3KJ6L

Crystal structure of a methylated beta2 adrenergic receptor-fab complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFIGTGSGQDYSLTISSLDYADMGIYYCLQYDEFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2 adrenergic receptor
publication title Ligand-specific regulation of the extracellular surface of a G-protein-coupled receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 43
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2009-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kj6L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kj6L01
4NHUA 1IBGL 3ULSA 3MNVB 1U8QB 5E99L 2A6DB 5EOTA 2I60L 4O2FA 1G6RH 1T22B 4NFCA 5KVDL 1P5VA 1AP2B 4X7EC 5I2IB 4OLVL 3T4YB 3UZQA 3FQUB 2KQMA 3EO1B 5DT1L 5FB8A 5KVGL 1I3VA 4NBYB 2D7TH 4ZYKB 3VWJC 4APQC 2W60B 3V5KA 1FP5A 4WFHE 5KSBE 1CT8A 3X12A 3SJVA 5D1ZA 3NFNA 2QKIB 3S88L 1ZGLP 2XNAA 5D7IF 5D7LE 5BRZD 3VMNA 4R96A 3D3VB 4JO4L 1LO3H 4PLOB 4NN5B 3MLYL 1ZVYA 1I3GL 4YEFA 4PV8A 4YAQB 1R24B 3MV7A 5E2JA 4QRPA 1FV1A 4CU6A 1CDIA 3TYFB 4ODVH 3PDDA 4BELD 3OAYH 4MX7B 4L8SA 1L7IH 3EYOA 3BKYH 4OZIE 1S5IL 1G7LA 5J4MA 4U05A 3OKDB 3WHXA 3DOSA 4I48B 4LVEA 3QB7C 5E4EC 1J1XL 4JR9L 3ZDZE 1TVBA 4LLYA 2EE6A 4WJ5A 4UQ3A 5EBGA 3LPFA 4KJPC 3O3AB 1BVLA 4HJJH 5ACZA 4U49A 4HGMA 4UZGA 4I18A 5EUKB 4BSWA 1RFDH 2XG4A 2Z92B 4XNYL 1HQRB 3CVHH 5E5RB 2HLAB 4GAFB 1YN6A 4W81A 3QHTC 3FQRB 4KI1A 3O8XB 4QHNA 3WIFB 2MPAH 4HMCA 2A1WL 4IIQA 4NQDE 1RZJL 4WHYH 1W0VB 4AENA 4EI5B 1ORSA 5KSAB 4NQXB 1DBKL 5GZND 2QQNH 3K4AA 4CVZB 4N0YH 1QG3A 5D9SB 4OM0L 3EIFA 3QUXA 4KQ3H 5F7EL 3AREB 1T83C 3D39D 1JNNL 1FAIH 4PG2C 3DXAD 1UENA 1T7ZA 5I1GL 2CK0H 4X6CA 2L7UA 5DF0A 5FCSH 2E7LC 1MI5A 4ZSOA 4YE4H 5HYSB 5CIPA 1AH1A 4P2CG 1NGYA 1CK0H 1O7VA 4PJHE 1T66C 1FLRH 3PG2A 5HHXH 1YEGL 2GY7B 5CSBA 3KPTA 5TDNB 2ZJSH 2ENYA 4F80A 3HZYA 3BZEA 2HJKA 1H5BC 3WKML 3MGOB 1AKJB 3FB5A 3S4SB 1Q8MA 1G7HA 1JGEB 4DK6A 1QRND 1E4KA 1TPXB 5MEPA 5LGHL 3HI6L 5T1DH 2OJEA 5F1IA 5CD5D 4ISVA 1U93B 2X9YA 4JFDA 5IMLB 5DJCA 1BEYH 1P4LB 4Z7QF 2Q76B 3FFCD 4MQTB 1RJZB 3QJHB 4HXAL 5GZOC 1L4IA 1BAFH 2WBJB 3RHWF 5B8CB 1QD0A 2XTLA 3GKWH 2J5LB 4K9EH 2GK2A 3QBTB 4MJ5B 1CXEA 4FXKB 4LCCA 4M61A 2YXFA 3RJDA 5L88L 5F44A 3KVQA 2MCPL 3T0BA 1UQSA 3RWDA 2JJSC 1U3HA 3GMPA 3DMMC 4X4XB 2APXA 3GSXA 3QULA 1U92A 3WLBB 5FGCE 4YFLI 3MV8D 1ADQL 5JXAL 2F8XC 4B7LA 4Y19D 3R1GL 4XC3L 1HN1A 5GGSY 4U6YB 4KKLC 1FNHA 1HHIA 3HE7D 3VFUA 2AERT 5GGQH 3NVQA 4OCXH 3TA3D 1WAAF 4JFYB 3QWOA 3H6JA 4FZEH 4I3RH 4PGCB 2APFA 3QXTA 4XBEL 1I1FA 3FFDA 3EYFA 3T65A 1SJHB 2QSCL 5DJ6A 3WN5B 3ZSTA 1RJYA 2CKNA 4R0LC 4ODUB 1VGEL 3QHZH 1KCUH 3RWEA 5E5MB 5F7KC 4GXVL 3TNMB 1JHKL 2VE6B 4JAMB 4DN4H 1P84K 1QPPA 1KPRA 1Q9KB 4QHUB 4PJ7E 5IESL 2J88H 3W5NA 2AXGA 1F8TH 4RBPH 1MPAH 1EO8H 3HE6A 4R4FL 5TF0A 5GS0C 1UWXH 2H6PB 3LMJL 2QQQA 1YN7B 3IRPX 3IJYB 2UZYB 5F7WC 1T20A 1LO0L 1KB5H 4TULL 1UB5A 3ARBD 4ESKA 5SX4H 3VW3L 3IKKA 3MYZA 4WFGE 1QTYT 4JN2B 3FQWA 1NBZA 1RZIB 1JE6A 1FFNA 3SKNB 1DBMH 3HPLA 4HWEL 4X9BA 3IDJB 4MB3A 2GITA 3BKJH 2ADJA 3BWUC 4HLZH 5C07E 5I1IL 3L3DA 5JOFB 5K9JH 3PWJB 4IMKC 4OLZH 1INQA 3UYRH 1PQZA 3T4AB 2GSGA 4I0CC 1FAKT 2IMMA 3OHXB 4OFYD 4C4KT 3ZKXB 3DVNA 4Y1AE 2FBOJ 5DO2D 4KJWD 2FWOB 5B38A 5DA0B 3MXWL 5TH2B 2PTTB 1F6AB 1IL1A 4NQVA 1R5WB 1HKLH 3VFWA 4G8IB 3CSYB 4L4TB 1IVLA 5C3TA 2IMNA 3UTSA 5IKCB 2VKXA 3OKOB 2VERN 5EIIA 1S7QB 4JN1L 2F53B 4IRSC 4P23C 5GSRB 5BV7C 1OAYH 5L2JB 1UKQA 5CZXC 3S5LA 3EOTH 4BKLB 2VLKA 3I85A 1E27B 1B0RB 1JK8B 1JFQL 2H3NB 3KPLA 3BP5A 4PGDB 3JV6A 3B6SA 1BF2A 3GNMH 1H0DB 1JWUB 3MOAL 4B50A 4F2MA 4M9OA 2XN9E 1KEML 3WIHL 1ROWA 1OL0A 4XXDA 5F21B 4R4ND 3B9KC 4XWOD 3F58L 5C08E 3MJ8B 5FKAB 3S96B 5IB5A 1NGQL 1BFVL 3V7MA 2VZVA 2YPLA 3O4LE 3WDIA 4KK5D 2KQNA 1NKOA 4G6AC 1JNHB 4QOKD 4NSKA 4R7NA 3WFBH 1A7BA 2DWEA 2DM3A 3VDAA 1FO0H 3P0GB 5JIPA 4NKMB 4EBQL 4LRNH 4ZUTA 3CLEL 4YHYB 5F72S 1J05A 2OR7A 4K7FA 4RFEB 2HFGH 4KZDH 3GSRB 4DFIA 2F15A 3MV11 1RIHL 1QQDB 4NWTH 4OJFL 4JZOB 2ADIA 1BQLL 1KF9B 2D0FA 1J0KA 2ESVD 3D1MC 3UAJC 2E8YA 4X98A 3WO4B 3IXTA 1Z0NA 3NCEB 5GGUB 3VFSB 3MV9D 2PO6C 4N9GB 5GRJH 3UO1L 5BO1L 3LKOB 3FB6B 3L5WA 2BOBA 5CCKH 3SQOL 4APQA 2WW8A 3VWJA 1EMTL 1YNTA 3A6CL 1KC5L 4WI4A 4DOHE 3KXFA 2VDQL 1A9BA 1SEQL 3P0VL 4TRPH 3EAKA 3RX5A 4YHIB 2DI7A 3DLQR 5I16A 1R3LA 2D31A 2R29L 3M8OH 5CKAA 1RUQL 4ZUWB 1FHGA 4G3YL 1CN4A 3TWCL 4FP8H 4QRTB 1KN2L 3BUYA 4P4KD 1U8OA 1T1WB 1IGMH 3QQ4B 4E9LA 2ICEA 1KLUB 1WK0A 4I5BB 2XTJD 5F88B 5DVOA 2OBGA 5ANMB 1S9XA 3OX8A 5IHUH 4HBCH 2YKLH 4YNYA 3QDME 2AEQH 1XGUA 1E4XL 1S7SA 5I71B 4HKJB 4LVHB 3CXDL 4S1RH 3O8XC 4JO2L 1UM4H 5EUOA 3RZCB 3X3FH 4Y5XA 4P9HL 3IRZA 1YYLH 4O58L 5KSAC 2PTVA 3IS1X 3WHE0 2A6KB 3MUGA 1NAMA 2H9GB 3FCTB 12E8L 1HH6A 1NDGA 4Z6AT 5DQ9A 2VLJD 1WBXB 3AREC 5IROC 1DQJB 1K5NA 5IQ9B 4LPYA 4YHML 2NQCA 1B2WL 1I7TA 1MCLA 4PJ8D 1U8KB 5ESAA 5DMGC 2X4UB 1NGWB 3D39B 3LVEA 5JUEH 3FO2B 5I1AB 3U0PA 5ESVB 1B4JH 4OZFG 2VXTH 3K4ZA 2ZUWA 1CF8L 1LMKA 3VXUE 4PR5B 3BP4B 5EOQL 5D72H 2ZSVB 1IAIH 3L3OB 5IVZB 4OAWB 2RGSA 2FZ3A 4XPHL 4XX1E 5DGQA 4P59H 3MC0A 5HI4C 4NP4L 3BE1L 1DFBL 3W82A 1VFBA 3TPUB 2ICES 5IK3A 4HUVA 1T7YA 4WEMB 3RY4A 1NCCH 1K4CA 3K8KA 1KACB 3GM0A 1X4XA 4PB0L 4M7LT 4MAUH 3TN0C 2R0ZL 1Q9LB 3X13A 1S7VA 1KIPA 3MLVL 2VMFA 5I15L 2HFFA 4U1JA 1H5BA 4AY0A 1CXKA 5D7IA 3HFML 4K3DL 1A8JH 4UTAL 4M9PA 1I1YA 2EDWA 3T3MF 1XZ0A 4ZOCA 4PBVC 3HC0A 5B8CC 2WBJC 3QCTL 4H8WL 5IW6A 4MCYA 4PRPB 4QYOA 5J9PA 3JV4A 1DL7H 2IAMB 2Q86B 3W11C 4YZFF 3IDNB 2WQ8A 3L7EA 3CDYA 5F9JB 4RBPK 2UZIL 5EZOL 3T8XB 3RIFK 4U1LB 4RISH 3OV6A 1JI2A 2OTWB 1MREL 6FABH 2FO4A 1UWXK 2FB4L 3O9WA 1WZKA 3DGGB 5EB9A 4G7VL 5CEZL 1WVZA 3VXRD 1LK3H 1MNUH 5EOCJ 1BD2A 1PG7W 5C0AA 1NBVL 4AH2B 1LK2A 3VXSD 3N9GL 3PABB 2VXSH 1GOFA 2JJSA 4WTWA 2QV2A 4ZUSA 3DMMA 1RUML 3HPJB 4WHTB 3RNKA 3OB0K 1OAQL 4JG1L 1T5XB 4NPYA 1L0QA 2PCPB 3QDJD 5KVFH 5LGJA 3CFJA 3TJEL 2GTWA 1V7NL 4FA8A 1D5XB 2ITDA 1IC7L 2ZP0T 4JQVA 4ACPA 4GQ9H 3WYRA 5F3BA 5DMJB 1MHCB 2XFXA 1ZT1B 3B9VA 3RY6C 2XWBB 4XP1L 1CFNB 4LVNB 2XOTA 2CMRH 4NO2A 5EBWB 5IFAH 1S9WB 3GSVA 3OJDA 3RWCB 5CEZD 4NQEE 1B0GA 1ZSDA 5ADOH 2I07B 4R0LA 4S1DC 5FECA 2AGJL 5DC9B 1LP9A 5D2NA 2MKWA 1C12A 5IR1B 5LAXA 5EFIA 4ALAL 4HFWA 3F6LA 3UPRB 4AQOA 4KVCH 1YEFH 4KXZH 3WNLA 4OZGE 1Q94B 3VXPB 5FO8B 3IDMB 3U30C 2AJUH 4DQOL 5KS9B 1PAMA 3FO1B 5EO9B 1XF5B 4OIIH 4BFBD 3D87B 1EHLH 4EI6A 4UQ2A 4LSQH 2HTLD 4TVPL 1KCSH 1U8NA 3RUGB 3WDJA 1LE9B 5ERWA 5C09D 2DWDB 3QUYA 3ZKXC 1BVZA 4UILH 4MJIE 3DV4A 3MJGX 4LHUG 1HE7A 4G43B 1MRDL 4QNPE 4NO0D 1KLFA 4FMFA 4G5ZL 3HS0B 4IMKA 4J3VA 2BHUA 4K8RL 1F3RB 4NQSB 2X6MA 1KIRA 4QXUH 1Q9OA 4S1QL 1CLOH 4MLSA 4OTXL 4MSWA 4RX4A 2E27H 3MLTA 3VRLE 4WFEE 2XZQL 5I1HH 2O93L 5K9QI 4NRYB 1MJ7H 1YEEH 5I8CB 2FD6L 4ODSH 1J8HE 4JO3L 2DQIH 1OGTB 1ZLUH 4Z77B 2HKHL 2P5EE 2OM5A 2B4CL 5FCUH 1S9VB 1IAOA 1L6ZA 2QEJA 5EOCL 3V5HA 3QT2A 1JZ8A 2HKFL 5AUMB 2D03H 4G9FA 4P23A 4U7KA 2EDOA 3RVWC 2VDLL 3QXVA 3P0YH 2BOCB 4OCRL 1VEMA 4LEOB 1CDUA 1F13A 3L9RB 5IEHA 4LLMB 3DX8B 3U9PL 4YHYC 3V8OA 1OB1B 4YXKL 4K8RD 1JGVH 4QOKB 3EZ8A 3B9KA 2X4PB 2MOVA 1AXSA 3I02A 1O5DT 4IM8A 2Z4QA 2A6DA 1KGCD 4RWYL 5K9OB 1KTKE 1T22A 4UV7L 2X40A 4HDIB 4L5FL 3QSKB 2Y25A 1AP2A 4PJ5A 5FUOH 3BZFB 4Y8DC 1GGCH 5SV3A 5C9JA 2GT9A 2B8OT 1IC5L 1NC4D 2ESVB 3FQUA 3WJJC 4AEHH 1A7RL 3EO1A 3SY0B 5D1QA 4ZYKA 2JB5H 4FQPA 3UP1A 3IDXH 4JQXA 3Q2CA 2W92A 3X3GH 1CDGA 5JIKA 2QKIA 2N7BA 1KBGH 2VSDA 4AT6B 2YRPA 3D3VA 3NPSB 4PBWD 1I8MB 1QHOA 1GSMA 5BXFA 2YBRA 2ZSWB 4YC2B 5F7LB 4YAQA 3OPZL 1NFDB 2APTA 4K94L 2PR4L 3TYFA 4U6TA 1QACA 2R2HB 3NCCB 4BUGA 3VI3E 4MX7A 4F7EB 3TV3H 5DJYB 1F11B 1VFOA 1LEKB 1A5FH 1EGJH 3O6LH 4IOIB 5I71C 2QQKH 3KJ4C 4LVHC 3W0WD 3OKDA 1EAPB 2XTJB 3F7QA 3RZCC 3QXAB 1G6RB 4J12A 4Q74A 1BX2B 3J7HA 3E6FB 1RUPL 1CD8A 4OZIB 4MXWL 4RIRB 4G8EB 5KTEL 5D8JL 3O3AA 1I8LC 4JJ5B 1TVHB 3ARPA 4X6EB 5EUKA 4ODTL 3H3PH 1JMZA 2Z92A 1HQRA 2YA2A 4ERSH 5GZNC 3QIWB 1AO7E 4BZ2L 3O8XA 3UTPE 1W72B 4JFFB 1HCVA 3I50H 1W0VA 3C8DA 4EI5A 5KSAA 1OAXL 4N0RA 4NQXA 2GQHA 4CVZA 4EN3B 2C4FT 1KENH 5D9SA 4X6BA 4X99B 1NJ9B 4PJ8B 1B6DA 1ORQB 1G9MH 1WZLA 2Y06L 4X7SL 1ZTXH 2HTKD 5TJWK 1T7WA 1GZPA 1QBBA 1VPOH 3QDGD 4NNPH 1WWAX 3G6JE 2LU3A 5HYSA 3VE0B 1HIML 1JN6B 4D0DA 3BRGC 4GRWB 1U95B 4U6XB 1KSRA 4ODWA 3O2DA 2DKSA 3RDTB 2JE8A 3WFHA 1MAJA 3MBXL 1BIIB 5TDNA 4GAJH 2A74B 3IDIB 5DDHB 2IJ0C 1CDCA 5KS9F 4J3UA 1UWGH 1A64A 1BZ9A 3O2DL 3PWPD 1YNLL 3MGOA 3ESUF 3S4SA 3RUGF 2P5WD 3W9DA 4S10A 1A6ZB 1MCEA 2J6EL 4N9OB 4K3GA 3LHPH 4QXGL 5ADPL 4XPAL 3UC0L 2W9EH 3LN4B 1QFUL 2XY2A 1U58A 4RA0C 5C3LD 5IVNA 5IMLA 3DUHA 1G7QB 4NCC2 3QDAA 1P4LA 2Q76A 1RZKH 4TSBL 5EZLB 1KFAL 3N85H 1RJZA 5HXMA 1HH9B 5F96H 4IRJB 3QEQA 1T1YA 5B8CA 4XT1C 2YA0A 4URTB 1MCQA 4H1LB 3HNSH 4KPHH 4MJ5A 4FXKA 1A3RH 3VXRB 1RUAH 1XFPA 4Z95L 3NFSH 4FRWA 3P4NB 3OG6B 4U1GC 4X4XA 2W07A 1M05A 3VXSB 3WLBA 2BNUB 3BH9B 2CUHA 5TQ2L 2E9JA 3CPLB 3ARXA 2PKDA 3TA3C 3MUZ1 1SBSL 5DD0H 4U6YA 1J88A 4JM4H 5EU5A 4NKIH 2RAMA 2CLZB 3R06B 4JQIL 4EUPG 3CDGB 4EDXB 5F7DB 4JFYA 4G8GA 1H3GA 4LVNC 1F4WH 4PGCA 1RIVH 5TDPB 1RAMA 1AFVL 3REWA 1SJHA 5D96C 3WN5A 2HN7A 1DQMH 4ODUA 1B4RA 1NLDL 5E5MA 3TNMA 2VE6A 2BRQA 4JAMA 1DJSA 5C0FB 3IJHB 3RY6A 5I8EB 1OT1A 2J8UA 4DEPB 1Q9KA 4QHUA 2G5BB 5GS2H 3KAAA 2NY6D 3T0EE 4TVSa 1UM6L 4HWUA 4Z7VE 3ARBC 3B9DA 1Z9OA 3VH8B 2WWMD 4JRXE 4PGJA 1YN7A 3IJYA 1BWWA 5EPMB 3MRMB 5DHVH 3LKSB 1EHNA 1FC1A 1ZT4B 1V05A 4TUJA 2FRGP 1RZIA 1F6LL 2G60H 5TE6L 3SGKC 1RSFA 3LIZH 3IDJA 1XT5A 4XNXH 5JOFA 2B1HL 1NFDF 1OVZA 3OAUL 4JFZH 25C8L 3PWJA 4MD0B 3JWNC 4AEIH 4N1CA 5DO2C 4KJWC 3NZ8B 3RTQD 3T4AA 3NACH 2H1PH 3OHXA 5DJZB 4DN3H 2AJYH 4MHHI 3B9AA 1I8KB 1MVFA 3BIAX 4XNUL 4P3WA 2FWOA 2ICWB 3RPIB 4P46D 3KLSA 5TH2A 3D2UB 3N1QC 2ZUSA 4JY6B 4X0KA 2VLME 5EU6D 1FJ1B 3SBWC 3LQMA 2FEEI 1OGAE 1R5WA 2M2DA 1R0AL 4G8IA 4ZTPL 3CSYA 1ZA3B 4L4TA 3O0RL 3RA7H 5IKCA 4OZIF 1TZIA 3OKOA 1CGSL 2F53A 5HVWA 4KK6D 5GSRA 5F1OB 4BA8A 1WUNT 5IJKC 5K9QG 1EVTC 5TF1H 4BKLA 1KJ2H 1E27A 4R4NC 1B0RA 1JK8A 3D6GA 3EDFA 4OCSH 4XWOC 2DQFB 2H3NA 3ZDZF 4PGDA 2DQEL 2NPLX 1MHHA 4YR6B 1H0DA 4YXHL 1CGVA 2DQHH 4OF7A 1PKQE 4KK5C 1KB5B 4NYLB 1C5DB 1RI8A 4D9RD 4MXQD 3MA9L 4FFYL 4OQTL 3OGCA 3MJ8A 2C5DC 5FKAA 4G6JH 3S96A 1QSFE 3WUZA 1Q9WB 2VQTA 1UVQB 3QCVL 4KI5E 4D8PA 3RFZC 4XPGH 3CUPB 4FQXD 3U6RA 4H5SB 4YQXH 5HYFA 1JF1A 3WIIH 1JNHA 2APVA 4NM8H 5GGTA 3P30L 1ZXQA 4JHWH 3VI4E 4NKMA 2FBJL 1DP0A 3OR7B 3TT3L 3NH7L 4R97C 4GRWF 4RFEA 5I1KL 4YLQT 3O4LB 3GSRA 5F8RC 1DVFD 4MDIB 1QQDA 1QYGL 4LLVB 2BJMH 4NRXB 2YMXL 3AS3A 3BRDA 3DUSB 5ESQB 1VB9A 4JVWA 4V2CB 4UNVA 3HMWH 1E0OB 1I9EA 4L3EE 4GSDL 1DN0B 5GGUA 3VFSA 3SGJC 2XKNB 4N9GA 1EJOH 1TIUA 4FQIH 4NN7C 1NL0H 3LKOA 3D48R 3FB6A 3WJJA 2XT1B 4YBQD 4QY8A 1F3DJ 5A40E 3STLB 3HZVA 1WFOA 5DRZB 4CGTA 4LAJH 3RIAK 5M94B 3C09C 5DWUH 1U6AH 2CKBH 4ZODA 3BPLB 4G6FB 1KJMB 2EXWD 2YRLA 4P4KC 3V6ZB 4ETYA 3VG9B 5IB3B 2VITA 3HAEA 1CLYL 3INUL 5CKGA 2I5YL 1MFDL 1OPGL 2AS5M 1J0ZA 3TO4B 5DC4B 4QRTA 1EH9A 2XTJC 5CEXB 1REIA 4OZHE 1FO0B 3BVNA 5I1CH 1IT9L 3KPSB 1KLUA 4I5BA 3BGAA 2IEPA 5TDOA 3MLUH 3ZTJG 1K3IA 1A6TB 4FTVE 5F88A 5K9KB 2XZAL 3I75B 4I3SL 5ANMA 2A9MH 1J86A 5GJSL 1HNGA 3QIWC 4YDKH 3RZCA 1MJJB 1LNUA 2CSPA 4H88L 4BK4A 5FHBL 5D7SL 2NY5H 2A6KA 2WZPD 2R0LH 2H9GA 3FCTA 4PJ8C 3QDMB 1WBXA 1A14H 4MZ2A 4U0RC 1N5YH 1WISA 4FFWD 1OLZA 4KH2A 4WY7H 3FT4B 4YEEA 5FYLH 1U8KA 2AK4B 2QADB 3HG1B 2X4UA 1NGWA 1IRAY 3IFOB 4JZNA 4NZTH 1QZ1A 5LG1A 3FO2A 5I1AA 1CD0A 1CL7I 1G7IB 3EOBB 2VXQH 3QIUD 2QQLL 5ESVA 4Q58C 4N5ED 4QT5B 1D5MB 1FVEA 4K7PH 5INCB 3WE6B 1U3ZA 1DUYB 4P9HC 3BP4A 3ULVH 2ZSVA 4XP6H 3L3OA 4GLRH 5IVZA 4OAWA 4I1NB 1MCSA 1OWRM 3TPUA 4G42A 32C2A 1I9JH 3SKOA 1A6VL 3CMGA 4WO4D 5FUCE 3VXUB 1CE1H 3SDCB 5IB4B 2OTPA 5B3NA 2DTSA 2GAZB 2P5WB 3K46A 1Q9LA 5J11B 5D1XD 4LP5A 2O5YH 1T04B 1PY9A 4K07A 5FYLE 1MJ8H 1BJMA 5FM4A 4X8JB 1WBZB 2DQCL 1Q72L 5BQ7B 4IRJC 4LCIL 1KCRH 3HNVH 2X4SB 1J10A 4PRPA 1AXIB 4U6VH 4GO6B 3MO1B 2IAMA 2Q86A 1HXMB 2LAAA 3IDNA 4QTHB 3WFCL 3FONB 5F9JA 5MEQB 2ENSA 3T8XA 3ULVE 4U1LA 3S37L 2D7MA 2OTWA 2R4RH 3X11B 1TTUA 1BVKB 3DGGA 1E4WL 1LGVA 1YDPB 2V9QA 1CLZH 3Q3GB 2YD2A 2XPGB 1I7ZB 3UDWC 3U2SB 3C5ZA 3G9AB 4NQCB 1F02I 1RZGB 3D85B 3O6ML 3PABA 4FZ8L 5ETUB 3SCMD 1JNJA 1RULH 4H8WC 1I1AA 1MAMH 3HPJA 1QSEA 4WHTA 2VNCA 4XAWL 5E6IB 2O5XH 4UIKH 3B83A 4M43L 5JORB 3SDXA 1VDGA 3L7FB 4CMHC 3VXMD 1SY6H 4UV4L 4UT6L 4KTEL 4MMZC 1MHCA 1ZANH 3I6LD 1ZT1A 1LDSA 2XWBA 3QUZD 4ODXB 2B5IC 5EBWA 1S9WA 5IB2B 3S37X 1GOHA 3RWCA 2CDGB 3MRRB 3GEWB 1QFHA 4KMTL 2I07A 4AG4L 4LU5L 3SDDD 1F58L 3U7AA 5IR1A 5FYKH 1S7TB 5C0CD 1LQSR 2R8SH 3ECBB 3UPRA 5FA4B 3VXPA 1Q94A 5FO8A 3IDMA 2HMID 1ZLWH 1CFSA 5KS9A 3FO1A 5EO9A 4HK0B 2OQJB 2F5AH 2FL5B 1P9MA 1U8IA 3GI9H 1C7TA 3MRPB 3RUGA 1UJ3B 2VDML 1LE9A 3T08A 2M8XA 4JFEE 1M7IB 2BXYA 2DWDA 4MWFA 3TZVA 2XXMB 2DL9A 4G43A 2R2EA 3VD7A 1YPZE 4POYA 4HPOH 3MA7B 1T1ZA 5EBLB 3HS0A 5M95B 1X5IA 1TJHH 1SYVB 4OCLC 1U91A 4NQSA 3WUWG 4WU7B 2EH7H 2Z8WC 1J5OH 4RGOH 4H0GA 4MHHG 5JW4N 1N59B 1OTSD 1YEJL 2DQJL 2ORBL 4KY1H 4MJIB 4FNLL 5EU6B 4MA8H 1N6VA 4UT7L 5HGHB 1WT5C 2HA1A 4UI2A 2FECI 2C1PB 3MOQA 1G9NH 2VDOH 4MNQB 5EC1B 4NRYA 4WWKD 4XMLL 5I8CA 4JPVL 1FGVL 1OGTA 4Z77A 5DC0A 2QSQA 5JIIA 2PYEB 5E03A 4PRHD 5GRVL 2DI8A 3OR6B 3QWRA 5AUMA 3IDUA 3SE8L 5JHDA 5SWZE 2IWGA 5IJKA 4RDQG 4L4VD 4W6YB 3DIFB 3KPOB 4PV9A 3B3IB 3U4BL 5I1EH 1AGFB 3EFDH 4LEOA 2P5EB 4LLMA 3RQ3A 3DX8A 2FX9H 4GXUN 1OB1A 3GMMB 5FGSA 3PHSA 3KGRA 4QOKA 1NCBL 1ETZB 4LQ1A 1AIFB 2X4PA 3HC3H 2OLDA 5HI5D 3R8QA 2XV6B 4M62H 5DYOB 5HVFB 5K9OA 4M8QA 1B6UA 3KJ6L 4M4RA 4WI5A 1S9KC 2B4CC 4DKFL 3VDBA 1ZEAH 2WINB 5F6HJ 3KYKH 4HDIA 5F1KC 2VABA 9CGTA 1GIGH 1DVFB 1W2KT 1AGDB 4IRZH 1J1OH 4EUPH 3BZFA 2YSSB 2FX7L 4P57B 2AI0H 2D3VA 3H42H 3HR6A 3SY0A 3QNZB 1PFCA 3S36X 4U0QB 1J18A 5TQ0H 3RGVB 4XI5C 1QEWA 4LQFH 4NM4L 1YEKH 3BPLC 3DVGB 5CS7A 1NMAL 4F7CA 4GBXB 4HZLB 2YS4A 4AT6A 2OR9L 2X5PA 2BY0A 4P9MH 3RVUD 4LHJB 4AEEA 1I8MA 4RMVA 2Z91B 2ZSWA 2ZCKL 3SJVE 5H35B 4XVUD 1JBJA 1NCAH 1NFDA 3RKDD 4CADB 5LBSL 2DIJA 5HD8D 5HHQB 3CU7A 1XGRB 3RU8H 4NWUL 5D7LA 5LWYH 4F7EA 3VFRB 5DJYA 3MV7E 5ELIA 4XVTL 4M7KL 2BVPB 3WEXB 1F11A 4DWHA 3MRGB 3GMLA 4ZO8A 3GSNH 3MLZL 5IW1B 4HULB 3FMGH 3LS4L 4IOIA 3FB8A 1C8PA 2XA8H 1I7UB 1EAPA 3JWOH 3MYJB 2P8PB 3OQ3B 1YZZA 1G6RA 3QXAA 5IMOB 5JDJA 1BX2A 3WV0A 1F3JB 4LSVH 4A6YH 3E6FA 4OZIA 4RIRA 4G8EA 4R7DA 4Y2OA 3QEUB 2V7NB 4YPGB 1T7VA 1TVHA 4JJ5A 3M07A 4X6EA 3AB0B 4K94C 5DXWA 3BSZH 1IE5A 4Y4HB 3V0WH 2W91A 1NBQA 3QIWA 4M00A 5JO5B 4CU7A 3MRJB 5FOBB 1IFHH 1W72A 4JFFA 5KJRH 1CGTA 3CLFH 2EEAA 3VGBA 1BM3H 1JYNA 2IFFH 1JRHL 2HTKC 2WWKT 3SO5A 4EN3A 2V5RA 5F9WB 4X99A 1NJ9A 2D7TL 1ORQA 5D70H 2XRAH 4XCYB 2GIYA 3QIUB 4DAGH 4MCZB 5K93A 3MJ9A 5ILTH 4NQDA 4XNZB 5HI3D 1XF1A 3QEHB 3MMEB 3LKRB 2GK0B 3VE0A 1J87A 3BPNB 1JN6A 2D4FA 1U95A 4U6XA 1H9VA 3TCLB 4X4ZA 3RDTA 3CMOL 4PRDB 4UBDD 5DFVD 4ZFOB 1YECH 4ODVL 1TZGH 5GGRB 3IDIA 1MI5E 3AVEA 3MOBH 1L7IL 4OKDA 5J11C 4WFFE 4ENED 3BKYL 1UJTA 4GW1B 4P2RE 3PGCB 3O41B 1IARB 2P46B 4PJHA 3P4LA 3MZGB 1A6ZA 2F74B 4LHUD 4UUJA 4YHOL 1QLRB 4RMUA 3HN3A 3LN4A 3LPGA 3EO9L 2DQUH 1AQDB 3CSBA 1JMXA 1G7QA 3MLSL 1OAKH 3A6BH 3BGMB 3PV7A 1MUJB 4MQ7B 3LQZB 5EZLA 1RFDL 4G80B 3CVHL 3D25B 1HH9A 4ZUUB 4IRJA 2YUWA 4YDIL 2BP3A 3QNXB 4JFDE 3MSPA 4PG9A 4X8XA 2BC4B 2SEBB 3B9EA 1A6WL 1WIPA 3TJHC 5C70A 1ZLWK 1U41A 4N0YL 4LLQA 3EUUA 2MNUA 3OJVC 4KQ3L 3P9LA 2NZ9D 5FIEA 3P4NA 5AWNL 2CDFA 5C92A 4AJ0A 1FAIL 4H20L 1C5CL 3V6FB 2BNUA 3EJZD 5KVEH 2BX5A 3BN9D 3CPLA 4QHLB 5I19H 4W70A 2GFBB 2NX5E 3UDWA 1CK0L 1DLFH 3R06A 4BH8B 4EDXA 4JZJB 3GJEB 2ZJSL 4UMGA 1OP3K 5HHMD 3VXMB 1O0VA 4AEFA 5A3ID 2H8PA 5FYJH 5FKPB 3QIBD 2CJUH 4S2SB 5SWSD 4WUUE 4O4YH 1KXQE 3CC5B 1CFTB 3VG0L 5C0FA 2ATKA 1A9EA 1KXTB 5I8EA 1PX4A 5FA3B 2UVFA 3JUZA 4Y16D 4QRQB 2WWMC 2G5BA 1LEIA 4YX2L 1GPOL 3P77A 5T5NG 2IALA 4NHCH 1BEYL 1ZHNB 3E3QE 5FUZH 3GRWL 5JNYB 5DUBB 4BZ1L 2Y7QA 4LDLB 5E70A 3JBG7 3WL9B 1UZ6E 3VH8A 3V4VH 4CN1A 1NEUA 1BAFL 1OWWA 3LQAC 1UJ3C 4MA3B 3MRMA 1CTNA 4PJ7A 1NLBH 2ARJB 3LKSA 4KHTH 4K9EL 4N8VG 2Q8BL 3BFOA 4V1DE 1ZT4A 5FXCH 3RTQC 4N0CC 2WIMA 1S3KH 5FYJE 3DBXB 1BFOB 4Q9RH 1NCWL 4MD0A 1MFNA 1R3HA 3HUJE 1IM3B 4WEBL 4FQCH 4X80L 3NZHH 5DJZA 3RBGA 3NOIA 3ALPA 2VDKL 2VIRB 1JGDB 4H0HB 1GGYA 1I8KA 4FQJL 4OD2B 4HF5H 3GI8H 1A22B 5GGQL 2ICWA 4OCXL 3RPIA 2Q3AA 3D2UA 3U1SH 1EA9C 3MBED 4GRLD 4JY6A 1FJ1A 4KK6C 4XCFH 1OTUC 4NFBA 5K59F 3VI3F 3CFEB 5T3XD 3L95B 5BS0D 3PL6D 3QI9B 4QF1B 4HHAB 4J1UB 3RBSA 1GL4B 1A1NB 3QUML 4XH2B 5C0EB 1FCCA 3AY4A 2EDNA 4HW6A 1KCUL 5JW5B 4F33B 35C8H 1OGAB 3UTSE 1FPTL 2RR3A 2DQFA 1SYSB 3LEXB 1B9ZA 3DHMA 4YR6A 3IETB 2R4SL 4X9FA 1KB5A 2DBJA 1C7SA 1KPUB 1C5DA 4NYLA 4XPBH 4P4RB 2FIRT 2VLKE 4JEGB 2DQDH 3KR3H 5EA0L 2DM7A 1ZS8B 1Q9WA 5IFJA 4OZFB 43C9B 3CUPA 4H5SA 1FE8H 5CJ5A 1L9MA 5DVKA 3RL1B 4PBXA 1SM3H 2AQ1A 1IGYB 2XN9A 4DW2L 3KLDA 1DVFC 4FQLL 3OR7A 1QSFB 4KAQH 4D0BB 5K9JL 3FQXB 2D4DA 3IYLW 3O4LA 5BZDB 4LIQL 4XXCC 5C07D 4KTDH 3UYRL 4MDIA 4WI2A 4HS3B 4JDZB 4LSRH 2VDRH 4PTUB 1FZMA 3RGVC 3MODH 4PD4J 3DUSA 5ESQA 4YBQC 3WD5H 5GPRA 2COQA 4X5XB 4Y1AD 2EIEA 4GW4B 1EVUA 4P3CH 2XKNA 5E0QA 5E2TH 2F58L 2EXWC 2WM0A 1HKLL 2V5YA 2JLLA 3STLA 2GUOA 3VFTA 3BEVB 2DM4A 5F8QC 5DJXB 4PJIB 1EX0A 1LO2H 1KJMA 1OAYL 5C0JB 1Q0YL 4RGMB 1FIEA 2DTML 1OW0A 3OAZK 2CLRB 1BZQK 3S8WA 3AU1B 5C8JB 3KXFE 3TO4A 3RIAF 1E28B 1SVCP 4CNIB 5CEXA 4NQUA 2GJ6E 5F7FA 5I66B 1FO0A 3ARGD 3IU4H 3O2WH 3KPSA 4YUEH 3S3JA 5C08D 4HWBL 1T6WA 2Y9RT 4AK1A 2OJZH 2RBLA 5K9KA 3MLRL 3I75A 1ACZA 3AB0C 1ZVSB 1JPGB 4Y4HC 2PXYB 3RWFB 1QKZH 1HHGB 4OZHB 1P7QD 5HDBE 2OL3H 1MJJA 3GIVB 3MXVL 1LVEA 4YXLH 2HFGL 4KZDL 4FTVB 1EAJA 1GAFH 4FFWC 5F9WC 3AROA 5BW7C 4JGJA 3QDMA 3IFNH 4U2ZA 4M7ZB 1ONQB 4MNGE 5JR1H 3O6FD 3QIUC 3I3EA 4XNZC 1H3TA 3FT4A 4HJGB 1K8DB 3S6CA 1AC6A 2AK4A 2CKBB 3HG1A 3IFOA 1PLGL 3U48A 2OP4H 4ZXBB 3EOBA 4M1DH 3V6BR 2NXYD 4QT5A 3WBDA 3GHEL 4OLUH 1D5MA 4LDOB 1J0HA 5INCA 1DEEA 5LXGH 2VWEC 3FL7A 3WE6A 1DUYA 3KWWB 4TRPL 3BW9B 3U9UB 1MIEH 3ZYJA 2ZCLL 5BZWB 1JPSL 2NTFA 3LEYH 2BSTB 2EDHA 4XPFH 4UNTA 3VRJB 5F6IB 4L8DB 4FP8L 5EIVA 3VXUA 4OKVB 3SDCA 5F71A 5IB4A 2J8OA 1MFBH 3GUTB 1IGML 3O11B 5L8KB 2KUTA 2GAZA 4KTYA 1YY8B 2P8MA 4C58B 1KB9K 1T04A 4XAKE 5IP4A 1EZVX 4ZDHB 1DSFH 4QXWA 1LEGB 1F4YH 5FFLA 5IHUL 3HTLX 2YKLL 4X8JA 1WBZA 4XHJD 5EO0B 5BQ7A 5FHAL 1DBJH 5JW3L 2X4SA 2ZKHL 1G9MC 4ZTOH 3X3FL 5EU7C 4L8BA 3MO1A 4FQ1L 5B39G 3SKMB 3PDGA 4Q6IA 4QTHA 3FONA 3AS0A 5MEQA 1CGUA 4YO0B 1JHLL 1AGEB 4XNMB 3X11A 1BVKA 2Y07H 5TE4H 5IBTH 3VFVA 4FFZH 5CBAB 3AMKA 1YDPA 3Q3GA 3SCMC 3TYGH 1XCTB 3LH2L 4F8TA 1NC2D 1B3JA 3U2SA 3KNBB 3OZ9H 4LSSL 4NJAH 5JUEL 4NQCA 5JW4Q 5E56A 1RZGA 3D85A 5FK9B 5I17A 5ETUA 1B4JL 4R90L 4Z9KB 2UUDH 3BH8A 4JZJC 4GJTB 1TJIH 5C0AE 5D72L 4OFVA 5DQDH 5E6IA 3ILQD 1KCLA 5C0ND 5DA4A 3L7FA 2Q1EA 1RJLB 4X4YB 5E2UL 3TH2T 2VSCA 3SE4C 1OP5H 4MJ2A 2FATH 2DKUA 4M7JL 3SE3C 1NCCL 1P7KB 1CG9B 5GS0H 4WHDA 5GGVH 3QIBB 1MCJA 4MAUL 3SDDC 4ODXA 1KCKA 1R3IL 1NMBH 1JWSB 1PSKH 3MFFB 5IB2A 4BQBA 5GIRB 2R0KL 3QCUH 5EH1A 5A2FA 3IAGC 2DJUA 2IPKB 1QFPA 3WO3B 5DK2B 1XAUA 3H9SE 5TFSH 2HMIC 4XP4L 3FTGB 4DGIH 2E7CA 1MCWW 5T1LB 5KOMC 3ECBA 2NY3D 4PTTB 4YBLB 3MCLL 5JW4R 2NNAB 3C08H 5CBEB 4OQ1A 4PLKC 2CIKA 1MWAH 5KBNC 4DGVH 4LF3B 1EFXD 3SDYH 5JPNB 6FABL 3E6HB 3LV3B 4MD5B 4HK0A 3CFKB 4PRID 2XA3A 3Q6FB 4IOFD 2FL5A 4PJ9B 3WSQH 3OTTA 1MNUL 1UJ3A 2NY7H 4PJIF 2R1YB 5E2WL 4OZGA 2OI9C 3CH1A 1CL7H 1M7IA 3C5SB 4LSUH 3ARDB 3UTTE 4S0TD 1I8IB 4L9LB 3BQUD 2VXSL 1XIWD 1HYSD 1L7TH 4JG0H 1EXUB 5C0GB 1WF5A 1E4XI 1QBLL 5GRXG 1SQ2N 2Y1VA 3MA7A 5BV7H 4KFZC 4XBPA 1SYVA 4JFEB 3QI9C 5E7FA 3FKUS 3NCJH 5DVNA 4WWKC 1N59A 1QOKA 4CL7A 4MJIA 5E2VH 5C0IB 3MR9B 3DO7B 4Z7QE 4P49A 2C1PA 1IMHC 3EGSB 2CRZA 3JV0A 1NGPH 1C5BL 1INEL 3I84A 4K23L 1VKXB 4MNQA 4YFLF 4HUKB 1FDLH 4LARL 3LS5H 4OZHF 2CMRL 3DO3A 2PYEA 1TITA 2H2PD 2VN4A 4L1HA 1WV7T 2R56H 1MEXL 4NQED 3OR6A 5MERB 4UIMB 3BYYA 5EORH 5ADOL 3D69B 2EDLA 1GZQB 3IGAB 3MX0A 2C1OB 5IT2H 4MAYB 3MRLB 1JI1A 1ZT7B 1J8HA 3DIFA 4DTGH 2PF6A 4DVBA 3B3IA 1X9QA 2DLIA 1RIUH 1AGFA 5HHVH 1JL8A 2KL6A 3ZHLA 2P5EA 2Y5TB 3IKCB 4G9FE 5CJQL 2AJUL 2EYTB 1GRWA 4JKKA 3GMMA 1HDMB 3UXFA 3C2AL 1AIFA 2Z31D 4M7LH 1WAAE 4PIRF 5DYOA 1DUZB 5EU4B 5I75C 4KVNH 1WGOA 4JFHD 2WUCL 1Z9MA 2WINA 4UILL 1YA5A 2JCCB 1KJVB 4ZS7H 1AGDA 5D7KE 4P2OA 3ZT5A 2YSSA 4PJDB 1P4BH 4P57A 3BP6B 1KTLB 3RJQB 5B4MD 3ZKMD 3QNZA 5BVPH 1MLBB 4XPTH 3RGVA 5CFHA 1CLOL 4KDWA 3DVGA 3KPQB 2VR4A 4XVUC 4GBXA 4HZLA 3RKDC 4TNWK 1IQWL 4RGMC 5I1HL 5DQJA 4ZMAT 1S7XB 2D7QA 5FGBC 1ED3B 4MJ4A 4ODSL 4JPKH 3BX7C 1OAUL 2Z91A 5J12B 3T2QA 1UH4A 1XGYH 5J1AA 4CADA 4OUUB 2XZCH 4KUZH 2XWJB 1XGRA 3D3VE 5CLWA 5HHQA 2EDKA 1N2RA 1F42A 5DMKB 4EXKA 3VFRA 3WEXA 1TCRB 4JDTH 5EDXA 5IW1A 5ID0B 3V4UH 4KUCF 1D9KB 4HIEB 1I7UA 3C87A 3PQYD 4HS8H 3FZUD 1T4KB 4I0PD 3B2UD 4HBQA 5IMOA 2KDGA 2DS4A 4YHKL 1IGCH 2FHCA 1BBDH 3C6LA 2V7NA 4YPGA 2HRPH 1P7QB 2R0WH 4EUPB 5MEND 1FNFA 1FYTB 4M7ZC 4Y4HA 4E5XB 1TENA 5AYUH 4KHXH 5JO5A 4MVBD 2K7QA 4U1NB 2E9IA 3MRJA 5FOBA 1IGFL 2KKQA 3P73B 1VCAA 4X6FB 1MCWM 3MACH 4BSJA 5FUOL 1GGCL 1IZKA 2F19H 4ZXBC 4Y4KD 4HK3N 4LSPH 5JQ6H 5HI3C 4HIHA 4XCYA 3D18B 3IDXL 3BD5A 1VGKB 1Z3GH 3GO1H 2G75B 1MLCB 2NXYB 1KBGL 3K2MC 3QEHA 5DFVC 5DEZA 4HUMB 1PYWB 3MRHB 3MMEA 3LKRA 4JHAH 2GK0A 5F6IC 2BSED 2HWZH 3TM6A 4ENEC 3RAJH 5H94B 3HB3D 3TCLA 3GSNB 4PRDA 2N4IA 4ZFOA 1I7RB 1QFOA 1EGJA 2APWA 2IAND 5GGRA 3VFMB 2FJGA 2GEEA 4GS7C 1P6FA 4HFUH 3TV3L 5CGYD 4GKNB 4GW1A 2BNRE 3O41A 5IG7B 4A6YB 5LCVH 1HINH 5C0BD 2Y36H 3B4NA 3F7PC 1EGJL 5ALBH 2H26B 3A6OA 3CX2A 2F74A 3THMH 4XP5H 3MGAA 1QLRA 3OF6D 5SV4A 4XTRD 2YC1B 1AQDA 3BO8B 5CINL 5ISZD 3BGMA 1MUJA 5C2UB 2DLFH 3LQZA 3GZKA 1ACYL 3H3PL 1PW3A 5HHOE 3D25A 4ZUUA 5C1MB 4ERSL 5CGMA 1AY1H 4DZBB 1AO7D 2ZWLT 4C56D 3QNXA 5ECJE 2IADB 5DJ8B 3DPBA 1I9IH 2BC4A 2NZ9C 2J3SA 4HIXL 4MDJB 3I50L 3V52H 5A43C 2SEBA 4O02L 4U1SB 2EDBA 3S3PA 4HH9B 5FO9B 1FH5H 3BJ91 4W4OC 5TPWH 3EJZC 1KENL 3V2AR 3BN9C 3BPCB 1NDMB 2Z9TA 1QLFB 1MRCH 4G8FB 3CDCA 2AJZB 3V6FA 2YK1L 4GUPB 3VXTB 3LZFH 3QZWA 1VPOL 1H3UA 4QHLA 5LVEA 2NLJB 2GFBA 4D2NA 5CZKA 4AL8L 2EC8A 4JRYB 1YMME 5A3IC 4BH8A 4JZJA 3GJEA 4QHMB 2IH3B 3QIBC 2NY1B 2BRRH 5J06A 1GGIL 3TBSB 1KIQB 1A1OB 3G6AB 2NX5B 4OCYH 5ALCH 1K3ZA 1OTTD 2HH0H 4P2QD 5FKPA 3ZKQD 4S2SA 4Y16C 3HLAB 1OP9A 5DEGB 3CC5A 4ODHH 1CFTA 3U7WL 4R8WH 2JCCF 4YBLC 4OF3A 5GRZA 2X1OA 4Q9QL 5FA3A 4Z8FL 1RURL 4I3GA 4OF8A 3W2DH 4XZUB 4PJDF 5DMIH 1T2QH 2L7JA 2FH6A 1RZKL 2B2XL 2FGWH 3P9MB 4X7TB 5DUBA 3VD3A 4OGYH 3WL9A 5F96L 2WANA 3CXHJ 3TVMD 5IBUG 4MA3A 4YDLB 3CX5J 1INDH 2ARJA 4PRIB 4GKZB 2WP3O 4KPHL 1A3RL 5IV2A 2CR6A 4Z7VA 3NFSL 3QFDB 1TQBC 3JZ7A 3DBXA 1BFOA 4GG8B 1IM3A 1JJUA 4YGVB 5C0RL 4V1DB 1ZOXA 1WZMA 4Y4FB 3MBEC 4GRLC 1JGDA 5DGRA 2WK2A 3OKNB 4QRRD 4OD2A 3PL6C 4D9QE 1ZLSH 3T3ME 1H3PH 3FN3A 3DSNA 2OSLA 1F4WL 1RIVL 2H45A 4RGND 4IDLA 4PY7B 5EBMB 4FXLA 1Y0LB 4LRIC 1A6UH 3ILPB 3T77B 3QI9A 4QF1A 1Q1JH 4YZFE 5D7JB 5J6HA 3IS0X 5DUMH 4XH2A 1VEPA 1FFPB 2ZPKH 4DGYH 2X42A 3KPRB 3LPWA 5JW5A 2VZUA 4F33A 3UPAA 5T33L 1A0QH 1OGAA 4JPWL 2F53E 1SYSA 3QWQB 3GMQB 1Q38A 3LEXA 1OCWH 4QXTA 3IETA 2E9WA 3R0MA 4L1DA 2C3VB 1JGLL 5D2LB 2A73B 2OZ4H 5DHVA 1KPUA 4G6KL 4P4RA 1R5IB 3T0ED 2K1MA 1RZFL 2ED7A 1LWRA 1UH3A 2DM2A 3RVXD 1X5HA 4OZFA 43C9A 4Y0GA 3BYTA 4KV5F 3VXQB 4JRXD 4OB5H 3RL1A 3G5ZB 2Z31B 3BESR 1U36A 5HJ3B 1IGYA 3E8UH 1AR1D 3GJFH 2FIKB 4ZNCD 4O5LH 2ATPB 4KGJA 2G60L 1QSFA 1MJUH 4D0BA 1N6UA 3FQXA 1L0XA 4AEIL 5CJOL 3OBAA 4HS3A 1DQLL 4JDZA 3NACL 4PTUA 2H1PL 1IBGH 4BFGA 3QRGH 3H7LA 2IG2H 2AJYL 4LPVA 4J2XA 3KPMB 1RK1B 4N0UE 2V2WB 4UOW1 4X5XA 4GW4A 5TGBA 5HYJD 1VA9A 4P5TD 4IJ3B 5HHPA 2UY6A 1UYWL 2OCFD 3V7AG 2VLMD 4OLVH 1ZE3C 1NCDL 3C60D 5KVGH 1FNGB 3BEVA 1QBML 4WU5A 3RRQA 1H15B 4JVPA 4L3EA 5D93B 5KSUB 4LCWB 2VZSA 4TUKL 2IGFH 1GGUA 2YEZB 3ARGC 1KJ2L 5FGBA 1SJXA 2CLRA 2X9WA 1ZA6B 2FSEB 5C6PB 3PXJA 4PGZA 2V17H 4JO4H 5C8JA 3TBYA 1CD1B 1E28A 3MLYH 4AZ8A 4CNIA 4CVXB 1I3GH 2DI9A 1X4YA 1YQVL 4WWID 3RGHA 1J0IA 4OZ4B 3DUUB 2GJJA 5I66A 1X6LA 1A1MA 1I3UA 5GXBB 4OLEA 3NABH 2XKSA 4PUBL 5J7CC 1XGPB 1GGTA 2Q8AH 4XP9L 1UB6B 4MQXD 1S5IH 1ZVSA 1BOGB 1JPGA 3EJYD 1P1ZB 5I6XC 5CILL 2PXYA 3SKJH 3VGAC 4QO1A 3RWFA 3GMNA 4FQ2H 4JHWL 1ZAGA 4OZHA 1IAIM 3GMRB 3GIVA 1B90A 1D5BB 3O6FC 5ANME 1A3LL 1JP5A 2AJ3B 4FTVA 4KKBD 4JR9H 4XC1H 3S7GA 1N0LA 2X70B 4WV1B 1HHHB 3OKEB 1ONQA 3T1WA 1MSPA 4Y4KB 5H2BB 3SGDH 1EPFA 1S78C 2NXYC 3KS0H 2X89A 1K8DA 4HJGA 3WDHA 4YWGL 2CKBA 3AXLB 3QRFM 4ZXBA 3SDAD 4MNGB 4ELKB 4I8DA 1DBKH 3QG7H 2X4QB 5IM7B 5BMFL 1U6AL 1E6OH 1L9NA 4PJFE 3D39E 5F7EH 3KWWA 3DTXB 3BW9A 2EDRA 2IFGA 3U9UA 4Z7UF 5DRXB 5BZWA 3DWTA 2BSTA 1JNLL 3IB4A 3WNPA 2X1XR 4L8DA 4AIZB 1FIGH 2A38A 5CP7B 4Y2DD 3MCG1 1UWEL 4Y5VB 5GHWH 5MI0B 1RJCA 4XRCB 1YEGH 3O11A 3HCVB 4XHJC 4QRSB 2BY2A 1YY8A 4J6RH 2OL3B 3NCFB 2CGRL 3D0LB 2E9BA 1KEGH 1ZHKB 1N5AB 1XEDA 2IQAB 2NW3B 1FRGH 2A9ML 2MSPA 4HJ0D 1LILA 3WKMH 1F00I 5EO0A 4F7TB 3WUWB 2X4RA 4YDKL 2YD5A 5FGRA 5ISZB 1QRNE 4IS6B 3SKMA 3DI2B 5LGHH 3UZEA 3HI6H 4OD1H 2NY5L 4YO0A 3ZYZA 2R0LL 2CUIA 1BJ1J 4PRPE 3O81A 4S11A 5AG9A 3FO9B 3VGGA 5JPMB 1IAKA 3FFCE 5EZJB 4Z0BL 1XCTA 5FYLL 4HXAH 3DYOA 3NPZB 4JM2B 3KNBA 4RMTA 2VXQL 4NZJA 5FK9A 3ILQC 4Z18A 5L2KD 3WS6A 2I9LB 3CH8A 2GTZB 2XKUA 5D2LF 3ULVL 2JIXD 2VDNH 4AQ1B 3SE9L 3T0DA 1ADQH 4Y19E 5DZNA 5JXAH 1RJLA 4X4YA 1I9JL 4XC3H 5BOZG 2X1PA 1P7KA 1CG9A 2AEWA 2P7TB 5FAAA 4P2QB 3O3UN 1T1XB 3QIBA 5DURD 1YUHB 2O5YL 5GIRA 4PJAB 3UTOA 2NW2A 3ULUL 3OSKA 2IPKA 3L3JB 3WLWD 5DK2A 1KCRL 1MVUB 3HNVL 4UAOB 5IFHL 5IJVB 1VGEH 5CJ8A 3FTGA 3WFDL 4GXVH 4YDLC 1ZMYA 5T1LA 2RCSH 4PTTA 4O51B 4IOFC 2NNAA 5CBEA 5JTWA 5FDYA 4D9LH 1MFAH 3MLWL 1MCKA 1RUKH 4ZO6A 4LF3A 5JPNA 3TVMB 4U1IB 4MD5A 3CFKA 5F1SA 1OHQA 3H9SB 2BHYA 4M93C 1G9EA 4R4FH 4PJ9A 3BQUC 4BYHA 1HYSC 3BI9X 2R1YA 5GRUL 4P5MB 5KS9E 2BNQB 3C5SA 3ARDA 1EHAA 3GJFK 3ZHDA 4L9LA 3VW3H 1RULL 1EXUA 5C0GA 3RUGE 5E8EB 1IM9D 1MAML 1SY6A 3WNKA 3ULUD 4QRRB 3G5VB 3GHBL 5I1IH 3BWAB 4JFEA 2O5XL 3BT2H 5DJDA 4K3JH 5JXED 3UTTB 5F3HB 4QTIH 4AIXA 1DBAH 5IIEB 1U3YA 1QNZL 1QFWL 3MR9A 1TLKA 3ARFD 5C0IA 3DO7A 1JPST 5E9DB 5C6WH 2BVYA 4AMKH 1YPZA 3QA3A 2Y72A 1VKXA 2F54B 4TN9A 5FV1L 1WCQA 1T0MA 1FNLA 5J6GB 3Q5OA 3B8SA 1UA6H 4HKBB 4UIMA 3D69A 1MWAB 1GZQA 2GY5A 3BIKA 3IGAA 1N7ML 4MAYA 3MRLA 1ZT7A 2DD8L 2Y5EA 4YHZH 2R8SL 5AEAA 2Z31C 3FAWA 3IKCA 4ZAKB 1JFQH 2GYSA 4HG4J 1HDMA 3CVIL 4NT6B 5SWZA 3RL2B 2HVJB 1KEMH 2F5AL 1GHFH 1UKSA 3GI9L 3F58H 2C3GA 1NGQH 3K3QA 3L3KB 1DUZA 4YHPB 5EU4A 1KN4L 1EEZB 4L3CA 4RCAA 1ES0B 4IRSB 5BV7B 4QOKE 4UT9L 4WGVB 3PWVB 5C6TL 5B4MC 5I8KH 2NY4D 3ZKMC 1KJVA 4Z7NF 2HJLB 4EBQH 2DLEA 4MNHB 1M7DB 4IJ3C 1U8PB 3BP6A 1KTLA 4Y7MA 4LMQI 4OV5B 2X4TA 1TJHL 3R0NA 1MLBA 2GSIB 4YFEA 1RIHH 4RGOL 2Q6WB 2F8VA 3ZE2F 3WMSA 4Y5YB 2E7HA 4GAGH 2MQ0A 5D93C 1NUFA 4L8CB 3KPQA 2ESVE 4DVRH 1G9NL 4KKCD 1S7XA 1Z0MA 2VXUL 4M6OL 3W9EB 1ED3A 1NANI 3ES6A 3MV9E 4PP2B 1P2CB 4ORZC 4WNQB 2BY3A 1MHEB 3ZKND 1XCQB 3UO1H 3T09A 4OF0A 5BO1H 3PGDB 3K74B 5D71L 4OUUA 3SQOH 2XWJA 3A6CH 1HZHH 1BQUA 4TNWF 5I1JH 5DMKA 2H32H 2VDQH 3UJIL 1XGTA 1W72H 4I0PC 1NFDE 1TCRA 3B2UC 1MIML 3BUTA 5ID0A 2R29H 5F7UA 1D9KA 3EFDL 1RUQH 4HIEA 1MCFA 4KJQC 4JM2F 3WJLC 3F62A 4BFIB 2PO6B 1TXKA 1ITBB 4RDQF 2H2SC 4NC0B 3MJ9H 4M6MH 4MVBC 1DANU 4OCNC 4IDJH 5E5UB 3K7UA 3FAXA 1N4XH 4EUPA 3TP4A 2XTJE 4Y88A 1FYTA 4WV1C 2EDTA 1FN4A 1JPFB 2L0DA 4Y4KC 1FFOB 4GRWH 7CGTA 4U1NA 1E4XH 3P73A 4EXPX 5F70A 4IRZL 1X4ZA 1J1OL 4LASH 5GJTL 4JO2H 3U82B 4P9HH 1FLTX 2AI0L 1SVZA 2BCKB 4JCMA 5F9OH 3PV6B 4MMXC 3GBML 4J4PC 2BSRB 5IF0A 1CZ8L 12E8H 3D18A 4JFFE 1PX3A 2DB8A 4LQFL 2VLJE 5GISH 1YEKL 1VGKA 3V6OC 1IGTB 4PJAF 4NNXA 2G75A 3SDAB 5I9QB 1MLCA 3FO0L 3HB3C 1RZ8B 4MGXA 4XWGH 5I18L 1PYWA 5KZCD 4XGZB 1ND0B 2QSTA 4CDHA 1DE4A 4Y5VC 5CGYC 5D1ZD 1NCAL 2BK8A 3B43A 5H94A 5J3HD 3GSNA 4JGUA 5MI0C 4GMSL 1V8HA 1I7RA 5GRYA 3KPPA 3RU8L 4N8VB 4X83A 2PNDA 5LWYL 1VERA 5EOQH 3RWIB 4GRWE 3NIDF 3MV7D 4H1LH 4QRPD 4XPHH 4A6YA 2AXJA 2IH1B 4XTRC 1AE6L 3FMGL 2MHAB 1DFBH 2XA8L 1UGNA 2H26A 3SPVB 2PW2B 1DZBA 3RWHB 3OKMB 2ZUVA 4HWNA 1CR9H 1T7XA 4LSVL 3ZSSA 4P2RA 2YC1A 1XF3B 5KG9B 2BNRB 5IMKB 1KOAA 4PB0H 4MD4A 3BO8A 1BWMA 3VDCA 2XQBH 2R0ZH 3MLVH 3BSZL 3KPNB 5EC2B 4UTBL 4HIJB 3HFMH 1K9TA 4WW2B 4UTAH 4HV8A 4DZBA 1W0WB 2IADA 4JM2C 1KB9J 5KJRL 4I0KA 4H8WH 3LN5B 3QCTH 4MDJA 2OMBA 3CLFL 1I3RB 4S1SL 1S5HB 4HH9A 2IFFL 3MRIB 4FHBD 4PPTA 5EZOH 5HHOB 2YOCA 3AUVA 3ZDYE 5D70L 1NDMA 2VR5A 3GM8A 1MREH 3TN0B 1QLFA 3OB8A 2FB4H 4G8FA 2AJZA 5ILTL 4GUPA 4WI8A 3VXTA 1PG7L 1MRFH 3VXRE 5CEZH 1UACL 1CFQB 3O3EA 3FHQA 5C9KA 4N8CH 1JYXA 3QUXD 1NBVH 4JRYA 3VXSE 1OY3B 1LO5B 3LKQB 1RK0B 1TTGA 3I3DA 5DS8B 1TZGL 4QHMA 2NR6D 4NZUL 4TNVK 3DRQB 1MI5D 1RUMH 1KIQA 1A1OA 2NX5A 3QDJE 4JG1H 3S97C 1T3FB 3WXVL 1YMMB 3ROLB 3BZDA 3MNWB 1FSKB 1ZVHA 3MCKB 5L9DH 5HGDA 4F58H 4UAOC 2W0LA 3HLAA 5DEGA 5CUSL 1UM5L 2NY2B 4CU8A 4OSUH 3AAZB 2MJWA 3P11L 4XP1H 1X5GA 4XZUA 3TVMC 5H37H 5HTSA 4WUUA 3K8MA 4X7TA 3QH3B 3R8BB 2IBBA 3G9VA 1X5ZA 2K3TA 1PG7X 4JFDD 4POZC 3DGCR 4M5YL 2LVCA 2JB6B 1WEJL 4N0FB 1OSPH 2VJXA 3N0PB 5FV2A 3QFDA 4O9HH 4DQOH 2IF7A 3VXNB 3HAEG 4HX1A 4LEXH 1QLEL 1QR4A 2WIIB 1MY7A 4V1DA 1IM9B 4ZQKA 1TJGL 1NEZG 1TCMA 3PWNA 4Y4FA 5I19L 5ITBH 1U3HD 4P3DA 1JYWA 3GMOB 4RGNC 5C09E 1NFIB 4ZO9A 1DLFL 2E6JA 2VAAA 3ARQA 3F7YB 3HUJA 3ARFB 2VLRB 4PY7A 5EBMA 3U30B 1LDPL 1Y0LA 3PDOB 4GAYB 4E41B 4G5ZH 3T77A 2WQRA 5D7JA 1JRHI 4B41A 3UMTA 4D3CL 3BKMH 1FFPA 4XMPH 1F2QA 3OB0H 1CDBA 3KPRA 4O4YL 4S1QH 1IC4H 1CGWA 5M7QA 3U83A 2H41A 4I9WE 3WS3B 2FHFA 2AXFB 4OI9A 2AKRB 3LKNB 1BJ8A 5DR5H 5EULV 2FD6H 3RVXC 4JO3H 4ZAKC 2C3VA 4NHCL 3O6KH 2VC2L 5D2LA 2A73A 4RQQB 2B4CH 3KYOB 1UXSB 3FOMA 4YDJB 2HKFH 1AR1C 5AD0B 3VXQA 3EDDA 3S98A 3ET9F 5F6HI 3G5ZA 1NLBL 5T5NF 4KHTL 3JV5A 2LTQC 1YYMH 3HE6D 4OCRH 1U8MB 1A02N 2FIKA 5HGGS 2DJ4A 2ATPA 1VEOA 3EYVA 1AHWB 3U9PH 4M03A 4A2MA 1JVKA 4PRBA 1HWGB 4YXKH 3CGTA 1JZ2A 2EIZB 1CICB 1MF2H 3V0VB 3Q1SL 5AZ2H 5FYKU 1J0YA 1FNAA 4FQCL 3RP1A 4NUGH 3NZHL 4P5TC 2Z8VC 4Y5YC 1KGCE 4LLUB 3PHQB 4RWYH 4F9PC 3TF7C 4UV7H 3C60C 1RK1A 3BRFA 1G7MB 2V2WA 4L5FH 4HF5L 2CLVB 3GI8L 2FR4B 3IFLH 4OCWH 4IEFB 4XCFL 1JV5B 1IC5H 3UTZB 1A7RH 3ELAT 1L0YA 2WLZA 5B39B 4KRPD 1DLHB 3IAQA 1H15A 1IKNC 3QO0B 4N0UB 5KSUA 3NTCH 4LCWA 3DARA 3NFPA 2YEZA 2V7HB 3UTSD 4WW2F 3K80A 1ZA6A 3EYSL 3MRKB 4F7MB 3RVTC 1CD1A 4H25B 4CVXA 4FABH 4JGMA 4MQXC 4XPBL 3DUUA 1RHFA 4K94H 3VFOB 1GGBH 2DQDL 2NMSA 2VLKD 3KR3L 3CCHB 3GJFB 5SWQA 1CBVH 5BRZB 5HDOA 1BPVA 4JE4B 1XGPA 1FE8L 1UB6A 3L3GA 4I77H 1BOGA 1P1ZA 3UJTL 2GJ6A 3MQIA 3KPSE 1X44A 1FNEA 3FQNB 4ONHB 3GMRA 3G5YB 2QHLA 4QWWD 4KAQL 2YPLD 5E8PB 2AJ3A 1JTOA 3IXAB 4KTDL 1OF2B 4RFNC 5I0DA 4K3EH 2VDRL 5KTEH 3MODL 1HHHA 1X5LA 3OKEA 3STZA 1MFCL 1K8IB 5CMAB 2X4NA 4O2FB 3WD5L 3SDAC 5I9QC 4LL9A 4BZ2H 2R1XA 4P3CL 5J56B 2HLFD 1I85C 3AXLA 1XR9B 3KJ4B 4LPCA 1UT9A 5E2TL 1A4JB 1OAXH 4MNGA 4ELKA 5E1HB 4J4PA 2X4QA 3BEWB 5IM7A 3H0TB 3OKYA 1IZJA 2AK4E 3HG1E 3WFZA 3V6OA 5D6DC 4C55A 3DETC 4F15B 1S7UA 5DSCA 1HWHB 3DV6A 1FBIL 3VWJD 4R96B 1U3JA 4APQD 4AIZA 3T0AA 1NAML 2CXGA 4M5ZL 1HIMH 4PJFB 1MQKL 4TQEH 3TH4T 4QRPB 2LVEA 4XRCA 1DBBL 4HJ0C 3IU4L 3DXAB 3HCVA 3MBXH 1A2YA 4QRSA 4BJLA 2OL3A 4JPIB 3D0LA 2OJZL 4L8SB 3HI1B 1T83A 3BD4A 5JLZA 1N5AA 2IQAA 3I9GL 2NW3A 4PG2A 4RA3A 1V7MH 1G7LB 2E7MA 4Z5RB 3T04D 1QKZL 4F7TA 4WW2C 3WUWA 2P5WE 3OXRB 4NN6B 2E7LA 2ICCA 2MQCA 3ULUF 5BCAA 4QXGH 4IS6A 5ADPH 3FN0L 2WBKA 3UC0H 3SGEI 1QFUH 4K2UH 2CXKA 1GAFL 2D7OA 5T1KA 3GDBA 2CH8A 1BVLB 1KG0B 5JR1L 3FO9A 5JPMA 4LPTA 2EICA 5EZJA 1QRNB 1FFQA 4JDVB 4JM2A 3QFJD 2WWKO 1PVHA 2X4OB 4HXBH 2OP4L 5L0QB 2Y6SD 4HGWB 2QR0B 3L5XL 3EW3B 3FFCB 2AP2A 2I9LA 4XCCH 1QHPA 2YD7A 2GTZA 3BDYL 3W39B 4NQCE 4FXGA 2WP3T 3TC9A 5D6CB 1JHTA 4RAVB 3B2VL 5FUCC 4Z7OF 3GGWB 4OT1L 5TQ2H 4NIKB 1Y6NR 3LEYL 3U36B 1JZ3A 3K0WA 1FSKC 4ZSOB 1SBSH 4Q9BA 3TNNB 1LO4H 2JJTC 3ESVF 3G6DL 3JTTB 2NY2C 1MFBL 1UXWB 2P7TA 1FC2D 1IEAB 3WLWC 1T1XA 2PYFB 3MV8B 1WWWX 1YUHA 4Y19B 3K81A 3LQAH 1SJVA 4U1GB 4XAKD 4KZEL 1AC0A 1NMCB 4YDVB 3L3JA 1BQSA 2DIBA 3HE7B 1S7WB 1DBJL 4GKSA 2NXZD 5IJVA 3TA3B 1NLDH 4ZTOL 1EUUA 2W59A 4X6DB 3REVB 1CE6B 2X9XA 1HEZB 3PXHA 2CIIB 4BZYA 4U1IA 1MCOH 3H9SA 3MRBB 5IBTL 1NSNL 1UM6H 1TDQA 5D96B 3TYGL 1CVSC 1F6FB 2AV7B 4U2YA 2HVKB 4P5MA 2BNQA 3OZ9L 4NJAL 5DJ2B 3ULUC 4EIZC 3O9WD 4BFEA 5E8EA 3JWDC 1UQSB 3RWDB 2HFEB 1P4IH 3ARFC 1BD2D 5B3JF 2WAHA 3G5VA 5C0AD 2B1HH 2IQ9L 1MY5A 3OAUH 25C8H 2AVGA 3QULB 1U92B 3S34L 3BGFC 3ARBB 3UTTA 3T2OA 1IJ9A 3VXOB 5IIEA 5L6YH 1J12A 4NZDA 5F89B 3SO3B 5E9DA 3DMMD 3TIEB 2FATL 3T2NH 1HXYB 2F54A 3VFUB 4XNUH 1CD9B 3RNQB 5GGVL 2B20A 5EU6E 3QWOB 1OD9A 2YUZA 3EYUH 5E8DL 5L8LB 3FFDB 2O61A 1RVFL 4ZTPH 3QCUL 4MNQE 4HKBA 4LLDB 1MWAA 1CGSH 1RJYB 1MH5B 4KK9D 2PYEE 4RAHA 1OM3H 1D5ZA 3KYNB 1NAKL 4ZAKA 1TETL 2R9HD 1AHWC 5FYJU 4YXHH 2AXGB 2R69H 3RL2A 2HVJA 4D9RE 1CICC 4U1HB 1GC1C 4OQTH 4TVPD 4YHPA 1ITCA 2ED8A 2NY7L 1ES0A 4IRSA 5HPOA 1CL7L 5CJXC 5CEYB 3T2PA 4ZO7A 3P30H 1L7TL 2HJLA 4JG0L 4MNHA 1M7DA 5DVMA 1U8PA 1WAAA 4HIIB 3FQWB 3TT3H 4PJFF 3UJJH 4BH7B 2GITB 5I1KH 4OV5A 3QUYD 4X7FC 1BGXL 3NCJL 1A7NL 2Q6WA 2VH5L 5E2VL 4F9PA 1UADC 3MNVA 3ZKNC 1U8QA 4L8CA 1BMGA 5CZVL 2QL1A 2YMXH 1BFTA 3FOLB 5L7XL 1A7QL 3DVNB 1FDLL 5F9AC 4GSDH 3W9EA 4PP2A 1BOYA 4ZFZB 4WNQA 1MHEA 2YUVA 4RZCB 5I2IA 4RX4D 1UC6A 3T4YA 4R97B 2E6PA 2EO1A 4OI8A 5EN2B 2W60A 5IT2L 1A7PL 1CCZA 1SEBB 3MV9B 1N64L 3WNNA 2FGZA 1RIUL 5HHVL 2DOCA 2GI7A 4WHCA 3UBXI 2HT2D 2VL5B 1CLYH 3INUH 3CJJA 2I5YH 1MFDH 4G9FD 4OGXL 1OPGH 2XZZA 3KPLB 4P23D 1MCPL 3JV6B 1IEBB 2PO6A 1JPTH 5CZXD 4NN7B 1S9YB 4F2MB 2Q7NA 1R24A 1VHPA 1MCDA 4M7LL 2OK0L 3C09B 4FN0A 5K59E 2AJXH 4QGTA 5F7MC 1YJDL 5DTFB 5DK0B 5BOPA 2QBWA 2XZAH 2ZUUA 4I3SH 5MHSD 4EQ2A 4P4KB 2DWEB 5GJSH 3B9KD 1AI1L 4ZS7L 2JJUA 5D7KD 1R3JB 5F93C 1J05B 2YN3A 3CNKA 4I48A 4K7FB 1H8NA 2BCKA 1NQBA 3MJ7B 3PV6A 5D7SH 5FHBH 2K7PA 2BSRA 2W38A 4XPTL 1OD7A 5E24E 2ADIB 4PJ5D 3MUY1 1E6JL 5J3HC 4F15C 1RZ8A 1T21B 2MMXA 1MCCA 4FFVD 2UV3A 4X98B 5D1QD 2HLAA 2JF1A 2P24B 3KLAB 3ARYA 4XGZA 4RFOL 1Y6MR 1ND0A 2H32B 3FQRA 3D9AL 5DJ0B 3WIFA 2IBZX 5IGXH 5IBUB 4X6DF 2BOBB 2VLJB 3BKCH 4WENB 4LCYB 1T03H 3ORJA 4Z7WB 5E00B 1JZ5A 1CU4H 3D3VD 3UROR 4WTZG 3RWIA 4L8SC 5IROA 3AREA 5AAWA 4YJZL 4W4NA 2WLYA 4U0RB 2VWEE 2MHAA 2XWTB 4BUHA 4RAUB 5T5FH 2PW2A 3RWHA 4NN6C 3OKMA 3DROB 3SEPA 1T0PB 4FOMA 1IGCL 1XF3A 3MJ6A 2BNRA 2R0WL 3IAPA 4YPJA 1NCUA 4HQQL 2DN7A 1RZJC 3KPNA 5EC2A 4PJBB 3DYMA 1KELL 4HIJA 3HRPA 5AYUL 4KHXL 4WW2A 3P40A 2EH8H 1PDKA 2WMPA 1XGUB 1Q72H 3MNZB 1DN2A 4LCIH 5DD1H 3TBVB 5CD5C 1AKJA 3LN5A 3MACL 1ZHBB 5EUOB 1I3RA 4Y5XB 2A9NH 4IIQC 1JGEA 4R9HA 5L0QC 4LSPL 3MRIA 3WFCH 4HUNB 2JELH 5HHOA 1DR9A 3QFJB 2Y23A 3S37H 4H26B 5EU7E 2ERJC 1NDGB 1U93A 3O8XD 3QUXC 3TN0A 5JQHC 3ZTNL 4J3XA 4EI5D 5KSAD 4CBPA 1CFQA 1NANH 3QJHA 2QHRL 5LGKA 2NR6C 1AGCB 2ZCHL 2HWZL 2WBJA 3NIFF 2Z8RA 1LO5A 3RAJL 4WUKL 4ZNEA 3LKQA 4FZ8H 3RWGB 4RWHA 3T0WA 5DS8A 5DMGD 3DRQA 1OSZB 3E1F1 3IF1B 4HLZG 4LSTH 1BREA 4OLXH 5HDQL 2B1AL 5LCVL 1NMCC 1HINL 1F4AA 3FJTA 1YMMA 3KHQA 3ROLA 3E2HC 2Y36L 3HE7C 5AZEL 4LKCB 3VXME 5GGSB 5K33A 4JLRB 4XP5L 2JJTA 4JKMA 5IK3B 1FZOB 3I6LE 1JIBA 4TNVF 1YEHH 3AAZA 5DHYB 5HI4D 2P45B 1K4CB 3QDJB 4POUB 4JY5H 2AEPL 5E1AB 1KIPB 5KW9H 1WCBB 3QH3A 4F9LC 4HT1L 4KMTH 1FNSL 4AG4H 1QVOB 4RRPG 4R26L 1F58H 4JKWA 4CJ1A 5C0CE 3V52L 4CMHB 1F5WA 3LD8C 1HILB 2JB6A 1AR2A 4X5WB 2C3HA 4N0FA 2WSKA 4N1EA 4EQ3A 3QEQD 2R23B 4HAFA 3O45B 1U3HC 2B5IB 3FT2B 3L3IB 3VXNA 3W11D 3WXWH 2GCYB 2WIIA 3FRPG 3LZFL 3NIGF 4G7YL 4KROD 3TLRA 3SO3C 1BD2B 3W81A 2H6PA 5IUSA 4Y8AA 1BHGA 4EDWL 3QPQD 1ZHLB 3F7YA 3PE9A 2VLRA 2ZUXA 4OZFH 3S35L 2BRRL 2OMNA 4GAYA 4JN2A 3SKNA 4E41A 5DZLA 4DUWA 5C09B 3EOAB 4PJXE 2HH0L 3NA9L 1K85A 2IPTH 4OFKA 5IVOA 3QQ3B 2ORBH 4OF5A 3LY6A 4FNLH 4G8GD 4NO0B 2AKRA 3LKNA 2BFVL 4ZOAA 3QO1B 4Z76B 4JPVH 1FGVH 4YGAB 1X5AA 3I6KB 1P5UA 2PTTA 5DMIL 1T2QL 1F6AA 1KCVH 5EWIL 3GSVB 2FGWL 2ARJQ 4FG6D 3KYOA 4XMKH 4YDJA 1ZSDB 4OLYH 1TQCC 3SE8H 4Q0XH 1LP9B 1S7QA 5D2NB 4L4VE 4V2BA 1MFEH 2MTPA 1I1RA 1WZ1L 1INDL 2I25N 5EFIB 4HFWB 5L2JA 2PTUA 1U8MA 4S1DD 1AHWA 3IJSB 3K4DA 3RI5K 3BN3B 2DQGL 3KDMB 3T3PF 3S3SA 2EIZA 1CICA 1FZJB 1JWUA 2DDQL 3V0VA 4EI6B 3S35X 1QRKA 4Z7WF 4U31A 1C1EL 1EV2E 4PYGA 3QUKB 1U8NB 2P1YA 4LLUA 3HMXA 1T6VN 3KJ6H 4TTDD 4H0IA 2ADFL 4OGAD 4TPRL 1G7MA 2CLVA 2FR4A 4D9QD 4HCRH 3K1DA 4KRPC 1ZLSL 1FL5B 3DI3B 1JV5A 4CMMB 3NAAH 5T3ZL 2A6JB 4JB9L 1A6UL 3UTZA 2ITCB 2DBLL 3M17B 4Y89A 4N0UA 5GGTL 3QO0A 4LLAA 4NM4H 1Q9OB 4JZOA 3DSFH 2OZ4A 1EIBA 3ZL4H 4PJBF 3MUJA 3HZKB 1NC4B 4L4TD 2V7HA 4M1CD 3LKPB 3MRKA 2F53D 3KS0J 4PJIE 4F7MA 4H25A 5EUOF 4C59B 2OZ4L 3CFIC 5JZ7D 2EKJA 1XF2B 3VFOA 5LBSH 3CCHA 3GJFA 5BRZA 1N0XH 4NO5B 3QXUA 3KG5A 4UOW0 1GH7A 2GKIA 4QWWC 4LLWB 4XVTH 4M7KH 3UBXG 1D5IH 5EIQA 1T89C 4YHIA 2RFXB 3FQNA 3LS4H 4ZUWA 5T3ZD 5IWLC 3G5YA 1MJUL 3ZDYF 2R2CA 3QHFL 3IXAA 1OF2A 4HPYH 1T1WA 3QQ4A 3QRGL 2HLFC 2Z4QB 2IG2L 3EBAA 4LP4A 1K8IA 3W0WB 4YIQB 5CMAA 2CR3A 3BJLA 5HVHB 2BVUA 1J8KA 1XR9A 4HKJA 4PJ5B 1CTOA 1A4JA 5C9JB 2GT9B 3VJ6B 1JRHH 3BEWA 3H0TA 5D1QB 2DMBA 4UB0L 1I8LA 4OM1L 3SOBL 5FEBA 1HK6A 2KH2B 2IGFL 2DIAA 1DQJA 2R15A 5IQ9A 5CP3H 5JA8B 1R5VB 1V3LA 2PETA 1AGBB 2V17L 5BXFB 2YBRB 4PJFA 3D39A 5A16B 3CMOH 3DXAA 3ZYOA 1FGNL 1H3VA 4WW1B 3ZKSD 2AJSH 3NABL 4D0CB 1QBAA 3QDGB 4JPIA 2Q8AL 4NBZB 4PR5A 3HI1A 1IILE 3MRNB 1VFAB 3SKJL 2FX8H 2NY0D 3IDYC 4Z5RA 4FQ2L 4HEME 3OXRA 5LQBL 4YHOH 4Y5XC 4XVJH 4XC1L 1WFUA 3RVVD 2EDJA 3EO9H 3PWPB 1EO5A 3MLSH 1KG0A 1D7FA 3CFCH 3RZCD 5E94B 1F90L 2FNBA 4J8RB 2LE9A 1QRNA 1X5JA 2Y6SC 4LCUB 5JHLL 4JDVA 4YDIH 2AABL 3V4PH 2X4OA 3U4AA 1EJ6A 4HGWA 1A6WH 2Z0BA 4HK3J 2QR0A 2WUBL 3QG7L 3FFCA 2RB8A 3QAZB 4X6BB 1P69B 1E6OL 3NMEA 2LV4A 4J3SA 5AWNH 4NKDB 3W39A 3TIDB 4HUWB 4H20H 5D6CA 4RAVA 1C5CH 4AM0B 4BK5A 3GGWA 4NOFA 3U36A 1GZPB 1PY4A 3MLXL 1RU9H 2MKLC 4PS4L 1LP9F 1FIGL 3TNNA 3U0WL 4G9DB 5GHWL 3MLPA 4D0DB 3JTTA 1UXWA 4ODWB 4AH2A 1IEAA 2VISB 3WFHB 2LQRA 2B39A 3B5HA 2PYFA 1D3CA 3MV8A 4ZD3L 3MZTA 5HHME 5I1DB 2NXZC 4J6RL 4Y19A 1KEGL 3QNYB 4YDVA 1FRGL 1BZ9B 1T5XA 3HE7A 1UEYA 2PCPA 1S7WA 5SWSE 4J3WA 3TA3A 1JGUL 3W9DB 1D5XA 5DRNB 4X6DA 3REVA 1CE6A 3VG0H 1HEZA 1U58B 4UINL 4OD1L 2CIIA 2ILLA 1HHJB 3BXNB 2BDNL 4YX2H 1GPOH 4L9DA 1CFNA 1FVCB 5GRVK 4PRPD 3MRBA 3O9WC 2IAMD 3GRWH 4F9LA 3GSOB 5T3XH 4BZ1H 2AV7A 3PHOB 3QEQB 1T1YB 2HVKA 3GKZA 4OV6F 3LSOB 3ALXA 3Q48A 5DJ2A 2NY6B 4LFHD 3VA2C 2Q8BH 2AK1L 1ADQA 2HTLC 3PGFH 2HJFB 5ICXB 4KROB 2HFEA 1DQQB 1BECA 1MCBA 3LCYA 3C5ZD 1S7RB 3VD5A 4MZ3A 3RY5A 1EBAA 1M05B 3GIZL 1NCWH 2VDNL 1XF5A 2YZ1A 2CK2A 1P84J 3ARBA 4WEBH 3VXOA 5HGBB 4X80H 5F89A 1I1AD 2AW2A 4KQ4H 2VDKH 3TIEA 1QSED 4JQVC 4E42B 5EU5B 4FQJH 1HXYA 1U2CA 3FB7B 3RNQA 1FL6B 4M1GL 2C7UB 1BIHA 7FABH 3RTQB 4G8GB 4KK9C 3GBNL 1HCFX 3SGKA 4OFYA 5T3XE 5BS0E 3REWB 1YEDB 2HN7B 3TPKA 3OKKB 5F7HA 4LLDA 1FG9C 1OP3H 5JA9A 3QUMH 1MH5A 1F45A 5FYKE 4HKXB 4HMDA 2R9HC 4P46B 5D2NC 1SJEB 2D0GA 2RCSL 3SGEH 5HDLA 3KYNA 1J7VR 2EE9A 1FPTH 4D9LL 1MFAL 1RUKL 2YPVL 2J8UB 3DX7B 3VCLB 3L1OH 3O3DB 3UYOD 3SBWA 2R4SH 1RMFL 1SMOA 3S36L 4U1HA 1EO7A 1NGZB 1S9VA 5EA0H 5C2BH 5ITFB 4K71C 3LRSB 1RV6X 1NBYB 1KJ3L 3UX9B 5HYEA 3FRUB 5CEYA 1AQKL 3H9HB 3QUYC 3CU1A 4K8RC 2BOCA 4G6MH 4DW2H 5I30L 4FQLH 4FQHB 4PJGE 5AYQA 4TUJB 3L9RA 4HIIA 4NO3B 2F5BH 4FQXB 3VWKD 4BH7A 2V5MA 2JCCE 3BT2L 4LIQH 1JTPA 3TZVD 4K3JL 5JOPD 4MXVE 4QTIL 1DBAL 2X05A 5J89A 4PJDE 5IVXB 2X1WL 1TZHB 4AMKL 5L8JB 3FOLA 1CDJA 1T80A 2J1KA 1DQDL 3F7VB 4PGEB 4U4BA 4ZFZA 4U1KB 1SHMA 2I26N 5DJAB 4RZCA 4X0KB 5FM5O 2F58H 1OQXA 4NC1C 1KPVB 1MCHA 2FJFB 4N1HB 4ONGL 1C16B 1D6VL 1UA6L 2ESVA 2LABA 3CIQA 2DQTH 1TZIB 2DL2A 5EN2A 2HT2C 3ARUA 4HC1H 1BBJB 1SEBA 1SBBA 2EDFA 3CSGA 3MV9A 4B0MM 4YHZL 1F2XK 4PB9L 5DD6B 4GLRI 3WIHA 1Q0YH 2DTMH 3IFPB 2VL5A 3QWRD 1JYVA 3ZDXF 2C4FU 4MA7L 3SGJA 5JHDD 4HSQA 1IEBA 1J11A 1UCTA 1MHHB 5TE7H 4LIQE 1S9YA 3VFGH 3QZWG 4JFOB 1E4JA 3OAYK 1GHFL 3HC4H 3RX8A 2DMCA 3C8KB 3OGCB 4EIGB 2O5ZL 4HWBH 2R2HA 4D8PB 15C8H 3M1BB 3U6RB 5DTFA 5DK0A 3MLRH 3WKNA 1JF1B 1II4E 1T89A 4P4KA 5I8KL 1CQKA 2J7LA 5HVHC 2VXVH 4DJMA 3L5IA 1MHPL 1YY9D 5IWLA 5E7BA 5A1AA 1LEKA 2LU4A 1R3JA 1FYTE 2V9RA 3TCXA 3MXVH 5DUPL 3QR2A 2P8LB 4EOWH 3MJ7A 5FF6B 3ZYIA 4FFVC 5IQ7L 5D1QC 5IMMB 4GAGL 2R2BB 2YXMA 2XQYG 1DEDA 4JQXC 1MOEA 3MRQB 4DVRL 2D7PA 1T21A 1G6RL 1BQHG 2P24A 2XICA 3KLAA 4KV5E 1YJDC 2H32A 5DJ0A 1PLGH 4NN5C 1XMWA 2VLJA 4QY8B 4LCYA 3FHAA 1ZK9A 4EEEA 3GHEH 3HZVB 4Z7WA 5E00A 1ZLVH 1YNKH 2ARWA 1HZHL 5I1JL 4PJ8A 2DMKA 1W72L 4WFHD 4I2XE 5GS1B 3C5JB 2ZCLH 2VITB 1JPSH 4JHBA 5HBBA 2XWTA 3HAEB 4RAUA 5D7LD 1QFWI 3DROA 1RPQA 1LO3L 1NEZB 3GB7B 2GHWB 3OAZH 2EZ0D 2NY0B 3BVNB 3MJ9L 4M6ML 4KGLA 4IDJL 2UYLB 3VD9A 1N4XL 1BIIA 2A74A 5TDOB 5DDHA 3B8YA 4WO4B 4PJBA 4O2CB 1CXIA 5E8NB 5JW3H 3MNZA 4O2EB 5FHAH 3WFEH 3TBVA 2FHBA 5JDSB 2ZKHH 3MGTB 1ZHBA 4LASL 1JTTA 1EZVY 4RSVA 1LNUB 4FQ1H 3NCMA 5D1XB 4EI5C 5F9OL 2YA1A 3QIWD 1P6AB 3QAZC 3QFJA 1JHLH 4H26A 3P3YA 2YWZA 4JFFD 5GISL 4PJEB 2YD9A 4HJJL 4KU1A 5ABDE 2W9DH 4F57H 3DURB 4LOUD 4XWGL 4EN3D 3LH2H 3PP4H 2VUYA 1AGCA 4JZNB 4LSSH 2MPAL 2NTSP 2ICWJ 4H1LA 4XCNB 3RWGA