3KIVA

Recombinant kringle iv-10/m66 variant of human apolipoprotein(a)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
79
structure length
79
Chain Sequence
QCYHGNGQSYRGTFSTTVTGRTCQSWSSMTPHRHQRTPENYPNDGLTMNYCRNPDADTGPWCFTTDPSIRWEYCNLTRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN
publication title Recombinant kringle IV-10 modules of human apolipoprotein(a): structure, ligand binding modes, and biological relevance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kringle
total genus 17
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 1998-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 3kivA00
2FD6A 3LAQA 4CIKA 5CSQA 1I5KA 3BT2A 2K51A 4DURA 1CEAA 1NK1A 4BV5A 4BVVA 1GMNA 1TPKA 5CS9A 2KJ4A 5CT2A 4BVDA 4D3CA 1I71A 1KI0A 3NXPA 5CT3A 1GMOA 1URKA 4A5TS 1B2IA 4HZHA 3E6PL 3KIVA 2K4RA 5CP9A 2DOHX 3MKPA 1KIVA 4BVWA 3BT1A 2I9BA 4KIVA 1KRNA 5CS5A 2PF1A 1PMKA 1PKRA 1NL1A 2QJ4A 4NZQA 1A0HA 3SP8A 1PMLA 5CS3A 1KDUA 1GP9A 3U73A 1JFNA 1HPJA 1CEBA 2I9AA 3K65A 1HPKA 2DOIA 4O03A 2PK4A 4BV7A 2KNFA 5HPGA 2HPQP 5CS1A 2PF2A 1PK4A 4IUAA 3HN4A 5CT1A 2QJ2A 2L0SA 2SPTA 4BVCA 1BHTA 2FEBA 5COEA 1PK2A 1NL2A 2HPPP
chains in the Genus database with same CATH superfamily
2FD6A 3LAQA 4CIKA 5CSQA 1I5KA 3BT2A 2K51A 4DURA 1CEAA 1NK1A 4BV5A 4BVVA 1GMNA 1TPKA 5CS9A 2KJ4A 5CT2A 4BVDA 4D3CA 1I71A 1KI0A 3NXPA 5CT3A 1GMOA 1URKA 4A5TS 1B2IA 4HZHA 3E6PL 3KIVA 2K4RA 5CP9A 2DOHX 3MKPA 1KIVA 4BVWA 3BT1A 2I9BA 4KIVA 1KRNA 5CS5A 2PF1A 1PMKA 1PKRA 1NL1A 2QJ4A 4NZQA 1A0HA 3SP8A 1PMLA 5CS3A 1KDUA 1GP9A 3U73A 1JFNA 1HPJA 1CEBA 2I9AA 3K65A 1HPKA 2DOIA 4O03A 2PK4A 4BV7A 2KNFA 5HPGA 2HPQP 5CS1A 2PF2A 1PK4A 4IUAA 3HN4A 5CT1A 2QJ2A 2L0SA 2SPTA 4BVCA 1BHTA 2FEBA 5COEA 1PK2A 1NL2A 2HPPP
chains in the Genus database with same CATH topology
2FD6A 3LAQA 4CIKA 5CSQA 1I5KA 3BT2A 2K51A 4DURA 1CEAA 1NK1A 4BV5A 4BVVA 1GMNA 1TPKA 5CS9A 2KJ4A 5CT2A 4BVDA 4D3CA 1I71A 1KI0A 3NXPA 5CT3A 1GMOA 1URKA 4A5TS 1B2IA 4HZHA 3E6PL 3KIVA 2K4RA 5CP9A 2DOHX 3MKPA 1KIVA 4BVWA 3BT1A 2I9BA 4KIVA 1KRNA 5CS5A 2PF1A 1PMKA 1PKRA 1NL1A 2QJ4A 4NZQA 1A0HA 3SP8A 1PMLA 5CS3A 1KDUA 1GP9A 3U73A 1JFNA 1HPJA 1CEBA 2I9AA 3K65A 1HPKA 2DOIA 4O03A 2PK4A 4BV7A 2KNFA 5HPGA 2HPQP 5CS1A 2PF2A 1PK4A 4IUAA 3HN4A 5CT1A 2QJ2A 2L0SA 2SPTA 4BVCA 1BHTA 2FEBA 5COEA 1PK2A 1NL2A 2HPPP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FD6 A;  3LAQ A;  4CIK A;  5CSQ A;  1I5K A;  3BT2 A;  2K51 A;  4DUR A;  1CEA A;  1NK1 A;  4BV5 A;  4BVV A;  1GMN A;  1TPK A;  5CS9 A;  2KJ4 A;  5CT2 A;  4BVD A;  4D3C A;  1I71 A;  1KI0 A;  3NXP A;  5CT3 A;  1GMO A;  1URK A;  4A5T S;  1B2I A;  4HZH A;  3E6P L;  3KIV A;  2K4R A;  5CP9 A;  2DOH X;  3MKP A;  1KIV A;  4BVW A;  3BT1 A;  2I9B A;  4KIV A;  1KRN A;  5CS5 A;  2PF1 A;  1PMK A;  1PKR A;  1NL1 A;  2QJ4 A;  4NZQ A;  1A0H A;  3SP8 A;  1PML A;  5CS3 A;  1KDU A;  1GP9 A;  3U73 A;  1JFN A;  1HPJ A;  1CEB A;  2I9A A;  3K65 A;  1HPK A;  2DOI A;  4O03 A;  2PK4 A;  4BV7 A;  2KNF A;  5HPG A;  2HPQ P;  5CS1 A;  2PF2 A;  1PK4 A;  4IUA A;  3HN4 A;  5CT1 A;  2QJ2 A;  2L0S A;  2SPT A;  4BVC A;  1BHT A;  2FEB A;  5COE A;  1PK2 A;  1NL2 A;  2HPP P; 
#chains in the Genus database with same CATH topology
 2FD6 A;  3LAQ A;  4CIK A;  5CSQ A;  1I5K A;  3BT2 A;  2K51 A;  4DUR A;  1CEA A;  1NK1 A;  4BV5 A;  4BVV A;  1GMN A;  1TPK A;  5CS9 A;  2KJ4 A;  5CT2 A;  4BVD A;  4D3C A;  1I71 A;  1KI0 A;  3NXP A;  5CT3 A;  1GMO A;  1URK A;  4A5T S;  1B2I A;  4HZH A;  3E6P L;  3KIV A;  2K4R A;  5CP9 A;  2DOH X;  3MKP A;  1KIV A;  4BVW A;  3BT1 A;  2I9B A;  4KIV A;  1KRN A;  5CS5 A;  2PF1 A;  1PMK A;  1PKR A;  1NL1 A;  2QJ4 A;  4NZQ A;  1A0H A;  3SP8 A;  1PML A;  5CS3 A;  1KDU A;  1GP9 A;  3U73 A;  1JFN A;  1HPJ A;  1CEB A;  2I9A A;  3K65 A;  1HPK A;  2DOI A;  4O03 A;  2PK4 A;  4BV7 A;  2KNF A;  5HPG A;  2HPQ P;  5CS1 A;  2PF2 A;  1PK4 A;  4IUA A;  3HN4 A;  5CT1 A;  2QJ2 A;  2L0S A;  2SPT A;  4BVC A;  1BHT A;  2FEB A;  5COE A;  1PK2 A;  1NL2 A;  2HPP P; 
#chains in the Genus database with same CATH homology
 2FD6 A;  3LAQ A;  4CIK A;  5CSQ A;  1I5K A;  3BT2 A;  2K51 A;  4DUR A;  1CEA A;  1NK1 A;  4BV5 A;  4BVV A;  1GMN A;  1TPK A;  5CS9 A;  2KJ4 A;  5CT2 A;  4BVD A;  4D3C A;  1I71 A;  1KI0 A;  3NXP A;  5CT3 A;  1GMO A;  1URK A;  4A5T S;  1B2I A;  4HZH A;  3E6P L;  3KIV A;  2K4R A;  5CP9 A;  2DOH X;  3MKP A;  1KIV A;  4BVW A;  3BT1 A;  2I9B A;  4KIV A;  1KRN A;  5CS5 A;  2PF1 A;  1PMK A;  1PKR A;  1NL1 A;  2QJ4 A;  4NZQ A;  1A0H A;  3SP8 A;  1PML A;  5CS3 A;  1KDU A;  1GP9 A;  3U73 A;  1JFN A;  1HPJ A;  1CEB A;  2I9A A;  3K65 A;  1HPK A;  2DOI A;  4O03 A;  2PK4 A;  4BV7 A;  2KNF A;  5HPG A;  2HPQ P;  5CS1 A;  2PF2 A;  1PK4 A;  4IUA A;  3HN4 A;  5CT1 A;  2QJ2 A;  2L0S A;  2SPT A;  4BVC A;  1BHT A;  2FEB A;  5COE A;  1PK2 A;  1NL2 A;  2HPP P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...