3KJ6H

Crystal structure of a methylated beta2 adrenergic receptor-fab complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
217
structure length
217
Chain Sequence
b'EVQLQQSGAELARPGASVKLSCKASGYIFTDYYINWVRQRTGQGFEWIGEIYPGSGNIDYNERFKDKATLTADKSSSTAYMQLSSLTSEDSAVYFCVRGFGYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSAVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2 adrenergic receptor
publication title Ligand-specific regulation of the extracellular surface of a G-protein-coupled receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 39
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2009-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kj6H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kj6H02
5IFJB 4F58L 1DBKL 2XG4A 2Z35B 4GKOA 3RIFF 3VGAB 2UYLB 1KLUB 2LU4A 4JFDB 4KRPC 4LF3A 2XQYG 4TOYL 4DGIH 5DUBB 3Q5OA 3WXVH 3KPLB 2DL9A 5DF0A 3ARWA 3MLZL 1VACA 4WUUA 4OLEA 3MXWL 1JZ2A 3CX5K 1L6XA 4EI5A 2DKUA 3F65A 2FSEA 4QRPE 4S1SL 4Y2DC 5IB4A 3D2UD 1RD6A 3MNZB 1AR2A 1WIOA 4XPHL 3FQUB 3WYRA 1T20A 2A1WH 1CXKA 4RA3A 2QQQA 4GRWF 4DGYL 1QEWB 3MRNA 3G5YA 4P2RA 4KKBC 1A8JH 1YQVL 5CAYB 1UXSB 1XEDA 1RFDL 2H32B 3EYVB 2MQ0A 4X6DF 1CL7L 5HHOB 5DK0A 2D03L 3LRHA 4UIMB 4L3EB 2H1PH 2Y5EA 3VFUB 1WFTA 3VD3A 3B9KC 4XTRD 5T1DH 4XRCB 1DUYB 5GJTH 3RWCB 1LEKB 4LEXH 2YN5A 4PJEE 1IGYA 4RNRB 1FIGH 2BHZA 4R4NC 4CVZA 3QFJE 2VO5A 2AEQH 1IQWH 3H9YA 4NQDB 4EN3D 1ZHLB 1FNEB 4PRAB 4LGRB 4R3SA 4QXWA 1RK1A 2PW2B 3KLAB 4XC1H 1CGTA 2NY2C 1WISA 1KUMA 2Z91A 5T1KD 3WIFB 1UQSB 3AC0A 3RIFK 4E41D 4UINH 2EC8A 5F89B 1NC4A 5AUMB 2MHAA 4YXLH 3NFSH 3MCKB 5IR1A 3EYFB 3MZGB 3VXME 2X7LB 1MCNA 5TH2B 1CN4A 1UYWL 4GAJL 3K8KA 1QBLH 5I1IH 1XF4B 3LH2H 4ZOAA 3RKDD 1H3UA 1ONQA 1K6QL 1MQKL 5IVZA 4PR5B 4U3CA 2XN9E 2AQ3A 1KB5B 3DMMC 3O2VH 4LSTL 1OWRM 1KIPA 1LO5A 1FO0L 3PV7A 4XVJH 4E9LA 4Q9CA 5GGVH 4ZUWB 1AGEA 3G08B 3MV9B 3TIEA 1P9MA 5C08B 1WCBA 4MDIB 4NRXB 4YHIB 3I2CL 3D25B 3HG1A 3QNZA 4LVOC 4JPKL 3Q48A 1LO2H 4RWYL 1M7XA 1P6FA 3PP3H 4F9LA 4I9WD 2X6MA 5CD3A 4MHHG 4MMZC 3UJTL 3RX8A 3PWPD 2VR9A 1MJJA 5C0AD 4MD0B 1CFQA 4YR6B 1FVEA 3W2DL 4YHYB 1A6TB 5JXEC 3RAJL 3WFHB 2CUIA 3FFDB 1E27A 2FX9H 4FNLL 4HFUH 4JZJA 3ZKXC 4DOHE 5CEZL 1S7TA 1H9VA 4KXZI 5DYOB 4LCYA 4Y5VB 1X7QB 5IESH 3MV8D 2JB5L 3LKQA 4PJ5B 4WCYH 2ZCLL 3VXMD 3QFDA 3HZMA 2Y7QA 3MGOA 5DMGD 4GW5A 2EE2A 2YPKB 5F7FA 4XH2B 1YDPA 3IS1X 4XX1E 1KEMH 2AXGB 5DJ2A 1OAXH 1NUGA 4KZDL 4PV9B 4NM8L 4HG4K 2FWOA 3CCHA 5KSAA 4XCCL 3OB0K 4YWGH 5DEZA 1E4XL 5DGRA 3UTQA 3IDJA 1A2YA 2AJVH 2K3TA 1YEJL 4OLVH 2ZOLB 3GIVB 4Q97A 5JW4N 3GGWB 1A14H 3KHOA 2ICWJ 4LIQE 2IBBA 5D2LE 2IPUK 2FJGA 2WBJA 4KK8D 1AGBB 3BE1L 4UOJA 5HI3C 4MVBC 3QIWD 3VFTA 1I8LC 5FV1L 4NJAL 5I1CH 1Z9OA 4GW1B 4BUHA 5DLMH 2PUQT 4LSVL 5FFLA 3KDMB 1CS6A 5JIPA 4NT6B 1PG7L 2VERN 3NOIA 5TDOB 2P8MB 3O3BB 4JQVA 4HLZH 4ZUUA 4YHKL 2BSTA 3MNVA 1Z9LA 4F58H 1DBKH 2AKRB 4EIZC 3R06A 4YHZL 1XMWA 3O9WA 5FCSH 4WVRA 4FA8A 5C09A 3MLZH 4HV8A 4LLAA 1BIIA 5DR5L 3DOSA 1KCVL 3MXWH 1S5HB 3QCTL 4QHKJ 4Q6YA 5IB2A 1BVLB 2MPAL 5ICYA 2LFGA 3K4ZA 2P5WB 4N8PA 1ED3A 5F3BA 4S1SH 5SWSB 5LGHL 2X4OB 2QR0B 1UH3A 4D0BA 2XWJA 3IDMA 5ALCL 4DGYH 4HKZB 1YUHB 2NXYC 2Q76A 1NCDL 1YQVH 4NZDA 3GSWA 1RFDH 5IBUG 4RMQA 4TSCL 1MCEA 1CL7H 3QUZD 2D03H 2R0LL 3G9VA 3IU4L 4G9FA 1CGWA 3MC0A 3ZTJG 2NW2A 4Q58C 2N7BA 2HTLD 1A1MA 1FC1A 1XZ0A 3HRPA 2FH8A 1AKJA 2X09A 4ZDHA 5JW4M 5JMOC 1A47A 3C60C 3P4NA 1IVLA 3L5IA 1N0XL 3I75B 3U7AA 4L3AA 5L8KB 3VXSD 3C09B 1RV6X 4MJIA 2HTKC 4PLKD 3I50L 2W1NA 1INEL 2Z93A 5E99H 4G80A 4WV1B 4JG0L 2V7HB 2V2XA 1Y18A 5F7WC 3I02A 1RHFA 1UYWH 4GAJH 4EI6A 1SMOA 4L8BB 3CDGB 4HS3A 1FRGL 3NCEB 1K6QH 3D5OF 4U6YB 1MQKH 4C56D 5DK3A 4LSTH 1XGYL 3O3UN 1FO0H 5H37G 2VXSH 5DJDA 4GXUN 1V3JA 1AJ7L 4UIKL 2P5EA 3I2CH 4EEEA 1KCLA 1HH6B 3UO1L 2D4FA 2OBGA 1WCQA 4JPKH 4P3DA 5FKAA 2D0FA 1AR1D 1I85A 3QNXA 4RWYH 1KJMB 1V7NL 1VPOL 1Q9OB 2ARJA 3JWOL 3UJTH 5C0CE 3WNKA 2C3GA 1IZKA 2VDRL 1HQRB 1BPVA 2VSCA 2QL1A 4P2QD 1SJEB 1DEEB 5D7IE 1BJ1H 5IW3A 4KK9D 5IMLB 1R24A 1P7QB 3W2DH 1KN2L 5HY9A 1A22B 3RAJH 5JOEA 1JWMB 1QFWL 1TZHA 3AS1A 2B8OT 4FNLH 5CEZH 5CJOL 5HYJE 3C87A 2JB5H 2OR8A 2ZCLH 4LLQA 4X6BA 4KUCF 5D9SB 2LAAA 3ZT6A 2SEBB 2HT2D 5I74B 2A74B 4G8GD 1INDL 5JW3L 3BW9A 3T0EC 3T1FB 4KZDH 5GGSY 2EDEA 2KL6A 3L6FA 3OBAA 3IDNB 4NM8H 2VSDA 4FMKA 1P7HL 3T0AA 1DQML 2BHYA 4XCCH 2GFBA 2E7LC 2NY4C 1E4XH 1OPGL 4H1LG 5KS9E 3B9KB 4H88L 3X14A 3V0VB 1J8HE 1BVKA 4YFEA 4HIEA 3UYOD 5BS0D 5CFHA 1YEJH 1FVCB 5D6CB 2UVFA 2XA8L 1CD1B 2YWZA 4IEFB 1MLBB 4GXUM 4QRRE 5C0CD 1C12B 4M8VA 3RUGE 3QXAA 1VHPA 3BE1H 1CZ8L 3VWKC 2R2HB 3WS3A 5T5NG 3KLHC 4NJAH 3DXAA 2AEPL 5D1XD 3QEHA 4MWFB 5DMIL 5B8CC 3CH8A 4FFYL 4UT9L 5ETUB 3SDAD 5FDWB 4HUWA 4YHMH 2VYRE 4LSVH 4KFZC 2E9BA 1PG7H 3TYGL 2QQLL 1JP5A 4YE4L 3VI4F 4WHDA 4XT1C 3QQNA 2P8LB 2GQHA 3DRQA 1WZLA 4YHKH 2NY0D 1CTOA 4I13B 5DQ9B 4YHZH 2W92A 3MRRA 3L3HB 3E3QC 1I4FB 1QUNA 2O5XL 4R4BA 4FQIL 3IJSA 3BESR 4K07A 4OLZL 1LEGA 3ZT7A 5DR5H 1KCVH 3QCTH 2MPAH 4MNQE 1AIFB 1N8ZA 4QRPA 3TYFA 5FGCE 4LVOB 4CU7A 1F11A 2N7AA 3PWUA 5LGHH 1SVCP 4HIIA 4H25A 3GSXA 2X89A 5ALCH 1XGUB 1VFBA 3GSRA 4QKXB 4AIXA 1NCDH 5CCKL 2NLJA 4TSCH 5E5MA 4WDIB 3BWAB 2R0LH 4IBLT 1IM3A 4Y4HB 3HS0A 3IU4H 1RZGA 5C9KA 2LU7A 5IROA 3S34L 4U7KA 5J57B 3HE7A 4X6CA 5FYLE 3UTTA 1ORSA 4C57C 1NC2D 1ACZA 3ZKXB 2XPGA 4XX1G 1N0XH 3QFJA 3MUGB 1HWHB 4Q9RL 3C6LB 4H1LA 1HKFA 4IM8A 3RVVD 3NFPA 2XV6B 3P73B 3E6FA 3BGMB 2X70A 4PJ9B 4KJQD 3I50H 1JNHB 1INEH 4N0CC 1GZPB 1LVEA 4IRSC 4Y1AE 1OT2A 1FV1A 4JG0H 2EKSB 1IQDA 4PLNC 2B2XL 3LHPL 1PKQB 4POUB 3O2WL 4G8FB 4W4OA 1RAMA 4Q7DA 3BKYL 1T1XB 4NOBA 5I1AB 1DANU 3VXNA 1FRGH 4X5WA 3MRGA 3EYQC 4NO0B 2E9WA 5DHYA 3FQTB 4MNQD 4BZYA 3LKRA 2XN9A 2K9UA 1XGYH 2ZCHL 4WJ5B 1FAKT 2B1HL 1UZ6E 1QEWA 2P43B 1IC5L 1T1WA 4GLRH 1A64A 1AJ7H 4UIKH 2WW8A 1BOGA 2Y5TB 1PX3A 3CAFA 2ED9A 1A1NB 1Z9SA 4KKLD 1LILA 1V7ML 3B9DA 4YFDB 4OIAA 2XNAA 3MYJA 5FECA 3UO1H 1CICC 1MHHA 1JWUB 4L29B 4GRLB 2ICWB 4OLWL 1HXYA 1V7NH 1VPOH 4BKLA 1ZS8B 3JWOH 1JV5A 3HI1A 5JO5A 4FFVD 5EU6D 5SWZA 3Q5YA 1XAUA 3F5WB 2VDRH 2VN4A 4JRYE 3IAPA 4HIHB 1U8QA 3RVUC 4W6YB 4YFLI 1DQJA 2OTUA 1LNUB 5IEHA 4Z7NF 1KN2H 2XZAL 1QFWH 4LVNB 3D6GA 2IPKB 1BQUA 3OGCB 4Z6AT 5CJOH 1NFIB 4LAJH 3L3GB 2CK0L 1UJ3C 2JCCA 5HYFA 2C3VB 4PJIB 2XZZA 3IAGC 5E94A 4PJCF 5EU7C 2VITB 1KFAL 2Z9TA 4ZAKD 2PCPA 3IJHB 1V8HA 1FZKA 1GRWA 1IC1A 2D31A 5I66B 1INDH 4YX2H 5JW3H 5HDOA 3ZKNC 1JPFA 3CNKA 4DZ8B 1A7QL 1DQMH 5JA9A 2EDRA 2G9HB 1UA6L 2Y72A 3L95B 2JB6B 3M8OL 4YHIA 4H88H 4P4RA 1H8OA 4DZBB 4CMMB 5D1ZA 5F1NA 3DHJA 3BUYA 1VFMA 5D70L 3SBWA 2XA8H 3SE3C 2HFEB 4X9IA 5D2LA 4BH7B 5AG9A 1Z5LA 4ZFGL 3MV7E 4XVUD 2CKNA 5I1EL 2JJVA 3M17B 4MXQD 1CZ8H 2MTPA 4JN2A 4P2OD 4M00A 2BNQE 1W8OA 1QOKA 3KR3L 3V5DA 3X11A 4IRJA 2AEPH 2A6KA 5DMIH 4FFYH 2J6EL 4UT9H 1A7BA 2JK5B 4K3HA 4QF1A 2QQLH 3TYGH 2J8UF 4YE4H 5EU5B 1MHEA 2H9GA 1LEIA 3IFPA 3BP6B 4PJ5A 1KULA 3RDTA 3TJHD 1I1AB 4LLMB 5DJ8B 2W91A 4YC2B 1VB9A 2W0LA 2XA3A 5E9DE 3HR5A 3O41B 3O6FB 3UPRB 2IAMA 1A9EA 1PQZB 2O5XH 4FQIH 4YNYB 4OLZH 1AD9A 1T7VA 4JM2C 3PDOB 5JMRA 4QXGL 2NY1C 1IAMA 2CRZA 5IFHL 3G9AB 4Z7VF 1ZVYA 3M07A 4NDMB 1GZQA 1OAYL 3OSKA 4OLYL 5GRVL 1ZA3B 4Y4KC 5DJXA 2BSED 4XGZA 3S34H 4OV6F 4PGBB 1LWRA 2UV3A 1MUJA 1BZ7B 1XF5B 2B5IC 5EPMB 1D5ZA 2R4SL 3KPNB 3CFDA 2CIKB 5GGTA 2CDFA 3QIBD 2E7MA 2FATL 4LSRL 4KU1A 4Q9RH 3OX8B 4JFFD 3C6SA 3TBYB 3HPLA 2D9QB 4JY6A 3FFCB 1IKNA 1H5BB 3N50A 5J6HA 1BLNA 4NO5B 2B2XH 3LHPH 1D9KB 3O2WH 3BKYH 3PJSB 1T3FA 5CMAB 1NDGA 1TLKA 4Z7WE 3ES6B 3MZTA 4QRQA 3U4EA 3W5NA 5DDHA 3CX2A 3RGVC 32C2B 2VQUA 3DTXA 1HHJA 4R2GD 4AIOA 2IH3A 2ZCHH 4JRXD 3F6IA 2B1HH 3FQNB 5J9PA 1YUHA 1IC5H 1S78D 2HKHL 1SEBB 4B0MM 1S8DB 1F3JA 5C0ND 2GSIB 1V7MH 3C5ZA 2X4SB 1G6RL 5B8CB 1LE9A 4NO2B 4XCNB 1CLYL 2FX8L 5TDPB 4HMDA 4OLWH 4ZS7L 4GBXC 5EWIL 3F12A 1OAUL 5CP7A 3NFNA 3CX5J 1RUKL 5DUML 4MD4A 3EUUA 4BFGA 5D7IA 2ITCB 4F2MB 1A9BA 2ZP0T 3LKPA 3L5JA 2FIKB 3VFVA 1QG3A 1AP2B 3LZFL 4WV1A 3GRWA 2XZAH 3IDIA 1ZT4A 4MQXC 2F74B 4AEHL 5HYJA 4O4YL 3BP4B 2CK0H 3PIQB 1U8LA 1W0VA 3RZCB 2YR3A 1TVHA 2PYFA 5KG9A 1NGPL 3FO1A 3KS0H 5DC4B 1KFAH 2HYMA 4G6ML 4XBGA 1AD0B 2ZUVA 2PYEB 4HWZB 4GRMB 1N7ML 4R26L 4WW1A 2NXZD 2EE9A 2QADD 3QEUA 4WEMB 4P23D 1A6ZB 3ULUE 4S2SA 5FO8B 5HD8D 2ZUSA 1UA6H 2NX5D 4ZMAT 4KI5E 1EO5A 3M8OH 3KJ4C 2DRUA 3T3PE 2YPLE 4PP2A 3MRLB 5JDSA 5KS9A 1ORQA 5E2JA 1T0MA 1J8HA 3T65A 3LSOB 3OAZH 3GB7B 5MHSE 4WIQA 5D70H 5IK3A 4JGMA 1Q9OA 1WAAA 1TJGL 2ZSWB 3A67L 5GRUL 1SQ2N 1AXSB 5JOFA 2GAZA 3AS3A 3HNSL 4FN0A 4QRRA 1X3DA 5CILL 4ZFGH 4BELD 5FEBA 5I1EH 1BBJB 4CNIA 1KF9B 3JV6A 4BYHA 3O2DL 3KR3H 5TF1H 4IRSB 1N4XL 4KJYA 2J6EH 4OZGF 4YBHA 1V3KA 3H3KA 4LGSB 5MENB 3BP5B 4QTIL 5I1GL 2APVA 2BVQA 2ATKB 3B3IB 3GUTB 5FM4A 1CFTB 5ANMA 4NZJA 4JZNB 2NW3B 4FFZL 2WWKT 2E8ZA 1JI1A 4J7RA 1H3PL 3MSPA 1MNUL 1PAMA 4OQTL 5F72S 3VG0L 2EDLA 1FZJB 1P7KB 2EXWC 4L4VD 3EYSH 3ULUD 5IQ9B 1EV2E 1A3QA 5KANI 4ZUVB 4J23A 1U3HA 2Q6WA 1HN1A 2W0KA 4KI5D 1LP9B 3O3DA 2V5YA 4HKBB 4QXGH 1T22B 1U8PA 4EKXA 5KSBB 1QRND 1J11A 4YZFF 1ZLVK 5IFHH 5MEPA 3ABZA 2E27L 3SHSA 4OF6A 4OZFB 1JHTB 1FFOB 1OAYH 1HHHA 1OAQL 2R2BB 4OLYH 1QTYT 3OF6D 3QUXB 3QDMB 4G43A 2YD8A 1OB1A 2VXQL 3BPCA 1U6AH 4PJBE 2DI7A 1QSFB 3MRHA 5DUPL 4PGEA 4WNQB 1U0QA 4R96B 3TNMA 2R4SH 4PJ8B 4RMUA 2DJSA 4RFEB 4NQVA 4P46A 1X6NA 4KQ4L 2W60A 4GXVL 2FATH 1W0YT 1HXMA 4JM2F 4LSRH 3SDDA 5GSRB 4ODUB 1IM9A 1J12A 1YY8A 2IGFL 5FM5M 1T5WB 3TN0C 25C8L 1H8SA 1HYSD 4ZFFB 3AY4C 3QDJB 1QP1A 4O2FB 1WC7A 1OL0A 3RPKA 5HDQL 3PGDB 3SE9L 2RB8A 2V2TB 4JFYB 1DBJL 2XRAL 2Q8AL 4WUKL 1GCFA 5F93C 1J18A 4UUJA 4JY4A 4YPJA 1FL3B 1ZVSB 3PL6D 3KXFE 4LSSL 2V17L 3M1BB 3BPOB 4NC1E 4BZ1L 2VXUL 2ED7A 4BFIB 4F37F 1P1ZB 4HIXL 3W5MA 2HKHH 3D85D 1BF2A 2DQIL 3ARYA 5EO1A 1G6RH 3TPKA 5EBMA 5ISZB 4X9FA 1CLYH 2FX8H 3I6GB 4ZS7H 3FCTB 5EWIH 1OAUH 4RBPH 5LQBL 4Q6IB 1QSZA 4BJLA 4NFDA 3G6JB 1RUKH 5DUMH 1QFUL 2QBWA 3MUGA 3G5ZB 1F3DH 2NYYD 4JRYA 3KVQA 1BFOB 1UGNA 1XR8B 4X4XB 4K3GA 2V5RA 3WEXB 2XY2A 5JNYA 3GO1L 5F3HB 1E4KA 4M3JA 3LZFH 5DRZA 3GI8L 3RNKA 1U8HA 4OAWA 4AEHH 1UWXH 5E2WL 3P9MA 4O4YH 1CIDA 3HMXA 4HH9B 3P4MA 1HHKA 1JYWA 2AK4A 2XZQL 1TTFA 1MCLA 3GJEA 3X12B 4I4WA 5TJWK 1NGPH 2AJZA 5DD1L 2NY1B 3MNWB 1NMCC 3ZSTA 4G6MH 4MJID 5DJZA 3L7FB 4F3FA 5KBNC 4WI4A 3FAXA 3HC0A 1N7MH 4XXDB 4R26H 3FQWB 1T2QL 3JWOC 2BSRA 2GJ6E 2EDHA 4I3SL 5E2TL 4NO3B 4LASL 1XR9B 1JRHL 3WMSA 3WIHA 4F37K 5HXMA 3TWCL 1CVSC 1IL1B 5CGTA 3VFWB 1KG0A 3TVMB 4W70A 5D2NE 5F9OL 2YD1A 4X0KB 1M7IA 4KTEL 1TJGH 1S5IL 3A67H 3MBEA 5GRUH 4ZD3L 3U7YH 3HNSH 4MCZA 5CILH 3MV7A 4GO6B 3TNNB 4RDQF 1SJVA 1RZ8A 2BNQA 3HB3C 5F9DC 1FNGA 3B4NA 3O2DH 3FO9B 4NQCE 3ESUF 2OJZL 3SKMA 1N4XH 3PHOA 2P7TA 2ZG1A 3N06B 3U0TA 3ORJA 3H9SE 1KTDB 1YA5A 1UEYA 2QQNL 4G8IB 3B5GA 2QSCL 2VLKB 4QTIH 1JL8A 4KKAD 5I1GH 3GFUA 4K7FA 4RGNC 1OGAE 4OCXL 5D1QA 2WLZA 1PG7W 5E9DA 4CRPA 4YEFA 4FFZH 5DJCA 4XP9L 3SGEH 1H3PH 1MNUH 1SBBA 4OQTH 4F7EB 3OTTA 4OQ1A 3VG0H 3NBNA 1H15B 3D39B 3VXRB 2AXFA 5DQDL 5AD0B 5DMKA 2APFA 1ZGLM 1QBML 5J11B 4U1LA 2OSLB 1DLFL 3MRMB 3EJZD 1T0NA 5HBBA 2DQJL 4GBXB 5I30L 3BH8B 4XXCC 4MXVE 2IMNA 2E27H 1PZ5B 1WZKA 1FL6A 1AO7D 1JGDB 1OAQH 5ENWA 1RUMH 1Z0NA 2WWMD 3NCMA 2FYYA 3ARGC 1KBGL 3H2WA 4ZFZB 1ZANL 2VXQH 1RJYA 3BQUD 3KPQB 1J87A 35C8L 1EGJA 4Z18A 5DUPH 4NQCD 3UTZB 5JW5B 2CDGA 4HEPG 4L8DB 2IQ9L 5I8EB 4PFEA 4MMXC 4U0RB 4IOIB 2IH1B 4Y5YC 1VDGA 3EHBC 4PRIB 3LB6D 4XWOD 4KQ4H 4I1NB 4GXVH 3SO5A 4ZUSB 1MFDL 1CG9A 3BP6A 5JTWA 4TVPD 1KGCE 1MELA 3MLUL 2IGFH 5T1LB 3SDXE 3VG9B 4Z5RA 5I9QC 3EJJX 1OGAD 1H0DA 25C8H 1B90A 4YGVA 4EVNB 2CLVB 3LKOB 2RHEA 5FA4B 3VXTA 2BRQA 5EUOE 3FT2A 1U42A 3EDDA 4EQ3A 3O45A 4CAGA 4N8VG 3SE9H 1DBJH 3L3JA 5D93C 2XRAH 1KOAA 4I2XE 2CKBL 2Q8AH 1CD8A 1X5HA 4WUKH 4I18B 4D8PA 3PDGA 5ILTL 5JZ7D 4JFDE 4M7ZC 1KN4L 4LSSH 1FSKC 2V17H 5H2BA 2F15A 4BZ1H 2VXUH 3V0WL 1JN6B 4WHTB 1RIHL 4HIXH 4HUUB 5INDA 3JTTB 4NHCL 1EAPB 2HJLB 3TBTA 2DQIH 4A6YL 3MR9B 1ZA3A 1A6UL 4K9EL 4YO0B 3U36A 4MAYB 4M6AA 5EZJB 4IMKC 1Y6NR 3E0GA 1WT5A 4GAYA 4OZIE 1IC7L 4HXAL 3WNOA 5DA4A 1MEXL 4BQBA 5LQBH 1ZGLP 2X89D 3K2MC 2Y06L 5EBWA 4EZMA 1M71A 1FNLA 3H3PL 4KUZL 1YNKL 3LN5A 1UWEL 4M6NL 5HHOE 4ORGB 4S1DD 1XIWA 4FTVD 5CD5C 3X3FL 1KGCD 5F1KC 2DQHL 5FHBL 1T4KB 3GO1H 3CFJB 5IB1B 4GRWB 4KV5E 3GI8H 2YOCA 4ELMF 3QNYA 4J3WA 3C8HA 1CDCA 4BSVA 2EDJA 5E2WH 5JPNB 1X9QA 4WI3A 4NQDE 1RURL 5EU3A 5FOBB 4FOMA 5CSZB 5IIEB 5DD1H 4NHUA 4P3WA 1QLRB 5DD0L 3RWHB 3ULVF 4Y4FB 4CN6A 4JFDD 1ZLUK 4N0UB 1FYTB 3KNBA 3B43A 1T2QH 4OCNC 3BJ91 1DQQB 3QUYA 4RX4A 4I3SH 5E2TH 2YS4A 3IF1B 1SEBA 4LASH 4KDTA 4WFHE 4B7LA 1S7WB 4MXWL 4OFYA 1JRHH 3AM8A 2VISA 5DWUL 3GMOA 5F9OH 4XTRC 1P53A 4KTEH 1S5IH 2NZIA 4N8VA 4ZD3H 5C08E 5C70A 2FJHA 4L9LC 4NN5C 2ADGB 3EOBA 5HHOD 3CZJA 2JJSA 4ODXB 2X4NA 4EN3C 4L3ED 4ZFOA 2X4UB 2OJZH 1H3XA 4EUPG 4HJGA 3AREB 5I1KL 1AP2A 4R0LA 1J05B 3ZKQD 3MRJA 3K3QA 1NKRA 1JTTA 2QQNH 2QSCH 1K8IA 4J8RA 4NQDD 4X7DC 1QLEL 4M62L 4OCXH 3CDFA 4R7NB 1U8NB 3V7AG 1B88A 1B4JL 2EXYD 4TSBL 3RKDC 1C7TA 4KZEL 1A4KA 5GZND 1MAKA 4JN1H 4MCYB 4XP9H 4LPUA 2BVOA 2HVJA 4AENB 3D0VB 4KMLB 2OTWA 5DQDH 4U6XA 3U48A 1QBMH 5J56B 2W9LA 3VXPA 4HT1L 3MRBB 1PFCA 1DLFH 1HSBA 3LSOA 3DX7A 3GB7A 2DQJH 3BWUC 2VLJE 5I30H 4QGYA 3MMEA 3VMOA 1JMXA 1RUAL 3FOMB 1JF1A 1T83C 5KZCB 3QHTC 2EEAA 1G9ML 4P4KA 5JXAL 3VRJA 3MV9D 5FO7B 1RJLA 2ICWI 1G7PA 5ERWA 4Y5XA 2ZOKA 1E4JA 1ZANH 2Z92A 3VE0A 1JJUA 4PJBA 1HEZB 35C8H 4ZOBA 2VL4A 1ND0B 4PRHE 2IQ9H 3H8NA 4GG6B 5A2LH 2R15A 2DTML 3LKSA 3FB5B 3L3DA 1MFDH 5CIPB 2ATKA 3MLUH 1WWWX 4OD3H 3WHE0 1OP3H 2BOCB 5DMGC 4UU9A 3IRPX 5JOPE 1OLZA 5GGSA 1G0DA 3KYNA 2V2WA 2X4RA 5HVWA 2YUZA 4P57A 2W0FA 4JKWA 4F33B 3AMKA 3O3AB 5MERA 4PJ5D 4LDLB 2CKBH 4XHQA 4MJ6A 3L7EB 4PRNB 4EUPA 2FDBP 1NGZA 3ARBA 4QHKI 5IKCB 1QSEA 2AV1A 5SX5H 4ZQKB 5IG7B 5EC1B 5BXFB 3KXFA 1FCGA 1KN4H 2PO6A 3PGCA 4HCRL 3V0WH 1U3YA 5DT1L 1FBIL 3T3MF 1RIHH 3ETBF 4JR9L 1HOCA 1JPGB 2E7HA 2P5WE 4A6YH 1EVUA 3LPWA 3ULUL 3PQYB 5D7KE 2DL2A 3D3VE 4WFEE 1A6UH 5DRNA 5HHMB 4K9EH 5SWSE 3BHBA 4KK8C 2Q1EA 1QSFA 4HWEL 3QIWC 1IC7H 2ZSVA 4HXAH 5CP3A 5GRXG 1MEXH 1ZXQA 4LHUG 1DN0A 1HDMA 2Y06H 1JZ7A 3H3PH 4KUZH 4MA1B 4ZXBA 2XWBA 1YNKH 2CO6B 1XT5A 3IFLL 1LMKA 1GC1L 1UWEH 4JHWL 4M6NH 1JCKA 2E6PA 3SJVB 3DV4B 1X5LA 2DJUA 3MLSL 3MOQA 2GHWB 3X3FH 4OUUB 3RTQB 2DQHH 5FHBH 1B0WA 2R2EA 4F57L 2IADB 4YDVB 1S7VB 1T1YB 4BQCA 4DK3A 2A83B 2BX5A 1KEGL 3PXJA 3HRZB 1RURH 3CSGA 4IOFD 3NGBB 2VE6A 2A2QT 3UYRL 3BKJL 4OZ4B 5ID1B 4AQ1B 4H0HB 5F1IB 5DD0H 1W72L 4TRPL 5FF6A 4M3KB 5DJYA 2ZNXA 2GJ6A 5IF0A 1HHIA 3WJLC 1TZIA 4MXWH 3R4DA 3BDYL 2ATPB 2P5WD 3GSNA 3QUZC 4WFED 3TPUB 5SWSD 1FVDA 2L4OA 5DWUH 1H3VA 4OB5L 3HUJA 4BK4A 5C0FB 3EJYD 2HTLC 4QHNB 2AJ3B 4LEOB 4Y0GA 2OTPA 1ZSDB 5E8NB 2R1YB 3G5ZA 4CDGC 2CRMA 2OMBA 1ITBB 2YSSB 2YBRB 1TIUA 3QI9A 2IQAA 3WNLA 3KPMB 4RAUA 4XPGL 1D5MB 1WFNA 1NBZA 5I1KH 4PLKC 4XHJD 3V2AR 2HT3D 2EIZA 3KPSE 3H9SA 5TFSL 7FABL 5DS8B 3LQAL 4WWKB 5D7LB 3QIUB 2ADJA 1MWAB 3V8CA 3GJFH 5C8JA 2FX7L 1QLEH 4M62H 3WNPA 4ODHL 4JREB 4LHUA 4KZEH 5DK2B 3EW3B 3HCVA 1DJSA 4JE4B 3QQ4B 2X2YA 4YBLC 3LRSA 5GGVY 4O2EB 4DVBA 1TMCB 4J3UA 3ZE2E 1F45A 1U2HA 3V6FA 3ZDXF 5DD3L 3OXSB 4JFHE 1R5WB 1KJVA 4TYUA 5EU4A 4HT1H 5B22A 3OKNB 5C07B 2FO4A 2FEEL 5IV2A 5K9QG 5IHZB 3KYOB 1RUAH 1AR1C 4YAQA 1NJ9A 4OLUL 1MRDL 5C0BB 1WBXA 4FQXB 3H0TA 1Z2KA 1RZJL 2WIIA 3BRFA 3MA7B 2I9LB 1G9MH 1EEYB 5JXAH 1LK2B 4K7PL 4U7MA 1J0IA 1DL7L 2AV7B 2DOCA 1DVFA 1ODAA 1OY3B 2XY1A 1BD2E 3MLTB 3HTLX 3T0DA 4KK9C 1YEFL 1WZ1L 5H8DA 4V1DE 2C1PB 2DTMH 1PG7X 4J4PA 1Q9WA 5BZDA 1ZLWH 5DFVD 4OSUL 1BZ9A 3IXAB 4KROB 3SDXA 1R3KA 4PJ7F 4WW2A 5IW1A 3FB8B 3O4OB 4AY0A 3L3OB 5EBGA 1FAIL 4OM0L 1JMZA 2HT2C 1SYVA 3AS2A 3MPCA 1M05B 1K2DB 4N0FA 2AABL 1A7PL 4UAOC 4HX1A 4PJEF 5TDNB 1C7SA 4I2XA 3UTSB 5C0EA 4NJ9H 1GHFL 1YN7B 4OFVA 4LRNL 3QEQB 1Q38A 3DYPA 1BQHB 4IRZL 1G7HA 2KZWA 4TULL 4Y89A 3RI5F 4HCRH 3VFRA 3OR6A 4LLYB 5DT1H 1FBIH 3SDCB 4HGMA 5TE7L 4JR9H 1JGEA 4HWNA 4X5XB 4ENED 3ULUH 2DMBA 1QR1A 5IMMA 4PJAB 3QQ3B 3S4SB 3KPQA 4FZ8L 4HWEH 4OZIA 2VJXA 3A6BL 4OV5B 5T5NF 1NGXB 1S7UB 3V0AC 5D1XC 4PRIA 5DTFB 4I5BB 3UTPE 3V5KB 3SDAC 5BW7C 4CU6A 4JHWH 1GC1H 3REVA 3ELAT 3QB7C 1RHHB 4IHOB 3W39B 2HFTA 4NKMB 3MLSH 5KOMC 2GT9B 4MLSA 4L1DA 4F57H 2NY0C 4EVNA 4XP4L 2CLVA 4LCWA 3DARA 3WBDA 1XGRA 5E6IB 3NIDE 5KTEL 5IBTL 5AYQA 3BIBX 1KEGH 2X4PA 4WFFE 4XCFL 1N6QL 4P46D 3D69B 5A1AA 4KVNL 4OCSL 3CPLB 1CDYA 3UYRH 4QRUA 2R0ZH 4TVPL 2Y36L 3BKJH 2YD5A 2ARWA 1QO3B 1UXWB 1OTTD 4U1HB 1W72H 5C0GB 4TRPH 1MLCA 1ADQA 3FL7A 1PKQE 4X8JA 3PABB 1YEIL 5J13C 3LV3B 2H6PB 3C5JA 1IBGL 4NZRL 1BX2B 4HZLA 3INUL 3RI5K 2EC9T 5BJTA 3C9NB 3KLSA 3BDYH 4KQ3L 1ERNA 3WV0A 1IGFH 2OP4L 1U8JB 4OB5H 4BK5A 4D3CL 3DGCR 5DQJB 2V6HA 1GVIA 1O0VA 1T04B 3UTPD 2BNRE 4RFNC 4LLWB 4YBQD 1C5DA 3MGTA 5I18L 3IB4A 1OTUD 3FQXA 4Y4HD 3DV6A 1N5AA 4NRYA 3RVVC 4XPGH 2L7UA 2HJKB 3KHQA 2J3SA 4KJQC 1WF5A 3NCJL 4NQSB 1KTKE 1DBML 4X6DA 1N2RA 2GEEA 5TFSH 3WJJC 7FABH 3OR7B 3FONA 4JHZA 2NMSA 3LQAH 5D4QA 3C6LD 3W0WB 1T0PB 2CR3A 3C8DA 2FX7H 4XAKE 3DWTA 4ODHH 4PJ9D 5D2LF 4JVWA 3EO1B 2FGZA 4YHPA 4Y4FA 5DJAA 1TVDA 5HJ3B 5A16B 3ZDZE 4WU7A 1G7JA 2F8XC 3QO0A 5IVXE 1MAJA 1UCBL 1RUQL 1QPXA 4PJIE 4NUJA 5DD3H 1MJ7L 3ARZA 1ZHKA 4QWWD 4NO0D 4KKLC 1T66D 3QIWB 2VLJA 3B83A 4LLUA 4X6FA 4OLUH 3WE6B 1MRDH 5EN2B 4PY8J 5C6WH 1RZJH 1YMMB 4PJCB 1J0YA 1CBVL 1TPXC 3GMLA 4FFVC 4IS6B 1L7TH 4K7PH 1DL7H 3P0VL 2DDQL 2WWKO 3SKNA 4F7MB 5C7XL 2I07A 2APWA 2ZUQC 4E42B 2B39A 2FR4A 3HAEB 3P4LA 4KTDL 4PRHA 5L0QC 4GRLD 1YEFH 3RWFB 4ZO8A 1BBDL 5E00B 1G0YR 2GITA 3MCLL 3I6LE 3VXUB 1Y0LA 2PNDA 1NAKL 2GTWB 1KC5L 4JGUA 4I0PB 1FG2A 2HFFA 2HN7A 1HILA 4C58B 4LNRB 1GIGH 3RWEA 5KVGL 4XAKD 4KWUA 1MHCB 1S9VB 1FAIH 4OM0H 4ZAKC 5I73B 1FZOB 1LHZA 5EBLB 1MCFA 5HHNB 2AABH 2GK2A 3JV5A 1A7PH 1OOAA 3D0VA 5GJSL 1JGUL 4M8QB 1EFXB 1QD0A 3Q1SL 4UDTB 3WO4B 1GHFH 3QG6A 4K8RD 4JO1L 1U8KB 3DPBA 5I17A 4LRNH 3PHQA 4YDLB 3O11B 3KG5A 4XNMB 3D0LA 4APQA 4IRZH 1INQB 2E5EA 1KCUL 4TULH 2HVKA 3H9HB 3ROOA 3TEUA 1B0RB 5TE7H 3S37L 1MVUB 3D3VA 4GKNB 1OF2B 2VWEC 4XVUC 4Z7UB 4FZ8H 4MXQC 3A6BH 1P4BL 4P2OC 3CD4A 1DTUA 4PJXE 3O4LB 1XF2A 1KB5L 4JDVA 4QY8A 2F54A 4H26B 5GS1B 3DUUA 3OWEA 1WBYA 1OD7A 1CXLA 4LDOB 1L0QA 1UH4A 5KOVC 4HUVA 2NTFB 4DVRL 3CSYB 1JPTL 3TJHC 4GQ9L 3P9LA 2P24A 3MREB 3O8XA 4WU5B 4XP4H 3TA3A 4YBLB 1CL7I 1CFNB 2XTJB 4HIJA 3EGSB 1KPRA 2Q3ZA 5KTEH 5IBTH 5HI5D 4YQXL 1N6QH 3ARDB 2A73B 4XCFH 1QQDA 3ULSA 3PV6B 3EZ8A 4KVNH 4OCSH 4CJ0A 2AJSL 4R7DB 1YZZA 3BEVA 3FT3B 4TVPH 5L2KB 2Y36H 1I1AD 5EOCL 3VWJB 1TQCC 1LD9B 4JPIB 1NFDE 3T0EE 3O6FD 5BZWB 3SY0B 3QXTA 3GMNB 2R29L 2J8UE 3SCMA 5DI8A 1YEIH 1YEHL 5H37H 1ZT1B 5FHAL 3N1MC 1QFOA 5GS2D 4RQQB 1IBGH 1NBQA 4NZRH 1J88A 3INUH 4JRWA 1IEBA 3RNQB 5K33A 3IU3A 4KQ3H 3L5WA 2VLMD 3DLQR 2OP4H 3FQRA 4D3CH 1GAFL 5BRZB 5ITFB 4PPTA 5BQ7A 2H2SD 2Z31A 1V05A 2LTQB 1CFSA 2PW1B 3K7UA 1UC6A 3QIBC 1NMBL 1UKSA 5I18H 5ESVB 4L3CB 3NZ8B 3IJYA 3MFFA 3NCJH 4NQUA 1DBMH 3KPSA 1JVKA 1F58L 1ETZB 2C7UA 3QUMB 5FA3B 3FKUS 5F7DA 4K3JL 2CK2A 4JFEE 2D0GA 1SJHA 1XIWD 2D7NA 3EO0A 3NMEA 5HVGB 1PYWA 1I3RA 1GOGA 4KMQA 2YZ8A 1RIVL 3FFCD 3RUGF 3DO7A 4R2GC 1D9KD 1JPST 1UCBH 4PRBA 1RUQH 4YHNA 1S78C 4Y2DA 2V9RA 2VIRB 3DBXB 4KDWA 4LQ1A 5C0NC 2Z8RA 4XNZB 1EJOL 3RL1B 5F9WB 2BMKA 2HA1A 4PG9A 4PLJD 1S9XB 2CLRA 3TT3L 1NPUA 2E8YA 3U6RA 3K81A 1ACYL 1CBVH 3P0VH 2DDQH 1BD2A 1H3WM 5C7XH 2EYSB 3S5LB 1P69B 2WINA 2OZ4A 3ARFB 3WO3B 4CVWA 3ILPA 3EBAA 2DQFB 4KTDH 3C8KB 3MRCA 5ESAA 1Y6MR 4Z0XA 4V1DA 3UYPA 3IGAB 4OKDA 1BECA 2O61A 3MCLH 1Z0MA 1G7IB 2OI9C 3DX8B 4LDEB 3X13A 4F7TB 4GUPB 1NAKH 5JHDE 1RMFL 1KC5H 2H32H 4D9RE 1SVZA 5KVGH 1RU9L 4XAWL 2VTFA 2ENYA 3VA2C 2BNUA 3GM8A 3SO3C 1V3MA 4Y88A 1OSPL 4MJ2A 2G2RB 5KVEL 4PYHA 1Q9LB 5IJVB 5GJSH 1JGUH 2NXZC 3FT4B 1CTNA 1I1YB 1G9MC 4P23C 3Q1SH 3RZCD 1F4YL 4RRPA 4JO1H 5HD8C 5EO9B 3DMMA 3V5HA 1JPSL 5FKPA 4M6ML 2PYED 5GS3A 4JFPB 4N5UA 4R4FL 3QYCA 1KCUH 2CMRL 1PSKH 4WI7A 3CFEA 1YNTA 3S37H 4AK1A 2Y07L 3AAZA 4PJFE 3TH4T 3GSQA 1W0WA 1JK8A 4UQ2B 2ZJSL 3TH3T 2KQMA 8FABB 1MI5A 4M7KL 5I1LB 1I8KB 2Z8WC 1P4BH 4LLDA 4P48A 3IFOB 5D7JB 1KB5H 2O5ZL 1EDQA 4G8EA 1I7RB 4CW1A 2APXA 2VQ1B 4WWID 4DGVL 4X7TA 3QDME 1O7VA 3WHXA 4FQQB 2OL3B 3UBXI 2VL5B 1UZ6F 4DVRH 3ZDYE 1JPTH 3O3EA 4FQCL 5JXEA 3AS0A 4GQ9H 2B4CL 3EFFB 2KH2B 1KIQA 3VFSB 4HS6A 4YQXH 3MUJA 1KXTB 5GGUB 1K5NA 2NY6B 3QULA 4KK6D 5MEND 4PJHB 2AJSH 1XGTB 1BEYL 1KPVA 1NDMB 3FN9A 5EOCH 3ULUC 1PY9A 3CDYA 2EO1A 1MFAL 3K46A 3MRQA 2XZCL 3QDJE 4OZGE 5I71B 3N85L 4KI5C 3P0GB 3WL9B 2ORBL 1ES0A 2R29H 3T8XA 1VEPA 3CVHB 1YEHH 5FHAH 1U58B 1A6AB 4NZUH 2XFXA 3DVGA 4YHLL 2ADFL 1GC1C 4G42A 4M93B 5KSAC 3G5VB 1TCMA 3ZHKA 1XCQA 4U6HA 5MEOB 1K85A 1VGKA 2NPLX 3IRZA 1FL5B 4NFCA 1GAFH 2VB5A 5HGDB 3VGFA 5E1AA 1S7SA 5DTFA 2VRAA 2WNGA 4NKDB 2BNRA 4QOKE 2VXTL 5AYUL 4JKKA 3L9RB 4NNXB 1NMBH 3QUXD 1QLFA 3QDMD 4NSKA 4ISVB 1T21B 2OJEB 4FHBD 4GLRI 1QSFD 2MWCA 5HHQB 1HYSC 4PJ8D 1F58H 4L8SC 1VERA 3P77B 4ZXBD 2YKLL 3B8YA 2DLEA 4MA3A 4K3JH 4BZ2L 3B6SA 4OCLC 3R8BB 4MX7B 5DHVA 5T3ZE 1RIVH 3ECBB 3OB8A 4XVSL 3HAEG 4Z78A 1QBBA 1N3NB 3PL6C 5IVXA 4U1MA 1VA9A 4PRPB 3NA4A 1BF8A 5CKAA 2EYTB 4ZPVA 3MV11 1TVBB 4JFOA 2VUYA 1QFWI 1R5IA 2NZ9D 3F62A 1IC4L 4P2OB 1EJOH 3U0PB 1KENL 5JPMB 3HC3L 1ZHNB 4M6OL 5CSGA 5EC2B 5ICZA 3TT3H 2HRPL 4LLVB 3LN4A 3NN8B 1ACYH 3T2OA 2BOBB 1XCTA 2EC9U 3AFLA 5ESQB 3LQAC 43CAA 3MRFB 5D5ME 5IMKA 1LDSA 2NCMA 4NCC2 2NYYC 1WZMA 5FB8B 4PJGB 2ITDA 3OL2A 3GMRB 5H94B 5ISZD 3CH1B 3C60A 5I0DA 5M94B 1FFNA 3FRUA 1Q1JL 3JSSA 1NLBL 4N0RA 4LCCB 1G9NL 3Q3GA 2IALB 3RWDB 2UZIL 3GSUA 4IIQC 1RMFH 3CZFA 1AGFB 2A6JB 4Y19E 2VAAA 1RU9H 4XAWH 5SV4A 4YK4C 2RBLA 4MDJA 4F15C 5KW9L 1NGYB 1YEGL 3U2SA 5T3ZD 2H26A 1OSPH 3T4AB 4U05A 4XWGL 1JFQL 3F7VA 2IFGA 1RZJC 2NQCA 3GKWL 4X6EB 4KHTL 1F4YH 5CEXB 1JPSH 4M6MH 1YEDB 3IT8D 1I8IB 4KKCC 2AEIT 4R4FH 5E7FA 1CCZA 1KJ2A 3BP7B 3VXRE 2CMRH 2CRIA 3L5XL 4CADA 2FD6L 2Y07H 5DJ6B 3BPLB 3MRKB 4MB5A 4JFFB 2ZJSH 4U1GB 3MJ8A 5CZKA 3GSVA 4M7KH 5GRYA 4X4YB 4M02A 2J4WL 4M9PA 3TVMD 3BPNC 2R4RL 4Z7WF 4JFQA 4PG2C 5IHBA 2AXHA 2J8OA 2O5ZH 4G6AD 7CGTA 3LQZA 5JHLL 3OAYK 2VNCA 1NAMB 2X1XR 4DGVH 3S9DB 1EEQA 1UB5B 1AHWC 4KKAC 4FQCH 5EIIB 3GMQA 2B4CH 5EG6C 2Q7YA 1FZOA 3DI3B 3NCYP 2R23A 4P2YA 4LF3B 4OI9A 3W9DA 4QHMA 4CKVX 2VLKD 1BEYH 3KPOA 1HNGA 3FOLA 1VACB 4WUUB 3CJJA 5F97E 4YHOL 5A2JH 1NFDA 1MFAH 2XZCH 3T0EA 3X17A 1PLGL 4EI5B 1E28A 3N85H 2FSEB 2ORBH 2J8UA 1KIRA 5IB5A 3EJZC 5IB4B 1RQ5A 3IDXL 2E7LA 5DC0A 1T20B 3NPSC 4D0CA 5D2NC 3D39D 4YHLH 2ADFH 3VXRD 5K59F 3MRNB 5GS0D 3G5YB 4P2RB 5K9OA 3F58L 4H0GA 2WWMC 1KV3A 4K8RL 5DK0B 1MCPL 3BQUC 3MRDA 5JA8B 3DX6A 3IKCA 3VXOA 1IGYB 2VXTH 4XWOC 5F1OB 3LB6C 1VEMA 5AYUH 3VWKA 4CVZB 5FM5O 3ULUF 3AROA 4KH2A 1X5YA 1KPUA 4R3SB 4OUOA 2YRPA 4KI5F 1RK1B 3T3PF 4OBSA 4Z7VA 3RJDA 4OGAD 2Z91B 3QDHA 4PRID 3T0XA 2P47B 1NC4B 1KYOK 2YKLH 4XBPA 4JFEA 5IR1B 3JWDL 3O0RL 5T1LD 3LVEA 4JM4L 2V5SA 3S5LG 3CXHK 1A4JA 1ONQB 4XVSH 4LCWD 5JZ7C 5IVZB 2X9XA 1XF3A 1KIPB 1LO5B 3U9PL 4X7SL 3DIFA 2G75A 1AGEB 1X5IA 1QBAA 3L3IA 3MYZA 1WCBB 1IC4H 5EO0A 5L9DL 4DEPC 1KENH 3HC3H 3HG1B 3QNZB 4N0UE 1FYTE 3CLFL 4M6OH 5ITFA 4P59L 2UZXB 3UCRA 2HRPH 1TCRB 1L9NA 5CD3B 3P30L 4YH6A 2R1XA 4O51A 2AVGA 1MJJB 4Z0BL 5DFTA 1FG9C 4S1DC 5IQ7L 2EDBA 3NZ8A 1CFQB 4MAYD 1FVEB 2UWEF 2K1MA 4HGKC 4JFZL 5IROC 1Q1JH 1VFAA 4W6XB 1BJMA 1NLBH 5AWNL 4UNUA 1G9NH 3CVIL 2CIIA 4H20L 5L6YL 2VLRE 4M03A 1E27B 1KJ3H 1BVZA 2QV2A 2UZIH 4JZJB 5JHDA 1S7TB 4LCYB 1ZEAL 2I24N 1F4HA 3LKQB 1CXHA 2DI9A 1WK0A 3MBXL 3QFDB 3HZMB 2Y7QB 3MGOB 4GW5B 5KW9H 1KNOA 5HI4D 4L8CA 3QQ9D 1YEGH 1YDPB 3VGAC 4RAVA 4PJBF 5DJ2B 1GGBL 4LHJB 4XWGH 2O26U 1JFQH 4BFEA 3GKWH 2FWOB 3CCHB 4A2MA 4KHTH 1T03L 5KSAB 1OP5H 3TP4A 2VIRA 4G9DA 2NY7L 3OKMA 1IGML 4ELME 3UTQB 3IDJB 1A2YB 4Y4FD 1K3IA 4I3GA 2EDDA 3VI3E 1RUPL 1T7ZA 3EKCA 3L5XH 5KVDL 4U33A 4PJFA 2HAZA 5EIQA 1SEQL 2D3VA 2FJGB 2WBJB 2Q86A 4G6FB 5M95B 4NGHH 2J4WH 3VFTB 1FCCA 2R4RH 3LY6A 2BXZA 4ODVL 1F4AA 4GG8A 5JHLH 4F7PA 1G7IA 3S6CA 5C2BL 5DD6A 2XOTA 2AAVA 1T7XA 2IBZX 3IETA 4ZUUB 2BSSA 2R9HD 4I3RL 1TITA 2BSTB 3CGTA 3MNVB 1FNAA 4I48A 3ARED 4GG6E 3R06B 2EXYC 3O9WB 4NP4L 5GZNC 1UJ3A 1I7UA 1I75A 4DUXA 3GEWB 2QEJA 4ZSOE 4G5ZL 4X7CC 2J5LB 5C09B 4HLZG 4HV8B 1BIIB 1UH2A 4P9HL 2YMXL 4YHOH 5IB2B 2E6JA 4OZGA 5ICYB 1PLGH 2WBWB 2Y6SD 5IGXL 1C5BL 1ED3B 5F3BB 3NZHL 4BSWA 3KGRA 1YYML 3IDXH 4D0BB 5C6TL 1TJHL 2XWJB 3IDMB 2GIYA 2ZWLT 2Q76B 2A6IB 3WDJA 3F58H 3GSWB 1NBYA 5J4MA 4K8RH 3KPPA 1WEJL 5LAXA 3VFPA 5I1LA 1MCPH 5F9JA 4G9FB 3S7GA 3BT2L 3SE3A 2FGWL 2NW2B 1A1MB 1XZ0B 3KPRE 3VA6A 5KZCD 1AKJB 3LKNA 3WFDL 4ZDHB 4QOKA 4HJJL 1V3LA 3P4NB 3PQYE 5IP4A 2AW2A 2X9WA 2YRLA 3QXDA 2XKNA 5CWSA 4Z77A 2X1WL 2DS4A 2F53E 3DROA 5E24E 1LQSR 2GCYA 4NNYA 2Z93B 4G80B 1DBBL 4I0CC 4RGNE 2V9TA 2V2XB 2BRRL 1Y18B 3JWDH 3O0RH 4Z7QE 4PV8A 5J12B 3I02B 3QJHA 4JM4H 4EI6B 4HS3B 3WN5A 1GPOL 3QWOA 3O8XD 4FFWD 3NIFE 4JM2A 2ARJQ 3TJEL 2BERA 4X7SH 4NQEE 1EHLL 1YEKL 1FDLL 5DJDB 3RGHA 3IXTA 3MACL 5F70A 2P5EB 5F7UA 5L9DH 3NA9L 3BPNB 4YUEL 1CYGA 5TF0A 3CLFH 2NTSP 5FKAB 3CU7A 4P3DB 3MLRL 1T6VN 1CK0L 4P59H 1UACL 2FNBA 3QNXB 4D2NA 2ARJB 5GS2H 4Y4KA 2X4QA 3P30H 4RGOL 1TTGA 4PRDA 4RDQG 3U0WL 5D5MA 3PQYD 4QCIA 4Z0BH 2X1QA 5HHMD 2WUCL 5IQ7H 1BHGA 2X40A 1R24B 3HLAA 1WUNT 2XI9A 1AH1A 3BOVA 1CDGA 3DO3A 5AWNH 5HY9B 1ITCA 3CVIH 3KAAA 1TZHB 4H20H 1F97A 5L6YH 5IBUB 1FNHA 4PBXA 1D5BA 1UM4L 3SJVD 1C8PA 1ZEAH 4MXVF 4Y19A 3JBG7 2IANE 1CE1L 4IOFC 1KTLA 1IGIL 3MBXH 3RTQD 4IMLA 4LLQB 4X6BB 3E6HA 4NYLA 1CDIA 1KLGA 3BIAX 3Q6GL 1N5YL 1GGBH 3BW9B 3QZWG 3L6FB 3TC9A 4AL8L 1MF2L 1T03H 43C9A 3RGVA 3TZVA 1R3JA 2GFBB 2NY7H 1IGMH 2FO1A 3SOBL 3J8F7 4JDTL 3BD3A 3X14B 4L4TE 3KJ6L 1BVKB 4HIEB 4MAUL 4Z9KB 3SDXF 4MLIA 1RUPH 3AMLA 1LO2L 1HCVA 3S97C 4WW2F 3EJYC 5KVDH 4TN9A 2A9NL 3C5SA 2BC4A 3OKKA 3LPGA 5EUOF 3G6DL 3JTSB 1SEQH 4JGJA 2HLFD 1BIHA 5DVNA 3SGEI 3QXAB 3WS3B 5H94A 5MI0C 3C5ZC 4DW2L 2HWZL 1FYHB 3DXAB 3I84A 1HWGB 4LCIL 1CDJA 4ODVH 2Q87A 3QEHB 3RIAF 4OD2A 4XHJC 1P2CA 2HT3C 4HUWB 3IDUA 1CGVA 5D72L 3MLXL 4B53A 5C2BH 5EIVA 5TGBA 4U1NA 4GW4B 3DRQB 3C09C 4Z7OE 4HUXA 4FRWA 4I3RH 1FO0A 4JJ5A 1EZVX 4LU5L 2DQDL 3MRRB 4NP4H 4JEGB 4MJ5A 4WV1C 2CRYA 4OZIF 4R4BB 2V7NA 4UMGA 3IJSB 2I9TA 1S3KL 1HYRC 1LEGB 4NWTL 4WWKD 5D7LD 3QIUD 4P9HH 2YMXH 1JGLL 1FFPA 1K4DA 4W4NA 4DEPB 2W38A 1N8ZB 4QRPB 3TYFB 6FABL 5IGXH 1C5BH 1P4LA 1F11B 3NZHH 1YYMH 4HIIB 4H25B 5T3ZL 3GSXB 5HGAA 4YDJA 3BJLA 1TJHH 4OLVL 2NY5L 5C6TH 3P40A 1YEEL 3V8OA 5IOPA 1VFBB 2FLRT 3GSRB 4KHXL 2K7QA 4P3CL 4HQQL 3MRIA 2NLJB 2RIKA 5E5MB 1F90L 5JORA 1WEJH 2YD7A 5C07D 1IM3B 4X80L 3HS0B 5IVNA 1RZGB 2WSKA 1OD9A 2B4CC 3BT2H 2FGWH 3HE7B 3UTTB 1J9CT 3QZWA 1ORSB 4XCEA 5LGKA 1IAOA 3WUWA 2ESVA 2XPGB 5C0BD 1J1PL 1NAMA 4FQXD 3RIAK 3WFDH 5LBSL 5L8JB 4HJJH 2IBZY 4KUCD 3QFJB 4PJAE 4H1LB 5DFVC 1ZT7A 3NFPB 3E6FB 1IGTA 2X70B 4E41E 1FV1B 1DBBH 4PGZA 1IQDB 1HKLL 4WI6A 1C08A 1YJDL 2BRRH 2WBKA 2KKQA 4KROD 4AH2A 1CGXA 4OGXL 3VXNB 5F21B 3BYYA 4X5WB 3MRGB 4JLRA 3EZJB 1GPOH 2DKMA 5DHYB 4GKSA 1N59A 3LKRB 4RGMC 1QACA 2XN9B 5I74C 1OP9A 2ILLA 4ETQA 3TJEH 3TBWA 3EYOA 1EHLH 1YEKH 3FTGA 2J1KA 5F7MC 1FDLH 1KB9K 1U92A 3VGDA 1T1WB 4PJ7E 3UTSD 4ZPTA 3LQMA 3RL2B 1BOGB 3MACH 4ENEC 5E8OA 3QEQD 3N1FC 3NA9H 4YUEH 1NGWA 2XNAB 3W81A 5J0BA 1GOHA 3MYJB 5FECB 3VFOA 1MHHB 3MLRH 1CK0H 4S0TD 1UACH 4I9WE 1HXYB 2YK1L 4BKLB 4G6JL 1JV5B 3HI1B 3SDCD 3PWPE 4ODWA 5JO5B 1L7IL 4BQ9A 4H8WH 5C0AE 5SWZB 4RGOH 3U0WH 5GS0L 3S96A 2WUCH 4HAFA 5F7EL 1U8QB 3DJ9A 4UZGA 1DQJB 2OTUB 5DRWA 1DUZA 4G6KL 5IEHB 5KJRH 1JRHI 4YIQA 3UJJH 5E99L 4CBPA 2CR6A 4WI5A 5H35A 2VLRA 3P4OA 4DOHB 2BY2A 4FP8L 3MV8E 1PEWA 5CHNA 4P46C 4OZFH 4UV4L 1UM4H 3TN0A 1S9WA 4HLJA 3BO8A 2JCCB 3AY4A 1CE1H 4QEGA 1IGIH 5E94B 3UBXA 2PCPB 4HD9A 1X5XA 4HUNB 1OTTC 1KXQE 1FZKB 2D31B 3Q6GH 5E6ID 4AM0A 1N5YH 4HEME 1JPFB 4AL8H 3W0WE 3S88L 1MF2H 2VXSL 3FO0L 5INCA 2JE8A 2DYPA 2KDGA 4MNHA 1AGCA 4ELMA 1B0GA 3SOBH 4JDTH 5BOPA 4M1DL 3KJ6H 4P4RB 4NBZB 3NPZB 4MAUH 5D1ZB 5F1NB 3BUYB 3RQ3A 3HFMH 1TCRA 1G9NC 4NBXB 4OGZA 5KSUA 2A9NH 5CBEA 4UTAL 5B38G 5D2LB 3G6DH 1Z5LB 2YHGA 5FM8A 1KCSL 4YBQC 4KRMB 3TH2T 4F9PC 4JN2B 1OTUC 4Y4HC 5F7KC 4DW2H 2HWZH 2JELL 3V5DB 1N64H 3WD5L 4LCIH 4IRJB 3X11B 2A6KB 2JF1A 5HYQA 5DSCA 1J0HA 1EUUA 4U1IA 4QF1B 3H3BC 4N9GA 5D72H 3MLXH 2I25N 4P5KA 3ZL4L 1MHEB 2H9GB 1LEIB 3IFPB 1YQ2A 5DEFA 5HYSG 3RDTB 1PBYA 3C6LC 3SKOA 3GSNH 3FMGL 4LU5H 4PJ9C 2P8PA 5FYJE 3HR5B 3BEWA 2DQDH 4O2CA 2IAMB 1A9EB 3REWA 4ZSOA 3Q6FA 2H3NA 4LPTA 1JNNL 1S3KH 1AD9B 4NWTH 4J1UA 3W0WD 3DGGA 1JGLH 4NOFA 2BY0A 2QHRL 5HGHA 3R0NA 4U31A 1BP3B 5C9JA 6FABH 4QWWC 1X4YA 4ERSL 4DUVA 3O81A 3QDGA 3ZSSA 1D7FA 1T66C 5L8LB 1YPZE 5F7HA 1QFPA 5T3ZH 3BGFB 4FQHA 3DURA 2NY5H 5B39G 1YEEH 5E95B 4KHXH 3K1DA 4P3CH 1IARB 2D2OA 4HQQH 1GZQB 1F90H 5HGGS 1XH3A 2VDKL 4QRSA 4X80H 5DJXB 2BZDA 4XGZB 2LU3A 1MUJB 3KPRA 3WKML 4JAMA 4GRLC 1D5ZB 4YHML 3CFDB 1J1PH 3JV4A 3RWJA 5LBSH 1I7TA 1YMMD 2CDFB 2RFXA 3NIGF 4C59B 1WBZA 3VXSE 3L3KA 3OKOA 3NVQA 4QXTA 4Z7UE 1EZVY 3K74B 3C6SB 4AIZB 2F53A 4P9ML 3HPLB 3WS6C 4JY6B 3EOAA 5J6HB 1BLNB 5J89A 5FYJD 1BWMA 5B38A 3T09A 3VXUD 4LVNC 1HKLH 5DHXB 1YJDH 3PF2A 1Q0XH 4QRTA 3CU1A 4I0PD 4OGXH 4JVUA 1T3FB 1NDGB 2JIXA 4K8RC 4QRQB 4C56E 1NGQL 3U4EB 5LGJA 3IKKA 5DDHB 3RY5A 4Q9BA 3DTXB 1HHJB 2B0SL 2IH3B 4NQTA 5CLWA 4LPWA 4NQEA 4ZNEA 2NY3B 1U8OA 5J9PB 5HYSA 1H8NA 3MJ7A 2A6IA 3G04A 1EFXD 5E6YA 1F3JB 5MI0B 3C5ZB 1YYLL 3N1GC 1LE9B 2AJUL 2OQJA 3MO1A 2YD4A 4U1SA 3F12B 4U6TA 5CP7B 2YK1H 3NFNB 4G6JH 4PLOB 2D7TL 3ARGA 3MTRA 3PWJA 5FGBC 1L7IH 5LWYL 4QT5A 5IBLD 5AAWA 4JG1L 4YXKL 3UC0L 5GS0H 1PZUB 4P2QE 4XNXL 3JWDC 5F7EH 4MD4B 1B9ZA 3ZE2F 4E5XA 2VKWA 5D7IB 5DZNA 4Y5YA 5KSVA 5MEQA 1A9BB 4KMTL 4Z95L 4ACPA 3QAZC 4F7CA 3LKPB 4G6KH 4ELKA 5B39A 1SHMA 3O4LD 1JE6A 3VFVB 2XQBL 3IDIB 1ZT4B 2XACC 4FP8H 5HI5C 5HYJB 4UV4H 1U8LB 1W0VB 2IANA 1TVHB 2PYFB 5KG9B 5HPMA 1I1AC 3FO1B 4JB9L 1RSFA 4G8GE 4XCYA 4XBGB 3VFMA 4YC2C 2XTJD 3O6FC 2E3VA 4AMKL 1M4KA 2JLLA 3ARDD 4WW1B 3S88H 3FO0H 3QEUB 4K2UL 4S2SB 1HI6A 5L2KD 4X98A 2CLZA 3I6KA 3VWJD 1DP0A 1NEZG 4U3XA 1YC8A 5KS9B 4PP2B 2PXYA 5JDSB 5BS0E 1ORQB 4L4TA 4M1DH 1T0MB 1J8HB 2W65A 3T65B 2ICEA 3D1MC 3Q2CA 1KYOJ 5IK3B 2H2SC 5HHPA 4HWBL 4C54A 4UTAH 1FNSL 4H0IA 4PY7A 5JOFB 2GAZB 4QRRB 1PGRB 4IMKA 1KCSH 3CXHJ 3ILQD 1FN4A 4CNIB 1WIPA 1AQDA 3JV6B 2DLGA 2HRLA 2JELH 3WD5H 5BRZD 2X4TA 4KJYB 1R3LA 4ZUTA 4L9DA 4QGTA 1QVOA 2D4DA 5F88A 3ZL4H 1NMAL 1A7RL 5EZLA 2BVQB 3LDBC 3R8QA 1RZKL 1XIWC 3FMGH 4RGMB 1R3HB 5ANMB 2R39A 1DBAL 3T08A 4LBEA 4LVEA 2DBJA 4YX2L 4LOUD 1H5BC 3FO2A 2DLTA 5DRXA 4HC1L 3NTCL 1JNNH 5F71A 1D9KC 3THML 2OM5A 4MNGA 2UUDK 2J8HA 1YMHA 2QHRH 2Y1VA 3K4AA 1U3HB 3D2UA 2Q6WB 5FGCB 3JXAA 3O3DB 2BP3A 4EXPX 4ERSH 4PTUA 1U8PB 3VXQA 4GRWH 3MUY1 5FGRA 4D9LL 1U95A 4PLJC 5MEPB 5I19L 3D87B 3V6OE 3JTSA 3NIDF 4FXKA 3S37X 4BA8A 1HHHB 2VDKH 3P3YA 4G43B 3TO2A 1OB1B 3BPCB 4J3TA 3IVKA 5HSFA 5E8PA 3MRHB 4PGEB 3WKMH 4L9LA 3QJFA 3FRPG 3TNMB 2F9BT 5CSBA 3S3SA 1LO3L 4NQVB 4P46B 2W60B 4EN3A 1NEZA 1HXMB 3SDDB 4HK0A 1OSZA 1IM9B 4P9HC 1T5XA 4GW4A 1YY8B 3ARFD 3CMGA 5T1KA 1BM3L 4P9MH 4E41A 4MQ7A 4Y1AB 3NAAL 1CU4L 3ARQA 3EDKA 4R0LC 4MS8D 1WC7B 3VD7A 3HZKA 2IG2L 2MFNA 4EXKA 4OKVA 3RZCC 4XZUA 4TUJA 1NGQH 5B4MD 4UUJB 1JWSA 4JY4B 5GZOD 1UVQA 5E4EB 2B0SH 3OB0H 1FZMA 4PJHE 2M1KA 2EDNA 4MZ3A 3RA7L 4PJ7A 2GSGA 5C0IA 1MQ8A 5D71L 3BZFA 1MWAL 3AXLA 1YYLH 2J6EA 3PNWA 5EO1B 1AGDA 1T83A 4LPXA 3SE4C 5EBMB 2AJUH 1EEZA 4PJEA 5EU6E 2QSVA 2D7TH 1NCTA 3PWPA 3ZDZF 5LWYH 5C0AA 4AT6A 5BV7B 4OZHE 4HMCA 4JG1H 4YXKH 3UC0H 5CBAA 4P5MB 4XNXH 5IVXF 4JRYB 3TT1L 5GGRY 3FN3A 1IZJA 4X7EC 4PJIF 4KJWD 4KMTH 4Z95H 4B41A 5JNYB 2LVCA 3BD5A 5D7JD 5DRZB 3RNKB 3V6BR 1U8HB 2XQBH 5JQHC 4OAWB 3MV8A 1ZVHA 3P9MB 2HG5A 3VXMA 3P4MB 1HHKB 3VW3H 4KK6C 2AK4B 4X5LA 3GJEB 2DQGL 4MZ2A 1I7ZA 1CF8L 1IGJA 4I4WB 2AJZB 4JB9H 5J8OA 3AVEA 5DJZB 2C3WA 3FRPA 4F3FB 1YY9D 2AJYL 2HP4A 2YA2A 5I6XB 4HKXB 4AMKH 3HC0B 4N5ED 2J88L 1VEOA 2NY6D 2BSRB 3GNML 4K2UH 4H8WC 5CIPH 3RL2A 5SX4H 3H42L 3HC4L 3ZKMD 2GJZA 1KG0B 3ZKSD 4PRPE 3TCXA 1M7IB 4HWBH 3MBEB 1FNSH 1G84A 4O9HL 2VWEE 5DZOA 1A1OA 3BAEL 4MCZB 4MSWA 1SMAA 4N1EA 3MV7B 1B6DA 2JJTC 1B3JA 3QUXC 4NPYA 3RHWF 1HHGA 1RZ8B 4GS7B 3KYMA 2BNQB 1FNGB 1F3RB 4YEEA 4OI7A 1R5VA 3QWRD 3SKMB 5F1SA 5ELIA 4JANA 3PHOB 2P7TB 1ZA6A 3B5TA 3VJ6A 4PJ8C 3U0TB 5GSVA 2FEEI 1U93B 3BH9A 5GHWL 4ZXBC 3QCUL 3OJVC 1NMAH 3VCLA 1A7RH 1Q8MA 4K7FB 1RZKH 5D1QB 5I1DA 5E9DB 4OLXL 1DBAH 2YUXA 1XGPA 1ZHBA 5DJCB 4XMPL 4HC1H 3DSFL 5FUCC 3NTCH 4PJXF 3HE6A 3JZ7A 1UEMA 4WEBL 3THMH 2DKSA 2EDYA 1G6RA 2AXFB 1T2JA 5DMKB 4ZOEA 3K2UL 2NZ9C 4U1LB 1YPZA 1T0NB 4QNPE 3WJLA 2DM4A 4D9LH 4PRPD 4YJZL 2FBJL 5I19H 2OX5A 2APBA 3BPOC 4LPYA 3QUZA 1FL6B 2O5YL 5ENWB 1CE6A 3TZVD 4QHUA 2FYYB 4NNPL 3I3BA 5CUSL 2OLDA 2EDOA 3QAZB 3DX9A 5A3ID 1RJYB 5TF1L 1MOEA 3MXVL 1OGTA 1FLRL 1NFDF 2CDGB 4HMEA 4GAFB 1LO3H 4Q6IC 3ALPA 4U1KA 3VXSA 4JFFE 1CG9B 1NQBA 3C2SA 4Z5RB 1A7OL 3OGOE 1IEHA 1BM3H 3BFOA 4PJDE 5DURD 1H0DB 4GT7A 3NAAH 1CU4H 4YGVB 4U4BA 3VXTB 4F8QA 4ETYA 3F8UB 3FT2B 2NY5C 3H7BA 2IG2H 1OQXA 3O45B 5CJQL 3EYSL 3L3JB 2IC2A 3G5XA 1EIBA 1EPFA 4C56A 3HZVA 4B50A 3SGJC 3NACL 4D8PB 3RY6C 4JRXE 3ZZ1A 5C0JA 5E4IA 5H2BB 4U1JA 3RA7H 2N56A 4WUUE 3D48R 5INDB 1FPTL 5D71H 3O2DA 5I16A 3OKYA 1CDHA 4D9QD 1MWAH 3TBTB 2E9IA 2AERT 3ZTNL 4NWUL 5GIRA 3CFBA 3U36B 1U6AL 4YDKL 4GAYB 5K9KA 3TVMC 5I2IA 3SPVA 5GRWA 5EBWB 1YN6A 4G6AC 1M71B 3LN5B 3LD8C 3GMPA 4P2QA 3LDBB 1YJDC 2IPTL 3TT1H 2HJFA 4JO4L 1TJIL 1XIWB 4AIZA 1JI2A 4P5TA 4M7LT 2GK0A 4MD5A 5ID0A 5CKGA 1CT8A 4OQTA 2Z4QA 1AQKL 3VFGL 3LEYL 4QYOA 4L4JA 5TE4L 2ICES 3QNYB 4D0DA 2ESVD 4Y8DC 4BSVB 3RWIA 2F19L 2VZ3A 4M43L 2YRZA 1G7QA 5EU3B 3ARPA 2DQGH 1HK6A 1CF8H 3CIQA 2QSTA 4G8GA 4NHUB 4OTXH 4HBCL 2AJYH 1RJCA 1X5JA 1DE4A 4UDUA 4HW6A 5FYJL 2J88H 3KNBB 3GNMH 3QUYB 2NX5E 2BVPA 3HKFA 3PUCA 5KN5A 4WUUD 4J3SA 5AZEL 5GS0C 4DKEL 3H42H 2R0KL 3HC4H 4EI5D 2G5BA 1NCUA 3BIKA 2CJUL 5J11C 1ZAGA 2YXMA 2VISB 3GMOB 5JW4R 2PKDA 4ZYKA 4N8VB 1D6EA 3Q5TA 5C0CA 1IAIM 2JTDA 4O9HH 4K3DL 3BAEH 4P2RD 4DKAA 2FJHB 3EOBB 5D1XA 2X4NB 1J0ZA 2QKIA 4X83A 4ZFOB 3SDAA 5BW7A 1RK0A 3QUKA 4LSQL 3B2UD 4HJGB 5J6GA 2ZKHL 4R0LB 4M7LL 2C1OA 5K59E 3AU1A 1KB9J 4JKMA 3MGAA 5I75B 4OGAC 3ZHDA 4U0RC 3MRJB 1BGXL 3QBTB 1J10A 5GHWH 2XKSA 3QCUH 1K8IB 4J8RB 4RMWA 3W9EA 4I77L 3VG9C 2DLIA 3BGAA 4PJFF 1KLFA 4TPRL 4N1CA 4OLXH 1R0AL 2CDEA 4KJPD 1O7SA 1A4KB 2FEDD 4XMPH 3DSFH 4L4VE 2BVOB 1NC4D 2HVJB 4TNVF 4NC0B 4WEBH 2AGJL 5F6HJ 2YPVL 5TE6L 1QNZL 1Z6JT 2OTWB 1EXUA 3HZYA 4Q2ZA 4U6XB 3U83A 5JLZA 5DA0B 2FJFA 3K2UH 4M5YL 4NKOA 3VXPB 1QPPA 1QRNE 4Z8FL 1HSBB 5IW6A 5IWLA 3DX7B 4I18C 3ZDYF 3MMEB 3RU8L 2QSQA 1C16A 1JF1B 4WGWB 3ROLA 2FBJH 3U7YL 1MFBL 5F7NC 4P4KB 3VRJB 3MOAL 2O5YH 3RUGA 1RJLB 1G7PB 5ERWB 4HULB 3VRLE 4NNPH 3CC5A 4Y5XB 2ZOKB 5CUSH 4ONHA 2Z92B 1M6OA 3VE0B 4PJBB 3V6ZA 4IJ3B 3WFBL 1NC2A 3HG1D 4MAYC 2P49B 2BY1A 3MXVH 5DXWA 3ZO0A 3CFIC 1FLRH 2LABA 3BMVA 4XMKL 4XNQB 2MQCA 4WI9A 3LKSB 4HGWA 3L3DB 3MLPA 1J0KA 1HE7A 3LMJL 5F6IB 3ULVD 3ZLQC 4Y16A 1II4E 1SM3L 3MCG1 3M45A 1BOYA 3OPZL 1A7OH 1R3HA 2P42B 1I1FA 3N0PB 3WJJA 2I26N 2XXCB 4CVXB 2E7CA 4UU9B 3FAWA 5HI4C 3QQ9C 1K8DA 2VDNL 5T33L 5GGSB 3KYNB 1XGQA 2V2WB 1SYSA 2X4RB 4LP4A 4FQLL 4P57B 2W0FB 5CJQH 3GHEL 1G0XA 5MERB 3G6AA 4MNQA 2UWEE 3WNNA 1VKXA 4MJ6B 4EUPB 4P49A 3NACH 1NGZB 3ARBB 1QSEB 2AV1B 2AEWA 3KXFB 1B6UA 5DMYA 1DDHA 4ZNCD 1FJ1A 4Y4FC 5C71A 2YEZB 2PO6B 3PGCB 2JJWA 3QUML 3NABL 5KSAD 1FPTH 1RUML 5ACLA 1HOCB 3HNTL 3SGKA 3ZTNH 5DRNB 4NWUH 4CMHB 1UT9A 3BKML 3BHBB 1J7VR 4YDKH 3ZE0E 4PTTA 1RI8A 1MSPA 2ZSVB 3IDYB 4HG4J 5EU6A 3ZMRA 1TXKA 1DN0B 1HDMB 2ADIA 4ZXBB 2XWBB 4OZHA 5K93A 2IPTH 3PP3K 4JO4H 1TJIH 2WBJD 4JZOA 4G9FE 4G6FD 3T0BA 1UZ8A 2R2EB 2R9HC 4Y1AA 1AQKH 3VFGH 2D7QA 3LEYH 3AREC 5TE4H 1R3IL 1M7DA 2F19H 1BQSA 4M43H 5JIIA 1IKFL 4X8XA 5C0DA 5KAQF 4ZAKA 2VE6B 4WFGD 2EE6A 4MJIE 1WQVT 4XPBL 3VDBA 5FXCH 5D5MF 2DMCA 4PREA 2IF7A 4HBCH 2Y6SC 5FF6B 3HAEH 2VOTA 3MROA 4TQEL 3O9WD 4CGTA 3AB0B 5DJYB 5FYJH 4TUKH 3S36L 2GJ6B 5IF0B 3OHXA 1HHIB 5C09D 2BFVL 3B9VA 4EIGB 5AZEH 1TZIB 4DKEH 2R0KH 3D9AL 2AS5M 2JIXD 3GSNB 2CJUH 1RJZA 1FVDB 3HUJB 5HTSA 1QA9A 3DVFA 4HK3J 4M61A 5MP6H 5HDLA 4F80A 2DTSA 4LKXA 4K3DH 4P5MA 1WJ3A 4R8WL 3GHBL 3E2HB 5J1AA 1PD6A 2IQAB 3QI9B 4G9FD 1OWWA 2C26A 4CL7A 4RAUB 4LSQH 1F6LL 1NBZB 5TQ0H 5M7QA 2ZKHH 4M7LH 4UOW1 5T3XE 2ID5A 2P4AB 2EIZB 1AKJD 1MPAL 4AQOA 2CKBA 1BGXH 3H9SB 1UB6A 2ADJB 2Y25A 5C8JB 4CN1A 4I77H 5EB9A 4TPRH 2IWGA 1R0AH 4RIRA 3LEXA 4LHUB 4HKXA 3O8XC 4FFWC 1PW3A 4K71B 3HCVB 3U9UA 3MJ9L 3TA3C 1UJTA 3LRSB 4A6YA 4DVBB 2RQ8A 3CUPA 2AGJH 5TE6H 2YPVH 1U91A 1QNZH 3WLBA 5KVMC 1HH9A 1TQBB 3V6FB 2W07A 3GSOA 4YLQT 2YD2A 1T89C 2OL3L 4M5YH 1KJVB 5EU4B 3K8MA 3K1KC 4KKCD 4Z8FH 2FO4B 3WHE1 5IV2B 3I9GL 2QLVB 3TO4A 1OVZA 2EDWA 2F58L 3RU8H 1JUFA 2EYRA 4PGCA 4YAQB 1NJ9B 3SCMC 1C5CL 3QG7L 1MH5A 4GAGL 1AO7E 3LD8B 1WBXB 1MFBH 3H0TB 2WIIB 1PDKA 3MOAH 3IYLW 3ZE1F 1F00I 1VFOA 2P5ED 3DUHA 1DVFB 4LQFL 1RZKC 2PXYD 3TIDA 3WFBH 4WHYH 4LFHG 4XMKH 3CVHL 3QIBA 4KTYA 1EERB 1U93A 1L6ZA 5T3XD 4TVPE 4I8DA 4MA1C 1Q9WB 5BZDB 4AEIL 3LMJH 3LIZL 1NLDL 3UDWC 1BZ9B 3GMMA 1SM3H 4WY7L 3SDXB 4KY1L 3OPZH 1R3KB 3DXAE 2DIJA 2PTTA 3CK0L 4WW2B 5IW1B 3RTQC 3T77A 4U0QB 3UXFA 3D18A 1SYVB 4JN1L 2VDNH 5T33H 4N0FB 1MCSA 4FQLH 1EX0A 3GHEH 1EBPA 4HX1B 1S7XA 4I2XB 5C0EB 3NGBC 4PBWD 3BD4A 4QHLA 4Q9QL 2DBLL 2A6DA 4POZD 5T1MA 2GTZA 4JRXA 2R1WA 5LXGL 1G7HB 4JQIL 2DF3A 5EUKA 5FK9A 3VFRB 2CQVA 3QUMH 3OR6B 2BVEA 3PWVA 3NABH 2APTA 3JVGC 1JGEB 4DAGL 3HNTH 2FL5A 2GYSA 3BKMH 1QR1B 3SQBA 2HLFC 1ZMYA 4FXGA 5IMMB 1MAML 1U8MB 3UMTA 4RMTA 5L2JA 4OZIB 2DWDA 5C2UB 1MHPL 3TCLA 4CU8A 3GJFA 4E0RA 4FG6D 3CXDL 4J3XA 3REVB 5CZXD 4FTVE 4QLRA 1FE8L 1UM5L 4OD3L 3QSKB 3UTTE 4X6CE 3DXAD 2OK0L 1T2XA 2AJXL 4NRZA 3FB6A 4LCWB 1URLA 1R3IH 1XGRB 4B7IA 2X4PB 1VCAA 4N90D 1IKFH 3L5HA 1WFOA 3EOYG 5E8EA 4WWKC 1A3RL 4QRUB 1F6AA 3QIUC 4Z7WA 4GJTB 4XPBH 2X44D 3K8LA 4JREC 3UP1A 1MLCB 4QO1A 4TQEH 2I60L 4P23A 4X8JB 4Z76A 4PS4L 4KRLB 2NX5A 3S36H 3C5JB 2BFVH 3LN9A 3ESVF 1S7QA 4HZLB 5BJTB 3HPJA 2WV3A 1I8MA 1ZLVH 3D9AH 1MY5A 4LCUB 4QRPD 5FYJU 1A21A 4HPYL 4DCQA 5FUOL 3RX7A 3L1OL 4PGDA 4LKCA 1DR9A 4FQXC 1WFUA 3NCBB 4R8WH 1CIUA 2HLAA 3GHBH 1C5DB 4L3EE 1PVHA 3MGTB 1JZ4A 3FQXB 2FH6A 3DV6B 1N5AB 2A0LD 4NRYB 2VLLA 1K4CA 4WTXA 3HE7D 3UTTD 4V2BA 2MCPL 3DUSA 1OM3L 1MPAH 5SWZE 4OD1L 4X6DB 3DETD 1N2RB 4QTHA 3KPTA 4JO2L 3VI3F 3FONB 3QFJD 2WK2A 4M1GL 2I27N 3C2AL 1J5OL 1TNMA 3CSBA 4KROC 3RP1A 5I8CA 1MVFA 3O4OC 4YHPB 3BZ4A 4HCRA 5DJAB 4URTB 3HNVL 1U8IB 3MJ9H 2CO7B 4L4VA 4WU7B 1G7JB 1D5XA 3IFNL 3QO0B 2JCCE 1NAML 5I76A 3V4PL 3MQIA 4NUJB 4LMQE 2OL3H 2YPLA 1ZHKB 1WLHA 4JDZA 1QRNA 3VD9A 5AZ2L 2VLJB 3I9GH 2XN9D 1U3JA 3ARXA 1PJ9A 2F58H 3U79A 4BH8A 4LLUB 4X6FB 5HDBF 1JZ5A 1C5CH 3QG7H 4GAGH 4TUOA 1EBAA 4GG6F 1T1ZA 3MV9E 3OF6A 1AY1L 3CFKA 5FGSA 3W11D 2OS7A 5DJ0A 3UZEA 3SDCC 4EJ1C 3GMLB 4PIRF 3WSQL 1OW0C 3EYUL 1CVRA 3SKNB 4LQFH 5HVHB 2I07B 2FR4B 4PRHB 3GI9L 3CVHH 4PD4K 2QHLA 1B4RA 2GITB 5SWZD 1NUNB 1Y0LB 4AEIH 4HUMB 3LIZH 3VRIB 1NLDH 1DZBA 1W72A 3T4YA 4WY7H 4CUCA 4KY1H 1FG2B 2HFFB 2HN7B 1HILB 3RWEB 4L8SA 3CK0H 3OAUL 3PXHA 3V4UL 3OJ2C 1EK3A 4M1CD 5E6IC 4LVHB 4J3VA 5SV3A 3BKCL 4F8TA 4PJ5E 1I3UA 4DFIA 2UWEA 2MOVA 5I17B 3QG6B 4Q9QH 3PHQB 3PL6A 5D7SL 2EZ0D 2DBLH 5IHLB 3D0LB 1MREL 4TOYH 4APQB 5LXGH 5IEKA 4JQIH 3D85A 2HVKB 3N9GL 4R90L 3HE6D 3ROOB 2FECL 5IMOA 1ZWIA 3BX7C 4DAGH 3DHMA 5EOTA 3D3VB 2VDPL 2ICCA 3ZYOA 2H2PD 2H45A 1MAMH 2KPNA 4X4ME 4XPHH 4Z7QF 4MJ4A 2YC1B 5D1ZD 1MHPH 3FB7A 3OG4B 4XNQA 1XF2B 3PWLA 4JDVB 4QY8B 1ZTXL 2F54B 3NIFF 3DUUB 1EVTC 1WBYB 3CXDH 1BZQK 1A3LL 4ORZC 1JHKL 5E70A 3RWGA 3NCFB 1FE8H 5BVJA 1UM5H 4HUVB 1J1XL 5I15L 2GUOA 2G60L 5FOJA 4X99A 4CVXA 3P9LB 2P24B 3O8XB 2OK0H 4IRJD 2AJXH 3H9ZA 1IAIL 3DYOA 4IIQA 3TA3B 4HIJB 1KPRB 1IAKA 3ULSB 1QQDB 5IJKA 1NSNL 2B1AL 4NN6B 3BEVB 1M1SA 1A3RH 3IDGA 2CGRL 2DM3A 4HHAA 4NJ9L 3RDTD 5ADPL 1F4WL 3ULVL 1G9EA 4RZCA 4HDIA 2Z8VC 1DEDA 4WO4A 3MUZ1 4POYA 4NKIL 2ZCKL 2IAMD 3OKDA 2I60H 3SCMB 2YEZA 5DI8B 3U46A 4UV7L 3T2QA 1F13A 4PS4H 1SY6A 2BVYA 3STZA 1DLHA 3T2NL 3DRTA 5DEGA 4RA0C 1IEBB 1WWCA 3IU3B 4YPGA 2VDOL 4JKLA 2XWTA 3L5WB 2DN7A 1T6WA 2ZUXA 1RZIA 4HPYH 1IEAA 1VADA 3OKLA 5HGBA 2AQ1A 2VMFA 3FQRB 5FUOH 5IB3A 1S7RA 3L1OH 5BQ7B 4OI8A 2Z31B 3QH3A 5ACMA 3OXRA 5IM7A 1CFSB 5DO2D 3F7YA 3P0YL 3VH8G 3GK8L 4KRNA 4PG2A 2L0DA 2DLHA 3IJYB 2MKWA 3MFFB 2MCPH 2OR9L 1OM3H 3F6LA 1NKOA 3V79C 3KPSB 4OD1H 4O00A 1AHWA 2C7UB 4JO2H 4JQXC 4Y8AA 3RVWD 3TBVA 5F7DB 4M1GH 3C2AH 2R0ZL 4GOSA 1J5OH 3RX5A 1SJHB 3EO0B 4I0PC 4P5TD 1PYWB 1I3RB 2PETA 4KRPB 2BCKA 4DK6A 1GYAA 2NNAA 4C55A 3BXNA 2C5DC 5I73C 3LPFA 3HNVH 2KQNA 3NIGE 5IHUL 3DO7B 1QKZL 3IFNH 3ET9F 1NAMH 3V4PH 4PRBB 15C8L 3RY4A 4YHNB 5GGQL 1FLTX 1RZFL 1FORL 4Y2DB 3WO4C 1Q9KA 2YD6A 5AZ2H 4JPWL 4YDLC 1IGFL 4S10A 5D2NA 3HMWL 2VZUA 2BMKB 4Z7OF 5D8JL 2DWEA 1HNFA 4PG9B 2FIRT 1AO7A 2NY3D 2CLRB 1AY1H 4MA8L 3U6RB 3A0OA 5GGRA 5IBLC 3WSQH 3EYUH 3BQUA 3KWWA 1BD2B 4KC3B 2EE3A 3C5ZD 4NQCA 2WINB 3RPIA 3QXVA 4NQXA 3ILPB 1WAAE 3GI9H 3MRCB 5ESAB 4Z0XB 4V1DB 4DN3L 3OKEA 4TSAL 2O61B 5GS1C 3X13B 1EHXA 3PWNA 1OGAA 3BYTA 2NY2B 4FQ2L 3OAUH 3V4UH 5SWQA 2BNUB 2RCSL 4DFHA 1MFCL 4PP1D 2XTJC 2R0WL 5EFIA 3QHFL 5EZIL 1F4XL 3BKCH 3VH8A 3ARDC 5HYJD 1QZ1A