA 5DHFA 4D79A 3B3QA 4K0RA 3ROMA 1X86B 2RCNA 5J2UA 4AK9A 3V4OA 1AKRA 4C6HA 4Q1DA 4PIVA 2CLSA 2HT6A 1OXVA 2OHXA 4YROA 3NRBA 4OFXA 2A0WA 2RE8A 3LX4A 4MUNA 3CVYA 3B7GA 3QBVA 5L3QA 1N0WA 1RTKA 2RJOA 3R09A 3PSHA 10MHA 3TLEA 1WP4A 3HQ4O 1X2EA 4DB4A 5M29A 2IYUA 3IQXA 3H2HA 4OHYA 3I8XA 1IOLA 2B1QA 1RQRA 2IXAA 1W0CA 2IW1A 4FMPA 3SC2B 4I5EA 1GPYA 2GSDA 1T1JA 1NGSA 1E1DA 2AXEA 3ZDQA 2BTQB 3NWEA 5D85A 1X9IA 3SC6A 4HGQA 1WXWA 2CVFA 3TXXA 3T5AA 2HADA 3DVLA 4FBMA 4FOLA 3TO5A 3LUHA 3H9QA 4CG0A 1Z5PA 4R8RA 2JK0A 2A8YA 3U4IA 4M86A 4I50B 4OGWA 3DDZX 3MQ2A 3LLSA 4Q9JA 4IUCS 4A0QA 3BGSA 3DOEA 1H69A 1PR3A 1U1EA 2GLUA 3K94A 1DEAA 1PNQA 2Z1MA 1CE8A 3WGOA 5I01A 1QFYA 1YQDA 2ZR8A 4AM8A 1KAEA 3ZCSA 821PA 1QTRA 1QHIA 1ZHFA 2QG4A 3MJFA 3ROQA 4DCVA 4OP2A 4IR7A 1PLLA 1RC1A 4GGOA 4IQGA 5E2AA 2QRJA 5A6SB 2QL9A 4ITUA 4D43A 3QA9A 2RGNC 5CH3A 1CQIA 3U3DA 2F17A 1P2TA 1P7VA 3HA5A 5AKJA 3UQYS 2WJIA 3D02A 3UAWA 2J9FB 3ZTTA 2I0FA 4WZBE 2BZSA 4RA6B 3WOVA 5TX7A 4QPPA 3BORA 3P7MA 1DG1G 1JW9B 3LY5A 3T6KA 1K75A 4INPA 1MNAA 4QXOA 3T7CA 1PUXA 5E4JA 1SHUX 5F4BA 1OFUX 2AZTA 5FI0B 4DUGA 3FCSB 5J1SB 2OHVA 1OFGA 4K9MA 2QUAA 3FTEA 1KHHA 4M55A 5DTIA 2C03A 4Z1MA 4UUNA 2EZ8A 3DC7A 2OGWA 1C7ZA 3MLEA 1ISIA 1AHIA 1SCKA 4HBGA 2HH9A 2XLBA 1ZWLA 4CF7A 3EIOA 4DKJA 1RCUA 1L7NA 1IZ7A 3MHTA 4WI1A 5HDQA 4K8RB 4RNDB 3F7OA 2FWBA 1Q91A 1GA4A 1KMMA 1QO7A 1JS1X 1UMBB 2Q5EA 2QHXA 3PR3A 4JI6B 1LGYA 2ORWA 3UH0A 3F6YA 4R8VA 3GEGA 1RXSA 2GQ0A 2REBA 2OUIA 4CV3A 4NPHA 2IT1A 4K88A 3ENZA 5TGDA 3W8DA 2VTBA 1LFAA 2BKXA 4MKRA 3IXMA 1SBZA 2NAPA 5CYOA 1BMTA 3A9SA 3FR7A 3H2GA 1QG6A 2E5LB 1LLQA 2P5SA 1L8AA 1LSOA 1SFRA 4BPBA 2ZBFA 1TU3A 5MHTA 3TRFA 1HQDA 2VJKA 1W0JA 5FHRA 3K6JA 4IGAA 1TAHA 4MXDA 1N5MA 4JY7A 4CBVA 2JIPA 4ZHQB 4UMEA 2I5PO 2VSFA 3T34A 3AIOA 3MGAA 1F0NA 1XT6A 4MIEA 1Z39A 2ZP1A 4PRYA 4HWKA 4IQ0A 2VKQA 4QA9A 3UWMA 4RJJA 3TM4A 2XGJA 1A7JA 4N3CA 3D1VA 1YI1A 1ZNQO 5CEFA 3OQJA 3OZDA 1OAOA 4ROSA 4H1WA 2B37A 5AW1A 4DDMA 4S2EA 3P20A 3T7KA 3DPSA 1W93A 1DXHA 1GG9A 1ZCFA 3CZ4A 3O3NB 1AO0A 1PD0A 1AGYA 4WZAA 2QK4A 3M9WA 5AHOA 3ZQJA 1IPEA 4DLYA 2V3CC 4RSMA 5EUQB 2Q9BA 1G3IA 1P44A 3GDHA 3TQHA 4YPVA 1M33A 3NBYC 3E22B 1YU6A 1I13A 3HDTA 1COZA 2ZB7A 4QXAA 3T3IA 5IM4F 5J3JA 4JLDA 3A2LA 3PC8C 1AMNA 2CHUA 2R86A 3UGQA 3R40A 4A0HA 1KDVA 2V7BA 3SBEA 4QJ4A 4PZ0A 4OAQA 4QGHA 3WS7A 2B7BA 5CA0F 4G24A 3WAKA 2I1QA 4I8IA 4PG4A 1JHDA 4CLOB 4TX1A 2QTTA 4TXNA 3GLVA 1GNPA 3B3JA 3SYMA 1CUAA 1XV5A 3C4QA 2YBDA 4CKWB 5I5GA 3U4GA 1DJMA 1K4YA 1JLLB 1XDZA 4HO1X 1PZHA 1A4RA 2W2KB 3IPYA 4MZDA 3LYUA 3FZYA 3USES 1TCBA 2PH1A 2JFNA 4QT4A 1II0A 1SCNE 4XQCA 1T5DX 4G5OA 1POWA 3WV5A 1IAVA 1I8TA 1VL0A 1DQPA 3TIGA 3KXPA 3ICVA 4QSHA 3JYPA 3OAAD 2X5JO 3P8ZA 1KFJB 2IJGX 4JWTA 5DHTA 4UUOA 1PR5A 3KK0A 1BMQA 1D1SA 2PRSA 3IHKA 2HOQA 2VTDA 5GM2A 4ZVNA 3M6FA 3QI2A 2AN3A 4AP6A 3L0OA 1PSWA 1KU0A 2V5UA 3PX3A 3TL2A 2AFVA 4B17A 3GK3A 5JJ5A 3P2OA 1Z7WA 2PUHA 4Q03A 3MWKA 4RXMA 4Z3DA 2QSZA 3AVXA 1PQYA 1EVEA 1I24A 3FVWA 3JYLA 2TS1A 4JKYA 1SIBE 3U80A 5CBPA 1UJ4A 4LZAA 4XAQA 3W5IA 2H1LA 3KOZA 3PR1A 4EY4A 5TLSA 2BF7A 2NUBA 3GJRA 4OQDA 3GP5A 1FFSA 5KJCA 1V48A 3BGDA 2C88A 2BWJA 5FUWA 5KJEA 4I1UA 2QT0A 1H5NA 4PX3A 2JBAA 2RH9B 3T35A 4QM7A 2OAEA 4GSLA 3MGGA 3EDCA 2PE5A 1QHGA 5GJVC 4EIWA 4PSUA 2RGNA 3BJZA 4KO1S 1PNTA 1QWOA 3RG8A 1ODFA 1P1KA 5LM3A 1XQVA 1EUZA 4RD1A 3VTZA 3L04A 1CJBA 5E7QA 2HJWA 4HAWA 4ZVOA 1U9YA 2B36A 3EXFA 3HVUA 1PP4A 5BUSA 4KREA 3BICA 4TQAA 2J1LA 3QLVC 4GM1A 2FR1A 3SQMA 1FFXA 1WZIA 2CZQA 2QI9F 1KA9H 3D4OA 4KPUB 1L7BA 4Q3OA 3TUIC 1FA9A 4OL0A 3U3ZA 1GTSA 1GUAA 4YHBA 3ER8A 2QOEA 2F3TA 1X3SA 1O4VA 4QUJA 1JI3A 4AUEA 3QY9A 1JHUA 3JVEA 1A27A 5L9AA 4ZANA 3E53A 3WA6A 1XPJA 1K8YB 4IXDA 2BR4A 1TTTA 1LK7A 4HVCA 2OK7A 3OQ6A 4PF1A 3RVJA 1WVMA 2IOFK 4HPWA 3KM0A 4FXPA 1T3TA 2O3UA 5H0IA 2PO7A 3NOVA 5IT5A 1MJHA 4FGJA 1Y7PA 2W2PA 3LW8A 1AZLA 4FCWA 2DXIA 3SS8A 2CXXA 3OHPA 2VNSA 1GGJA 4QYWA 5FHQA 2PS0A 4GPZA 3GZJA 1M1XB 4XW2A 3FOFC 3RAFC 1IBRA 2CFCA 3OE1A 4TLMB 1M2VB 4Y1FA 3KR2A 3D6MA 3VYTB 2QWXA 4XGNA 1AV7A 1BMFD 1F2UB 4KH1A 5FCDA 2PX3A 4NP6A 2RGGA 3IQZA 3PUXA 4BIIA 4MRNA 3I9LA 3NGMA 2AFRA 4BEJA 1IWOA 3RIHA 1JG1A 2DULA 2JLAA 1ICIA 1TVKA 4KYIB 3G5UA 4P3OA 2QROA 2PLWA 3WL7A 1Q14A 1B3RA 3KB2A 1BFUA 1XKXA 4LBWA 3TZKA 5IUNC 2H9AA 3L0BA 3PC4A 3LC1O 1P19A 2R2GA 3FMOB 3JR7A 4ZGWA 2W6IA 4OI2A 4GBMA 2J6BA 3ZDXB 1QF6A 3AL3A 3L49A 3V34A 4LRSB 5HG0A 4F84A 4EK9A 4HNUA 1T8TA 3T9CA 1YDFA 3VDQA 2P2GA 4HAUA 2X4IA 4QYIB 4B7AA 1KAQA 2AQHA 2ZRJA 2CB0A 3D31A 1E2HA 1JSRA 1KL7A 1AE1A 2Q3MA 3EGIA 1DX9A 3W8RA 1OXBB 4IRMA 3F5DA 3UXHA 3A1UA 1P5JA 2Q3CA 1V11A 2FLKA 3CISA 4UQLA 2XRFA 1MV8A 1ZGBA 3V4ZA 3I5YA 3EARA 2IHUA 1HZZA 3OJWA 1IQ0A 3D8BA 4DV0B 4TYMA 3AEZA 4X63A 1YBFA 2C4VA 2XQVA 3RKSA 1T3SA 1NMEA 1UQTA 1J1IA 1IPHA 3FTCA 1REQA 1T9GS 2OCLA 1GU1A 1H9BA 2E48A 2PZEA 5TPWB 3TH5A 4MWSA 2C59A 1FRVA 4TKLA 5AM0A 2W2MA 3HUDA 3QOFA 5AHXA 3Q2IA 3DTNA 4EGQA 4XWWA 1QVRA 2MJLA 5JFOA 1E0KA 1MN6A 4GPEA 4UVHA 2J4DA 2V97A 3RRXA 4AY4A 2WJVA 1TO1E 3ABQB 5EIWA 3PX7A 1N5KA 2Q4EA 4M98A 2ECFA 5THXA 5CB4A 1VPEA 3EQ8A 3SWWA 1SZJG 2PKRA 2BD0A 2C4NA 3L43A 1QE0A 3M6XA 4L72A 2XAUA 2VP6A 1V0JA 1XROA 1RKXA 3GFFA 2EQ5A 1YZLA 4M54A 1NL3A 1U0SY 4CMHA 1RIIA 4FYMA 3GBPA 1F8GA 1YZVA 1PFGA 4X1KA 4KKXB 5A9SA 4KQIA 3QWAA 2GPAA 3JARB 2QL6A 3W78A 3ZZUA 2B4AA 1JI0A 4ENVA 4W1PA 4RCVA 5LN1A 2FSFA 4YRQA 2ZYTX 1X1DA 2OHHA 1IRXA 2G63A 1L5SA 2OLEA 3L79A 1EHIA 4U2BA 3ICEA 2HQ1A 1IVNA 2XYQA 3B3FA 1MW8X 1ZUWA 3RBAA 5CCXA 3AR3A 4V02A 4EPXA 1YL7A 3Q85A 2XZTA 1MAUA 1SXGA 1D4AA 3FTFA 1VA4A 1HI9A 1TVCA 4W1SA 5MN6A 5K7SA 5KPDA 2XMQA 1TEHA 1XZMA 5FYDA 1XXHA 4N9WA 2GD1O 5GOTA 5ALJA 1JF8A 2YJNA 2QNBA 1QR2A 2BZ0A 3DOHA 3PF8A 4JENA 3H5AA 4CJXA 2ZRDA 3QF4A 2G06A 3L4SO 2XE4A 3W9UA 3WTCA 3U4QA 3UYKA 4AG5A 4I36A 2ZYUX 3T7DA 4I50F 1T2EA 3KOYA 5IT0A 2IYZA 5CK5A 2RJNA 3SDSA 2JJ1A 1RDFA 1IHOA 2PYIA 7REQA 1N9ZA 2V9ZA 3L6EA 1AB5A 2C0CA 1MJFA 4M1OA 2FFRA 3SDZA 3MD0A 4NBLA 4TKUB 1MDBA 3QJ5A 1M1YB 1WDWB 1TNDA 2D5CA 1AD2A 1QIGA 1UWCA 2VT3A 4AX4A 2XTAA 4L07A 4EHJA 1PE0A 3PQ6A 4DCCA 1RW4A 3QPDA 3RFFA 1AQYA 1IOWA 3WB2A 3TF5A 2FXIA 3U7QB 3EN0A 3HDQA 1DBWA 4PGGA 4YVFA 2G7ZA 1KVQA 3H18A 4NCIA 1JV2B 4DT1B 2JDID 2DJ5A 2GCIA 1ZIXA 4OHMA 4OJMX 3LK7A 4BX0A 3EEFA 2EFGA 3G2HA 4Z2AA 3BB4A 3EGVA 4G8JA 4YRLA 1N6PA 1R66A 2H5JA 3CZAA 5L8VA 1E6EA 1ZEMA 4EKIA 2YYAA 5LOVA 3K0SA 4DA9A 3OHMA 4H6VA 2AFIA 3E9QA 4UAJA 1BXZA 2EXXA 2ID9A 1ZRSA 3GRFA 4RH1A 3NTUA 4ZQIA 2BI4A 1Z6YA 4LJ7A 2H3EA 4WBNF 2ZRPA 3TW0A 4RTMA 3TTXA 2TRSB 1G55A 4W5OA 3U40A 3LI2A 3L93A 1ZL2A 2ZYSA 3FVQA 1G5PA 4PAGA 4PVDA 4P22A 1RU3A 3G2IA 2DC1A 3T3NA 4IWXA 1HNWB 2DH5A 3M6IA 4B2IA 4EEZA 2IYFA 3U6BA 1WXHA 2IOQA 3JYQA 1JJFA 1V95A 1P6QA 2VFAA 3BL6A 1HEUA 3ANSA 5GV7A 5G4KB 5JPDA 1MQ9A 1U5BB 3L05A 1U3VA 3OPMA 1YGPA 3A9TA 3MTBA 2Y2UA 4RF5A 1EB9A 1DC8A 3CVJA 4G0MA 4UBKA 3U3RA 3PKJA 1TMGE 1C3OB 4MH0R 3HB9A 4G0NA 3OOEA 2CL7X 2C5GA 1KEWA 5M5BA 1V11B 1DUVG 1OFIA 4NC9A 1CLEA 2OPBA 3IXLA 5FBLB 4XSGA 4GFDA 3KTFA 1JVSA 3E03A 4JP8A 3ADOA 4JGIA 4ONEA 3PUJA 3E5RA 1ECCA 4GI5A 2XB4A 3QIVA 5CA1B 2OLJA 2WHPB 2PG3A 3P4YA 3GJ8A 5FPSA 3R9KA 4Q16A 4K87A 4OXQA 4ZCQA 4R69A 2OQRA 5KOYA 5DNEA 1B6GA 1GGFA 1P5HA 2IA5A 1E4YA 2FMUA 1VSUA 4XDHA 3QJGA 3SS7X 5EIBD 2HDWA 2O2HA 4GMHA 3FCCA 1UMKA 1MUUA 5AK6A 1YD7A 2A5GA 3L7CA 5CVUA 2ODWA 2OCPA 4GWKA 3AXTA 5AJHA 1BXRB 1I3MA 1DCTA 5LMCA 3AF5A 1VJ1A 4S24A 2H1SA 1JYFA 2JI4A 4GZMA 4YCSA 2MR5A 4TKMA 4TXHA 4AJEA 1ABBA 1Q0PA 3NTVA 5TPZD 1VHTA 2WQ7A 3GMTA 2PX6A 1DKRA 1TW3A 2PKYX 1GKKA 4MPPA 5E6RA 5HRCA 3THRA 2QPOA 4IOLA 4HNHA 4RHTA 2O5CA 4YMTA 1S2LA 2ZCVA 3L7JA 2QTGA 2XUJA 3H4VA 4LGYA 2J9XB 4FN4A 4EQ6B 5K3BA 3SZUA 2HGSA 3PPXA 1WRBA 3CNLA 4Y9UA 1E7SA 4GUDA 5INTA 5KNBH 3LDUA 1BXKA 1Y1QA 4GWLA 2DQSA 5FNVB 4FCCA 3DB2A 5JCJD 2ORED 3MC1A 4Q21A 3OLZA 3QMMA 4WMLA 2IUUA 4AP9A 3O8LA 4QTXA 4DV1B 3KHSA 4Q66C 2ECOA 2GAOA 2A4MA 4J07A 2P9EA 3ANLA 2QAGC 4I5GA 1BCSA 3AW9A 3OT1B 4MQ4A 2I6FA 2XRMA 3I0MA 2RC5A 5GAJA 1IIRA 3UJDA 3G5MA 4B84A 4YMUA 1TOAA 2P7HA 2QVCA 1G9TA 1D4ZA 4U02A 5IVPA 3CW2A 2XUIA 2WQ6A 3W6UA 1GQ2A 4WKOA 3G0GA 2G1KA 3JALA 3LXUX 1X9HA 1VKHA 2BUCA 1U0BB 1AXRA 2NO6A 5FBHA 1ZOIA 2C4MA 3AP2A 1P77A 4LQ4A 2JLYA 2XF8A 1XAGA 3FJ1A 4OPMA 3ELWA 1T5BA 1WUTA 3DEHA 2GX6A 4TUYF 3O4GA 4A82A 1SY7A 1PS9A 2FW1A 3DE2X 1Y1TA 2AZDA 3MBOA 2PWPA 4P35A 5DBHX 1KFBB 1RLMA 3BIXA 3OBBA 2XMZA 3NAMA 2ZJ2A 3FAZA 4JZKA 1Y8QA 2I22A 5H8WA 3SS9X 1PLJA 2NTEA 3P27A 4FR0A 4MW4A 1F5SA 2CLEB 4S04A 4HX2A 1W4LA 2OEPA 5F5LA 3OKCA 5J23A 1CZNA 1ISRA 4M0LA 1E1RD 3OJOA 4NULA 4R84A 1TKRA 3N76A 3BTOA 1XQ1A 4J7CA 5FOTA 2GAIA 4MCIA 2XCSB 2FRDC 3U1BA 3H97A 4R2KA 2QZPA 3Q9NA 2V7XA 5CU7A 1KI4A 3HI4A 2VCEA 5I9TA 3S2ZA 4YJHB 2GEBA 3S2SA 4ZICA 3SQLA 3PD7A 2H08A 3F5SA 5DH9A 5B1HA 4ZTUB 1F4LA 2A0XA 4BJ3A 1FZQA 3BA6A 4MR7A 1J07A 1SWWA 2FZCA 3AEUA 2RH8A 3K5IA 1NATA 2H29A 4XWGA 5BVHA 2IHBA 4NMWA 3OFVA 3P0HA 1TU0A 5EINA 1AUXA 2Y93A 3VAAA 4D9JA 2IYTA 1Q77A 3UH1A 5A62A 1UFQA 5C2JB 1DAIA 1Q92A 4RLFA 5ERXA 5BN4B 1E9RA 5HW0A 1QX3A 1H2RS 4BLWA 5ENDA 3WIEA 1OLSA 3OD5A 2FI1A 2CF6A 2VUHB 2C29D 2Q1TA 3AHIA 4OFWA 5BW6B 4F12A 1HE8B 4E3ZA 1EM6A 2AMYA 2W0SA 1H9CA 4EPYA 1XFDA 4BJHB 2WF9A 3M5WA 4JYZA 4L50A 4BLVA 3FF1A 3W3AH 3OCCA 1T0UA 3CXUA 1YS9A 3NOOA 4AF8A 3QSYA 3I9FA 1MXHA 2GTIA 1C30B 2WZQA 2Z3WA 1BC5A 1RHKA 3F8SA 4L8WB 2VKTA 1WW8A 3AHHA 5B58T 4AWXA 4C2AA 3EC7A 2P2SA 3AM5A 1PYOA 2ZI6A 5A71A 4BKPA 4N5IX 4DRXB 2NO9A 5B7QA 4RVGA 5IULC 4BUJA 2WMNB 3HG7A 4UM8B 4DN6A 3GDWA 2BFWA 4NMHA 1BXGB 2UVPB 3QELB 5AOCA 3IQHX 3IVAA 5GZ6A 1NVEA 3WNBA 3G2LA 4QO8A 1GPJA 3GWZA 1N57A 1UM9A 4E13A 1FSSA 5FBRB 2UUBB 4BXOA 3TKYA 4FYIA 4PHTA 3UA3A 1X15A 5K3AA 4EPRA 4MVJA 1DKOA 2Q2NA 2QRHA 1YA8A 5K03A 3VH4A 4LDNA 1UJCA 1R00A 3HDVA 2HWYA 1P1BA 1X1TA 1R6TA 2J9FA 2XNKA 1OVMA 4Q37A 3R4CA 3R24A 2WD9A 4B43A 4RE6A 4WZAB 4B44A 4BNGA 2JLZA 2UUCB 2RHMA 4DV5B 1GL6A 4EHLA 5I7UA 1HQYE 2PUEA 4G8BA 4RLQA 1LK5A 1UK8A 2CLDX 3JWEA 5EJIA 3ZYCA 3TTTA 4OQMA 4CN9A 2GUWA 2DWPA 5IJZA 4DA0A 1V1RA 2Y2VA 3A7EA 4PAMA 5EUBA 3KQLA 3FJYA 2D74A 3HCCA 3FOAA 4PCAA 3RRNA 4XOUA 2GPWA 3AINA 3K2BA 3MWJA 4FYVA 5ITZB 2ZI9A 2J09A 3EDOA 1CVIA 1NVDA 1JP7A 2UVPA 3MQ4A 3F3SA 4YRMA 4HQFA 4TM8A 5K45A 4GVLA 1BNCA 3MUOA 4J76A 1G5FA 3T5TA 4MUGA 5EUCA 2QP9X 4KU4A 4JI4B 2RGRA 2P5YA 2NU9A 1GSIA 3JWIA 4J0JA 5JWHA 4C88A 4DABA 1OAOC 2FH5B 2O8EA 3JQ9C 2DECA 2CJWA 3UGKA 3VKVA 3T7RA 5GV8A 5AHWA 2NXNA 1N5IA 1WCYA 5EHQA 221PA 5B37A 1YB4A 3GXBA 3U7GA 1Z22A 3HDHA 3MCWA 1WDLA 1KPGA 2AKYA 2X9NA 3KXIA 2X22A 4W6ZA 5EIAA 1ATIA 1E1YA 3L82B 3IXQA 1SOWA 1MX1A 4FFRA 4MGHA 5F7JA 5FI3A 3V55A 4MROA 1QP4A 4RZIA 3W5SA 2HSDA 1DIHA 1IHYA 3WKDA 3D6AA 3WIDA 5EXTA 3CM0A 1F4PA 2WHEA 4IVRA 1U7UA 4EGFA 2QGFA 2K87A 5E8JA 1S2NA 4RDCA 1H8HA 1Y3AA 3M5CA 4ILEA 1GCAA 2AB0A 1IY8A 4MOWA 4CFZA 1FQKA 1I32A 3HR4A 2ATVA 2X9GA 4OUKX 3AYZB 4MYCA 3VPGA 4HLCA 5ADWA 1X3LA 2OV8A 3MJEA 1FX0B 4K9DA 4QUHA 1OIWA 1YQTA 2IPOA 2W2LA 2BFCB 5JSFA 1UF9A 3NVKI 4KHZA 1BS9A 5B3JC 2GFIA 4LHXA 3V8QA 1JA0A 4OYLA 4Q4AB 3GNLA 3N2NA 3CVOA 1EH5A 4KEAA 4JUCA 3O1LA 5CIWA 2PS9A 4ZP1A 2CFIA 4LJAA 2QD3A 3DBIA 3T61A 4N03A 3TIIA 2QVBA 4WY2A 2BGRA 3JQ7A 1WLYA 4AKTA 1QRSA 1YKSA 4H3KB 2EFJA 1BSVA 3A32A 4YAWA 3CLHA 3RFXA 5TQJA 4JXJA 1THZA 2IV7A 1YL6A 2I34A 4I5DA 1KR5A 2EAUA 4C20A 4CIXA 5E1DA 4ACAA 3OIWA 1VE5A 2BBWA 2Z6UA 1P62B 1I3LA 2HPZA 4A16A 5TMPA 2R1UA 5CCEA 3STYA 4J7XA 3O38A 4C0SA 1OI4A 2OL4A 3CBQA 4KWEA 1IBLB 3MRVA 3VVMA 4AYXA 2XZLA 2PX2A 2ACEA 1S02A 3G2JA 2M6KA 1GTG1 3JWGA 1C29B 2CNOA 1QIHA 4QAJA 3ROFA 1IU9A 4M6WB 4X00A 1V2HE 1WF6A 3KYJB 2XKKA 1TLFA 3W7VA 1L5HA 3JAKA 1HMPA 1U0HC 1QE5A 5JDIC 1H05A 3CLVA 1VJTA 4M4SA 3T3GA 4LDQA 3U62A 1PK9A 1Z0KA 1YJXA 2PBRA 2HMTA 4ML3A 4TTTS 1EFHA 1Y8AA 3CB4A 3MG9A 3AILA 3TLXA 4M38A 5J2UB 2FLVA 4K9RA 4PW0A 1D09A 3UJ8A 3TIFA 4EYQA 1FUUA 3FHOA 1IZ0A 2OT3B 1OGYA 3E15A 3OA0A 1LFDB 3DMDA 3OZ7A 2AG1A 4FFLA 4FYWA 5HDBB 3UMSA 4F11A 3NC1C 4EECA 2OXRA 4BATA 4R9NA 3O74A 1Z4PX 1SA0A 1TYBE 4LXHA 3TRKA 5HQ3A 2PT5A 3HU2A 3VI4B 2B2NA 2VA8A 2G82A 4NMMA 4J29A 5IJ0A 3AIKA 3JR3A 1P7ZA 2WC1A 3AT1A 3K3PA 3QKUA 4PLFA 4A6EA 2MWMA 3IIMA 3PYXA 4J2HA 3GRZA 4R6WA 2QD1A 4YH1A 5FB3A 2W2QA 3KB6A 3QF7A 1QLJA 1HLDA 4PSCA 1PJ8A 1GNVA 4PBTA 1JT9A 1G41A 5CLIA 4M8SA 1K88A 2NM0A 4F6RA 1AMUA 3WL6A 2JGNA 4BO1A 1XZHA 2FWMX 4URHA 5GADl 2C5BA 2WICA 5LP6C 3ROXA 3QLUA 4BY9E 2QJOA 2A1TR 4JA0A 3CH5A 1YR8A 2AX4A 1X8JA 1C0KA 1B76A 2YMLA 4I55B 1DRJA 5ITZA 4WL0A 2FW9A 4REQB 4OQXA 4QBFA 1XZ8A 4EAAA 4EJFA 2WKRA 1NXOA 3NH9A 3QP9A 2DGDA 4G2NA 4IHJF 4PZCA 4DIKA 1U7XA 2PGNA 2YW9A 3DKKA 3KR0A 1J9EA 3NIGB 4I1OA 5EKSA 2HJRA 2R6ZA 1JYSA 3IV7A 2DKNA 3H13A 3JQGA 4COKA 4DJJA 4YA6A 4M8NE 1LX7A 5G0UA 1G5RA 1Y6FA 3T1QA 4HXGA 4P93A 4A03A 2I78A 3UAOA 4QGSA 2BEWB 2B2XA 1K66A 3EGEA 2Y99A 4MCHA 1A96A 1L7EA 4V2UA 4LFAB 1E2IA 4QX6A 4YAEA 4P4LA 4MW7A 4TMYA 3FFTA 3CCBA 3U13A 2W22A 4F96A 5I8WA 3DNMA 3RCBA 1E9FA 1IUOA 5G02A 5JHGB 3LQRA 3WNVA 1L3BA 2FQQA 3K2QA 3KUXA 2R1VA 3SK0A 3MJDA 4GXNA 4B4VA 4BUCA 3NOXA 5ERGB 5JD4A 1VB3A 2DX7A 2EIHA 4RD2A 2R8RA 3Q5GA 5AVOA 3TIVA 3RAEC 2H92A 1SKUA 3AUTA 1NHWA 1N6LA 2PSFA 4RYDA 3SMVA 1K1EA 5KOIA 3IBCA 1TU4A 5F3RA 1G8SA 4S1OA 5LA6A 4WN9A 4YCNA 2JDIA 1E18A 1TZJA 4KQKA 2XVAA 3IDSA 2QZ9A 5ICEA 3F49S 1UKBA 1CQJB 5I7EA 4YJKA 2E6KA 1X7WA 1UBSB 5EQFA 4RTNA 2IUYA 3DCIA 4MGEA 4DLPA 1U8CB 2JGFA 3ZK8A 1NPTO 2O4CA 1DARA 2VBFA 1D2RA 4PZLA 3TZ6A 1XPRA 3L0SA 4COOA 4G56A 5FPPA 3A8TA 4ZU3A 3Q3EA 7AT1A 3JATB 3WLTA 2FMKA 3LC2O 4C2TA 2YN4A 5DOZA 4FB4A 5C8YB 1QIFA 2QLBA 3ZGZA 5KSYA 4X64B 1P3JA 3FE2A 4YP6A 1TMYA 4YTEA 2PZFA 2IU4A 5A4FS 1M1NB 4P86A 3FKQA 4WFKA 4X7RA 4NENA 5IWCA 2F3PA 1DSSG 3LWNA 2W8BA 4IDBA 1E2QA 1HNZB 4KCGA 4EJ0A 1JDTA 4N0DA 2DKOA 2YASA 2G88A 3B38A 3E4CA 3H11B 3P2EA 2C2XA 1R4NB 3VPAA 3B85A 5CM2Z 2GMWA 3OWXA 4UTPA 2AOTA 5MF6A 2PX4A 4W1RA 5EKTA 3KZMA 2CJFA 4V39A 1E0AA 3BFXA 3PGXA 4G67A 1EWQA 3O95A 3F7NA 4NJOA 3R3HA 1ISJA 1IG3A 2CGEA 3P9SA 4P34A 1PWEA 1YZTA 1R0ZA 1Q3TA 4OB8A 3W5VA 1WHSB 4DLNA 1FDVA 1MX3A 5D3ZA 5GMOA 1YZQA 4DW8A 4KP7A 4MUEA 3RTDA 5A9SB 2BH2A 4BP1A 2VLIA 4CM1A 1KERA 2OILA 2VHVA 1PO7A 4B6RA 2YCBA 2G5PA 2OXTA 2AN9A 1SC3A 1EJBA 4HVTA 5A4JA 1LK0A 2E82A 4OQZA 3MTQA 5LSAA 3AM1A 5JNVA 2VDVE 1H6BA 4RVUA 2DQYA 4O8CA 2ZR7A 2PUWA 2JLQA 4CLRB 5JYDA 4RZHA 4P7JA 4MVJI 2WWRA 5DWVA 4BAZA 2HFKA 5A5GA 1FPMA 3QY0A 1PZFA 3A25A 3R3ZA 1IC6A 4N18A 4PY2A 3T94A 4WGFA 4OXIA 3WWYA 4A2CA 3FDFA 3UJ7A 1DGQA 1E5LA 1GNQA 5F52A 1YRYE 1PW7A 2GN2A 2Y77A 3K0AB 3ETCA 1NE7A 3EASA 4QU5A 3G0BA 2XWJI 3AFIA 4UHCA 1R0RE 1NW4A 5LXTF 3GGJA 1KQ3A 3H5LA 3PDJA 2QW1A 1TVMA 2J4CA 4KUEA 1ZJ4A 4BV3A 5BW5A 1J0AA 1HMYA 1ZBQA 2O5VA 2VHQA 4H9GA 1K6IA 5GONF 1DZ3A 1U3UA 3RVBA 2NGRA 3LQYA 4QEKA 1JGTA 3VR4H 2ZG6A 3IE1A 2XXAA 2BEUA 5TY0A 2ZSAA 5KBYA 1S7GA 1DQSA 1Z4KA 4TTVA 3OVMA 3PHBE 1H94A 2ZWPA 3L4BA 4C0JA 3E9MA 2ID7A 4NAVA 4NWIA 3B6EA 2SCUB 3LQ2A 2C00A 4P08A 1V4NA 2ZRFA 4OQPA 2GS9A 4R9SA 5CNJA 1ZOPA 2D8MA 5HIJA 4BNZA 3NXSA 3MT7A 4K1XA 1W19A 2XTZA 4Q1BA 2O2GA 5JNWA 13PKA 5DM70 2OFOA 2PQ2A 4EO9A 1LSJA 1TM1E 2H7YA 1CT9A 1T5HX 3UT6A 5HJEA 5K0ZA 2H0QA 3LKVA 1VRCA 4TLDA 3K32A 1C81A 1I3OA 3O92A 1FFCA 1NUHA 2P3LA 5K9ZA 2IS1A 4GRDA 1D4OA 3A2NA 1XHEA 3EF0A 4W5HA 3KQTA 3SE0A 4IRUB 2WA1A 2WAOA 4P5PA 3ZE0B 1WB9A 4JFAA 3PP8A 3R7FA 1JVBA 4DMKA 1M6NA 4F4FA 3EYAA 4HAIA 2CVOA 2QMOA 4MP6A 3FGNA 2QUHA 2GD0A 2V8BA 3BK2A 3L8DA 3TG8A 3GAAA 3COJA 1TVKB 1XZEA 2NAFA 3NDRA 4GF5A 4JJFA 3LT2A 3N2ZB 4OA5A 1H1TA 2X58A 3MBIA 4M83A 5A05A 3TRJA 2ESRA 3H8SA 1XCJA 1GUYA 1RABA 3H1EA 4I19A 3RH0A 3W77A 4NBVA 3N39C 3DXZA 3LPCA 3ZNNA 1X38A 4RFVA 4OP3A 3TBKA 4CV0A 2TMYA 4ESOA 5L3SA 1W30A 4QBGB 4EX6A 1W1WA 1HYBA 4NFSA 3ZHOA 3WBJA 5EZYF 1UPXA 1DQRA 1PBNA 1YS4A 2MSCB 3TQQA 2GRAA 4B1FA 2BFNA 1ULZA 4HNRA 2RSLA 1QONA 3IAAA 2WABA 2CW5A 3ELBA 3CRNA 3MLBA 1U3FA 2QKYA 2RMKA 4J1TA 4OHFA 5CJJA 2PMDA 3BIJA 5K0CA 3FWPA 1EQUA 1E3DA 2R84A 1ZH6A 2V7UA 4OI4A 1KJ8A 3FUVA 4KZPA 2OCGA 3JATA 3DO8A 3A1DA 3GJTA 2I6SA 4ZOLF 4CE6A 1EUQA 3TW8A 1IUPA 3AF2A 2XH8A 3WQRA 1QB8A 4JN6B 3ZX4A 3H3XA 1AUOA 1QJ4A 1BJTA 1FP4B 1NQTA 3S29A 1N1MA 3OLQA 1E6MA 3P0IA 3ZCUA 3ZHRA 1SVSA 2QQ0A 4NV0A 3KNZA 3GUCA 3TS1A 3X1KA 2XGMA 1G7TA 2Q29A 3KT6A 3TRDA 3NO4A 2PGOA 1S3IA 3CPEA 2D59A 1FDOA 3HS3A 3OLCX 3EMBA 4RM3A 2PEYA 1JQDA 3OOJA 2J9GA 3T9EA 2B5OA 1T43A 2EDAA 3C48A 4KQHA 3VYRB 2FUKA 3NYIA 4TQUS 1OXSC 4RVHA 3F0TA 3V4SA 3V48A 5GZ1A 2XBMA 4YAOA 2DF8A 3G9TA 1GRVA 4D6XA 3K9HA 2D0OB 2QP3A 3H2KA 4GVXA 5I5EA 2V58A 2D7JA 2EW1A 2FETA 2Y1EA 4AZTA 4HN4B 2NSYA 4CKBB 2EEZA 3ZCRA 4IMRA 1IEXA 4Z8XA 4LJYA 3GAZA 4RL6A 4HS9A 1B4DA 1IM8A 3WWZA 5FPKA 2J3EA 2IP1A 3D7KA 3PITA 4ZZ3A 2FZWA 1D6SA 4EP1A 2C07A 4A8JB 4G4SP 1SRQA 1TL7C 1W87A 2R7LA 2VDNB 2VJMB 4G0OA 4YT2A 4BVFA 2FK8A 1PJ4A 2CZCA 2BCEA 3U0BA 4DC0A 5HS4A 5ALOA 3RRJA 2CZGA 2ZB8A 1P4HA 1B1CA 1J70A 1EQ2A 4BBJA 1W47A 3PC8A 5FT9A 3O0DA 4P3XA 4YPFA 5JTUA 4RSHA 1T35A 1F48A 4LSGA 1D9ZA 2AUTA 3H0CA 5ARDA 1L5GB 3UMRA 2NUPB 4IX9A 3ZV6A 5KVCA 1UOPA 1C1DA 3ZWXA 2KM1A 3HUEA 3HADA 2ECKA 3Q3HA 1N25A 3QQPA 4MEAA 4QICA 3CEHA 4YP1A 5HZMA 1WTAA 4DJFC 4FMCB 1QTNA 3LT5A 3FM9A 3GGDA 5E3IA 3R5SA 4O08A 2ZS7A 5F33A 4IIHA 1FU8A 5EIOA 2ZSJA 1CJCA 3S1AB 2WIKA 3LOQA 3AJRA 3Q2OA 2OZLA 2JAWA 4CCYA 2HB6A 1U8UA 2PL5A 2YINC 1I94B 2JLVA 2HEIA 2XWQA 1T36B 5DHPA 1GVNB 3Q0IA 1A8SA 2AJTA 1X94A 3KHUA 4KXNA 1YDWA 3I23A 1ULHA 4KWIA 5A1JA 4YJ2B 2RHOA 1A2QA 1N9KA 3NTOA 4IIGA 1J7JA 3A1VA 4ZVPA 2NACA 3DL4A 4MRSA 4GOMD 4C4SA 2XSZA 2E21A 3OCWA 4QQFA 1B16A 5AKLA 4JLWA 3W3AD 1CJSA 3IV6A 1XZDA 5CFZA 3V46A 3KLMX 4PZPA 2W2OA 1D2NA 5C4GB 3RF6A 1D1TA 5C8YF 5CD9A 3JAKB 1KQNA 3E8MA 4EI2A 5KAPA 2ZT8A 4KYUA 5CVCA 4RTJA 4H7FA 4BNIA 3SFZA 1YO6A 2V65A 5T7BA 4MWTA 3E0XA 1TA4A 1UEXC 2CNLA 1ZW1A 1D0SA 1I4TD 3PFFA 2QX8A 2PRIA 3SHTA 3LCCA 2JF0A 2JIOA 3E7PA 3IKTA 1TUIA 4PO8A 1OX4A 1P0QA 1FS5A 5AJZA 5FUVA 1FB5A 4E5NA 4WD3A 3K0HA 4CVNA 5LVAA 4NK5A 1F51E 3Q8XB 3LQ1A 2VTBB 1JAHA 4IW3B 4GKAA 4I6EA 1DMSA 1AUPA 5E38A 2I3ZA 1LTKA 1NV9A 1S3SA 1Z45A 3BMQA 4CL3A 1GAWA 1BG6A 3G49A 4GPD1 2ACVA 4XM1A 1EVLA 2YN2A 3ETJA 2G0NA 3CUWA 1D2EA 2V54A 3MNFA 5IYZF 2VJBA 1ONOA 3U7JA 4C4YA 3ITEA 2G25A 1IXRC 2C8VA 3N8GA 1W581 3N8DA 3EZYA 2J9RA 5JRJA 5HUQA 2QY9A 3WGQA 1UK9A 1ZN2A 1SZCA 1XPUA 4OHOA 3RE1A 4GT1A 3W7AA 2W2LD 1X77A 3WDKA 2WJ6A 2KPOA 3TAXA 1FFGA 3M89A 5B6PA 3LZDA 1AV6A 3WWEA 1DI0A 2G9ZA 2JA1A 4X95A 1UT6A 4FONA 4XARA 5K4AA 2I3DA 3W04A 3DM9B 4AY5A 1NUUA 1MHTA 1QFSA 1QHEA 1N2SA 2R48A 1H3FA 5KOHA 9MHTA 4UE3S 5ADVA 5IC4A 5C7IO 1RJ9B 1JAIA 5K3FB 3VYSB 1XNQB 3TSYA 4EYEA 2ODNA 3NHYA 3MSXA 2NVUB 1PR9A 1VPWA 4H18A 4CMGA 3QEJA 5DTEA 1SG0A 2E4ZA 2I71A 2JI7A 2A5DA 4K9NA 2ZYRA 2VQDA 3DDHA 2BMFA 1RWQA 4U6NA 5BSWA 5J4HA 3ZU2A 2QMQA 3BD8A 5DE3A 3PUIA 2CL5A 4M0UA 3KOWA 5AUNB 3ZI7A 1I6MA 1QFMA 2DMRA 3D6UA 1T5SA 3ZE1B 5M3BA 4KR3A 4CG3A 3H05A 4O3FA 4PLGA 1IZ8A 2WKWA 1EUDB 2O3TA 4M1TA 3E61A 1KF0A 3VR5D 4MQLA 5EG5A 1OI2A 4LRQA 2G1AA 2PXHA 3PVCA 4RIEA 3Q3JB 4W8HA 1LXCA 3PC6A 2P0AA 4LZZA 4PN3A 3TNYA 1ZZEA 4IIJB 1S01A 5IEJA 2ICAA 3V5NA 4ZXFA 4JR0A 5KSPA 3PJFA 3BTUA 3HA7A 2OHIA 3IP6A 1L7VC 5BN5B 3UKOA 3VNAA 1PK7A 2IITA 2NSHA 3HMKA 4YREA 1DV1A 2JIQA 3C3WA 3G59A 4KODA 2QUIA 1DIOB 3L8CA 4JXXA 1GWNA 3DHNA 2OBYA 2R68A 1ZCZA 2VRBA 2LPMA 3DULA 2I6UA 4Q7MB 4R8KA 4RCYA 5DXAA 3VC1A 5C8VA 4OHKA 4E4YA 2E89A 5DV9A 1YI8A 3CG4A 4ARVA 4KWHA 5A03A 3LTNC 1ZUD1 1E20A 3NDIA 5LWHA 4FFNA 1B1AA 3PUKA 3KT8A 5DASA 2Q1XA 5HTKA 2OP1A 4IJUA 3JVVA 4CTJA 4DSOA 1T0BA 3F2VA 3ROPA 3WKCA 1RLOA 1SCIA 3H9EO 4I2NA 1QCCA 1EYZA 3OX1A 1W46A 1NVWQ 3RSCA 2DPYA 3LH5A 4N6OA 3U0VA 1LQUA 2CVHA 3HCDA 4ZZ2A 4W5RA 5JMTA 2WF8A 4Y7CA 4DVJA 3WFIA 8ABPA 1U94A 1QOZA 2ISCA 3GPIA 1P33A 4R1UA 4BFWA 3P96A 4U7PB 1LJLA 1YIDA 3OICA 5H4GA 3AUKA 4RFSA 2WU3A 4R81A 4WJZA 4TSFD 4M9QA 4P38A 3NNSA 4IFEA 2CNDA 4KXVA 3ZHCA 2RGAA 2D1YA 4GMKA 3BD7A 3MRTA 2JJYA 1FTGA 2A1UA 5JNSA 2C9OA 1IY9A 3BUSA 3DLIA 1TT5B 1E6WA 2XNCA 1LBHA 2LRHA 3L0CA 4TS9A 4Q7QA 5JI2E 3D0QA 3H5VA 1QK3A 3DT9A 4CV2A 3W0LB 1SBCA 2RH4A 1A7UA 4PXSA 2BHSA 1V9LA 3FHLA 2VP0A 4FEGA 3OU7A 2JASA 4F5YA 1Z6XA 1E0SA 1UP6A 4C7BA 1H5UA 2I7XA 4KE8A 2D2VA 2YQ5A 3USZA 1J8VA 3VFDA 2YFHA 2V1XA 1QPGA 2HF8A 5KNDA 3QKRA 4ARIA 3ANYB 4HKTA 2C77A 2DY0A 3SKYA 4G26A 3C8MA 5AUQA 3TEFA 3DEFA 1ONSA 1UBLS 3DD1A 4RK6A 2XQJA 3LVFO 4RL4A 1E58A 1PN3A 2ZBPA 5K8VA 3K5PA 4Z4IA 4I5FA 4FDMA 4X8MA 2BTEA 1DRVA 1SCJA 1CUBA 1N8KA 5IPFA 3PCXA 1VLVA 3N7AA 2I99A 2SICE 3ZD9A 4H2DA 4F1WA 4Q4CA 4XCVA 1AZTA 3C98A 1SHKA 4AECA 3A6DA 4NZYA 3WI7A 5BSKA 1RPJA 5LU9A 2CMHA 2Q27A 4ANFA 1CETA 1QZTA 4PSAA 3R6LA 1ZYUA 1E64A 4HR7A 2OO3A 4RQAA 2I1LA 5MGBA 1CEQA 1WF3A 1YH3A 1GRRA 1QRRA 1A9RA 1SCDA 1AKUA 2H8KA 4CM9A 1R6AA 2YWDA 3WR5A 3L1VA 3EZ6A 1ANKA 5FRDA 3VZBA 1P60A 4QJIA 1CBUA 3ECAA 3F97A 1LI4A 5IK2A 5KOHB 3GGOA 5CH8A 2XKJE 2W6ZA 3KDPA 2Q7DA 5JQGA 1TT5A 1JDPA 4RAQA 1HDOA 1DKPA 3GZNB 5MDHA 5IRCD 1U2RA 1VOTA 1ZGZA 2LNDA 4WRRA 3WE7A 1NZJA 1EA5A 3FPSA 4Q1CA 2XB2A 5KINB 5FPTA 1C3EA 1UZLA 2FZLA 3FCEA 2ZJZA 3SZOA 1PTJC 2PH5A 1Z5NA 3WMWA 4N8EA 2ZYWX 3FPJA 2PL3A 2JLUA 4ZOLB 5K0SA 3AB3A 4KRXA 2I2CA 5HZHA 3VAYA 1N9GB 4YCLA 3CNEA 3V8PA 1DADA 3IT2A 1QYIA 3LP6A 4Q7KA 5FH9A 1OAAA 2WU8A 3MMNA 4N8SA 3LC0A 2VAMA 1NX6A 4EG3A 1C0IA 3MJTA 1KIFA 3OFND 3RT7A 3PEWA 2VO1A 3HP7A 5AW8A 5ALEA 5IAGA 1N92A 2ZJAA 4MB2A 5KYKA 1HX7A 4A8JA 3DXXA 1D2CA 1CF9A 4Q48A 4JCOA 3WZ2A 1LS1A 1QKJA 2Q99A 3LX5A 1ZH2A 1CF2O 1X87A 5FTKA 3AF0A 3EXEB 2J0UA 5C37A 3LHFA 1DAHA 1J8YF 4UPEA 2I62A 3MWFA 3NS7A 3CONA 4B7UA 2WD7A 5KC8A 3CZMA 4UE6A 1FW6A 2OG1A 3SX0A 3SBOA 3LFUA 1EPUA 1QGOA 1T3LA 5CLLA 3VKHA 1VYUA 1U28C 1TUEA 3NNDA 4FZVA 3BCRA 1K7FB 1SHLA 1SUCA 2HO4A 1AB6A 5BXYA 4LOAA 3MCUA 1Z47A 1BXRA 2RHDA 1EFPB 5I4CA 1KI3A 1NVAA 1WZEA 1P8JA 3FCYA 4GR4A 4P0TA 4H6PA 4NBWA 2NTYC 4AMGA 5JJIA 4QYMA 5AVUA 3TINA 2R7MA 3LO8A 3C3BA 3MB5A 4JGBA 5DB4A 3AFGA 5A7FA 5J47A 1ZINA 1EXVA 1VGRA 3JD0A 4UREA 3QX7A 1OXXK 2IIQA 4DG8A 1ZJJA 1AKTA 2B8NA 1DAKA 4JSRA 4WW0A 1QFXA 3IP8A 2FAXA 2PUVA 3R5XA 5A4MS 1KRWA 3IUPA 4O33A 4BRSA 1AQUA 5D7NA 1ZVMA 3H0EA 5ALIA 2OORC 3B3GA 2IZ5A 4K05A 5AP9A 4RZXA 4RF2A 1K0UA 4TWIA 5DCYA 4RIFA 3EF1A 4BNKA 2DHDA 2FX3A 4WKBA 1NBMD 1UP4A 1NONA 1KGDA 1DZIA 2MYTA 2C0QA 2TMKA 4BFVA 4X65B 5HK9A 4OV6B 3TW8B 3LS2A 3CIFA 3LZCA 3KOOA 4R40A 4LS3A 5CX1A 5I8PA 3DO5A 4UM5A 4DEYA 4DY4A 4MNTA 4WK4B 1RPZA 4HAVA 2F8SA 2VJDA 3KWLA 3QLEA 1XAIA 3AVTA 3ESZA 1E79A