3KJ6L

Crystal structure of a methylated beta2 adrenergic receptor-fab complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFIGTGSGQDYSLTISSLDYADMGIYYCLQYDEFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Beta-2 adrenergic receptor
publication title Ligand-specific regulation of the extracellular surface of a G-protein-coupled receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2009-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kj6L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kj6L01
2M2DA 5L0QC 2X10A 3B83A 3H9SE 3VGHA 5EFIA 4YXKH 1P53A 1D5BB 4LCYA 4YR6A 4NHCH 3IJYB 5TDOA 3LEYH 1RURH 1CFSA 1UH2A 4MLIA 5GRZA 4KTYA 3E6HA 5JLZA 2W9LA 1U9KA 2D7OA 3GSNH 3VXME 1FL3B 3U46B 4MXVF 5AG9A 5KVFL 4JFEA 1FO0A 1X5JA 3MOAL 5EO1A 1S7XB 4GQPH 5HHVL 3ARGA 4JFFB 3KLHD 3GSXB 4LLQA 3TBSA 1L7IL 1JGLL 1ACYL 4QXUH 3CVIH 1A6AB 3RVTD 4CU6A 4S1QL 5DRXA 5EU7E 2XY2A 1UENA 1MFBH 4TULL 4O5LH 5T3ZE 1YY8B 5SWSE 3PXJA 2EYTA 4MYWB 4RX4A 1CF8L 5BS0B 2EC9U 1A1MA 4Y4KA 1CD0A 2NTFA 1K8DB 3KXFA 5E5UB 2YXMA 4Z0XB 2AXGA 1I1AA 3UTSB 4PS4H 3WUWB 5KVDL 2QQNH 1NDGB 1TVHA 3LVEA 4KVCH 5C0IA 4I77L 1H0DB 5E99L 4LF3B 3HAEG 3RUGF 4B0MM 5IB4B 1RFDH 3BN9D 3ZKMC 1KIRA 3V5HB 3LKRB 4HIIA 5IBTL 2GSIB 3SDDB 4FP8L 5GGVL 3OXRB 4WRLA 5B39B 5D7LD 4PGBA 3DVNB 2FEDD 4Z76B 5D1XB 2IANA 1TENA 5DD0L 3L5XH 1F13A 1V7MH 3ZE1E 1ZHNA 5D7SH 5GGTH 5IV2B 3V4VL 5TQ0L 1BECA 1AXSB 3QXAA 5IJKA 2P1YA 1QA9B 1NGYA 2GJZB 4P2YA 4TSAH 1LK3L 3I3DA 2Z8WC 3R1GH 5C6TH 5CJXA 1CFQB 1NC4A 1U8OB 5CP7B 3TO2A 3U2SA 3UTPD 3BGFB 2F53A 1DR9A 4ELMA 5DD6A 3K81A 3VFUB 4JFXB 4UTAL 4WUUA 5DUML 4M7LH 4NC0B 1ZT7A 1OGAD 4KMQA 1FNEB 3EIFA 4JFOA 1WAAA 2E7HA 3RVWD 4NO3A 5JOEA 2NMSA 4UMGA 4FABL 4HD9A 4EUPB 4XXDB 4P5KB 1JNJA 4KRMB 1JUFB 3STZA 5DJYB 4X8XA 4NQCB 2N4IA 4QRSB 3T3PF 2Y5TB 3CNKA 1MAJA 4PP2A 1NMBH 3HG1D 1AY1L 1U93A 1YPZA 1LEIA 3RHWK 2CDEB 4JZOB 5FHAH 4WGWB 4Z7QE 3D18B 3TA3A 4NM4L 2BNQE 4LRIC 2R2HB 3LB6D 5EOTA 3QUYB 5DQDH 3UROR 1YC7A 3MYZA 3DX8A 4OCSL 2FECI 2FSEB 4PJAA 1JV5B 4JB9H 4ODWA 5EBMA 5JA8B 4U6XA 3D2UA 3A6CL 2DQHL 2R1YB 3K2MC 1U58B 2CIKA 3LKPA 4HUMB 4Y4FC 5EOCH 4MQXC 3PGCA 3O3AB 2XG5A 1T5XB 4G3YH 4OFYD 1J5OH 5HDQL 4F58H 4K3DL 5DEFB 4FXKB 2AJSH 2IMMA 3WJLC 5HI3C 5C6PB 3RGVA 5EO0B 1LO3L 4C56E 4HIHA 2VL4A 2X4OB 2HKHH 4R7NA 2LU3A 2NY6B 1OTSC 2V5SA 5IQ9B 5E8DH 5I8EB 4FTVD 3SCMB 2E8YA 3QCUH 4Z6AT 3SKNA 4X6DF 5D7JB 1EO5A 1IC5H 4Z7NE 3EYOA 3EYUH 3Q2CA 1VACA 5I76A 4CAGA 4L8BA 1XR9B 5JPMB 3AS0A 5JW3L 4PJ9B 3KYMA 1HXMA 2ZSVA 5I1HH 1KTLB 2YD9A 4GW1A 4F33B 3UYOD 3H42L 5C3TA 4MD4A 4MS8D 3OSKA 3ARXA 4OCXL 2ZUVA 3OHXB 1EEYB 3FB6B 3BPCA 3BPLB 2GJ6B 5HHMB 1P7KB 1Z3GH 2YWYA 3I3EA 1LP9E 4FQIL 3PNWB 5BV7C 2W9DL 3NIDE 3GIVB 4M02A 2GAZB 4WHDA 4GRLD 3SY0B 2DAVA 2NY0B 3CPLB 4PJ5D 3L95A 4F3FB 1JPGA 1N8ZB 1JGVL 3T65B 4ODSH 1R5VB 4AY0A 3S36H 1I8KB 3N1GC 3T09A 4UNUA 3PWNA 2V2WB 4M6OH 2BJMH 3S96B 1H9VA 5IGXH 1JRHH 4L3CA 4BSWA 5LQBH 3ARFA 1NANH 1Q1JL 3C60C 4FQHB 4ZFOA 1F6AA 1AJ7H 1SVCP 4ZO6A 3IYLW 2GUOA 2MWCA 4YDKL 4GG6F 5F96L 2QEJA 1DN0A 1E4XL 4JPIA 4AYFA 4U49A 3ZMRA 3TZVA 1F3DJ 2FL5A 1A2YB 1B4RA 4LLVA 4G9DA 4N9GB 3RIAF 2LU4A 3BW9A 2QADC 2P8MB 4OCWH 4R4BA 2FX7H 2CDFA 2CK0L 3IXAA 3F7VB 5C2BH 2EIZA 2E9BA 1F8TL 3DURB 5E6IA 2OLDA 1RZ7L 1N0XL 2DBLH 1WCBA 2DMCA 4BH8B 4CU8A 3I75B 4OIIH 5ICYB 1UH3A 4JANB 3L5WA 2HVKB 2P24A 4R9HA 2FZ3A 3Q1SH 4AM0A 4O9HL 1LK2A 4PR5A 4BM7A 4Z7WB 5KANI 5DZNA 1MUJB 1J0YA 1QQDA 4JO3H 1UVQA 5GRVK 3FQXB 2Y06H 4PV9B 4YHOH 1VKXB 4PJ8C 3DGGB 5J13C 5D1ZD 2IQAA 4M1CC 4NOBA 1FLRH 5F7FA 3K4ZA 4N0UB 1PKQE 4QO1A 5IJVB 4NUGL 2VLJA 4UU9A 5DVLA 4Y16A 5DC9B 4AIZA 1F45A 2N56A 3K7UA 5ID1A 2A73A 1IAOA 1OB1B 2IGFL 4PJCE 4MA8L 4PYHA 4Y5XA 5IEKA 1HSAA 2CUIA 5SWZA 1AE6H 1NGPL 4BQ9A 3BKCH 4OQTA 5DRZB 1I8MA 3VD3A 4YHYC 4LNRB 1OCWH 1SY6L 3MR9B 1QR4A 5HHXL 2ATKB 1AGFB 4XVJL 2C1OB 1F4XL 1PSKL 1CDGA 1KOAA 3FFCE 5FECB 4PRPA 5CS7A 5IT2L 4BZ2L 1QFHA 3P4LA 3AREA 1AD9A 4OGAC 2IFFH 3ARRA 4F7TA 5C8JA 2ZCHL 4P4KA 3WL9A 4JRXD 1S7QA 4PV8B 4HF5H 5FYKU 3KWWA 4OLYL 4ZNCD 4Y1AD 3QUMH 3AFLA 4UILL 4ELMF 3BEWB 1CXLA 4IRZL 2I5YL 4UQ2B 1CD9B 4WWKA 2X1OA 4DK6A 3BRFA 1WAAF 4QRRE 5GRWA 4FQLL 1S7RA 4GS7C 1XR8B 1ZVSA 4B7IA 1R3KA 2WLYA 2ESVE 3KPPA 1EUUA 2YPVL 1RHHB 2BVQA 3V6OC 2XTLA 4HWUA 2PYEA 3MBXH 3M8OH 3JXAA 3TEUA 5GS0C 2HJFB 3HI5L 5EBGA 1K6QH 3P3YA 2UZIH 4KRPB 4K71C 1OTUC 3C09B 4CUCA 4JKKA 5MEQA 3QIBD 1DTUA 1YMHB 3D39B 4GMSL 4JHWL 4ODHH 4K94H 2B0SL 1YC8A 1FO0L 1MHPH 2IAMD 4YPGB 1WSST 4Y5YB 2F58H 5J0BA 5TE7H 3MOBL 4PJAF 3B8YA 1S78C 4YDJB 1KJVB 4OV5B 4XP5H 1HHKA 3TBYB 1UJ3C 2Q76B 2X4SB 3HRZB 4NBXB 4M43H 3GHEH 4O58H 4PJBB 1ONQB 1B0RB 1JP5A 2P5EB 5KSAC 4KHXL 4NC1E 5I1JL 1KV3A 3TP4A 3GK8H 3PABA 1Z0NA 3H6JA 4N8VG 1FAIH 3EO1B 3AMKA 2RHEA 1WISA 2ICWB 1FGNL 3SEPA 5CEZD 2BFVH 3P40A 1GC1H 2NX5A 4FFWC 3B9VA 2J4WL 3TCLB 4PD4J 4M03A 5EC1A 5FKAA 2VDRH 4ZS6D 1BX2A 1EFXB 1DUZA 1KELL 4K8RH 1CL7L 3RVVD 1GCFA 5BS0E 2YKLH 4JLRB 4L4VB 1KJ2A 3LPWA 2XACC 2NXZC 3QG7L 4HHAB 4KUCF 3DRTA 5AUMA 5LXGH 1U2HA 3ARBB 2FJHB 4HMEA 3UTSE 2WQRA 3QCTH 2J8UA 1QBLH 3JWNC 3OAUH 1AI1H 5CSGA 1X44A 4Z95H 1KIUA 2VZOA 4M3KB 1XH3A 3BKJL 3KJ4C 3RY6C 1YQVH 3MV9A 5I19L 1HNGA 1Q94A 2HJLB 4M3JA 1CDIA 4NRZA 4M6NL 4Q9QH 1CT8A 5F93C 1HYSD 3TN0B 1BF8A 1BLNA 5TH2A 3WEXB 1T21B 5D5ME 5EULV 1AO7B 5FGBA 4MNQA 4IHOA 4UOW1 4LPCA 1HXYB 4ETQB 4KKBC 3X3FL 5HI4C 1BJMA 3GMNB 3ESUF 4JO1L 1AXSA 5I1KH 2JJTA 2HT2D 4G6KH 5E2VH 1A64A 2H9GA 5ICXB 5GXBB 4L5FH 3VXOB 3VFGH 5D96B 1AH1A 1ZT4A 1HZHL 1J0JA 3VXRA 2PW1A 5AD0A 2ICES 4F7PB 3LN5B 4LVNB 1FNEA 2FNBA 2YMXH 1DVFB 1S5HB 1VGEL 3H2WA 2ZUUA 4HKBB 3BJ91 2BCKA 4F7CB 1FFOB 4MXWH 4YBHA 2APXA 4X99B 3NA9L 4MXQD 4LFHG 4XXDA 1AR1C 3QIUB 4P5KA 5DJ8B 4KH2A 4MJ5A 4HKJB 5T33H 1I85C 4NQCA 1F00I 4D3CH 3BVNB 1J1PH 5ABDE 5C08D 1IGML 3VFTA 3FFDB 1NC2B 5I9QC 1RZFL 2Y6SC 1VERA 2PR4L 4WO4C 3B9KC 4WY7L 5F88A 1QTYT 3HE6C 5JIIA 1HHIB 4YHIA 2PTTB 4BUHA 3UBXB 3RTQC 2PYFB 4OLUH 5FO7A 1H3GA 4KUZL 4U1LB 4LSSH 1XGTB 1X5LA 3LQZB 2XRAL 2A0LD 4MHHI 5D7IB 5IFJB 3TLRA 5HI5C 1L0YA 2VKXA 3FT3A 1KLGB 1BQHG 2RJMA 1YNKH 3UYRH 1OAZL 5FA3B 3QXTA 1X4XA 4U7MA 5CHNB 3G5ZA 2R1YA 5F8QC 4QOKB 3O2WL 5D71H 3ULUF 1QP1A 5DFVD 2P8LA 3TBWA 3TVMD 4N90D 1AQDA 5HHNA 3N1QC 4DGIL 3W0WD 3L3IB 1D9KD 1QSEA 2QHRL 2EE6A 2DQFB 2EH7L 3L1OL 4TUOA 3ZKXB 1T3FB 1B90A 2RGSA 1CFVH 4YPJA 4HIJB 5IROC 2B8OT 3ARDD 3E1F1 3LEXB 5EO0A 4GW4B 1J0ZA 1ZLVH 1ZSDA 3MNZB 1QRND 2ZWLT 3FQUB 4QT5A 1BFTA 4GBXB 4YBLC 4MMXC 1SJHB 3NGBC 4NRYA 3OJ2C 4R4FH 3FRUB 4XAKD 3CJJA 1AFVL 3GUTA 4HUVA 4GXVH 1JNLL 5DEGB 3SDXE 2VLRB 1S9VA 5KVEL 1MI5B 1XZ0B 4P57A 1P5VA 1IT9H 3M45A 2XKSA 2AJYL 3GRWH 5I73C 2X4UA 1MRCL 2E7MA 2VITA 3PGFL 1G9NC 2BY1A 4PJEA 5LJYH 2GJ6E 5JHDB 5ITBL 1P7KA 1JWUA 1UC6A 1YEHL 1REIA 4NDMB 4DKEH 2DLHA 3Q6FB 4WFFE 4ZFOL 3QQ9C 3GIVA 3GJFH 1K85A 5DJAB 1MFAL 3MLTA 3WDHA 1IGTB 1N8ZA 5F7UA 3MV11 3D5OF 4Z7OE 1IBGH 2F54A 4NN6B 4DCQB 2HFFB 4K3GA 2G9HB 3GMRA 5F9AC 1BIIA 4AEFA 3UJIH 1PVHA 4UDTA 3QUMB 4RMSA 5BZWA 5FEBA 5IESL 4FQHA 5D2NE 3UYPA 4Z78A 3OF6A 4HCRH 4LAQH 3UX9B 5KW9L 4NN7C 5KZCB 5LAXB 4YC2B 1HKLH 1YEKL 5ALCL 3W82A 3LAFA 2QJDA 1TVDA 2IG2L 3QUXC 1JF5A 4RIRB 5DJDA 4NJAH 3LEVL 2J8OA 3BESR 5EU6D 5HYSA 2AQ1A 4O2CB 3OKNB 4N0CD 4RQQB 4P9MH 4PRHA 3C5SB 5CAYB 1T22B 4JREC 3FO1B 5GJTL 1NDMA 3EOTH 3GSRB 3RKDD 4Y5VC 4M48L 5DK3A 1Z5LA 1OAQL 3P77B 4OZ4B 2ADGB 1NFDB 4MD0B 3ULUL 3PIQB 1FRGL 4H1LG 1T03H 3UP1A 1C1EL 3NTCH 3IDGA 1S7UB 2A2QT 3RL1B 3V0VA 1OTTD 4OQTL 4WDIB 1EPFA 2FJFA 4N0UE 3GSNA 2J8UF 5A2LH 5TFSL 1U8PA 5MERA 4GUPB 3IDUA 5M95B 1FNGA 1VENA 2JIXA 4YHPB 2H2SD 4OM0H 4YEEA 4KJYB 3MOQA 5A2JH 3O6FA 4OB5L 4LU5L 1QFUL 3WLBA 4KGJA 4U0RB 1VEOA 2XKNB 5BQ7A 1X9QA 1IZKA 4L8DA 3C8DA 5FYKH 1CLYL 1HH6A 1U3HC 4GSDL 3O6KL 1AGFA 1NLBL 4G6FB 2MPAH 1UJ3A 1DL7H 2NPLX 2V7NA 2V7HB 3G08A 5EU7C 1XF2B 3KR3H 1EEUA 5GGVY 2ED7A 1WEJH 4Y2DA 3PWUA 1EBAA 2HTLD 2QR0B 3U9UA 1C5DA 2CLZA 2IBBA 1A3LL 5CWSA 1NCCL 3LZFL 3K8MA 4XGZA 2C9AA 4UT9H 5D1QC 5E8PA 2VISB 4X83A 1JYVA 1WC7A 4YUEH 3RPKA 5DHVH 5DUPH 5IB1B 5C0FA 4RFNB 1ZGLM 2XY1A 3IFPA 4HX1B 1JZ4A 3O41A 5I1AB 2FD6H 5INDA 2VXQH 1IQDB 3BN3B 2IADB 2IWGA 3LKSB 2FO1A 1OGAB 4G7YL 5DURD 5C0JA 1S7TB 4AH2B 1Y18A 5F9JA 2RQ8A 1D5XA 1I7UB 1T1ZB 1B9ZA 1NBQA 4GKZA 2WIIB 5GGTA 3WHE1 3QRFM 1W0WB 3FT4A 4Q6IC 2D03L 2C4XA 3RIFF 2X9YA 1HSBB 2WP3O 3V5KB 3VGAB 2EDYA 3KYKH 5JW4Q 4E41A 1KJ3L 4D2NA 1YECH 5DVMA 5EU4A 3WIIH 4D9QE 3JTTB 4LSPL 1SQ2N 1HNFA 2F74A 3D39E 3HG1B 4IMKA 3DECA 4XAWL 3NPSC 5IVNA 4G8FA 4AEHL 3PQYA 5D6DC 3RWFA 4YPGA 3L7FB 4MJIA 4J23A 4PJGE 1D5IL 4NQEA 1U8NB 1YN7A 1L4IA 4MZ3A 5DJ0B 3TCXA 1JWSB 1JHKL 4OTXH 1A7QL 5IEHB 4F7MB 3I6GB 1XT5A 4R97C 4QXTA 3VWKC 4MX7B 2OJEB 5EH1A 2R69L 1CZ8L 2R4SL 4XCNB 3X12A 2HTKD 4WFED 5E5MA 1SYSB 1A0QL 1MIMH 2ARJQ 4N5EC 1KJ2L 4LOUC 5SX5H 1RQ5A 2HRLA 4DGYL 2BHYA 4XPFH 4KK9C 3IU3A 2XG4A 1FPTL 1FFQA 3O4OC 2F5BH 1ZMYA 3C2SA 5D8JH 5IBUG 4MA7L 5IVOA 4HWZA 1NUNB 2ZSWB 5SV4A 2YZ1A 4QXGL 5BMFL 2W60A 5DSCB 3B9EA 3TJEH 5CILH 3HN3A 3QI9D 4FTVB 4LSTL 4UOJA 4EI6A 2BOBA 4ZQKA 3C5ZA 4ZTOH 5GISL 5HYFA 1CE1H 2PCPA 3DYMA 2QQLL 1SM3L 2OTUB 5TDNB 5IW1A 4H5SB 4ZFGL 4XXCA 3OR6B 3RVUD 1JI1A 3PUCA 4ZFFA 2IC2A 3B9KA 5K9OA 4OV6F 1K3ZA 4PJEF 3QEHB 5FGSA 2PXYD 2EE9A 4HH9B 5HHQB 4P3CH 3ZDYF 3RTQA 3FB8B 2SEBA 2IH1B 4JFYB 4ISVB 3V4UL 1XF4A 2NYYD 3WLWD 3OB0H 2R2CA 3TN0A 1P9MA 2BSSB 4LKXA 5JNYA 2DTML 1A6ZA 5EZIH 5FO9B 3FCTA 1XF1A 4JPWL 4LVOC 2ZPKL 4PRBB 4IIQC 4I18C 4GRLB 4MAUH 3FB7A 4PJ5B 3GMNA 3WHE0 5HYEA 5CBEB 4HC1H 3S88L 1EGJH 1OOAA 4D0BB 3DBXA 1D6EA 3SDYH 4J6RL 2C5DC 3VXOA 1CDUA 1KIPA 4LEXH 5I1IH 3QT2A 4ZUVA 4UV4H 4ZO9A 3C6LC 3SBWA 5SX4H 1NLDL 2AEIT 3KNBB 2H45A 5CCKH 5J11C 3LN5A 3MGAA 5GRUL 3MRIB 2A9NH 2GK0A 3I2CH 4X4ZA 2ZZUT 3PJSA 3FOMA 4M93C 4WI9A 3GJFB 4TTDC 5IB3B 4HJJH 4QHLA 1VFAB 4CJ0A 3RZCD 4IEFB 3FHQA 1I7ZB 3T77B 4S10A 1UH4A 5CJOH 1WBXB 3CFJA 5BV7L 2P5WD 3PDGA 4NKQB 3QEGL 4ZXBC 4X98B 2RAMA 4U1NB 1NC2A 3DO3A 3LQAL 4ZTPH 1A7OH 3JZ7A 3WXWL 3WHXB 1I7RA 4D9RD 1HI6A 4G6ML 3LKOA 4EBQL 4Z7WF 5J06A 3ZSSA 4CDGC 4U1KB 2PTTA 1A6TB 5E2UH 2DJ4A 5AWNL 3VGFA 1UYWH 1XGTA 1F3DH 2F8OA 3AUVA 2EYRB 2KUTA 5D7IA 2YD5A 4GFTB 2PNDA 4HK0A 3WNOA 1TZGL 5FCUL 4LCCC 2OJZH 4FQQB 1N6QL 4JJ5B 5AAMA 3N85H 3NVQA 3VFWA 4O4YL 4JDVA 5J1TC 4WU5B 4N1EA 3FMGL 1T7ZA 4QTIH 5IW6B 4WTZG 4P5TC 3WFCL 1FNSH 1R24A 1Q0XL 3NIFE 1T3FA 4GT7A 1TPXB 4XP6L 4IMLB 4ZUTA 1NAKL 3HKFA 3OAYK 4NQDA 2A6JA 4OLZL 4YX2L 3WN5C 3LS4L 1EJ6A 2RFXA 2YXFA 3EHBC 4JFZH 2XWTB 4JPKH 4NIKB 43CAB 3D85A 4M9PA 2BP3A 1BQLH 4RWHA 4XRCA 3EYVA 4HDIB 4L4TB 3GM0A 3PGDA 2VLRE 4JRXB 3G5VA 4M00A 1I3GH 1F3RB 2OXHA 5F44A 5E9DD 1RU9H 4Y1AB 5DUBB 5FKPA 2E6JA 3PL6D 2D7TH 4Y5VA 4X7TB 4HS8H 4XVUC 1QPXA 1LO5B 2AGJL 4JR9H 4CMHB 5JHDE 1TZHA 3MRFB 5LCVL 2BC4B 2YA0A 4NZRH 1G84A 3QBTB 4WFGD 2H26A 2IQ9L 4X6EA 4HMDA 5CUSL 2ADFH 3O8XD 1J8HD 5DDHB 4RAUB 1A3RH 4MCYB 4TQEL 2UY7A 4WUKH 3WS3B 2NY2C 3VXMA 2FEEL 2HFFA 1WFTA 4PUBH 5JHLL 1S9XB 4MQTB 2Q86A 2HRPL 5JOFB 3OWEA 2EKSA 1MVUB 1IGIL 4YXLL 3SDCD 2EEAA 1KCUL 4HBCL 4KPHL 3B2UC 5E7FA 3B2VH 3CC5A 4OIAA 2IAMB 5MP6L 4MNGE 4X4XA 3DO7B 1QHOA 3ROOA 1QEWB 4PJBF 1A6VL 3R8QA 2OP4L 2H8PA 4PG9A 4KI5F 1RUAH 5JXEC 3UPRA 1QKZH 4WHTB 1NJ9B 4YE4H 4YXKL 4YO0B 3MCLL 4FQCH 3QO1A 4NHCL 2CKBH 1SBSL 4Z7UB 3LN4B 5DYOA 1DLHB 2R9HD 1GRWA 4DZ8A 4OI8A 3OTTA 1RURL 5ANME 3C5SA 3WIHH 3GSNL 2L4OA 4RAVB 3OB8A 5IP4A 2APBA 3WJJC 1SYVB 3D9AL 3HE7C 3K80A 1X5IA 2AJVH 3HAEH 1PYWA 4OZIB 3UMTA 3TV3H 5TDPA 2VL5B 1VGKA 1CVSC 4QXUL 3AB0B 2DQEH 12E8H 2PW2A 4Q6IA 3QG6B 1U95B 2ADJA 4RMVA 2BVUA 3IS1X 4JCMA 1E4KC 1MFBL 4FG6D 4O5LL 1BAFL 1ED3B 4RAHA 4L29A 4JFPB 1MFEH 4U1IA 3TBTB 2DQTH 3QXVA 4Y89A 5KANG 4LCWD 5D6DA 3BE1H 3DMMD 3FONB 4P2RD 1I4FA 4PS4L 3WE6A 3X3GH 2VYRE 4YZFE 2EYSB 1U3YA 3ARWA 3ARYA 5D7LE 1OPGH 3KJ6H 4ZUUA 2YN3A 1DANT 5DHYB 5IWLA 3MBED 5IBLC 3SE9H 3QWQB 1UA6L 4G6JH 3BGMA 4PRNB 4QHMB 5C0CD 5FA4A 3QQ4A 2DM4A 2CLVB 5T1LA 4AT6A 1V7ML 5D7SL 5GGTL 2QSTA 5CEXB 1RY7B 4PJHE 2DQIH 5J1AA 3OGOE 5GS3A 4L8SB 4OF0A 1RV6X 4TVPE 5ERWA 3UTPE 1XMWA 4HX1A 1H5BC 3P11L 4IRJD 3RWHB 2X09A 5EIIB 3R1GL 2BNQA 3MA7A 4JJHA 4O2FB 3GSVA 3SDDC 2NY1D 2AJZB 4UDUB 3NABH 5A16B 3ZDXE 1FORH 3W39B 4RBPK 1CWVA 4LHQB 3DUSA 4NKMA 5D1XC 3MNVB 3RWJB 1I75A 1BMGA 1MLCB 4M7LL 3WSQH 5HDBF 5DS8B 4HKZB 5BZDA 4FFVD 2ZUSA 5C08B 3HZKB 2OQJA 1AGCA 1Z6JT 4LDLB 3GNMH 3GBML 4M61B 3HG1E 4HS6A 3CD4A 4LRNH 3WMSA 5D7IF 1CDYA 3OKLA 3VFRA 3QDJA 4C56A 2YOCA 2EXWC 3DV6A 1QFWH 1GGCH 3BGFC 1F11B 1JWMB 3KPQA 3RIAK 4ACPA 4NNXB 1EHAA 2FBJH 2VDKH 4KVNH 1OSZB 4I18A 2L0DA 1OQOA 3MLYL 2XN9D 5FHAL 4U1JB 3VXUE 4X6CA 3RNKB 1OAYH 5F1IB 1PKOA 2R2BB 1R3JA 5C9JA 3VWJD 3MJ8B 2VKWA 3TVMB 4HFUH 5DQDL 2BOCA 4EI5B 3FRPA 2FHFA 3W0WB 1HHGB 2J6EH 1D9KB 5IR1B 4LLAA 4DUVA 5K9KA 2CMRL 4QHUB 3BP5B 4FXGB 4BZ1H 4P23D 3ARDB 4I5BA 2CIIA 1HH9A 1CXEA 4IJ3B 3K46A 4G3YL 4U6HB 1NMCC 2A83A 2GJJA 1J5OL 5FIEA 1X4YA 4Y4HB 1BOGA 2AJSL 5LG1A 3SPVB 2EDXA 1D6VH 3IDMB 4FTVE 1AHWB 1XCTA 2E8ZA 1C08A 1EEZB 2O93L 3V5DB 3SKJH 2O5ZL 3MGTB 2OTUA 1KYOK 3QA3B 2BDNH 4ZXBA 2G60H 3KPRD 4OD2A 3MRQB 4FZ8H 4JGMA 3QCUL 1IEBA 1XGPA 4XNQA 1IC5L 1TVBA 4APQA 3DROA 4JEGB 3BDYH 4I3RH 4LCIL 2ZNXA 4ODUB 3QUZC 4LLMA 2Z8RA 1W72H 4Z9KB 4JRYA 4JFYA 3GSUA 4PRID 1CYGA 5I1HL 2M26A 2V5YA 3ZL4H 1G7IA 1ES0B 1UB5B 3MYJA 1GIGL 3CVHH 1OP9A 3VXNA 4JZJB 2RB8A 2NY6C 4P2OD 4RGMB 4PJ5E 2UWEA 3CFDB 4OFPA 1YNLH 1QSZA 4PFEA 2C1PA 2DWDB 1RHFA 3D25A 1Z3GL 4HUUB 5BJTB 4YIQA 3FO2B 5CJQH 3SE3C 3VXSD 4KXZH 4YHZH 2QSVA 2VMFA 1LD9A 1JZ2A 4YFLI 2DKUA 4GOSA 3FQTB 4QYOA 5KSBE 2Z9TA 4PJ9C 1KTDB 1DBAL 1A8JH 5D2LB 4ODSL 5F21B 5E1HB 3O4LE 3S36L 1CQYA 1U2CA 4M1GH 1JPTH 5DVNA 1O7SA 4M6OL 5D7KE 4PJIB 1LWRA 5C0RL 4N68A 3BPLC 3OJVC 1AJ7L 5IB3A 1KUMA 1PKQA 3QEQD 5T1MB 3REVA 2LQRA 5FUZH 4X98A 5D6CA 2F19H 4EVNA 2LE9A 2A74A 4QRPD 4J3OC 4OCWL 1NFDF 4HBQA 1MCEA 5GGSB 2FX7L 4PJCA 2W0LA 4F2MA 3LDBB 2E6QA 3V79C 4JO2L 3RNQB 5L2JA 3RRQA 2AQ3A 3P0YH 1G9MH 2DMBA 4DW2H 4OIIL 4WFHE 4PJDA 2ITCA 3G6DH 1FL6A 5C0AA 4M5ZH 1NKRA 4FQXA 4K7FA 3EJYC 4JO3L 5HGBB 5K59E 1UWGH 2Y06L 4YHOL 3BMWA 4K2UH 3QHZH 2VXSH 3CDGB 1R6VA 4OSUH 2VXTH 4JY4A 4XPTH 4MHHG 5EBLA 1EVUA 2A6DB 3D3VD 2DRUA 2UV3A 1KG0A 4MJ4A 1AE6L 2NY3D 3RWDA 1G7LB 4NT6B 1A4KB 5JIHA 1OCWL 4DKFH 1FBIH 2CGRL 4GRWB 1F4HA 4A2MA 2HG5B 3L3GB 3HZMB 5MHSD 4OM1H 4RRPA 1IKFH 5HDLA 3P4NB 5TF1H 3T8XB 1TJIL 4BSVA 5GZOC 2CK2A 1U8JA 2PUQT 5ALBH 4XP4H 3LH2L 4LHJB 2IFFL 3UDWC 4GMTL 4X7TA 5K93A 3CSYB 3K8LA 4ZS7H 2GY7B 4K3HA 4HF5L 1TZIA 2HN7B 4ORZC 4WHYG 3QUML 2YD8A 5DO2D 1KNOA 5DURB 2PTUA 2R2EB 1NGZB 3WCYA 3TF7C 5DRNB 3JSSA 5IQ7H 4EN3D 4MMZC 5DDHA 5J3HD 2EXYC 4MCYA 1NSNH 3IGAA 1M05B 5FGCB 5ESVA 5DMJB 1FZMB 1KLFA 2VUOA 4NKDB 4ZD3H 1CGYA 5DHVA 2VQUA 1TLKA 4B7LA 5KAQG 1SEBB 3S3SA 2UZIL 3W5NA 1KB9J 3E2HB 3TNNA 3V6FA 2W65A 1DQQA 4R96A 1QEWA 1GGIL 4OZFA 1MY7A 2VE6A 4X6CF 1EHLH 1RJYB 4OBSA 4WHTA 3BWUC 5D70L 4UAOC 3QHFL 3QFJD 2I9LB 4PJXB 1MCDA 4K07A 1MHPL 5B3JE 3JWOL 3T0EA 5E2WL 5ETUB 4PRDB 4JY6A 4Q7DA 5EUKA 1JF1A 2VZSA 2WBJD 4XP5L 1F90H 1ZLSH 5F3BB 4BK4A 3B4NA 1Z9LA 3QAZC 4M43L 3GHEL 4O58L 3UTZA 4NQSB 5F9WC 3DX9A 5CEZE 4KRPC 3S4SG 2V2XB 3GK8L 4I9WD 1RI8A 1IM9D 3C09C 1H5BA 5AZEH 3QJFB 3VFVB 1FAIL 3CLEL 4PTTB 5TGBA 5JQ6H 5JMRA 2FX8H 5BXFB 3KPMB 5CLTA 1FYHB 4MAYD 1CE6A 1N5AB 4Y5YC 1HHJB 3QI9B 1U8LB 2G5BA 2WZPD 3BP6A 2DLEA 4NWTL 5D5MA 3TFKD 2Y4SA 2P8PB 2VDRL 1T7XA 5I75B 4K8RL 5KBNC 4N8CH 4OKDA 3OG6B 3EJZD 3VH8G 5IIEA 4TSCL 5LXGL 1IAIH 4JFDA 4KAQL 2X70A 3IDIA 1FAKT 1I1FB 2PXYB 1AQKL 3QCTL 1T1YB 3T1FA 3FOLB 1QBLL 3MCKB 5IF0B 3OAUL 1AI1L 3HUJA 5T1KA 2OZ4A 4Z95L 4X7CC 1G7MB 3BJLA 1BGXH 4I2XA 4J1UA 1WJ3A 3F12B 3HZVA 4F57L 1IC1A 2GFBB 2UWEF 1NEZB 4OF5A 2EIDA 3EOBA 1YQVL 3T0DA 1PY9A 2PO6D 3D87B 1S7VA 1KJMB 1TCRA 2YPKA 2DL2A 3U4EA 4Q9QL 4LEOB 1I8LC 3ARBC 5EZJA 1B0GA 2O5XH 3OGCB 3S5LA 5IG7B 2Z35B 1Z2KA 2CR6A 4XBPB 3MMEB 4NKIH 1IRAY 4K9EH 4HPYH 1W72B 5DK2A 5E94A 5I1KL 3I84A 3MJ7B 4Z5RB 2IBZX 4G6KL 4JFED 4L5FL 4J8RB 1QVOB 3VFGL 3IDXH 4S1QH 1WWBX 2P7TB 4YHKH 3ARGD 1EO7A 3BH8A 4TULH 3BZEB 1FZOA 2BNUA 4H0GA 3TO4A 3CFCH 3GKZA 3ULVH 1XGRB 4LLWB 3RZCB 3PP3K 4HC1A 4BFIB 1EGJA 3HS0A 2FYYA 1UM5H 5EC2A 3MRBA 4HKZA 4L3ED 5B21A 4MXWL 4IRSD 5FK9B 3U0WH 1T83A 3MLWH 2B5IB 5K33A 3QUZA 5I74B 2KL6A 4RX4D 1CFTB 1PEZA 2JCCB 4Y4KD 5T33L 1FZKA 1ZA6B 3B9DA 4D3CL 5D96C 4BFEA 2IPTH 3KXFD 1J1PL 2J5LC 1I1AD 4PJDF 5IBTH 3QZWG 5DRWB 4NNXA 1F3JA 1R0AL 5F3HA 1DZBA 3KHOA 1KULA 4D0CA 5IB5A 2Z93B 5A2KH 3JVGC 1DVFC 4LHUA 3VFSB 5DQJB 3IAQA 1BVZA 2AABH 4GAYB 1RZ8B 2ADIB 3SE3A 5CEYA 3MRGA 4EI5A 3IU4H 4FQ1H 4M62H 5TQ0H 5HVWA 1MJ8L 3W0WE 3STLB 1VFMA 4Y8DC 1G6RB 3NPZB 3SDXA 1YNKL 4HSQA 5IR1A 5GIRA 4HKXA 4QRUB 1CFNA 1T1XB 2V6HA 2IAND 5FAAA 4Q58C 5D71L 4TOYH 4LIQE 4PJ7E 4QF1B 4P5MB 3U9PL 3HTLX 5IOPB 5ESAB 3ROLA 4NWUL 1QRNE 4FQJL 4X5XA 1AHWA 3R06B 1OLLA 2EZ0C 3V5DA 4S1SH 4XAKE 1NC4D 2VR4A 4R4NC 4C58B 2VXVL 2F53D 1FG2A 1Q9LA 1E6OH 4WUUD 3MRKA 1Q9KB 5A3ID 5L88H 2JB6B 2MFNA 4R4FL 5E9DB 5DA4A 1ZV5A 3IDYB 4ODUA 3PL6B 4PGEA 3WDJA 1DEEB 1T66C 4W70A 3L7EB 2DKSA 3MLRH 4NCC1 5T3XH 2DICA 4E5XA 4TVSa 5D2NA 4ZSOB 5GZND 1JI2A 1QLFA 4XPBH 4MQ7B 3DTXA 3OXSA 3EO9H 3BWAA 1S7SB 2HJKB 5GSRA 3CXHJ 4GBXC 1CG9B 1W0VB 1HILB 4YAQB 1AP2A 4POUB 2JTDA 5LGJB 3O8XB 2C4FT 1J8HB 5KN5B 1V7NH 4WI4A 2W9EH 4XCFL 3TA3D 6CGTA 4DKEL 3LKNB 2Y9RT 2P4AB 4PJFB 5GS1B 2F5AH 2H6PB 3SDCB 4J4PC 4LPWA 2YR3A 5TE4L 3D2UD 4LQFH 2VAJA 5CBAB 6FABH 1PEWA 2AQ2A 1LO3H 2K9UA 4XWOC 4PJIE 3UJIL 3BFOA 4PLNC 4WU7B 2NNAB 1Z9MA 3S37X 4HEPG 3OL2A 3KPNA 5JORB 1X5HA 4H1LH 4QHNA 1WWAX 4Z7UF 4HCRL 4MSWB 3RGVD 4BK5A 1HKLL 5EU6E 2Q7NA 3QXDB 1Q72L 5C3LD 3NFPA 1JK8A 1YEEL 1OVZA 1WGOA 3ULSB 1AKJD 3RX8A 2QQKL 3T0VA 4NN6C 2MHAB 3ZHLA 3QDMA 4N8VB 4OZIF 1UG9A 5CSZB 5KOVC 4PLJD 1CICC 3SGDI 3RWCA 5C0ND 5CIPH 4KUCD 3ZTNH 1TQCC 4ZAKA 2FHCA 4G80A 3S9DB 2O26U 5GGUA 1I8IB 1FVDA 5B38G 1F97A 1NAMA 2HA1A 4YC2C 3EOTL 2X44D 3ESVF 4KDVA 2R0KL 1TNMA 1GGBL 1WIUA 3T4YA 2CKBA 1N5YL 5J6HB 2V2TB 4IOFD 2FWOA 3O3DB 5J12B 5HGAB 3BMVA 3MODH 3WIHA 2OL3A 4LCWB 1U36A 4I8DA 3VE0A 3HUJF 3DMMB 4P2RB 4JM2A 4MDJA 2A6DA 3V6ZA 1Q1JH 3MRCA 4HIEB 4JG1H 3CX2A 3HAEA 3QFDB 4OI7A 3KLHC 4DQOH 4EDXA 3DSNA 3C8KA 5ENWA 5I1LB 3NZ8B 4P4RB 4K94C 2NY5C 4YDKH 3RVTC 2W0KA 2BZDA 2AEQL 1IGFH 1HEZB 4NZDA 4J3XA 5FYKL 1CXKA 5C0CB 2APTA 1BD2A 4GRWE 1K5NB 1YDPB 2MPAL 4NKOB 4A2LA 1DL7L 2EDBA 4AEIL 2YSSA 2R23A 5CKAA 2CK0H 2ZNWA 3KR3L 1MRDL 3OBAA 1EFQA 4S2SB 3WFHA 3OR7A 3TZVD 1F8TH 1K4CA 1MCSA 1RJZB 5I8KH 1I9RH 3BN9C 4UT9L 1WZKA 1DE4A 4U0RC 4PJGA 1GC1C 3SKMB 4O9HH 4IRJB 5DQ9A 3UXFA 3F6LA 4YUEL 4CW1B 5JW5B 3SHSA 5E6ID 5DUPL 2NY1B 1IM3B 2E9JA 5DRNA 1LE5A 2H32H 4ZYKB 3BIKA 2FD6L 3ILPB 1KBGH 1EJOH 2VXQL 4B50A 2FEDC 5HHPA 3SGEH 3L3HB 2D9QB 3GJEB 5I66B 2JJSC 1SJEB 4WTWA 1EX0A 2XXMB 4QY8B 5E8OB 2IGFH 1GXEA 3DI3B 3OAZK 3B3IA 2HWZH 4GW5B 4LCUB 3L3DB 1CIUA 3FQNA 1N3NA 4Y16D 3WIIL 4JFQA 1P6AB 2JJWA 4F9PC 4RFNC 1SY6H 2GY5A 3ULUD 4D94A 5IHZB 3DVFA 1JZ5A 4XVJH 2VZ1A 4R0LB 5SWZD 4YGVB 2XN9B 4ZPTA 2NW2A 3U4BH 5DTFB 1XIWA 4BZ2H 3RVWC 3VWJB 1U8QB 4X5WA 1JVKA 4OTXL 5J7CC 4WFEE 3CUPA 5KTEH 5DMIH 1OF2B 3RY4A 3VGAC 2PN5A 4PRPD 3LKQA 2R1XB 4CVWA 3CSPA 3K4AA 4P23B 3VRIB 3AM8C 4MCZB 1MQ8A 3ARED 4K3JH 4UILH 3RU8L 3VFVA 4F7EB 5MI0B 2I5YH 2XTJD 4P4KD 1VEPA 2NCMA 4NYLB 3EFFA 3TNMB 5C07E 4HH8A 2VQ1B 3F5WA 5DK0A 3MNWB 1ZLUH 2BMKB 5H94A 4FQLH 4GKSA 5CJ5A 4X6BB 3LB6C 2F5BL 3VMOA 4WV1B 2OZ4L 2VR9A 4WWKD 2V5TA 1MCWM 3TJEL 5CILL 3GSQB 3KPRB 1AGEB 4F37F 2YZ8A 2J6EA 5HPMB 2CUMA 2IEPA 3AU1A 4ZTOL 3HI1A 4ZPVA 1KLUB 3GGWB 2YPLB 2D7PA 4GMSH 5F1SA 2PYED 1XF5A 1HDMB 3U6RB 3CK0H 1VADA 1U8IB 4PRIB 2Z4QA 2EDRA 3HLAB 1FO0H 4Y19E 2GK2A 5F89B 5DJZA 1MJ7H 1DUYA 2HYMA 4P3CL 1G7HB 2WWKO 2UZXB 2CO6B 4P2OB 1II4E 4LAJH 1JPFB 1TXKA 4PY8I 1LO4H 2AXFB 4ETYA 4XNMB 2VIRA 3BZFA 5EZIL 3P9LB 2RCSH 5I1JH 2FO4A 4NUJA 3VXSB 1JN6A 5D2LF 1J9CT 5IG7A 4MAUL 3VXPA 4H8WH 1TCMA 1KPUB 1Q38A 3IF1B 4HC1L 1EGJL 2AK4A 3SDYL 3IVKB 4J8RA 4U6VH 1MFNA 4LEXL 5I1IL 4MS8C 5IFHL 4PGJA 3G6AA 2X4QA 3OJDB 5CZVH 5IB2B 4R2GD 1IQWL 4DWHA 3CVHA 4H25B 3FN3A 4C83B 4LDEB 2EDKA 2W0FA 3QUKB 3IAGC 4I48B 5EO9A 2NX5D 5CCKL 4UZGA 4H26A 1GZPB 5GRYA 3RL2B 1VSCA 3VGEA 1KXVC 3I2CL 3BEVB 2P5WE 2FCBA 3HCVB 3QEQB 4GRLC 5HVHB 3MFFB 4FHBD 2IPKB 5FOBB 3BD5A 1ND0A 2XWBB 4R3SB 5CP3H 4QRPB 4K3EH 1F4YL 3UPAA 4HS3B 1JTPA 5A2IH 3LCYA 4A6YH 3SKOB 1NFIB 2JCCE 5CJOL 4Y8AA 1ZA6A 4N1CA 3EDKA 4UIMB 4GXUN 3BKJH 4ELKA 4NQVA 3L3KA 3RJQB 1A7OL 1T04B 2HFEA 3DWTA 1RZJH 4I0PA 4WW2A 2B4CC 2QTEA 3TJHC 4U7SA 4HJGB 4WI2A 3T2OA 3CFKA 4G8GE 4H1LB 5MENB 5I2IB 1J05B 3X11B 3O81A 1UYWL 2J8HA 3OZ9H 3MV9D 3BRDA 1JRHI 4I1NB 4DAGH 3HZYB 2YEZA 1GOHA 3W9EA 1NANI 5KSVA 1FNHA 3P4OB 5FB8A 1NCTA 4JO1H 4G8IA 3UJJH 2OJZL 5H2BA 1ZA3A 4JM2F 3N85L 3UBXI 3JWDL 4WENB 4MNQD 3L9RA 2LFGA 3T0WA 4H0IA 1JNHB 3OKMA 4QTIL 1J0KA 2D7NA 1FNSL 5CIPB 5EBWB 25C8L 2YA1A 4HG4K 1C7TA 5I15H 1UCTA 3QULA 3KHQA 3QWOB 1CD1B 3KYAA 3VXRD 5D1ZC 5FDWA 4JZNA 4JPKL 5BW7A 5E9DE 1KACB 4BKLB 1D5ZB 1EK3A 4OAWB 4NQTA 3VFPB 3RDTB 4P3DB 1E0OB 1CICA 3BD4A 1IAKA 4WY7H 4ZSOE 1YN6B 1M7DB 4NQCD 1RU9L 3W9DA 2D7TL 4NN5C 2XRAH 3MRLA 3GB7A 4HS8L 4WFGE 3BQUB 1FFNA 3HFMH 4JR9L 4EN3B 4W81A 1RZKC 5E0QA 3BO8A 1P1ZB 1J8HE 2VLLA 3O2DA 4ZUWB 5FYLE 3BPOB 3QUYD 4S1RH 3LKNA 5HGGS 1I9JH 1CGWA 2EH7H 5ANMA 1HE7A 2ADFL 2YD7A 5GS1A 4M7LT 1A3RL 4YDLB 4WUKL 3J7HA 1F5WA 3LHPH 3Q5YA 4NQXB 5DMKB 4OCRH 3E6FB 3EYFB 1LHZA 4WU7A 1G7QB 1P4LB 1QSED 1MWAA 4XBGA 4X8JA 4CMHC 3B5GA 3KPLA 4HZLA 3B2VL 3QFJB 4POZD 3X13A 4MSWA 4QRTB 2FJGB 4JQVA 4Z77A 4XNXL 2H2PD 1U8KB 1ZHLB 2VAAA 1IL1B 3HB3C 4NGHH 3SDAA 4JDTH 2CXKA 2WBJB 3WNKA 1QKZL 3VCLB 1BZ7A 5IK3A 5FO8A 3EDDA 1IFHL 3L3OA 3U7WH 4YE4L 1ZEAH 5GSVA 3SCMD 1T7VA 4O51B 1BVLB 2V5MA 5D7JD 4FQCL 5M94B 4X6FA 2CKBL 5ID0B 3VFNA 1MRCH 1IM9B 3PGFH 4Z0BL 3QIBC 5FXCH 3QNZB 3AXLA 1U92A 3WIHL 1ETZA 4ONGH 1OWRM 2IAMC 1X5FA 4D9LH 5ITBH 4ONHA 5D7LA 1GHFL 5EOQH 2AJVL 2Q7YA 5TPWH 4PRAB 3TV3L 3RWEA 3GSOA 2JJSA 3QIWA 2AEPH 4J3SA 3IS0X 2DQEL 2EO9A 3VI3E 1BPVA 4LCWE 1WT5C 3DV4B 5MEPB 4P2RE 3PG2A 2E27H 4PJHA 2OSLB 1RJCA 4Q0XL 1MFEL 2Q6WA 1QFOA 2F54D 2DQTL 3JV0A 4JAMA 4P4RA 4LLYB 2F8XC 3LSOA 1T1WB 2ORBH 1RUQH 4D0DA 3BE1L 2DYPA 3KYNA 3VFOB 3T2NH 2APVA 3KS0J 1HEZA 1BP3B 4KJPD 2PO6B 3X3GL 5FFLA 2IG2H 4ZS6C 3U7YL 1ZHBA 3QO0A 3AB0C 5C0CE 5EFIB 3NIGF 3OF6D 3RVVC 7CGTA 1OPGL 3LEVH 1WUNT 4LCYB 3VFMA 4YR6B 1H3WM 1IGYA 3SE9L 5TDOB 1H8NA 1KEML 4M8QA 3Q3GA 1CFSB 5JLZB 3E6HB 4OLEA 4HGMA 4NPYA 4KKAD 4C54A 2BVEA 3TYFA 5DZLA 4JN2B 4JFEB 4LLUA 1FO0B 2P45B 1ZWIA 1YJDC 1BZ9A 2NZ9D 5EO1B 5JW5A 4OCNC 1BFOA 2DQIL 2VOTA 4PRHD 3ARGB 4LLQB 3TBSB 3BUYA 3O3EA 1HYSC 4E0RA 1LDSA 1T0MA 4XPGH 3VXUA 1YNTA 5F7WC 5DRXB 4N8PA 5TJWK 3NABL 2R39A 1PQZA 2EYTB 2HT2C 1A1MB 1UFUA 4OZGA 4Y4KB 4OB5H 1QFUH 3H9HA 1BJ1J 4OCYH 2NTFB 3L3DA 1T4KA 3KXFB 4BYHA 2AXGB 1I1AB 2H1PL 1F4AA 3GMOA 2JIXD 3MUY1 3GNML 2VABB 1TVHB 3AROA 5C0IB 4W6YB 3FZUD 3O6KH 3UZVB 1NLBH 1UB6A 1RZGA 1NCWL 5E8NA 4KHTH 5DJCB 4ZO8A 3O6FD 2XN9E 1KIRB 3ZE2E 5J6GA 1QFWL 4HIIB 1GGCL 1BQHA 1JHTA 4MXQC 1TIUA 2VDKL 4WEUD 1PFCA 4PGBB 4YFDB 1OSPH 1S9WA 2IANB 3MZGB 3BUTA 1DBML 1ZHNB 4RRPG 4NCC2 5HVFB 4Y2DD 2D0FA 3BH9A 3MCG1 2J6EL 2XYCA 4EKXA 3QXAB 3UTTA 1MAML 2GHWB 2BMKA 3EUUA 1NGYB 4BZ1L 2P46B 2Y7QA 4ZOBA 5DJ2A 4G7YH 2A0LC 4ZO7A 2A6KA 2CD0A 3TO2B 1NC4B 3U2SB 1NGWA 2OR7A 5E00A 2F53B 1UKTA 1FFPB 4ELMB 5DD6B 1UGNA 1PG7H 3KPRE 4WUUB 1D6VL 5SWQA 1ZT7B 2GI7A 1PZ5A 4JFOB 4Q2ZA 5DFVC 5EU3A 3TVMC 5I18H 3WFEH 1FVCA 3MO1A 4NO3B 4WI5A 4P9HC 5A43C 3TIDA 2BDNL 5KSBA 2G60L 2XQYK 4U6YA 4XAWH 4FZ8L 5JOPD 5DMYA 1AD0A 1MLBA 1MOEA 3O4LA 3ARDC 3STZB 4E41D 4NHUA 3PHSA 4I3RL 2FIKA 4UQ3A 4IJ3C 4PP2B 3NMEA 2OYPA 1U93B 2ED9A 4YJZL 4RFOL 1YPZB 1LEIB 3PQYD 3S97C 3ZL4L 5FM5O 4G42A 4MJID 3H9ZA 4NQED 1BBJA 4KQ3L 1F02I 3TA3B 1INQA 1CZ8H 4PJFF 3CVHL 5ISZE 5EOTB 5A1AA 3DX8B 2X4PA 4X9FA 3WFBH 4PJAB 1YNLL 5B8CC 4ODWB 1KJ2H 4KI5D 1A9BA 5HI4D 2AVGA 5EBMB 2P5ED 4U6XB 1KTKE 4DGYH 3HC3L 5CJQL 3CMGA 3D2UB 3WUWG 1CR9H 4YHZL 1JNNH 2CIKB 3LKPB 1FPTH 2O5YH 3G9VA 3HC4L 1X5GA 1FH5L 3ECBA 4MXVE 5IB2A 3M07A 3PGCB 4YK4C 4H25A 1LEGA 1QLEH 4QXGH 4XNUL 4M9OA 4JVUA 5D1ZA 4U6TA 4X4MA 1JPTL 3RGVB 3KG5A 3DX7A 1INDH 1I3RA 1PDKA 4HIHB 4JZJC 2ZOKA 1NMAL 5C0DA 5B39G 3QEQE 4R7NB 4RGMC 2ZCLH 2KDGA 1SM3H 2B1AH 1LGVA 2VO5A 4U1GB 5KS9E 1CU4L 4PG2A 4QRPE 4LP4A 1RIVL 3G5XA 1DANU 1X5XA 2PKDA 3RX7A 4RA0C 1AR1D 5EA0H 5LGHH 3SKNB 3M17A 3EYOB 3C5ZD 1A7PH 1VACB 4TNWF 2BERA 5I76B 1UJTA 1T0NA 5FUZL 4L8BB 3JBG7 5F6HI 4P46C 1URLA 2VDPL 3QNYA 1N6VA 4KK6D 3KYMB 2ZSVB 3QDGA 4GW1B 3B9KD 5MENA 1MJUH 3TYGL 3U1SH 1N64H 4RSVA 4MD4B 3RTQD 4KU1A 3F6IA 3RUGE 3P0YL 3EW3B 5FYJH 2Z31A 3J8F7 4AK1A 3BPCB 4DW2L 3VU2A 5KJRL 4MJ2A 3TN0D 5HI5D 4JG0H 2DLIA 3TC9A 4CRPA 1OT1A 3BXNA 4V1DE 2VZ3A 4MDIA 2L7JA 4EUPG 4N0CC 1RULH 2X7LA 1KSRA 1Z9SA 3MRPA 3L95B 1JPGB 3MRDA 1G7JA 4MWFA 3QHZL 2VXSL 2X4RA 3D3VE 3U79A 4OSUL 2VXTL 4R8WL 4XPTL 3RKDC 4M6MH 5LWYH 5IMLA 3BX7C 3PWNB 2AJXH 4BQ8A 1J86A 1QSFA 1T20A 4L3CB 4BSWB 3TH2T 3ARFB 4WHYH 3DRQA 3PV7A 3QWOA 4ZFOB 4QKXB 5GGRA 1F6AB 4QTHA 2XFXA 4UBDD 4FFZH 1OTTC 1ZLVK 3DIFA 2GUOB 5MHSE 3V52L 4DFHA 7FABL 5BV7H 1DN0B 4JPIB 3TZVB 4DKFL 1FBIL 2FL5B 4LLVB 4G9DB 3QIBA 3BW9B 1HHHA 4I4WB 3O2DL 2CLRA 4OM1L 4EBQH 4R4BB 1MY5A 3U30B 5TF1L 5C71A 2CDFB 3IXAB 4HT1H 2YBRA 5CMAA 5ALBL 3V7AE 4XP4L 2I24N 1NC2D 1PAMA 1BVKA 2EIZB 5E6IB 1WCBB 2GTZA 4ZS7L 3T3PE 1MH5A 3L5WB 2P24B 2FZ3B 1UZ6F 4AM0B 1LK2B 1IEAA 1RUPH 4PR5B 4R26H 1MWAL 4YDIH 1QQDB 4GKNA 2AS5M 1UVQB 1XCQA 3QQ9D 3FMGH 4QXWA 2HTLC 4OZGF 4LLDA 3WFCH 5IQ7L 2IQAB 1SMOA 3SE4A 3GJFK 3UC0H 5IM7A 3BZDA 4QOKD 1D5MA 3QRGH 2VLJB 4UU9B 2XA8L 3HC0A 3EYFA 4Y16B 1BQUA 5ID1B 2A73B 1IAOB 5DR5H 3ULVF 5IVXE 1JJUA 4Y5XB 1T5WB 5IEKB 2BVYA 3QFJE 1HSAB 2H32A 3IETA 5SWZB 3CDYA 4S0SD 2OCFD 1I8MB 1EH9A 4NQDD 3IJHA 4FNLH 4PLOB 1EHLL 1IKNC 2DJUA 1DBJL 1QSVA 2HT3D 3KPOA 2DQCH 5L8KB 1FSKC 4QRQA 4PRPB 5FCSH 1FP5A 3D85D 2YUWA 1K4DA 1G0XA 4I9WE 4HJ0D 3AREB 1ZLSL 1AD9B 1F90L 4X6DE 5C8JB 2XTJB 1FV1B 4P4KB 5F70A 3WL9B 1S7QB 1MI5D 2EH8H 3MV8E 4C4KT 3HR5B 3E2HC 3KWWB 1GJIA 2Q8AH 5AZEL 4WIQA 3PF2A 3MGOA 4JO4H 4TVPL 5FOJA 4WWKB 2FX8L 3IXTA 3QWRD 1O0VA 4RFEA 1BEYH 4X9IA 4PB0H 5C6WH 2GSGA 5BRZA 4NNPH 1S7RB 4F80A 1ADQA 1MCCA 1X6LA 1ZVSB 3OV6A 2VWEE 1R3KB 1NCAL 2V17H 2HTKC 3KPPB 3DV4A 3O6ML 1WBZA 1IGIH 2BVQB 3R4DA 2PYEB 4N8CL 1OHQA 4KPHH 3VXMD 1IAIL 5E1AA 1T1WA 3SJVA 2Q8BL 5INCA 4KKCD 2DDQL 2NQCA 5MEQB 2OP4H 3DETD 5DJXA 3SGKC 3W2DH 3D0LA 4P3WA 3QI9C 1BGXL 5KZCD 4P59H 3MCLH 3DLQR 1SBSH 4FQ2H 2R8SH 4OFKA 5K9QI 1P7HL 1HHKB 4GG6E 3W81A 5EUOA 3PWLA 5BOPA 5DZOA 3RVUC 1MCJA 1A1NA 5GS0H 1WV7T 4JN2A 3D9AH 1IGJA 3PABB 2O5XL 2IPUK 1JGDA 5IW3A 4OFIA 1A4JA 4PIRF 4NKIL 4R2GB 1NEUA 3WLWC 4K9EL 4HPYL 3SGJA 1DCLA 3MRHA 2EDNA 2NX5B 2HLAA 3IDXL 3HPJA 5EC1B 3MLZL 1X4ZA 2HFGH 3BYTA 3LPGA 4L3EE 5FKAB 4YHKL 2E7LA 4DFIA 3R0NA 4GXUM 1BAFH 1BX2B 5LVEA 1DUZB 3CFCL 1M1SA 3ULVL 2OTWA 4HPOL 1KJ2B 1A6PA 5AUMB 3DRTB 2AP2A 1UM5L 4PJ7A 3U0WL 3O9WA 2IH3A 3MLWL 3I6KA 2J8UB 3BPNB 2VABA 4KMTH 3CMOH 3EO0A 4LSRH 1QRNA 1X5KA 2YK1H 5DJCA 3VG0H 1PX4A 4LGRB 2NXYD 4DGVH 2BSED 2IPTL 1HOCA 1XH3B 4MB4A 4FXLA 1FIEA 1UA6H 3FTGA 5C70A 3MV9B 2I27N 4KWUA 3HNVH 1Q94B 5GHWL 1EA9C 2X4TA 4NRZB 1CT8B 2JELH 4G6FD 3RZCC 1WFNA 1BLNB 5TH2B 5CP3A 4K8RD 2UUDH 3OKEA 3I9GH 3K0WA 2IANE 3RP1A 4MJ6A 4TRPH 4A6YA 2AABL 4MNQB 4WTZA 4IHOB 3IU4L 4FQ1L 4M62L 5I74C 4HIXH 4Y4FB 3U83A 3T4AA 5T1LD 4Z8FH 2NW3A 4LOUD 2H9GB 4DZBA 3LMJH 4TOYL 3P11H 1MQKL 3U36A 2R1WA 3VI4F 5SX5K 4OLXL 1ZT4B 2C3VA 4JQXA 5JDSA 4BFGA 3T1WA 2F53E 1FFPA 3VXRB 4ELME 3OG4B 2PW1B 1IC4H 4WUUE 3S3PA 5AD0B 1PZUB 5AEAA 4S11A 2YRZA 2BNQD 1IARB 2BCKB 1WAAE 3BAEL 4S1SL 1OGTA 3B5TA 1E6OL 3GBMH 4MJ5B 1ORSA 2ARJA 4P46A 1T2QL 3ZT5A 5L88L 2ZUQB 1MCNA 3QSKB 1C12A 4PGZA 3VFTB 5IHLB 3PWPA 1EEQA 5HHOA 4AQOA 2QL1A 3MLRL 5T3XL 4U31A 3SO3B 1G9MC 5F88B 1A14H 3MLYH 2I07A 3P2TA 4XPBL 4YHIB 1S3KH 5I8OH 4CVXA 4DOHB 3QDJD 5FO7B 3EO9L 4C56D 4W4OC 1JYWA 2IBZY 4TUJB 3B6SA 3OB0K 2DWEA 1N6UA 4RMTA 3CAFA 5BV7B 3GKWH 4PB9H 1YEDA 3FT3B 8FABA 2VLMD 4PJAE 2D0GA 2GCYA 1V7NL 2CMRH 2W9EL 5DI8A 1LNUA 3G5ZB 2OM5A 3QNXA 3IDYC 3PL6C 1YY9D 3TBWB 2P8LB 1AQDB 4FN0A 5HHNB 2DQUL 3H0TA 1QSEB 1J7VR 2DJSA 4TUOB 2F5AL 5HYQA 3ALPA 4LQFL 3NACH 1A9EA 6FABL 3DYOA 2EDJA 1VB9A 3QJHA 5GGSY 1ZSDB 2O5ZH 3MJGX 4S0TD 1MJJA 4QT5B 4NO0A 3DJ9A 3O8XC 2ZOLA 1OW0A 4NRYB 4BQ6A 4I0KA 5DJ6A 3VJ6A 4LCIH 1NL0L 3GUTB 1PBYA 4HUVB 2DBJA 4KC3B 1S9VB 1KB5A 4OD3H 2LAGB 4P57B 1B4JH 4PYGA 4APQD 1FC2D 1GIGH 2X4UB 2VITB 2VDML 4PP1C 3RQ3A 3ZTNL 2GTWA 4JRYD 1NFKA 1CXIA 1AC0A 4PJEB 1A3QA 1RIUH 3C08L 3GMPB 4ENEC 5D4QA 4U33A 4P99A 1JWUB 2VLKE 3KPTA 5JZ7D 1FYTA 1MCKA 5JDJA 3F7RA 1X5ZA 4L9LA 2R9HC 4XX1G 3CU7A 3RWGA 3WS6C 3MLTB 4M1DH 3FB5A 2KQMA 5H35A 1DBAH 4J3WA 3EZJB 3MZTA 1VFBA 2F54B 1UXWA 3ARPA 3MODL 4HLJA 4GAJH 3EBAA 3GMRB 1BIIB 4EXKA 4UDTB 3OKDA 5C0RH 4JG1L 5BZWB 3BDBA 1G9NH 1JYNA 4F37K 3FKUS 4LSQH 4DQOL 3NOIA 3UBXG 2GEEA 4YHYB 1YEFH 4Z78B 3WFDH 1IKNA 5HGHA 2FB4H 2FATL 2QV2A 4UB0L 5T1DH 1LEKA 5EUOF 3RJDA 1IGFL 1U91A 3IJSA 3WKMH 5EIVA 3BSZH 1MSPA 4K7PH 1H3XA 2WINA 4I4WA 3VMPA 5DJDB 5HYSB 3IKCA 3KS0H 3K3QA 3ME0A 4JO2H 3WNNA 4PRHB 1KT2A 4ONOA 1L6ZA 3PDOA 1TTFA 2V9RA 3RA7L 1SHMA 3KLSA 3RI5F 5I8KL 1I9RL 1NDMB 3ALWA 3MBEC 5C0BE 1Z5LB 1MCHA 4HGWA 3IDGB 5F9OH 4DEPB 2LTQB 3V0VB 35C8H 1KN2L 1KBGL 1EJOL 3DVIA 5C0AD 1BF2A 2EC8A 4FQXD 2FJFB 4HWNA 3GSNB 1T89C 2A6IA 2WUBH 1U8PB 5MERB 3TH3T 1FNGB 2IALA 2JIXB 3P0GB 4KZEH 3ULUE 5C07A 1T5WA 3S35L 1LO2H 2HWZL 4RNRA 3O6FB 3ZKSD 4IRJC 1MCQA 4WCYH 1CK0L 4WEMB 3WLBB 5BQ7B 5IKCA 2NY1C 4L8DB 5I17A 1C5BH 3QQ3A 5HSFA 1HH6B 1R3IH 3L5IA 3GMMA 3P9MA 2CGRH 3VRJA 1NCDH 4YXHH 1J0HA 4MVBD 1UJ3B 2HVJA 15C8L 4NCDA 2V7NB 3F65A 3G08B 1K8IA 3U4BL 1TJIH 3B5HA 2ATPA 3V0WL 3NH7H 4FFVC 5F7YC 1MAKA 3LH2H 3BKYH 5AYQA 1FHGA 4Y2DB 4L4TD 3PWUB 4GMTH 5KTEL 5DMIL 1FV1A 1EIBA 2XTJE 3U9UB 1C5DB 5IMOB 2CLZB 5CWSB 3CFEA 4XGZB 3MROA 3HR5A 4Y19A 5E8PB 4XCEA 2D4DA 4EZMA 3I6LE 4K3JL 1WC7B 2D31B 4LDOB 3MLSH 3G6JE 5C0FB 1BOYA 1R5WA 3IFPB 5FYKD 1ZANL 3O41B 4HUWA 5INDB 1UADC 3TIEA 4G9FE 1CTOA 3VWJC 3RBGA 5C0JB 1Y18B 1DFBH 5F9JB 1QBBA 3WD5H 5T3ZH 1D5XB 4E42A 3OJMB 4GKZB 2X89A 3VXQA 3FT4B 3H7LA 1VDGA 2PYEE 2WBKA 4HK3N 5JR1H 1MNUL 3P0VH 4P23C 2X2YA 5C09A 4E41B 3K8KA 2GYSA 2M8XA 3VDCA 3F7QA 1YPZF 2ERJB 5EU4B 1GGIH 2F74B 5J9PA 4PD4K 4IM8A 1F58H 5D70H 3CK0L 4X4YA 3QHFH 1KCRH 5E24E 4G8FB 3PQYB 1MHHA 3RWFB 1FDLL 4MJIB 5BCAA 4NQEB 4GG8A 2RBLA 1YN7B 3JWOH 5E4IA 5CD3A 5E2WH 1MJ7L 2W91A 4WV1C 3NFSL 5JUEL 5HVGB 1JYXA 2FR4A 5JIPA 4UUJA 1LO4L 4QXTB 1JIBA 1F42A 3GO1H 2H3NA 4N0YH 3T0ED 3V0AC 2RCSL 3HMXH 4BH7A 4ALAL 4NQUA 2C7UA 4S1DD 3X12B 4JGUA 4LVEA 3CLEH 5E5MB 4H8WL 4EOWL 4JFFE 5E7BA 1QHPA 1WWCA 32C2A 3MPCA 4CMMA 4U6VL 4G8GA 1HK6A 1JTOA 2VZUA 1XGUA 3HNSH 3IU3B 4NWTH 4P2OC 1V5JA 2CKNA 5CZVL 4KKLD 3MACH 4HWZB 1M71A 2DM3A 2W60B 1UCBH 4WJ5B 2Q20A 4P2QA 4EI6B 2BOBB 3E3QE 4TSCH 5M7QA 4ZQKB 4KAQH 1FE8H 1BQSA 3C5ZB 4ODXA 2PCPB 1ZOXA 4G5ZH 1AQKH 3NFNA 3GIZL 4JY5H 4LASH 5IW1B 2J8UE 4Y88A 4K3EL 5JO5A 3NN8A 1DLFH 5I0ZA 4A6YL 4ZFFB 5C0EA 4JFDD 4WO4B 3B9KB 5K9OB 4F57H 4U1SA 5EN2A 1BHGA 1KPVA 3EGSA 4KXZI 1CGXA 4LK4A 3X14A 5CFHA 3RTQB 2D7MA 3MV9E 2SEBB 4LRIA 5TF0A 2FECL 1RZJL 5F97E 1ZK9A 4KK5C 1IAMA 5T1KD 1XF4B 2DLFH 1A1OB 2QKIB 1QYGH 5B3NA 4LKXB 1FN4A 3IFLH 4L4JA 4ZNEE 1YEIH 4RZCA 5JNYB 1A6ZB 1A7NH 3QPQD 3FCTB 1FCCA 2E6PA 3OZ9L 4MNQE 4DAGL 4OF3A 3FB7B 4KI1A 4TUKH 1ZTXL 4TPRH 4Y4FA 2X5PA 3TBVA 3UJJL 2NY4D 1KENH 3DBXB 1D6EB 5GGQH 3H7BA 1KIPB 3WJLA 4FRWA 1ITBB 4EQ2A 1QFWM 1V3MA 4ZUVB 5ITFA 5FDYA 3VXRE 1BWMA 4JHAL 1G1YA 4YBLB 3NGBB 2GK0B 5I15L 3PJSB 3FOMB 3MUZ1 5AAWA 2GT9A 4QHLB 3TO4D 4Z7VB 3SKUD 3F8UB 3CFJB 1EVTC 4NQCE 1EV2E 1KGCD 1G7PA 2G2RA 1QD0A 3N1FC 1R0AH 1I7RB 4JRWA 4YFEA 1OP3H 1HI6B 1I7TA 3LKOB 2NY3C 4L1DA 5B22A 4B41A 4DOHE 3OKYA 1CLOL 4TUJA 1A7RL 1MCLA 1P6FA 2EDWA 1S8DA 5E4EB 4HK0B 1MJ8H 3L3JA 3HFML 2X6MA 4RWYL 4HFWA 2APWA 2YD6A 3MRJA 3VFWB 4LHUD 2I9TA 2XA3A 4JDVB 3O0RL 4S1RL 1GL4B 4EI5D 1T7YA 3U9PH 1I9JL 1QSEE 1R24B 4NWUH 4FQJH 5L6YH 3C60A 3I02A 1A47A 5E56A 1HQ4A 2VSDA 4R7DA 1DQLH 4ZUTB 2IF7A 3LHPL 5DO2C 4CNIA 4XWGH 1T0PB 4OCRL 1ZGLA 1KXQE 3SQOH 4OUOA 4NQDB 2A6JB 2VXVH 1V05A 5TQ2H 4WEBH 4EN3C 4Y4HD 2C26A 5J3HC 2RFXB 2R29L 1MCPH 5D93B 4OBRA 3D85B 4NGHL 4WFFD 4JDTL 4NFDA 4XRCB 3EYVB 1GAFH 5I71B 4O2EA 3U7WL 3PGDB 3S4SA 1ZEAL 3THMH 4YDLC 3T2PA 3G5VB 2I60L 5D72L 4MLSA 4KJWD 5FKPB 2Y5EA 2B1HH 1DQML 1VEMA 1IJ9A 2JK5A 4Y5VB 3ILQD 4KJQD 1DBKH 5LGKA 4PJEE 1FG9C 4ONGL 3W5MA 5HHME 3GMPA 4D9LL 1TZHB 3ZDYE 4PJ8A 5DXWA 4XCFH 5EOQL 5L7XL 4H20L 4LGPB 2LVEA 2WBJC 1MF2H 5TPWL 2H26B 3EJYD 4N5UA 4X6EB 1H15A 3VH8A 2AEPL 2XZQL 1WZ1H 4MZ2A 5TE4H 2IJ0C 2F54E 3VXMB 4ORGA 3KPSA 2Q86B 2ZG1A 4OKVA 3JTSA 2EKSB 5JW4N 2E27L 3ZDZF 3AY4C 1RD6A 5CGTA 2LV4A 4MAYC 4MQSB 4KROD 3CC5B 3CZFA 4OGYL 2ORBL 1RUQL 4X4XB 5ECJE 3TFKC 1RUKH 3ROOB 4MA1C 3T2NL 1Q72H 1OD7A 2H8PB 4PG9B 3UPRB 1U42A 1AIFA 1YEEH 1QNZL 3PHQA 2QQKH 3EJZC 5T5NG 2FRGP 4GRMA 2VWEC 1QBML 3QO1B 2AAVA 4F9LC 2FDBP 3I85A 2QQQA 3QXUA 4L3AA 5DYOB 5D1QB 3NCFB 4DZ8B 5GZOD 1CCZA 4PRHE 1QG3A 1N2RA 1PW3A 3QDMD 1JGEA 1RAMA 2R0KH 4ZFZA 1EAJA 5ESQA 4Z7WE 2PO6C 1GGBH 1PYWB 4ZAKD 1N5YH 5TDPB 1MFCH 1VGKB 5C9KA 5EZLA 4WWID 4N0FA 5F72S 3FN0L 3V6OA 3CCHB 4U1MA 3A0OA 1MCOH 2ZUTA 2IBGA 4XPGL 1OL0A 2PW2B 4Q6IB 4XC1H 4OZHA 3MUGA 3JV5A 2ADJB 3JV4A 1PLGL 1R5IA 2VDOH 1HKFA 4L29B 4J3TA 1UQSA 4U1IB 2IFGA 3VG9C 1ZVHA 1DDHA 4MNHA 1J1OH 4NO2A 4D8PB 2NXYB 3QZWA 4OCYL 4EDWL 4JM2D 3ZZ1A 1I4FB 2AEQH 1TJHH 1ZHKA 3WE6B 4IOIA 1P69B 5EWIH 3MJ9A 3C5JA 4KHTL 4KY1H 4ZUUB 1FC1A 4AEIH 4YDVA 2BNRA 5KSAA 1MRDH 4IRSC 4CGTA 5IHUH 1BBDL 3BGMB 3MRMA 3QDHA 5FA4B 1BD2D 3QQ4B 1IMHC 1GOFA 5IMOA 1OSPL 2FX9L 4Y4KC 3SE8L 3ZKND 5T1LB 4AT6B 1J88A 1Q9OA 1GZQA 1T6VN 1I1AC 4AIOA 2D31A 5J1AB 3OX8A 2Y1VA 2O61A 2XKUA 5ERWB 2A9ML 3RPIA 3TT3H 3DPBA 1ULVA 4OZFH 1JCKA 2BNQB 3MA7B 3GSVB 3T0AA 5ISZA 1I1YA 4KMLB 1PG7L 4XP1H 2FGWH 3DUSB 4NKMB 5JOPE 4IBLT 3D48R 4E41E 4JPVH 3A67H 5I18L 3WFEL 3O6LL 5BZDB 5F7KC 3S36X 4PGCA 1TQBB 1S5IH 2OQJB 1AGCB 3VRLF 3FO0H 3REWA 1YQ2A 2CRMA 3RY6A 4HS6B 3PV6A 5IJKC 3DSFH 3OKOA 4XC3L 2G75B 3PQYE 1G9EA 2XNAA 4M7JL 4MJIE 4NQEE 3OKLB 4DKDC 5CJXC 3VFRB 3QDJB 4XTRD 4C56B 4JHBA 3DV6B 3I50H 2DB8A 3KPQB 3DNKA 4LVOB 3CU1A 1R3HA 4I18B 4PJBE 5KS9A 5A3IC 4KI5E 1IAIM 4X6CB 2P5EE 4K7PX 1XIWD 2WLZA 4UT7H 5KAQF 1R3JB 5C9JB 2BOCB 3FQRA 3RU8H 2R15A 3WFBL 5ICZA 1MCWW 4XPHH 2ZJSL 3NCMA 3U0PA 3MLXH 5K9KB 3C6LB 5GZNC 3CLFH 5F9DC 4WI3A 1CR9L 4QLRA 5K9QG 1JNNL 1P84K 4I5BB 2JF1A 2CIIB 2O5YL 4AL8H 1HH9B 1HWGB 1NBVH 1OP5H 2OZ4H 1ZS8A 3RUGA 2A83B 1LE9A 1QLEL 5DWUH 1BOGB 4M93B 4UT6L 2J7LA 3D69A 3TA3C 4WJ5A 1XCTB 4L4VE 1C5CH 4LSUH 1INDL 1C08B 4PBVC 1YYLH 1FNFA 4V1DA 1KC5H 1I85A 2ZCLL 3ZE0F 3OKKA 2B1AL 4EUPH 4ZXBB 3U7AA 4OD2B 1ZE3C 2WBWB 1I1CA 5EA0L 5LGHL 1IEBB 1XGPB 3D3VA 4WO4A 1TVBB 4XNQB 5F7MC 3DROB 4APQB 1A7PL 2D2OA 3HE6A 3HNTH 5EB9A 2R4RH 2VZTA 4LLMB 5B38A 3N50A 3BP7B 3DX6A 4JRYB 3LY6A 3GSUB 1JGUH 4JHZA 1A1OA 2QKIA 4QNPF 3WFZA 4YLQT 3RGVC 1UKQA 2YRPA 1G7IB 1MJUL 3MYJB 2BSRA 4XZUA 1RJLA 4LVHC 3U1SL 3C8HA 1N64L 1JHLL 1AO7E 3VXNB 1CGVA 4U1GC 5FYJL 3CFBA 3QH3A 3UTQA 2UWEB 2C1PB 2WIMA 4JG0L 3D25B 4X0KA 4YIQB 3JV6A 1N26A 3GBNH 1WBYA 1ZT1A 4PLJC 1RULL 5IFHH 5IROA 5C0NC 1LD9B 4O02H 4QYOB 1CGTA 1IQWH 1KIQA 3C2AH 1JZ3A 5C7XH 2AK4D 5ILTH 2OTPA 4M6ML 3LRSA 5LWYL 2AJXL 2YD4A 1ZGLP 2P48B 2DN7A 4HUXA 3AS2A 3EYQD 4XB7A 4IOFC 4Z7VA 4FFZL 1F4YH 1M7IA 4XX1E 1U6AH 5CD5D 1G0YR 1PKQB 3REVB 5EZOH 3TPUB 2OR9H 5EPMA 5D6CB 4EVNB 3QCVL 2A74B 2X1XR 5HDBE 2CRIA 3S3JA 3MV7A 1O7VA 1ZLWH 5IVXA 2NLJA 4PJCB 4F2MB 4HT1L 2DLGA 3O11A 3EDJA 3F7YA 5L2JB 4I0PD 5D7IE 2W38A 2DOCA 2Y23A 3DXAA 4OZHF 1S9KC 4PJDB 3DUHA 2ITCB 4NP4L 3MLPA 2X1PA 1FL6B 5C0AB 1MREH 4FQXB 3JWDH 4YHNA 1RUPL 4K7FB 4R26L 5ACZA 4QOKE 4XCYA 4YDIL 4PREA 1E4XI 3IRZA 4NBZB 4X6DA 5F7EL 5F6HJ 4HXAL 3IFOA 4JY4B 1ROWA 3UC0L 25C8H 3MV8A 5I16A 3QRGL 4MAYA 3F58H 1ORQB 3V4PH 5EBLB 1RK1A 3MRRA 5E6IC 3B9AA 4NQDE 4M7KH 3ABZA 1EMTH 1KCSL 5DR5L 1CDHA 3MV01 5GJSL 4J2XA 2ICEA 3LN9A 2C3XA 1KG0B 1M6OA 3QUXA 2CUHA 3T3ME 3LS5H 3ZT7A 5L2KA 3FT2A 3RWDB 3LV3A 5HGDA 3HI6H 4FNLL 4F9LA 2YS4A 2AKRA 5EORL 5HYJA 5I1DA 4BQCA 1MI5E 2DQCL 2BVOA 3RKPA 2XI9A 4RMQA 1N4XH 4BSVB 3SGEI 1U8JB 1YMMA 2DQDL 2MJWA 4OD1H 5L9DL 3ULUC 1CICD 4X80H 3FQWA 4Y5XC 2EH8L 1TZIB 3H9SA 3UZQA 4ODVH 3ZO0A 2OR8A 1L7TH 1FZJA 2FH8A 4LBEA 2Q8AL 2KQNA 4GJTB 3D0VA 4CN1A 4LPUA 1KNOB 4JO4L 3FO9A 4HMCA 5DEZA 4GG6A 1BEYL 4PB0L 1N7MH 4NNPL 3IGAB 4PLKD 1OAXL 2V17L 3AREC 3QPXL 5ESVB 2XTJC 4P4KC 5CGYD 5DHVB 1E27A 1KEGH 1HINH 1EHNA 3P4MA 1U3HA 3VD9A 3ZTJG 3TNNB 3V6FB 4XNXH 4CU7A 2W65B 1DQQB 4DN4H 4R96B 2DLTA 5IMMA 2YD2A 4OZFB 5KS9F 4WWKC 4JDZA 5B4MD 2VE6B 3W2DL 4L3EA 1NAMH 4IRSA 3KDMA 1IFHH 2C3WA 3H3PH 3O45A 5SWSA 4NRXB 4P59L 4MA3B 3T0EB 2EECA 3M1BA 5FGRA 4FQ2L 3SDAD 2HMID 2R8SL 4JY6B 5EUKB 1JF1B 4Z0BH 5D1QA 4LSVH 3DYPA 1MPAH 3UTZB 4WI6A 3PXHA 2CJUH 2OL3H 5GS0L 3DX9B 5F71A 1GHFH 2XPGA 1H5BB 3TGXA 1IC7L 1NFDE 5TGBB 5DVOA 3GMLA 2WWMD 1UT9A 1CE6B 3CCHA 2G5BB 4WW1A 3BP6B 5D5MB 3HMXA 4Q74A 2HFGL 3MJ9L 3BZ4A 2EEBA 1BFVH 3ZT6A 3QIWD 1MHEA 1A5FH 3AAZA 1DBBH 4Q0XH 1CGSH 5IIEB 5F1KC 4D8PA 1P2CA 4JFDB 4X9BA 4I3GA 2X70B 3IDIB 1UZ8A 2DF3A 4J7RA 5FF6A 4R2GC 3T1FB 4KMTL 3CMOL 4TVPD 3U7YH 3HUJB 5T1KB 4LSRL 3QB7C 2X9WA 2YK1L 3VG0L 4I2XB 4J1UB 1LQSR 3HZVB 4YHMH 4DGVL 5HJ3A 2WANA 4BUGA 1LO0H 2DYPD 2AV1A 2QSCH 4KRLB 3VWKA 3EOBB 1ODAA 1KEMH 1WFOA 2Y36H 5J4MA 3HNVL 3LIZL 1S7VB 2HT4D 1TCRB 2YPKB 3CDCA 3U4EB 3H9YA 2JELL 4JKWA 2MCG1 3E3QC 2NY4B 3S7GA 1CBVH 2X4NA 1CL7I 3I9GL 1B88A 1VHPA 4TRPL 4JFHD 5EZJB 1B0GB 1J10A 3S5LB 1E28A 1NH6A 3HMWH 1DN2A 1Y0LA 3BPNC 1FL5A 4HIXL 1UACH 5DK2B 5E94B 4Z8FL 2BVPA 1A7BA 1NMCB 1P7QA 3LMJL 3OPZH 5KSUA 2J3SA 1OGAE 4Z7VF 1PY4A 1ZLUK 3BYYA 3BH8B 3TESA 1FZOB 2BNUB 3TO4B 2MKWA 1R3LA 4ZUSA 3G5YA 1IC4L 3KLAA 3VXUD 3INUL 5FGBC 4U1HA 3HS0B 1YUHA 2FYYB 5IVZA 4LFHD 4G6AC 4X9GA 3ZYJA 5EC2B 3MRBB 4MD5A 1OQXA 2H1PH 2WUCH 5IVXF 3LPFA 5C0GA 3QUZB 1F6FB 2JJTC 1MFDL 1X5YA 1NCWH 2G75A 1FZKB 4TSBL 3IDJA 2ZUWA 4XI5D 1KCVH 3TM6A 3CH1A 4QCIA 5F8RC 3ZYIA 3QDJE 2Q3ZA 4JVWA 3SO5A 1X7QA 1CXHA 1F3JB 3LRHA 5BVJA 5F3HB 5I1GH 3WV0A 4IIQA 2VLME 1A14L 5IB5B 4D0CB 1AKJA 2ZG2A 1JPSH 4X6CE 1S3KL 5I8OL 3ULVD 4LHUB 1DBMH 1XF3A 4K23H 4HV8A 2ZKHH 5CEYB 3MRGB 1Y6MR 4RGND 3GKWL 4PB9L 3RI5K 1JL8A 3SDXB 1MAMH 3U0TB 2ZUQC 5GIRB 4HKXB 3W11C 1CFNB 4XHQA 3C6LA 2YHGA 1EXUA 1MCFA 4ZDHA 2AI0H 1Z9OA 4U7KA 3WNPA 3SO3C 4GQ9L 4HAGA 3ROLB 2N7BA 3RWIA 3UTTD 4KZDH 1NEZG 4X5XB 3VD5A 3NACL 1K2DA 3BOVA 1LP9A 1QPPA 1KPRA 3QDAA 2VLKA 3QUYC 1EERB 1FIGH 2MQCA 4NSKA 2XOTA 1NQBA 4PBWD 2K3TA 2UYLA 1FG2B 1Q9LB 3LQAC 3MRKB 3FN9A 3CX5K 4Q9BA 3BDXA 4LNVA 2E5EA 2YC1A 1ZKAA 3BI9X 4PGEB 3V9FA 2YPLD 2KBGA 1FJ1A 3BP7A 1QLRA 4JRYE 1CVRA 1E6JH 4RFOH 4E5XB 5D2NB 4POZC 4OD3L 3BHBA 1B4JL 5CJBA 3O4LD 4GAGH 1QLFB 3TJHD 4LCCA 4KQ3H 2H2PC 5F7DB 3OXSB 3DHJA 3DTXB 5D7KD 4CJ1A 3BWAB 1FLTX 5GQBA 3LD8B 1INEH 3MREA 3NCEB 1X5AA 5GSRB 1YEGL 2UWEE 3V95A 1AP2B 4RA3A 2BSTA 3SCMC 1RIUL 1RMFH 2DIAA 4AMKH 5JW4M 5FHBL 5D7JC 1EAPA 1MCBA 4P5TA 4BA8A 3HC3H 3C6SA 4JKMA 3CH8A 1IVLA 2Y72A 3U4AA 4AIXA 5F1NA 3HC4H 4M1DL 1FH5H 1MHCA 5E8EA 1RK0B 5E5RB 5T3XD 5DT1H 4XNUH 4KK8D 2C3GA 1M4KA 2EDQA 3WO4B 4KROB 4GAJL 3WN5A 1AGDA 1HQRA 5C0BA 1NMAH 3B8SA 3RBSA 3ES6B 4UV7H 1AGBA 1G9NL 4OCLC 4LSQL 4CKVX 2AXJA 1YEFL 4RCAA 1OM3H 1CU4H 3KPNB 4QHNB 3WFDL 1RIVH 4WFHD 3VA6A 2FB4L 2XT1B 1I1RA 3KYOA 1UWXH 4MGXA 3PHOA 5T1DL 4P2CG 1NGXA 4R6UA 2NY0C 3NFPB 3TPUA 1JK8B 1T80A 5JXAH 3S34L 3WKML 3BSZL 4K7PL 2VDPH 3PWJA 1EUTA 5FUOH 3NCJH 3QDMB 1P4IH 2Z91A 5DFWH 3HPLA 3TYGH 4LKCA 3BP4A 3RWCB 4FFYH 4KJPC 4OLWL 4ZAKB 4G80B 5GGUB 1FVDB 3QDGD 5KJRH 4DUXA 1NAMB 4PJDE 5HD8D 3ZE1F 5MEND 1HIMH 5C0AE 3FFCA 5C92A 3T4YB 3QEUA 2OXGA 2CKBB 2Z31D 5F9OL 2QBWA 3GI8H 2UZYB 2FWOB 8CGTA 4KKAC 4JKPL 3T04D 35C8L 4HGKC 3O3BA 4R8WH 1N59A 1WVZA 2OL3B 1W2KT 2WUBL 5AYUH 1ORQA 2NZ9C 3VE0B 3CSGA 4JM2B 4MDJB 1W0YT 3V6ZB 3MRCB 5L8JB 4V2CB 3HAEB 1RZIA 4KZEL 3G6JA 4EDXB 4QHKI 3C8KB 1QFPA 5ENWB 5JXEA 4CVZA 3L6FA 3OQ3B 1UXSA 1LO2L 4OF6A 4UAOB 3V52H 4QRRA 1S7WB 1QSFD 4WCYL 4G9FA 7FABH 2ZCKL 3F62A 4HZAA 4XVSH 1KFAL 1C5BL 1DQJA 3HB3D 2ESVA 4HWBH 2HFTA 2DS4A 1YEJL 2B7DT 1R3IL 3PWVA 4DEPC 4L4TE 2LTQC 1NCDL 4YXHL 1BD2B 4JRXE 3O2DH 3QAZB 1Q9WA 2XWJA 4YNYA 5D9SA 4X7FC 2YSSB 2R23B 3IDNA 4AENA 4Y1AE 5F9WB 3WJJA 3NH7L 3WFHB 3HE7A 3OR7B 3BKYL 4ODTH 3RDTD 4JCLA 1KB9K 1ERNA 1K4CB 2FBOJ 1Q0YL 3QR2A 4OUUA 3FZUC 4X7SH 4Z7QF 5FYKE 1WFUA 3O6FC 2EEDA 4ESKA 2NY5H 1DE4B 1D5BA 4PJGB 2XZCH 5DQ9B 1MWAH 2MQ0A 1XGYL 3MLSL 3BQUD 3IJYA 1LE5B 3S98A 1E4KA 5EIQA 3BIKB 2AV7B 5HHPB 1FL3A 3U46A 1PX3A 1UKSA 1WIOA 3NCCB 3WNMA 1DFBL 4OI9A 2XA8H 3WYRA 3WD5L 4G7VH 4Y2DC 5T3ZL 1S7XA 1UM6L 4JFFA 2DKMA 5JR1L 3B3IB 3GSXA 3P0VL 2MKLC 5MEOB 4QGYA 2BY0A 1A6AA 1F4WH 1N3NB 3FQNB 5E6YA 4JFQB 4NFCA 4YGAB 4M6AA 5J57B 4KDWA 1F58L 4Q9CA 2FLRT