3KJ4A

Structure of rat nogo receptor bound to 1d9 antagonist antibody
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
283
structure length
283
Chain Sequence
CPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISYVPAASFQSCRNLTILWLHSNALAGIDAAAFTGLTLLEQLDLSDNAQLRVVDPTTFRGLGHLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLVPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLAGRDLKRLAASDLEGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment 1D9 light chain
publication title Resolution of disulfide heterogeneity in Nogo receptor 1 fusion proteins by molecular engineering.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 69
structure length 283
sequence length 283
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3kj4A00
4C2AB 3RW6A 2Z82A 3ZYNA 1D0BA 3RJ0A 1OTMA 4K17A 1JL5A 4LSXA 3BZ5A 4CILA 1OTNA 2WQUA 4CNMA 1DCEA 4U09A 3W3MA 2Z65A 4BSUA 3C6NB 3OGLB 2Z66A 2P1PB 4XGOA 3OGKB 2WQWA 1M9SA 4YEBB 4M7EC 3PMHG 4Z94G 4QC0A 3KJ4A 2V9TB 4U06A 2V70A 4EZGA 4RWTC 1QYYA 5IJDA 4M7EA 4FDWA 5CMNA 4J4LA 3CIYA 3A79B 3OGMB 3OJAA 5GS2B 5FTTB 1P9AG 4XSQA 3REZA 2Z63A 3UL9A 4WP6A 2ID5A 5A5CA 4U08A 1SQ0B 4U7LA 2Z7XA 4OQTA 4R6GA 1FS2A 4R6JA 4AW4A 4LI2A 4FD0A 4V2DA 1GWBA 2Z81A 2P1MB 1FO1A 2FT3A 3M18A 5GS0A 1XWDC 4GT6A 4ARNA 4WYKA 4Z64C 1XKUA 2OMZA 2OMYA 5AZ5A 4KT1A 4ECNA 5IJCA 3G3BA 4C2BB 3C6OB 3ZYOA 2XWTC 3GOZA 3OJAB 1M9LA 4R5DA 1H6UA 5B0NA 5AWAA 2Q4GW 4CNCA 1K5DC 2O6QA 4PERA 4J0MA 3UN9A 4V2CA 3ULUA 3RFSA 1O6SA 3O6NA 1KOOA 4PEQB 4TZHA 2Z7XB 1KOHA 4NKGA 3W3NA 3DZEA 3WPBA 2IFGA 2OMWA 1A4YA 4HQ1A 4NKHA 3JB9j 4L3FA 4MN8B 1M0ZA 2BEXA 2RR6A 3CIGA 3RGXA 1W8AA 3WPIA 3E3ZA 4FCGA 4FS7A 4ARRA 3WPFA 4Z79A 4H09A 3RFEA 4V2EA 3G3AA 3RIZA 1WWLA 3WPHA 3E6JA 3ULVA 4G8AA 2JE1A 5AWCA 4R08A 4B8CD 3P72A 1FT8A 3RGZA 4R09A 1U0ND 3RFJA 5B0TA 3ZYJA 4R5CA 4R6AA 1IO0A 4Z8GA 3M19A 3W3KA 3O53A 5GMHA 4ECOA 5D3IA 2P1QB 2UZXA 1XCDA 4BSSA 4CC4C 2OMUA 4PQ8A 5IJBA 4LI1A 4FMZA 4CP6A 4XOSA 1XECA 4RCWA 3G39A 3WPDA 2WQVA 1ZIWA 2OMTA 4QBZA 2Z64A 3CVRA 3W3GA 1A9NA 4LSCA 4QXEA 2V9SA 5CMPA 1O6TA 2XOTA 4BV4R 1DS9A 4UFRA 1XEUA 4I6JB 5GQRK 3G06A 1K5GC 1OZNA 1OTOA 3RW7A 4LSXC 3E4GA 4RCAB 1YRGA 1PGVA 4LSAA 2ASTB 3UL7A 4BSRA 3WN4A 3W3LA 5GMGA 4PSJA 3ZYIA 1DFJI 1OGQA 2R9UA 4L3AA 4FHOA 2JE0A 4Y61B 3WPGA 5B4PA 4R6FA 4KXFB 1FQVA 1Z7XW 4IM6A 2WFHA 2OMXA 2P1NB 3W3JA 3FXIA 2WQXA 2UZYA 2ELLA 4Q3IA 5GMFA 1P8VA 4LXSA 4Z61C 3SB4A 5AWBA 4Q62A 4P91A 1P8TA 4R58A 2CA6A 1M10B 3WPEA 2BNHA 2O6RA 3E2JA 3ULAA 2RA8A 3VQ2A 2P1OB 2O6SA 4R07A 1O6VA 3WPCA 1G9UA 4Q3GA 4AY9X 3UL8A 4KNGA 1LTXA 4CC4A 2Y5QA 4MQWX 2ASSB 4PKIG 2OMVA 5HZLB 5LFNA 2JQDA 2A0ZA 1H6TA 5HDHA 4P8SA 3VQ1A 4GLPA 3TSRE 4LXRA 1OOKG 3C6PB 3G04C 4R0AA 2Z62A 5AWDA 5IYXC
chains in the Genus database with same CATH superfamily
4C2AB 3RW6A 2Z82A 3ZYNA 1D0BA 3RJ0A 1OTMA 4K17A 1JL5A 4LSXA 3BZ5A 4CILA 1OTNA 2WQUA 4CNMA 1DCEA 4U09A 3W3MA 2Z65A 4BSUA 3C6NB 3OGLB 2Z66A 2P1PB 4NZTM 4XGOA 3OGKB 2WQWA 1M9SA 4YEBB 4M7EC 3PMHG 4Z94G 4QC0A 3KJ4A 2V9TB 4U06A 2V70A 4EZGA 4RWTC 1QYYA 5IJDA 4M7EA 4FDWA 5CMNA 4J4LA 3CIYA 3A79B 3OGMB 3OJAA 5GS2B 5FTTB 1P9AG 4XSQA 3REZA 2Z63A 3UL9A 4WP6A 2ID5A 5A5CA 4U08A 1SQ0B 4U7LA 2Z7XA 4OQTA 4R6GA 1FS2A 4R6JA 4AW4A 4LI2A 4FD0A 4V2DA 1GWBA 2Z81A 2P1MB 1FO1A 2FT3A 3M18A 5GS0A 1XWDC 4GT6A 4ARNA 4WYKA 4Z64C 1XKUA 2OMZA 2OMYA 5AZ5A 4KT1A 4ECNA 5IJCA 3G3BA 4C2BB 3C6OB 3ZYOA 2XWTC 3GOZA 3OJAB 1M9LA 4R5DA 1H6UA 5B0NA 5AWAA 2Q4GW 4CNCA 1K5DC 2O6QA 4PERA 4J0MA 3UN9A 4V2CA 3ULUA 3RFSA 1O6SA 3O6NA 1KOOA 4PEQB 4TZHA 2Z7XB 1KOHA 4NKGA 3W3NA 3DZEA 3WPBA 2IFGA 2OMWA 1A4YA 4HQ1A 4NKHA 3JB9j 4L3FA 4MN8B 1M0ZA 2BEXA 2RR6A 3CIGA 3RGXA 1W8AA 3WPIA 3E3ZA 4FCGA 4FS7A 4ARRA 3WPFA 4Z79A 4H09A 3RFEA 4V2EA 3G3AA 3RIZA 1WWLA 3WPHA 3E6JA 3ULVA 4G8AA 2JE1A 5AWCA 4R08A 4B8CD 3P72A 1FT8A 3RGZA 4R09A 1U0ND 3RFJA 5B0TA 3ZYJA 4R5CA 4R6AA 1IO0A 4Z8GA 3M19A 3W3KA 3O53A 5GMHA 4ECOA 5D3IA 2P1QB 2UZXA 1XCDA 4BSSA 4CC4C 2OMUA 4PQ8A 5IJBA 4LI1A 4FMZA 4CP6A 4XOSA 1XECA 4RCWA 3G39A 3WPDA 2WQVA 1ZIWA 2OMTA 4QBZA 2Z64A 3CVRA 3W3GA 1A9NA 4LSCA 4QXEA 2V9SA 4NZRM 5CMPA 1O6TA 2XOTA 4BV4R 1DS9A 4UFRA 1XEUA 4I6JB 5GQRK 3G06A 1K5GC 1OZNA 1OTOA 3RW7A 4LSXC 3E4GA 4RCAB 1YRGA 1PGVA 4LSAA 2ASTB 3UL7A 4BSRA 3WN4A 3W3LA 5GMGA 4PSJA 3ZYIA 1DFJI 1OGQA 2R9UA 4L3AA 4FHOA 2JE0A 4Y61B 3WPGA 5B4PA 4R6FA 4KXFB 1FQVA 1Z7XW 4IM6A 2WFHA 2OMXA 2P1NB 3W3JA 3FXIA 2WQXA 2UZYA 2ELLA 4Q3IA 5GMFA 1P8VA 4LXSA 4Z61C 3SB4A 5AWBA 4Q62A 4P91A 1P8TA 4R58A 2CA6A 1M10B 3WPEA 2BNHA 2O6RA 3E2JA 3ULAA 2RA8A 3VQ2A 2P1OB 2O6SA 4R07A 1O6VA 3WPCA 1G9UA 4Q3GA 4AY9X 3UL8A 4KNGA 1LTXA 4CC4A 2Y5QA 4MQWX 2ASSB 4PKIG 2OMVA 5HZLB 5LFNA 2JQDA 2A0ZA 1H6TA 5HDHA 4P8SA 3VQ1A 4GLPA 3TSRE 4LXRA 1OOKG 3C6PB 3G04C 4R0AA 2Z62A 5AWDA 5IYXC
chains in the Genus database with same CATH topology
4C2AB 3RW6A 2Z82A 3ZYNA 1D0BA 3RJ0A 1OTMA 4K17A 1JL5A 4LSXA 3BZ5A 4CILA 1OTNA 2WQUA 4CNMA 1DCEA 4U09A 3W3MA 2Z65A 4BSUA 3C6NB 3OGLB 2Z66A 2P1PB 4XGOA 3OGKB 2WQWA 1M9SA 4YEBB 4M7EC 3PMHG 4Z94G 4QC0A 3KJ4A 2V9TB 4U06A 2V70A 4EZGA 4RWTC 1QYYA 5IJDA 4M7EA 4FDWA 5CMNA 4J4LA 3CIYA 3A79B 3OGMB 3OJAA 5GS2B 5FTTB 1P9AG 4XSQA 3REZA 2Z63A 3UL9A 4WP6A 2ID5A 5A5CA 4U08A 1SQ0B 4U7LA 2Z7XA 4OQTA 4R6GA 1FS2A 4R6JA 4AW4A 4LI2A 4FD0A 4V2DA 1GWBA 2Z81A 2P1MB 1FO1A 2FT3A 3M18A 5GS0A 1XWDC 4GT6A 4ARNA 4WYKA 4Z64C 1XKUA 2OMZA 2OMYA 5AZ5A 4KT1A 4ECNA 5IJCA 3G3BA 4C2BB 3C6OB 3ZYOA 2XWTC 3GOZA 3OJAB 1M9LA 4R5DA 1H6UA 5B0NA 5AWAA 2Q4GW 4CNCA 1K5DC 2O6QA 4PERA 4J0MA 3UN9A 4V2CA 3ULUA 3RFSA 1O6SA 3O6NA 1KOOA 4PEQB 4TZHA 2Z7XB 1KOHA 4NKGA 3W3NA 3DZEA 3WPBA 2IFGA 2OMWA 1A4YA 4HQ1A 4NKHA 3JB9j 4L3FA 4MN8B 1M0ZA 2BEXA 2RR6A 3CIGA 3RGXA 1W8AA 3WPIA 3E3ZA 4FCGA 4FS7A 4ARRA 3WPFA 4Z79A 4H09A 3RFEA 4V2EA 3G3AA 3RIZA 1WWLA 3WPHA 3E6JA 3ULVA 4G8AA 2JE1A 5AWCA 4R08A 4B8CD 3P72A 1FT8A 3RGZA 4R09A 1U0ND 3RFJA 5B0TA 3ZYJA 4R5CA 4R6AA 1IO0A 4Z8GA 3M19A 3W3KA 3O53A 5GMHA 4ECOA 5D3IA 2P1QB 2UZXA 1XCDA 4BSSA 4CC4C 2OMUA 4PQ8A 5IJBA 4LI1A 4FMZA 4CP6A 4XOSA 1XECA 4RCWA 3G39A 3WPDA 2WQVA 1ZIWA 2OMTA 4QBZA 2Z64A 3CVRA 3W3GA 1A9NA 4LSCA 4QXEA 2V9SA 5CMPA 1O6TA 2XOTA 4BV4R 1DS9A 4UFRA 1XEUA 4I6JB 5GQRK 3G06A 1K5GC 1OZNA 1OTOA 3RW7A 4LSXC 3E4GA 4RCAB 1YRGA 1PGVA 4LSAA 2ASTB 3UL7A 4BSRA 3WN4A 3W3LA 5GMGA 4PSJA 3ZYIA 1DFJI 1OGQA 2R9UA 4L3AA 4FHOA 2JE0A 4Y61B 3WPGA 5B4PA 4R6FA 4KXFB 1FQVA 1Z7XW 4IM6A 2WFHA 2OMXA 2P1NB 3W3JA 3FXIA 2WQXA 2UZYA 2ELLA 4Q3IA 5GMFA 1P8VA 4LXSA 4Z61C 3SB4A 5AWBA 4Q62A 4P91A 1P8TA 4R58A 2CA6A 1M10B 3WPEA 2BNHA 2O6RA 3E2JA 3ULAA 2RA8A 3VQ2A 2P1OB 2O6SA 4R07A 1O6VA 3WPCA 1G9UA 4Q3GA 4AY9X 3UL8A 4KNGA 1LTXA 4CC4A 2Y5QA 4MQWX 2ASSB 4PKIG 2OMVA 5HZLB 5LFNA 2JQDA 2A0ZA 1H6TA 5HDHA 4P8SA 3VQ1A 4GLPA 3TSRE 4LXRA 1OOKG 3C6PB 3G04C 4R0AA 2Z62A 5AWDA 5IYXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2A B;  3RW6 A;  2Z82 A;  3ZYN A;  1D0B A;  3RJ0 A;  1OTM A;  4K17 A;  1JL5 A;  4LSX A;  3BZ5 A;  4CIL A;  1OTN A;  2WQU A;  4CNM A;  1DCE A;  4U09 A;  3W3M A;  2Z65 A;  4BSU A;  3C6N B;  3OGL B;  2Z66 A;  2P1P B;  4XGO A;  3OGK B;  2WQW A;  1M9S A;  4YEB B;  4M7E C;  3PMH G;  4Z94 G;  4QC0 A;  3KJ4 A;  2V9T B;  4U06 A;  2V70 A;  4EZG A;  4RWT C;  1QYY A;  5IJD A;  4M7E A;  4FDW A;  5CMN A;  4J4L A;  3CIY A;  3A79 B;  3OGM B;  3OJA A;  5GS2 B;  5FTT B;  1P9A G;  4XSQ A;  3REZ A;  2Z63 A;  3UL9 A;  4WP6 A;  2ID5 A;  5A5C A;  4U08 A;  1SQ0 B;  4U7L A;  2Z7X A;  4OQT A;  4R6G A;  1FS2 A;  4R6J A;  4AW4 A;  4LI2 A;  4FD0 A;  4V2D A;  1GWB A;  2Z81 A;  2P1M B;  1FO1 A;  2FT3 A;  3M18 A;  5GS0 A;  1XWD C;  4GT6 A;  4ARN A;  4WYK A;  4Z64 C;  1XKU A;  2OMZ A;  2OMY A;  5AZ5 A;  4KT1 A;  4ECN A;  5IJC A;  3G3B A;  4C2B B;  3C6O B;  3ZYO A;  2XWT C;  3GOZ A;  3OJA B;  1M9L A;  4R5D A;  1H6U A;  5B0N A;  5AWA A;  2Q4G W;  4CNC A;  1K5D C;  2O6Q A;  4PER A;  4J0M A;  3UN9 A;  4V2C A;  3ULU A;  3RFS A;  1O6S A;  3O6N A;  1KOO A;  4PEQ B;  4TZH A;  2Z7X B;  1KOH A;  4NKG A;  3W3N A;  3DZE A;  3WPB A;  2IFG A;  2OMW A;  1A4Y A;  4HQ1 A;  4NKH A;  3JB9 j;  4L3F A;  4MN8 B;  1M0Z A;  2BEX A;  2RR6 A;  3CIG A;  3RGX A;  1W8A A;  3WPI A;  3E3Z A;  4FCG A;  4FS7 A;  4ARR A;  3WPF A;  4Z79 A;  4H09 A;  3RFE A;  4V2E A;  3G3A A;  3RIZ A;  1WWL A;  3WPH A;  3E6J A;  3ULV A;  4G8A A;  2JE1 A;  5AWC A;  4R08 A;  4B8C D;  3P72 A;  1FT8 A;  3RGZ A;  4R09 A;  1U0N D;  3RFJ A;  5B0T A;  3ZYJ A;  4R5C A;  4R6A A;  1IO0 A;  4Z8G A;  3M19 A;  3W3K A;  3O53 A;  5GMH A;  4ECO A;  5D3I A;  2P1Q B;  2UZX A;  1XCD A;  4BSS A;  4CC4 C;  2OMU A;  4PQ8 A;  5IJB A;  4LI1 A;  4FMZ A;  4CP6 A;  4XOS A;  1XEC A;  4RCW A;  3G39 A;  3WPD A;  2WQV A;  1ZIW A;  2OMT A;  4QBZ A;  2Z64 A;  3CVR A;  3W3G A;  1A9N A;  4LSC A;  4QXE A;  2V9S A;  5CMP A;  1O6T A;  2XOT A;  4BV4 R;  1DS9 A;  4UFR A;  1XEU A;  4I6J B;  5GQR K;  3G06 A;  1K5G C;  1OZN A;  1OTO A;  3RW7 A;  4LSX C;  3E4G A;  4RCA B;  1YRG A;  1PGV A;  4LSA A;  2AST B;  3UL7 A;  4BSR A;  3WN4 A;  3W3L A;  5GMG A;  4PSJ A;  3ZYI A;  1DFJ I;  1OGQ A;  2R9U A;  4L3A A;  4FHO A;  2JE0 A;  4Y61 B;  3WPG A;  5B4P A;  4R6F A;  4KXF B;  1FQV A;  1Z7X W;  4IM6 A;  2WFH A;  2OMX A;  2P1N B;  3W3J A;  3FXI A;  2WQX A;  2UZY A;  2ELL A;  4Q3I A;  5GMF A;  1P8V A;  4LXS A;  4Z61 C;  3SB4 A;  5AWB A;  4Q62 A;  4P91 A;  1P8T A;  4R58 A;  2CA6 A;  1M10 B;  3WPE A;  2BNH A;  2O6R A;  3E2J A;  3ULA A;  2RA8 A;  3VQ2 A;  2P1O B;  2O6S A;  4R07 A;  1O6V A;  3WPC A;  1G9U A;  4Q3G A;  4AY9 X;  3UL8 A;  4KNG A;  1LTX A;  4CC4 A;  2Y5Q A;  4MQW X;  2ASS B;  4PKI G;  2OMV A;  5HZL B;  5LFN A;  2JQD A;  2A0Z A;  1H6T A;  5HDH A;  4P8S A;  3VQ1 A;  4GLP A;  3TSR E;  4LXR A;  1OOK G;  3C6P B;  3G04 C;  4R0A A;  2Z62 A;  5AWD A;  5IYX C; 
#chains in the Genus database with same CATH topology
 4C2A B;  3RW6 A;  2Z82 A;  3ZYN A;  1D0B A;  3RJ0 A;  1OTM A;  4K17 A;  1JL5 A;  4LSX A;  3BZ5 A;  4CIL A;  1OTN A;  2WQU A;  4CNM A;  1DCE A;  4U09 A;  3W3M A;  2Z65 A;  4BSU A;  3C6N B;  3OGL B;  2Z66 A;  2P1P B;  4NZT M;  4XGO A;  3OGK B;  2WQW A;  1M9S A;  4YEB B;  4M7E C;  3PMH G;  4Z94 G;  4QC0 A;  3KJ4 A;  2V9T B;  4U06 A;  2V70 A;  4EZG A;  4RWT C;  1QYY A;  5IJD A;  4M7E A;  4FDW A;  5CMN A;  4J4L A;  3CIY A;  3A79 B;  3OGM B;  3OJA A;  5GS2 B;  5FTT B;  1P9A G;  4XSQ A;  3REZ A;  2Z63 A;  3UL9 A;  4WP6 A;  2ID5 A;  5A5C A;  4U08 A;  1SQ0 B;  4U7L A;  2Z7X A;  4OQT A;  4R6G A;  1FS2 A;  4R6J A;  4AW4 A;  4LI2 A;  4FD0 A;  4V2D A;  1GWB A;  2Z81 A;  2P1M B;  1FO1 A;  2FT3 A;  3M18 A;  5GS0 A;  1XWD C;  4GT6 A;  4ARN A;  4WYK A;  4Z64 C;  1XKU A;  2OMZ A;  2OMY A;  5AZ5 A;  4KT1 A;  4ECN A;  5IJC A;  3G3B A;  4C2B B;  3C6O B;  3ZYO A;  2XWT C;  3GOZ A;  3OJA B;  1M9L A;  4R5D A;  1H6U A;  5B0N A;  5AWA A;  2Q4G W;  4CNC A;  1K5D C;  2O6Q A;  4PER A;  4J0M A;  3UN9 A;  4V2C A;  3ULU A;  3RFS A;  1O6S A;  3O6N A;  1KOO A;  4PEQ B;  4TZH A;  2Z7X B;  1KOH A;  4NKG A;  3W3N A;  3DZE A;  3WPB A;  2IFG A;  2OMW A;  1A4Y A;  4HQ1 A;  4NKH A;  3JB9 j;  4L3F A;  4MN8 B;  1M0Z A;  2BEX A;  2RR6 A;  3CIG A;  3RGX A;  1W8A A;  3WPI A;  3E3Z A;  4FCG A;  4FS7 A;  4ARR A;  3WPF A;  4Z79 A;  4H09 A;  3RFE A;  4V2E A;  3G3A A;  3RIZ A;  1WWL A;  3WPH A;  3E6J A;  3ULV A;  4G8A A;  2JE1 A;  5AWC A;  4R08 A;  4B8C D;  3P72 A;  1FT8 A;  3RGZ A;  4R09 A;  1U0N D;  3RFJ A;  5B0T A;  3ZYJ A;  4R5C A;  4R6A A;  1IO0 A;  4Z8G A;  3M19 A;  3W3K A;  3O53 A;  5GMH A;  4ECO A;  5D3I A;  2P1Q B;  2UZX A;  1XCD A;  4BSS A;  4CC4 C;  2OMU A;  4PQ8 A;  5IJB A;  4LI1 A;  4FMZ A;  4CP6 A;  4XOS A;  1XEC A;  4RCW A;  3G39 A;  3WPD A;  2WQV A;  1ZIW A;  2OMT A;  4QBZ A;  2Z64 A;  3CVR A;  3W3G A;  1A9N A;  4LSC A;  4QXE A;  2V9S A;  4NZR M;  5CMP A;  1O6T A;  2XOT A;  4BV4 R;  1DS9 A;  4UFR A;  1XEU A;  4I6J B;  5GQR K;  3G06 A;  1K5G C;  1OZN A;  1OTO A;  3RW7 A;  4LSX C;  3E4G A;  4RCA B;  1YRG A;  1PGV A;  4LSA A;  2AST B;  3UL7 A;  4BSR A;  3WN4 A;  3W3L A;  5GMG A;  4PSJ A;  3ZYI A;  1DFJ I;  1OGQ A;  2R9U A;  4L3A A;  4FHO A;  2JE0 A;  4Y61 B;  3WPG A;  5B4P A;  4R6F A;  4KXF B;  1FQV A;  1Z7X W;  4IM6 A;  2WFH A;  2OMX A;  2P1N B;  3W3J A;  3FXI A;  2WQX A;  2UZY A;  2ELL A;  4Q3I A;  5GMF A;  1P8V A;  4LXS A;  4Z61 C;  3SB4 A;  5AWB A;  4Q62 A;  4P91 A;  1P8T A;  4R58 A;  2CA6 A;  1M10 B;  3WPE A;  2BNH A;  2O6R A;  3E2J A;  3ULA A;  2RA8 A;  3VQ2 A;  2P1O B;  2O6S A;  4R07 A;  1O6V A;  3WPC A;  1G9U A;  4Q3G A;  4AY9 X;  3UL8 A;  4KNG A;  1LTX A;  4CC4 A;  2Y5Q A;  4MQW X;  2ASS B;  4PKI G;  2OMV A;  5HZL B;  5LFN A;  2JQD A;  2A0Z A;  1H6T A;  5HDH A;  4P8S A;  3VQ1 A;  4GLP A;  3TSR E;  4LXR A;  1OOK G;  3C6P B;  3G04 C;  4R0A A;  2Z62 A;  5AWD A;  5IYX C; 
#chains in the Genus database with same CATH homology
 4C2A B;  3RW6 A;  2Z82 A;  3ZYN A;  1D0B A;  3RJ0 A;  1OTM A;  4K17 A;  1JL5 A;  4LSX A;  3BZ5 A;  4CIL A;  1OTN A;  2WQU A;  4CNM A;  1DCE A;  4U09 A;  3W3M A;  2Z65 A;  4BSU A;  3C6N B;  3OGL B;  2Z66 A;  2P1P B;  4XGO A;  3OGK B;  2WQW A;  1M9S A;  4YEB B;  4M7E C;  3PMH G;  4Z94 G;  4QC0 A;  3KJ4 A;  2V9T B;  4U06 A;  2V70 A;  4EZG A;  4RWT C;  1QYY A;  5IJD A;  4M7E A;  4FDW A;  5CMN A;  4J4L A;  3CIY A;  3A79 B;  3OGM B;  3OJA A;  5GS2 B;  5FTT B;  1P9A G;  4XSQ A;  3REZ A;  2Z63 A;  3UL9 A;  4WP6 A;  2ID5 A;  5A5C A;  4U08 A;  1SQ0 B;  4U7L A;  2Z7X A;  4OQT A;  4R6G A;  1FS2 A;  4R6J A;  4AW4 A;  4LI2 A;  4FD0 A;  4V2D A;  1GWB A;  2Z81 A;  2P1M B;  1FO1 A;  2FT3 A;  3M18 A;  5GS0 A;  1XWD C;  4GT6 A;  4ARN A;  4WYK A;  4Z64 C;  1XKU A;  2OMZ A;  2OMY A;  5AZ5 A;  4KT1 A;  4ECN A;  5IJC A;  3G3B A;  4C2B B;  3C6O B;  3ZYO A;  2XWT C;  3GOZ A;  3OJA B;  1M9L A;  4R5D A;  1H6U A;  5B0N A;  5AWA A;  2Q4G W;  4CNC A;  1K5D C;  2O6Q A;  4PER A;  4J0M A;  3UN9 A;  4V2C A;  3ULU A;  3RFS A;  1O6S A;  3O6N A;  1KOO A;  4PEQ B;  4TZH A;  2Z7X B;  1KOH A;  4NKG A;  3W3N A;  3DZE A;  3WPB A;  2IFG A;  2OMW A;  1A4Y A;  4HQ1 A;  4NKH A;  3JB9 j;  4L3F A;  4MN8 B;  1M0Z A;  2BEX A;  2RR6 A;  3CIG A;  3RGX A;  1W8A A;  3WPI A;  3E3Z A;  4FCG A;  4FS7 A;  4ARR A;  3WPF A;  4Z79 A;  4H09 A;  3RFE A;  4V2E A;  3G3A A;  3RIZ A;  1WWL A;  3WPH A;  3E6J A;  3ULV A;  4G8A A;  2JE1 A;  5AWC A;  4R08 A;  4B8C D;  3P72 A;  1FT8 A;  3RGZ A;  4R09 A;  1U0N D;  3RFJ A;  5B0T A;  3ZYJ A;  4R5C A;  4R6A A;  1IO0 A;  4Z8G A;  3M19 A;  3W3K A;  3O53 A;  5GMH A;  4ECO A;  5D3I A;  2P1Q B;  2UZX A;  1XCD A;  4BSS A;  4CC4 C;  2OMU A;  4PQ8 A;  5IJB A;  4LI1 A;  4FMZ A;  4CP6 A;  4XOS A;  1XEC A;  4RCW A;  3G39 A;  3WPD A;  2WQV A;  1ZIW A;  2OMT A;  4QBZ A;  2Z64 A;  3CVR A;  3W3G A;  1A9N A;  4LSC A;  4QXE A;  2V9S A;  5CMP A;  1O6T A;  2XOT A;  4BV4 R;  1DS9 A;  4UFR A;  1XEU A;  4I6J B;  5GQR K;  3G06 A;  1K5G C;  1OZN A;  1OTO A;  3RW7 A;  4LSX C;  3E4G A;  4RCA B;  1YRG A;  1PGV A;  4LSA A;  2AST B;  3UL7 A;  4BSR A;  3WN4 A;  3W3L A;  5GMG A;  4PSJ A;  3ZYI A;  1DFJ I;  1OGQ A;  2R9U A;  4L3A A;  4FHO A;  2JE0 A;  4Y61 B;  3WPG A;  5B4P A;  4R6F A;  4KXF B;  1FQV A;  1Z7X W;  4IM6 A;  2WFH A;  2OMX A;  2P1N B;  3W3J A;  3FXI A;  2WQX A;  2UZY A;  2ELL A;  4Q3I A;  5GMF A;  1P8V A;  4LXS A;  4Z61 C;  3SB4 A;  5AWB A;  4Q62 A;  4P91 A;  1P8T A;  4R58 A;  2CA6 A;  1M10 B;  3WPE A;  2BNH A;  2O6R A;  3E2J A;  3ULA A;  2RA8 A;  3VQ2 A;  2P1O B;  2O6S A;  4R07 A;  1O6V A;  3WPC A;  1G9U A;  4Q3G A;  4AY9 X;  3UL8 A;  4KNG A;  1LTX A;  4CC4 A;  2Y5Q A;  4MQW X;  2ASS B;  4PKI G;  2OMV A;  5HZL B;  5LFN A;  2JQD A;  2A0Z A;  1H6T A;  5HDH A;  4P8S A;  3VQ1 A;  4GLP A;  3TSR E;  4LXR A;  1OOK G;  3C6P B;  3G04 C;  4R0A A;  2Z62 A;  5AWD A;  5IYX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...