3KJ4A

Structure of rat nogo receptor bound to 1d9 antagonist antibody
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
283
structure length
283
Chain Sequence
b'CPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISYVPAASFQSCRNLTILWLHSNALAGIDAAAFTGLTLLEQLDLSDNAQLRVVDPTTFRGLGHLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLVPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLAGRDLKRLAASDLEGC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment 1D9 light chain
publication title Resolution of disulfide heterogeneity in Nogo receptor 1 fusion proteins by molecular engineering.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 69
structure length 283
sequence length 283
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3kj4A00
2WQVA 4Z79A 2V9SA 5IYXC 1XKUA 4R6FA 4QXEA 3W3JA 3OJAB 4MN8B 4XSQA 4PQ8A 1DCEA 5AWCA 3C6PB 4ECOA 3G39A 2IFGA 4M7EC 5GMGA 4Z8GA 5IJCA 5B0NA 1DS9A 1K5GC 5CMPA 4R08A 5IJBA 4PKIG 3OJAA 3CIGA 4AY9X 3E6JA 2UZXA 1O6TA 4NKGA 2OMUA 1XWDC 4Q62A 3PMHG 3VQ2A 1P9AG 2P1OB 1Z7XW 4CP6A 4IM6A 4V2DA 4U06A 4J0MA 4LSAA 2P1NB 2XWTC 1W8AA 4G8AA 5AWAA 2OMZA 3UL9A 3G3AA 1M9SA 2A0ZA 3RJ0A 3CIYA 3E3ZA 3A79B 2P1QB 3ZYJA 5A5CA 1U0ND 1O6VA 2Z82A 4QC0A 4QBZA 4P8SA 3M18A 1G9UA 2ID5A 4R5CA 4RWTC 4OQTA 4ECNA 4FCGA 2ELLA 1YRGA 4KXFB 4XOSA 1KOHA 1M0ZA 4LSXA 4R58A 2Z66A 4K17A 3ZYOA 5B0TA 1A4YA 2Z62A 4ARRA 3RIZA 1ZIWA 4R6JA 1M9LA 3WPEA 4RCAB 4Q3GA 1P8VA 4LI1A 3G04C 1OOKG 4Z64C 2P1MB 2BEXA 5AWBA 3E2JA 1IO0A 5GMHA 4L3FA 4PSJA 1WWLA 5GS0A 3REZA 4FD0A 3SB4A 2XOTA 1QYYA 3OGKB 3BZ5A 4ARNA 2Z81A 5GQRK 5IJDA 3W3NA 4I6JB 5GMFA 4WP6A 4PEQB 2WQUA 3W3KA 1M10B 3WPCA 3TSRE 4FMZA 4CNCA 2V70A 4KT1A 4AW4A 3GOZA 3CVRA 4FHOA 1H6UA 2OMVA 1OGQA 2RR6A 1FO1A 5LFNA 3RFEA 3RGZA 4P91A 2WQWA 1OTNA 4RCWA 2Z63A 4BSSA 3UN9A 2Z7XB 2Y5QA 4UFRA 1XECA 4BSRA 4Y61B 5HZLB 2OMTA 2WQXA 2WFHA 4Z61C 4LXSA 4CC4A 3VQ1A 2RA8A 3W3LA 2R9UA 2CA6A 1LTXA 4V2EA 2Z7XA 1XCDA 4YEBB 3WPFA 3WPGA 4FS7A 4U7LA 2FT3A 4LI2A 3WN4A 1FS2A 3G06A 3WPIA 2OMWA 1O6SA 4FDWA 3M19A 4KNGA 3OGLB 4U09A 1FT8A 4NKHA 4GT6A 3UL8A 4LSXC 4CNMA 1H6TA 4C2BB 3RFJA 3ULAA 4Z94G 4PERA 2UZYA 3E4GA 3ZYNA 4H09A 4MQWX 4EZGA 4M7EA 2Z64A 5D3IA 3FXIA 1DFJI 4R6AA 1OZNA 4BSUA 1GWBA 2Z65A 3RW7A 3O6NA 1A9NA 3G3BA 5FTTB 5AZ5A 4R6GA 5GS2B 1OTMA 5HDHA 1PGVA 4R07A 3JB9j 2P1PB 3OGMB 3WPBA 4LXRA 4XGOA 2V9TB 3C6NB 3W3MA 1JL5A 3RFSA 1OTOA 4V2CA 5AWDA 2BNHA 2JQDA 1D0BA 5B4PA 3RGXA 4J4LA 4R5DA 2O6RA 4R0AA 2JE1A 3WPDA 4TZHA 3DZEA 3KJ4A 4BV4R 3WPHA 2JE0A 2O6QA 2OMYA 4B8CD 1P8TA 1XEUA 3RW6A 2O6SA 3UL7A 2OMXA 1K5DC 5CMNA 4U08A 4Q3IA 4WYKA 4L3AA 4R09A 3ULUA 3ZYIA 3ULVA 4LSCA 4HQ1A 2Q4GW 2ASTB 4CC4C 4GLPA 3W3GA 1SQ0B 3C6OB 3P72A 4CILA 1KOOA 4C2AB 3O53A 2ASSB 1FQVA
chains in the Genus database with same CATH superfamily
2WQVA 4Z79A 2V9SA 5IYXC 1XKUA 4R6FA 4QXEA 3W3JA 3OJAB 4MN8B 4XSQA 4PQ8A 1DCEA 5AWCA 4NZTM 3C6PB 4ECOA 3G39A 2IFGA 4M7EC 5GMGA 4Z8GA 5IJCA 5B0NA 1DS9A 1K5GC 5CMPA 4R08A 5IJBA 4PKIG 3OJAA 3CIGA 4AY9X 3E6JA 2UZXA 1O6TA 4NKGA 2OMUA 1XWDC 4Q62A 3PMHG 3VQ2A 1P9AG 2P1OB 1Z7XW 4CP6A 4IM6A 4V2DA 4U06A 4J0MA 4LSAA 2P1NB 2XWTC 1W8AA 4G8AA 5AWAA 2OMZA 3UL9A 3G3AA 1M9SA 2A0ZA 3RJ0A 3CIYA 3E3ZA 3A79B 2P1QB 3ZYJA 5A5CA 1U0ND 1O6VA 2Z82A 4QC0A 4QBZA 4P8SA 3M18A 1G9UA 2ID5A 4R5CA 4RWTC 4OQTA 4ECNA 4FCGA 2ELLA 1YRGA 4KXFB 4XOSA 1KOHA 1M0ZA 4LSXA 4R58A 2Z66A 4K17A 3ZYOA 5B0TA 1A4YA 2Z62A 4ARRA 3RIZA 1ZIWA 4R6JA 1M9LA 3WPEA 4RCAB 4Q3GA 1P8VA 4LI1A 3G04C 1OOKG 4Z64C 2P1MB 2BEXA 5AWBA 3E2JA 1IO0A 5GMHA 4L3FA 4PSJA 1WWLA 5GS0A 3REZA 4FD0A 3SB4A 2XOTA 1QYYA 3OGKB 3BZ5A 4ARNA 2Z81A 5GQRK 5IJDA 3W3NA 4I6JB 5GMFA 4WP6A 4PEQB 2WQUA 3W3KA 1M10B 3WPCA 3TSRE 4FMZA 4CNCA 2V70A 4KT1A 4AW4A 3GOZA 3CVRA 4FHOA 1H6UA 2OMVA 1OGQA 2RR6A 1FO1A 5LFNA 3RFEA 3RGZA 4P91A 2WQWA 1OTNA 4RCWA 2Z63A 4BSSA 3UN9A 2Z7XB 2Y5QA 4UFRA 1XECA 4BSRA 4Y61B 5HZLB 2OMTA 2WQXA 2WFHA 4Z61C 4LXSA 4CC4A 3VQ1A 2RA8A 3W3LA 2R9UA 2CA6A 1LTXA 4V2EA 2Z7XA 1XCDA 4YEBB 3WPFA 3WPGA 4FS7A 4U7LA 2FT3A 4LI2A 3WN4A 1FS2A 3G06A 3WPIA 2OMWA 1O6SA 4FDWA 3M19A 4KNGA 3OGLB 4U09A 1FT8A 4NKHA 4GT6A 3UL8A 4LSXC 4CNMA 1H6TA 4C2BB 3RFJA 3ULAA 4Z94G 4PERA 2UZYA 3E4GA 3ZYNA 4H09A 4MQWX 4EZGA 4M7EA 2Z64A 5D3IA 3FXIA 1DFJI 4R6AA 1OZNA 4BSUA 1GWBA 2Z65A 3RW7A 3O6NA 1A9NA 4NZRM 3G3BA 5FTTB 5AZ5A 4R6GA 5GS2B 1OTMA 5HDHA 1PGVA 4R07A 3JB9j 2P1PB 3OGMB 3WPBA 4LXRA 4XGOA 2V9TB 3C6NB 3W3MA 1JL5A 3RFSA 1OTOA 4V2CA 5AWDA 2BNHA 2JQDA 1D0BA 5B4PA 3RGXA 4J4LA 4R5DA 2O6RA 4R0AA 2JE1A 3WPDA 4TZHA 3DZEA 3KJ4A 4BV4R 3WPHA 2JE0A 2O6QA 2OMYA 4B8CD 1P8TA 1XEUA 3RW6A 2O6SA 3UL7A 2OMXA 1K5DC 5CMNA 4U08A 4Q3IA 4WYKA 4L3AA 4R09A 3ULUA 3ZYIA 3ULVA 4LSCA 4HQ1A 2Q4GW 2ASTB 4CC4C 4GLPA 3W3GA 1SQ0B 3C6OB 3P72A 4CILA 1KOOA 4C2AB 3O53A 2ASSB 1FQVA
chains in the Genus database with same CATH topology
2WQVA 4Z79A 2V9SA 5IYXC 1XKUA 4R6FA 4QXEA 3W3JA 3OJAB 4MN8B 4XSQA 4PQ8A 1DCEA 5AWCA 3C6PB 4ECOA 3G39A 2IFGA 4M7EC 5GMGA 4Z8GA 5IJCA 5B0NA 1DS9A 1K5GC 5CMPA 4R08A 5IJBA 4PKIG 3OJAA 3CIGA 4AY9X 3E6JA 2UZXA 1O6TA 4NKGA 2OMUA 1XWDC 4Q62A 3PMHG 3VQ2A 1P9AG 2P1OB 1Z7XW 4CP6A 4IM6A 4V2DA 4U06A 4J0MA 4LSAA 2P1NB 2XWTC 1W8AA 4G8AA 5AWAA 2OMZA 3UL9A 3G3AA 1M9SA 2A0ZA 3RJ0A 3CIYA 3E3ZA 3A79B 2P1QB 3ZYJA 5A5CA 1U0ND 1O6VA 2Z82A 4QC0A 4QBZA 4P8SA 3M18A 1G9UA 2ID5A 4R5CA 4RWTC 4OQTA 4ECNA 4FCGA 2ELLA 1YRGA 4KXFB 4XOSA 1KOHA 1M0ZA 4LSXA 4R58A 2Z66A 4K17A 3ZYOA 5B0TA 1A4YA 2Z62A 4ARRA 3RIZA 1ZIWA 4R6JA 1M9LA 3WPEA 4RCAB 4Q3GA 1P8VA 4LI1A 3G04C 1OOKG 4Z64C 2P1MB 2BEXA 5AWBA 3E2JA 1IO0A 5GMHA 4L3FA 4PSJA 1WWLA 5GS0A 3REZA 4FD0A 3SB4A 2XOTA 1QYYA 3OGKB 3BZ5A 4ARNA 2Z81A 5GQRK 5IJDA 3W3NA 4I6JB 5GMFA 4WP6A 4PEQB 2WQUA 3W3KA 1M10B 3WPCA 3TSRE 4FMZA 4CNCA 2V70A 4KT1A 4AW4A 3GOZA 3CVRA 4FHOA 1H6UA 2OMVA 1OGQA 2RR6A 1FO1A 5LFNA 3RFEA 3RGZA 4P91A 2WQWA 1OTNA 4RCWA 2Z63A 4BSSA 3UN9A 2Z7XB 2Y5QA 4UFRA 1XECA 4BSRA 4Y61B 5HZLB 2OMTA 2WQXA 2WFHA 4Z61C 4LXSA 4CC4A 3VQ1A 2RA8A 3W3LA 2R9UA 2CA6A 1LTXA 4V2EA 2Z7XA 1XCDA 4YEBB 3WPFA 3WPGA 4FS7A 4U7LA 2FT3A 4LI2A 3WN4A 1FS2A 3G06A 3WPIA 2OMWA 1O6SA 4FDWA 3M19A 4KNGA 3OGLB 4U09A 1FT8A 4NKHA 4GT6A 3UL8A 4LSXC 4CNMA 1H6TA 4C2BB 3RFJA 3ULAA 4Z94G 4PERA 2UZYA 3E4GA 3ZYNA 4H09A 4MQWX 4EZGA 4M7EA 2Z64A 5D3IA 3FXIA 1DFJI 4R6AA 1OZNA 4BSUA 1GWBA 2Z65A 3RW7A 3O6NA 1A9NA 3G3BA 5FTTB 5AZ5A 4R6GA 5GS2B 1OTMA 5HDHA 1PGVA 4R07A 3JB9j 2P1PB 3OGMB 3WPBA 4LXRA 4XGOA 2V9TB 3C6NB 3W3MA 1JL5A 3RFSA 1OTOA 4V2CA 5AWDA 2BNHA 2JQDA 1D0BA 5B4PA 3RGXA 4J4LA 4R5DA 2O6RA 4R0AA 2JE1A 3WPDA 4TZHA 3DZEA 3KJ4A 4BV4R 3WPHA 2JE0A 2O6QA 2OMYA 4B8CD 1P8TA 1XEUA 3RW6A 2O6SA 3UL7A 2OMXA 1K5DC 5CMNA 4U08A 4Q3IA 4WYKA 4L3AA 4R09A 3ULUA 3ZYIA 3ULVA 4LSCA 4HQ1A 2Q4GW 2ASTB 4CC4C 4GLPA 3W3GA 1SQ0B 3C6OB 3P72A 4CILA 1KOOA 4C2AB 3O53A 2ASSB 1FQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WQV A;  4Z79 A;  2V9S A;  5IYX C;  1XKU A;  4R6F A;  4QXE A;  3W3J A;  3OJA B;  4MN8 B;  4XSQ A;  4PQ8 A;  1DCE A;  5AWC A;  3C6P B;  4ECO A;  3G39 A;  2IFG A;  4M7E C;  5GMG A;  4Z8G A;  5IJC A;  5B0N A;  1DS9 A;  1K5G C;  5CMP A;  4R08 A;  5IJB A;  4PKI G;  3OJA A;  3CIG A;  4AY9 X;  3E6J A;  2UZX A;  1O6T A;  4NKG A;  2OMU A;  1XWD C;  4Q62 A;  3PMH G;  3VQ2 A;  1P9A G;  2P1O B;  1Z7X W;  4CP6 A;  4IM6 A;  4V2D A;  4U06 A;  4J0M A;  4LSA A;  2P1N B;  2XWT C;  1W8A A;  4G8A A;  5AWA A;  2OMZ A;  3UL9 A;  3G3A A;  1M9S A;  2A0Z A;  3RJ0 A;  3CIY A;  3E3Z A;  3A79 B;  2P1Q B;  3ZYJ A;  5A5C A;  1U0N D;  1O6V A;  2Z82 A;  4QC0 A;  4QBZ A;  4P8S A;  3M18 A;  1G9U A;  2ID5 A;  4R5C A;  4RWT C;  4OQT A;  4ECN A;  4FCG A;  2ELL A;  1YRG A;  4KXF B;  4XOS A;  1KOH A;  1M0Z A;  4LSX A;  4R58 A;  2Z66 A;  4K17 A;  3ZYO A;  5B0T A;  1A4Y A;  2Z62 A;  4ARR A;  3RIZ A;  1ZIW A;  4R6J A;  1M9L A;  3WPE A;  4RCA B;  4Q3G A;  1P8V A;  4LI1 A;  3G04 C;  1OOK G;  4Z64 C;  2P1M B;  2BEX A;  5AWB A;  3E2J A;  1IO0 A;  5GMH A;  4L3F A;  4PSJ A;  1WWL A;  5GS0 A;  3REZ A;  4FD0 A;  3SB4 A;  2XOT A;  1QYY A;  3OGK B;  3BZ5 A;  4ARN A;  2Z81 A;  5GQR K;  5IJD A;  3W3N A;  4I6J B;  5GMF A;  4WP6 A;  4PEQ B;  2WQU A;  3W3K A;  1M10 B;  3WPC A;  3TSR E;  4FMZ A;  4CNC A;  2V70 A;  4KT1 A;  4AW4 A;  3GOZ A;  3CVR A;  4FHO A;  1H6U A;  2OMV A;  1OGQ A;  2RR6 A;  1FO1 A;  5LFN A;  3RFE A;  3RGZ A;  4P91 A;  2WQW A;  1OTN A;  4RCW A;  2Z63 A;  4BSS A;  3UN9 A;  2Z7X B;  2Y5Q A;  4UFR A;  1XEC A;  4BSR A;  4Y61 B;  5HZL B;  2OMT A;  2WQX A;  2WFH A;  4Z61 C;  4LXS A;  4CC4 A;  3VQ1 A;  2RA8 A;  3W3L A;  2R9U A;  2CA6 A;  1LTX A;  4V2E A;  2Z7X A;  1XCD A;  4YEB B;  3WPF A;  3WPG A;  4FS7 A;  4U7L A;  2FT3 A;  4LI2 A;  3WN4 A;  1FS2 A;  3G06 A;  3WPI A;  2OMW A;  1O6S A;  4FDW A;  3M19 A;  4KNG A;  3OGL B;  4U09 A;  1FT8 A;  4NKH A;  4GT6 A;  3UL8 A;  4LSX C;  4CNM A;  1H6T A;  4C2B B;  3RFJ A;  3ULA A;  4Z94 G;  4PER A;  2UZY A;  3E4G A;  3ZYN A;  4H09 A;  4MQW X;  4EZG A;  4M7E A;  2Z64 A;  5D3I A;  3FXI A;  1DFJ I;  4R6A A;  1OZN A;  4BSU A;  1GWB A;  2Z65 A;  3RW7 A;  3O6N A;  1A9N A;  3G3B A;  5FTT B;  5AZ5 A;  4R6G A;  5GS2 B;  1OTM A;  5HDH A;  1PGV A;  4R07 A;  3JB9 j;  2P1P B;  3OGM B;  3WPB A;  4LXR A;  4XGO A;  2V9T B;  3C6N B;  3W3M A;  1JL5 A;  3RFS A;  1OTO A;  4V2C A;  5AWD A;  2BNH A;  2JQD A;  1D0B A;  5B4P A;  3RGX A;  4J4L A;  4R5D A;  2O6R A;  4R0A A;  2JE1 A;  3WPD A;  4TZH A;  3DZE A;  3KJ4 A;  4BV4 R;  3WPH A;  2JE0 A;  2O6Q A;  2OMY A;  4B8C D;  1P8T A;  1XEU A;  3RW6 A;  2O6S A;  3UL7 A;  2OMX A;  1K5D C;  5CMN A;  4U08 A;  4Q3I A;  4WYK A;  4L3A A;  4R09 A;  3ULU A;  3ZYI A;  3ULV A;  4LSC A;  4HQ1 A;  2Q4G W;  2AST B;  4CC4 C;  4GLP A;  3W3G A;  1SQ0 B;  3C6O B;  3P72 A;  4CIL A;  1KOO A;  4C2A B;  3O53 A;  2ASS B;  1FQV A; 
#chains in the Genus database with same CATH topology
 2WQV A;  4Z79 A;  2V9S A;  5IYX C;  1XKU A;  4R6F A;  4QXE A;  3W3J A;  3OJA B;  4MN8 B;  4XSQ A;  4PQ8 A;  1DCE A;  5AWC A;  4NZT M;  3C6P B;  4ECO A;  3G39 A;  2IFG A;  4M7E C;  5GMG A;  4Z8G A;  5IJC A;  5B0N A;  1DS9 A;  1K5G C;  5CMP A;  4R08 A;  5IJB A;  4PKI G;  3OJA A;  3CIG A;  4AY9 X;  3E6J A;  2UZX A;  1O6T A;  4NKG A;  2OMU A;  1XWD C;  4Q62 A;  3PMH G;  3VQ2 A;  1P9A G;  2P1O B;  1Z7X W;  4CP6 A;  4IM6 A;  4V2D A;  4U06 A;  4J0M A;  4LSA A;  2P1N B;  2XWT C;  1W8A A;  4G8A A;  5AWA A;  2OMZ A;  3UL9 A;  3G3A A;  1M9S A;  2A0Z A;  3RJ0 A;  3CIY A;  3E3Z A;  3A79 B;  2P1Q B;  3ZYJ A;  5A5C A;  1U0N D;  1O6V A;  2Z82 A;  4QC0 A;  4QBZ A;  4P8S A;  3M18 A;  1G9U A;  2ID5 A;  4R5C A;  4RWT C;  4OQT A;  4ECN A;  4FCG A;  2ELL A;  1YRG A;  4KXF B;  4XOS A;  1KOH A;  1M0Z A;  4LSX A;  4R58 A;  2Z66 A;  4K17 A;  3ZYO A;  5B0T A;  1A4Y A;  2Z62 A;  4ARR A;  3RIZ A;  1ZIW A;  4R6J A;  1M9L A;  3WPE A;  4RCA B;  4Q3G A;  1P8V A;  4LI1 A;  3G04 C;  1OOK G;  4Z64 C;  2P1M B;  2BEX A;  5AWB A;  3E2J A;  1IO0 A;  5GMH A;  4L3F A;  4PSJ A;  1WWL A;  5GS0 A;  3REZ A;  4FD0 A;  3SB4 A;  2XOT A;  1QYY A;  3OGK B;  3BZ5 A;  4ARN A;  2Z81 A;  5GQR K;  5IJD A;  3W3N A;  4I6J B;  5GMF A;  4WP6 A;  4PEQ B;  2WQU A;  3W3K A;  1M10 B;  3WPC A;  3TSR E;  4FMZ A;  4CNC A;  2V70 A;  4KT1 A;  4AW4 A;  3GOZ A;  3CVR A;  4FHO A;  1H6U A;  2OMV A;  1OGQ A;  2RR6 A;  1FO1 A;  5LFN A;  3RFE A;  3RGZ A;  4P91 A;  2WQW A;  1OTN A;  4RCW A;  2Z63 A;  4BSS A;  3UN9 A;  2Z7X B;  2Y5Q A;  4UFR A;  1XEC A;  4BSR A;  4Y61 B;  5HZL B;  2OMT A;  2WQX A;  2WFH A;  4Z61 C;  4LXS A;  4CC4 A;  3VQ1 A;  2RA8 A;  3W3L A;  2R9U A;  2CA6 A;  1LTX A;  4V2E A;  2Z7X A;  1XCD A;  4YEB B;  3WPF A;  3WPG A;  4FS7 A;  4U7L A;  2FT3 A;  4LI2 A;  3WN4 A;  1FS2 A;  3G06 A;  3WPI A;  2OMW A;  1O6S A;  4FDW A;  3M19 A;  4KNG A;  3OGL B;  4U09 A;  1FT8 A;  4NKH A;  4GT6 A;  3UL8 A;  4LSX C;  4CNM A;  1H6T A;  4C2B B;  3RFJ A;  3ULA A;  4Z94 G;  4PER A;  2UZY A;  3E4G A;  3ZYN A;  4H09 A;  4MQW X;  4EZG A;  4M7E A;  2Z64 A;  5D3I A;  3FXI A;  1DFJ I;  4R6A A;  1OZN A;  4BSU A;  1GWB A;  2Z65 A;  3RW7 A;  3O6N A;  1A9N A;  4NZR M;  3G3B A;  5FTT B;  5AZ5 A;  4R6G A;  5GS2 B;  1OTM A;  5HDH A;  1PGV A;  4R07 A;  3JB9 j;  2P1P B;  3OGM B;  3WPB A;  4LXR A;  4XGO A;  2V9T B;  3C6N B;  3W3M A;  1JL5 A;  3RFS A;  1OTO A;  4V2C A;  5AWD A;  2BNH A;  2JQD A;  1D0B A;  5B4P A;  3RGX A;  4J4L A;  4R5D A;  2O6R A;  4R0A A;  2JE1 A;  3WPD A;  4TZH A;  3DZE A;  3KJ4 A;  4BV4 R;  3WPH A;  2JE0 A;  2O6Q A;  2OMY A;  4B8C D;  1P8T A;  1XEU A;  3RW6 A;  2O6S A;  3UL7 A;  2OMX A;  1K5D C;  5CMN A;  4U08 A;  4Q3I A;  4WYK A;  4L3A A;  4R09 A;  3ULU A;  3ZYI A;  3ULV A;  4LSC A;  4HQ1 A;  2Q4G W;  2AST B;  4CC4 C;  4GLP A;  3W3G A;  1SQ0 B;  3C6O B;  3P72 A;  4CIL A;  1KOO A;  4C2A B;  3O53 A;  2ASS B;  1FQV A; 
#chains in the Genus database with same CATH homology
 2WQV A;  4Z79 A;  2V9S A;  5IYX C;  1XKU A;  4R6F A;  4QXE A;  3W3J A;  3OJA B;  4MN8 B;  4XSQ A;  4PQ8 A;  1DCE A;  5AWC A;  3C6P B;  4ECO A;  3G39 A;  2IFG A;  4M7E C;  5GMG A;  4Z8G A;  5IJC A;  5B0N A;  1DS9 A;  1K5G C;  5CMP A;  4R08 A;  5IJB A;  4PKI G;  3OJA A;  3CIG A;  4AY9 X;  3E6J A;  2UZX A;  1O6T A;  4NKG A;  2OMU A;  1XWD C;  4Q62 A;  3PMH G;  3VQ2 A;  1P9A G;  2P1O B;  1Z7X W;  4CP6 A;  4IM6 A;  4V2D A;  4U06 A;  4J0M A;  4LSA A;  2P1N B;  2XWT C;  1W8A A;  4G8A A;  5AWA A;  2OMZ A;  3UL9 A;  3G3A A;  1M9S A;  2A0Z A;  3RJ0 A;  3CIY A;  3E3Z A;  3A79 B;  2P1Q B;  3ZYJ A;  5A5C A;  1U0N D;  1O6V A;  2Z82 A;  4QC0 A;  4QBZ A;  4P8S A;  3M18 A;  1G9U A;  2ID5 A;  4R5C A;  4RWT C;  4OQT A;  4ECN A;  4FCG A;  2ELL A;  1YRG A;  4KXF B;  4XOS A;  1KOH A;  1M0Z A;  4LSX A;  4R58 A;  2Z66 A;  4K17 A;  3ZYO A;  5B0T A;  1A4Y A;  2Z62 A;  4ARR A;  3RIZ A;  1ZIW A;  4R6J A;  1M9L A;  3WPE A;  4RCA B;  4Q3G A;  1P8V A;  4LI1 A;  3G04 C;  1OOK G;  4Z64 C;  2P1M B;  2BEX A;  5AWB A;  3E2J A;  1IO0 A;  5GMH A;  4L3F A;  4PSJ A;  1WWL A;  5GS0 A;  3REZ A;  4FD0 A;  3SB4 A;  2XOT A;  1QYY A;  3OGK B;  3BZ5 A;  4ARN A;  2Z81 A;  5GQR K;  5IJD A;  3W3N A;  4I6J B;  5GMF A;  4WP6 A;  4PEQ B;  2WQU A;  3W3K A;  1M10 B;  3WPC A;  3TSR E;  4FMZ A;  4CNC A;  2V70 A;  4KT1 A;  4AW4 A;  3GOZ A;  3CVR A;  4FHO A;  1H6U A;  2OMV A;  1OGQ A;  2RR6 A;  1FO1 A;  5LFN A;  3RFE A;  3RGZ A;  4P91 A;  2WQW A;  1OTN A;  4RCW A;  2Z63 A;  4BSS A;  3UN9 A;  2Z7X B;  2Y5Q A;  4UFR A;  1XEC A;  4BSR A;  4Y61 B;  5HZL B;  2OMT A;  2WQX A;  2WFH A;  4Z61 C;  4LXS A;  4CC4 A;  3VQ1 A;  2RA8 A;  3W3L A;  2R9U A;  2CA6 A;  1LTX A;  4V2E A;  2Z7X A;  1XCD A;  4YEB B;  3WPF A;  3WPG A;  4FS7 A;  4U7L A;  2FT3 A;  4LI2 A;  3WN4 A;  1FS2 A;  3G06 A;  3WPI A;  2OMW A;  1O6S A;  4FDW A;  3M19 A;  4KNG A;  3OGL B;  4U09 A;  1FT8 A;  4NKH A;  4GT6 A;  3UL8 A;  4LSX C;  4CNM A;  1H6T A;  4C2B B;  3RFJ A;  3ULA A;  4Z94 G;  4PER A;  2UZY A;  3E4G A;  3ZYN A;  4H09 A;  4MQW X;  4EZG A;  4M7E A;  2Z64 A;  5D3I A;  3FXI A;  1DFJ I;  4R6A A;  1OZN A;  4BSU A;  1GWB A;  2Z65 A;  3RW7 A;  3O6N A;  1A9N A;  3G3B A;  5FTT B;  5AZ5 A;  4R6G A;  5GS2 B;  1OTM A;  5HDH A;  1PGV A;  4R07 A;  3JB9 j;  2P1P B;  3OGM B;  3WPB A;  4LXR A;  4XGO A;  2V9T B;  3C6N B;  3W3M A;  1JL5 A;  3RFS A;  1OTO A;  4V2C A;  5AWD A;  2BNH A;  2JQD A;  1D0B A;  5B4P A;  3RGX A;  4J4L A;  4R5D A;  2O6R A;  4R0A A;  2JE1 A;  3WPD A;  4TZH A;  3DZE A;  3KJ4 A;  4BV4 R;  3WPH A;  2JE0 A;  2O6Q A;  2OMY A;  4B8C D;  1P8T A;  1XEU A;  3RW6 A;  2O6S A;  3UL7 A;  2OMX A;  1K5D C;  5CMN A;  4U08 A;  4Q3I A;  4WYK A;  4L3A A;  4R09 A;  3ULU A;  3ZYI A;  3ULV A;  4LSC A;  4HQ1 A;  2Q4G W;  2AST B;  4CC4 C;  4GLP A;  3W3G A;  1SQ0 B;  3C6O B;  3P72 A;  4CIL A;  1KOO A;  4C2A B;  3O53 A;  2ASS B;  1FQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...