3KJ6H

Crystal structure of a methylated beta2 adrenergic receptor-fab complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
217
structure length
217
Chain Sequence
EVQLQQSGAELARPGASVKLSCKASGYIFTDYYINWVRQRTGQGFEWIGEIYPGSGNIDYNERFKDKATLTADKSSSTAYMQLSSLTSEDSAVYFCVRGFGYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSAVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Beta-2 adrenergic receptor
publication title Ligand-specific regulation of the extracellular surface of a G-protein-coupled receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2009-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kj6H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kj6H02
2NZIA 3HLAB 4HEPG 2R2EA 4EN3B 2JJWA 1L6XA 4KZDL 3T1WA 3FN0L 1BLNB 1J8HD 4PV8B 1EBPA 1G0XA 3K81A 3LH2H 4M61B 4QHLB 1CXLA 3P9LA 1YEGH 5JOPD 3GSWB 4TUJB 4JQXA 4NKQB 4G9DB 3CNKA 3UDWC 3LRSB 1RIVH 2GIYA 4MVBC 4Z0BH 1XGPB 2V2TA 5DUMH 4MD4B 5LBSL 3AS3A 4J6RL 1VFOA 4QTHA 4RA3A 4MQ7A 3BJ91 12E8L 4X8JA 5D2LE 3AXLB 3Q5YA 4FXKA 4PJXB 1U8IA 4Q74A 2EKSA 3BI9X 3WFDH 4XNZC 4E41B 1J10A 4G80A 3VXUE 1K4DA 1WWAX 2BSRB 5FUCC 4PBWD 4R26H 4NQDA 3MLVH 2G9HB 2LU4A 1WCQA 3QDGB 2NY4D 3DX7A 3RVTD 1A7NL 1X44A 3IXTA 1D6EB 2B8OT 4M6NL 5CJ8A 3RWGA 3GMOA 1I1AD 3KJ4B 4YHZH 2KBGA 4PRHD 5EBMA 5EWIH 1XR9A 3RHWK 3I3DA 4G6JH 4CMMB 1P4LA 4A6YB 2ZJSL 1KNOB 3O11B 3ZE2E 2A6JB 3VWJB 5AAMA 3OKOB 2MFNA 2BFVH 3RVUC 5F1OB 1NDMB 4UTAH 3F7QA 1NGWA 3ZT5A 5HVFB 4Z78A 1LEGB 3RY4A 2F8VA 1MRFL 3KPLA 3WV0A 2APWA 1DQDH 1KEML 1JGUL 3ARWA 3VXOA 2ADIA 4U1NA 4PS4H 3VXTA 3NN8B 3BKML 4IM8A 1TQBC 1DQJB 2ATKA 3GIVA 4XP9H 4OF0A 5GRJL 5JOFB 3MRQB 3QIBA 5H2BB 5MI0C 3NPSC 3IB4A 3FB6B 1WC7A 2W60B 3S97C 4NO3B 1T04B 5HVHB 4M62H 3DXAB 5SWSD 4ONOA 5IESH 2XRAH 4I1NB 4MNQD 4P99A 4G7VL 2P45B 1FL3B 4JANA 2V5TA 4WTZG 5D7JA 4P59L 4AZ8A 4NZTH 3FQWB 3MJ7A 3IU4L 1BVKB 4LQFL 4F8TA 4JPWL 4ZXBC 3MBEA 4HV8A 3IKCB 5CWSB 2GITB 4G3YL 1OSZB 1H15B 1ZEAL 2WIMA 3REVA 2B4CC 2V5RA 4K3DH 2OJZL 4YXHL 3OKLB 2HT4C 4ACPA 1JF1B 1T20B 3O3AB 2R0WH 1QPXA 5DUBB 1VEPA 4NCC1 5T3ZD 2F58H 3CFEB 4NPYA 4U2ZA 1GGIH 1U58A 4LKCB 4L4TD 5HBBA 3QJHB 2JF1A 3TIEA 2CQVA 4NQEB 1VGKB 4PJEE 3BEVB 1NGQH 1ZT1B 5H8DA 3CFBA 1JHKH 1UJTA 4MXVF 5FOJA 2UWEE 5ESVB 3QUZA 4PUBL 1CDCA 3MJGX 3OGOE 5ANMB 3ARBC 5DLML 4U0RB 1ZANH 3EDJA 4LF3B 1U41A 3OKKA 3L3KA 1DEEA 1IQDB 3NPZB 1YMMA 2VDQL 3N06B 4XH2A 2O5XH 2PUQT 5HYSA 1JZ6A 2CKBH 2BY2A 4MMZC 2HTLC 1JK8B 4JB9H 4WV1C 4X9FA 4WY7H 5D9SB 3IT8D 4HIJB 1UT9A 4RFOH 3C8DA 3QIUD 5I76B 5B4MC 4Z77A 4W68A 1CL7H 1FE8L 5TQ2L 2XWJA 1KCVL 2GKIA 4OQTA 3S37X 1CU4L 5D5ME 2I9LB 1PG7W 4IOFD 5E8PB 3B8SA 3TPKA 2YD8A 1HNGA 4I4WB 2DAVA 1MI5E 4R7NB 5IF0B 4EUPA 4DKFL 4WHTA 5TDPB 4U3HA 1KELL 3ARGD 1Z5LB 1AR1C 1UWGL 2ORBH 1MI5A 4G8EB 4JVUA 2C26A 4LMQI 3STZB 4P2RA 3S98A 1MEXH 4HZLB 5DK2B 4KV5E 4NGHL 4XCFL 3HG1B 4TNWF 4AYFA 3HZVA 3EYSH 4D9QD 1RMFL 2BNRB 2ZUYA 5F6IB 1QQDA 3PWUB 3RBGA 5I1AA 4XMLL 5HHOA 3TWCL 1LVEA 1NFIB 2W9EL 3C8KA 4P2OA 3OSKA 1TVBA 3PWJB 2X70A 3TVMC 3CSGA 1CGSH 3ARYA 3QIWD 2VQTA 3WNPA 4E5XB 1FO0L 4MJ5A 2IPUK 4ZS7H 5FGBA 2PETA 4U3XA 3TEUA 2R23A 3ILPA 3QISA 3P0YL 5IT2L 4X83A 4YBHA 1A2YA 3CLEL 5I8CA 4RIRA 3KHOA 2MCG1 3HE7D 4G8FA 4OZGB 4C55A 1A1NB 1F6AB 5B39G 1N4XL 3VH8A 5JDSB 1BVLB 4DVRL 3WIFB 2VLKA 5L2KA 5I8EB 3UZEA 1KTKE 2NX5E 3MFGB 4NWUL 5E8EA 1W0WB 1FFNB 3QB7C 4MD5A 2CK2A 1FDLH 4OFDA 1B0GB 4N68A 3UZVB 1FLRH 3UTPD 4XPTH 3RDTA 3FZUD 4ORZC 5FO7B 1UKQA 1WT5C 3MZTA 5DJCB 5EU6D 3FAWA 2H2PD 3E3QC 4QCIA 2E9WA 5BMFH 5F7EL 3MCLL 1ZVSB 4KMLB 2BOBA 5CIPA 4YDLB 5JW4R 5DHYA 2X4NB 3O3DA 5E2UL 1NFDB 5FKPB 3IJYB 4FNLL 5GSRB 2R29L 3MRMB 5CUSH 3RP1A 4EOWH 4TSBH 3RVWC 2AQ1A 2X4SA 4D0BB 2QQNH 4APQD 3R0NA 4QHNB 3TYGH 3O81A 5CEXB 1GGBL 2RCSH 4UNTA 4G9FA 4X7TB 4KRPD 4WGVB 2HH0L 4CVUA 1IAIH 1U92A 3W2DL 3WS3B 3FN3A 1RK0A 3ABZA 4ZPTB 5E5MB 1KC5H 1EGJH 4JFDE 3DURB 2BJMH 3WIIL 3MRNB 4L9LA 2DQCH 4N8VA 4X4YB 4HKXA 4UT7L 3HR5A 3RTQB 3DYMA 3QG6A 5DRNB 2G5RA 4S0SD 3BZ4B 1CE6B 4IRZL 5HGHA 5AG8A 1DDHA 2JB6B 3ES6A 4WO4D 2E9IA 4LLUB 4Z7UF 5ETUB 2A6KB 2NY5L 5F70A 2VXQH 4H5SB 3LS4L 1KPRA 3O6FC 4XC1L 3VE0B 4QF1A 4PJGB 3N1MC 3MRLB 1NCBH 1E6JL 2R0LL 1OAYH 2JCCB 1BQHB 4EI5A 5J6GA 3GUTB 1ZS8A 2B5IB 4D2NA 4GW4A 4CADB 4K71C 4R90H 2DLEA 3RIAK 2OLDA 4PJDB 1N3NB 5FUZH 2QSCH 2W0LA 4ZS6C 1J5OH 2VIRB 1R24B 4XX1E 4PJBE 4LHUG 3DVGB 3Q1SH 5DJXA 1B90A 5DQ9B 5HPMB 1I7ZA 4ESKA 1FFOA 4OB5L 2VO5A 4WCYH 4Z7QF 2W0FA 3HPLB 4MZ3A 3T65A 3M8OL 3VGHA 3SDDA 1PKQB 1HHHB 4P2QB 1A8JH 1T3FA 1Z3GH 3L6FA 4ENEC 3O9WA 4RAUB 2IPKB 3S36H 4F7CB 1BWWA 1TNNA 4XWGL 3LDBC 1SJVA 5KW9H 3UYRH 4X4XA 3TA3A 4M43H 1FPTL 3OHXA 5E1HB 3TN0D 2P49B 5I71C 2WUCH 1JGEA 4K55A 4RISL 4MA7H 5EU4B 3O2DA 3TBVA 4QY8B 1S7QB 3BKCH 2R1WA 5I1JH 5L9DL 1JZ4A 3WO4C 2DYPD 1A1OA 1ACZA 3GBLA 5BS0D 1Y6MR 1CG9B 3SDYL 2EO1A 4KK5D 5E9DE 1JGDA 4PGBA 2R9HC 4HGKC 3C60B 4NO0B 2X4PB 4MYWB 1YNLL 1AC6A 1QRNB 4K3EL 4L4VE 1KCSL 4LAJH 5IHZB 5FGCB 5JNYB 4YDKH 4X4MA 4S1QL 5HYIA 3VD4A 2X7LA 3GMLA 4ISVA 4GQ9H 2VITA 5DD3H 4YK4B 4OFIA 4MB5A 4JQVC 5DC4B 4I5BB 3GMNB 4WDIB 2IG2H 2OI9B 5K9OA 5CGYC 3TZVB 5GGRB 5GXBB 3D0LA 4JJ5A 2XQYG 4I77L 3CK0L 1F4XL 1HH6A 4GMSH 3RGVA 4KQ4H 4NKOB 2OL3A 2GJJA 1Q8MA 4NKMA 4P23A 1R3JA 1A4JB 1LEKA 2IF7A 3OJ2C 2E6JA 6FABH 2ZSWA 4B53A 4YGAB 1LNUA 3ARSA 3F6LA 3U1SH 1FZMB 3RNKA 2BXZA 3L95B 1F3DJ 3S37L 5JW4M 1W72A 1BREA 2IANE 4M1DL 2AK1H 2NPLX 2Y6SC 3DUHA 1XF4A 3VG9B 3MO1B 1UJ3C 3TO4C 5HGGS 3UPAA 1ZWIB 2IANA 1KPUA 1AHWB 5TE7H 1C08A 3TV3L 4HDIB 1P5UA 2BERA 1N5YH 4JFED 2AS5M 5I30L 1TLKA 3VI4F 4UBDC 1U8LA 5DZOA 1DVFC 4M7KL 2HFEB 4Z7WA 3QUXD 3W0WA 2MCPL 4W6YB 1NMAL 3B2VL 5ERWB 3VXNB 3ECBA 3LHPH 4TRPL 3O4LA 4N0UE 3DI2B 2BSTB 3RKDC 5DK0A 4YHLH 3HI5H 4HJJL 4N8CH 1A4KB 4CU8A 4PR5A 1KEGL 1D5BB 3J7HA 3MACH 4PRIA 4DVBA 2R1YA 4Q6YA 1Q0XL 2GJ6B 2JELL 2EC8A 4Q9RL 3DARA 3S5LB 1IGFL 5JDJA 1ERNA 1W2KT 2DQHL 3WLWC 2OTWB 5IBTL 4PJFE 4CJ0A 2V7HA 3GM8A 4L3CB 1GOGA 3ARPA 4UI2A 2A1WL 2IC2A 2RAMA 4PJFA 1X5ZA 1ED3A 1NGYB 4P5TB 3L7FA 4WU7A 3TBYA 3SGJC 4MXQD 4GW5A 3X13B 1NC2B 1P69B 3RVVD 1U0QA 2VJXA 5JHDD 4U6YB 3V4UH 4U1JA 3BGMB 1KJ3H 4RMUA 5GS0D 1VADB 5C7XH 1A0QH 4KXZI 2LTQB 2GI7A 3KLHC 4N1EA 1AY1L 3WKML 4AIOA 3BWAA 4P0DA 4G8GD 1A14H 2DBLH 4XHJC 1JI2A 4XPHL 5T3ZH 3L9RB 3H3BC 4YEEA 4JREB 2R8SL 4Z8FH 3R4DA 4P2CG 1IBGL 4R4BB 3BGFB 2JJSA 1PEWA 1RURL 5J7CC 4LK4A 2NNAA 3H0TB 4KK8C 1A64A 3MLRH 4YPJA 1BM3L 4M6AA 4S11A 4W70A 2HJLB 5LGHH 5FECA 3H9HB 4LBEB 4LAQH 1ACYH 1QSFA 4P5MA 3ZTJH 1CXHA 3D39A 5IJKC 2OZ4H 3MV8B 3UJTH 3FFCD 3JTTA 4LFHG 4EZMA 1S7UA 5ICYB 1BLNA 4PV8A 2ZUQC 5J1TC 5D7LB 1UZ6F 5ID1B 2ED7A 4DFIA 1KXTB 3MOBL 1YEFH 3TO2B 4ONHB 2UY6A 1H5BA 4TUJA 2OM5A 4XBGA 4EXPX 3LRSA 2D7PA 4MD4A 5CCKL 1Q9KB 1BIHA 1P4IH 4TSCH 4LLAA 3MMEB 5TDNB 1YDPB 4QOKB 3MOQA 2HRPL 1EO8H 4PGEA 5D2NE 5FYLD 1U6AL 3VFTA 4OZHE 2XWBB 4WFHD 1DFBH 4IRJD 4E41A 2I5YL 3BO8A 4NQSB 4J4PD 3GO1H 1N2RA 1K3IA 4EN3D 4DUWA 4BQBA 2G9HA 4OLZH 4ZOBA 2FEDD 3DLQR 3CH1B 1F3RB 3MBXH 3LEVL 4RWYH 5ISZE 4ZOCA 4HLZH 4QYOA 3TT1L 5ADPL 4CMMA 1GVIA 5FCUL 1JNNH 4G43B 4LLQB 4LNVA 1CYGA 1KNOA 2QL1A 5D1ZC 3SKOA 3VWJA 4YX2H 4Y4KD 3D3VB 1Z9SA 3IDIA 4GAYB 4ZNEA 4ONGL 1T1ZA 2BK8A 2VSCA 5LQBH 1A6PA 3EJZC 3QDGD 4HW6A 3VCLB 1JZ3A 1SHMA 2X4OB 4Y4HD 5FYJL 3RWFB 1I3GH 4L3EB 3O0RH 4RAVA 3AM8A 5DT1L 4JRYA 4X6BB 4LLYA 1DQJA 2EDFA 1A9BB 1BBDL 2NXZC 4FQ2L 4LHUD 5DHVB 1AFVL 2FZ3B 5DD5H 1J0YA 3NFNB 1F90H 5H2BA 4YBLC 5E8NB 2P46B 2WV3A 3MR9B 5CINL 2VDPH 4UTBH 5EIIA 3Q2CA 2E7BA 4WI7A 3DXAA 4L3AA 3WXVL 1E4XI 1CDGA 1VESA 2XA8H 3GMMB 1KN2L 2VZ1A 1FL3A 1CFNA 3WXWH 1RHFA 3FQWA 1DE4B 4LARL 1T2QH 1BVKA 1HSAB 5DVLA 1YEIL 4FFYH 4LSQL 4G6FD 5IQ7L 1CF8L 1EXUB 4JM2D 1RIHL 3C09C 2GITA 4KVCL 3B9KC 1RHHB 4QT5B 3BW9B 2GCYA 4OIAA 2VAAB 5I1KL 4LPUA 1XGQB 5DZNA 3FT2B 1JF1A 4BKLB 2FB4L 1YUHA 1M7DA 2EDQA 2P7TB 1OL0A 3IDGA 4NHCL 5DUBA 1U3ZA 2CKBA 4UAOB 3HC4L 3CFEA 1WF5A 4XP6L 1PEZA 1DN0A 4G6AD 4LCWE 4NQEA 4V1DE 3BEVA 2C1PA 3AMKA 1ZT1A 3BDBA 4YWGH 4NYLA 1DR9A 3P3YA 2P5EB 4V1DA 3QA3A 5ESVA 2J8UB 4I48B 2DLFH 1EHLH 5DD0L 1TZIA 2HT2D 2YBRA 1YN7B 1GXEA 3SCMC 3IS1X 5EBGA 3T0EC 4LVOC 4PJXF 3THML 4M5YH 3EDKA 2YPLB 3VGEA 1DBML 1FL5B 4G5ZL 5GGRY 3TBTB 5DUPL 3BP7B 5IP4A 4P9HC 1P7KA 2VLMD 5EZOL 1WFUA 3HR6A 4MS8C 1QO3A 5GJSH 4TTDC 4NO2A 5IB1A 4UU9B 5BRZD 3D85A 4YO0A 4LOUD 3V7MA 2NW3B 1KJ2B 1KYOJ 3NA9L 3G6JE 1LHZA 5E8PA 4MX7B 3VFMA 2ED8A 2ARJB 1HQ4B 3N85H 1V7MH 1INQB 2ZCKL 1P5VA 3K8LA 5F9DC 4PD4K 2SEBB 3ULUC 4IJ3B 3G6JA 5TDPA 4U1MA 3FONA 3SY0A 1MIML 1Z5LA 2DQJL 2WP3O 2CDGB 1FVDB 3KYKL 4G8EA 3W39B 5L88H 2Z4QA 2OL3L 1MAJA 2X4QA 5DK2A 4CVXB 4H0IA 3HFML 3RL1B 1ZHKB 5KSBB 5IMMA 4JM2F 3PQYE 3TFKC 3LMJL 3ELAT 3EOTL 1KJ2H 4YPGA 1PYWB 4H26A 5AUMA 2XN9B 4ZO8A 4X6DE 4KKCD 4EDXB 1UB5B 1W72L 1XAUA 3GIZL 5ALCL 5IG7A 4PLJC 2NQCA 4X6DA 1KV3A 1A3RL 4MAUH 3AREB 5DMIL 2Q7NA 2W9DL 4BFIB 4EBQH 3D9AL 5H37H 5E99H 4E9LA 1VFBA 3WJJA 3X11B 3HG1D 4Q58C 1YEKH 3UTQB 4UINL 3F7VB 1WTGT 2AXFA 4DQOL 2M8XA 1FH5H 4OZGA 3SQBA 4IS6A 4OM0L 4JZJA 3NIFE 3P4NA 2DWEB 2FJHB 1BVLA 3WIFA 2EC9U 1GGTA 3HKFA 5HI3C 3P73B 2HLFC 1T2JA 4H8WC 3SKMA 3A6BL 3BDXA 1W0WA 1EEQA 1FFNA 2XFXA 2XQBH 4LSTL 1DP0A 4BUHA 1RULH 4NKIH 1MWAB 1F6LL 3QXAA 3MNZB 5GS0L 1OTUC 2DTML 2WBJC 4LGPB 2QSQA 4P5KB 2QQLH 3IETA 5DJCA 1JBJA 2G75B 1FIGL 1Q1JL 3EGSA 2CIIB 3N1QC 1M7IB 4XNZB 3G6AA 2VN7A 3QRGH 1T7WA 1EGJA 3LPFA 4YGVA 4OD2A 1Q9WB 2X4NA 5AZ2L 4O51B 3HNVL 4KDWA 1RUML 4NJ9H 3NAAL 3UTTE 1TJIL 3K0WA 4RGNC 3B9EA 3OQ3B 5CD3B 5C9JB 4JEGB 4LNRA 1T7VA 5CEXA 1LDPL 1CLCA 1A7QH 4X7TA 1FV1B 1QPPA 4QXTA 4L29B 1EHNA 3QNYB 4BFBD 3WS3A 3O3EB 3T8XB 2X89A 1MRDH 5K93A 5E5MA 3PHQB 2BX5A 3BP6A 3BFOA 5I1IH 1F8TH 2XV6B 3MRNA 1DANU 5IB5B 4X4YA 1JCKA 1P1ZB 2G60H 3B5TA 3LPWA 5EC2B 1EIBA 5L6YH 2UUDH 5DRNA 3EDDA 5J06A 3IFOB 4UT9H 1CE6A 3H9ZA 2X05A 2ZG3A 1A9EB 1UZ8B 2D0FA 3LN4A 3QQ4B 1TQBB 4LLUA 1AKJD 5ETUA 1QG3A 2A6KA 2ZNXA 1NPUA 2DQEH 4H20H 4H5SA 2VR4A 4LFHD 3QWRD 4EDWL 1BJ1J 2FIKA 4PJGA 5MI0B 4Z76B 1T0MA 1YEGL 1INDH 4OGYH 2JCCA 1BQHA 5KAQG 1U8JB 4HXAL 3GUTA 1I85A 5C0ND 2FGWH 4PJDA 1JRHH 1ZGLP 3D2UB 1N3NA 4JDVB 4PJ8A 2AJYH 3NCCB 4R2GC 1MHHA 4JFFB 4K07A 1WIUA 1X6NA 3IU3B 1MCRA 3RTQD 4ZTPL 4Y8AA 3BZFA 4ZXBB 1CIDA 4Y1AB 1U3YA 3WFDL 2VTFA 1DBJL 5HPMA 3LEYH 1AO7B 1WBYB 1IQWH 1AGCA 4Q6IA 2PR4H 4GAJH 4R26L 5FM4A 3QFJB 3HPLA 3JWOH 4NZRH 1PKQA 5IBLD 2UVEA 3S96B 3LRHA 4YHZL 3T09A 1NC4D 2DF3A 4RAUA 5EWIL 1KB9K 1OOAA 4GRLD 4HUXB 5F6HI 4FS0A 4NKDB 1MLCB 3KYOB 5ACZA 2B39A 1C16B 4HCRA 1FN4B 3E6FB 4AG4L 1PKOA 3OGCA 3ZKMC 1VPOH 2PXYC 4QY8A 1S7QA 2OXHA 3ARBB 3V0AC 1R0AH 4UNUA 5DFWH 2VNCA 4BH8A 1DJSA 4HKJB 3QDJD 1J8HE 3DRTA 5E00A 1K2DA 3MXVH 1CG9A 1TPXC 1R3LA 1J8HA 3JWDC 4P2QD 2UYLA 2QADD 4NO0A 4A6YL 2DQUL 4XVSH 5I1EL 3SE3C 4OGXH 1NFDF 1QRNA 1LGVA 2D0HA 4HFUH 3GMPB 4LKXB 3UMTA 5KANI 4PJ7B 4YQXH 2ZUXA 2BHYA 2FDBP 5JNYA 1YEHH 3S36X 3HUJE 3VRIB 2YC1B 3FOMA 3OB8A 5IESL 1TTUA 1PW3A 4FQLL 5D6DC 1FCGA 3HUJA 4U2YA 2VDLH 3QEHA 2FD6L 1S7XB 3TZVA 1ZTXL 5M7QA 3RBSA 3D0VA 2AKRB 4PRHE 4M1CC 3C60D 2IFGA 4MCZB 5K9KB 4WU5B 1D5ZB 1OSPL 5F71A 1A4JA 4YIQB 4DK3A 4L8BB 1X5GA 2DJUA 2F58L 4LVHC 3IDYC 1RZ8A 3KPOB 3L95A 1PZUB 3ZL4H 3BH8A 2EXWC 4FFVC 3V6OC 3O2WH 4OUUB 1KN4H 3ZE1F 1LO4H 1FYTB 2JCCF 4WFFD 1IEBA 3GSXB 4PLKD 3KYNB 3MO1A 1LILA 1EJOL 1UWXK 1RSFA 3TVMB 1SVCP 1ZWIA 3RY6A 2YA1A 4GFTB 2AJVL 3DO3A 2O5YH 1PG7H 1ZANL 4WW2F 3FQNA 1CD9B 2D7QA 3QUYA 2P5WD 3O6KH 4A2MA 1V8HA 2JJTA 2I9TA 1S9YA 2NY1C 2BVOB 4XTRC 4XBEL 1S9XA 4JB9L 4ELMB 2AABL 2HFEA 5CP3H 5SWSE 5KBNC 3MLSH 5C9KA 2V9QA 4FQPA 4MNQE 1V3KA 4POZD 4Z95H 1HDMA 5C70A 2QEJA 1II4E 2ZCLL 1JN6B 5BCAA 3MA7B 1D3CA 4HEME 3U36A 3WS6C 2AJXL 4XP5H 1C7SA 1N64L 4TYUA 3MZGB 3P11L 1T89A 3U0WH 5INCA 4P46C 2D7NA 1G6RH 1H8OA 4JRXB 2VUYA 2KDGA 3HTLX 1NCDH 4OF3A 4Z7VE 5DEFB 2GJ6A 2IPTH 3JV5A 5T3ZE 2ORBL 3FN9A 4Z7VA 1YN6B 3FRUA 3EO9L 4OF5A 5GRVL 5CJOH 5CAYB 3WEXA 3EJJX 4XVJL 3NBNA 2K7PA 1J11A 2Z31C 4L4TE 2W9LA 1ZLVK 3FHAA 1MAML 1N6UA 3IXAA 4X98A 4X7FC 5DD1L 1R5VB 1Z9MA 4KJYB 1S78C 3L1OL 4HWBH 3SKNB 1ZHNB 3LKPA 3D87B 4FFWC 2PW1A 4OCMC 2H1PL 4D8PB 2ZWLT 4U6YA 3NGBC 3BGMA 1U8PB 5BVPH 1VADA 3C6LB 3STLB 1T21B 1CGSL 5F89A 2EYTB 2XZCL 5ESQA 1LO2H 1BWMA 1N5AA 1OW0A 2QQKH 1P6FA 3I9GL 2PW2B 3LKQA 2ZUVA 3ZMRA 5HHXH 3BPLB 2ZSVB 1IARB 4R4BA 5EOQH 1K4CB 5DFVD 4P5TD 4FMKA 2OZ4A 4CKVX 3GHEH 3QI9C 3QIUA 4GRWB 4YNYA 5IIEB 3VA2C 3W81A 3RVXD 3KPSE 2WSKA 3OJMB 1BFVL 1NC2D 1EZVY 4FG6C 3O6FB 1WAAE 4O2FA 2DLTA 2A6IA 4U4BA 5D8JL 3KPSA 4KTEL 3BIKB 4XVUD 5C0AD 4LBEA 2F74B 5FYKD 1EK3A 1FLRL 1WAAA 5T1LB 4HKZB 3UJIL 4ZD3H 4K71B 4KK9C 2M26A 4OFPA 3ARGA 1FL6B 1CGVA 2W92A 4HFWB 1G6VK 3OJVC 1QVOA 4XAKD 2D03L 4MB3A 5L7XH 2E8YA 5D7SL 5BMFL 4OZIF 1T22B 1FCCA 2CRYA 2XTJD 5ICYA 2OYPA 1JWUB 3BQUD 2B1HH 4NRYA 5LG1A 1NQBA 2VLLB 3ORJA 2DTSA 1FORH 5CMAB 3TO2A 3N1GC 4ONHA 4EOWL 2Y07H 1A6ZB 2EDNA 1MCNA 3UBXA 2FX8H 4MB4A 2AJSH 1MQKL 2AI0L 1YQ2A 2WQ8A 2WWMD 1QSZA 4JN2A 3O3BB 3LDBB 4JFPB 5I1HL 3PGCB 3MMEA 1IAIL 5TDNA 5AG9A 5IKCA 4Z7UE 3GJFB 2MQCA 4JHAL 5I71B 3EUUA 5GZOD 2XWBA 1NBZA 3MV8D 3HI1A 1ZHLA 2DQCL 3OAUL 3CCHB 2P8PB 1SYVA 1QKZH 1MFCH 4YHOL 1RZJC 3JUYA 5TJWK 1HZHH 1X9QA 1QACA 4FQHB 3UTPE 4I9WD 2ICWB 4G43A 4EXKA 2VXQL 3GJFH 5HI5C 1DQMH 5DR5L 4N8PA 4D3CH 4F7TA 5DVKA 2VAJA 1V7NL 2RJMA 4QOKD 5EU6E 2VDOH 1OAYL 2YA2A 4YUEH 1BAFL 3D3VA 1HHGB 4GAYA 4M9OA 2OTUB 1P84K 3QIBC 4MCYB 4EJ1C 5FIEA 4HWNA 1L6ZA 35C8H 1YPZB 1OPGH 3VCLA 4F2MB 5GISL 4WI2A 4X6CF 4NQCD 5K59F 1OGAD 3RWFA 4L3EA 1JWMA 4K9EC 5LWYH 4M1GH 3PWLB 5DURB 3UPRB 1GSMA 5SX5H 3UYOD 4XPFH 1A9BA 2YD3A 3WFEH 2H8PB 2A6DA 4NP4H 1FGNL 4X9GA 3NFNA 1OAQL 3MBEC 4F58H 5B38B 4ZG1A 3T2QA 1RZKL 4IDLA 4LRNH 3WUWA 5KJRL 4UMGA 3I02B 3S36L 5EULV 1LQSR 1W0VA 4M03A 4OCWL 3QQNA 3ZSTA 1UJ3B 1H3TA 2OR9H 4FFZH 4KZEL 1Z0NA 2YWZA 3Q6FB 3TO4B 3UO1H 4KDTA 1S5IL 3K7UA 1NLBL 1B2WL 3ZE0F 1RHHA 4QT5A 5I1GH 2VAAA 2C3HA 4KMTL 4P4KD 4R97B 1XGQA 1UXWB 1JP5A 3DUUB 3QUZC 4WO4A 2R4RH 4H25B 4QHMA 3C5ZA 1YNKL 5C2BL 2BP3A 4I13B 1BECA 1L0XA 5C0IA 4CNIB 5KN5B 4NOFA 5C0FA 5F1SA 1J1XH 1BEYL 3OR7B 4YC2C 2NY0C 5J1AA 4ZO7A 4HCRL 3ZKSD 4RX4A 2P5EA 5C3TA 2LVEA 5F96H 3GSUA 1OCWH 2PTTB 4PRNB 3GSVA 4JG0L 3BEWB 4LEXL 2J8UA 2BMKA 1A1MB 4PRPB 1IGYB 5IMKB 3FQXA 4WHDA 5D7IB 1YN7A 1GZQB 4IDJL 3V6ZA 3U7YH 4RRPA 3NFSH 1MELA 2V17L 3WL9A 2EYRA 4NIKB 2Z8SA 2DD8H 4NWTL 1JUFA 1UQSB 1Y6KR 4KY1L 3T4YA 1FL5A 5KAQF 1FNLA 3QDME 4OZFB 2XG4A 3TBTA 5F9JA 4PPTA 4QRRB 3BP7A 2BSSB 1MCPL 3QDMA 1F97A 3EFDL 6FABL 3U4EB 1L0QA 3FAXA 1YJDC 5JMOC 4U6VL 3U1SL 3S3SA 1EFQA 3KNBB 1KJ2A 4KUZL 3VI4E 1IC5L 3MLYH 4H1LG 4TVPD 4XGZB 5TH2B 4MX7A 1HQ4A 5HHVL 3LY6A 1INQA 3L3OA 4MLSA 2SEBA 4JO4L 3SJVD 2YHGA 5IVXB 3FB8B 1QTYT 2D2OA 1XIWA 2CDGA 1FVDA 3RNQB 4M93C 3W39A 5FO8B 4HGWB 2ZCHL 1N5YL 4YHIB 4CVXA 2P43B 4UB0L 1PY9A 1ZHKA 3TESA 4YBQC 5GRUH 1XGTB 5IFJB 4RZCB 3KR3L 3FTGB 1P2CB 3GMQB 3MODL 5A16B 1NCTA 1A7PH 5FGBC 5T33L 3NH7H 3RJDA 1FVEB 1TCRA 3ARVA 4UZGA 4YHMH 2PCPA 1TJHL 4M7LT 4HK3N 1INEL 4HT1H 1HXYB 5JQ6L 2DQIH 1CGYA 4X5XA 4DKEL 4YHKL 3Q3GA 4ODWB 5JXED 3IF1A 1ZV5A 2CK0H 4HK0B 4WTZA 1SBSL 4AH2B 2O61B 1U8QA 3RDTC 1MFAL 5CBAB 1S7TB 2EE6A 2DWEA 2KZWA 2XN9D 1OQOA 4XNYH 2FBJH 1JFQL 1G7PB 2ZUQB 2CDEA 4NRZB 4BQ6A 3MLWL 5JPMB 4ZFZB 3ZT6A 5CSBA 1HILA 3ARED 3HNSH 2DL2A 1AQDB 4QXUL 5C0GB 1JTPA 1MWAA 1NCNA 3U46B 3ZYZA 4EVNB 5JIIA 4JFEE 4TVSa 3VA6A 1OAZL 3R1GH 4K3HA 1UM4L 5GGQH 1KACB 1A0QL 3SGEI 2G75A 4M6MH 4HIXH 2AEPL 2COQA 1MUJB 1M7IA 3L3JB 4K8RD 5DQJA 2ZUTA 2HLAA 1LK3H 3CH8A 4JKLA 1UM6L 4P49A 3IDNA 4Z8FL 3TIDB 3VFGH 1N7MH 2IAMD 2P44B 3FRPG 2BNUB 4JZNB 5E08L 4MJID 5CD3A 1N8ZB 5TF1H 3RWHB 4L9LC 1V3JA 5GRWA 4MVBD 3AMLA 3OPZH 4HX1B 1I8KB 1DBBH 1IGMH 1FC1A 3QNYA 5LGHL 5FYKL 3RWDB 3OR6A 5JW3H 5D1ZB 1C7TA 4RQQB 3PHQA 2KPNA 1R3HA 3UTZB 2Q3ZA 4LAQL 2EECA 4ERSH 1ACYL 2DLIA 5EU3B 3Q5TA 5EC2A 2NXYD 4M7ZC 4EI5C 4MDIB 3GNMH 4M6OH 1A9EA 2N4IA 4HXBL 4JY6A 5KSBF 3QUMB 4UOW0 1NLDH 2NXZB 2ICWJ 1R5IA 1ZHBA 3NACH 1MCJA 4F9LA 4YBLB 2R4SL 4Z76A 1B4JH 2OR7A 5E4EC 1IM9B 2DLHA 3RVUD 3WIHL 4FOMA 4LIQL 3SDDC 4JDVA 3VFPA 2KL6A 5BJTB 1OLZA 2X6MA 1HKLH 1XT5A 1EO8L 32C2B 3IU3A 3MREB 4AIXA 4ZXBA 5GS2D 1CFQA 3C09B 1WBYA 3B9KB 3KPRA 2CJUL 3H3PH 3SOBH 5IB2A 4MDJB 3ZDZF 3MBXL 2LAGB 5IBUB 3NZHH 5BV7C 1CDBA 2IBGA 4NKDA 4QRUA 3KYOA 3D2UD 4Y2OA 2DIBA 3CFJA 3E6FA 3I3EA 4KI5E 2VMFA 1BVZA 4Y1AD 5EFIB 1G9ML 4Y5VC 3F65A 3HS0A 3ROOB 3M45A 1AO7D 5GGUA 5KVDH 1MCDA 5B38G 2I24N 3SCMB 3QFJD 5LQBL 1IAIM 3T0EB 4LVOB 4PRDA 2HT4D 1I3GL 1R5WA 3O0RL 3P77B 1RJZB 3ZT7A 2RGSA 2EDKA 4WW1B 3B5GA 3TJHC 2X4UB 3S6CA 3GMPA 4LKXA 5HGBA 4PJ7A 2J5LC 4XZUB 4K94L 1LP9B 4PLOB 4XRCA 4Y0GA 3MRPA 5FYLE 4E0RB 2LVCA 2D31B 1N6QL 3VRIA 2YC1A 1BP3B 4WEMB 3KPQB 4P23C 4ZSOB 1OM3H 3VFOA 5IB4B 5DD6B 1GAFH 3IJSA 3BKJL 3WXWL 4IRJA 1NBVH 1T2QL 3HA0A 5JPNA 1RZIA 2ESVB 3BN3B 5IFAH 2AKRA 3PWVB 3VXRD 2HTLD 1NSNH 4R0LA 5K9KA 1IJ9A 4WU5A 1L7TL 4UIKH 5GRZA 3OZ9H 4ZO9A 4CMHC 2H2SC 3ZYOA 2J2ZA 2VH5H 4OCSH 4YIQA 3U0PA 5B4MD 3NTCH 4IEFB 4IMKA 3VFNA 3G5YB 4PJXE 5SWZB 7FABH 1VEOA 5C86A 1DBKL 5CP3A 1KTRL 4YWGL 3T1FA 1BD2B 2J6EL 3BWUC 4OUUA 3ULUH 4QRTB 1FYTA 5FOBB 4Y19B 3GSXA 2RIKA 3QDGE 3SPVA 2F19H 2NY6C 1A6WH 2ATPA 5E2TH 1BZ9B 2YK1H 5CD5C 2LQRA 4WUUD 2AJZB 2HYMA 1EHLL 1BQLH 3RWJB 1CXIA 2IBBA 1SEQH 1CICD 4MA3B 1KYOK 5MP6H 2JK5A 3HB3C 2XZAL 3KXFD 4PJCB 4BSWA 5IEKB 2BVOA 4M5YL 3VWKD 4X5WB 2FO4A 4ELMA 1MCHA 1S7SB 3GZKA 4KK6D 3CC5B 1CXEA 1JN6A 5EUOA 5JLZB 3EYUH 2YZ8A 3DSFL 2FL5A 4LSSH 4PJ5B 3TVMD 4GBXD 4AIZA 4PTTB 2R56L 3RGHA 4NT6B 5TDOA 1J0JA 4HWBA 4XC3H 2WBJB 4FXGB 3JV4A 4P3CH 4UDTB 1N59B 4WI5A 5C09B 1PY4A 1NCAH 3G08A 3IAGC 1ODAA 1QFWH 4S1RL 2EDRA 3JUZA 1PG7X 2IQ9H 1YN6A 5L88L 1G1YA 1PX3A 3EAKA 2K1MA 1IGJB 2ADFL 4KWUA 3PDOB 5T5FH 1ZAGA 4HK3J 1I8MB 4M5ZH 2XT1B 4XP1H 5JW4N 1DLFL 3MFFB 4RGNB 2E3VA 1KJ2L 1WEJH 1RU9H 1R5VA 3HZYB 1SEBB 1G0YR 5GHWH 2H6PB 2QLVB 1C1EH 1MJ8H 3D48R 4LSUH 2AJUH 2YA0A 3F8UB 4JRXD 1WQVT 2JJSC 5C71A 2ZUUA 1HNFA 4F37F 5JUEH 3QNZB 4MAUL 4C56B 5JORB 2GSGB 3C6LA 1MHPH 5FF6A 5EO9A 1JIBA 4NNPH 3ARFD 2EZ0C 2W65B 5HDQL 3F12B 2PW2A 4ODBD 2VLME 2H9GB 4HH9B 1HHKB 3HCVB 5D70H 3ARXA 3VFUB 4N90D 1K4CA 1FG9C 1K5NB 3KLAA 2V5MA 5BRZE 3IGAA 3RVWD 3CLFH 4YXKL 3WBDA 5IIEA 3MRBB 4AT6A 4BSVB 1XF3A 1KBGL 2NR6D 2P8MA 4HJGA 4LCCA 3G6DL 2WUBL 4NM8L 1KTLB 2VDML 4CDHA 1KCUL 4LCUB 5D1XD 4WIQA 3HRPA 4HKZA 5IR1B 3INUH 3FO2B 2XKNA 1S9KC 5FV1L 3SDCC 1H5BC 2UVFA 3EOAA 4R2GB 1CFTB 1A6AA 3DETC 3MLZL 1L0YA 1T22A 4I0PA 1GCFA 5J4MA 2EH8H 3TC9A 4H88H 1C5CH 1FZJB 3JSSA 1YQVH 3O6FD 3V52L 2EIZA 2BSED 2IGFL 3KPTA 5F7DB 4ELMF 3RZCA 3NABH 4ZUSA 1NGPL 1KTDA 1J1OL 1X4ZA 1MWAL 4LPTA 5D2NC 4F7EA 1B0RA 2HJKB 3SE9L 1AGEB 1GIGH 3K2UH 1NKOA 5T1LD 4JFPA 5FA3B 1XF2B 4TULL 5HGDB 3F6IA 3GJFA 4ZS6D 4Y16D 1IGIH 3NOIA 5DS8B 1ND0B 1MRDL 1M71A 1AD9B 4O2CB 3C2AH 4LLVB 3T77B 5DMGC 2PXYB 5I1IL 3PJSB 1F8TL 4C54A 1KCKA 1WZ1L 2EDBA 5F8RC 2HG5A 2EE2A 1JF5A 2G60L 4DZ8B 4BH7A 1DSFH 4S1SL 1TPXB 4FZ8L 1NBYB 1WISA 5K9QI 3RUGB 5GPRA 4OGAC 4FQXC 4ENED 2D9CA 3PIQB 1X5IA 4NNYA 2FHBA 3AS2A 5GIRB 2RFXA 5LXGH 2YMXH 4G8IA 3RQ3A 3AM8C 2NTFB 4OGYL 3LCYA 3NCJH 3LN5A 3FCTB 4NC2B 3K8KA 4MCYA 5IBUG 4L8DA 3WUZA 1YPZA 3EYOA 3X12A 2CH8A 3GHBL 3MGOB 5EBLB 4F2MA 1M05B 3V5HB 1T1WB 1OP5K 3CAFA 2R9HD 4DZBA 5B8CA 3LEYL 2XY2A 3UPRA 3BPNC 5T3XL 4GAJL 4HUUB 2V2WB 1Z9LA 3PWNA 1MHEB 1JV5B 2H8PA 2VDNL 2BNQE 3JWOL 4RGMC 3V0VB 2FX7H 2JB5H 3AS1A 3UTSB 4GRWF 4ZTOL 2BNQA 4LVHB 5DEGB 2X1OA 3I02A 3IDYB 1XCTB 3MRFB 5TGBB 3RU8L 4BZ2H 1FNHA 3DVNA 2UY7A 4M3KB 5TPWL 3QUKA 1T5WB 3KJ6L 5GGTH 1E27A 4XPAL 3Q6FA 4KPHH 5KSUB 5EORH 2OBGA 4KC3B 3ARDD 1Q0YH 1VPOL 1NCCH 2B4CL 4MA8H 4GW1B 4PY7A 2GTZB 3T0XA 1UXWA 5SX4I 1S8DB 4H25A 1AKJA 2NY1B 3CU7A 3MV9B 3WNKA 3L3HB 3CJJA 4ZDHA 3V4PL 4CNIA 1FAKT 4QRSB 1T66C 5KN5A 1ZK9A 5C0DB 3VFVB 4RMRA 5C0BE 2VB5A 2R2HB 3VD5A 3CU1A 4TPRL 2IADA 3N1FC 2AXHA 5C0BA 1NAMH 4MA1C 4PJIB 3ULVH 3TO4D 1TVHB 2A9MH 1FC2D 1X5XA 1FQ9C 1TJGH 3L3DB 4P46B 1IGYA 4IMLB 5IMKA 5C3LD 3KLDA 1GZQA 3CDGB 2EIBA 5DGQA 4UOJA 4YFDB 3ZKNC 1XGRB 2VDLL 3MSPA 4OKVB 2EDJA 5HHNA 1KLGB 5JR1H 1UACH 1UA6H 1UQSA 2E5EA 4UBDD 1OY3B 4QWWC 1F11B 2X9XA 1DVFD 3DVIA 2Z31B 3BMVA 4QRRA 2BSSA 4OSUH 3TCXA 2DQGH 2L7UA 2YRZA 5T5NF 4ZQKB 3U4EA 3CFCH 1GJIA 1OP3K 5BZWB 3KNBA 1IAII 3HMXH 5HD8D 4PRPD 2IPUG 3EYFB 3WN5A 3QDJE 5TH2A 4WENB 4HULB 1HWHB 3CVHB 3NGBB 1LO4L 4LSRL 1JNHA 2DI7A 4F8QA 1EJ6A 1TTFA 2YD1A 3V7AG 5KS9E 3FO1B 4MLIA 4P2QE 3RNQA 2O5YL 4X7SH 1PG7L 2EYSB 4KROD 4HGWA 5KS9A 1YPZF 3JVGC 3QRFM 1HH9B 3GB7B 5IFJA 4RZCA 2BOCA 5MEPA 3R06B 3VXME 1P2CA 2Z93A 4ZUWA 5M95B 2W38A 5ELIA 4LU5H 3QI9B 1IFHL 5DJZA 5HJ3B 4I3SH 2AK4B 3WJJC 3MLSL 1ULVA 3OF6D 2VKXA 1EUTA 3VXMA 4NHUB 1CTOA 4UIMA 4NRXB 5I0ZA 4I0CC 5DJ2A 3OKDA 2R2EB 4XP5L 3E6HB 2ITDB 3BIBX 4JZJC 5HDLA 4Y4FC 3KLHD 5EZJA 4ODWA 4XHJD 1F6FB 3CVIH 1NCDL 3OB0K 2WLZA 1AXSB 2FWOB 5IJKA 4GLRI 3A6CH 3H3KA 2O61A 4ETQA 3L5HA 5HHME 5CBAA 4GXVH 4QTHB 4MQ7B 2ZG1A 1G7PA 4X8JB 4JN1H 4KK8D 4NRZA 1L4IA 4WWKA 3P30H 2R15A 1E6OL 3A67H 4C83A 2EKSB 1QA9B 1K4DB 2VZUA 5C6WH 5D2LB 1SY6L 2QV2A 4YDLC 2OK0H 2VLJD 2IFFH 1CBVH 5C0GA 1J1PH 2HKFH 3VXUB 1NEZG 1AXTL 3OX8B 4EVNA 2P5WE 3P4OA 1X6LA 4U33A 5CKGA 3GDBA 4JPIA 1XR9B 2P8LB 4XMPL 1P4LB 3KPMA 4DGVL 5KVGL 1MUJA 4OD3L 1HINL 5D7IF 1BQUA 1KXQE 5EOCH 5HHXL 4I3GA 2BNUA 1P7QD 1RUAH 1EV2E 4G7YH 1NGWB 4Y5YC 4Z78B 2NZ9D 4MMXC 3GHEL 3FFDA 3QFDB 5T1DH 1FBIH 4HUWB 3KPLB 3EYQC 5CJ5A 4JDZB 3EO1B 1P4BH 4OZIE 5KVFL 4LGSB 5E70A 1FZKB 3CXDL 3RWDA 2ADIB 3KDMA 1J7VR 1I9JL 3VXTB 5D1ZA 2CUMA 2OP4L 4XCEA 4XWOC 3EJYC 5E6YA 1EX0A 4ZD3L 4LPCA 3QIBB 1A3LL 5I1CH 1WC7B 3QHTC 3MX0A 1AH1A 5E2WH 3GM0A 5IVXF 2CUIA 5L7XL 4OCRH 4ZUVB 2YPVL 3QCVL 4WNQA 2BRRH 4PJ8C 4X8XA 4JANB 4XP4H 1MVFA 4LRIA 1MCEA 1BOYA 2HTKC 3NIDF 4HPYH 4J7RA 3MJ7B 2B1HL 4M4RA 1QNZL 3MBEB 5ITBH 4BFEA 1I3RA 1YC8A 1AXIB 1IAMA 5FUOL 2FX8L 3X14A 2ILLA 4JCMA 4Q6IC 4KVNH 4M4PA 1N26A 3CMOH 1WBZB 3MRKA 4H1LH 3PP3H 5L8KB 2FJFB 5BJTA 3IFLL 1FJ1A 1A6VH 32C2A 4K9EH 4NPYB 2KUTA 3VXSD 2Z8RA 1QYGL 4RMQA 1YZZA 1JPTH 3CFBB 1XEDA 3MNWA 2IMNA 4JKMA 1T80A 5AZEH 4TUKH 1ZLSH 2CGRL 2NXZD 4GKSB 1XH3A 1QKZL 1RZ7H 4MQXD 4PJEB 2GY5A 3QUZB 2QHRH 3ZO0A 3FO0H 2DMCA 4HAGA 2R69H 4X6FB 3QCTL 2UWEB 5C0AE 1IM9D 3OKKB 2A74A 3BYTA 1LE9B 1YMMB 3RL2A 4X6CE 4AMKH 3UXFA 1X5YA 4YC2B 1DQML 2NY0B 5HYSB 1FG2B 5IV2A 1IM3A 1CLYL 1WBXB 4N0FA 5DMJB 5C07D 4WEBH 4OF8A 2VDOL 2EEAA 5ITFA 4K3JH 1JF6A 5EFIA 2XTJE 1CFBA 3B9KD 5I1DA 4Z77B 4ODHL 1OPGL 3T0EA 1J0ZA 2CRIA 1M7XA 5HPOA 3P77A 4KRMB 5LWYL 4M1GL 2Z35A 3UROR 2GEEA 2X4UA 3KYAA 5D5MB 4EUPB 1HSBA 5EG6C 4JO2L 1F02I 4WHTB 3TZVC 2WQRA 1EMTL 4MJ4A 2YUXA 4UV7H 1BJ8A 4P9MH 1MI5B 1MNUL 1LP9A 3QNXB 4LRNL 2ZOKA 2NY4C 3WYRA 3RVTC 4E0RA 1B3JA 2D31A 3DV6A 3KPQA 1FRGH 4ZSOA 4K7PY 2BY0A 4MZ2A 3HZVB 5DD6A 5KANG 5FKAB 3SCMD 1FNEA 4JY4A 5I1AB 1LO0H 1S7VB 1TDQA 5EZIH 4MJ6A 3PWVA 1HHJA 4M93B 5CSGA 3GBNH 5I9QC 4HIHA 4I9WE 4X6EA 5CHNA 1ZSDB 2X70B 3SGKA 4Y5XA 2FRGP 1AGDA 4QOKE 3T3ME 1OWRM 3G5YA 4MJ5B 4S2SA 5SWZA 3QUYC 4ZFGH 4NO5B 1KFAL 3UC0L 2R23B 4Z7OE 2JJTC 1A2YB 1J18A 5I8CB 4RIRB 4QRTA 1ORQA 3BE1H 4Q9QL 1EFXB 4Y19A 5JHLH 3P0VL 4LVNC 1BZ9A 4NQCE 1OGAE 2ESVD 2YS4A 1MRCL 2FLRT 1F13A 1MJ7L 3VH8B 4NZUH 3WFHB 4UDUA 4OCYL 2VL5A 4OM1H 3RX7A 4MA3A 4NCC2 2ED9A 3T2NL 5KSVA 4MD5B 3MA9L 2JIXB 3H7LA 1ITCA 4X5WA 3TFKD 1KJVB 3T4AA 3RDTB 4HMCA 2PF6A 4XB8A 2DS4A 2CDFA 2XKSA 3CGTA 5JLZA 3HNTH 4QCIB 4GG6E 3I3BA 3V5KA 4EI6A 3HI6H 1EEYB 5DHYB 3O3DB 4PTTA 5I16B 4GOSA 4JFYA 4GG6A 4NT6A 5TE6L 5TE4H 5TF0A 2GK2A 4FXGA 2CMRH 1X7QB 4G6KH 4UDTA 2VABB 1BZ7B 2DKUA 1BFTA 4KHTH 2X4SB 3CZJA 1SJHA 4LPYA 4ETYA 2LABA 3L3GB 4BK4A 2R0ZL 4XNUL 3ZHKA 1KIPB 4G9FB 1GOFA 4FABH 4GAFB 3PHSA 1EEZA 4WI8A 3UBXI 1U92B 1G7IB 1I8MA 5EOCJ 5HY9A 2H3NA 4UUJA 2BHZA 3MFFA 4XXDB 3LIZH 5MEQB 5F97E 5D93C 4ZFOA 3GFUA 5HHPB 1SEBA 2EC9T 3KPNA 4L9LB 3NH7L 4N8VB 4PJ5D 4HKXB 1UWEH 3HR5B 4JFDB 1IMHC 2VXSL 3LKOB 3QG6B 2XQYK 1OTUD 2QJDA 1GHFL 5HGHB 3FL7A 2WBJD 3B6SB 3QNZA 4C56A 5C09D 4F7MB 5JORA 2GSGA 3QIUC 4JQIH 3ES6B 4HT1L 4NM4L 2DQIL 5IVZA 4XCNB 4MHHI 1PLGL 3S35H 5FB8B 4PG9A 1CDYA 1KPRB 4QF1B 3DGGA 3F12A 3GI9H 4IOFC 1X5HA 4HH9A 5E0QA 5J11C 4M7ZB 4EI5B 5DFTA 1K5NA 1ZS8B 4ZODA 1U8OA 4GW4B 4HJ0D 3ARGC 1MJJA 1S5HA 3MXWL 1JNLH 3MRBA 4JY5L 2FBJL 4BSVA 4PBVC 4TVPE 5C0JA 1IRAY 4O58H 4KUCD 4PB0H 4FZEH 4KGLA 5DJXB 1BF2A 3SJVE 5E4EB 5GGVY 2RHEA 1I4FB 4DAGL 4LCUA 2XY1A 4XCCL 2W0FB 2F15A 5IR1A 3U7WL 3FO2A 5KSAA 3SDDB 2VLRD 2J3SA 5AYUH 5BXFB 3R1GL 4U0QB 5INDA 5DDHB 3BHBA 1MCKA 5C08D 5EPMB 1CLOL 1DANT 5BW7C 4K7FA 1UADC 2VN4A 5B3JF 3B3IB 1H8SA 3F58H 3K8MA 5HYQB 3QYCA 3VFGL 1N7ML 4PJCF 3DROB 2K3TA 1G7LA 2F5BL 1JGEB 2EH7H 4MAYA 2R2BA 3TBVB 3L5IA 4MWFB 3RWEA 5BV7B 1AGEA 3L3IA 2H32H 4JHWL 1MH5B 3OPZL 4NN5C 4OV5B 2ADJB 1MCOL 4LSVH 1GC1H 1IGML 3AU1A 4PGBB 2R1XB 5SX5K 5JW3L 2HWZH 4RBPH 5DS8A 1ND0A 4WHYH 1F4WH 4LLVA 5E9DB 2HN7B 5CGTA 3PJSA 4Y5VB 1EPFA 4ERSL 4XAWL 4FQJH 3MV01 1D9KD 4XPBH 4WI6A 4JPKL 1JGVL 4ORGB 3FZUC 4L4VB 4YHPA 2WLYA 3ARQA 3GMLB 4JKWA 2XKUA 1BZQK 3GNML 4TNVK 1CD8A 5BV7H 5J6HB 1UCBL 1PX4A 3RUGA 2H2PC 1EH9A 1NLDL 5JO5A 3PIQA 1JPFA 4UQ2A 1OLLA 3L5XH 5K9OB 3GI8H 3GSNH 1QSED 2Y06H 3D0LB 3FMGH 2J5LB 4JJ5B 1B4JL 3MQIA 1F2QA 2NTFA 2RQ8A 1QR4A 1V5JA 4XBPA 4AY0A 3V79C 5IMLA 5GJTH 4NKMB 4P23B 2PXYD 3S88H 4KUCF 5C0RL 1GPOH 4KRPC 2ZSWB 1LNUB 2BRQA 3WSQH 5EBLA 3V5HA 4OAWB 1YY8B 2DM4A 5GGTA 4MJIE 3QHZL 3QUML 5HYSG 1J9CT 2IAMA 4AM0A 1W72B 3H42L 2P1YA 4LDEB 2FR4A 3LVEA 4HUUA 5J3HC 4DGIH 1XF4B 1E4WH 4CMHB 1MHEA 1JV5A 3ESUF 4MJIA 3SOBL 5LJYH 3QG7H 3V0VA 1LK2B 4KDTC 2IANB 1KPUB 4HG4K 3OWEA 3SKJH 1C08B 5CILH 5DEGA 4X0KB 2MWCA 4R3SA 3MLUH 4WO4C 3V6OA 5KTEH 3C5ZC 3CFDB 3EYVB 3PWPE 4QRPE 3ZDXE 4UAOC 1ONQB 3QHFH 2NY6B 4Z7WB 1CD1A 3PWPA 5LVEA 4QRPA 1NAMA 4PD4J 4FQ1H 1OT2A 4M1CD 4QTIL 5DJ6B 1OARH 4GW1A 3QQ9C 4JG1L 2GTZA 2Z92A 3RIAF 4JDTL 4OFYD 5L8LB 2PO6A 1JPSH 5DK0B 4JZOA 4JKKA 3OG6B 1KULA 4PR5B 1MAKA 4WUKL 1K6QH 2EXWD 4FFVD 3LKRA 3AROA 4NQTA 1IC7L 3QAZC 1R3IL 2ADGA 2NY7H 3BD5A 2APVA 1G9NH 1TVHA 2V7HB 5DRZA 2AVGA 4TN9A 3L3DA 4P46A 2VDKL 3ZDYE 4IMLA 2J8HA 3BZEA 1T1XB 4PJFB 1KJMA 3IVKA 1ED3B 3JTSA 1XGRA 43CAA 3U2SA 2V6HA 3L7FB 4WU7B 2NY1D 3MV9D 3OBAA 4XTRD 5EOTA 1O5DT 3DECA 5TFSH 2KH2B 4P9HL 4U1JB 4Y89A 4ELKB 3V6FA 2Q6WA 2VH5L 1XIWC 2B1AH 4PYHA 3BWAB 4ZQKA 2DWDA 2XICA 3D1MC 4DKDC 4ZNCD 1Q38A 3ULSA 5BZWA 4Y1AE 3WDIA 3ULUL 4D9LH 4CUCA 2NNAB 3TH3T 2GJZB 1SJEA 1YYML 5I18H 1I7TB 4NCDA 2VQ1A 3CPLA 2EYSA 3IFNL 4LDOB 4OIIH 4O4YH 1I9RH 4AJ0A 2Z31D 3ISWA 2F9BT 5E8OA 1OAXH 15C8H 2XZZA 5E56A 2IBZX 5FECB 2V9TA 1MSPA 5DXWA 3R06A 4KKBC 2GTWB 3IAQA 4DCQA 2AK4A 3SO5A 1DQTA 1ZT7A 4NHUA 3LB6D 3QDHA 3JTTB 3MRDA 4ZAKA 1S7UB 2X44D 2ITDA 3E6HA 3MUGB 3NFPB 1YYLH 5LCVL 3VXRE 1IGCH 1A7RH 1OTTD 3MV7D 2ZKHL 3SDCB 1H5BB 4JFZH 3BSZH 4OLVH 1AXSA 4LLMA 2FWOA 4XBGB 4B41A 3KPPB 4FQIH 2VXVL 3QI9D 4UT6H 2P24A 5KZCB 5CZXC 3SDXE 4H8WL 4PGEB 5JW5B 1Y6NR 3CX5K 4R4FL 3VFTB 2HVJA 4JRWA 1QA9A 3BO8B 4RAHA 1RU9L 5D2LA 2DOCA 3DMMA 5D2NB 1N2RB 4IIQC 4WUUE 4OZHB 4YAQA 1UYWL 2JKXA 2O93L 1KPVB 3RY5A 3VXUA 2AJUL 3OX8A 2BY1A 2ID5A 4KK9D 3QUXC 3HC0A 2NYYC 3PNWA 5JUEL 1JYXA 4PJIF 4QYOB 3KXFE 4PJ9A 1E4XH 1J0IA 2P8LA 3I2CH 2OSLA 5ISZB 3CDYA 1YNTA 3KXFA 1G7QA 1AJ7H 2NCMA 5I66A 4GUPA 5DVNA 3SKOB 4HWUA 2DDQL 4OJFH 1M6OA 3MRJA 1MREL 1C12A 3IDIB 5CEZH 4HBCH 2BDNH 1T1ZB 3C5JA 4FQXB 3PGFL 3QFDA 4R7DA 3S34H 4O9HL 4HUWA 4NQDD 3QULB 1JJUA 4JPVH 1KB9J 4JDZA 4HUVB 4O2EA 3EO1A 4GBXA 1FZKA 3LZFH 4RAVB 2IJ0C 2O5ZH 3DSNA 4JRYB 5AD0A 1CK0H 1F4YL 2JJUA 2F54D 4LLYB 3SDAA 3SE8L 4IRSB 1CFSA 1I7UA 5I2IB 1QHOA 1YEJH 3DRQA 4F9LC 3A0OA 1HCFX 1YECL 4H1LA 4OLWL 4ODVH 2N7BA 3JWOC 4XHQA 5EIIB 2ARWA 3DX8B 1QR1A 4D9RE 4EIZC 1VGEL 3RVVC 4YEFA 3O2VH 1MCQA 2HP4A 4ZUVA 1RUPL 1KIUA 1FVCA 3BPNB 4KKLC 4Y2DA 4HF5L 1CFNB 3LQZB 4OCXH 1C5CL 4JRXE 1U3HA 4RGMB 4G6MH 4LMQE 1OAKL 1YQVL 4KZDH 5EB9A 2W0PA 1T6VN 4J1UB 4C58B 3UPCA 3V0WL 2BVUA 1HIMH 1Z9OA 2GCYB 2DI9A 3BOVA 1WBZA 1GIGL 2R0KL 3W9EA 3VW3H 4PGCB 2BVTA 3FB7B 1YUHB 1M7DB 2FJFA 3IDGB 4BA8A 3RPIA 1T0NA 2CKBB 1L7IH 3AS0A 3GRWA 4J6RH 1HKFA 1DN0B 1MFDL 2C1PB 2G2RB 1EO7A 4NYLB 5D7JD 4GJTB 4R96B 3QBTB 4GKSA 4V1DB 3QA3B 1DSFL 4PJEA 3MBED 5SV3A 5MERA 4X6FA 4AEHL 2UWEA 1TZIB 4OIBA 2YBRB 4KI5C 2JE8A 1A7NH 1LE9A 2V2XB 1OF2A 1ZVHA 2VWEE 3WHXB 2YMXL 1TZHB 1FG2A 1O7VA 1WBXA 1QBML 3RX5A 2HFFB 4NBXB 4MA1B 2ZJSH 1TZGL 1LDSA 4JFXA 4JKPL 1KGCE 1P7KB 4OQ1A 4GRWE 2OQJB 1QO3B 5C0EA 1BHGA 2ICES 4NO2B 5IB1B 2WM0A 1DQLH 1WZLA 1I7RA 1EHXA 3DBXB 3D85B 4YO0B 3JWDL 3QUZD 4CVZA 5H94B 4MNGE 2CXGA 1U42A 3VFMB 3QH3B 4IRJC 1KEMH 1ZA6A 1JGUH 3MUY1 5D5MA 1YMMD 4GKOA 4K2UL 1IEHA 4J4PC 3G6JB 3BKMH 1T1YA 4MNGA 5HXMA 4U1MB 3FONB 3SY0B 2JB5L 1LO3H 3QNXA 4NC1E 2Z4QB 2FEDC 5F72S 3E8UL 4NUGH 4R0LC 5GRJH 2X4QB 1J88A 4KRNA 2C1OB 2CO7B 2B2XH 5IMMB 5CEYA 5FKAA 2FCBA 4F57H 2NW2B 4IMKC 4WJ5B 4YPGB 4H26B 1ETZA 1F58L 5AUMB 1S7VA 1CDHA 4KPHL 5C8JB 4ZUUB 1Q0YL 3PQYB 3F5WA 1XCQB 5IG7B 4Y4KC 1PDKA 4JPWH 4X6DB 3LS5L 1UEYA 1ZSDA 4K7PL 3I6GA 1CWVA 4G3YH 4DOHE 3H9SE 3HMWH 3QO1B 2OJZH 2GFBA 4P2RD 1EERB 4Y4HC 1LEIB 1A3QA 2ICEA 4NO5A 1VFBB 4HGMA 3H9SA 2ZP0T 2AXFB 2CRMA 1EFXA 4HIIA 3VFSB 4IS6B 1OD7A 1RFDL 3BD4A 4JZJB 3ULVL 3P4NB 2A9ML 4Y4FB 2AEIT 2FECL 3PL6B 4U31A 5HHOD 5GS1A 3WFHA 2IQAA 4M48H 4P2OD 4R8WL 4PUBH 3SKMB 4KDVA 1WV7T 4M8VA 5DLMH 2XFXB 4LP4A 1ZVYA 2NX5A 2JIXA 1UACL 4PG2A 3C87A 3QXAB 1KJVA 5EO1B 2XACC 4B50A 1D6VH 3IETB 5C6TH 5DO2D 1I9IH 1OQXA 4JHBA 3EGSB 5C0CE 2UWEF 3BAEH 3G6AB 2BVQB 4HS3A 4KHXH 1EEYA 4YGVB 4OD2B 4ZYKA 5I16A 4DJMA 2VLKD 5C0CA 5L2KD 4OCNC 1FE8H 2DM2A 5TQ2H 1X7QA 4NUJB 2VABA 1BZ7A 1CU4H 4LNRB 4JM4L 1H0DB 4JVWA 3L3GA 3UTTB 2I07B 1S3KL 1KIPA 1NFKA 3RDTD 2GUOA 3HAEB 4QXTB 2X4TA 4XCYA 3MJ9L 1KELH 1G7IA 1UWGH 3C6LC 1Q9OB 2X41A 4HD9A 3BP6B 1IAOA 4XXDA 4NGHH 5MEQA 1Z2KA 5F7YC 4Y5YB 5HHPA 1VFAA 3DNKA 4LU5L 4ZUTA 5D5MF 1UEMA 3C6SB 3BUTA 1RMFH 1A47A 3CVHL 5HSFA 4JFDA 3BPLC 3LKOA 3U48A 4XB7A 5GRXG 5CJBA 4WFGD 4XMLH 3B6SA 2AV7A 3TWCH 4F7MA 3LN4B 2W9EH 3HAEH 3T2PA 4XCNA 4RWHA 5FB8A 4G9FD 4XI5D 4LCCC 2BCKA 4I2XE 1TENA 4KV5F 2FIKB 1T0MB 5E7BA 4F9PA 1OB1B 3AUVA 3FB5B 4I2XA 2ICWI 1QSVA 3JV6A 2E6PA 1K85A 4M00A 4NN6C 4PJ8B 4ZFFB 3CLEH 2EE9A 1HK6A 5F88B 4GXVL 1EHAA 1MHHB 4KGJA 3VGDA 2DKMA 2A9NL 4B0MM 1NBQA 2NY2C 3BZFB 2VKWA 5M94B 1N4XH 3GK8H 4DVRH 3OMZA 4PJBA 4I0PC 4J3TA 4KKNA 2MHAA 4OGZA 5FYJD 1I4FA 4NWUH 1AGCB 4Q6IB 1GL4B 4POYA 3V4VL 4DTGH 4KKCC 25C8H 2H32A 5BXFA 5DDHA 3RZCC 1P84J 2E7CA 5EPMA 3RJQB 4W81A 1YEEH 4QXGL 4EI5D 1CR9L 3S35X 3OJDA 5DK3A 2Q87A 3B3IA 1AGBA 5ACZB 5HYQA 5EOCL 5GGVL 1JMXA 4RA0C 1CGXA 3MCLH 1NUDA 3DROA 3QZWB 2B20A 3OGCB 1RUAL 1U8HB 4G7YL 5IWLA 4MWFA 5CS7A 1QFWM 2XWTB 4BH8B 4I18C 3W11C 3DRTB 5T1DL 4DW2L 5E00B 1FGVL 1MF2H 1K2DB 1MH5A 4OV5A 2F53E 2ADJA 4DN4L 3SDDD 1R3LB 2R1XA 4M7JL 1J8HB 1GGBH 2UYLB 4ZMAT 1WIPA 3O9WD 5D72H 2F53A 2HH0H 5E9DA 2HN7A 5J12C 3W2DH 4Y5VA 5D7KD 2JLLA 3TA3D 5IEHA 4ORGA 1RZJL 5E2WL 4L4VA 3WIIH 2DQDL 2VE6A 3TJEL 3FOMB 4U7KA 5J6HA 4UT7H 1IZJA 4J8RA 4LGRB 3E2HC 2VLJE 4PB9H 3HUJB 4IRZH 4YZFE 3QEHB 1ADQA 2E7LA 3D0VB 5B8CC 5K9QG 2NY5H 2ZNWA 2NY4B 3HC3L 3X3FL 3LS4H 1A5FH 4XC1H 4KVNL 3CFIC 3MRHB 4PRHB 1NL0L 2R0LH 1U93A 4FQQA 2DM3A 4K9EL 1JHLL 2A77L 1JYWA 4OAWA 1T2XA 1RZ8B 1YY8A 2VC2H 3BH8B 2B0SH 2P42B 1JPTL 5DWUL 1QFUH 5I9QB 1IEBB 1ZLSL 1LK2A 2Q8BL 3CFKA 3FO0L 3PV6B 5E5UB 3FQNB 4M9PA 3M8OH 4X0KA 3QUYB 3RGVD 4JLRA 4R97C 3O8XA 4DUVA 4OI8A 4P23D 5J89A 4OLXL 2I9TB 1S9YB 3CFDA 1RZGB 3EYVA 4Z0XA 3WD5H 3GRWL 1S9XB 3OXSA 4XWGH 3U7AA 4WEBL 2YN5A 1ONQA 2DLGA 4LVNB 5HYEA 4B5EA 4K3JL 1FPTH 3GSOB 3NCYP 1HDMB 4KFZC 5DJ6A 4JR9H 2FHCA 5SWSB 5SWQA 5F9OL 3U36B 5L9DH 2M1KA 3EZ8A 4N0UA 3VD7A 1BOGB 4LDLB 5INCB 2XPGB 4TQEL 2AGJH 3SDYH 1AQKH 1ZA3B 5D96C 1MJUH 4Z9KB 2GAZA 2FIRT 4Z7VB 3FRUB 4K3EH 2WAHA 1KCSH 3WEXB 4LSPL 2NY6D 5IBLC 1RY7B 3VXSE 3W0WD 4PREA 1AP2A 1LWRA 5CD5D 5CZKA 1T7YA 1IT9H 3CIQA 4S1QH 3SEPA 1T1XA 3IXAB 4GRLC 4X98B 4WGWB 3O4LD 4L4TB 4OQTL 5BZDA 2ZPKL 4WW2C 5I8KL 1DN2A 3LKPB 4KJPD 3WN5C 2X4RA 2PW1B 4CN4A 3MRGB 3MC0A 4PRID 1S7WA 4KTYA 4YDIL 4ELKA 3IAPA 2PYED 1XR8A 1T5XB 5F89B 5GZND 1F4XH 1X5AA 1YJDL 5D71L 5C07E 5ESQB 5D93B 1MPAH 1N5AB 5GS3A 1OP9A 4PRAB 2D7TH 1E4KC 1X5LA 3LKQB 5C07A 3BP5B 2QADC 4JO1H 2W0KA 5I19L 1LE5A 4Z7NE 4J3OC 2GJZA 1MCLA 3QIUB 4YNYB 1QEWA 1IKFL 3P4MB 4NZUL 1I7TA 1J05A 3S4SA 3ALPA 1XZ0A 4O2FB 2A6IB 5F3HA 3KPSB 1CGUA 5CKAA 1I1FA 5J11B 3TV3H 1U2HA 3U0TA 2P47B 2LAAA 2HAZA 4YHNA 1HQRA 2GTWA 5I30H 3PUCA 3ARGB 3VGBA 2Y72A 3BP4A 1ZE3C 2I27N 2VXTH 3CDCA 4ZOEA 1QVOB 4M7KH 1NCWH 3B4NA 4LQ1A 2MCPH 2FEEL 8FABB 1RZFL 3B2VH 3MUGA 4TRPH 3NFPA 4YXLL 4NRYB 4K23H 4WWKC 2GYSA 3O6LH 1PZ5B 2Y36H 2CMRL 2EZ0D 2C4XA 1TFHA 3SDCA 2VXUL 3UBXB 4KH2A 4L8SA 43C9A 4Z7WF 4N9GA 2EDHA 5F9AC 4TOYL 3SGDI 3C08L 3M1BA 4JN2B 2CKNA 4PLKC 5E6IA 1MQ8A 1Q0XH 2JELH 3KPPA 2DQTL 4FABL 1IGTA 4Q9RH 3QIWB 1QSFD 5IKCB 1F42A 3I50L 3B8YA 3KS0H 4JFQB 3D39D 3VGAC 5JW5A 2DQHH 5I0DA 5CEZE 1U8NA 1NBZB 3HI1B 1F4AA 4ODSH 3ZYJA 4N0CC 2A1WH 1ZHLB 5D2NA 2J88L 1FFPB 2KZ1B 4OZHA 3MJ8A 1SYVB 1BQHG 1KPVA 5C2UB 4NN5B 3L7EA 4GT7A 5ICZB 5LGJA 4POZC 4QRQA 4JQIL 5MHSD 5ISZA 1LMKA 3DETD 4PJFF 3MJ6A 4UOW1 2HMIC 3MLXL 4F7TB 3U9UB 1AY1H 3WKMH 5KZCD 2F5AL 4U1IB 1MFEL 4XPHH 3Q6GL 1DUZA 3PP3K 2H26A 1G7HA 4E41D 5EU6B 3PV7A 2X42A 4ALAL 3RWIA 1IBGH 4FQXA 3PF2A 5FK9B 3QULA 4C59B 5K9JH 4HUVA 4DK6A 1WCBB 1JWMB 2KQNA 3IDJA 4FZEL 4PB0L 5CZVL 1K9TA 3HE6A 2X1QA 1UH2A 4LRIC 4PJCE 1BM3H 4PJAE 4IRSA 5I2IA 2A6DB 3A6OA 4UILH 3VJ6A 4OLYL 5E95B 3V7AE 3RI5K 4PJHE 3DX8A 2EXYC 3WUWB 5BQ7B 4KRPB 3VWJD 3DX9B 5E2VL 2HKHL 3U9PH 2IALA 3LV3B 1W0VB 2OXGA 3D69A 4PJHA 4G42A 4WFEE 3QEQE 1NMCC 3LQZA 2C3GA 2FLBT 3NZ8A 2EH7L 1RUKH 3QEQA 1CTNA 5EO0A 4CN1A 4OT1H 5EBWB 1YC7A 4J3WA 4J1UA 4YDJA 3EW3B 4JRYD 2XOTA 5DFVC 3MOBH 1N6VA 5T1KA 4PGCA 4S10A 3FB7A 4OTXH 1CZ8L 1CDJA 4PFEA 3C5ZB 4LSVL 4QHMB 4WO4B 3ROLB 3BDYH 3RVXC 1RUQH 2GQHA 5C0IB 3FT3A 5CCKH 3DXAD 5C0FB 1NANH 1OP5H 5IHBA 2G2RA 5J1AB 1JZ5A 3RIFF 3Q0HA 3EKCA 3U4BL 3SBWA 4R96A 4J3UA 4XPBL 4LCWA 3O2DL 3GSUB 1S7RA 5A1AA 3GSVB 2C4FT 5BV7L 2BMKB 3DVFA 3FQXB 1HOCA 1W0YT 4OD1H 5IGXL 3O41B 1EVTC 3V6ZB 2A38A 3LEVH 5JZ7C 3WL9B 2V2XA 2EYRB 3L5XL 3KWWB 2VLRE 3TT1H 2Y06L 3WHXA 3FMGL 1TZHA 5ADPH 3T4YB 1JUFB 3QAZB 5C08E 2V7NB 1ES0A 5FCUH 4PV9A 3VI3E 3FQRB 3LSOB 3IJHB 2HFFA 2BC4A 3S3PA 2CXKA 5F9JB 5CJXA 5C08A 2HA1A 4NQED 3S88L 3QDMB 2OQJA 1NEZA 1QFWI 1G9EA 1GOHA 1GPOL 2FSEB 3QO0A 3DBXA 4ONGH 2ZG2A 1D5IL 3IDUA 2EDYA 4RNRA 4V1DD 5E03A 4BQ9A 1T83C 5H94A 2PKDA 1UB6A 4JGJA 2IMMA 3KGRA 1ADQL 1RAMA 2OCFD 3QH3A 5FYJH 3L3OB 5TQ0H 2QHLA 1XIWB 2DYPB 1BBDH 2RBLA 4FQ2H 4FTVE 1AFVH 3G9AB 3U83A 1OTSD 5CINH 1WJ3A 5D1QA 3SGKC 1AIFA 2C1OA 4FTVA 2HVKB 4TTGA 4Y5XC 3WDJA 5HYJE 3WXVH 4HKBA 4DN3L 2DI8A 2NW2A 4WJ5A 3ZKND 4F15C 3QHFL 3D85D 5C8JA 2D7MA 4ZUUA 1D9KA 1IEAA 5HYJA 3PQYA 3G5VB 4OLUL 1XCQA 4LARH 3T3PE 1TCRB 2DB8A 2Q3AA 3QP3A 3QPQD 4QWWD 5IQ9A 2WANA 1J0HA 4LSQH 3S5LG 1H3UA 2PCPB 5FYJU 1SQ2N 1CF8H 3FOLA 5CSZA 3GSQA 3WLBA 3JVGA 1RIHH 1QSEE 4KVCH 3SGEH 5FV2A 4M7LL 4X5XB 3Q3GB 5I1KH 5MENE 3QO1A 5E5RB 3IF1B 2Y5TB 3CDFA 1ZGLB 1LEIA 2YOCA 2L0DA 3BH9A 3QWOB 1OP3H 2FB4H 4NHCH 1S9WA 4HWZA 4LASL 3HC4H 5MENA 4MSWA 3MNVA 1RJYB 2CSPA 1KIQA 1U8QB 3OKNA 3RA7L 4PRBA 1DL7L 5ALBL 3VFSA 2BNRD 5JW4Q 3H8NA 4Y4FA 3DHJA 3PL6A 2CDEB 3LRGA 5E8DL 5DJ0B 2NY3C 5I15L 5DA0B 2YWYA 1HILB 1JYVA 1PD6A 1OGTA 5DD0H 4GRMB 1KLUB 4XPGL 5DVOA 3QJFB 5EO1A 2N56A 3ZTJG 3MRCA 3LKNA 2HT3C 4OKDA 3THMH 3QXVA 1DBMH 4G5ZH 3IDXL 1V05A 4JFEB 1SM3L 3KS0J 2B1AL 4Y7MA 4P4KC 5DQJB 4FQCL 2HLAB 5EZLA 2BVQA 1HWGB 3CUPB 5EZOH 3IDNB 1JZ7A 3QSKB 4IIQB 2YSSA 4UQ3B 2K7QA 2DMKA 5DTFB 3W9DA 3QUXB 1G1CA 4NUJA 4HWEH 3GKWL 3NA9H 5ESAA 3OB0H 3QQ3A 1MFBL 1H0DA 3UTTA 2I07A 4JHZA 5IHUL 2ZCKH 3P9MB 5FA4B 5IFHL 3PDDA 4HC1H 3HAEA 4YE4H 4OIIL 1MIMH 1K8IB 2DQJH 1URLA 5I73C 3OR6B 2G5BB 1Q9OA 1OAXL 4U6HB 2UZIL 1R3HB 3VMNA 1KOAA 3HFMH 5F3BA 4Y5YA 5JIKA 1NEUA 6CGTA 1AI1L 3C6SA 3UBXG 3LMJH 3G6JF 3EOTH 4MXWL 4ZPVA 4EQ2A 1BGXL 1UGNA 3QEGL 3GIZH 5ALCH 4OI9A 3B2UC 4JY6B 4Q9CA 4LVEA 5LKNA 1A3RH 1R5IB 1DEDA 3LH2L 1ZHBB 5DMIH 3IKKA 2W9DH 4KQ3H 3D9AH 1OB1A 3BSZL 4OLVL 2FJGB 5HHQB 3FB5A 2X89D 1RIVL 4Z0BL 3CSBA 5DUML 5DRXB 4MHHG 4GO6B 5FDYA 5KSAC 4X6DF 4ZFFA 4YR6B 3VFPB 4UINH 3BISA 1R3KB 3DV4A 5F88A 3VFRB 4RBPK 2ZOLB 2H45A 1DQQB 5JXAH 3EYQD 4OM0H 5I1LA 1JWSA 5L0QC 1CFQB 1F3JB 3BESR 5DJAA 3KPRB 4WRLA 4XWOD 1RK1A 3U4AA 3EJYD 3A6BH 3MLVL 1VACB 3U30C 5IB2B 3RPKA 3I6LD 4OZGF 4MAYC 4QKXB 4PGDB 5GS0H 1KUMA 2DTMH 4G6JL 5B39B 1O0VA 4N5EC 1MOEA 4QRUB 4TSAH 9CGTA 4PJ8D 1FIGH 1Q1JH 3KAAA 1DUYA 3ZKQD 2HTKD 3CFJB 1VFUA 2BFVL 3QZWA 3JV0A 3WFBH 5AZ2H 4UTAL 1U8HA 3HS0B 2BDNL 1FNGA 3HNVH 1RUMH 2XWTA 5GGUB 4HH8A 1HYSC 3F7PC 3S34L 1TJIH 3GKZA 1WITA 2LU7A 4CW1B 4JPVL 3MV7E 3ZHDA 5J1SC 4PRDB 5JOPE 1DQDL 1R5WB 4XVTH 3LZFL 4U1KB 2O5ZL 4PS4L 1LDPH 2FECI 1CK0L 5F8QC 3C5SA 4PP2B 2QR0A 1EEUA 3NCEB 5D4QA 4XP9L 3UAJD 5HGBB 4ODVL 1ZXQA 4XRCB 1JTTA 3MRPB 4M62L 3GJEB 2XRAL 3VFOB 2YUWA 3IJSB 3LKSA 4NZTL 4IRJB 4K8RC 4MD0A 1F5WA 5JPNB 1RZIB 1C5DA 4KJQD 5MEOB 3DUSB 3HZMA 4G6ML 1IE5A 4MXVE 4LHQB 2IAMC 1GGCH 4NO0D 4QEGA 4R0LB 1HIML 1RV6X 4EDWH 1I1AA 2GK0A 3MRHA 4PRHA 3VW3L 4K3DL 1QRND 4RFEB 3BN9C 3W82A 4HXAH 3U0PB 2R0WL 1N0XH 4X9HA 5SV4A 1L7IL 5EA0H 3VFNB 4Q9BA 1GGIL 1KENH 4RRPG 5CP7B 5FYLH 3U6RA 5J8OA 3AB0C 2EDXA 1CS6A 5DJDA 2A83A 4LCIH 1MCWW 1NGQL 4GAGH 4HMDA 4MQTB 4PJGF 4Y4KB 3T1FB 4ZTPH 3U79A 1JHKL 1Q94B 4GMTH 4J3VA 4NQDE 3WHE1 3SPVB 2L4OA 1DBJH 1BMGA 4OFKA 1VENA 2ATPB 5J9PA 3TZVD 3ILQC 4PJDF 3BX7C 2NXYC 2NLJA 3ULVC 2F54E 3PV6A 2WMPA 4Y4HB 1G6RB 2XNAA 2O5XL 2PO6C 1T7ZA 1E4JA 4RDQF 2JK5B 2F54A 1VA9A 1RZGA 1CFVH 2CKBL 4BSWB 3PHOB 4LHUB 4X4ZA 2FO4B 4WY7L 4XNQA 2WINB 3BPCB 3EO0A 5KVMC 1A6UH 3GSOA 4RFOL 4AG4H 4P2YA 1X5KA 5EUOB 5SWSA 1G7MA 1T03H 3MRIA 1DQLL 4NQXA 1H3VA 1CL7L 4MNQA 2FL5B 3DX6B 5H37G 5HI4D 1Z6JT 4AIZB 1BOGA 2XPGA 4RMSA 5TDOB 2APXA 4G6FB 3JV4B 4GKZA 3QUYD 4JM2B 1CIUA 1ZA3A 2WNGA 1A7BA 3G08B 4RSVA 5F9WC 2DQUH 4A6YH 5I1EH 4NQUA 1AD0B 1LO3L 1P6AB 3K1KC 4IHOB 4NUGL 1MEXL 1CDIA 4HIEA 4EKXA 2B2XL 3EYSL 1A7OH 4L4TA 4F57L 4FQLH 1UFUA 5F1NB 1EAPB 1TQCC 2FD6H 3MRGA 1UC6A 2IH3A 4PTUB 1UVQA 1ZTXH 2GJ6D 1T5XA 4FN0A 5FF6B 5EO9B 3HMWL 1OSPH 3HUJF 3HHRB 4ZS7L 4PRAA 5I17A 3BP5A 4U3CA 1U8KA 3TBWA 5IOPA 3K1DA 4J3XA 3KLAB 3IGAB 3CXHJ 2I26N 3G04B 1W8OA 3P4MA 1OHQA 4AT6B 1XF3B 2DIJA 5BRZB 4M48L 2P8MB 4HJGB 3EFFA 1EJOH 4LCCB 3EOYG 4ZAKC 5DJ8B 1YMME 2AJVH 1FDLL 1TTGA 3K2MC 1BFOA 4W4OA 4XPTL 2XKNB 5GSVA 4NN6B 1I1YB 1D6VL 4XBEH 3EOAB 1N0LA 2EDOA 5C6TL 1I9IL 1BPVA 1JZ2A 1A6AB 2AABH 2NY2B 4GQPH 4D9QE 3AAZB 3BAEL 8FABA 1MCBA 4I0PB 4KHXL 4ZOAA 2ZCLH 5JA8B 2DQFA 1BX2B 3LAFA 2AJXH 1N64H 1PZ5A 1BF8A 1WTLA 5CUSL 3P11H 2EIZB 4TSBL 2LU3A 3RZCB 4ZUSB 3KPSD 5DSCB 1KTDB 2QQNL 4F7EB 3DMMC 1B0RB 3TYGL 5BW7A 2RCSL 4P2RE 3IFPA 1DCLA 1FZOA 4U1HA 3QIWA 3MUJA 5AWNH 4JFQA 5IM7B 4JFHD 3EO9H 4PJ9C 3RFZC 1M71B 1KC5L 4WWID 4XVJH 1CICC 1EGJL 4Z7UA 2BJML 4XT1C 5A3ID 1FFPA 1I8IB 1MAMH 2YEZA 4I18B 5HHOE 3HE7A 3VWKC 2HG5B 4BH7B 5I74C 5D7LD 2J8OA 5DD1H 1F3DH 5ICZA 4R4ND 4Z7VF 4KK6C 4PY8J 2FH8A 3L1OH 2AJ3A 2Z8VC 3SKUD 4NN7C 2H1PH 5EU7E 4LEOB 5J12B 4NNYB 2RFXB 4G8IB 4GBXC 3U9UA 5C6PB 3IRZA 4Z7QE 1IKNA 2XZCH 4QGYA 5E1AB 1NCBL 8CGTA 3SDAC 4U1IA 3LN9A 2J12B 1ZT4A 3VRJB 3HZKA 3LN5B 3I9GH 5H35A 4R90L 5EU6A 3E2HB 5FUZL 2QSCL 1J5OL 4L8DB 3KG5A 5FK9A 5EU5B 2VLKE 4XMKH 5L2KE 4NQVB 5SX4H 2V5YA 3EYOB 4LSDA 3X12B 3X17A 4CDGC 2OR8A 1WCBA 2Y5EA 1J87A 3GK8L 3Q1SL 4DZBB 5B8CB 5IW6A 1BFVH 4Y2DC 4WCYL 3PWNB 3K4AA 5D8JH 4KTEH 1U3HC 4APQA 2VUOA 2Q20A 4DTGL 3PGDA 25C8L 1YY9C 1IILE 1YMHA 3UJIH 5BQ7A 1Z3GL 2BNQB 3DX9A 2CUHA 4YFEA 1YEEL 3LV3A 3D3VD 3DVNB 5KW9L 2PN5A 3UYRL 2R2CA 2D03H 4M43L 5D7SH 3QUKB 3ARFC 1E27B 2WUCL 2JJVA 4WFGE 1WAAF 4N9OB 1S9VA 1R6VA 4MA7L 1RJCA 4L3ED 5EBWA 3BKCL 5I1JL 4O02H 1DZBA 4PY7B 1HXMB 1MF2L 4G9FE 1AKJB 1MQKH 3ROLA 2AI0H 1UENA 2NR6C 3TT3H 4ZDHB 5I1HH 5D72L 1TNMA 2Y1VA 4JHAH 4LHJB 4J3SA 4HZAA 5D1XC 3UCRA 2IADB 5J3HD 2A0LC 4YDKL 3ESVF 2VWEC 5C0BB 3F7RA 4GQ9L 5DD3L 3OAUH 4BFGA 5BO1H 5FYJE 4WTXA 5GQBA 1NGZA 1P53A 3QCUH 4YHOH 4PB9L 3O41A 4P3WA 4W6XB 5F7KC 1ROWA 2IG2L 3BVNA 5HHNB 2BZDA 2FEEI 3KWWA 5D96B 5I6XC 4A2LA 5I75C 3C5ZD 5EUKB 2V7NA 3FQRA 3LSOA 3IJHA 5DR5H 1A5FL 2LV4A 4GMSL 4KQ4L 2N1KA 2C9AA 5J57B 1V7NH 1NC4B 1TITA 4GRLB 4RX4D 3QQ9D 1BAFH 1AE6H 4U6TA 2P5ED 4ODTH 2FSEA 2YN3A 4F80A 1IAKA 4TUOB 4WW2B 4N0YH 2VC2L 4Y16C 4NC1C 3TN0A 3JBG7 4WHCA 3WN5B 2B0SL 5GISH 2AK1L 1QFUL 2OTPA 1JNHB 5BS0E 3OV6A 4GLRH 3QDJB 4U1LB 1QBBA 2DYPA 3M07A 2N7AA 2YPLD 5BS0A 5TE7L 1FGNH 1OAQH 5KS9B 2DL9A 1RZKH 1LD9B 5D7KE 2QADB 2HVKA 5KJRH 3QDMD 1XMWA 2BOCB 3WD5L 5MEPB 1L9MA 5EIVA 2Z93B 4ZUWB 4HLJA 1QOKA 2CLVB 4OCWH 5DJZB 4N5UA 4LPXA 3G5VA 3VXMB 1JE6A 5HGAA 4UIMB 3LHPL 5DI8A 4KZEH 4JR9L 1JPST 1WICA 1S5IH 3DOSA 5DJ2B 3OKDB 1NLBH 1B2WH 4YHLL 3HI5L 2E9JA 5GS1C 4N8CL 4YDVB 1XIWD 5EZJB 4KMTH 1C5BH 2AGJL 2Y5TA 3MACL 1ZGLA 1YNKH 1AQKL 3QWOA 3S9DB 4M02A 5C2BH 2WBWB 1BIIA 1MJUL 1RJYA 5EN2A 1TETH 4PG2C 3RRQA 3REWB 4ETQB 3FHQA 1BEYH 4X4ME 4HCRH 1CI5A 1Y0LB 4KKAC 5DC9B 3NCMA 4WWKB 3EIFA 5HHMB 1IT9L 5DJ0A 4C83B 4JG0H 3F62A 4LEXH